1IBYA

Red copper protein nitrosocyanin from nitrosomonas europaea
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
112
structure length
112
Chain Sequence
EHNFNVVINAYDTTIPELNVEGVTVKNIRAFNVLNEPETLVVKKGDAVKVVVENKSPISEGFSIDAFGVQEVIKAGETKTISFTADKAGAFTIWCQLHPKNIHLPGTLNVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords NITROSOCYANIN
publication title Crystal structure of a novel red copper protein from Nitrosomonas europaea.
pubmed doi rcsb
total genus 21
structure length 112
sequence length 112
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ibyA00
4KO7A 1M57B 3KW7A 1L9TA 1JOIA 4K9JA 4M4RB 1JVLA 3X1NA 3CDZB 5PCYA 4YSUA 5LDUA 1BAWA 4AX3A 2GHZA 1FA4A 1AZBA 4P5RA 3QJUB 4W9ZA 5B1AB 2AZAA 3PLYA 4JKNA 1HAUA 4YSPA 2CJ3A 5B1KA 1A8ZA 2B08A 1QHQA 3AG4B 2BP0A 2YAEA 4KO5A 3ABLB 1JZIA 4BXVA 1KCWA 5I6KA 4HHGA 3IE9A 4KNTA 1J9TA 2Q5BA 3ZIYA 2HX8A 1PZCA 1OOWA 3IBOA 1DYZA 4BK5C 4E9WA 3CVBA 8PAZA 4FA7B 4QKTA 3WNIA 2NRDA 2YAMA 4A2GA 1CUOA 1OE1A 1TKWA 4AZUA 1SNRA 1IUZA 1AS6A 2H3XC 3NJGA 3NJIA 5B1JC 2HRGA 3TA4D 3QJSB 2EIMB 4GP4B 3WKQA 5I6MA 4G7QB 3SBRA 4YSDA 1A4AA 3UAEA 3FQYA 2PPEA 2QDVA 2BW5A 1GY1A 1L9QA 1OCZB 1KBWA 1L9PA 1X9UA 2EILB 3CG8A 2GSMB 1TU2A 2QPDB 5D4IA 3QQXA 7PCYA 1BYPA 1X9RA 3FQ1A 2PP9A 2GC7C 2N0MA 1JZHA 2JKWA 1M56B 1AZUA 2GIMA 1CYXA 2IWEA 3EH3B 3V9CA 3MBWB 1WS7A 4CSPA 5I5JA 4BWTA 1GYCA 2FTAA 5A7EA 2YXWA 5ANHA 2PP8A 1N70A 2BP0B 1AZRA 4G71B 1GSKA 3X1FA 1TEFA 1AIZA 1BQ5A 4E9QA 4F2FA 4KO6A 3AG3B 1E5ZA 5I5IA 4BWWA 1BXUA 1L9SA 5AZUA 2IH8A 2DY2A 1ZV2A 1GS7A 1J5DA 6PCYA 3FSVA 3S3BB 3QJTB 2FJSA 4F7KA 2PPCA 1NZRA 1NDTA 2XXFA 1RCYA 3FU8A 3OMAB 1ID2A 2IDQA 2VM4A 2AFNA 1EHKB 3ABMB 4YSOA 1W6LA 1ILSA 3X1EA 4G72B 5I28A 2XX0A 1IKOP 2HZHA 1AQ8A 2DYRB 3ABGA 4GP5B 2FNWA 3SBPA 2GI0A 1J5CA 1QNIA 1PLAA 2MRYA 2FQGA 4HALA 3T6VA 1E5YA 5FC9A 5PAZA 4AI7A 3FU7B 3IN0A 3X1BA 1SF3A 3CVDA 2DYSB 1PLCA 1DZ0A 1FFTB 1NIFA 1PY0A 2R7EA 1IBZA 2P80D 3OQRA 4KNUA 2YQBA 4NERA 2I7OA 2VN3A 3T6ZA 3X1GA 2PPFA 1PLBA 1ASOA 1V55B 1JZJA 3FPXA 1URIA 3TBBA 3S3DB 1KBVA 4KO9A 3NSCA 1AR1B 1A65A 3NJNA 3WIAA 1CC3A 4A2HA 3OMIB 2PCFA 4DPCX 4YL4A 4BXSV 3H4FA 1J9QA 2IDUA 3N55A 4NAJA 1T5KA 2XYBA 2X87A 1QLEB 4G70B 3RYMA 1PCSA 2AVFA 1JZFA 4X4KA 1OF0A 4YSEA 2DWTA 1GY2A 1NWOA 1NPJA 2ZONA 3NP4A 3FSZA 1RKRA 5I26A 1BYOA 1VLXA 5B1BB 4AKQA 2DV6A 1NIBA 1NICA 4E9YA 2BWIA 1SHWA 1WAEA 4BDVA 5TK4A 5B7FA 3WKPA 1OCRB 1ZIBA 5E9NA 2BO0A 1JVOA 4HAKA 2XVBA 3ASNB 2LLNA 3S3CB 3UACA 7PAZA 1ZDSA 4A68A 1AZNA 2FQFA 1I53A 2XLLA 1NWPA 4AKPA 1R1CA 3ZBMA 3NJMA 2R7EB 4DPAX 4G7SB 3AG2B 3X2QB 3QJRB 4YSQA 3S8GB 1BXAA 1ET7A 2I85A 2HX7A 1PNDA 2BP8A 4DP6X 1OE3A 3C75A 2MTAA 2EINB 1CURA 2H47C 3KW8A 2J56A 2CBPA 3NJFA 3HB3B 1E30A 2RACA 1OCOB 4N8UA 1W8EA 2E86A 3MX0B 2UX7A 1KDJA 2JXMA 3S8FB 3EHBB 2J55A 2Q9OA 4A2DA 1BQRA 3IEAA 4HHWA 4HIPA 4TXVB 4YVUA 2WSDA 2PLTA 4DP1X 1WA2X 3DTUB 3FT0A 1AANA 3NYKA 4HCGA 2IDSA 2Y1AA 1F56A 2HRHA 2YAFA 4N4YB 2XX1A 3H56A 5EHFA 4DP5X 2YAOA 1JXGA 1SDDA 3NJHA 1E65A 4Q8BA 1NIEA 2PP7A 1PAZA 1AG6A 4F2EA 3PPSA 4YSAA 3AY2A 2FQEA 3BQVA 2J5WA 3NSYA 1ILUA 2YARA 9PCYA 3NSDA 2VSKB 3PAZA 2ZOOA 1GS8A 2YXVA 1GS6X 1RZQA 3SBQA 3T71A 4DPBX 1IC0A 3TBCA 2XWZA 3UAAA 2HXAA 3BVDB 3HEIB 3NT0A 5I6PA 2IH9A 2FT7A 1XMEB 2WO3B 4E9SA 2BHFA 3DKHA 5I6NA 2QT6A 4KNSA 3T9WA 1HFUA 3CZUB 1JZEA 3G5WA 4BWUA 2CUAA 2B3IA 3PAUA 3GXUB 4E9RA 3AW5A 2W8CA 2BP8B 4GXFA 1W6WA 2EIKB 1AS8A 3ASOB 4EF3A 1GW0A 2AZUA 2CCWA 2VM3A 1PNCA 3ABKB 3WG7B 4WTQA 5B1JA 5F7AA 1L9OA 4DP0X 5I5MA 4A2EA 1CYWA 4E9XA 1PZAA 3GYRA 4DP4X 1BXVA 1MG2C 3SQRA 4Q89A 2VSMB 3N2JA 4WKXA 1WS8A 3FU9A 3NJJA 1RZPA 4UAHA 4W1TA 1XB8A 2VW6A 4GP8B 4A2FA 2YAHA 3GDCA 3ZX1A 3EH5B 1FWXA 2GC4C 3FYEB 5AFAA 1M9WA 1ZDQA 1SDDB 5AKRA 1MZZA 4A67A 1KDIA 4DP7X 1V10A 2TSAA 3NSFA 4A66A 2IWFA 3OMNB 5B7EA 6PAZA 1ZIAA 4UANA 3PXLA 3NJLA 4L0PB 3PCYA 2PCYA 1AAJA 2BZ7A 1BEXA 1A3ZA 1JZGA 1ZPUA 1GR7A 2FT8A 2UX6A 3WI9A 3DIVA 3EH4B 4E9TA 1SF5A 3T6XA 3CVCA 4GY4A 4AKOA 2XXGA 3OM3B 5F7BA 4YSSA 1KV7A 2YAPA 1ET5A 1MDAA 2OCCB 1AZCA 1IBYA 3UADA 2HLEB 1OCCB 2P80A 3FYIB 5B3SB 4FAAB 1NIDA 4YSCA 1PZBA 2OV0A 3D12B 3U25A 3FQ2A 1BQKA 3AZUA 2BZCA 1SFDA 5IY5B 3FSAA 4P5SA 1NINA 4GYBA 1EZLA 4JHVA 1XB3A 2UXVA 2WO2B 1TEGA 1ASQA 3UGEA 3UABA 1JXFA 3FU7A 4KOBA 2DWSA 4QLWA 1OE2A 1SJMA 2ZXWB 1AACA 3FS9A 1WA0X 4NB7A 2GBAA 2YAQA 3QJVB 4YSRA 1L9RA 4DP9X 4PAZA 4HZ1A 3CDZA 4PCYA 2XUWA 1J9RA 4ENZA 2IWKA 2X88A 1MG3C 5I6LA 1ET8A 3JTBA 2UXGA 2W88A 4DP8X 3EF4A 4MFHA 1NIAA 1ASPA 2UXTA 1XB6A 2CAKA 2VW7A 1MZYA 4KOCA 2XV2A 2Y69B 5D4JA 2JFCA 3OD3A 3NJKA 1KGYE 2EIJB 3IN2A 2H5UA 4UF7C 3TASA 2BWDA 2IDTA 2VMJA 1SFHA 4BDVB 2J57A 1OV8A 2IAAC 4YSTA 1ETJA 4YVNA 2PPAA 5B7MA 1A4BA 2CALA 1PMYA 4HCFA 1HAWA 2IDFA 3FPYA 3L45A 3PAVA 1AOZA 2XV3A 1J9SA 1ADWA 5I6OA 1SHXA 2A3TA 1WA1X 1KCBA 2PPDA 3H4HA 2ZWNA 2OJ1A 3NP3A 4HCIA 3T6WA 2XV0A 2QPEB 4DP2X 4JHUA 5TK2A 2HX9A 4ZK8A 4E9VA 2XU9A 2VW4A 2GB2A 2QDWA 1V54B 3FSWA 3V9EA 1PF3A 3ERXA 2FWLB 3ZDWA 2FQDA 1AS7A 4M3HA 1JXDA 2TSBA 2UXFA 2FT6A 1N68A 1E67A 2BW4A 4G7RB 1A4CA 2I7SA 4RH4A 1YLBB 1NPNA 3JT2A 4CSZA 1JERA 5D4HA 1B3IA 1AG0A 1UATA 3QJQB 1NTDA 2AANA 3AG1B 1KYAA 3TU6A 3WNJA 3QPKA
