3PFUA

N-terminal domain of thiol:disulfide interchange protein dsbd in its reduced form
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
119
structure length
119
Chain Sequence
b'GRSQFVPADQAFAFDFQQNQHDLNLTWQIKDGYYLYRKQIRITPEHAKIADVQLPQGVWHEDEFYGKSEIYRDRLTLPVTINQASAGATLTVTYQGCADAGFCYPPETKTVPLSEVVAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein dsbD
molecule tags Electron transport
source organism Escherichia coli
publication title Oxidation state-dependent protein-protein interactions in disulfide cascades
pubmed doi rcsb
total genus 23
structure length 119
sequence length 119
ec nomenclature ec 1.8.1.8: Protein-disulfide reductase.
pdb deposition date 2010-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11412 DsbC Disulphide bond corrector protein DsbC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1250 Mainly Beta Sandwich Immunoglobulin-like Thiol:disulfide interchange protein DsbD, N-terminal domain 3pfuA00
3PFUA 2K9FB 2K0RA 1VRSA 1L6PA 1JZDC 1Z5YD 1JPEA
chains in the Genus database with same CATH superfamily
3JYCA 5D1ZB 1D5ZB 4OFKA 1X6NA 4NZ8A 5HJDA 3WIFB 1AZBA 5E1AB 1S3KL 2JKTM 3BWAA 3C60C 1XDTT 3GTTA 3MCKA 3OR6B 3BAXA 1K2DA 1MAML 1NBCA 1QZ1A 2CDEB 4WJ5A 1AKJB 3MLSL 4JFOA 1AXTH 3PE9A 1UKQA 3MLZH 3DX0A 3OR7A 2JI2A 4M9PA 4WKXA 2VLJB 3MR9A 3QG7H 1QD0A 4X5XB 2PCYA 4Y5YC 3GB7B 4R7XA 1VEOA 2NXZD 3GSNH 4GAFB 4IKIA 4NUMA 3M1BA 1U8IA 1NDTA 3MRFB 5I1DA 3CH1B 3G6JE 4UI2A 2X4OA 4DZBB 2XPZA 1F56A 4ZOBA 2ESVA 3DPBB 2HYMA 3MRPB 5DD1L 3RWDA 1QBML 2WXQA 1ZHKB 2LGNA 3ARDC 1DCEA 5IQ9A 5IQOA 4W6XB 3EJUA 3VFMA 2R7EB 5LN4A 4U1NA 3DO7B 3QS2A 1GYUA 2IALA 2PTUA 3CDZB 3OKKB 4OTXL 1RZJH 4Z5RA 5GGSY 2DWEB 4EDXA 4LPTA 3VH8B 1EFQA 5AW3B 3HS0A 1FHGA 3D4YA 4ZDHA 3T0ED 4DKEH 2BFVL 4U1HA 5JUEL 3IE4A 4ETQA 4G7YL 2CWRA 2F1BA 3N9GL 2OCCB 3A67H 4U3HA 1C12A 5DJAA 1RZ8B 4JZNB 4FYSA 2Q8BH 3K2UH 4ONOA 3U9WA 3VU1A 3MJ7B 4XMWA 4AEEA 3KBFA 1TTFA 3MXVH 1OAZH 5C09E 2B15A 4QXUL 3V4UH 4IU3A 1CMOA 2KI6A 4NZDA 1T1YA 5FO7A 4JCLA 1UXWB 1A14H 1W72H 3AG3B 1M2VB 2KKQA 2X6UA 3HVDA 3TPUB 2VDRH 5T1KD 4L3FA 2PW2A 4HIPA 4WK4B 2LVCA 1CXFA 4TTDC 3N06B 4M3JA 2DWDB 2FE0A 2A77H 2NY5C 3WFDH 4DN4L 2VW6A 4HWZA 3AG2B 5F1SA 2ZTBA 4M6NH 1V55B 4PWJA 4AEHL 4DH2A 1FL5A 5HDBE 1JL8A 2B8OT 4KK6C 5AZ2H 2ZUWA 3C08L 5EEYA 1ZHLB 3CFJA 4KGJA 4YO0B 3VFTA 1A3ZA 4F7PA 3S2CA 5IMLA 1JXFA 4V1DB 5GGUB 1UH3A 4RFNB 2AEOA 3QNFA 4ZMXA 2IFFH 4POZC 1I1RA 2OMVA 4BUHA 2JJWA 4B9PA 3OAZH 4OV5B 3ULVL 1HK6A 2COQA 3HE6B 1OB1B 2AV7A 4X83A 5IB3A 2Q6WB 3KD4A 3TJHD 1DTUA 3DX9B 3FFCD 4BFJA 3MO1A 2MWCA 1WAAF 1GC1H 1C8PA 3B9KC 3BX7C 5D71H 4AV4A 4WUUD 1U95B 1OT1A 4B7IA 4QRRD 2OP4H 1H3WM 1ZTXL 2X4NB 4C57C 1LD9B 2B2XH 1KBGH 1LK2A 4QRQB 3CC5A 2Y7NA 1UYWH 1ZANH 1D5XA 2B9BA 1JWSA 1WSST 3NH7H 5JHDB 4HH9A 5D2LB 1NUNB 1KTBA 2G2PA 3UTTB 3WIHA 2E4TA 4PRPD 2VLRE 3FUDA 1OTUD 1IAOB 4ZTPL 4HKXB 1RH8A 4OCLC 3BEVB 1T1ZB 3GXUB 1T22A 2ZKYA 1NBYB 1CTOA 1EQWA 1AO7E 1M1SA 1M53A 2NX5D 4OFIA 2ZXCA 5AKRA 3QQDA 1YAIA 1C16A 1KCRH 2R9HC 4LQFL 4OM1L 2OMZB 3POHA 3LD8C 1ZVYA 5INCB 4UB0L 3E2HC 5K9QG 3QDJB 4QXGL 4B9ZA 2A4CA 2YLHA 4DO5A 4URKA 3N40F 4R3SA 3EUUA 3H0TB 4TLUA 2XVLA 4OKVA 1I8KA 2B5IB 2YK1L 3DBXB 4GXUN 3SDDB 3BO8B 1YEEL 4HOWA 4R2GB 1JPGB 2C7FA 1KGXA 4WFED 4DKFL 1AD9A 3B2VH 1JV5B 4NP4H 4X6CB 3IGUA 1KBWA 1LWRA 2VITB 5JA9A 2AP2A 4QY8B 4O4YL 5A2LH 3PXHA 1YEEH 3QDMB 3HAEH 3BESR 2A99A 1UCBH 1G1CA 4OZGB 5D1XB 4APXA 4N9GB 5KTEH 3H9SA 5AVYB 2OA9A 4DAGL 2R1YB 1T21A 