1IBYA

Red copper protein nitrosocyanin from nitrosomonas europaea
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
112
structure length
112
Chain Sequence
b'EHNFNVVINAYDTTIPELNVEGVTVKNIRAFNVLNEPETLVVKKGDAVKVVVENKSPISEGFSIDAFGVQEVIKAGETKTISFTADKAGAFTIWCQLHPKNIHLPGTLNVVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NITROSOCYANIN
publication title Crystal structure of a novel red copper protein from Nitrosomonas europaea.
pubmed doi rcsb
molecule tags Metal binding protein
total genus 21
structure length 112
sequence length 112
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ibyA00
4E9YA 1NINA 2UX7A 3PCYA 1ZPUA 2PPFA 1AIZA 3JTBA 2XV0A 1TU2A 1BQ5A 2GHZA 5FC9A 4Q8BA 3T9WA 3ERXA 1QHQA 3X1NA 1CYXA 1URIA 1IUZA 2HLEB 3NJLA 2B3IA 3IN0A 3PXLA 3CZUB 5AFAA 4G70B 1NZRA 2HRGA 3CVDA 1BAWA 3NJKA 1GY1A 1OOWA 1SDDA 3FYEB 4DPAX 2IWFA 2EIKB 2QPDB 4HHWA 1KGYE 2GBAA 5F7AA 2EILB 4BWTA 3OMIB 4AKQA 2XLLA 4WTQA 4AX3A 3C75A 4NB7A 4E9SA 1A8ZA 2H3XC 1IC0A 3L45A 4KO7A 4YSRA 4F2FA 1N68A 1M57B 4KO6A 4TXVB 2FQFA 3JT2A 3QJUB 2HX7A 1A4AA 1NPNA 1SFHA 2CAKA 2GIMA 4RH4A 3PPSA 3QJSB 5B1JA 3T71A 3NJNA 4A2DA 1MG3C 5I6PA 5I6LA 4DP2X 3FSZA 2CALA 3T6WA 1GR7A 1RKRA 4A2GA 1CC3A 4E9VA 4E9QA 1ETJA 2MTAA 4HCIA 1BYOA 2UX6A 4M4RB 1OCOB 1BQKA 1PLCA 2FQGA 1AR1B 1OCRB 1GS8A 3PLYA 3X1GA 4E9WA 2ZONA 2PCFA 3NP3A 6PCYA 3FPYA 1MZYA 1NIDA 1AZNA 2RACA 4YSEA 5TK2A 1IBZA 2A3TA 4HCGA 2FTAA 3HEIB 2MRYA 4DP6X 2YAFA 3OD3A 2IDQA 1BXVA 3FQ1A 1ET5A 1R1CA 1L9PA 5I5JA 2FWLB 4K9JA 3ABLB 2GSMB 3EHBB 2AVFA 1ASPA 2HRHA 1E30A 4YSTA 2QT6A 2XU9A 2YXVA 1ILUA 4KNUA 4BDVB 2FQDA 2XV3A 8PAZA 1RZQA 3MX0B 1X9UA 5D4JA 3AW5A 2AZAA 3S8GB 3AG1B 1DZ0A 3UAAA 5ANHA 2YXWA 4F2EA 1M9WA 5I6OA 1M56B 1GY2A 1JZJA 2DYRB 2UXTA 3EH4B 1ILSA 1NWOA 2BP8B 2BO0A 2H5UA 3RYMA 3T6ZA 2BW4A 1AQ8A 1FWXA 1FA4A 3QJTB 5B7EA 4HHGA 1PLAA 1JZEA 3IEAA 3UABA 4BWUA 2CJ3A 1PLBA 1IBYA 2X88A 1ZIAA 4N4YB 1PCSA 4ENZA 2IDTA 2CUAA 4A2EA 1SNRA 4W9ZA 3FPXA 3T6XA 3QJRB 2X87A 1JVLA 2WSDA 2GC4C 3KW8A 3AG4B 3UGEA 2AZUA 2HX8A 2YAPA 2IAAC 2BZCA 2XXFA 4DP4X 7PAZA 2FT8A 4BDVA 2XUWA 4X4KA 3WNIA 5A7EA 2IDUA 1AZCA 2AFNA 1JZGA 5D4IA 3WG7B 1RCYA 2QPEB 3KW7A 4BXVA 4DP0X 1GYCA 2IWEA 3UAEA 1NTDA 2EIJB 2FQEA 2ZOOA 1CURA 2VW6A 1L9SA 1PZAA 4P5RA 3EF4A 1KDJA 2J55A 1GS6X 3NSDA 1WA2X 4JHVA 1JXGA 2BP8A 2HXAA 3S3DB 2DWSA 5AZUA 4GP4B 1E5ZA 3TBBA 3NJIA 3X1BA 3ZX1A 2YAOA 3SBQA 1KDIA 2YQBA 3PAVA 3UADA 1XB6A 3X1EA 2Q9OA 3NT0A 3WI9A 2XYBA 7PCYA 1JVOA 2QDWA 2ZWNA 4G71B 1AOZA 1X9RA 4GYBA 1F56A 1NICA 4KNTA 5B7MA 1ID2A 4CSPA 1WS8A 5I5MA 4GP5B 4YSPA 1QLEB 2NRDA 3DIVA 1JXFA 1HFUA 2DYSB 4YSOA 1IKOP 2VW4A 4WKXA 1BEXA 1JZIA 3MBWB 3GYRA 3QJQB 4A2FA 2UXFA 4YL4A 2DWTA 2EIMB 3FQYA 1AANA 1FFTB 1OE1A 4MFHA 2R7EB 4NAJA 2HX9A 1SJMA 4HAKA 3V9CA 2B08A 1AZBA 3UACA 1AG6A 1ET7A 2W8CA 5E9NA 2Y1AA 1BXUA 3NSCA 1JOIA 1JERA 2OV0A 1I53A 2FT6A 3FSWA 1ZV2A 1PMYA 1QNIA 4HALA 4BWWA 3ZBMA 2YAEA 3V9EA 1KV7A 2BWIA 1OV8A 1SFDA 1WS7A 2WO3B 4FA7B 2I7SA 2CBPA 3FU9A 3H4HA 4NERA 4A67A 3TASA 3ASNB 4E9XA 4E9RA 2XXGA 1PNDA 2IDSA 2PP7A 2PP9A 3QJVB 3NJGA 2YARA 5LDUA 2BHFA 2FJSA 4UF7C 3DKHA 6PAZA 4UAHA 4HCFA 1CYWA 3ABGA 5AKRA 4AZUA 1SHWA 3WKQA 1A4BA 2BWDA 3H56A 1OE2A 5I6MA 1GS7A 1WA0X 5B1JC 3FSAA 3OQRA 3X1FA 1KBVA 5I6KA 1NPJA 2PPCA 1MDAA 1E65A 3FS9A 3SBPA 2R7EA 1WAEA 3AY2A 4DPCX 2H47C 4YSUA 5TK4A 3FT0A 4AKOA 1L9QA 2IDFA 1ZDQA 1V54B 2VMJA 1W6WA 1OCZB 4YVUA 3SBRA 3TU6A 4A2HA 2VN3A 2VM4A 3N2JA 1ASQA 2GC7C 4KOCA 2P80D 1HAWA 3NJHA 2VM3A 3S3BB 3CG8A 1AS8A 1TEGA 1GSKA 2XX0A 4HZ1A 4JHUA 4DP5X 1AZRA 2PPEA 3CVBA 1PAZA 1L9TA 1V55B 3TBCA 1A4CA 3U25A 3ABKB 1AAJA 2CCWA 3IE9A 1VLXA 2VSKB 3T6VA 1E5YA 1PY0A 3AG2B 3BQVA 3ASOB 5B3SB 1J5CA 1JZFA 5I28A 2IH8A 2IH9A 5B1BB 3FSVA 1OF0A 3S8FB 2HZHA 1NIAA 1OE3A 4KNSA 3QPKA 2J57A 2UXVA 1NIFA 3WKPA 1E67A 3NP4A 2XV2A 3CVCA 2VW7A 1NWPA 3X2QB 3IBOA 3ABMB 4DP7X 2ZXWB 5F7BA 4AKPA 4DPBX 1PZCA 4DP8X 3HB3B 2LLNA 2TSAA 4DP9X 4G7QB 5EHFA 3FYIB 2PPDA 1ASOA 4A68A 3G5WA 1N70A 3PAZA 2OJ1A 5B7FA 2YAHA 3IN2A 4QLWA 3NSFA 1UATA 1NIBA 4JKNA 4YVNA 1J5DA 1AS6A 5I26A 4EF3A 1SF3A 5IY5B 5I5IA 1L9RA 3AZUA 1AG0A 1CUOA 2N0MA 1J9RA 3FU7B 1ADWA 4KO5A 2AANA 4GXFA 4DP1X 1XB8A 3NJJA 3N55A 1DYZA 2GB2A 4QKTA 4YSSA 2BP0B 4KOBA 1MG2C 4GP8B 1EHKB 1J9SA 1WA1X 2XX1A 3CDZB 4G72B 4PCYA 3AG3B 1NIEA 1SF5A 2I85A 2W88A 4YSQA 4P5SA 5B1KA 3FU8A 5I6NA 4ZK8A 3EH3B 3EH5B 2J56A 3SQRA 5PAZA 1ZDSA 4L0PB 1ET8A 2FT7A 3WNJA 3ZIYA 4UANA 3NJMA 3S3CB 1AACA 1AS7A 4YSDA 2PP8A 4KO9A 2YAMA 4CSZA 1EZLA 4A66A 2PPAA 2GI0A 4Q89A 1JZHA 2OCCB 3FU7A 3PAUA 3WIAA 4F7KA 1BQRA 1BYPA 1XMEB 3BVDB 3GXUB 1BXAA 1W6LA 1TKWA 1GW0A 9PCYA 2TSBA 2PCYA 2DY2A 1A65A 1PF3A 2FNWA 2JKWA 1KCWA 2VSMB 4E9TA 2XVBA 4M3HA 2IWKA 5D4HA 3ZDWA 4W1TA 1J9TA 4G7RB 2BP0A 3TA4D 4FAAB 2BZ7A 3D12B 1PZBA 4BXSV 2Y69B 1AZUA 2XWZA 3OM3B 2UXGA 1OCCB 3NJFA 1NDTA 2J5WA 3OMNB 1SDDB 5PCYA 3CDZA 1TEFA 2QDVA 3OMAB 4GY4A 2PLTA 1HAUA 1B3IA 2Q5BA 2I7OA 3FQ2A 1SHXA 1A3ZA 1KCBA 2BW5A 5B1AB 3DTUB 3GDCA 1KYAA 1ZIBA 1T5KA 4PAZA 3H4FA 4N8UA 1W8EA 4HIPA 4YSCA 4G7SB 2JFCA 1L9OA 3NYKA 3NSYA 1KBWA 2WO2B 1J9QA 1JXDA 2EINB 1V10A 2JXMA 1YLBB 3QQXA 4AI7A 2E86A 2YAQA 1RZPA 1MZZA 4YSAA 4BK5C 2DV6A 2P80A 1PNCA 1XB3A