chains in the Genus database with same CATH superfamily
4KO7A 5TJWK 1GYVA 4KJWC 5E5RB 1U9KA 1K5WA 3M07A 1UKSA 1JGUH 5LBSL 3B4NA 1UXWA 2OM5A 5F3BB 4G43B 4EN3B 2KH2B 3CVIL 3BVVA 4KJPD 4ELKA 3JTTA 3MLVH 3S5LB 5CIPH 1Z9MA 3WEMA 2CJ3A 5CJXC 4PH8A 4HKZA 4QRUA 4W9KC 2KPWA 4LAJH 5DEGB 1JZ6A 4NKIL 1Z9NA 2A73A 1RK7A 1T2QH 4PJ5E 5EZPA 4JVPA 4EMZA 3IJYB 1IO4C 4NI6A 3RZCC 4N68A 3FO2B 5T1MB 4ABQA 5GSVA 4BXVA 2P8PA 2ZOKB 1ZV5A 3CVHA 3MRMB 4HBCH 4EAEA 3TESA 3EJYC 2VT0A 4HCRH 4HUWA 1ZD6A 3MACH 3D2TA 3FRPA 4FA7B 5FM4A 4HG4K 1N6QH 2HVKA 4OD2A 1XGPB 3MLXH 1R6VA 1CUOA 3IU4L 2DQUH 2FWSA 1IUZA 3FU3A 4MYWB 4UV4L 3O4LA 1SVBA 1YEIL 2VKXA 4Y5XC 4IBVA 4JJHA 2UZXB 3QJSB 4ZW6A 4TQEH 3F12A 3LOWA 2Y0SA 4TM9A 3IGAA 4GKLA 5L6YH 3SBRA 5HDRA 5ICXA 3QUZA 1KTDA 4Y5YA 4ECNA 2FJFB 1B9ZA 5GSRB 3WS3A 1YSOA 1AJ7L 5D9SA 1DANT 4MNGB 2EAEA 3TJPA 4N2KA 3OLDA 4XRCA 4LSRH 3B2VL 3O9WA 1QO3B 4GT7A 3TBYB 1L9MA 3B9AA 1GOFA 4F1SA 2VDRB 3V6OA 3W3BA 4X5XA 3GTVA 3UJTH 3ZTNL 5I1AB 1SDAB 2QADD 2BVQB 4P5MB 1AGEA 5LVEA 5AKTA 1L0PA 3ES6A 4WZ9A 1KCKA 5BJTB 4FMFA 1O75A 1IM3B 4PJEA 5FA3B 1CFQA 2FHCA 5JO5B 3S34L 3MHZA 1WFTA 3CFDA 3QXDB 1MRDH 4GB9A 4L4TE 3V7MA 4A7UA 3S98A 1QHOA 3T4AC 1WS7A 4HEME 3MYJA 4RGNB 4AM0B 4WNSA 2FX8L 4R26H 2ERJC 3QEUB 1JTPA 5DF0A 2Y1YA 1GYCA 1O5PA 5DURB 3L08A 4MRBA 5BRQA 5A6MA 1ORQA 3L48A 5AW7B 2HKFH 4ONFL 1AZRA 1OAXH 2XZZA 2Y7QB 1JNLL 5EU6B 3RJQB 4YXHL 1UGNA 4WWNA 3O3EB 4HC1L 1MAML 5L8KB 4JFUA 2WINA 1BVNT 3HS8A 4H1LG 1NCBH 2W60B 3SE8L 1WTGT 2DBJA 4O4YH 3ZTEA 3U4KA 2OMYB 2E75C 2DLHA 3VRIB 3X3GL 4H25B 1S8DA 3BVWA 3MXVL 3QUMB 1A7PH 5E5MA 3F5WB 4UDTA 3KE0A 2WAHA 2MNUA 4L29B 4OSUL 4ZG1A 4D0DA 5JIQA 2NR6A 2K78A 1T20B 2GY7B 4R2GC 1WBXB 3CDYA 4XP9L 3COOA 5EEYA 5DVMA 1QFHA 1I7ZB 4NZJA 3ARGD 3KD4A 2EDDA 1SDYA 2Q2LA 3OHXC 3W2DH 4ZFFB 1W15A 5BVPH 3OKEA 3CHQA 4J4PC 5T5FA 1QOKA 5A16A 5J11C 4OGAD 5CJXA 1BD2E 2AK4A 5HJDA 1QNIA 3BP4A 5FC9A 4ZQKA 3A23A 1JFQH 1JZDC 3HE7B 4JMXA 5DXWA 3OAYH 4WJG3 4KVNH 1R5IA 4ZJ9A 3QRFM 1HSAB 1E4WL 3PWPD 4M5SA 5FGRA 1AO7B 2BX5A 2H4EA 1NMBL 3GSXA 2X4RA 4FFYA 4X6FA 4DEWA 2QQQA 3RB5A 3F7VB 3FFDA 1OT1A 3KXFB 2WZPA 3WY3A 3NSCA 4FTVB 1QBMH 3D85A 1ETA1 4B53A 1SHMA 3H85A 3DX6A 3D0LB 3LDBC 3FT4B 2VUYA 3ABZA 1DFBH 4G9FD 4Y5XA 5MEOA 3H4FA 1ZLDA 2C9SA 5KYWB 2J88L 3CHOA 3SKNB 4ACPA 2OMTA 5DMGD 4B7LA 1V7ML 4F15C 1DBML 3F83A 4TVPL 5DQ9B 4RFOL 4YUEL 4FQXD 4L2YA 1CU4L 4NZFA 5E94B 3WHXB 4KKCC 1ACXA 1XL4A 4GEJA 1NAML 1NC2B 5I74C 3MRCA 4OZ4A 2FUQA 2ROXA 3IETB 4WW2B 5I76A 4MNQB 5B1BB 3VXQA 4AKQA 5EC2A 1BVKA 5TGBA 2VGLM 2DLGA 4LCCC 1NIBA 2WVTA 1DDHA 3BX7C 4JN1L 4M8RA 3VRLF 1OAUH 3KM1A 3GRWL 5AAMC 3LKOA 3WKPA 4TL4A 5AD0A 4MS6A 3T4AA 5CJOH 4FADA 2I9LA 1K8DA 3PNWB 4L48A 2VR8A 3F2LA 4PJDE 4AENB 2Y7OA 4LMQI 5CSZB 4AYBA 4PY8J 3GI8H 3QO1A 3H42H 3QI9B 2EEXA 1E4XI 3EGSA 3VI4F 3CMOH 1IEHA 2WXGA 4LF3A 5TF1L 2A9NH 1U58B 2ZF8A 3FT9A 1A3RH 4XVUD 3QJRB 3TEXA 1Z5LA 1VCAA 4R4BA 1NSNH 3DTXA 1KCRH 2MTPA 4JM4L 4DVRH 1NGYB 4K3EH 4RIRA 4OD3L 5D1QA 4AGPA 5I8CA 3TZVB 1DQVA 5K9QG 1T0NB 2N7BA 4RRPA 4A39A 4APQD 1HYRC 3MLRL 1S7VB 4MNGE 1HCVA 3FCUB 4O58L 1FVEA 1W0VB 3ZDZF 4LIQH 2P7TA 4LNRB 3OHXA 2Q9OA 3VFNB 2G9HA 2ZQKA 1KULA 4PBDA 3KGUA 1XGUA 1HHIA 4J4PA 4K9EH 1OM3L 4JL1A 1NGQL 1RP9A 3F01A 3B7RL 4DERA 2I69A 4CW1A 2FX7H 2GAZB 3V0IA 1LP9F 5B8CB 4PUBL 1BGXH 1T3FA 1SJVA 1SDDA 3UFIA 4RGNE 4JVUA 1R3KA 2ZWYA 3SDYL 2K45A 4W6XB 5IB3B 3ZE0F 3VW3L 2CZNA 1P1ZA 4UIMB 4HIXH 2P5PA 4IKJA 4YZFE 1H6TA 2COVD 2M8XA 1K5NA 5EU6E 1K6QH 3QDJA 1IC0A 1RK0A 3GQFA 3OJ2C 2OMUA 1U2HA 3RX7A 1QEWA 3BKCL 1QSVA 3BGFC 3H8NA 4WFEE 4XZUA 5DFVC 4BHUA 2EEFA 1PX3A 1XMEB 3BPOB 1OOAA 1HJCA 3MGTA 3LS4H 2AQ1A 2MCPH 3UYPA 5I6NA 1NUGA 2FK9A 3GMQA 4CDHA 3OKNB 32C2B 3RNQA 4NLAA 5CO1A 4OLZL 1CK0H 4FLOA 4Z3TA 3BGMA 4XN5A 3DUSB 4EZKA 3RWIA 4PJIF 2X9XA 5EBWB 1T21B 1GW0A 3ATBA 4QXVA 4EBQH 4JRXD 4LSDA 2OPCA 5JPNC 3RWCB 1EHLH 1UWGL 5J3HD 2YWZA 1CD1B 4HLZH 2PKDA 1WFNA 1OP4A 2OMWA 3O9WD 5BV7C 4KHXL 3A67H 1K4CA 2WXIA 5D72H 5DS2A 2WXPA 5K9KB 1FCGA 1JGVH 2WLHA 4LCCA 4Y2OA 5LCVL 3D69A 1HHKA 2PABA 2VLRB 35C8L 1H3XA 3N3EA 4NRXB 4WWID 5IB1A 1VADB 5AAMA 3EO0B 5JDSA 1JV2B 3B5GA 4H26B 4OGXH 3U2JA 1D5IL 4RX4A 5HYSB 1FYTA 2ARJB 4JGUA 4M6ML 3VGGA 2R1XA 5IVNA 2OL3B 3ZK0A 2Y06L 1DO5A 1K72A 3BW9B 1RV6X 1IBDA 4HUXB 4K7FA 2HN7B 4ZUWB 1T89A 4H0GA 2I27N 4Y2LA 1AR1D 1CFSA 3KXFE 4MKMA 3LRSA 5DD1L 4KX8A 2WXMA 3PIQA 2QL1A 5KOMC 5ENWA 4FTVE 1KDIA 3PNRB 2CHWA 4KZ0A 3U9UA 3UTSB 4YE4L 3MUHL 1UACH 3NEEA 4GI9A 1AXTL 4PS7A 3FN0L 1A6TA 3E3QE 2UWEB 3O0RH 4PR5A 4A37A 1CT8A 2H6PB 5DYOA 5E4IA 5IJCC 4ZMWA 1IGIH 1QYGL 2G5BB 4R8WH 1SHSA 1FGVL 1I9JH 3PUUA 4KDTC 5TE6H 1GTFA 4RMVA 3ML9A 1Z7JA 1M53A 5IVXB 3O3DA 4S1DD 1KV7A 3NN8A 3QS2A 3HE6A 4MJJA 5L4JA 1ET5A 3FTVA 3ALPA 4N2BA 3PUCA 4Z6AT 1DQLL 1IGJA 1NAMB 4BA8A 1OK8A 3BAWA 4YSCA 4U6VL 4YHYB 5E6ID 4HUVB 4MNQE 4KJWD 4L1BA 1Q72H 3FONA 3FUNA 5FB8B 3SYPA 3M86A 5HDBB 1NINA 2VLJE 2PW2B 2XA3A 4QHKI 5DVLA 3L3KA 4ABVA 4CADA 3UGEA 3ZKXB 3KPSA 4B95C 4I3GA 1A14H 1I8LC 4FLQA 1N6UA 2AK4D 3F00A 4TNVF 4JFXA 1FG9C 2FAUA 2J6EL 3LSOB 1CTNA 