5B22A 1FRGL 3OAUL 1KTJA 4GH7B 4QWWD 1RUKL 3PHOB 3L54A 2WQUA 4AMWA 3CZGA 5T1KA 3DMMD 1SN0A 5MP6L 3OSKA 2CRIA 3R4DA 2EDBA 5AOJA 1PD1A 3OKLB 1U8MB 5E9DB 2EEAA 5FYJD 2KZBA 3CVDA 3D4ZA 4HYTB 5IF0A 4WSJA 2VQ1B 4KJPC 4P2AA 4Y5VC 4ZFOA 5GXBB 1HZKA 1ACXA 3RGBA 3ZYJA 1PNDA 4JHZA 5KS9A 4IYKA 3HMWL 3Q1EA 4H20H 2HTKC 3N44F 1U8JA 2QHRL 2DYPB 4H0GA 4Z76B 5EZOH 4GQZA 5E9DE 1AS8A 4D7BA 4W9HC 1XGUA 3SDXA 5HHOE 1KB3A 4I0PA 4UV7H 1NDMB 4P4KB 3FHQA 1U8HA 1MEXL 1KXTA 5DR5H 1PFCA 1GOFA 3B8SA 1AC6A 2IGFH 1Z2KA 3WN5C 2CDFA 4TQEH 2X87A 3Q1SL 5IFAH 1T5KA 2AANA 4NO5A 3RWFB 5D2NE 5HHQB 2BIPA 1OT2A 1MCPH 1JN6A 1U3HA 2PLTA 2XQYG 3TT1H 5GZOA 4AWJC 2ZUXA 3PGFL 4PJHF 3VSUA 3D3VD 4NPYA 4AT6B 2J5LB 1ZJAA 2PR9A 3EZJB 4LAJH 5L4JA 2Z31D 4BSVB 1HU8A 3X13A 5HHOA 4FTVE 4PVNA 4UT9H 4AQEA 3BGMB 3B2PA 1EA9C 2G0KA 1DSYA 1IKFH 4UIMB 4ZYKA 4U49A 1PG7W 4GNKB 1MHHA 5I1AB 4XE0A 2X4OB 4D3CH 3DOHA 4WTQA 4EUPH 2BZCA 2JVUA 1FG9C 4ZUTB 4BZ2A 2F58H 5KOMC 2F19H 3LRGA 5KVEH 1JPSL 4B97A 1B4JL 4LCIH 5EBWA 4JFED 4Y9FA 3WLBB 4JRYA 2NRDA 4ZO6A 1ID2A 4AEFA 1G6RL 1PFOA 4PSPA 2JIXB 3ARWA 4G9DB 2Z8RA 3D50A 5DHEA 5D2NC 3HI6H 4ZG1A 4OV6F 2CHNA 2RIKA 4G43B 1P7QB 4LBEB 4MD0A 1BP3B 1Q0YH 2A5UA 5HSFA 4WU5B 1OSZA 2ENJA 1NPJA 4PHZA 4E9VA 2IH3B 4Z7QB 5IT2L 2VZ3A 5FUOH 1J0ZA 4CBPA 3VXRE 3V79C 3US0A 1UWEH 1OCRB 5MENA 2BW4A 1HYSC 4TUJB 2ZP8A 2ZAGA 4ALAC 5I66B 4LCYA 2YA2A 4IMKA 4H40A 4B96A 3UCQA 2W60B 1RY7B 3FRPB 3F85A 3ARZA 2COVD 1KOAA 3FO9B 3DARA 4KBPA 3CHOA 3KJ6H 3W0WE 3S8GB 2ZJSH 2IH8A 3KL0A 1JXJA 3OAUH 4IRZL 1WGOA 5JYMA 2A77L 3HG4A 1AG0A 1MUJB 5CLYA 3CIQA 5GRYA 4ANXA 3S3SA 3VSTA 3QCUH 5CZXC 1RZFL 1DYZA 2WBJA 1B2WH 4I85A 5EOQL 4HPOL 1HT6A 2HN7B 1X9LA 4QT5B 5A6LA 2ZOWA 1I9IL 5EC2A 3IDNB 1AQHA 4C83B 3CFBB 4MCNA 3Q3GB 4G42A 4JY5H 3S36H 5F9OL 4FA7B 2H8PB 1E4KA 3I6LD 5TFSH 3IGLA 1QFOA 4IDLA 5ICUA 4JL1A 4K5OA 4DK3A 2ENYA 2IQ9L 2AXFB 1PIFA 5CIPA 1KB9J 4NQVA 5IHZA 3H54A 1IC5H 5K1JA 1CLOH 2C3WA 2YKLL 2IGFL 1BBDL 3G5VA 1O9VA 1OSPL 1WBXB 1MCEA 3V10A 2XY1A 5D7KE 4ZMOA 4WWPA 1MFNA 1LO3L 4KUCF 5IFHH 1U91B 3CVCA 3QDJD 1L7IL 5L6YL 2NY0B 3MUUA 4XCCH 2X44D 4Z78A 1FFNB 1I82A 5TDOB 2YPKB 5DUBA 5F70A 1SN5A 3QISA 5D7LA 1I1FB 3QAQA 4OT1L 4X9GA 1YA5A 5EH1A 4H4NA 2Y6TE 3KDPB 3QUKA 5AFAA 3ETTA 1S9XA 3LEVL 1CE1H 2IG2H 3L2MA 1IILE 4G1EB 1MWAA 4M03A 5DS8A 3NCWA 4PG9B 1S9YB 5FECA 4I3GA 1VGKA 2V7NB 3HW7A 3O3BB 4RNRB 2XV0A 1XAUA 4ZOAA 3ZDZB 4WV1A 4OFYD 1S5IL 3CFKB 1T66D 1PNCA 3DX7A 5EC2B 1Z66A 3UXFA 3IDUA 3Q5YA 4RIRB 2XA8H 4FDWA 3ARBA 4XNXL 2BNRB 4P2RB 1ZE3C 4GG8A 5JPNC 2C1PB 1FFPA 3MOAL 2OI9C 2YJQA 3NGBC 4AG4H 3DO3A 3HPJA 3M7OA 3DMMB 1MCWM 1E50A 1GZQA 2DN7A 4IBYA 2PTTA 4LHQB 4Q6YA 1XFPA 5H2BA 3C6LA 3KXFE 4X9IA 4XCYA 2G4EA 3V8OA 3V6OA 5LXVA 5T5NF 2QLVB 2XWBA 1RUPH 2ADIA 3NBNA 2UYLA 4KXZH 4JKPH 3TU6A 2EILB 4L8DB 4X2UA 5EULV 3ZYIA 1VIWA 4E5XG 1EZLA 1CD9B 5BVPL 1UFGA 2WINB 1SLXA 1INQA 1NFDF 1TQWA 1GTNA 4QKTA 1IQWH 2OMYA 4O02A 2G2RA 2HFGL 2XFXA 3ULUE 3KLHD 4AM0A 3S98A 4Q56A 4XPGH 3QORB 5AWNH 3SPCA 4DEUA 4F7MB 3AAZB 3BXNB 4GB9A 2AJ3A 2CIKA 4EZJA 5F96L 3D69A 7FABL 3JV0A 2VR3A 3FUFA 3H7BB 4YBQC 5KYXA 2WLIA 1I31A 3IMUA 4JQIL 5I74B 3ZUNC 4BFBD 4HU8A 1AG6A 2UY7A 4KV5F 4JANA 4ZUVA 1H6UA 3K8KA 3QFJE 5F88A 3IJ7A 4LVHC 1F00I 1GZQB 1MOEA 1CBVL 2AJUL 5C0EA 3WXVH 3CZFB 1DJGA 2EH7L 2YPVA 4GBXC 1RURH 1WH0A 1HEJC 1ADQH 1KCVH 1FLTX 3B6SA 1P6AB 3KH3A 3BZEA 4X6DE 3QUMB 3EOYG 3AXLA 2AXHA 4Z7VB 2CO4A 5EZLA 5J6SA 2BNQB 3U0TA 4HETA 4GMSL 4FMVA 2VLLA 5D7IE 3SKUD 1YEFH 2CRYA 5IVXE 3U82B 