chains in the Genus database with same CATH superfamily
4MA1C 4XNBA 1P1ZB 3I6GA 4TSAL 1A25A 3PCYA 2MCG1 3CFNA 4L3ED 5TDOA 5ILTH 1SYVA 3C8HA 3FUDA 2ZG1A 3ULAB 4KQ4L 3ZT7A 4ALAH 1BP3B 3LD8B 4UQAA 2FRGP 3VFUA 5KSUA 1BFOA 4IRSA 4M6NH 4NCC1 4XNUH 1NZRA 2NPLX 2WKGA 2YPLB 4XNZC 4HC1H 4L4TB 2NCEA 4Y0GA 2ZX7A 4QHKI 3OKKB 3N43F 1ONQA 2GBAA 1BD2D 3JWNC 4N6RA 1W8OA 4P0DA 2V2XA 4KY1H 4OCWH 4BWTA 4QOKA 2WP3T 5BRZB 1WWCA 1MEXL 2ED9A 3Q6FA 1ACYH 3O2DL 1I8AA 4P5KB 2OFQA 1IVTA 2HKAA 4PJCE 2R29H 5DURB 4CVZA 3RTQC 4JN1L 2H0JA 2XPGB 2VDLL 3C8DA 3SDAC 2UV3A 3RIAK 2R27A 3U1SH 4RMQA 2IPKB 2VRAA 2ZOUA 4S1DC 2X4NB 3EBIA 1AFVL 2CR0A 1XF5A 4J6RH 1JHLH 1OSYA 2AQ2A 3ZOAA 1I8KA 1N7MH 4OI7A 1RSYA 4JRXA 4HUXA 1YDPA 4F8QA 2CALA 3V0HA 4X80L 3UTSD 3UGXA 1N3NB 1UWXH 4F7TB 3WFEH 2CRZA 1BZ9A 4QJ4B 4WI5A 1ZV9A 4N1HB 4QNPE 5IMKB 2A99A 3WE6A 5INDA 2BIMA 2IOIA 3BDYL 3HG3A 3D4CA 1VFUA 1NC4B 4NAMA 4XPHL 4MCNA 6PCYA 3GSRB 4N5EC 1MCJA 2XFGB 3T3PF 1NIDA 4NRYB 5GGVY 3SGDI 3QEUA 1S9VA 4XC3H 2UWEB 2IBBA 4Y4HB 1BVKA 3KLAA 3PYCA 2XV6B 4QXUH 5AB9A 2VL4A 2F54A 1K3ZA 3FQ1A 5DD3H 3G04A 3P4OB 1B6UA 1KN2L 3QZOA 2EVFA 2VDQH 3D0VB 3IJ8A 4JO3L 1ZTMA 3PP4H 1LK3H 4HCRH 3UFIA 2C9QA 4A1RA 3P4LA 4U1MB 1FRGL 2HRHA 2XCMC 4KHXH 4BK4A 2X40A 3OXSA 4AM0Q 4KNUA 3FFDB 4WUUD 3WFDL 3O2WL 3K46A 1N4XH 4DVRH 1GYVA 3WDIA 4E42B 5C0CD 1UH3A 1E40A 2WQXA 5JIKA 4YLCA 5A6IA 3NPZB 1A7PL 4AEHL 3QZLA 3D39B 5TFSH 3AG1B 2EIZB 4TQ8A 4GKZB 4IRJB 1U0QA 4JREC 2O61B 3GRBA 3IS0X 1NWOA 2BP8B 2VC2B 2Y3NA 4WV1C 3QARA 5AW5B 4AVJA 3SJVD 1KTRL 4F2MA 1OAYH 1FWXA 3T2QA 4YR6A 3BFWA 4AJ0A 4JCLA 4U3XA 3QJTB 4JCWA 1X44A 3APNA 3QH3A 4IOSD 3VWJB 1E43A 4DKFL 1F11B 3AREA 3KWWB 4JDTH 5L4FA 1YEWA 2BSSB 2CUAA 3NZHH 4GQPH 1LP9B 2CE6A 4MYPA 3CQPA 4NOBA 4QRRB 3QJRB 1O7DC 3M1CA 2ZSVA 3NA9H 2NYYD 4TQHA 3UGEA 3IGKA 3IGUA 2XQYK 5JHMA 1AP2B 4L37B 3RLSA 1HHIB 2Z92B 1JE6A 4U2ZA 3VFWB 5JXEC 4IBVA 5BW7C 5I8OH 5DZ9A 2VNCA 2V3DA 2K6WA 1WGOA 3GKWL 4ZBJA 4Z7WB 3OAUL 4Z78B 2IWEA 4XMTA 3RI5K 3U0TA 3CFBB 1OQOA 4HH9B 2NTFB 2OMVA 3Q13A 4CN4A 4OZ4B 2BX5A 4M7LT 1BZ7A 1JGUH 5JIHA 3UC0H 5BNXD 3CLEH 1U8OB 5GRUL 3S4SB 3ARDB 2V7HB 3I6KA 3TZVD 3JUZA 4RMRA 2RALA 4E0RA 4LVOC 1FFPB 1CFNA 1VA9A 3PY9A 1FVEB 4XVSH 4JO2L 1EHAA 2Q9OA 4FFYA 3WI9A 1C5DA 1BA9A 2NY2D 1RUQL 2BRRL 4XWOC 4G71B 3BKJH 1SBSH 4HKXA 2Y9RT 4OI9A 3CLFL 3B3IB 5E8OB 3X13A 2VW4A 1P84K 4U0RB 5DO2C 3UAJA 2ADGB 3QDGA 1ED3A 2UXFA 3Q5YA 5IGXH 1N0LB 3U6RA 1WAPA 4PJIB 2QGCA 1KNOA 5TD4A 1HHHB 3GXTA 4Y19D 5H35B 3WJLC 3KM2A 1HDMA 5AZ2L 1NLBL 2X4QA 1R9FA 1WF5A 1E0OB 2L04A 2YBRB 3QORA 2EDFA 2VDOL 2W8CA 5TE7H 3D0AA 3UJTL 3D69A 5CNHA 2D4FA 5AOIA 1H8NA 1N59A 2G75B 2NY6D 3CD4A 4O02B 4PJHA 5FYLE 2EDHA 4AH2B 3GO1H 1KG0B 4FG4A 3QZPA 2WXFA 3U0PB 4DK3A 1CDJA 1HE7A 3V9EA 1HQ4A 3WO4B 3T2NL 1NCJA 3JT0A 4YHNA 1OV8A 4DSYA 2ZOLA 3MRLA 3GHBH 1JDAA 5DQDL 1AHMA 1NCAL 2XQ0A 3V0WL 2ICES 1P5UC 3EJRA 3NJGA 1YAIA 2E7DA 2XKSA 4PJXF 3PWVA 1XEUA 1QO3A 2ZUSA 3NCJL 3PNWB 2DQDH 4K3EH 4UDTB 4XO8A 3P1VA 2H1LM 4M8VA 3A4EA 3SDYL 1LO4L 4QNPF 2D2OA 2H32A 1YVLA 5I0WA 5CBAA 4GBXB 2JJUA 1RH8A 5HYEA 2ZE0A 4CBPA 1DCLA 4P2RA 3X1FA 4NZTH 3P3RA 2PPCA 5D1XD 3X3FL 4WJ5A 3MLXL 4HIIA 2IWGA 3NIFB 3H9HA 2WANA 2H47C 4ZXBB 3EJQA 5KAQG 4JM4H 1BZDA 3SGEH 3GSVA 3D3VB 3FT0A 4F15C 5AW2B 2RGSA 4GUCA 1Z3RA 4A2HA 3L16A 1GPOH 3HE6A 3QJHA 3LV3A 3CLWA 3NK4A 1EXGA 5DUPH 5FYJH 1NAKH 4FQIL 7FABL 1MUJB 3N1FC 3TYGH 1IL1A 1UWGL 1XGTB 2EDMA 2FBJH 1A7OH 2A9CA 5CP7A 3IJ9A 5C08D 3ZTJG 4JPVL 3ROLB 1OSZA 3QR0A 3PUUA 4RA3A 1OO2A 1KB9K 3GXPA 3POHA 4QTIL 2VSKB 1ZVSB 2CKBH 5T1LD 3HHSA 3T0EB 2AQRA 4YO0B 1CIDA 2O5NA 2FGWH 3C60B 5I28A 1WBYB 5D1QC 3IKCA 1QEXA 1MIEL 5HDBB 3KYMB 5KG9A 5C0DA 2QVFB 5I1LA 2VDKH 2XBZA 1KBKA 1NIFA 5EZIH 3W5NA 2CNYA 4NQXA 4U1LA 5EU7E 2F6AA 4DIXA 2NY3C 2P3YA 4XP9H 5AVTB 4JGMA 2OW6A 1IKNA 1KCVH 3FQUB 5EC1A 5EEVA 3HB3B 2QPUA 1ZSDB 2GK2A 4IS6B 4UT7H 4ZSOB 2IAMB 5A6LA 4HGWB 4X5PA 2WTPA 3D2TA 3CX5K 5B38B 1FNFA 1BQSA 2A4EA 1RP9A 4UZSA 2FJFB 1HH9A 1N70A 4U1GB 5KBDA 3B9KB 3T3ME 1HH6A 3VXRD 4Y89A 4HX1B 2EUXA 3KJ6H 4AYFB 5FF6A 5ESAB 2DWYA 2Z8SA 1NH6A 3MGTA 3RB7A 2W38A 3DSFH 4C56D 4BFKA 2FLBT 5FA3A 1YQ2A 1JF5A 2APTA 1QAWA 5HDRA 3U7YH 3DX7B 4LOUD 2D7TH 4X7CC 1YQVH 5F2FA 4HKZB 1GZQA 5EO0B 3ZGIA 4FNLL 4C58B 5D8JL 1NBYA 5CCHE 3H0TA 2W9EH 3O3DB 3BWUC 4XNAA 3QJOA 2W65A 5C09A 5EBWB 3OBAA 5EA0L 5E4EC 5CD5D 1U93B 4DKTA 3PDGA 5HY9A 4P59L 2H1PL 3OJDA 3QB7C 1FYTB 2XY2A 1HJBC 4G9FD 5FGBA 3X12A 2DQGL 3RRQA 3O8XD 4JZNB 5IQ7H 2NOYA 4JFXB 5LG1A 2V33A 4MMZC 4KVNL 5DMGD 1JDDA 3HPLB 3UTQB 1W72B 12E8H 5EU5B 4JQXC 4L1TA 1UXLA 1DANT 1FGNL 3VD5A 1DQQB 1PDKB 5IQNA 4P07A 4NQCD 5DRWA 2P24B 4KGJA 3KH3A 1Q0EA 1ZDSA 2DQUH 4N3TA 2LR4A 4WI6A 3MJ9L 5CR1A 3VDBA 1G6RA 4ZFOA 1RK0A 2Y5QA 1HCVA 2DI7A 4W9IC 4NKOA 2GI0A 4Y4FC 2PABA 1RK7A 1CTNA 1Q9LB 5J6GB 2NNCA 1F00I 4JDEB 2L7QA 3T65A 2R0KL 3FL7A 3FU7A 4WW2B 3WIAA 1FFNA 3GJFK 4OJCA 2YGPA 1BYPA 3D8MA 1IJNA 4G6KL 5KYNA 3PP3K 5HHMB 2J73A 2JI3A 4GKOA 1KCSL 1AO7D 1VKXB 1JPTL 1LDPH 4Y9BA 2CLVB 3OKDA 2NYKA 3IXAB 3JTSB 3WFCH 1CGWA 