3EFDH 1CE1H 1OE2A 1SEQH 4KITB 1U3HC 3BCFA 2HFGL 3ECVA 3RZCD 4IBZA 4OAWA 4PAZA 4U1SA 3WYRA 1WEJH 1G4RA 3O2VL 4J3OH 2R69A 4BSVB 5I6LA 4A1RA 4X4YB 5FKAA 1CDHA 2A74C 3EJYD 4JDZA 2AGJL 4NQSA 3FTWA 1HJBC 2V0AA 4OJFL 2WZPD 3D3VD 3V8OA 2UXTA 1HQ4B 3D85D 1MZYA 3PFQA 4OLUH 3VNZA 2A6JB 5KYXB 1ZT7A 2AJYH 3IN2A 3RY5A 1FI8C 2EIBA 2C1PA 1E2ZA 2H5UA 1MW1A 3WBDA 5AB9A 1L7IL 2RTTA 3T8MA 1K4DB 3MOBH 5HVGB 4WKZA 5FW6A 3EDJA 5CGBA 3G6JA 3G5VB 5C0CB 5JPNA 4P2QB 1HQRA 1RZGA 2IDFA 4JQIH 5L0QC 4EIBA 3BT0A 2NCEA 5GS1B 1SHXA 1T7YA 3LIZL 3BSZH 2VLME 4YHOL 3RGVB 1AXSB 4X6DA 5E70A 1T7VA 5F96H 2EEDA 4QXTB 2A83B 2QFPA 4EZLA 3DSFL 1SUJA 4WU7B 2EEBA 4DESA 2WYHA 4ELMA 4NPYA 1OF2A 2Q0ZX 4H8WH 4AQ1B 4JRLA 4JRYB 3NZSA 2X3AA 4NI3A 2DWDB 5JA8B 5CEZD 1Q9WB 2N1KA 4HZAA 4UT7L 4UOW0 5I1HH 2R4RH 1T0OA 5E2TL 4FNPA 2Z64C 4ZTEA 3WUWG 4PRHA 2I24N 3T4YB 3QJQB 4RISH 1GXEA 4X98A 2VMFA 3H9HA 1KEML 4OLWL 4XBPA 5D8JL 1P0SE 3UJIH 4OZHF 3UCRA 1JVLA 3FH8A 4OZIE 1J1PH 4UT9H 3EYOA 5C0IB 4C59B 3KEHA 4NCDA 3Q8BA 4U7KA 4KDTA 4LGPB 3MBWA 2OMXB 1HAUA 3VFPB 3EUUA 3DO3A 3HOGA 4RGMC 4NZUL 3T3PB 5D1ZD 1KJ2A 3BVNA 4B9IA 4BQ9A 4MSWB 2HWZH 1XCTA 4R2GD 1YN6A 2KQMA 4IKKA 1NGWA 4YHPB 3MLTB 2Q8BH 1MCQA 4PJAA 3QFDA 4NUMA 4JZJC 5GGUB 3IBOA 2NNXA 3NH7H 1AD9B 3X3FH 4AV5A 4J4PD 1HHHB 3J07A 5FGSA 1E4XL 2RHEA 1D5ZB 3GSQB 4BCZA 5D7SL 5E0QA 1I8LA 3MUGA 2WBJB 3T2LA 4NAMA 5IB2A 3EGDA 2Z8RA 5J6HA 3O6LL 3SCMB 5C0FB 5HHMD 1Z9OA 1D2OA 4PI0A 1U3HA 4NCC1 4J2QA 4LHUD 5D2NE 1QMUA 4XVOA 1RVFL 4WNQA 1BZ9B 2QMJA 4A6YL 2ORBH 2YKLL 2CHDA 4TSBL 3UTSE 4P57A 3CQQA 3AWGA 2A74A 3F04A 5D7KD 5F9JB 3QDJD 2UWEE 4N0CD 1BW8A 4EI5B 2J8OA 1IFGA 3Q01A 3ULAB 3SKOB 1N8ZB 2LGNA 5F8RC 3HR5B 1JHLH 1ULVA 4N9GA 2V2XA 3LMJL 1RZJL 5CXPA 2ZSVB 4HWZA 4MJ6B 1DL7H 5DC2A 5IVXE 1A4KA 3C8HA 5D5MF 3PWJB 3MKGA 3OAUH 1KT2A 2ZOUA 3HNTH 4L05A 3UZQB 2ZAGA 3BOVA 2YSSA 2AV1A 1LILA 5I5JA 4TV3A 4GFTB 5HDBE 1JPGA 5TH2B 4YBHA 4U2ZA 2BP0B 1PQZA 1JPFB 2VITA 3HPLB 3PRZA 4YHNB 3RVXC 3NCEB 3QR0A 1TEFA 3ZQWA 1U8QB 4X4XB 3BUYB 1DUYA 2W07A 2DH2A 5I5IA 2MPAH 2DMKA 4DVBB 1KB5A 1ADQH 3HAEG 4BFNA 3PP4L 1OSEA 4PMEA 1W80A 1VFMA 5EIIA 4RX4D 2NT1A 4IKNA 1FYTD 1JRHH 2E7DA 4YAQB 5FYLH 3UGUA 1J5DA 3KAAA 4PN6A 3VWJD 4CGTA 3F6IA 3DURB 3P0YL 1A1OB 1NBVH 4E36A 1FRGH 1FLTX 3V5DB 1WZ1L 4IRJC 4WEEA 5JQ6H 1A3LH 5MERB 3SB3A 2W0FB 5SV4A 4LCIL 1MFAH 2OXGB 3L6FA 3ABMB 5I24A 4ZSOB 3U46A 2B2XL 3V4VH 2O5XL 1YDPB 1WBYA 2JKSA 4G5AA 4DKFH 5AOJA 3CFEB 4AYDC 5C3IA 5I28A 4LSUH 3JUYA 1AQ8A 3QULB 2GI0A 4MJ5B 2R51A 5C0CE 2A9DA 4O5LL 4P2QE 5MENB 1WFJA 1P6WA 3NRPA 1B4RA 3CSBA 3FU7B 5DK0A 1H5BB 4I48A 2RB8A 4NQCB 1QFUH 1EHAA 3I9IA 3JWDC 1PY0A 5GS0D 1JGEB 1G7PB 1KC5L 2P8LB 4KJYB 3R18A 4KNUA 3U4EA 4JR9L 4UZSA 5C0EA 4JZJA 2PPFA 5DJ8B 1I8MA 1PJWA 1W72A 1KJVB 1URIA 3WFHA 4TUJB 1W2KT 3ZL4H 4CVZA 4Z8FH 3S2AA 3U9PH 1U8IA 2VJ0A 4JRYE 3EXJA 3NJNA 1VA9A 2EYRB 2NT0A 5F44A 3KDMB 1BOYA 2VDNB 2VQUA 3B5HA 4P9HH 1G5AA 4BXSV 5FCSH 3LN5A 3W11C 4ZO7A 4OJCA 4CSTA 4M7KL 1MFVA 3TNMA 1GW6A 4Q6KA 4OIIL 2O30A 3TJHC 2VXVL 4NAJA 1OQXA 5HPMA 5SWSB 2D2CC 1HE8A 2Q86A 1XZWA 3UMTA 1P5VA 3N42F 3H54A 3P9MA 1AYRA 1E6OH 5BO0D 4UIKL 3FL7A 1G6RB 4AH2B 1IBBA 3L3OB 4PGEB 3FSZA 4X4MA 1RUMH 4HLJA 3K3QA 4WI0B 1H3TA 2MHAB 4RETB 4XMKL 3RI5K 4QEGA 3NFNA 2BSDA 2WO4A 3RDTB 4QJ4B 5BNXD 3T3PE 1P5UC 1SHWA 4BDVA 3VD1A 3BMVA 4ZO8A 4XNZC 2YA2A 2JI1A 4AL8L 1A0QH 2O61A 3DX7B 1YEKH 2BO0A 2WUBL 3GM8A 3L16A 3SDCC 4GAAA 1PIGA 2ADIA 3V79C 1DVFB 1JD7A 5DHVA 1NKGA 3FT3A 1MY5A 2AEPH 4ZTPH 2GI7A 2XLLA 1FYHB 5K93A 1A7NH 5KVFH 5FO7A 3IXAA 5AW8B 1XF1A 4M8QA 3WNLA 1FORL 5CCKH 5DRWB 1BF5A 2GSIA 4HPHA 3AG2B 4PEEA 3N6YA 3WN5C 1ND0A 3LH2H 1BXAA 3LZNA 5DWPA 2NUTB 1KEGH 2GIXA 3PDOA 3TFKC 1N5AB 3PL6B 2XKUA 5ALCH 1AKPA 1G0XA 3HB3B 1U3ZA 1NCHA 4FNQA 3MRQB 4PJ5A 3OJDB 4ETYA 3SYQA 3VGHA 1I8KA 1QRNB 2X4PB 3K6DA 4IRJA 4WNJA 3NABH 2NY7L 3BAYA 1KDJA 2WHVA 3L9EA 4PRHD 4IBLT 4HIIA 2UY6A 3ECUA 3GHBL 3IDGB 4C4KT 1FFPB 5L4MA 4A2LA 1WA2X 3FQWB 4W81A 4MCYB 1SJHA 2JQZA 2DQ6A 3AS0A 3BUBA 3NYKA 3O11B 4I87A 1FNEB 4QOKB 2X42A 25C8L 4AM0Q 5SX4H 2WWKT 1JF5A 5FHAH 2K7QA 2R2HA 4KRPB 5IFJB 2J2ZB 1KY6A 4HJJH 4BINA 4JL2A 5CEYA 1NCIA 2R23A 3GMNB 3OKLA 4LASL 4EEEA 1HZHH 3E6HB 4ALAC 2P45B 4W9FC 1S9YB 4EN3C 3V52L 2P24B 4DFHA 3EOBA 4FQ2L 3NAAL 5EA0L 2BC4B 5CBAB 1KIPA 3OLIA 4WJ5B 5I17B 1F6AB 2QT6A 3T9WA 2NNFA 3OGOE 1RURH 4HJEA 4CC4C 1NCUA 4AT6B 2Y9RT 3TEZA 2R2CA 2ZWZA 2W5PA 4G11A 1GKEA 1U3HD 4K71B 4X8JB 4EKJA 1W6WA 4B9PA 2X6CA 4BK5A 2NY0B 4Q9CA 4RMUA 2YPVL 1MXDA 2PCPA 2XIDA 4ZSOE 4UOJA 1KNOB 1PNCA 1DJWA 4KQ3L 4H1LA 4ODXA 2PNDA 4YIQB 2YPKA 3WG7B 3SKJL 3VI4B 4F7MA 3QUYD 5D96B 5DWUL 1CDUA 5LWYH 5MENE 1P5UA 1SXZA 2EXYC 1OSPH 4R0LB 3VXNB 3JV6A 4E2OA 4OI8A 5BZDB 1A7QL 3DX0A 4K94C 4NQCE 3E1ZA 3SQBA 3SDCA 1Q94A 3W0WA 5E0FA 2WV3A 3HZMB 3WGUB 4UNVA 1RJZB 3APNA 3BZ4B 1SBBA 4TQHA 3M7OA 4F57H 4XB8A 1CMOA 4C54A 2FEJA 3HCVB 3JVGC 3ZDZB 3EBIA 4BZ1H 1T04A 2YGVA 5C70A 3W5NA 1WG3A 4GI8A 3WN5A 2A7BA 4JY5H 4UANA 5J5EA 3ZKQD 2KLSA 3VXTA 1GZPB 4OJYA 3UTQA 1MCWM 1MCKA 1UD8A 2IG2H 4KK8C 4F3FB 5SWSE 5LG6A 5DQDL 3JWNH 3WFCH 2UZPA 4RGNC 5EPMA 4MX7A 2FX9H 