2FJGA 2MH4A 1MHEB 4HULB 1NLDH 3EYOA 4DP2X 4XO3A 2ZUQC 1MY7A 3CFEA 1KJVA 3CHRA 4FN0A 5C2BL 2AV1A 3PWJB 1WIOA 4RWYH 2IADB 1QWNA 5TGBB 1ZLEA 2H9GA 3ULUL 3CK0H 3I75A 3SY0A 3EH3B 1BQHB 5C7ZA 2DIAA 3GM0A 4HKJB 1PZ5B 5DJ2A 4PJ6A 1HQRA 3BAWA 4ZUWA 5HYSG 3M1CA 1B90A 1HDMB 4HPYH 3E6FB 1OAQL 1KCSH 1SJEA 3I6KA 3VG0H 5F21B 3KE0A 1AP2A 1GGCH 5KJRH 2DD8L 3LS5H 3NSXA 4G8IA 2ZOKA 1FNHA 1QR1B 2VDQB 2VB5A 3IETB 3N42F 1S7UB 3OV6A 3RWCA 3FCBA 3FCTA 3L5XH 4BH8B 2QVTA 3N42B 3MUGA 3UPRA 2WYHA 1CCZA 1T20B 1XH3B 4PRIE 5DEFA 2FR4B 3CDGB 2UY6B 3C12A 3IDNA 3LH9A 3UJJL 2E9JA 4N2NA 2OJEB 1A2YB 2WLYA 4GQ9L 3BT2L 1TYJA 2L3BA 4LXFA 5AYUL 2Z35B 1MRDH 4NXKA 4F80A 1RIVH 4U3XA 4G3YL 3LIZH 5JMOC 5I8CA 1NCNA 5HVGB 2DOCA 3WSQL 3SE4A 4K7FB 2CHZA 3ZR5A 4X7CC 1IGCL 1UZ8A 4ZFZA 3B2DC 2OK0H 3EFFB 4AV0A 4J6RL 3LV3A 4A68A 3RVWD 3B43A 2XI9A 5C0CA 3BH9A 1CLZL 4OM0L 1N2RA 2B39A 2EIJB 1A4JB 1O7SA 3EJZC 3UFIA 3LQZA 1OAKH 3WV0A 2FX7L 3IXTB 4QRPD 1RZJL 3GBNL 2R51A 5DUML 4UQ3A 4IGBD 4A63A 4BFNA 2EJ1A 4ENED 2YGPA 3KVDD 1H5BC 4LSQH 4EE2A 1QBMH 2ZYHA 3ZVVA 1VFMA 1MI5A 1Z3GL 3T0EE 3IJHA 4OKVB 4NC1C 1H3UA 1ZWIA 3PJSB 4UTCA 3RLSA 3RX5A 3W11C 3E9TA 4LBEA 4HIXH 1BLNA 5E94B 5GS2D 3CGTA 4EXKA 1IZJA 4YHZL 2PXYC 2WPGA 5DJDA 2P3YA 1MI5D 3MFGB 4FG6D 4Z7UE 3NIFF 3ATBA 4BGDA 1T1ZA 3WXVL 4LNVA 1LNUA 3PXJA 3WFHA 3P4MB 1HHIB 1ZCRA 4L4TD 1IAOA 2A9AA 2ZOOA 3EFFA 3GUTA 1KSRA 3K6SB 3X12A 2G4GA 1GVIA 5FF6A 2V8LA 4FXKA 4DGUA 2K6ZA 1DJZA 4U1JB 2DJUA 3EYSL 5IP4A 2WQWA 1R24B 2GFBB 1GZPB 3JVGA 1E30A 4G7QB 4UINH 1S3RA 3T3MB 4E68A 5AUMB 2J1ZA 4W93A 3AY4C 3KYNA 3ASNB 3MV8B 4YHOH 3ULUF 3DYPA 1JNNL 1WFNA 4PJ7E 3FUNA 3TFKC 3V9FA 1NEUA 2ZCHL 5D93C 1SEQH 3OKMA 4S1RH 1UZGA 4YDVA 4XN7A 5EO1A 3IDIA 1PG7X 2FTAA 3DX9A 2BCKA 5E2WH 4JO3L 1JOIA 3RWFA 2AV7B 5IB3B 4NT6A 1Z9OA 2NNRA 2OX5A 1W80A 1UZ6E 4LDCA 2J8UE 3D0LA 3HI6L 1SBBA 1RUAH 5T1JA 5EU3A 5IEHB 1KXTB 5AOMA 4FHBD 4P5TA 5TF1H 4PAZA 5DZJA 4BWWA 4FL4C 4CKVX 5LGJB 2X2YA 3I6GB 5CR1A 3C5ZD 4ZZKA 4G9FA 1GGCL 2DQHH 2DQDL 3H85A 4NP4L 3IMVA 4JY6A 4CSZA 2OR9H 3MV7B 3PABB 1TQVA 4TUOB 4XMUA 4MBOA 3BLBA 5I5MA 3SGJC 2QHLA 3BMWA 4TS6A 3RBSA 4KRPB 4HOZA 2VM9A 3DVGA 1JIBA 3BRDA 2WXMA 3FFDB 1CN4A 1BJ8A 4N0CD 1KENH 2JKNA 3CK0L 5F7EH 2VDPB 1DVFD 4DQAA 1NL0L 5H4ZA 1N64H 2R1YA 4JCWA 5D96C 3RVUD 2PETA 5FKPA 1WCBA 2OJZH 3GUFA 3DX2A 4F37K 1FFRA 4YWGH 5TPWH 4OJAA 3UZQA 4PS4H 3HJ0A 3WTUA 3MGAA 3T4YA 2LU7A 3FU7B 4KAQL 4ETQB 1U93A 1RU9L 3VFPA 2DAVA 2CBQA 1RVFL 3D52A 1TENA 3KLLA 4UV7L 4H8PA 1QASA 3BE1H 3WTTA 2JB6B 3TH2T 4JFXA 5DD5L 1JWUA 4URTB 4LCWD 4XI5D 1M57B 5ABAA 5HHNA 3ZRSA 3HMXH 4BKSC 2N59A 2YRLA 2YGVA 4RQQB 3DI3B 3ZMEA 4JDTL 3WNOA 4GLRH 1F90H 1P4BH 2ZCLH 4IK7A 3RPBA 4OFQA 5ESAB 4B9IA 1CDYA 1KN2H 4ZAKD 3TJPA 3R8BB 4B9YA 1QSVA 1SY6L 4CC0A 4U1KA 2WINA 5CZVH 1WZAA 3ELQA 4KKBD 3MNZB 2NNXA 1FA4A 3IFLH 3RKPA 1T0MB 4JFZL 4UOZA 4XCNB 1DVZA 4XPGL 3W1ZA 3SDDD 2C3VA 1E5YA 5EORL 2ZJSL 5BRQA 1HSBA 1IAMA 5SWQA 1RZGA 4OF8A 5DD3L 1CZ8H 4BV1A 3AXIA 5ID1A 5KTEL 3L9EA 4OJFH 1P5UB 3SZ6A 1Y1UA 3MHZA 3L4WA 3F58H 3GMLA 3HE6C 1L3WA 2FGZA 2WAQA 3R1GH 5I73C 1NCHA 4K73A 1DANT 4EO5A 3AROA 5FYJE 1ASQA 1J1XH 1QI4A 4ZJ9A 3B5TA 2X4TB 3QUZD 5ISZB 3CUPB 3IDXL 5JORB 1GZPA 3QUZC 5DYFA 1SDAB 4NLAA 3UBFA 25C8H 4UOW0 5JHAA 5HJGA 1MIEL 2Z1KA 4GW4A 1BVKA 1MFVA 2WXPA 4ODVH 2I26N 4PV9A 3QC5X 1KCRL 1URLA 3KPRD 1LNUB 4F8PA 2VERA 3DUHA 4MNGB 5F72S 1QKZL 5DEZA 1A6VH 2HVBA 4DP1X 1MCDA 3GZQA 3EJYC 1RUMH 1DANU 2DM3A 2FH6A 2UXFA 5B7EA 5DHYA 3S3CB 2YJLA 2CKNA 3L1OL 4HWZB 