1VGEL 4W9JC 5A1AA 4I3SH 5BXFA 3JZ7A 3CFUA 4JPKH 4XN9A 5E99L 4YXLH 3EYSH 5I30L 4GH7B 1IT9H 4UOQA 1JZ4A 3RL1A 3PJNA 1IGYA 3K6OA 3OLIA 2VDRH 3S88L 3ARSA 3NPSC 3RWGB 2FIKB 4OFIA 1WHPA 2EYRB 4J3OF 4KDWA 4NHUA 3V6BR 3MRJA 5KS9E 5DD6A 3QIBA 1A6UL 4PJ7B 3ZW3A 5FOBB 1D7FA 2VQUA 2CBMA 1T0NA 3LKRA 4N8UA 4LSRH 2GW5A 3WHXA 5EO9B 3P9LB 4AYDC 5I73B 4PU2A 2WLZA 4LDLB 1F6LL 1U2CA 4YLQT 4L23A 4HETA 3HI6L 1EWHA 1WIPA 3MV8A 1T0MB 1ZLVK 2B2XH 1QOKA 3RVTC 3GRWL 2A6JB 4I4WB 4NPYB 1RZPA 4PRIB 4X9GA 1MRFL 4G2AA 3O6KH 3U9PH 2VXVH 1Z0NA 2Z9TA 1KEGH 3FQXB 1NC2D 2WXQA 4IDJL 4QF1A 4OGYH 1P7QD 2PPFA 2YUZA 1F90L 4FQXC 1SXBA 4QPEA 1D5BA 4ODHL 2OR8A 5IJBC 4OQTL 5I1IH 3SQBA 4L1SA 2XKNB 1D5RA 3UO1L 5HYIA 4QDGA 4I2XA 2VKXA 4OM0L 1BWMA 3BGMA 2YLKA 3MREA 3DTXB 4YE0A 2XC8A 4OLVH 5L88H 1KGYE 4UB0L 5KYXA 4Y1SA 3LRKA 1TTGA 1XWVA 1RZFL 2ZUXA 3CMOH 5IHUL 3ML9A 3RX8A 4PWEA 3MFFA 4AYEC 5DS8B 1ZHNB 5F89B 5FUZL 3CZSA 1A5FL 2D8KA 4NB7A 4OF7A 4UQ3B 5LGHL 1J1PH 5J12B 2YFOA 4FF9A 1OAKH 1AE6L 5K93A 1RK1A 4HK0A 4K3JL 3RZCB 3STZA 4Z7VB 2AJ3A 1FO0A 2HLFD 2DTMH 3DHJA 5KANG 2HLAB 3GI9H 4Z7IA 3GBNL 5GRYA 1HSAA 4POZD 5C0AD 3T3MF 2MCMA 2AJVH 2WVVB 6CGTA 2W92A 3U36B 4M93C 3L7FB 3DX8A 1VHPA 3MRBA 2KZBA 4UV4L 2UX6A 4OZGB 4UILL 3IETB 3RDTB 1C8PA 4PWHA 1URLA 2I9LB 4EXPX 3EADA 4AZ8B 2ATPA 4IKLA 3APCA 4HFUL 1GS8A 4OFYD 3C6LD 4GT7A 1O6SB 3AGWA 5IP4A 1I4FA 3DUSB 3QJHB 1SOSA 4TUOB 1KENL 4EI5D 5ADOL 4JFVA 2OTUB 1A1NB 5KTEL 3UJJH 1ICTA 2FHFA 4LLWB 4XRCB 1RZJL 1CD1B 2W9DH 2VLRA 4O4YH 1W0VA 4KK9C 3VRJB 4Z7NE 4JVWA 1VPOL 4YHYB 4N8VG 1UOVA 3RBSA 3B56A 4W4OA 4WCYL 2HFGL 5EOCH 5CGYD 2BNQA 4OCYH 2XU9A 2VXQA 1MFNA 5JHLL 4JFPB 2BXYA 3N3EA 1TSHA 3IRCA 3F5WB 3CSYA 4OM1L 3WEMA 5HXMA 5A16A 2Z1PA 3S8GB 1TQUA 5FHAL 4MBRA 5KVGL 4NIYE 5CMAB 1CDHA 1V3LA 2QGEA 5EZPA 3SKMB 4DFHA 3GBMH 3ILPA 1IU1A 3PDOA 3F04A 5IREA 4TRPH 3VNYA 2PYED 5CD3A 2HFFA 4X5XB 3LD8C 5LBSA 4WI9A 1B88A 1Z9MA 4Y2LA 1NDMB 2Y6SD 4ZMPA 4YPGA 2G5RA 2JVUA 1JZEA 3F7VB 2VN5A 2ZUQB 2CJ3A 5TTRA 4GRMA 3HI1B 1SY6A 5C7XH 4Q6IC 4WHCA 4ENZA 2IDTA 4FZEH 2IH3B 4WI8A 2CLZA 4K71C 4L8DA 4O58H 2EEFA 4WO4C 5H4ZA 2APBA 1FHGA 2VDPL 2AMGA 3KW8A 4LP4A 2Y1VA 1QLEL 2YEVB 2DL2A 4UT9A 4EAEA 3L08A 4IRZH 4RMSA 4TVPH 3B2UD 3L6FA 4WWNA 3BT0A 3AQYA 2PCXA 3QRBA 4NYLA 5DHEA 4L3AA 25C8L 5ECJE 4X6EB 3MR9A 4OJFH 4H5SB 4YS4A 1THAA 3OAYK 8FABB 4BH8B 3RPKA 2F53A 1XCTB 2Z91B 1WA2X 1IAOB 3GSUB 2I32A 1CTMA 2HXAA 2EUVA 2BY3A 4OIIH 2E27L 4Y4KB 4AXWA 1RY7B 3CPUA 2E7MA 3CIQA 1MLCB 3THMH 4KVCH 4JGNA 1BLNB 1CZ8H 1U3YA 2P43B 1J11A 2GTWA 1VEPA 1R6VA 1YY8B 3UBXG 4LIQE 4NRXA 1MFDH 2A2QT 3B5TA 1WS8A 5I5MA 2HP4A 1TZGH 1XSOA 3CVHH 3QNYA 4NT6A 2AP2A 3Q6GL 5AVVB 4TF4A 1OOAA 2GJJA 2X6UA 2G3XA 3U4BL 4WWKD 1KV3A 1YEDB 2X7LB 1UT2A 4HDIA 5AAWA 5KVFH 3LEYH 2R7EB 1JF1A 2ITDB 4ISVB 2BMKB 1EXHA 4NQEE 1QLRB 5INCB 2OMNA 5LCVA 4QHMA 3BUYB 5CEYB 3UTTE 1P7KA 1SN5A 2GBVA 2RQEA 3V9CA 1U4FA 5ANME 4XVTH 3LXUX 5GS2H 5AVQB 4RAVA 1BXUA 2ZCLH 1A9EB 2F7QA 3GIZH 5E1AA 3KPRA 1TMCB 3S36H 2BSEA 1GMIA 3DVNA 3M8OL 3MLTA 2VABA 1IILE 1OARH 4JY4A 4LCUA 4QRBA 5DJ6B 3V52L 2Y72A 3LKNA 1MCNA 2IANE 5FYJE 3ILEA 1JK9A 5FO8B 1N5AB 4GKNA 1WO2A 3L7EA 3KBFA 2IPTL 3LRGA 1MQKH 1YJDC 3FU6A 5K33A 3F8UB 2M8XA 5DVOA 5E0QA 2R23B 2A1WH 4XI5D 4C54A 5BS0E 5K9QG 5DK0B 5DF0A 3VWJC 1HIMH 4F27A 3ULUE 1F41A 4G8AC 2AJXL 2P7TB 3PQYB 2P4AB 4L9DA 5FECB 3MBWA 4LLQA 4YGAB 1KWGA 1FL3B 3RKDD 2XYCA 1MWOA 4EDXB 2R2HB 2XN1A 2YQ2A 1GMEA 4KROD 4NQDB 5D7LB 4DPCX 3HR5B 3F6JA 5TF1L 4UTBL 1A2YA 5I19L 4G8FA 2DAVA 3NIDB 1NFDE 3OZ9H 4Z7NF 1S7XA 4J3XA 1EZSA 3K81A 3N2JA 3T8MA 3TXAA 5AD0B 4QTHB 4H8QA 4U1IA 1EZUA 5K9KB 2R59A 4L0YA 5LAXB 5HHQB 1QR4A 4HJSA 5TPWL 3D6GA 1HXYB 3S6CA 3TLRA 4JVPA 5J9PB 2ADFL 4G8EA 1V55B 4JG0H 4MLSA 3ARDC 1F58H 3IE9A 1DBMH 3TCLB 1AGFB 2YEZA 4LLVB 4BSJA 4CBZA 1S3KL 3TONA 3L3IA 4ZW6A 1RPQA 4UT6H 5A3ID 3LPWA 1Q90A 4GQ9H 4JRYE 4HQQH 1OF0A 3ARTA 3D06A 1FVCB 1ZLDA 1JZ8A 2FEEI 5GSVB 2WXGA 1YECH 1J8SA 1F3JB 2VT0A 1F45A 2DQJH 1K5NA 1XIWA 3L3HB 4Z7UB 1IM9D 1B0GB 2C1PA 4X2UA 4U0RC 2QGBA 5EIIG 4XCCL 1JG9A 4YHIA 4NUJB 2V3FA 4P2OB 2V5TA 1CR9L 2HT4C 5KYYB 4TKWA 4JW3A 2EECA 1CJYA 4ZYKA 5HHXH 1E90A 3L5HA 4A68A 3RILA 3GWJA 3ULVH 3BT2H 4MJ5A 3HW7A 5B7FA 4IEFA 1OGSA 3JV5A 3VFMA 2M26A 2BVEA 3GMMB 4FNTA 3VRLF 4PGEA 1F1AA 4GO9A 1UJ3C 1U8CB 2IQAA 2VDML 4JQVC 2B1AH 5BMFL 5AAMA 1I8MA 3O3BB 2JJSA 3QEQA 2YR3A 1KPUA 2Q6WB 3MRIB 3RWIB 1UZ8A 4RRPG 3WO4C 5I5IA 2IBZX 1W0VB 2D3VA 3P54A 1DBJH 1IAKA 4PJ9D 2J5LB 1IGTA 5IBUG 3KWUA 2VR4A 4L18A 2H4EA 2DI9A 3V4PH 4MNHA 1DLHB 2AANA 1P9MA 5I2IA 3MJ8B 2LGNA 3U46A 1S5IH 4NQTA 1F4YL 1A6VL 1F13A 4C4UA 2DQHH 2CU9A 1EAOA 3PL6A 4GP8B 4N5UA 4DVBA 4GBXC 4N2GA 3AS2A 1J48A 5DJXB 4D0BB 2XTJB 2OM5A 3T8VA 1Q72H 5I16B 4AGOA 3L5JA 3F12B 4PWGA 2W88A 5EEZA 3KLQA 4RCAA 4ZXBC 3ABZA 3P02A 3A22A 4ZK8A 3LXCA 4PJAE 4L0PB 2MCAA 5AB2A 4JM0A 4EVNB 5DHDA 2XACC 5KSVA 5SX5H 1OP5K 1AACA 2MNWA 5HDQL 3L5XH 2AGJL 2ILLA 3HRPA 4CSZA 3NBNA 3HHMA 4X6CE 2C9XA 2HN7A 2LE9A 3NCWA 4L9LC 3AQXA 1TMQA 2JXMB 3L4VA 3ZKSD 1KB5A 4PJCB 3PAUA 2VMCA 4U6VL 2H8PA 4XPTL 4R7NB 5D5MF 1K85A 3T0EC 4XZUB 4X7SL 3AQZA 2DY2A 4KTYA 