4NO5B 1RUAH 2CPCA 1LMKA 4Y16C 1T03L 2V2TA 2Z7YA 2OCCB 3F64A 3F58L 2HLEB 1A6VH 1UZ8B 1XGRA 4J23A 3ZE0B 2WVUA 2R0KH 3FNKA 3BLPX 3U25A 4LHQB 2NXZB 3CZJA 3RTQB 4M5TA 2K8QA 4PFEA 2UZYB 2FBOJ 4M03A 3EYQC 4AEFA 3STLA 3QCUH 3P2DA 3DUUA 1XB3A 1GZQB 1PX4A 2QJDA 4OQ1A 5DGRA 4L3EB 5FOBA 2O72A 4LZKA 3UBGA 1Z5HA 3CBRA 1UOKA 5F88A 5DS8B 3KDPB 1RZFL 4I4WA 2ZXWB 4LMQE 4MMYB 4OCYH 1OKEA 2H0EA 3FTGB 3TBSB 3WTYA 3VI3F 4HZ1A 1OPGH 3MVSA 2V17L 3C08L 2WQAA 1ED3B 1N4XH 5CZVL 5F9DC 2FYVA 4WHTB 5F3BA 4G43A 4EN3A 1UA6H 5F1KC 5IQLA 2VJXA 2X1WL 3BUPA 3S5LA 3ML8A 3B2MA 4DUWA 1ZVNA 1B9KA 3NIDB 1ASPA 1SMOA 1YJDH 3ALWA 3L4XA 5A3ID 3OLGA 1U91B 2FE0A 2XV2A 5DEGA 4JKPH 4CC4A 3NTCL 3HE7C 4JO3L 1YVLA 4OCSH 3IJYA 2G0KA 3O45B 7FABH 1QRNE 1MCNA 1NEZB 2Z6FA 3HMXL 2MCMA 5T1MA 4DEPB 3B9EA 3MCLH 2ZOKA 3MRMA 4AEHL 2HFEB 1NBZB 2ED9A 2HTKC 2CALA 2N56A 3L45A 4H20H 3REWB 3QRLA 5C86A 1KXTB 1IAKB 1NM9A 3G6AB 3UC0L 2BRRH 3VQLA 4AQEB 1XGPA 3P77B 3KWVA 5IROC 3VD0A 4JKLA 3SQOL 1LO3L 3VFWB 2YFNA 4KXAA 2ITCB 5IQOA 5JPMB 2HKHH 3E3QC 1IZKA 4QOKE 3V4LA 2UZXA 2WBWB 5C07D 3FSWA 4LPTA 5IG7B 3A6BH 4M3HA 2IMMA 5EWIH 5HYFA 3MOAH 2ZAIA 4ZZFA 5GSRA 4FNSA 4MNGA 4JAMA 3L5XL 1QO3A 3TBYA 1FV1B 1OP3H 2W9DL 5J8OA 5EULV 4BZ2A 3ZIMA 2AEQL 3JVGA 5EU5B 5I1AA 3BH8B 1CDBA 1JPSH 4WW2C 2WD0A 4P5MA 3AJ7A 4HWBL 4TSAH 5BJTA 3APMA 4LEEA 3ZY7A 1W9XA 2JCWA 3RVXD 3GBNL 3QT2A 2OJZH 5FA3A 3X1NA 4PIRF 2VZVA 5EMYA 4B97A 5JO5A 4C8XA 5GISH 5HGDB 4YSUA 1UWEH 2D7QA 2BSSB 2AKRB 3EGXB 3L7FB 3QXDA 5KSVB 5EH1A 5E99L 5FYKL 3VRLE 3IWUA 3DHPA 4MZIA 3LHPL 4P9ML 4RMTA 4AM0A 2C4FU 2W95A 4R96B 5I18L 1ZE3C 4WY7H 4Y16A 3AREB 3QI9C 4IRJD 1E5CA 1YAIA 1DEDA 5T3XD 2Y7QA 4DGVH 3WD5L 1OY3B 4GSRA 4XMLH 3IE4A 5F1OB 3O3EA 4OLXH 5I6KA 2EC9T 4KNTA 1B4JL 3VI4E 2O6PA 3RDJA 5JTWA 4JHWH 4GFXA 5DJAB 2WLIB 1DYZA 1UM6H 2X4OB 4GAGH 4Q2ZA 4DAGH 1FLRH 3TYGH 2ARJQ 2OMYA 3CFCH 3VRIA 2PWFA 4H25A 3TZVC 1OE1A 1CXEA 2ZUXA 3F5WA 1AS6A 3IJ8A 2ENQA 3MJ8B 3LNEA 4L29A 3WOVA 2Y07H 4HOWA 3ATDA 3QR1A 1T20A 4Y5VB 3MQIA 1WBXA 5I8KL 1I7ZA 3WXVL 3O3UN 4HXBH 4BQ8A 4RAVA 3ZDZE 3ZQ9A 1LK3L 1MQKH 3SE9H 4ZFFA 2BIOA 3PWUB 1V3LA 3V0AC 1HEHC 1MCIA 2J20A 3GNMH 3GXIA 1HKFA 1MY7A 1O9VA 5LAXA 3FF8A 3RWHB 3KPRB 4TNWF 2X4TB 4ZAKB 4LPWA 5CILL 4B9FA 5B8CC 1X9RA 3NDZE 3HE7A 2J21A 4UTBL 3W11D 5IFHH 3MUZ1 2P5WB 4KRLB 5AUMB 3SPVB 3KZ8A 1HSAA 3TJHD 3D07A 3ISRA 1AO7A 2CK2A 3FB5B 3PWNB 4OM0L 4WUUD 3ZE0E 4QXGL 5FEBA 3KXFA 3QQ4B 1V3MA 5AVUB 4FTVA 1UC6A 2DI9A 2FTAA 3BPOC 3GKWL 3EOYG 3HZ3A 5F2FA 3D0LA 3FT4A 4FNLH 5C09B 4L3EE 2I60L 1GJWA 4J3SA 4NYLB 1UYWH 5KYWA 4WU5B 5D2LF 4KO6A 4IDJH 4WGWB 4YHIB 1V27A 4NRYB 3OMZA 4NUGL 1DN2A 1OSZB 4HXAL 5DQ9A 3HRZC 2IH8A 3TF7C 5LNEA 1UH3A 5ILTH 3SDCD 3WO4B 2EIZA 3W0WD 5E94A 4PJIE 5F7MC 2NW3B 1NC2A 2WK2A 1JXKA 5LBSA 1HS6A 2H1LM 1JTOA 1E3FA 3IETA 1U33A 4MNQA 4N1HB 4WW2A 2PPCA 4P2RD 4MBOA 2B1OA 2X7LA 2R0ZL 2XT1B 4LK4A 1HILB 2XTJD 2W1NA 3U6XA 1ILSA 4OF8A 2P9RA 2CO7B 3NUKA 2QPUA 3TFKD 2HZHA 3FAXA 2NNRA 3ABGA 4GP5B 4AENA 1SLUA 4P0DA 5CSZA 3RA7H 1TTBA 1J5CA 3L13A 2B39A 2MRYA 1CFVL 3PS6A 1V05A 3ZMNA 3QI9A 2CMRL 1CR9H 4XO9A 2VSCA 2JWYA 4NM8H 2BVEA 4U6HB 1MWAH 1IJNA 1U42A 2E7BA 5A1AA 4DGIH 2ITEA 2Z35B 2ATPB 3GK8H 4JO1L 1V7NH 3HN5A 5I1DA 2DWEB 5HYJB 1ASOA 2EDQA 1NGYA 3ZN6A 3FXIC 5ISZD 2DYPB 4Z3GA 3TZVA 4NBXB 1T0NA 1SVZA 2LOEA 3D0VB 3LZPA 1S7VA 4PLNC 1I3UA 3BI9X 1ORSB 1W0VA 1ITCA 4QTIH 4I77H 3VH8G 2X9ZA 4NQDA 3AS2A 3HI5H 5BS0B 3L1OH 3K1DA 3VFNA 2X87A 2MQ0A 2QZQA 4YHYC 1PCSA 4HH9B 1P7QB 4U6YB 1RZ7L 4XPBL 3TO4C 4B7IA 4C4BA 2IC2A 2WJ5A 5ADOL 4EN3D 2ZONA 1YUKB 3IKKA 4JB9L 3TPKA 2YRLA 4S0TD 1NANH 3X11B 1Z3RA 1M7DA 1H3VA 3V0VB 3ZKXC 5B8CA 3UEZA 1R3HB 3S3SA 3MZTA 5B21A 2DBLL 3GZKA 3UO8B 4EXPX 4ODSH 4G8IB 4UIMA 3NFPB 4X5WA 2MSPA 3MV8B 2PR9A 5TK4A 1Z0MA 4JG1L 3KLAB 2F74B 3AY4C 3CX5K 4FC3E 3N1PC 1OANA 2P5ED 4HC1A 1JYVA 1D6VL 4NNPH 3VDCA 1YEDB 2ICWJ 5AW4B 4LFHD 4W9IC 1J0JA 3HC0B 1HZLA 32C2A 3UBHA 1EDYA 1L9NA 1ZT1B 2R7EB 5HDQH 1D3CA 4QI3A 5FGCB 1AP2B 2BNQB 2MCG1 2J72A 4EUPG 3I3EA 2EXYD 4OGYL 5TF0A 4S10A 2BVOA 3DUSA 3D7PA 3MRBB 1GVIA 3HRZA 1T21A 2F61A 1U0QA 2EINB 3F6JA 5ICUA 3RWCA 2RJMA 3W37A 4NO0D 4N86A 3CZKA 3EFOA 5GS1C 1CD1A 2WOBA 4LVEA 4M3JA 3HG3A 3QDGB 3RGVC 2DEYX 1W8EA 1KIRB 5D70H 3EDDA 3KL3A 3WDHA 5K9KA 5DZLA 3VXUD 2UZIL 1ZVYA 3KPRE 4RWYH 2VLRA 1VGEL 4NRXA 3EO0A 4PB9H 4H26A 5C0NC 3SZKC 4LVOC 2P5WE 3CDGB 4MTMA 4AQ1C 5HYSA 5IESH 1WT5C 2ARJA 4K5LA 1DEEB 3Q1EA 1R3IL 2OL3A 3L4ZA 4KK8D 4P3CH 3CH8A 4XNYL 3DTUB 5DD5H 1JNNH 3TWYA 5DMKB 3D4CA 2P43B 3BW9A 4N2LA 1HL8A 1KCVL 4HUXA 5FA4B 3I6KB 2HN7A 4K0OA 4ZUWA 1OARL 2YAOA 1U30A 4YR6B 2XVLA 1ZJBA 4Y16D 1X6NA 2PMZA 5DK3A 5DZAA 5G5DB 3UTSA 1WGOA 3K6IA 5C0AB 2J5WA 5DD6B 4JFZH 2ADGB 1DJGA 2UWEA 3DHMA 5K9JL 2H6PA 2XYCA 2XQ0A 1T4KB 3TBCA 5EF3A 1UT2A 4WFED 3BUQA 5EZOL 1TJHH 2HJLB 3EYQD 4FZEL 4OZHE 2G5BA 2NCMA 5AVRB 3H7BB 3VXMB 3WNNA 4R4FL 5E2UH 1PX8A 5IVXA 2IO5A 4L9DA 4N2FA 4C56B 3L3DB 4ILDA 1MHEB 1RJYB 3B1TA 1ZS8B 5DJXB 1JZEA 5KG9B 5EO1B 2V5RA 1NM4A 1XGYH 1NAMA 1SN5A 4WFFE 3GBDA 1JF1B 2NSQA 2HLAB 1CLYL 1RP8A 5B3NA 3SYOA 3DYPA 4O51B 4X0NA 5FB8A 3AQYA 1VFBB 4PVMA 2V33A 