4LEBA 1BLNB 1OTTC 3OHXA 3PWUA 3O3DB 2WNXA 2YO3A 1EO8L 1CK0H 2VLKB 4KK8C 1UM5H 3D2UA 4NZUL 2A9BA 1QWHA 3IJHB 3IK2A 4FG4A 5KN5B 4XAKE 2PCPB 1GPOH 1YC7A 2Q7YA 5MHSD 5K9QI 5K1VA 4DUVA 3MV9A 1UXWA 3ARXA 5AKSA 1X44A 1CU4L 3US9A 5LB1A 5MEOA 4C83A 2IQAB 2CA3A 5IEKA 4AVIA 4PJHE 2IANA 4D0DB 3MLVL 3RTQC 3WS3B 4XN5A 3RRQA 1N2RB 3S34L 4K7PL 1COBA 4KI5E 3LV3B 4P9HL 2AEPL 4GKZB 4MZIA 4ZAKC 1QR4A 2ITDA 3MUZ1 1HXYA 3BOVA 1ILSA 5GRJH 5IB4B 3WGUB 4TQPA 4PTTA 5A16B 1A4AA 2NY6D 3RWIB 3T4AB 3GS7A 3X14A 2V2TA 4MB3A 2X05A 1ZVSB 4TOYH 2V5YA 4RISL 3TYGL 2YD2A 1CFTB 5J0BA 5CCHE 2ZWKA 2ZWLT 1UOLA 1DFXA 3D85B 7PCYA 3RFRA 1OO2A 5IMMA 3HKZA 3HHRB 3LN5B 3RKDD 2XVBA 1CQYA 3EGSA 4R90L 1UGNA 4OZGE 5EU5A 3QO1A 1IFHL 2WLJA 1OALA 3EYVB 1ITCA 3AY4A 5EA0H 5I17B 5JYLA 2R1WA 2VDOH 4K0OA 4FJYA 1W72L 4U6HA 2OMUB 5E23A 5ACMA 5HD8C 3EDJA 1QTSA 1W8OA 5ESVA 4ORGB 4M93C 2ZWZA 1M7DB 2ZUTA 2FIKB 3TPKA 5CAYB 1A4CA 1IGML 4HU2A 3BHBB 5EO9B 1YNTA 3BKJH 5ICZB 4GRMA 2W0FB 1W16A 2J21A 2GCYB 1YEHL 3H3PH 4U3CA 4TPRL 4PD4K 4DEPC 4YS4A 2YUZA 3HNTH 1THCA 4PJAE 3SOBH 1O75A 3AT9A 3FL7A 1IEAA 1DE4A 1MJJA 2WLZA 4L9LA 2KYIA 4A55A 4P5KB 1CFVH 2ARWA 5TF1L 2VQUA 1GSMA 1DSWA 4WK0B 4TRPL 3S5LB 2FJSA 3ZE0E 1MFEH 4PJAB 5FC9A 4AQ1B 4OLZH 3MYJB 3QQ9D 5D7KD 1JN6B 1U3HB 4Y4FA 5F93C 1KG0B 3I9GL 1A6TA 1S7QA 2Z31A 1MCFA 2C9RA 2PYFA 1FE8H 2AXJA 2D7OA 4LHJB 1MCCA 2HPTA 5BV7B 3IWUA 2D3VA 4PRBA 2CCVA 4K3EL 4KRPC 1RD6A 2C9XA 4GRWE 4HD9A 2PO6C 2BVPB 1P53A 4NKOB 5DEGB 4Q52A 4RLDA 2YMXH 2A4EA 1ZT1B 2BP8B 3T0XA 1I7RB 3QZWG 3NN8A 5I2IB 2NYYC 1QRNB 4ZFGL 3IKKA 3FBKA 2F18A 2JI3A 3VXUD 5IESL 1DBJL 3FN0L 4FFVC 3ETBF 1A3QA 1CR9L 3IN0A 4ZOEA 4FABH 4JDZB 4MB1A 3QIBD 4H8WH 2JJVA 5J6GB 3O3UN 1J9CT 1T7VA 1WD8A 4JAMA 1J8KA 4HF5L 5LBSL 3RURA 2BO0A 4TVSa 1PD6A 4YAQB 3GI9L 5D7JB 4A37A 2PF6A 4E0RB 3QJOA 2JJTA 4QUOA 2AI0H 4O2EA 4YHZH 4QNPE 2X70B 1GW0A 4XRCB 5HHVL 2LQRA 4LMQE 1YMMD 3PWVB 4X6FB 12E8H 4R4NC 1NMAL 2JKWA 5DHVA 2ICWJ 2VLMD 1FPTH 4PJIF 4JG0H 4LLMA 2OMUA 4W81A 1ZGLA 4UU9B 3JWNG 1GCYA 4J5VA 1U21A 2J12B 4H7VA 2FLRT 2BRQA 4HBCL 5EHFA 3WJLA 4KZDH 2P5WE 2XQYK 2JJSA 3BUBA 1XGQB 2Y07H 3DUSA 1MFEL 4OF0A 3KWXA 1BV8A 4Y5VB 1KELH 2DKSA 4LLQA 2HJKA 3C60D 5C0IB 2DQEH 4D94A 5J1SC 2WXNA 1HYRC 2FATH 1HOCA 4G1EA 3QAZB 4ESKA 2R69L 5L7XL 1AGFB 5I6NA 3QUKB 1JVLA 4HCRA 3HZVB 1KACB 3IPFA 2R0WH 4K7PX 4AQOA 4PTTB 4FLHA 4KTGA 3RWIA 3MNWB 4ZMTA 5A16A 1UOKA 5KUKA 3Q6FA 3V6ZB 4E0RA 4HP5A 3LRSA 4XC1H 5CU5A 3CMOH 4EI6A 1IGMH 1MG3C 1OL0A 3OPZH 1TTUA 2LTQC 4Y5XB 2HRPH 1HNFA 4LSVH 4XN2A 3AQYA 4ENZA 2EVHA 1NJ9B 5KSBA 1ZSDA 4LFHD 5I6XB 1DBJH 3O6FB 3WG7B 1P7HL 3ZDZE 1ACYL 3D39D 2WBWB 4Z23A 1CG9A 1WE5A 4JJHA 1NICA 5JTWA 2G2NA 3FUHA 1L9PA 5SX5H 2WB7A 3BPNC 3UAAA 2NW2B 2GBUA 2ZP0T 5I8KH 3SJVD 2W9LA 3G6DL 2DTML 2OMTB 3U6XS 4DF9A 1NAML 4PBXA 2R8SH 4K2UL 1DLHA 1MCQA 3MX0A 1X6LA 3ARGC 3L9YA 3U9UA 4LRIC 1FE8L 3K2MC 4MJIE 1MLCA 3QR2A 1EAPB 1M6OA 3REWA 3T8XA 5H35B 3ARGB 5BMFL 3VQ2C 3ARBD 3AS2A 2BVQA 1RIHL 4WI7A 3HUJF 3SCMD 5I0XA 4JX0A 2OYPA 5CBAA 2ICEB 4I13B 1HJBC 2BVEA 3SSGA 3C5SA 4OCXL 3U30C 1W91A 3B34A 5ESQB 3MLVH 1RHFA 3FJTA 2WVVA 4LMQI 1NFDA 4PRNA 1GYCA 4U1JA 3WEOA 3OLDA 3QK0A 1KPUA 3FN0H 2J55A 2YWYA 2W38A 3ARRA 3GUTB 3TGXA 3B9KB 4U1SA 3O3EA 3PGDB 3APCA 4MWFB 3D0VA 2N1KA 3SE3A 1TJGH 1PLGL 3DVFA 3FTGA 1PW3A 1BA9A 4GRLC 3HB3D 2RMNA 1DSFH 4XXDB 1OGTA 1FNEB 4PH8A 5DA4A 2KERA 2FD6L 4XX1E 1HSBB 5ID1B 3E38A 5LLIC 4PG2C 4OVVA 3FT4A 2VQTA 4FD0A 4CVXB 2EYRA 4WHTA 4KJQD 43C9A 1GRWA 4X8GA 3WLBA 1JHKL 3UJTH 