1RIVL 2C7UA 4G6AC 3C60C 3IS1X 3TNNA 5IVOA 4PVBA 5LJYH 4G7RB 4TUKH 1YN7A 4AQOA 4A04A 1PZBA 2WQ8A 3H7BA 2N1KA 3OKEA 2G60L 4QRPE 5F7NC 1WEJH 2PXYC 5IB3B 3RL2B 1JYXA 3DX6A 4G5ZL 1QG3A 4PG9A 1RFDL 1KCRH 4B5ZA 5EWIH 4JGJA 4A7VA 4UM8A 1OTUC 2ARJQ 1A7RL 1FF5A 1GC1H 3HB3C 4R3SB 5AW1B 2VH5H 4TNWF 2IAMC 1E50A 2IGFH 3AM8A 1Z9NA 4H0GA 5I15L 2KZ1B 4KVPA 3GXIA 2J8UB 1V5JA 2B0SH 3VGBA 4U1GC 3VFOB 2LAGB 1YNKH 2JFCA 3BKML 1QSFB 4U05A 3OXRA 3FB7A 1UM5H 5CN1A 4DEPB 1NFDF 2H41A 2YAQA 1TCRA 3FQRA 3ZUCA 2OMUB 4BFBD 1RIUH 2J6EL 4JE0A 4GG8A 1HT6A 5HJBA 1PNCA 3V8OA 4MNGB 4GS7C 2VZSA 4K8RL 3A4FA 4GFXA 1CXFA 4P46D 1SEQH 4JFDE 4NZRH 2ADIB 4FG2A 2X6AA 3GM0A 3T9WA 1MCPL 3IWVA 2D31A 3NRQA 1J8RA 1QHQA 1CYXA 1IB5A 3DGCR 4MKTA 1J10A 4F58H 2K7QA 3EOBB 4G6JH 4DGIL 5E8DL 3RVXD 2PCFB 4BYHA 4ZOCA 1S5HB 3OGCB 2IWFA 4LCVA 4FXKA 4PJ8A 1U95A 2X2JA 1R5IA 1LWRA 1QABA 1TF4A 4WFGD 4XPFH 4NO0D 2J72A 1N6VA 4MD5A 4AV4A 3WMPA 1Y07A 5ESVB 3EOTL 1TETL 5IFHL 5K59E 2DJSA 1P5VA 3BE1H 1A8ZA 2YSSA 4L4TD 4Y2DB 2Z93B 3NCFB 1N8ZA 1PG7H 2IVFC 3RHWF 1YO4A 4JQIA 1DVYA 4YBQD 5DQJB 4TSAH 3QIWD 5DHXB 1GVIA 1ZKAA 1G7QB 1ETZA 5BRZD 1TVDA 4A2LA 4ODBD 4KQ4H 3TBVB 1U8MA 2CDFB 1DVFA 1AZZC 3MCG1 3FCBA 1T2JA 3PJSA 3QO1B 1U8NB 1MHHB 4FQPA 4WW2C 6TAAA 1WRFA 1CICB 3II1A 3MACL 3FOLA 4E9VA 3BQUA 3QI9D 1M7DA 1OAQH 4Z9KB 3VXMA 4QRUB 5E4AA 5J11B 1FFRA 1MAJA 3HZ3A 4Q4IA 2DLTA 3RFZB 2WLIB 5E03A 2MHAA 3DUUA 5CCKL 2AQ1A 2ZCKL 2G2RA 1MEXH 4KKBD 1OF2A 2A9AA 2OTWB 4LGPB 4RISL 3RY4A 1VADA 2VC2L 5E4OA 4QXTB 5E5MA 2JCWA 4QXWA 2X4TA 2CXKA 3G6AA 3ORJA 2OYLA 1YJDL 5CBEA 4Z3EA 4HHAB 4K94C 4HC1A 1YNTF 4CNIA 4JN1H 1V05A 4UTAL 5KS9A 3RDJA 2FTAA 3PWLA 4NUQA 2WLKA 4L3FA 1IC7L 3AJ7A 2QMKA 4MNQD 4WGWB 4XP1L 1KTCA 5FA4B 1AFVH 1R1CA 1JPFB 3MSPA 1MVYA 2R29A 3UZQB 2XWJB 3DO4A 1V7NL 3C09B 4ZTOH 4F37F 4X80H 4ZNEA 5I73C 3SDXF 2FQDA 4ZQKA 4OV5A 3VYPA 3MPCA 4OGXH 1E9QA 4TVPE 4B95C 4FQQB 4ZZFA 2VRKA 4K3HA 2GFBB 1DZ0A 1LGVA 1U91A 3BDYH 1YMMB 3FB6A 1QFUH 2EDTA 3I2CL 4XPHH 1NJ9B 1ULVA 4QRTA 1JZJA 5DS2A 1LO5B 2FO4B 2V5YA 1E27A 5BRPA 4U1HA 3HN5A 3HI5H 4X6CF 4DZ8A 4ELMF 3WN5C 1SXCA 4IMLA 2LQRA 5EBMB 5EO1B 3QULA 3EDDA 3R4DA 2AJSH 1DN0B 3AU1B 4N0FA 1KN2H 3T2LA 2BSCA 3TVMA 1PLAA 2W59A 2NDGA 5CLYA 3AC0A 4ZX4A 3CDGB 2QADD 2WNXA 4ODWB 3OHXB 1FRGH 2ZOKB 5D2NB 1JV2A 4JAMB 3ZPDA 1ZGLM 5LDSA 3E9UA 3IJHA 3Q2VA 3B8SA 4WTZG 5C0JB 5GISL 3WFDH 1OGTB 4XXDA 2ZG3A 4H1LB 4NQQA 1YY9D 5FUCE 5I8CA 4RZKA 1NUFA 5F96L 4AEHH 1A7PH 2YLHA 4HLZG 5MHSD 4BELD 4GEJA 4HCRA 5J12C 4RMBA 2OI9C 4FLHA 1KXHA 1BVNT 4TNVK 3T0VA 4DP4X 4P05A 7PAZA 1NBZB 2FT8A 3RZCC 2IXQA 3PV6B 4FQHA 2PWHA 3CFQA 1M9SA 1NCUA 1LL1A 4V1DD 1Y0LB 2OZ4L 4LO9A 3SDDD 3VXNB 4E41E 2GUYA 4XMZA 4WWOA 1PKOA 4QTFA 5L2KD 1F86A 1MCSA 4FQLH 5JHDB 1JPGA 4M43L 1JXGA 3MFGB 3BAWA 4XZ4A 3I02A 4DKFH 1CFQA 5JDSB 4O02L 3ZX1A 2DQCL 3RDTC 3M86A 1KEML 1KDIA 4FA8A 5IW6A 3M7OA 1JVOA 2BVOA 3TT3L 5E9DE 5B3JF 1NGPL 3ZRSA 4POYA 2XOTA 1MH5A 3HG0A 3WIFB 4J8RB 3L3OB 3CK0L 1ZE3H 3APMA 3LRSB 3HS9A 1QQDB 1IKOP 3T77B 5AEAA 5CJQH 4PY7A 2WXHA 5ITFB 3GKWH 2DBLL 4W9DC 2DOCA 3BP6B 2ICEB 4RX4D 4YHYC 3OAUH 5I82A 3Q06A 2X4SB 3K72A 4YHZH 1NGWA 3F7YB 3UPAA 4JFFE 2HX9A 3LNFA 3MBXL 3ATEA 5D6CA 5H37H 1L7IL 4Y7OC 2XN2A 5CN2A 3MOAH 1URZA 3TT1L 1N12A 1AG6A 3IGAA 3RU8L 5AG9A 1JOIA 4WEMB 4JO2H 4Q9QH 3DX6B 1YNLL 4HWZA 3N41F 1QNIA 5KVEL 4DWHA 4UNUA 5JPMA 1RUQH 2BRRH 2HRPL 3MVSA 5CSGA 1CN4A 4CVXA 2VN6A 1SN0A 1SOQA 3CLFH 4BFIB 2ESVA 4FRWA 2EZ0D 2V5SA 4ZG1A 2COQA 4MWFA 4LEXL 1BIHA 2F68X 1PZ5B 4L8CB 1WHOA 5C0IA 4GLRH 5F71A 1EBPA 2ZUQC 1SEBB 5I6XC 2GJ6E 4XHJD 5J56B 2IF7A 4Y16B 5T3ZD 3SCMA 1Z0MA 3GMOB 1HS6A 1CXIA 4AL8C 1EEZB 4I0CC 2AITA 4FL4B 3IE4A 5AZ2H 3QWRD 2Z4QB 2FR4A 3K7UA 1KT2B 3U4KA 2CM5A 1CO1A 3UJTH 3ATDA 3EJTA 3P3SA 4QRSA 5C0BD 5IWLC 4BA0A 3SBWC 2YGOA 3UP1A 1JZ2A 4HMCA 1KGCD 1TITA 1WC7A 3MTXA 3A6OA 2MPVA 5AWNL 3TU6A 2X2YA 2XN9D 4GO6B 3UEQA 1DANU 3S48A 3AS3A 5DQDH 2NQCA 1U3JA 3QDAA 4UYQA 1CDGA 3V0WH 2EYSB 5I76A 3ULVE 3WO3B 3UPCA 1JZ7A 4R0LA 5IHHA 1T1YA 3CVBA 3NCJH 3F2LA 43C9B 4AUUA 3CXDL 2FX9L 1XX9C 3MOBL 3SDYH 1QHPA 1LO4H 3FT4A 3IF1A 4IRSD 3V4VH 4Y4KC 3VGFA 3WTUA 2SEBA 1IO4C 4ZS7L 5EIVA 5HYSA 2VCOA 3JVFC 1RAMA 2CPUA 2MPAH 2P5WE 1H3WM 4D0CB 2VJ0A 2EE3A 4K15A 4G1EA 4QOKD 2WUBH 5DRXB 3WKPA 5C0NC 2XV2A 2VW7A 4WI0B 5E6UB 3ABMB 4LQFH 4M1CC 4KMTH 1CDUA 2XWBB 4G7VL 5JW4N 3T08A 3EYVA 2Q3ZA 1ECYA 1PZCA 3P9MA 4DP8X 2CIIB 5E8EB 1S9YB 3DV6B 1CVSC 3HS8A 2CZNA 5ICUA 3K91A 4FQIH 3UTTA 4M7KL 3GLAA 1F6AB 3FYIB 1DUZB 7FABH 4FD0A 1QMUA 1UWGH 4FJYA 2X53A 5TDPA 3NSJA 4DNLA 5HVHB 3BSHA 1SQMA 4TUJB 5ANMA 3TF4A 1FZOB 2V7NB 3LVEA 4JPVH 4JFUA 4K7PX 2BVQA 4JRXD 1P4UA 3BEVB 4QTIH 4IU2B 5CJ5A 4M5TA 3TIDA 2VZOA 4YHOL 5DEFA 5ITBL 2D3LA 2HT2C 4YDLC 2F19L 5T3XE 1MIEH 3G5XA 2VMFA 3QUMA 3GB7A 2OMZB 2QKIA 3WN6A 4AWJC 4YDVB 4BFRA 1KBGL 3ARPA 3B9KD 2XG4B 5E8PA 3BMVA 3CQFA 1X7TA 1NCNA 3WNNA 3K6SA 2CKBA 3ZZQA 2AXHA 2YC1A 3BH9B 4FFVC 3CXHJ 5DVPA 3C5ZB 1DYZA 1NCHA 2Q3XA 2WLJA 3D52A 1OB1A 4P23A 4P2QE 1WZAA 3RWFB 4PJFE 4F91B 5MEQB 4CADA 3VM5A 2AEQL 3OTTA 3KPLA 2F54D 4JANA 1CXKA 1FL5A 1VZIA 3JWNH 3VG9B 4YDJB 3VACA 3TPUB 