4PWFA 2PW2A 2YOAA 1UADC 2ED6A 3GLDA 1WYJA 3LD8B 1TETL 2XZAH 3GRWA 4JN2A 3RKPA 1GC1L 2AP2A 3RKDC 4JPSA 4FFZL 4H88H 1PZ2A 2ADFH 3N5AA 2HCZX 2WBJC 4HF5L 4KKZA 5E6UB 3VE0B 3SCMC 1A6AB 4AG4H 4ZW8A 1U8CB 3S3JA 1YEHL 2VSMB 4GMSH 3CZSA 1P7HL 4DUXA 2BH0A 3VGEA 1AO7D 3UTTD 1OSYA 4BSVA 2HTKD 4WSGA 4X4YA 3BZEA 5CP7B 4X42A 1J86A 3I75B 1MXGA 1KCSH 1SBSL 1FAIL 1BVLB 3KXFD 5HYJE 5IROD 4FTVD 1HQ4A 1KBGH 1XEUA 1NUDA 4QWWD 2A6JA 2EH7H 5KYXA 5ESAB 3GUTB 4MNHB 4XOCA 2F7PA 1XH1A 2MKWA 4G8AC 3RJDA 5DSCB 1K4DA 5CLWA 2WGNB 2G5RA 2FT8A 3G5VA 3OLEA 5C0CA 5KYNA 5D5ME 3DIVA 3PU7A 3QC6X 5BS0E 2AS5M 5GS1A 3O6KH 3RGVA 1AXSA 4URTB 1WZLA 5J6GA 1X5JA 4QXTA 4PGCA 2A83A 2DQIH 1NC2D 1BX2B 3O81A 5EOQL 3KCPB 4MMXB 5DMIH 4MNQD 4WU7A 1IRAY 4G1MA 3BD5A 3WDIA 4HUUB 1MCDA 4MMZB 4AQ1A 5IGXL 4JRYA 5IHBA 1WT5A 2CU9A 1EGJH 2DWDA 4IMLB 3L1EA 2FIKB 1Q9WA 3T1FB 2XZCL 1U3YA 1TEGA 5I8EB 2Y6TE 3IMUA 4PY8I 1Q1JH 1J7VR 3P3SA 5F93C 4XB7A 3U7WH 2XQBL 2APWA 4Y0GA 4BH7B 3ESMA 2XRAH 3T4YA 1XXDC 2DQHH 5H37H 4Q9QH 2DWSA 1I4FB 3QI9D 1JGLH 4ZFGL 4QLWA 3VDAA 3RX8A 1LVEA 2WOYA 4Y9GA 4ZFQA 4D9QE 4N8PA 4K5NA 4NWTH 1JCKA 4AJWA 4ZMAT 4S0HA 1U8JB 1MG3C 5C0IA 3BE1L 2CKBH 5FGCE 1AHMA 2GUOA 2BNQE 2ZP8A 4RGOH 5IVZB 5CCJA 4G8EB 4RDBA 1DBJH 1USQA 3EF4A 1BWWA 2OMXA 2YS4A 3VFPA 4FXKB 1NIAA 4PGZA 2CAKA 3VXOB 2IXQB 3MA7B 3NJXA 3OKDB 4HX1B 3PGFL 1H5BC 2G3XA 4MSWA 5CMAB 2HRPL 3T0VA 5TQ2H 4DGYL 4QJ5B 2FEDC 4G3YH 1SVCP 3DIDA 3QQDB 1FZOB 1T7WA 4NQDD 1ETJA 3MLTA 5TDPB 3ULSB 4YVNA 2PPAA 4TNEA 1BA9A 2Y36H 5GGUA 5LCVA 2BINA 3GEFA 1AD9A 5EG6C 4YHLL 5JXAH 1ZOXA 1HHHA 2BOBB 4RMBA 4YZWA 3OTTA 4POZD 4AUJA 1D5ZA 1KCBA 3GSQA 3H4HA 3LKSB 4KXZH 3TBTA 2WBJA 3RBGA 1U36A 2OTWA 1EDHA 1LL1A 3LTVA 4ZK8A 3SCMA 5C0FA 4ZUUA 1IQDB 1BZ9A 1JV5A 1UEYA 2OP4L 3NACL 5I9QB 4DZBB 3SDAD 2X3CA 3Q6FB 1BIIB 5CUSL 3C5JA 3KYOB 3GSNH 5C0AE 3AS3A 3QFJA 4W70A 2YN3A 4LSPL 1J5OL 1R5WA 3JT2A 5INDA 2VXSL 3TLRA 1ONQB 3SKOA 1N8ZA 3ZVVA 4ES9A 2Q8AL 3HR5A 2A1WL 3VXME 5AYUL 1IIIA 3ARDD 2R4SL 4MJ6A 3BAEH 1P7KB 4PG9B 4JFYB 2WN3A 4KXBA 3A47A 4YLQT 4C56E 1AHKA 1EVUA 2ZG3A 4YDIL 2NSXA 3PWJA 3W9EB 4KPHH 1WTLA 3UZQA 3ZUNC 1MVFA 3HMWH 5TE4H 1FBIL 2JIXD 4HIQA 5AVSB 3FMGH 4FEIA 5CKGA 3IFNL 3U9WA 5CKAA 3I6GB 4D0CB 1YEFL 5TD4A 5TH2A 3JTSB 2BP0A 1JPFA 2NDFA 4JO2H 3HPLA 4YHNA 1TITA 3US1A 1P9MC 2WQWA 2E27L 4MQSB 1U8QA 1M3JA 3H2QA 4X4XA 3VI3B 3BUYA 4HHGA 5FHBL 3OZKA 4DVBA 2VLRD 2GKIA 1P84J 2J6EA 2CJSA 4JDVB 3Q9QA 4QKTA 4YAQA 4NDMB 3PL6C 4ZUSA 3HB3C 2G3MA 4FQ1L 1P69B 3DURA 1BECA 1A1OA 3HAEH 3V5DA 4W9LC 3ARFC 4AOFA 2QHLA 5B38B 3GMPB 5MERA 4Z5RB 2BHUA 2OXGA 4A2MA 4BUQA 4ZRGA 2OTPA 3MA9H 3UTSD 1GAFH 1CL7H 1M9SA 3E2HB 4ZSOA 3UBXI 3C2SA 5B4MC 1YDPA 4DN4H 3FQYA 1MOEA 1RZJC 3ZTJH 4QRRB 2PWDA 4POUB 4OQTL 4O02L 3QULA 3TN0B 2YA0A 2WCPA 2FECI 4Z7WB 4MJ5A 2V37A 5CSBA 3LEVH 1UT1A 2EYTB 5DVOA 1QSED 1QBBA 7PCYA 1SN2A 4ZI8A 3WIHH 2QSTA 4AIZB 1S78D 1H5BA 1IBFA 4NP4H 4KMTL 3GO1L 1C7TA 2AF2A 2B7DT 3LIZA 4HJ0C 4NQCA 2V9TA 3O6MH 3ZRCC 4KTEL 3EW3B 3FUEA 4KRPC 4XNBA 1G9NL 4XNUL 1JGEA 1G7PA 1MJUH 1PG7X 2P8LA 4KJYA 5D7JB 2GIMA 1CYXA 1SOXA 3G6DH 1JHKH 4GEIA 4DO4A 1VZIA 1TF4A 1PVHA 3DO7B 4ATTA 1K8IB 1X9QA 3M1BB 5DHMC 3TO4D 5IEKB 4XCCL 2HJKB 4LOUC 3WFDH 2IGLA 3KDMA 3INOA 3AQDA 3H2PA 3WLBB 2A6IA 1PKQB 3C60D 2HT4C 4F37F 2VQ1B 3PHQB 5IOPA 1E5ZA 4M5YL 5SWSA 2UUDK 3AFLA 2YLKA 1GA2A 1LMIA 4S1QH 4N2CA 2J8UF 3QWOB 3TEUA 4J7RA 1KCLA 3LCYA 3O8XD 4K23L 4A04A 4CN6A 5DZ9A 4OLYL 4AH2A 3L3OA 4PGEA 4HT1H 4ZTOH 1ZSDB 2DQCH 1XSIA 2XN9B 4WI0A 4LARL 2ZKXA 1BZEA 2MHAA 3I9GH 4NQEB 3ZMRA 3FCTB 2Z7ZA 1CS6A 3NZHH 5D96C 3T65B 4IKLA 3GKZA 4KY2A 3IMWA 1VFOA 3B2DC 1OHQA 3LH8A 4QTFA 3C09B 1VENA 4FQLL 4YHKH 2PYEB 3ULVL 2VDML 3DX7A 5HD8C 4NPKA 5C0CD 1ACYH 1SOKA 3K74B 2AHIA 3REVA 3QXAB 5DI8B 1PZDA 3RGVD 5HJBA 3D34A 3D06A 4JRFA 4IM8A 4Y88A 3RHWK 4NGHL 1P9MA 1NIFA 2VXTH 1VZHA 3MV7B 5DRWA 2Y2YA 1DSFL 4XWGH 2EDHA 2P8MB 1IGYB 3SN6N 5F0LB 5GS2H 1P4LB 3S37H 1A9BB 5IR1B 4TS6A 5C0ND 2NUTA 1JZJA 1NGPL 1FDLH 2X2UA 1N5AA 1KBVA 4NUPA 3PL6A 4JX0A 1X5GA 5A2BA 4A6YA 1MCEA 2QBWA 2Y3AA 4KV5F 5EF1A 3LNIA 3MRQA 3OJDA 4NUQA 1TVHA 4L8SC 2WCGA 1INDH 3D4YA 2EH8H 2X4PA 3FN3A 4RSVA 4UV7L 3SJVD 4ODUB 2AQPA 4NKMB 3ZRFC 4QHLB 5GGVY 2ESVB 4HSAC 5FCUL 5GRJH 2PYFB 2V2WB 1O5DT 2NXZC 2AVFA 3GC3A 3H3BC 4LSTL 3RTQC 5D6CB 3T04D 3IDGA 1YNKH 4AEEA 2ZCHL 4M7ZB 1FFPA 3MXWH 4M1DH 1NWOA 3QIUB 4NO2A 3FQWA 4MCYA 3O11A 4QOKA 3N9GH 1E9PB 1MHPL 4L4JA 4AL8C 3UYRL 2ICCA 3HG5A 3QNZB 5BOJA 2EYSB 2I9TB 1NCCL 3DMMB 3D0AA 2J2ZA 1FO0H 2E8YA 1AQKL 1FJ1B 3GMNA 4YHZH 1DQML 1PEWA 1WRFA 2RIKA 2EDYA 2AVGA 3E6HA 4QRSB 4I5BB 3VI3E 4X80L 2P24A 2J1YA 2CXKA 4BFGA 3C2AL 1CZ8L 4MYPA 1R0AH 1C1EH 2XSKA 2BC4A 3P4OB 4WJ5A 1F6AA 5E4EC 3LQAL 5IBUG 3RKDD 3ECWA 2WBJD 2Z31B 4JY4B 3S36X 3BC9A 4AT6A 4G7SB 5A7BA 1BJ1H 3FU6A 5CEZH 2I85A 3KPMB 4X8JA 4HSCX 4PTTB 1OE3A 4KMLB 4JFVA 3L81A 1ML0A 2VC2H 3K6OA 5IW3A 1SQMA 5E2WH 5B38G 1AGCB 4AEIL 4CU8A 5FYJE 2BJML 3NJFA 1KNOA 3QFJD 1OB1B 5D7LB 2OCJA 3L9RB 4YIQA 2JELL 1UWXK 4QRRE 2UX7A 1I7RB 3CFJB 3LV3B 3M17B 3VI4A 4O02B 2J7LA 2Y5EA 5JPMC 4Z7WE 3E9TA 4OGZA 4YDZA 1MFBH 3IEAA 2DAVA 4XPHL 