3WLWD 5CNHA 3QO1B 5IM7B 1FO0B 2B59A 5C07A 3OX8B 5TJWK 4JFYB 4XBPB 1E9QB 1XSOA 4LIQH 1RZ8A 2DQUL 1UD4A 5DJ8B 1I53A 1P7KA 3IJ8A 1FF5A 1IQWL 1EDQA 1QSFD 1TTAA 4YL4A 2R29L 4U1HB 4HSCX 2KHAA 3TM6A 1R33A 3KPNB 1GYAA 5T5FH 3HG1B 1MHCB 4JJOA 4RFEB 4OCRL 1CD1B 4MA8L 5E1HB 2FB4L 2ZUSA 3B2UD 4HZ1A 3WJMA 1BZ7B 1J0YA 3IKCA 3WNIA 3VYNA 2R0WL 3HAEG 1R1CA 4MMZC 5B38G 1R3LA 2ITCB 3SGKC 1NGYB 3V4LA 5CGTA 2F53A 2N0KA 4F7EB 3F05A 4C4BA 1MFUA 3VQLA 4D2NA 4Y4KD 3LB6C 3KGRA 4G1MB 3BGAA 2RFXA 3WDIA 4TYUA 2FWOA 5A6MA 1P84K 2NY1C 2OXHA 4IBSA 1XF4B 2N7AA 1A2YA 3BZ4A 2Q5BA 1LO2H 1B0GB 1S7SA 5KYNA 5EU4B 1U8HB 3BVTA 3CZKA 3T9WA 1WAPA 4XP9H 1DBML 1ECZA 3EJSA 5AALA 4RGMB 1E40A 3BH8B 4Y1AA 4ETYA 1WYJA 3RWJA 4KDTC 2ZNWA 4AE0A 1A0QH 3MJGX 4OCWH 1MI5E 2ZT9C 1C5DA 1OGAA 3BW9A 4JKMA 4K5PA 4OZFG 2OW6A 4TF4A 2F1EA 3HEIB 2OTPA 4ZX3A 2PR4L 4O58L 1E5ZA 4ZFOB 4FEIA 2WZPA 2LV4A 2JB5H 2EDJA 4HS8L 1AXTL 3T3ME 3F12B 2J6EH 4YGVA 3E3QE 5D2NB 3R7RA 5FYKL 1CICB 3RHWK 1RU9H 3B3IB 4N1EA 4IRJC 2AJSL 1JF1A 2APWA 4XCFL 3QNYA 2IWKA 4AV5A 2AEQL 3BFQG 3HE6D 2NY7H 4K3JH 5IESH 1T03H 1RHHB 2IGLA 2NTFA 1UJTA 3C75A 1M3JA 2VR9A 3EDFA 3P3SA 4UANA 5D7IF 5H37A 4E9RA 2UZIL 2CUIA 5J4MA 2EIBA 3H53A 2XBDA 2R4SH 5DJ6A 3KDMB 4MAYB 4JRXE 1S8DA 1HCYA 4U1LA 5ERWA 2BNQA 1OAUL 2GAZA 4I9XA 3TTYA 3ZK0A 2AQNA 1JS4A 3KWUA 2X7LB 1A47A 1G9ML 5I23A 4J4PA 3HE7C 4ONHB 2PWDA 3BCDA 2ENPA 5LCVA 2MPVA 1SHMA 3GSWA 1WUZA 5BV7C 3ILPB 4BKTC 5AW5B 3JV4B 4N22A 4EUPG 2YQBA 4J3OF 3NPZB 4FXLA 4JFDD 5TDPB 4YHML 3P30L 2UY7B 3TNNB 2WN2A 3D9AH 2CHXA 5FKAA 4OSUL 1ET7A 2OSWA 4CILA 3LX9A 5A6IA 2XXCB 3T3MF 5AKTA 1JRHH 1D7DA 1CL7L 4IBTA 4LCCA 4LPVA 3RUGF 1UUSA 1BX2B 2MKLC 3OLGA 4NS0A 4B3EA 5E08H 1S7WB 4TSBH 3IMRA 5J8OA 4ANVA 4PN6A 4S1QL 4P3CH 4NN7B 5DHDA 1FZMB 4ODBD 5HY9B 1D9KD 5HHNB 3KYKH 3OF6D 3MRJA 2X0VA 4DK5A 1WFIA 1J1OH 1ZHBA 1M9SA 1FL6B 3V4VB 1I1YB 4DKAA 2W0PA 9CGTA 4Q9BA 4GP4B 4A6YB 2Z4TA 5KYWB 3L3JB 3RY4A 2X5PA 1VFUA 1BIHA 3WL9A 5ICYB 3DXAD 4WRLA 3AS1A 4R7NA 1ZT7A 1MF2H 1QP1A 2VYRE 3D5OF 5J6HB 2RD0A 2R15A 3D6GA 2Y6SD 5DUPL 1CDCA 1IFHH 1I8IA 5INDA 2PTVA 3WD5H 4RMQA 4LIQE 5FA3A 4OTXH 4U7KA 4WK2B 4P2RA 1OM3H 5KSBF 4HUWA 3AUVA 1KTKE 2LABA 1IZKA 4OW6A 1XL6A 4MZRA 3VWJB 2VMDA 4YBHA 5DTFB 3L1OH 4OJYA 1YMHA 4ZFQA 2FUTA 5K1NA 5CD5C 1I7ZA 3FFDA 4KXBA 4QI3A 4PJXB 5CZVL 4I5BA 3Q7JA 1QFHA 3K46A 5JLZA 1S9YA 2HFEB 1F5WA 4HMEA 1NSNL 2C8NA 3IAPA 4G83A 4NGHH 3KW8A 3GINA 4OGQC 2NX5E 3L6FA 4TUKL 5SWSD 1EFXA 2DYPD 4IIQC 4BZYA 1BECA 3BRGC 1UWXK 1WA2X 1OD7A 2OXGB 2Y7MA 2C26A 3F2LA 3GSQA 2APTA 4M8QA 4Q0XH 1BXUA 4WW2C 3RNQB 1J1PL 2BY2A 4KK8D 1CBJA 4Y16D 1TMCB 3NQKA 2DQTL 3BAKA 3ZZSA 2GKIA 1MSPA 1Y1DA 4X6CE 5C08B 2C7UA 3CX5K 3EO1A 4TVPH 4U6HB 4XMTA 1WQVT 1KLFA 1AGEB 3L4TA 4CN6A 2X1OA 1IV8A 2NDGA 3MTXA 1P7BA 3NSCA 2J1KA 2AQTA 4A04A 5HI3D 1UADC 4ZOCA 3GXDA 5B7MA 5BRPA 4NO0D 1AO7D 1I1CA 2E7BA 2IOMA 2NQCA 1IFRA 2RALA 3DUUB 3NFNA 5GZNA 3VFUA 3VQMA 1B4LA 2X4PA 1H0DA 4HJJL 1NIEA 1FJ1B 5DVNA 3VI4F 1FC2D 4AL8L 3L5JA 3UMNA 3L3OA 3DJ9A 3FSOA 3FAWA 1PYWA 4MNQE 1P2CA 1T2QH 3DO4A 4AGLA 3EKCA 2V2TB 4QF1B 4MCYA 1OTTD 5CP3H 3UJJH 3D85D 3CPUA 3EYSH 4ZPTA 2BLFA 1OQXA 5ECGA 3DVNA 5MI0B 3V4UL 2HLEB 2J1XA 1FG2A 4NZJA 1EXGA 2ITDB 3VB9A 3U36B 4UNVA 3QC6X 3S88H 5L0QC 2NY6B 1DFBH 2ZYIA 4HLZG 4KI5D 4XPBL 3ZKSD 3SN6N 4HGMA 3QEUB 4OZFA 1MAJA 3UL4A 2VN4A 3OQRA 5KVGH 1DUYA 4IBQA 5E2VL 3UTQA 4ES8A 3C5ZB 1A1MB 5LO7A 5T1DH 4TSAL 3BUPA 1QSFA 2FO8A 2Y06H 2NLJA 4MXVF 1F8TH 4FQHA 3L3DB 5E70A 4G6FD 2E9IA 4ODUB 3WKML 