2UVFA 5I74B 4OD2A 4MAUL 4R83A 3AUVA 2B16A 2XIIA 1BSIA 4H25A 1G7HA 1NFDA 3JWOL 1S9WB 4K94L 2JB5L 2I69A 1S9XB 2E74C 1FIEA 3BAXA 5F0JB 5IB1A 3T1FB 4UCFA 2J1WA 1RZGA 3MZGB 2NXZB 5TF0A 5D55A 2QHRH 4UANA 3BPLB 5E6IA 1AS7A 4FNLH 5D8JH 2PP8A 2FX8H 3ARBB 4PYHA 3GKZA 4ABQA 3WNOA 2E9JA 4DGWC 2VXTL 4AM0A 5JW5A 2OCCB 4QHLA 5EA0H 2IH1B 3UYPB 4PGCB 1JZDC 3Q3GA 3BWZA 4P59H 1XMEB 2FZ3B 2H1PH 3B1UA 4PN6A 4JRYA 1TKWA 3HVNA 3MV9E 3WLWC 2AS5M 2VLKB 2JELL 1KCWA 3EAKA 3QFJE 4LFHG 1FNGB 1D5MA 1SXNA 1KIPB 1OM3L 3ARED 3TEYA 1JV5B 1TTFA 2A38A 3CZKA 3Q2LA 4KVNH 5ENWA 3GJEA 5EU6B 4UMSA 5IFJB 5AYUL 3VXUB 4W9EC 2O6FA 3EGXA 2WK2A 3MJ9H 3LIZH 1JGDA 1TQTA 1TVHA 3LZPA 4P2OC 2E0PA 4JHAL 2I7OA 1UOKA 5GS3A 2HH0H 1KCBA 2BW5A 4POZC 2R0KH 3OF6A 2PO6B 1UENA 3DC0A 1QSEB 4H2AA 4HIPA 3REVA 4G6KH 1OGAE 2E56A 1RUPH 3NYKA 1KCSH 3VH8A 3FTWA 1JPTH 4XVJL 3VFRA 3NSYA 2OMYB 3M7FB 4U33A 2WV3A 5KBLA 2LFEA 2BSTA 4O9HL 3FQWB 1KC5L 2JKSA 2X9XA 1SOKA 3EBAA 1YNTA 5E99H 4CUCA 3GMRB 4OZIB 1KLFB 1AIZA 1IQDB 2P1YA 3JTBA 2J2ZB 3L1EA 4LLUB 4PS3A 4U6YB 3U83A 2K3TA 1BM7A 2JIXB 1SVCP 1L5GA 5IT2L 1ZT4B 1BQ5A 4AY0A 3BEWA 1AC0A 3QXAB 3S88H 2HVKA 4PGZA 4XCEA 5H8DA 1URIA 4CU8A 1EFQA 5KJRL 4K5NA 3IK2A 2WB7A 3PP3H 5DCCA 1A6UH 1I3UA 5DLML 3UAJD 1WBXA 3FYEB 4N2DA 2AJUL 3ES6B 3QDGD 3C12A 3CZFA 3FN3A 4HJ1A 3K2UL 3SDXA 3PIQB 4JDZA 2XTJC 4PGJA 3BZFB 4FI6A 5ABDE 3CE1A 3BVXA 1J8HA 5DGQA 3IDJA 3HI6H 1M1XB 4OV6F 4PJAA 4QCIB 1EEQA 2G9HB 5LGKA 4H20L 1MRCH 2VM9A 3GRWH 2AQQA 3H2PA 3GHPA 1WBZB 1E4KC 1Q9WA 3QZWB 3EDKA 1TZIB 3RGVA 3PPEA 3SGKA 5MERA 2OR9H 4IDJH 4X6CA 3SO5A 1VENA 2OK0L 1F90H 2K1MA 4ODHH 3NRPA 3ZQXA 4OQTH 5I1CL 3A0OA 4WHYG 3PPSA 3ZDZF 1MG3C 4Z7QE 1CFSB 3UO1H 1MCWW 2ZKWA 3L5WA 3WS6C 1SZNA 3VA2C 4Q9RL 5FYKD 1RKRA 4Z76A 5J5EA 4OM0H 4UNIA 4I0KA 2HA1A 4RFNB 5D1ZI 1UZGA 3DETC 1UG9A 2QQKL 4PJ5E 1ZLVH 3DBXA 2F58H 4HIHA 3GSNB 5IHUH 4QRPA 2G5UA 4RGOL 3FHEA 4MS6A 4O2CB 2COVD 2ZKMX 3O9WA 1OY3B 3HAEH 4P2RD 3MV01 3VX1A 4AUYA 2A6KB 5IB4B 2ZNWA 4AENA 1AE6H 5K1NA 3Q2CA 4NP9A 1U8IA 4K3JH 2ZKHH 3TBSB 3B2UC 3KYKL 4PJFF 3PS6A 3J2PA 4HCGA 4FMFA 5E2UH 5B39A 4U1KA 4PQXA 4XAWL 5DC2A 1WPCA 2WQRA 1FORL 1U92B 1I9JL 1H9DA 3GBNH 2IBGA 3W0WA 3ARYA 3HE6D 4ZAKA 3CFCH 4AL8L 1KB9J 1OANA 4I1RA 2NX5B 4G5AA 1ASPA 2BY2A 4P4KB 2DQFB 2H45A 4RGNE 4UV4H 4AGQA 4Z8FL 4NI3A 4AVHA 4PRPE 4LLAA 4UILH 4KXDA 2DEWX 3BW9B 3IXTA 4HFUH 5JZ7D 2DH2A 3X11B 3D87B 2C3WA 1EA9C 2HTKD 3QUXB 1UH2A 4JFDA 4NUGH 4PW3A 1EEUA 5ADOH 1KENH 4NQEB 1J1OH 4H8PA 5KTEH 3KPSE 3OZKA 1I85A 4HXAL 3B9AA 4KJWD 1RZJH 5DA4A 2WKLA 4PUBL 3ZJAA 2DS4A 1GOHA 3CX5J 1VPOH 2YHGA 2NTSP 4BQCA 2GK0B 1SJEA 3HS0A 2DWEB 1G1YA 1NGYA 4FNSA 4WCYH 2HFGH 2B5IC 1UADC 1PCSA 2IANB 2CD0A 2HFEA 3EXJA 3FPXA 4QY8A 5JHLH 5AOJA 1AMXA 4OM1H 1JGLL 4I48B 2IG2L 4IIQC 3LZQA 5FHAH 3I50L 2B7DT 4Y2DC 2MCPH 5BS0B 2IAAC 2FATL 1VFMA 2BZCA 3VFTB 4F9LA 5ID0B 4NFBA 1DE4B 5A2FA 5L2JB 1G7JB 1MNNA 2XUWA 1NCDL 3MX0A 5DRZA 5EG6C 5C9JA 4ZODA 2PNDA 4OLEA 3LS4H 1MVFA 2H3NB 4P5TC 2XWTA 4HWBL 4PRDB 4NO3B 1MCFA 1MJ7L 1U6AL 1T7XA 2J55A 2PW2B 1CICC 3HG2A 4O2EA 3CSGA 3OSVA 5AZUA 2X4RA 4PLJC 5C09D 3WY3A 3H85A 4LLDB 3V0VA 1CK0L 4XOEA 1IAII 3GZQA 5I8EA 2MEJB 3SBQA 5EF3A 3QUGA 2A83A 3RFZC 1CLYL 3BVWA 4JY5L 3DSNB 1G6VK 3RKDC 3P4NB 2ZWNA 3G5VA 3L3GA 2VDPH 3NCYS 5EIIB 4PGBA 1DJWA 1QLEH 1WJ3A 4AEEA 4P2CG 4CSSA 1BOYA 2EYTA 1BZQK 2BSRA 4U49A 5EOQL 1K5WA 2ROYA 2VAAB 1M3IA 2FEJA 4LPUA 4X5LA 25C8H 3P11L 3QR1A 2Q0ZX 4MDRA 2EO1A 3RQ3A 4UM9B 1UCTA 2EE2A 3BN9D 5CZVL 3AXLA 4X7DC 4NAJA 5B22A 4IRZA 3UCQA 3BH4A 3C09C 4PD4K 3N1QC 2CRMA 5CCGE 4P2AA 2E27H 3DMMB 4HJEA 2H2PD 4GW5A 2Y1AA 1RU9L 4FC3E 1IGCL 3ZE2E 2EKSA 5IBUB 1VCBC 5DJZA 1G7PB 1MCDA 2MOQA 3S37X 3JV0A 3PFQA 4ODUB 4BWWA 5FYKU 1YEKL 3MRFA 1C1EL 4B9KC 4IOFC 1U36A 4M8RA 5CJOL 2P5PA 4BUHA 4KXZI 4Y2OB 3OAYH 2H26B 1UD4A 4NN6B 3Q6GH 2IDSA 2R2BA 3D85A 3MNMA 4R7XA 3U4BH 1XGQA 1Z5HA 4QXGL 5F7DA 3SKNB 2P5EA 1X5GA 3GPEA 4ZMYA 1IMHC 1DVXA 4MDIB 3FQNB 3RIAF 5KYUB 2NY4D 3DYOA 3OHXC 3GZOA 3RUGE 4CC1A 5D2NC 1OW0A 3FRUA 3IDYC 2C1OA 3J7HA 3QIBD 5B1JC 1NAMB 3FAWA 3CVHA 4F92B 4I18B 5IMOB 2V6HA 2G5BA 1KIUA 2VB5A 1ZS8A 4L8BB 1KJ3L 1TJMA 2VMDA 3M8OH 2OSLB 2AQPA 1HESA 2CHDA 2QZQA 2ZSWB 1JTOA 1D5IH 3HZYB 3MV8D 1T6VN 3QISA 5SX4I 3N1PC 2FSEA 2OMXA 2MOGA 3WTSA 4P3DB 2VN3A 4PJ9C 2BWQA 2IPTH 2BCMA 4MS8C 2JTYA 4QXVA 5BPPA 3UERA 5JW4Q 1IV8A 1UXWA 3IJSB 3PGFL 3T4AC 4HZ1A 1A1MA 3KPQA 2NSMA 3B9DA 3WY4A 3WNLA 4N9GA 3L2NA 4G82A 3ABKB 1JWUA 1Q9OB 3C2AL 3IDJB 1HEZB 5L7XL 2YGQA 5E9DA 3CSFA 3APFA 4G42A 4YOKA 3ASOB 5BQ7B 1A4KB 4K3DL 4LHUA 5DFVC 3QVAA 1DTUA 4NC1C 5A2AA 5KSAB 1F1GA 1WCBB 4KJYA 4UMGA 3L3OC 4JM2F 4UTBH 1JWSB 1A7NH 5C0GA 4DP7X 4MMXB 4PJDE 2PCPA 4PJGF 2DEYX 2GJRA 4HP5A 1M3JA 3FONB 3CPLB 4Z7AA 1MXDA 4JFFA 1JK8B 1ZA3B 2BRQA 3JWNE 5DUBA 5H2BA 2WVSA 3OLGA 3PGDB 4G7QB 2QL1A 4BFJA 1G87A 2W07B 1BFSA 5LBVA 3ARGB 5C9KA 5CP3H 5TPWH 1CLOH 1EHNA 2ADFH 2C3VA 4KX7A 3UZVB 5IEHB 5CO1A 3G5ZB 3ROOB 9CGTA 3EH2A 1KLGB 2JI2A 4QLWA 1VFOA 2IALA 4HOMA 1S3KH 2B14A 4FTVB 3S97C 1T21A 2YD7A 2F5AL 1AKJA 2CNZA 3FHQA 3X14A 4RZCB 1J9RA 1N2RB 3NIGE 1KTKE 3IU3B 1NCBL 1MF2H 4AUJA 3CFJB 