2D4FA 3VXNA 4M93B 1IC4L 2XKNB 2O5YH 2WIIB 3CHPA 1C5BL 4LQFL 2QLYA 4OCRH 3BT2L 3HZMA 5F89B 1UXMA 4XNXL 4GBXB 1RJZA 2F7QA 3BZ4A 4HCGA 2Y1AA 5GGVL 5JHMA 1NPUA 1E90A 4GQ9H 3RLSA 5HPOA 3HCVA 1KENH 2X38A 4QHNA 1ZT4B 1ZKAA 5L8LB 5EU4B 5FKPB 1FGNL 1OQOA 2M83A 2CR0A 4J3VA 1NFAA 2YXVA 3ARVA 1YEGH 1RZQA 4WCYL 3UAAA 1GZPA 1PKQE 4TVSa 1QNZL 5DUPL 3CXHK 1ZHNA 2O5NA 2WXQA 4F3FA 2FT7A 1T1ZB 3BZDA 4I9XA 5HBBA 1BBDL 3AXLB 3SD2A 3QJZA 2VDNH 3KJ4C 4NO5A 1NCDL 2OR9H 2B4CL 1X7SA 3AREC 5DT1L 1IAIM 2B3IA 1UZ8A 3BWUF 4QDGA 2WXRA 4JGNA 2AQTA 2EKSA 2XN9E 3RTQA 5IHLB 3ET9F 2P3YA 2UZYA 4NQEE 5CU9A 5EUKB 1Z2KA 4JFPB 3HPJB 1BF8A 1L4IA 1GZQA 3HS9A 1TYEB 1W0YT 4OLVL 3ABKB 3GSVB 2PYEE 3RJOA 3V6ZB 1NA8A 3ZYZA 5BMFL 1QLEL 3MO1B 3QJHB 5DS8A 2E76C 2CBQA 5F9OH 4WQOA 4XNAA 4Y5VC 4PWEA 4NQCD 1ETZB 3FTGA 2FEDD 3TBSA 2MNJB 3HVNA 3RG1C 4WEUD 3FCGA 3GB7B 1DQKA 3MV7E 1ED3A 3OQ3B 3HLAB 1K3ZA 3H53A 4PWGA 3VFTB 5KN5B 1XF3B 3JYBA 1MFCL 4G6MH 1ZDQA 1O9WA 4ES8A 1EEUA 1JSYA 5ID1B 1FF5A 1U91A 4M6OL 6FABH 1OP5H 2WWOA 4X2UA 3SPIA 3TA3B 5DMJB 1EUUA 3KPOB 3O45A 5SV3A 1NEZA 3G7TA 2ZPKL 5LXVA 3NBNA 3PCYA 3AMKA 3U1SL 1YEWA 3BUIA 2HFEA 1NBZA 1ZPUA 3ETSA 3GS0A 5DQJA 3VD7A 2LAAA 2ESVE 3LNHA 3REWA 4CJ1A 1KXTA 1IAKA 4AQEA 3G6AA 3IS0X 4NFBA 3CVCA 4OIBA 1R47A 3Q3GA 5F7BA 2YAPA 2X2HA 4Y89A 3L5IA 3VFWA 1SPDA 3DGCR 3GFUA 3F7YB 3LEXB 3EFFB 1S3KH 5JPMA 4D7PA 3CZLA 4JJ5B 1YECL 4R7LA 3VWKB 3EHBC 4H5SA 5IG7A 2TAAA 4PJXA 3EF7A 3VFVB 3G5YA 3NPSB 4GYBA 2V5SA 1S9WB 4RMWA 4AE1A 3QQNA 1HWHB 4LSVL 1FV1A 2NY3B 3B7YA 2FLMA 3FOMA 3WO4C 3MRFB 2Z4TA 3F3HA 4P2OD 2BFGA 3MV9D 4KOBA 5GS0H 3QRGL 1YYML 5E9DB 2DD8H 4S1SH 3UAFA 1UM4L 1I3GL 2VABB 5IMKB 2B9BA 3L4TA 2WXOA 4YFDB 5BO1L 3HZVB 1KZQA 3IDMB 5HGDA 4IW4C 2AI0H 3MLWH 2BSSA 2AKRA 3EGXA 3L7FA 5KSVA 2YUXA 4WENB 4X99A 4YDVB 4OTXH 4R96A 5DUJA 3HB3D 2VW7A 3GUFA 3ARUA 3KM2A 2YPVA 3QJXA 4W6YB 5DJCB 2NNCA 3L9BA 3AREA 3ARFD 4XC1H 2BVUA 2DLFL 2XBZA 5D7LE 3TCLB 3MRPB 1RZKL 4FJYA 4M7LL 3RU8H 2EDXA 1F4XL 3DVGB 2CHZA 4JFHE 5CJ8A 2IIJA 1PMYA 3PAVA 3KH4A 3B7SA 5DJAA 2WLIA 2X4OA 2XV3A 5F3HA 4PRPB 1B3JA 3DI2B 5DTFB 3GSRB 4OCXH 3UX9B 2WYTA 3S4SB 1MCHA 4J8RB 4P46B 3LZFH 2DQTL 2OJ1A 4L1TA 4GH7B 3G04B 4QOKD 3BZFB 4KZDL 3MJ8A 4Z7IA 5LNGA 4GUPB 5F6IB 5D7IA 4Y5VA 4YC2B 5DHYB 2CK0L 1JBJA 2F15A 3V9EA 1MNNA 4HJ0D 4UQ2B 4EIUA 4G6JL 4FULA 4KRPD 4TTGA 2EUZA 4N0FB 1E67A 2BW4A 3PWUA 5K1NA 1A4CA 2LE9A 4YNYB 1NPNA 4LCYB 3VYOA 3PJLA 3C6SB 3RWHA 1BZQK 1UG9A 3KPRA 1UATA 4PJFF 4LOUD 2X4TA 3M8OH 1MJ8L 3W5MA 4TRPL 4B50A 1A7OH 2EC9U 4QHMB 1EO5A 2P5WA 4HV8B 2NDGA 5AUMA 4X6EB 1SEBB 3DV6B 2VLKB 3FB5A 1DBBL 4N90E 3P4NB 4AC4A 3MRRB 4EKXA 2AZAA 3T2NL 2CUMA 2VOTA 2BCMA 3ME0B 3CPUA 3CSFA 1F2XK 2B08A 3T2OA 3W82A 5C09A 4YOKA 5JOPD 4NYLA 1I8AA 3MLVL 1M4KA 4YHIA 2NZ9C 5KSAB 2Q5BA 4GNKB 4V1DB 3O3AB 4NRYA 2PXYB 4J3OF 4I9WE 3KBHE 3VXSD 3F7KA 1OSZA 4E9WA 8PAZA 2EDTA 4BFOA 4FL4B 4BKLB 5HD8D 1Q0XH 4YHMH 4AZUA 5I23A 2NW3A 4HBCL 1HT6A 4JE0A 2XICA 1UGKA 3ESOA 1YRKA 5AOLA 1WICA 4HCRL 5DR5H 2Z4QB 1E2WA 1CXKA 2W9LA 3IM1A 5IJKC 1CD9B 3V0EA 4ZX4A 3SEPA 4IRZL 3ALXA 4H2CA 5JNYB 5F7EH 3AT9A 3NOIA 2DQUL 4ZPTB 4RDQF 2BW5A 4ENEC 1UTDA 2CO7A 1HH9B 3WJLC 1IFHH 3JQOB 1X9UA 1EFXB 2F7IA 3HNSH 4O2FA 3BWAB 4HFUL 3VAEA 4L18A 4HJIA 2OYMA 3STZB 3V6FB 4I7ZC 4U6HA 1WFUA 4IBSA 4LSRL 4BIKA 3S48A 1A8JH 4XH2B 2Z35A 4OT1H 2ATPA 4ZFZB 3HKFA 2NXZD 3UJTL 2DWEA 3RTQD 3V9CA 4WVRA 5HYJA 3TF4A 1Z3GH 5GJTH 5KW9L 2DYPA 4BWTA 1BXXA 4P23B 3U2SB 2QZ5A 1IC7H 3D50A 2YXWA 2BNRB 3D0VA 4CNIA 5A7EA 1R9FA 1PLGH 5CWSA 1RD6A 3D09A 2QGDA 3KPLB 1C16B 1ORSA 2GFBB 4XOEA 3SZ6A 1R17A 5KVDH 1FNAA 2WNXA 4X9FA 4KQ4H 4PJGF 1MFNA 4QR7A 4OZGA 4R26L 4IOSA 4BWWA 5E9DE 2QSVA 2VXQH 3EJPA 4HH9A 5HYQB 1P7QA 4HWBA 4GO9A 2HKFL 4U6YA 2JJUA 1IFRA 5BRZD 1RAMA 3TFBA 5CN2A 2FYYB 2OQJB 3FB6B 4N3TA 3TT1L 3LD8C 1TO4A 2WYZA 3X11A 1XR9B 3V0VA 4MD5A 1B6UA 1R3HA 5MI0C 4K3DL 4OIFA 4O4YL 5E03A 3HBQA 1WE5A 3UL4A 3ARPA 4G8IA 5IB5B 1A7PL 3MV8A 2B8OT 2XV6B 2DIAA 4L8DA 1S3RA 3X1EA 2F74A 3BYYA 1VHPA 5ABAA 1CPUA 4U1HB 4MAYC 1YEDA 3D5OF 5EF2A 1SQ2N 5I2IB 4IMKC 1VDGA 4ODBD 2CIKB 4PW4A 5PAZA 3K5SA 4PRPE 2WLNA 4LOVA 1Y07A 5L9DL 3HC0A 3GIZH 5E1IA 2QEJA 4XP5H 5EEVA 1ZT1A 2R7EA 2VE6B 4MB5A 4U4IA 2QSQA 4L0ZA 1AP2A 2BNQA 3S4SG 2VN3A 2D7TL 3GRGA 2JJWA 3DGGA 4N2IA 3HR6A 3MRBA 1ZXKA 2CE6A 1MI5D 1QBLH 1USZA 4KVNL 4EUPH 1WAAE 4YXLH 4Z0BH 3P4MB 2CO4A 4YDJB 3QDGA 2OK0H 1F4AA 1KIRA 4RMRA 1HTYA 1DQQB 4FYRA 4LBEB 4FF9A 5IJKA 4M7JH 3VM7A 4MMXC 2V7HA 5FS5A 1YQVH 1KXVC 5IBLC 1QBML 2F5BL 3CH1A 5HHXL 4E41A 1QWHA 2XBTA 3U4AA 3KWUA 4MMZC 4QAWA 4UTBA 3WJLA 1DFBL 3CDGA 5E4OA 2NTFB 2FATH 1DEEA 3M46A 4UT6L 5I0YA 3FTZA 2VLKE 1NPJA 3QP3A 1ZJAA 4I3SH 1T0MB 1E8YA 3II3A 1TQCB 4WV1B 5FA4A 4YX2L 2G2NA 3I6KA 3V0FA 5BW7C 4GG6F 1KXHA 3D2UB 4FYSA 4RA0C 4UQAA 5G5DA 4YR6A 4WFGE 4E9YA 3ARED 3MGOB 5AOZA 4HIJB 5C0AA 5DD6A 1QHPA 2UVEA 1IM9B 2ADGA 3F6LA 4HZLB 1T4KA 2GJ6B 4LB8A 2HJLA 4WHYH 3LJ3A 5CIPB 2B16A 3ASNB 4FI8A 3H7BA 3VXMA 4V1DE 3WMSA 2ZXEB 2GIYA 5L88H 2CHXA 2E8ZA 2V5YA 3GHEL 4FXKC 3S97C 4C56A 3L3DA 1FFOB 1HINH 1MHEA 1RJYA 4XCYA 1ZS8A 1UFUA 3IAQA 5KG9A 3OKOB 1AQDB 5C7XH 