4K94C 5KOVC 1IT9L 3MLUH 3REVA 5DHYB 4ZO9A 1U42A 5LXGH 1MFMA 4PJBA 4WGVB 1ML0A 2X2UA 2VXQA 1M71A 3S7GA 1HHGB 1NIBA 3RKDC 1QBLL 1UM4L 3D2UD 5IMOA 2FJHA 2DQIH 4CSSA 5DVLA 1CD0A 4FS0A 4RAHA 4HZLA 1A1NB 4JHAL 1KCLA 5D96B 5F89B 4L5FE 5FWQA 5JNYB 3VFNB 2F7QA 2BDNL 2FQFA 4JFPA 1TQSA 4RA0C 3RB7A 4Q89A 1FORL 5GHWL 5FOBA 3U36A 4BSJA 2ADIB 1MCKA 3LVTA 5F6HJ 1VENA 5ISZA 3SYAA 1Q9KA 1ZTXH 3CLFL 1CUOA 1BLIA 2Y5EA 2EEXA 2BIIA 3FB6A 4NSKA 2OYMA 5CZRA 3SDAD 1DQTA 4NUGL 3G9VA 1DBAL 4JFDB 2IFGA 4G82A 3IFOA 4AYSA 2QQLH 4DP5X 2K7PA 4LOUD 1V54B 5ETUA 1JDCA 1QW8A 1KGIA 1ZVHA 4WO4D 4ZODA 5E99L 3EH2A 3IDGB 1EGJH 1MIML 2AQQA 3G5XA 3HG3A 3VFSB 4B53A 4M1DH 4PG9A 4M8RA 3BAEL 3UTZB 1G9NL 1T0MA 4N26A 2MJWA 4J1UB 3SGDI 3DURB 4OLXL 1OCCB 3MNZA 1GZHA 3AUWB 4G6AC 3BSZL 5GS1C 4OIIL 1KTDB 3LYRA 5AB2A 1U8NB 2PPAA 4TTDD 4U6XA 3UH8A 3B2MA 2HP4A 2MQ3A 4S1SL 2AK1H 4JMNA 5F9JA 1YEKL 1FVEA 3X3FL 3FQNA 3THMH 5B3SB 1Z32X 2FYYB 4H0HB 2BSRA 5E0QA 4MLSA 5C0AD 5KANG 1XCTB 3QIBB 3H4HA 4NKMA 4L1TA 4Y4HD 3CE1A 3RZCB 5L8JB 3G6JA 1DEEB 3M45A 4N8UA 3HKFA 2ESVE 4XB3A 4OFYA 4ALAL 5FFLA 1AYRA 3FC8A 4GRWF 3L5XL 3OZ9H 3SKJH 4OZHE 3G3LA 5JW3H 5CCKH 5HXMA 4KQ3H 1AFVL 3GMMA 1I7ZB 1C5BH 5GISL 1FORH 3QUYA 5E03A 3VG9C 2DQ6A 5F97E 4U6VL 4D9RD 1BBJB 1BBJA 2ZZUT 2B3IA 1T4WA 1CGXA 5KYYA 4BINA 4E42A 4G5ZH 2DMHA 2IXQA 1ZDSA 2XKSA 5KYXB 3G5WA 3HZKB 1YNLH 3ECBA 1UB6A 4AYID 2IJ0C 5C0JA 4KNUA 4ZX4A 4OD1H 1SQMA 1CGTA 2F6AA 4K55A 4LLYA 4PLNC 4OCMC 4M3HA 4KNQA 5DO2D 4YQXH 5DUPH 3WD5L 2VDQH 1ZHNA 1IT9H 3FO9A 3MLUL 5TDNB 3TURA 3G6JB 5C2BH 1SEBA 1MQKH 2Z7WA 3CN1A 3VXQA 4DVRH 5C09A 2CLVB 1HHKB 4U0QB 2DDQL 2NR6A 3BKYL 4FJ6A 1C16B 5I66A 1ET8A 3PP3H 3PDGA 3LSOB 4UNIA 3TJHC 3WS6A 3O8XA 5D71L 3I6GA 2I07B 2XZCL 3BUYA 5E4IA 4HEPA 3IJYB 3MV11 1T0NA 2ZKHL 1RIHH 2NR6D 4KKQA 1ETZB 1IGTB 4GI9A 3FTXA 4WW2A 4DP6X 5GGRB 2OCFD 1I1AD 4GOSA 4HV8A 2MNJB 4L37A 3IPEA 3MLTB 1BM3H 5BV7H 5KYYB 5KJRL 4LP5A 1IC1A 2VDNL 4K8RD 5D6DC 3AT8A 4POYA 4P2QE 1OTUC 1I4FA 4MBRA 1NGPL 3BIAX 3RY5A 1DVFB 3IJEB 5D1XE 2Y23A 3LZFH 4BZ1A 3P69A 3TCTA 2X9YA 1WT5C 3RVXD 1NCUA 1V7NL 3U4BH 3GS4A 3RP1A 3V7MA 4P2QB 4TXVB 1R24A 1XCWA 2NY1D 3O4LA 4PS8A 5E7FA 3EOAA 3WSQH 3LN4B 3TO4C 5FF6B 3X12B 1SF3A 1JPST 2V9TA 5DUBB 1YQVH 3L3OC 3TO4D 2G5BB 1RUQL 4N5UA 3L81A 4FJZA 5DFAA 3BD3A 4FXTA 4Q9CA 2X1QA 3DOSA 1WVZA 1FL3B 4FQCH 5IVXF 3N1FC 3CSBA 2A73B 2ZOUA 1OOAA 3ZDYB 2NXYD 2FWSA 4IJ3B 1W9XA 2YPVL 3CSGA 4BQ8A 4O9HH 2FIRT 3OXRA 4UM8B 4NQDE 4H1LA 3UROR 5L7XH 2Z9TA 1YUHB 3LS5L 3W82A 4N85A 4MMYB 1VFOA 35C8H 4HWEL 4LKXA 2H8PA 3TTSA 2QQNH 3NJIA 2Q8AH 1KELL 4OQTL 5A2JH 4G42B 3RWJB 3HTLX 1E2WA 4ISVA 1WWCA 2H0JA 3O4LE 2QGEA 4MMYA 4WLCA 1FI8C 4HW6A 4UV4H 1U8PA 4B60A 1YEJL 3PAZA 3I74A 4JGMA 2OR7A 3QXAA 2WP3T 1FV1B 2Q86A 1YEGL 3T0DA 4L8CA 5C0DB 3Q8AA 3G04B 3UBXG 3LRLA 5EEUA 1F8TL 5F7KC 4NRZA 1HCFX 2YZ1A 4KXAA 4QTIL 2J1WA 4HC1A 4Y2NA 5GS0H 2F53B 4F7EA 3CU7A 3UTPE 3PQYD 3UYPB 2WSPA 1T21B 2Z35A 4X9YA 2FCBA 4ZPTB 5EUKB 5A2FA 4XNAA 4UT6L 5IMOB 2FBOJ 5C71A 4HFUL 2R2CA 1E9OB 4QF1A 2OL3B 2B5IC 2BOLA 2CO6A 1KIRA 2YKLH 2YRPA 1AI1L 5EFIA 4GAYB 2C4FT 5HDQL 3P9WB 4AQAA 1EZSA 4PTUA 2H41A 4ATTA 2CO1A 1Z1WA 3UYRH 2HFTA 3L2NA 1EPFA 4MCZA 3HBQA 4PREA 1BVLA 4F58L 4HK3J 4HX1A 4J3BA 2ADGB 1ICTA 1MNUH 3UTQB 2I5YL 1S5HA 2ENSA 4IU2A 4XVOA 5J11B 2I9TB 2B08A 4YHYC 4FQQA 4L1HA 2O5XH 2UZXB 1AKJA 4MA3B 4PLKC 3V4VH 1YLBB 3H56A 1D5BA 1KB5A 1U8CA 3LEVH 5D7IA 3MCKB 1MHHB 2LU4A 1KGCD 4W68A 1SYSB 1RXLA 4JPKL 3GJFB 4QXTB 3UTSB 5I30L 3GS0A 1WWAX 