5KN5B 4GXFA 3B2PA 2JJVA 4M5YL 4UT6A 3N55A 4XCCH 3TO2A 2VLLA 1CR9H 2X10A 4FA6A 3ESOA 2VLRD 3H55A 2VERN 4KOBA 4PWKA 3NFSL 4U2YA 5C86A 4HUWA 1KIQB 2VR3A 4E5XA 3WFHA 3VXPB 4FL4C 1BQLL 4PWIA 3RI5F 1HILB 3D09A 3X3GL 2BNQD 1H0DA 3UOAB 4Z77B 2PR9A 2RQ8A 4AYID 2C7FA 1E9OA 4ZUSB 5IHBA 5BMFH 2VDMH 3BZEB 5JYMA 3CBRA 2AEWA 2BVYA 3FU8A 3QT2A 2WAHA 4I3RL 5BZDB 3P73A 3FTZA 3FT9A 3TP4A 2KUTA 3I75B 3SQRA 3C5XA 4HIEB 1JFQL 2VR7A 1MY7A 3QUZB 4K5OA 5DR5L 2CO6B 5JPNC 1DJZA 4K7PL 1UB5B 3EFFA 4ZRGA 4A66A 2WHVA 1FG2B 4OTXH 5ALBL 3CDYA 3W37A 1V3MA 3F58H 3ECQA 1A6VH 5KJ4A 1TPXC 3AXHA 3DV4B 4YZFE 5J57B 4L8SA 1PFCA 3T8XA 4FYRA 4ZD3H 1XR9B 2XG5B 5FB8A 2P5WA 2Z0BA 1PF3A 4CC4C 4MX7A 3V4PA 5FWQA 1I1AA 5HTSA 3ZMNA 3JTTA 1TYRA 3HUJB 1AI1L 4G9DB 2E46A 3FBQA 4FAAB 3S98A 2BZ7A 2DQTL 2OMBA 1QFPA 5J0BA 2IEPA 3WELA 5IROC 3QRFM 3IVKA 2ZP8A 5KSBE 3LN4B 1I8LC 1WFIA 3RA7L 4LEBA 1TEFA 5DJDB 5HDQH 3QIWC 2ALAA 2I9TB 2AGJH 1JI2A 3ZKMD 2P44B 4GRLB 1O7DE 2J1YA 2YD2A 3P3TA 2X4RB 3IJEA 3O6FB 4F5CA 3HOGA 3QJFB 4LSPH 4ZUVB 1E7UA 4NKMB 3L2MA 1CDIA 2VLJE 2KBGA 1XSKA 5JOFA 2Z8RA 4PJEE 4U6VH 4TTDC 1WWBX 4UINL 1CF1A 4IGBA 4RLDA 4U3SA 4XPTH 3VQLA 1V3KA 1FNEB 4X7SH 5C97A 3CDFA 1KBWA 3NFNB 3B9EA 4M1DL 2Y3AA 4G7YL 5GS0D 1GGIH 2XZQL 4JPIA 2VZ1A 3QA3B 2MNJB 2OXHA 2CDGB 3DURB 3QFDB 5D7KE 5E2VL 3T0BA 5FK9A 3HE7A 1OP5H 2G60H 3KS0J 2CO7B 4P2QA 2Q10A 1THCA 1K4CA 3K74B 4G5ZH 4LVHB 4OLUH 4PJFA 5CZXD 1TU2A 1RFDH 3CBJB 3ZT6A 1PQZA 5FO7B 2KQMA 2UY7A 3BRDA 4GO8A 4APQB 1T1WA 2DLGA 2KLRA 4WKZA 3D9AL 4F7EB 5BJTB 5ADPH 2YN5A 4WY7L 2PR4L 4RFEB 4WGKA 1XBRA 5GRVK 3TYFA 2X70B 5I15H 1ORSB 2FLRT 4G3YL 2AEPL 4TS6A 3VG9C 3WHE0 5D7IB 2JKXA 5EC2A 3TGXA 2EILB 4XX1E 4JO8A 1H19A 2LU3A 1OWWA 1DP0A 1V3JA 1A6ZA 3D2UA 2EH7L 3IDIB 2NNAB 2AV7B 2NR6D 1OTTD 2BOBB 2CDEA 4L29A 3ZHNA 4N24A 3GD1C 3L95A 4PJDF 5DJ2A 1G9NC 1P6FA 2EO7A 1BBJB 4JFSA 2J6EH 4S2SB 1VFAA 1CMOA 4HK3J 4L3EA 1MFVA 4Z3IA 2FQFA 4LRIA 4K8RH 3BPLC 1HI6B 1TQBB 3QJUB 5G5DB 5GRVL 1SFHA 2ZNXA 4MGXA 1MCPH 3MV9A 5T1JA 2BH0A 2ZAHA 4HGMA 3U4AA 3GMQB 2Y23A 3LZOA 3FT2B 4U4IA 4A2GA 1NFIA 4DGIH 5GGUA 3MODL 3QFJA 4M48L 5E8DH 3ETSA 5T1MA 4ELKA 1FNHA 3LZFL 2F7PA 4HKBA 1CDBA 5ICYA 3L3DB 2FJGB 1G7IA 4MB4A 5EB9A 3ILDA 2R1YA 3EDJA 4E41B 3NN8B 2CHZA 3EOTH 1TETH 2FD6L 4PRNB 5IFHH 3BXNA 1YY9C 1CFMA 1MZYA 1UB6A 1YA5A 2RFXB 3KXFB 2AV1B 2YK1L 3EFDL 4M5SA 3NSXA 1HNFA 1RHHB 1OP3K 1QVOA 4NZUL 4PSRA 3QJZA 3SY6A 1XTMA 5C07E 4HSAC 1ET5A 1H6TA 1KFAL 1OP9A 3QEGH 2Q87A 1WT5C 2JNZA 2PWEA 1OGAA 4F3FB 3LMJL 2PO6C 2VGLM 2BNRA 3RWEA 3W39B 4DN4L 5IJKA 1R3LA 3KPNA 5FDWA 3MACH 1VSCA 3U0WL 1ILUA 1KYOJ 2P8PB 1WVZA 1NBVL 2WTRB 2R0LL 2Y7OA 3AWFA 4DH2A 4G11A 5KVGE 3VSQA 1W80A 4K0OA 1AIFA 5IMMB 3R8QA 1R3HB 4OZHE 3EKCA 2MTPA 4PREB 3WJJA 4BSWB 5I17B 4RISH 3VXSE 2VC2H 4XBPB 1M9WA 4IIZA 1P2CA 1YJDH 2VXUL 4EQ3A 1IC1A 1DQDL 2F8OA 4UTAH 1D9KA 2BW4A 4M7LL 3CN3A 4EZJA 1QX1A 2DYPB 2EEBA 4F8LA 4QIRA 1E6JL 1IC7H 4PB0L 3O11B 1MLBA 2ED7A 2NW3B 4IBTA 5FW6A 4LF3B 4PLKC 5D1QE 1SVZA 4N2MA 5IQLA 1PLBA 2D7MA 1Q38A 1GW6A 3SQOL 3BWAB 1QFWL 4HUVA 4Y1AB 2O6CA 3CVIL 3FB5B 4R96B 5C0CA 1G5GA 3ISYA 4MQXD 1HL4A 5FFGA 5T5NF 5FYLD 3KCPA 1AZVA 3PRZA 4GW1B 5KSBF 5DD1H 2O5XH 2WBJB 5AW7B 2LVEA 5LG6A 3SIKA 4JG5A 3KPPA 3I2CH 4BDVA 4CN6A 2GJ6B 1UXSA 5AOLA 1PYWA 4CRPA 2P8LB 2IDUA 3ISRA 1PZDA 1U2YA 4OLWH 5E00B 2CJSA 4RMWA 3ZTDC 2FQEA 3E6FA 4UBDC 3NQIA 3TA3B 2X28A 4PJEF 1PZAA 3PGCA 4DW2L 3OMZA 1KPRA 1VAHA 4HUCA 4PJ5A 3IAPA 2HKHL 1GS6X 3FULA 4BE5A 3FUFA 3O4LE 4I7ZC 2IADB 4J3OD 5DJAB 4JJ5A 3ULSB 2EVHA 2OYKA 3NJIA 4XP5L 4EUPB 2YAOA 2XA3A 5IK3B 3ZKND 4A7QA 4QUOA 5MEOB 3MV7E 3PL6D 2QSQA 2WBKA 5GISH 4HUKB 2WCSA 2Y2TA 1JUFB 3FH5A 4LPCA 5D9SB 2GJPA 3OB0K 3N44B 3VGAB 4R97C 5F96H 1M2VB 5F70A 4HEME 2FUQA 3FF8A 5LBGA 4S10A 4ZFFB 2NRDA 2ENJA 4IHOA 5ERWA 1BF8A 4J1UA 3KH4A 2Q7YB 3RWHA 1SYSA 1BEXA 4ZO8A 1S46A 1HNGA 2OZ4H 4H26A 1UXMA 1LO3L 4YE4H 3TCTA 3D0LB 1ECZA 1Y1UA 4N0UE 2A73B 1OE1A 4PI0A 3GBLA 4JPWL 4XAKE 3S5LG 4PRPA 3NZSA 1N6QL 3TZVA 3NCCB 1X4XA 4KKRA 4M43H 2J1KA 4JRFA 4UNVA 3QNZA 3QZBA 4DEUA 5SWZB 2EAEA 3N91A 4O02H 1MFBL 1Y18A 2BERA 2DQCH 4IRSC 1BMZA 1KEMH 3TNMB 3NSCA 1OXYA 1TTRA 1FNLA 2OV0A 2K78A 5DD5L 5SWSB 1HKLL 3TT3H 4UOJA 3KPSA 1CT8B 1SMDA 3ZBMA 1T4KA 2EDYA 3PUCA 3ZL4L 4JM2A 3TEZA 1O9VA 4MDJB 4PY8J 3LPPA 2EDDA 2I7SA 3H4HA 4ZQTA 2IGTA 1KJ2B 2WBWB 3K8LA 3SYQA 3GTVA 2ZCZA 2DBLH 3V2AR 2F08A 5F3HA 4JG9A 3FRPB 5F9WB 5IBTL 1M71B 3WS3B 2Y7QB 2O6DA 1CD0A 1I1FB 2AI0H 1L7IH 4H2CA 2K0RA 1WA0X 3P77A 1M7IB 2IGLA 4PJXB 5DMYA 2AVGA 4JO5A 3SKOA 3TT1H 1WGVA 5I6KA 1HQRB 1NPJA 1TXKA 3RU8H 2LU4A 3ET9F 2J4WL 2Y36L 4ODVL 5I1AA 2Z8VC 3FAXA 3HLAA 3O4OB 4YZWA 3ZRFC 1YNLH 3HNSH 5ICXB 3TOPA 4YGVA 2ARJA 4FS0A 5I1DA 2ZZUT 5H37A 2IDCA 4ZX6A 4PP2A 4UUJB 2NY5C 2KLSA 4WDIB 2GC7C 3NJHA 5FLUA 1FZKA 2XQYA 5AUMA 3ARZA 2GKIA 4IMKA 2YPKA 2DWXA 1G4RA 4JHUA 5BV7C 2UY6A 4R8WH 2ROXA 5L9DH 4I0PB 4EN3A 5C8JA 1KOAA 3EJYD 1J18A 1NBQA 2Q3AA 3S37L 4PTTA 1SJHA 3HBGA 4K9EL 3UG3A 2CR3A 4ZPVA 1T5WA 4OZHF 5AVZB 1KTDA 2CO2A 5D70L 4J3BA 1RJZB 1E2VA 4ZMZA 2H6PA 3RY6C 3FTSA 4KX8A 4PJ8D 5B39G 3S8FB 2PMZA 4K7FB 4CC0A 2VZTA 4CMHB 