4BCYA 3HC4L 5DJDB 2OTUB 4K2UL 2HLAA 1K85A 2ZOWA 5EBMB 3QIWD 3BWZA 1K3IA 4O51A 4PJBF 2PUQT 2FHBA 2CRIA 4FKHA 3L3GB 2DM2A 1OCOB 2A9NL 1DQDH 5I1LA 3MTRA 1QW8A 1A3RL 3JWOH 4JPKL 4LVNB 4NFDA 4LKXB 3DYMA 3ZKMC 1CGSH 3FUHA 3FUFA 3K0WA 3UBXG 1NSNL 4P3DB 3WEXB 1KCRL 3KPRD 3VE0A 3UCQA 1BJ1J 2IPUG 1A6AA 4L1LA 1RFDH 4QF1A 2P5WD 5AYQA 4WHDA 5I9QC 4LO9A 3JXAA 5DU7A 1GHFL 2TRYA 4DP1X 1I9IH 3O41A 5CP7A 4LIQL 3QEHB 4N22A 5DK2A 3I75A 1YYCA 4IMKA 5T3XH 1BVLA 4I0PD 1I85C 1M2VB 1O7DE 3BHBB 3N0AA 3SPHA 5EIQA 3S96B 3FO0L 4LOFA 5JR1H 2PO6B 4WTZG 5ESAA 4IU2B 1G7MB 2VDLL 3CNKA 1TR7A 2BNRE 5C09D 3GUTA 4MNHA 3EHBD 3MRHB 1W16A 1HN1A 2PWGA 4DIXA 3QZPA 4LLWB 1IGCH 1AHWB 2XTSA 1NAKH 3UC2A 1M1XB 1J8HB 1IC5L 2WLMA 4HSQA 2CDFB 4LOEA 4KNSA 1WZMA 4UB0H 1TLKA 1UASA 4KKPA 4N2MA 1QI5A 1E7UA 1K6QL 1MCPL 3AWFA 3DPDA 5IKCB 1J87A 1MCFA 3KCPA 4MMXA 4Q58C 3LPPA 3LZOA 3NEXA 2VDKL 4J3WA 2P46B 4HUUA 5GZOC 2H2SC 1GC1C 2LHAA 4JM2D 1KGCD 3LS4L 2X0WA 4MMZA 1JRHI 2BSTB 2CCVA 2VNCA 5I6XB 3CFUA 4FDWA 2VZTA 3T1FA 1AOHA 1KLUB 5I8EA 5CJQL 4G7YH 5BW7A 1CK0L 1N0XH 4RNRB 4UINL 2VAAB 4FFTA 4UZGA 1B0RA 1OAZH 2ZG2A 4QNPF 4BH7A 2RCSH 2ZXQA 3UAJC 1EHLL 4KVPA 3MPCA 2YD9A 4JBSA 4L1SA 2NXYB 4Z7UF 1U8JA 1RHFA 2OLDA 2RMNA 4PP1C 1JGVL 3NCBB 5IVZA 5FO8B 5HYJD 4J39A 3MU3A 4G8EA 1P4BL 2OJEB 1J1XH 4M1GH 3TBVB 4EOWL 5AFAA 4UTAH 4FXKA 4TYUA 3QXWA 2I25N 3ZYOA 1FNHA 3VXOA 2IXQA 3MA7A 3OKDA 4HX1A 4RLDA 5FFOA 4OY9A 4JW3A 4P4RB 5J1AB 3R0MA 1AD0B 5CMAA 2AC0A 1YUHB 2WXHA 3QZBA 1L0YA 1YEJL 2I5YL 4L0PB 1EJ8A 3QQDA 1FZOA 1AAJA 3PGCA 1JZGA 5D7JC 3BAXA 5TDPA 4FLSA 3ULSA 4IOSD 3VFUB 3ZE2F 2EDNA 4E9TA 1P7QD 5T3ZE 3GJFK 5KS9F 1CJYA 4D8PA 1LK2B 4U0QB 3O0RL 2VDOH 4PRAB 4AC2A 3LKSA 1E3XA 4FFYL 4RMSA 5DA0B 4FYTA 3WFZA 1UXLA 1ZMYA 2DMBA 3E80A 4OI7A 4FAAB 4OVUA 1I3VA 5FYKD 1IQDA 1PG7L 4S1RH 3AZUA 5ID0A 4X6BB 3ZTCC 2C9UA 2O4EA 3BKYL 4DZBA 3MV8D 3Q6FA 1BIIA 3U7AA 3NCYS 3KYOA 2DIJA 1J8SA 3HUJF 3IKCB 3KWWB 4WEMB 3D4ZA 4PI2A 3RUGF 1HHJB 3V55A 2J8UE 4KTGA 3ESPA 1ONQA 5FUZH 2DQJH 5KYUB 3MLUL 4X0KB 3H3PH 5AKSA 3WAKA 1T83C 4XTRD 1ROWA 1WA0X 2D7NA 1P7KA 4PG9A 2GBAA 3GLAA 4JFYA 3QJVB 4DP9X 1JMXA 3ZDXB 4PCYA 3W9EA 3IPFA 4XWOC 2NZ9D 5FX3A 1A14L 1HE7A 1ET8A 4IJ3B 2DS4A 4KJQD 3VRJB 1UD2A 3CBJB 3S8WA 2RR3A 3EFDL 4AW4A 1SEQL 1I7TA 5FOJA 4Y1AB 4CILA 3I6GA 1FFRA 3KPNB 5IFAL 1W91A 2NY2D 3D18B 4HOMA 1KMGA 1D7CA 1O6TA 3NJKA 3QDGD 4LSQL 2UV3A 3KVPA 3UTZB 4YDLB 1NFIB 1AGDB 4WUKH 5AG8A 5ABDE 4Y7OC 3N85L 4ATWA 5GZOA 1I8UA 4M62H 4R5XA 4FFZA 4A7QA 4AYGA 1X4ZA 2XCMC 5EOTB 3VXPB 4TUOB 4TLSA 4E41D 4DQOH 3GTTA 5E6SB 4ENED 2RBLA 4OBSA 1RQ5A 5FF6B 4NDMA 1Z9LA 3IAPA 3NMEA 3T6WA 4F58H 4JDTL 3MOBL 5B38A 1EO8H 5KJRH 3GMPA 4KV5E 3N40P 3UAJA 4Z5RA 1EHNA 1C8QA 1EJ6A 3FH5A 1MLCB 3SSGA 2E56A 2UXFA 1N68A 1FH5L 1S7SB 1UKQA 1UUSA 5JOEA 4KVCH 5C6TH 4QRRA 4M7ZC 1RU9H 2B1AH 2IFGA 4XBEH 1ECYA 5SX4I 4CSZA 3TN0A 2PR4H 3QIUC 4Z7WA 3IDNA 1IV8A 2O26U 4H8WL 2CRZA 1EZSA 4FNUA 4W9EC 3WS6C 4AIZA 4C56D 2R8SH 1J8HE 3CTTA 1AVAA 2ZUWA 3TJEL 1L9TA 1JOIA 4TLTA 2ZKHH 4LXFA 3IFLH 3DMMC 1S7WB 4TPRH 5D7JA 2R4RL 3CXDH 4L3FA 3WNPA 1B0IA 3C5ZB 5DZJA 1M42A 2Y6SC 3Q5YA 2XA8L 3KLDA 1K8IA 3DO7A 1WD8A 1UUNA 5HHOA 2E7MA 4U3SA 1QFWM 1RMFH 4WSJA 5IEKA 2YD6A 4LCWB 4JPQA 3WU1A 1CGTA 1KLGB 4UT9L 3AG4B 1B2WH 4FQJH 3WLBA 4XPAL 3EDKA 2Z31C 3SYAA 3GZOA 1HEJC 3ASWA 4LNVA 2EDMA 2VQ1A 3PHQA 5KOVC 1F2QA 4LPYA 3MODH 3CFNA 4XN9A 1XAKA 3QWOA 5EU7E 2E74C 2XFXB 1EAJA 2HWZL 1SNRA 4MAYD 3NJGA 3WTTA 1YC7A 1F02I 1KTLB 1T83A 1ZSDA 2XN9A 3S36L 1DVYA 5LKNA 3LXBA 4NQEA 1JP5A 3FCTA 3X3FL 1BQLL 3J7HA 4AVIA 1DHKA 3T65A 4V11A 1Q4NX 1A66A 3PREA 1NFDA 3WNOA 4WO0A 4FD0A 4KQ0A 2F1BA 2PPEA 2QDVA 4M93C 4AGNA 1GY1A 2PYEA 2YMXH 4DCQB 4L1HA 4QYAA 5DGQA 2GSMB 3LIUA 3EOAB 5K5YA 3Q8CA 1G9NC 5GRXG 4TUKH 5KTEH 4GBXC 4DW2H 4M6NH 4MLIA 3QXAA 2HB0A 2PP9A 4O9HH 5KBMA 3ARRA 5FO9B 3MV7A 4NX0A 1XV8A 2ZTBA 1M56B 4JO4L 5AQ0A 5LQBL 4FG0A 4GQRA 3LPOA 2P8MA 5DJ6A 5DZOA 5IBLD 1P4LA 1JHLL 3DC0A 2VN7A 3I2CH 3HNVH 3KBEA 5IR1A 2JLLA 3U4BH 4F92B 4XR8C 4IBQA 2PWHA 1IAIH 2Y7SA 2KMWA 3LQZB 5KVEL 4PJFB 3OAUL 4KAQH 3HNTL 1N70A 1J18A 4ODUA 4NKMA 3LRGA 1U95B 3D08A 5D1XB 3Q2NA 4QHLA 2ESVA 3FUDA 2Y3NA 2PYFA 2V2WA 2VDQL 1KF9B 5D6CA 5HI4C 3S3PA 1J8RA 1B4LA 1DQIA 2APFA 3WKMH 3QIUA 4IK7A 2ENYA 3H9SB 1EMTH 3TYFB 1EA9C 1E9PA 1X7TA 3WS6A 5AVWB 3ULVC 2B0SH 1RY7B 3B5TA 3D25B 3QNZA 2DIEA 4HA1A 2EYSA 2YIHA 4XBGB 4Y1AE 3WIIH 4URKA 3DMMA 2I9TA 2V3DA 3PWLB 5BZWA 4HWEL 3WTWA 3FQNA 2AJSL 5ACLA 1T0PB 2GEEA 5T1DL 1NBVL 1ZLUK 1FRGL 1FJ1A 1LEIA 2I07B 1A3LL 2NNAB 3UJJH 4EQ2A 2H3KA 4QRSA 3U83A 4MBRA 3VXRB 2ITFA 4U6XA 5K33A 1CF8H 1OTUC 4M02A 1OTSC 4V33A 3P4OA 1MCOH 3V4VL 3ZKMD 2R69L 2DYSB 2ZF9A 4RWHA 1PLCA 2FRGP 2Z31A 1DZ0A 3K80A 4JY4A 5AB0A 3TA3C 5ESQA 2XY2A 4MJID 4NZRL 4RAUB 3KPMA 4LIQE 4U1NB 5T33L 1Z0NA 2Y7MA 3LKPB 4M00A 4PTTA 1V55B 1TFHA 1XFPA 5C97A 1AGCA 4HU2A 5CFHA 1OB1A 4WFHE 5D7LA 3L9RA 2ZCLH 2ATKB 4N8VB 1I7RA 4QRPA 3CDCA 2DH3A 4OQTA 2W94A 4HGKC 4O02A 3ECBB 5F71A 3RTLA 1JDCA 3VU2A 3ZL4L 4ZUTB 4QRQB 5BPPA 1URZA 4UV4H 4Z8FL 3U9PL 1JVKA 3VWKC 5E6ZA 2JF1A 2XKNA 4P9HL 4EI6B 2WIIA 3NPSC 4MB1A 3TONA 