1F45A 1QSEA 1HXMA 3DKHA 4OZ4B 1DQML 1A8ZA 3LSOA 5DMGC 3O2VL 2DI8A 3VW3H 2QGCA 2QR0B 4U1MB 4AH2B 5J12B 2J7LA 4KU1A 4L23A 4I3SL 2VGLM 1G94A 3OWRA 3QJSB 4G71B 1AOHA 1XR9A 1YPZA 3S4SG 4HWNA 1NMAH 3CC5B 1E6JH 1THAA 1ZOXA 1F0LA 3CSYA 3SPJA 3HRZB 3QAZC 5IT2H 3QZOA 1ZLDA 3ISWA 1QACA 5ACZB 3NABH 2AVFA 1TJMA 5T33L 4GEIA 4MQ7B 1PX8A 1LO0L 2ADJB 1CVRA 3MN8A 3O6KL 5E8OA 1XH0A 3OG4B 4XMVA 2EE3A 4QJ3B 5E8DL 5IBLC 4LASH 4ZTEA 1I9RH 4MHHG 5EOCH 1JFQH 3WIIH 1DEDA 1JGVL 3PS6A 3HC3H 3LB6D 5PAZA 4G8FB 5GGSB 3NTCL 1I3VA 3F5WB 4R7NB 4XBGA 3WI9A 5F6HI 5GGTA 1XIWB 3V0GA 3U0PB 4N8VB 4HLZH 1MW2A 4X7TA 4LEOA 4Z7WA 2AJVL 5I0WA 3CFJB 3QEHA 4FRWA 3UZVB 5B3NA 2YARA 4JRYE 1AQDB 3DIFA 4M8QB 2XFXB 4E2OA 4PCSA 1V3LA 2WJ7A 4N0UA 1ZA6B 4YXLH 1BZOA 3TEUA 4U3SB 3HC4H 1E0OB 2GSIB 1G5GA 2YGQA 2JMRA 1SVZA 1Q0EA 1QAWA 5CP7A 1ZHNB 1HI6A 2K6YA 1RK0B 2PPDA 3G5YB 2EEDA 1ZLWK 1MWOA 2PXYB 4ELMB 2Q3AA 2P8MA 4QGYA 4YE4L 3MV7D 3ECBB 5DZAA 2PTTB 1IAKA 5DMIL 5H2BB 3CQQA 3DA0A 5FKAB 1MVUB 3MNWA 3W2DH 3P0VL 4FFVD 4JM2D 1L7TH 3C5JB 4WEUD 1GXEA 4G5AA 1WS8A 1ZKAA 3EIFA 3A47A 3M86A 3FQTB 4X7DC 1ND0A 2PPFA 3J27A 2W5PA 2F53D 2ICWB 3ZE2F 1ZIAA 4PJ9A 4GINA 1F18A 4QRRE 5D4QA 3MRRA 3T0VA 2R29H 2PO6D 2CKBB 5JW4R 1TJIL 5GJSH 5IV2B 2B20A 2W9DH 3KDMA 1XT5A 1AVAA 2BSTA 3K71A 3RWEA 3QDMD 3F7PC 4QLWA 2BERA 4B5ZA 1IKNC 2MSPA 1CO1A 2L4OA 5SWZE 3SBPA 4CUCA 1PQZA 4RZKA 5FLUA 1KCBA 5KBLA 5EEXA 2EZ0C 2G9KA 2VL4A 2NNFA 2GQHA 2ZD0A 3EOBB 4ZQKB 3U6RB 1NAMB 4JJ5B 2SEBA 1FVDA 1A1NA 5F7BA 3KZ8A 5C7XL 1SDDB 5DRWB 3ZHKA 3CXFA 5DHXB 1JFHA 1N18A 2XU9A 3S96B 3ZE1E 5GGVL 2P52A 2NXYC 2ZCLL 3BVNA 4P99A 4FFZA 4CAGA 1XB3A 4YSOA 3D87B 5D2LA 5AB1A 4NUJB 3MBXL 4NZRH 2NY6C 3TYGH 1TJHL 6FABL 1XGPA 4KKBC 1O9WA 1L9NA 1C5DB 1OGAB 3BW9B 3NJVA 3L8QA 2B0SL 3OR7B 4GO6B 5C09D 3ZMRA 1SF5A 5CD5D 4EBQL 3W9EA 5IBLD 1QSFB 2F2HA 1FNLA 3P4LA 4QHKJ 2DS4A 3MODL 2BWDA 3C5ZA 3SDCD 2KS0A 2NW3A 1IC4L 5D7LE 1SHSA 1EXHA 5IHBA 1FFOA 3CDFA 3FPXA 1ETA1 2L7EA 4LF3A 5ERWB 5JQ6L 3VD9A 2AJXL 4I0KA 4YDKL 5FK9A 1FCGA 2BP3A 2N7BA 5SWZD 4P2RE 2EADA 1X4XA 3UG5A 1Q90A 2UZYB 4KKNA 3T3PF 3AREA 5GS0D 1BXXA 3FOMB 2UVFA 3FK3A 1E67A 4JBSA 2HKHH 1QW9A 1G6RA 2NY2D 3LNHA 1ETB1 1DJXA 2FJHB 1L0XA 2VDLH 3RL1A 4JGUA 4JB9L 3V6OE 2VC2L 3ESNA 4M6MH 3T2QA 4PWIA 5C08D 1FJ1A 2Y24A 4MJ5A 4PW4A 1ACYH 1N9PA 4QHNB 1S46A 2VXSL 5D72H 5JXED 3CXHJ 1PKQB 1FNSH 5EMYA 5E00A 2EO9A 1VA9A 3FYEB 2P9RA 3AADB 4FQHB 4U4IA 5C0BA 2JNZA 3ULAB 2VJXA 3CTTA 1EHNA 1UT2A 2ADFH 3OXRB 3TVMA 5L0QB 3QQXA 4U1GC 4MMXC 1D6EB 1JCKA 3Q6GL 3P77A 4PIBA 4I18B 4U2YA 1HL5A 1KBBA 3A6CL 4OLYH 3QIUB 3VDCA 5E5UB 1G7JA 3JTSA 3MBXH 4NZRL 5BZWB 3IFNL 4FQXC 3MLXL 5D1XC 3PV6B 4M5SA 4X42A 3RDTD 2FWOB 1MREH 2QELA 4LHUG 4NNXA 5EORH 5F7LB 3QNXB 1SEQL 3L3IB 4M62H 4R9HA 5EU5B 4XHQA 2RBLA 2P43B 3H1ZA 2CM6A 4DQOL 4LARH 3HS0B 3ARDD 2O30A 5DHMC 3X13B 3QFJA 4ZMYA 2ZX8A 2DQJH 5LAXB 4OLVH 4AIZB 1IUZA 3MRDA 5K39A 4RZCA 3ZU8A 3J07A 4ZTPH 3VD3A 4GO9A 2FT8A 3MKGA 1NCJA 4TTGA 1MHCA 4DP0X 2ICEA 2BSEA 5T5NG 4KHXH 2VWEE 5EN2B 1IARB 2DB8A 1YMHB 5DZVA 1WUNT 2EDKA 2GBAA 3AU0A 4XOEA 1OAJA 1BF2A 3FT1A 5A2KH 4K8RH 2CDFB 1XIWD 2D2OA 4GAJH 1RK7A 3BVDB 4MAZA 4YHIB 3VJ6B 2LTQB 5GHWH 1KFGA 4PV8A 1TSHA 5DA0B 4WW2B 4FZ8H 4P4KA 2H26A 2IEPA 2K8MA 3QIWB 4K23L 5DJ0B 3IMSA 1RAMA 3EO1B 1UM4H 1T0NB 5FGCB 3OB0K 5IJKA 3BWAB 1OGTB 2B4CH 3NABL 5C07D 1GAFH 4WI6A 4Q6IC 1D5ZA 1NL0H 1KCUL 2VRAA 5EOTA 2VLKA 1NAKH 3CN2A 2GHZA 4HK0B 4UUJA 1NANI 1NLBL 2CLVA 2FL5A 3VD4A 1OAKL 3Q05A 3ZE0F 1NJ9A 2EYTB 4N0RA 