5IKCB 1S8DA 1MXGA 4YBLC 2GAZA 4U3CA 4RNRB 1J86A 2I5YL 5IFAL 5ICZA 4CDHA 4KFMA 4OFKA 1HJCA 2QBWA 1PEZA 1HXMB 3E2HB 2QVTA 5AWNH 3CQQA 4RGMB 4AQAA 2NDFA 5IIEA 4DP9X 5EU4B 1NCCH 5GS1A 3O6ML 5FW7A 4OJYA 1FV1B 2LTQB 1A4JA 3B4NA 4YN3A 4XPAL 5CZKA 4IQHA 2FH8A 1H6EA 3CFDA 1DVFD 1MAML 2WOYA 3CXDH 2JJTA 3MOBH 4IBZA 4XR8C 5IVXE 3ARRA 4DKDC 2B15A 1MY5A 4G8GB 1RZ7L 5EEXA 4OIFA 4ATWA 3WY2A 3A24A 4QRFA 1NA8A 1CCZA 3BQUD 1U58A 3VXMD 1VERA 4JKNA 4LAJH 4ZS7H 4M7JL 4B9ZA 3NMEA 3O3AA 4KI5C 4YXKL 4EF3A 3AREC 1SF3A 2AXJA 1YUHB 3BVTA 1L9RA 4FEMA 2YKLL 1HHGA 4AYSA 3QDMB 3BX7C 3KCWA 1INQA 1YYLL 4G7VH 4DO6A 3JWDC 4NN6C 2ATKB 3AWEA 4TOYL 4K55A 1U8QB 3WENA 3WEXA 3RUGA 4LP8A 3OGOE 1QBBA 4M7KH 2JK5B 4Y7MA 4WSJA 2V2WB 1VACA 3RVUC 3KGUA 2MQ3A 3IFPB 3MA7B 4PVLA 2Z4TA 5DYOA 4IJTA 1FZJB 2BCKA 3SPGA 4OF3A 1Z1WA 5F9JA 1RUML 3FUNA 2YZ8A 4OKVA 1W72H 3B2DC 1ZVNA 2EE9A 4M5ZL 4O2FB 1ACZA 4YHOH 5ITBH 1UM6H 2KPWA 4NSKB 4W9FC 4NO5A 5D7JA 1J05B 1USQA 2TAAA 2F19H 1HHJA 4J4PD 2ZUYA 4IYKA 2RJMA 1ODAA 5JR1L 2I60H 5DYFA 1RL1A 2J56A 4PY8I 3WBDA 3DHMA 1KBGH 2FWOB 3EG9A 3DX4A 2XIBA 3QR2A 2DQIL 5IMLA 3S3CB 4ESKA 5HI5D 1CL7H 1UEYA 1INDL 1VCAA 2KI6A 3KPOA 1EZLA 2WYZA 2BOLA 4FGMA 4MAYA 3QPXL 4PV9B 5EMYA 4AE0A 1AQDA 3OKLB 4U1SB 5JQ6L 1SXSA 3DIFB 3GSQB 1QBLH 1I1RA 5FM5O 2VDLB 4BQ9A 4F7KA 3FXIC 2NXZD 2KHAA 3KDMA 4NNXA 4ZDHB 3UZEC 4WU7A 4D8PB 5CFHA 1W6LA 3PHOB 3TN0B 3TVMD 5MENE 32C2B 4NN5C 3BHBB 4HIJB 3S3PA 5A40E 1A65A 2NLJB 5FGSA 4G8IB 2L8AA 4MAUH 3VFNA 2BP0A 4M8QB 4BJLA 5KSAC 2DRUA 3JWOH 3BP7B 1T3FB 3M17A 4K94H 2JB5H 4JBSA 2PKDA 4PJDA 4PR5A 4RIRB 1F5WA 5LN8A 1G84A 2XWZA 3MRMA 2AXFA 2CLRB 4F7CA 4KJQC 3QORC 4HD9A 4ZMAT 2HJLB 2YPLE 2H9GB 4MMXC 3OMNB 4K23L 4ERSL 4LAQL 2DBJA 4D3CL 4PG2C 4UIKL 5CEZL 2FNBA 4MJIE 3WGUB 2HJKB 3PHQB 1K2DA 3LN9A 4P3CH 2VXTH 3V6ZA 3RTQA 3SGJA 3ARGC 3KYOA 5IUSA 5JA9A 3GDCA 4PAZA 1AO7A 3MBEB 3CZNA 3C5SA 4Z5RB 4JDVA 4AIEA 3DHPA 4OU3A 4JFOA 1LNUA 5DK2B 1EV2E 3HNVH 2MKLC 3MRDB 1T20B 1OM3H 3TO4B 4P9HC 2XKUA 1M6UA 4H8UA 1D6EA 2ZWSA 1F3RB 4H44C 5T1KA 1SN2A 5FLVA 2R0ZL 4CW1B 5AYTA 1ND0B 1Q94B 5MEPB 5AYUH 4L4VB 3FTGB 4RGNB 1U3HB 1BBDL 2WWMC 5E94B 2MH4A 1F3DH 4JKPH 4I89A 2HLEB 4JHAH 3TEXA 3GHEL 2QQLL 1NANI 4DCQB 1E3ZA 1FI8C 1BAWA 1FN4A 3GSNL 4G80B 2N1TE 4WO0A 5EPMA 2YOCA 1QRKA 1BVLB 3UO8B 4JFYA 3LH2L 2WZ5A 3QNFA 3K71A 2XZAH 3MJ9A 1P4LB 2UWEE 3LIZA 4XVJH 4KTEL 3STLB 3C6SA 5DZAA 5D2LB 5EZLA 1ID5I 3TBYB 1HZHL 4XGZA 5D1ZB 2AKRA 1E6OL 5CF3A 2OJEA 3RNKB 2H3XC 1I9IL 4O9HH 1IC0A 4QHUA 3L45A 2WMPA 1GH7A 3WXWL 4X9YA 3UIYA 1GA2A 4KO6A 4R2GD 3ARFB 4MJHA 3T4YB 3F01A 2HX7A 3QUZC 2NT0A 2I07B 1CDYA 5IT2H 3CFIC 4W70A 5GZOC 3C8KA 5I6PA 1EAPB 3L5IA 5KYWB 5KJRH 2ESVD 2ZPKL 5IJVB 4P3WA 4YDIH 3FSZA 3BJLA 4GEIA 2HCZX 4LHUG 5FDYA 4A6YB 1CC3A 2J8HA 3D39E 2DIBA 5DLMH 3VXQA 1BGXL 2AJUH 2B1HL 4HJTA 1LILA 4LCCB 3K2UH 1TJXA 3TWYA 5E2JA 1X4ZA 3FTUA 3HG1B 4Q9BA 3CFKB 1XF1A 1OCRB 3SCMD 1XH3B 1JNNL 3ZT5A 5CGMA 2Y07H 5KSBA 3GJFA 3TPKA 1MHCA 4H20H 3HRZB 3EO1B 3QNXA 5IB5B 4LPXA 3WJMA 2RACA 4IU3A 3S2CA 4HBQA 1T2QL 4IOIA 1QR1B 1IBZA 3QWOB 4L3CA 2F8VA 2GYSA 5CSZB 5GQBA 5I66B 3DJ9A 3VI3B 2OK0H 1LP9E 1QTYT 4QRRE 5I1CH 4PJEA 1YMHA 1NDGB 4GRLC 2OULB 3V95A 4K9JA 1M6OA 5HHPA 3GRWA 4MTMA 5JXEA 3EHBB 3FUMA 4MVBD 1QWNA 5BVJA 4OFDA 4B7IA 5A2CA 1Z3GL 5EDXA 3SHSA 3V5KA 4JKWA 2QQKH 1I7UA 4XH2A 4PRHB 2HRLA 4OFYA 1IGJB 2WD0A 1NGXA 1H3XA 1IRAY 3MO1A 4I77L 1EMTL 1X9UA 2J88L 4LNRB 4OQTA 3WTVA 4RGOH 4TM9A 3UMTA 1J5OL 4P4KD 4EI5A 2WY3B 2YXWA 4XXWC 4AK2A 1ORQA 1CPUA 3KLHD 3MUZ1 4F1ZA 4LVHC 3MJ7A 1IFGA 3PHAA 5JA8B 1EFXA 2JWYA 2F9BT 1PJWA 3FTXA 4GAAA 4E5XG 1AQ8A 4APQC 1G9MH 4XAWH 3RPIA 5C0EB 3L4WA 1XGYL 3OL2A 2MJWA 2X6CA 1ZLUK 1C16B 1I9JH 3EYOB 1R34A 2CGZA 3HAEA 1B0RB 3W3BA 2EIBA 4AL8H 4NQED 5EOTB 1MFUA 1AD9B 1X5AA 3N0AA 3BN9C 4KKAC 3B8YA 3UTTD 3ECVA 5DQ9A 2WCGA 1MHEB 2V8LA 4NNYA 2OSWA 4Z8FH 4OB5H 2K7PA 4RAUA 1BQHG 2EACA 2ZYHA 4X83A 3WFZA 2H2PC 5GGRY 3QYCA 1I8IB 2E59A 2CUIA 2APVA 2X4OA 3D4GA 3HC0A 3WJLA 1WD8A 1HOCB 3TH4T 5M94B 2BSBA 2IAND 1D6VL 5FYJD 4YDNA 1Z9OA 4UYPA 3LKOA 3SE6A 4PJIE 3LQMA 4J27A 3ETTA 3NZUA 5JW3L 1JZGA 3R06A 2QPEB 2VE6B 4HXAH 2VN4A 2EDBA 2ZOOA 4NQUA 5BVPH 3ECWA 1W0YT 1I31A 4HKJA 3ZTEA 5BS0D 2Z35B 1VGKA 3RB5A 1DZBA 5E56A 4PJBB 4P23D 1TLKA 5AVXB 3ULUD 2NUPA 1SLVA 3U79A 1P5UA 1LJMA 4L0ZA 5EF2A 1K9TA 5DJCA 4YHML 3HFMH 3GMPA 3NACH 1QLFA 4QHNA 5J1AA 2Y22A 3HG5A 3PHSA 2IG2H 4MJ4A 4ZUTB 3I50H 2KKQA 1NICA 2FATH 5C07A 4GP5B 2NQ3A 1QEWB 3LNIA 1NCDH 2RHEA 4U1JA 4YSOA 4NRZB 4NO2B 5JHLA 1BFVH 4A2FA 1MN4A 4HWBH 4FABL 1AANA 5E6ID 1NUNB 1MJ7H 1S7TB 1S7VB 1UD5A 2JB6A 4DKEL 1NAML 1U6AH 4QWWC 3NFPB 3NIFE 2UWEF 4M6ML 2HT3C 3DXAB 1NOAA 3KYNB 1U8PA 4UQ2A 3D3VE 4WHTA 4OZHA 1CK0H 2R4RH 3DX0A 5IF0B 1I75A 1NOFA 4LPTA 3VXSA 5IZ7A 3I9PA 5KVEE 4HEPA 1CLYH 3CFTA 4QYOB 3IMSA 3FOMB 3QO0B 4JY5H 4PM1A 4JRYD 3HBQA 3MNWB 1PMYA 5ACZA 3FCTB 3FFCB 1MW3A 2FEEL 2WNWA 4ANKA 2G2PA 2OZNA 4LLMB 1IFHL 3FZUC 3IGFA 2DIAA 3LKSA 2ZIDA 4NCDA 4Q9CA 1SBBA 3NDYE 5EOQH 3ASNB 4KGLA 2FYYB 2OS7A 2Q7AA 1Q0XL 1KCKA 1D7CA 2M83A 4FN0A 1PEWA 2LT9A 3QJVB 4FHBD 4WWKA 3SDAB 3T0EE 4ZPTB 5F1IB 3U1PA 3P11H 