4GRWF 4GSQA 1NDGB 5F89A 4L2LA 3TT3H 5IW1B 1IEAB 5AAPA 4GBXA 3VFSB 1N2RB 3BESR 4JGMA 2ILLA 5I1EL 2NY3C 4H2AA 4PS8A 3B2VH 1UURA 1N19A 3GSWB 1G9MH 5FLVA 3WEAA 3IGFA 1E6OL 4P59L 1ZT4A 3U0WL 1MVYA 4LCWE 1GSMA 3LQMA 5EU4A 5FKPA 2LVCA 3D52A 4PJGB 1UWYA 3ZTNH 4N0YL 3ULUF 1IE4A 1OCRB 5GZOD 1S46A 3LQAC 4OCMC 1OLZA 5E9NA 2Z65C 3WV0A 3OB0H 2VLLB 3ZUCA 4X7CC 7PAZA 3N1MC 1GZHA 3SDXF 4A68A 4CMMB 1T1ZA 3AXLA 1HHGB 3MBXH 4UNTA 2V9RA 4MQ7B 5GRZA 2APVA 1XH2A 2VZSA 1A0QL 2X44D 5DC9B 5GGRB 1FL5A 3POCA 2LABA 1I9EA 4PJ7B 5AW6B 3S5YA 5I1IH 4UMSA 4F93B 2Q1EA 3UAJD 4FKEA 4WGKA 4LLUB 2HX7A 1R3LB 1JNLH 2AEPL 3HIZA 1J0IA 1JXJA 5KVFL 2AXFB 5EUKA 5JORB 5DUBB 4JFPA 4PB0L 4PP1D 3CJJA 4N8UA 1XGZA 2C7UA 2PCFB 1LM8V 2IPTH 1NEPA 3D30A 1F4WH 3GSVA 3LH2L 4P46C 3V6ZA 4F5CE 3MO1A 1KGJA 3QJHA 3MXVH 1KEGL 1BMWA 2E3VA 3MJ9H 1RPQA 5F6IC 5ALCL 3C87A 4OSUH 1ETZA 1WFOA 4KFZC 5CF3A 2WGXA 1VEOA 2XJKA 4HK3J 1JWUB 5D7JD 4S2SB 3HLAA 3VFTA 5KN5A 4OM1H 2YJLA 2MOGA 1LO0L 4MA1C 4F7PB 1XSOA 3FT0A 2B5IB 3Q5TA 2BVTA 4ZYKB 2JB5L 5HHOD 4G9DA 3VVVA 4B9CA 1P4IL 2XI9A 3NJHA 2KERA 4RZKA 4YSAA 3IVKB 3PP3K 4FFWC 1LE5B 1GGTA 3BPNB 4JFFD 3TA3A 2VN5A 2VERA 3QC5X 4PJFE 3KPOA 5D7EA 5FAAA 2HG0A 4BFKA 4G6KL 2B4CC 2R83A 2YPLB 5D1XE 3ZO9A 3HEIB 1E4WH 5FHAL 4AJ0A 3WEBA 5E23A 3BFWA 4GUQA 1NMBH 2J8HA 2XG5B 4FP8L 4Z7VF 4HJJL 2LU3A 3HN3A 4K73A 1SXNA 3U0TB 5AALA 2LVEA 3F7YA 3LEXA 3EFFA 5H4ZA 4FFVC 3Q8EA 5KBPA 1IKFL 5FGBA 3H9SE 4L23A 3HA0A 3VWKA 5I8OL 3DOSA 4NQED 3C5XA 3WL9B 4KBPA 3FUIA 3VFVA 1RURL 2IAMC 3DPBB 1RLWA 2QSCH 5KJ7E 1BM3L 3K72B 1V7MH 1G7HB 2EDRA 3PV6B 4TVPH 3FFCA 3MRFA 5ICZB 4J3OG 4RFOH 1QA9B 1CXIA 5IMOB 4RZCB 1CU4H 2JXMB 4N2EA 3VXRE 5E9DA 1EBPA 1MG2C 1F86A 2OSYA 12E8L 1OGTB 2ZX8A 4P99A 3FT2B 5IMKA 3V4VB 3MV7D 3HZVA 3IDMA 4GP8B 4PJBB 4ONHB 3D87B 1TOXA 3IGUA 2C5DC 4NO3B 1A47A 3ZLQC 1BF2A 2ZAHA 3AUVA 4YDVA 2AJZA 2C3VB 4OI9A 4R3SA 2IWGA 1A02N 3A4DA 1OSPL 3UPRA 4TLUA 4RDQG 1QD0A 3NSFA 1VZGA 2H6UA 1MJJB 3TCLA 3MRPA 2FZ3B 3G5ZB 1HC1A 1LO4H 3FQUB 2QVKA 1JPEA 2XETA 4F57L 4FTDA 2IH1B 1GJUA 4N8VG 5TF1H 5JLZB 4BZ1L 4P04A 1INEH 1WIPA 3QYCA 4PRPA 2B1HL 3ZU8A 5DTFA 4YSSA 3GSRA 4ODTH 4JM4H 1XMWA 2NLJB 4J8RA 4JY5L 4P46A 5FECB 1DLHB 1W8OA 3A6CH 3VSQA 1F5WA 2AEOA 3G04A 4FZ8L 3BZFA 5T1KB 1W72L 3A24A 3NSXA 4GUPA 5AVVB 5FDWB 4G6FD 3MLPA 3OKMB 3MLRH 2X2JA 5DHYA 2ED8A 3LRLA 4UQ2A 1MF2H 2GTZB 5FXCH 3DMMD 2FX9L 2DJ4A 5D93C 2NYKA 1RUAL 1WAAA 4N0FA 1E7VA 4HUCA 3EOTL 4PJGE 4B41A 1A6VL 1NANI 3T8XB 2Y6SD 4LCYA 4RFNB 2R0KL 4CU6A 3C6SA 3QARA 2P44B 2E4FA 1WCBB 1UD5A 3QCUL 1RULL 4QHMA 1H3PH 4HV8A 2Z31D 1YPZF 1C8PA 3FCBA 1SEBA 5JW4Q 2VLKA 5AKVA 4K5PA 1CBVH 2XBDA 3RY6A 3AB0B 3JTBA 2AJXL 2HG5B 4PJ7E 3VW3H 2YO3A 2ZG1A 3P4NA 4PLOB 1I1AB 4GS7B 4LP5A 1RZKC 1QRKA 4ACTA 4F7EB 4OLEA 1OPGL 2APBA 3BKCH 2ZCKH 4E5XB 5D7LD 5EC1A 3RIAF 3PY9A 1UA6L 5H35B 2IDTA 4M4PA 4QRPD 5HJ3B 2E7HA 4Q7DA 4C47A 1TQSA 4QXWA 2NUPB 4Z7UB 1WISA 3AXIA 5K39B 2NY6C 4HCFA 1CXHA 3DHJA 2IAMA 2KPNA 5KANI 4OLZH 5EO0B 2B9AA 4ZNEE 3P0VH 2JTDA 4OCSL 1FQ9C 1BJMA 5L2KB 3MCLL 3CUPB 4GBXD 1TEYA 3PDGA 4KRNA 4PV8B 4ZO9A 3OAZK 5JW4R 4H20L 2Z4QA 2G75B 1V54B 2KZ1B 3L4WA 4KHXH 1MHHB 1NDMA 2BRRL 3TV8A 1RIUH 2GUYA 4LDLB 1BQUA 5JNYA 3C8KB 4XE5B 1PYWB 4ZPTA 3ZE2B 5IB4A 5BUGA 1IEBB 5JHDB 3VTAA 35C8H 3IFOB 1HH9A 1ZHBB 3HN8A 1UJ3B 2G5UA 4KKQA 1EFXA 5KS9B 4L4VB 1AG0A 3BWAA 4X8CA 3VGAC 2VR9A 1Z6JT 2YPLE 3A6BL 3M6DA 1TQCC 1KYAA 3PHOB 5IV2B 3QPKA 2WXLA 3LEYL 3STZA 3V6FA 2X41A 1Z32X 3RURA 4C4KO 1OCWL 5AL0A 4O00A 5A2AA 2NMSA 5DD1H 4WEBL 4XH2A 3KBPA 4ZFZA 3E1F1 3A4EA 1AXTH 3BLBA 1JIBA 5HI4D 5B1AB 2WWKO 4JKNA 3G5XB 4CVUA 2AMUA 3LPWA 3RUGB 4ZMOA 4BKTC 3GMRB 3U2SA 5K69A 2OJZL 3N1GC 4W93A 4UZUA 4MASA 1QYGH 2BNRA 2RALA 5FYLE 1FGVH 3KH3A 2APTA 2M2DA 3KPLA 1C16A 2X28A 2Z93B 2GFBA 3QEQD 4XN1A 3ULVD 5TQ0L 2OMVB 4HBQA 3VYPA 2E9WA 4I9WD 4XP4H 1EERB 1J9TA 2CO2A 1NL0H 3OJVC 1U21A 2GCYA 3B83A 3HVDA 5HYQA 3GBMH 3GTNA 3EYSH 4DGVL 4A2GA 4XMLL 3BAKA 1A2YB 5C0BD 3WTVA 1YCSA 2VKWA 2L4OA 4PJBE 5C9JB 2FYYA 2EE3A 2OQJA 1OTUD 2F58H 4LVNC 1XR9A 4W4OC 1N18A 1NKOA 4DAGL 1FLRL 1YNLH 3WFBH 1Y1DA 4FGMA 4KK6C 4NKDA 3D39D 5IB5A 2AEIT 4UDUB 3UP6A 5FUCE 1L9QA 2HFGH 1KBWA 4WWKB 1TU2A 4U1HA 3O2VH 4AQZA 3EJJX 1JCVA 2YXMA 2FD6H 5I2IA 2CIKA 2YEZB 1MW2A 4Q6IB 1MQKL 2AGJH 4IU3B 1CE6B 3IK2A 4FE9A 1JZHA 2VE6A 4XGZB 2WPGA 1AI1H 2IWEA 3VWKD 3ARSA 3VG0H 4Z3JA 1C08A 2JVUA 2E59A 1LQSR 2YJQA 5I16B 3AU0A 3TBWB 1L7IH 5IFHL 2H32H 3C5SB 2VXUL 1OD7A 3U7YL 3P4MA 4J1UB 3QFGA 4YDJA 2NY3D 4OJEH 3FFCD 5J13C 4LBEA 4YHOH 2DL9A 1RL1A 5GGSY 4ODVH 5E9DD 5EZJB 1AQMA 1U6AH 4F27A 3DSFH 2AERT 1RUPL 2VN4A 1OGAB 2XACC 4P5TD 4HOXA 1KPRB 5I6XC 1WFMA 2NTFA 2VIRB 4YL9A 1UYWL 3DXAA 3QZWA 1JYXA 3GLZA 3QJTB 4IDJL 1GGBH 2AW2A 3LNFA 4QRFA 1JAEA 3MNZB 2KDGA 3D2UA 1U8PB 1NZRA 1HL4A 2PTVA 2XXFA 1HI6B 3C6LB 2CSPA 3MGOA 4LLYB 5ILTL 4HIJA 4QNPE 5EU7C 4JO8A 1IM9A 4ZMZA 4PTUB 3P73B 1KEMH 2HUEA 2NXYC 4HZLA 5KVGE 4OLWH 5GRUH 5D8JH 3E7JA 2GJ6A 4NHUB 5DRNA 1YY9C 1UOVA 5CIPA 3IFPB 4Z7UE 1X5YA 5CN1A 2FQGA 2IQ9L 1E5YA 3GXPA 4JO5A 2X1PA 2WNWA 1M2OA 2R0LL 1FFOA 4P46D 1AIFB 3FB7B 3OKOA 1AQDA 1A6UH 3QDHA 4NZUH