4ZMNA 3NH7H 3P0GB 2DH3A 5CZVH 3V0DA 43CAA 1LDSA 3RX9A 1AXSA 3V55A 3WNMA 5GIRB 5JQIB 2CK0L 2YA1A 5HI4C 3FCSA 2GEEA 3WTYA 4JZOA 4N0CC 2WLLB 3OF6D 3NJVA 5AVYB 3HZVB 1O0VA 1RU9H 5DFAA 1IGCH 2WBXA 1CBVH 2WBJC 3GRGA 3IMVA 2VQ1A 1WAAE 5C2UB 4PS4H 4ZSOE 1LP9F 1C1EH 1ZDQA 3LNEA 3KGRA 3DJRA 1AJ7L 1S2EA 1ZPLA 2XJKA 5CINL 3AT9A 4KOCA 3Q0HA 2VM3A 3HVDA 2P52A 3UG4A 4KITB 1I7TB 1AS8A 3TA3C 2VJXA 3EDFA 1BREA 2XPZA 1QWUA 2JQAA 4QXGH 2OQJB 2VIRB 3EYQC 4Z95L 4KZDL 4FFTA 2EABA 4NGHL 2H0EA 1RERA 3MV7A 3KR3L 2OMWA 1CQYA 5DT1L 3DRTB 4Z7WF 5FR3A 3AY4A 4HS3A 1QI5A 4P9HL 4BRJA 4ORZC 3IJYA 3LJ3A 4PIBA 4HEMA 2BVUA 1TDQA 4GB9A 3VGAC 1MJ8H 2NSXA 2ODIA 1KJ3H 5E7BA 2P47B 3G5YB 4JL2A 1L3NA 5F7BA 3VQMA 1P4BL 4YBHA 1FYTE 4N0UA 4MMZA 1IARB 3MLUL 4WK0B 3BVNA 4JREB 4FQ1H 4EIZC 3RGVD 3SPIA 4FOMA 3Q2NA 1LE9A 4ADGA 4HG4J 2X89A 3SOBL 4WV1B 3PGFH 4X5WB 4R4BA 4N9OB 1GJWA 2HG5B 1ASOA 1HYSD 5FYJU 1EEYA 3G5WA 1X5KA 3PAZA 1YUKB 15C8L 4F33B 3C2AH 1PZ2A 1KACB 4FNUA 3HMWL 5L7XH 1ZWIA 4Y4FA 3T0WA 4K3DH 1OTSC 1R5VB 4PJIF 2APFA 1MNUL 5EZJA 5DRNB 3K5SA 4QRPD 3S7GA 4RWYL 3BUPA 1EZVY 4YH6A 2G3MA 1ZXKA 4XBEL 2VLJB 4FEIA 4NXSA 2E7BA 4MA8L 1NMCB 1NM4A 1ADWA 2NY1B 4Q2ZA 3ZMEA 2W0LA 1N64L 1S7UA 5HHME 2PTVA 4DP1X 5HHVL 2OW7A 4U7SA 4I1PA 2GB2A 4J39A 2Y2YA 5CHNA 3H9SE 4UOW0 1OK0A 1N19A 4PCSA 4YX2L 3G08A 4UTBA 1BIIB 4LCIL 4XCNA 2D03L 1DVQA 1UVQB 3F6IA 4ZAKD 1AVAA 1BPVA 4QO1B 4FJZA 3CDZB 1KGXA 4XBGA 2DLHA 3LKPA 4G6FD 3V6FB 2DMCA 4LDOB 3O4OC 3ILQD 5E6RB 2EVJA 2F5AH 5IHZA 4XPBH 5T8IA 4J23A 1T5XA 4ETQB 5CP3A 1GTNA 1X5JA 4NDMB 1I1YA 1VRSA 4PJ7E 3VI4B 2FT7A 2W0FA 3CSPA 3JV4B 3OR6A 3T1WA 5IB2B 3SE4A 5JNYA 1NCBH 1SY6H 5TQ0L 3MGOA 4WU5A 1O6TA 4JFDD 2R1WA 3DRQB 4KAQL 4M5YH 5GJSL 5HHOB 2ICWJ 1R5WA 4AE1A 2G4EA 4WI7A 4QGYA 4I0PC 3VCLA 3CCHA 1LMIA 4PRIE 3NFSH 4FQXA 2BM3A 2K6YA 1YEFL 4MJ6A 4MRCA 4ORGB 2XN0A 1S7RB 3LPFA 1BQLH 1QBAA 2V9UA 2DJMA 1YEGL 4JFQB 3V7AG 1VFBB 2XVBA 1OK8A 4OD3L 5DI8A 3X3GH 1CQKA 4WW1A 3CBKB 4LL9A 5CU9A 4W1TA 2Z31A 5SV4A 4HBCL 1HSBA 4F7PB 4GIAA 3TA4D 4JE4B 3D33A 4Z0BL 2BJMH 3EJZD 4U3HA 3VE0B 4I3RH 5C70A 5D5MB 3OM3B 4X6BA 3A21A 1U3ZA 1SDDB 2PN5A 2QFPA 3E7JA 3NCMA 3BIKA 3MRHA 5IW3A 1BFTA 4RGMC 1YEHL 2FL5A 1JFQH 5HDBF 1PBYA 4LARL 1I3VA 4XMPL 5DR5H 5LXVA 4K7PH 4Y5XA 2V3EA 5IVXA 4MA7L 1MRDL 5ALBH 2LTQC 3ME0B 2IPUK 3W57A 5HGBB 1JZ6A 2Q1EA 2BHUA 3KNBB 5HPMA 1J88A 5JMRA 3WFBH 1XF3B 1W8EA 1IVLA 2YBGA 4NJAH 4JN2A 4N2NA 4WFFE 5EZOL 1C08A 2X2HA 1QLFB 5CGBA 2XZZA 3CFEB 2DLEA 3RAJL 3LQZB 3IFOB 5E23A 3INUL 5HHNA 3KE0A 1V10A 5FGCB 4NXKA 3OKOA 1OAJA 1QPXA 4Z3HA 1MZZA 4UU9A 2A77L 2CCVA 2EKJA 5K9JL 3E6HB 2XNAA 4H8VA 2DQTH 4BK5C 4NENA 5JO5B 3VAEA 3VWKB 3BP4B 2R8SL 1JYVA 1SHMA 1Z5LB 3MXVL 4LCYB 1UD8A 2E9IA 3ASWA 2E8ZA 3VFVB 2VISB 1LMKA 4OZGE 4OCXH 4Q8BA 3A67H 4F15B 5ACLA 3EIFA 4IBWA 1XSJA 1FE8H 2VSDA 3R0NA 5C92A 4JEGB 3LQAC 4ZO7A 1H8SA 3DIDA 2VSCA 2B4CC 3MROB 4HHWA 4Q97A 2CQVA 4RBPK 5IVNA 1HU8A 4UINH 1A1OA 1F0LA 4QRQB 1C5CL 4TVPD 3EZJB 4M1DH 5HGHB 1XGPB 1ZHKB 2GUOA 4G7YH 5FKPB 1KPVA 2XZQH 4OGQC 1UUSA 3HZMB 1AGCB 5IHLB 3P0YL 2RBLA 4YNYB 5D1QB 1RJLA 5E2VH 5GPRA 1M57B 1E9PB 3P40A 4P46A 3RGHA 2BLFA 3GM8A 3SE8L 2YD0A 2RCSL 1T1ZB 4WUKL 1F4WL 5IUCA 1UKSA 1FNAA 1XBDA 3SGDH 5E2TH 4FQJL 4XB3A 3QJSB 3VDCA 4OF0A 4R5TA 1KYUA 3D9AH 4YPJA 4ZNCD 5GZNC 5I6LA 5MENA 4WY7H 1CGTA 1P1ZA 1XIWC 2PR4H 2DTSA 4XTRD 4QI3A 3N42B 3ZU8A 3D85D 1U8HA 1BJ1H 2AEPH 3TN0C 4LNVA 1OM9A 1ZLWK 3S96B 1TQVA 3K8KA 3WTTA 1BQKA 4OH2A 1OGPA 4FQ2H 2GSIB 4DF9A 3ECBB 4HV8B 2YRBA 4NM4L 3BUIA 3PLYA 3AAZB 1AQMA 2EH7H 1EAQA 1F2XK 2YPLA 5HI3D 2L7UA 3MN8A 4L4TA 2F1EA 3EYUL 1JSYA 4Y2NA 1Z9SB 1YYML 3OKKA 2WZ0A 1GZHC 2HVJB 3FJTA 5TK2A 4ETYA 4FI8A 2YXMA 3O4LB 4HXBL 3S5LB 4P5KA 2JJSC 2IDQA 3BD5A 1TJHH 1PS3A 3B3BA 1FO0L 1FQ9C 5F3BB 1LLAA 4DOHB 2AVFA 2O4EA 2XPGA 3KBHE 3TJHD 2A6DB 2J6EA 2IPKA 3MODH 4M48H 1EGJL 5E4EB 4Z3TA 3QQ3B 2Y1YA 3GZPA 2X4NA 5F7HA 4JFEE 5F9OL 3F83A 3HFFA 3UXFA 4Y8AA 4FG6C 1ZT1B 3K1DA 3ZKNC 4PJ7F 5J8OA 5CILL 5E9DD 1KXTB 5C3TA 2NY0D 4HGKC 1H3UA 4D7BA 4GSUA 1CU4L 2FD6H 1N3NA 4QAMB 3RWCB 5I6OA 3IFNL 4F7TA 4MB1A 1KTBA 4LHUD 3RVVD 2VDRB 1XSIA 3BESR 3WUWB 5IMKA 4LASL 1U3HC 5DHYB 3U4EB 3IB4A 3HKFA 1G0YR 3RWDB 3WMQA 4EIGB 4NZUH 3GUFA 2FJHB 1NC4A 2WIIB 2LW3A 3QIUB 5EF1A 3GSRA 4KDTC 1RUAL 5L8KB 2N7BA 4NRYA 4BWUA 3Q8CA 3OKMB 3UBGA 5FPIA 4A7UA 2UWEA 4JFFD 4ELMB 3LMJH 2FWSA 4Y4HA 5ID1B 4DN4H 1KJMB 4W9ZA 5DSCB 3U0WH 4H1LH 1Q0YL 4XNQB 1RZ8B 3P4OA 1NFKA 5BOJA 2YJQA 3D0VA 1I1CA 1P69B 1IBHA 3P30L 4HPYH 4U1MA 3W2DH 4OUUB 3FFDA 4PJHF 5LGYA 5FM4A 1MFEL 4FLQA 4FCAA 5I75C 3VXOB 3CHQA 4HWNA 4EJ1C 2VXUH 3ARFC 1AKJD 2X2UA 1UWEL 2AFNA 4E42A 5F7YC 1KY7A 4OVUA 3V4UL 4BXVA 5JHBA 1L6PA 4Z7OE 3D39A 1HE8A 3MRPB 5D72H 2EIZA 4GKZA 5G4NA 4IRJA 3F84A 4KI1A 4M1GL 1FLTX 3NPSB 4GG6B 2O61A 2GJ6D 4Z7VF 1SXAA 2BP8A 4WWPA 1DQKA 3BSZL 1EDHA 2DWSA 3QUYB 3SQOH 5L9DL 1DEEB 4LCCC 4UTAA 2Q8AL 1AC6A 1UUNA 3MRKB 4KUZL 3L3JB 4YUEL 3UADA 2WWKT 3F64A 1A22B 7PCYA 2XYBA 2QDWA 4HJJL 3VWJA 3SY0B 1IM3B 3HRZC 4PHZA 1F11A 2JQMA 3JXAA 3KWWA 5D4QA 1X9RA 2BSSA 4AV5A 1KJ2L 1FFOB 1LP9A 4FNQA 4OZGF 4WU5B 4JX0A 4HWEL 4QRRA 3PWJB