2QADC 2WZ6A 3T71A 2X4QA 3DV6A 2YKKA 4IS6B 2EC9U 4Y5XA 4DT2A 3GZOA 4N0CC 3KM2A 5I8KL 4M02A 2B16A 2VDML 1X7QA 1A7QH 1QABA 1WAAA 3PWPD 3Q8BA 1F13A 4CW1A 2H1XA 4PJFB 1QRKA 2EH8H 3ZTJH 1KXVA 1XEDA 3SODB 3VXOA 4QRTA 1RMFL 2ZSVB 3BVWA 5GIRB 1LP9B 5F1NB 4PEEA 4RETB 1ZSHA 1TPXB 2VL5B 5GGTH 3AC0A 3N43F 4PYHA 4XPFL 3WGVB 2RQEA 5GSRB 2H6OA 4DCQB 1ORQB 2E7CA 4YOKA 2WWMD 5T33H 1Q9LB 2QPSA 1I9EA 4GW5B 4F7TB 3OTTA 1BAGA 4N0FB 1VERA 5KYWA 3MKKA 2AJYH 1E7UA 1FYTD 1I1YA 3OSVA 3LEXB 3IDJB 3ROLB 1I7TA 2C9SA 2ZQKA 2YD1A 3CFTA 2DLTA 2ED8A 4HISA 3VFRA 5EDSA 5JHLA 1HKLL 1OAYL 2YAEA 5GJTH 4AGNA 5HI4C 2WZPD 1RL1A 2A74A 3QORC 5FCUL 1T22B 3TZVC 3ECUA 5D1QC 1QRND 4AJWA 1LHZA 5B8CA 3WNPA 3FT0A 3QEGH 5EWIL 2YD3A 1MIMH 3SCMC 4BYHA 2A6IB 1V7NH 3V0DA 2P5EE 3FN3A 4HH9B 4MNHA 2CO7A 1MRDL 4KRMB 2DQTH 2O5NA 3GMNA 3SYQA 2XXGA 2FEDD 5FW7A 5C0RL 5FPIA 3UBGA 3VFRB 3O6MH 1TT6A 4B95C 3ARUA 3APDA 3II3A 4KJWC 4YSQA 5J57B 4YLQT 1UATA 2E7HA 4DPAX 2QZ5A 3BWUF 1LLAA 4A7UA 2AJZB 3OB0H 1AHKA 1U93B 4ORZC 1MQ8A 5CHNB 1G43A 2XWDA 4MSWA 4EI5A 2ZXDA 1OB1A 2NY5L 3F7QA 4M6OH 1WP6A 3ATAA 4HHWA 1AQ8A 4FI7A 4N2OA 3TBSA 2Y2TA 2OMVB 4LPCA 2EUXA 3EO0B 1FZOA 4YVUA 4IJTA 2Z7ZA 5JHLL 2W81C 3IYLW 5JHMA 2D03L 5MEPB 4MD5A 4MKMA 1TIUA 1XB6A 5D1QE 3L5WB 4WWKB 4XP5H 3QVAA 4IIZA 2IF7A 3TBWB 1PY0A 3LS4H 1F86A 2NY1B 4P23B 1F97A 1SVBA 4XHJD 2FYVA 1L0YA 2H32A 2G75B 5J6GA 4AW4A 4KJWD 4LSUH 1ZGLM 1DE4B 4L9LB 1DN0B 1KYUA 4U6VH 2YQ3A 1NUFA 5IBTH 4HIJA 1KYDA 3PDOA 1J8HA 2Y1AA 4XVSH 5KVFH 3OC8A 3DV4A 2K1MA 1TTBA 2LU5A 2VLME 1W8NA 2D3LA 3GJFH 5I1LB 4OD2B 2A3TA 5AW4B 5JIMA 3NJJA 1LE5B 1JG9A 2ALWA 1W6LA 1BW8A 4LLWA 2Z7UA 1NBZA 1OOWA 5HVFB 5AW1B 3O6FD 3UABA 4L0YA 4BFEA 5HHPA 1KYOJ 4AYDC 5E4AA 1KLGA 3S35X 4K9EL 2DWTA 4X4KA 1QO3A 2CGRH 3A4DA 3I50L 3VXNA 2Z3FA 1TOXA 1XF2A 1JD9A 2K78A 4XZUA 1XGZA 4MJ6A 4PB9H 4F91B 3U0WH 4Y89A 1XB8A 3DROA 1E4WL 1G9NC 1S7RB 2IDQA 2A83A 1WBZA 4FI8A 2O1AA 2FJFA 2XIDA 1R47A 4LGPB 5E4EC 3RVXC 2ICWI 4YFDB 4DIXA 4S1RL 2BOBB 1ZLWH 4OJFL 2OMWB 5JOPE 1BG1A 1CGSH 5KZCB 1P5UC 4OCYH 4PVLA 2FWLB 3QFJB 5LNDA 5E6UB 5H35A 3TVMD 1NGPH 2E5EA 4PJCA 4XXWA 3SJVA 1N10A 2C4FU 5IW3A 5C0BD 2ZXGA 5C07B 2C9UA 2Q76A 1A3LH 3H8NA 1YN6A 1I3GL 1AH1A 2PWHA 3NFSH 3TV3H 4E5XA 5GS2H 1X7SA 4AG4L 2AERT 1KLGB 1CFMA 4M7LH 3STZB 4WJ5B 5E2UL 4TVPD 4ZAKB 2FO1A 4JO1H 4JKLA 1CFSB 1SXSA 2BVYA 3T4AC 2WMPB 4Z3HA 1PZDA 4ANKA 1BZEA 3RZCD 1L6ZA 2DBJA 3IE9A 3OHXC 2VXUL 4LSDA 1XBDA 1E28B 5AAWC 1NGWA 4XO8A 2XUWA 1HCVA 1DN0A 1GC1C 4KKRA 4F3FB 2Y7QB 2FT6A 2I69A 4ADIA 4ZNEA 3SJVE 5JOPD 3CX2A 5SX4I 1UXLA 4GPVA 4GSXA 2M8XA 3MRBB 1PDKA 1E42A 4XP5L 3DJZA 7FABH 3RTQA 5KS9E 5I75C 1GMEA 4YDIH 3QI9C 1BZ9A 1DQDH 1C7SA 1A6WL 2XHNA 1FGNH 2UZYA 1EAPA 1M6OB 3ARFB 1S9KC 3ULSB 3GJEB 4Q58C 2HX9A 2NSQA 1OK0A 2JK5A 1ZT7B 4IRJD 5IEKB 1UWGL 4LZKA 4PRIB 5M95B 4PGCA 4ZO8A 5J9PB 3MV8D 3ILQD 1T20A 5E2VH 2OMTA 4YHNA 3SD5A 2Z8SA 4GG6E 1WFTA 3TONA 3D09A 3HG0A 5IJVB 3X1BA 4MDIA 5HD8D 3QDJE 1Y6KR 1USZA 4X9HA 2F54E 4RMWA 3WFCH 1TZIB 3KPSA 1TVBA 3ESMA 1XR8B 2GSMB 1HHJA 4PSRA 4UBDD 2ISDA 4HJGA 4OR1A 1ZPLA 2FEEI 4YZFE 1BVNT 1IGJA 1N8ZB 5HJ3B 1K8DB 4KTEH 4MAUL 3RJOA 3VYOA 9PCYA 1T7XA 4MS6A 2EVJA 2PXYD 3ASWA 3N04A 3NJMA 4CVZA 5LUMA 1XGTA 4P9MH 2GTQA 1HQRB 4FHKA 3V7AE 2A9MH 3S96A 2E27H 1YECH 3LRSB 4FI6A 2A38A 2RH0A 4UAOC 3TCLB 1FVDB 2FNWA 5DVMA 3TNNA 5BVJA 2EO1A 1QQDB 3EOBA 5D7HA 4ZQKA 3E6HB 3WFZA 2HVKA 3AB0B 3F62A 3UJIL 5L6YH 4HJ1A 2R4RH 2ITEA 3I02A 3TESA 3SDXF 4TL5A 4OT1H 1RJYA 4JVPA 2V7HA 3C6SA 1WFUA 3FB5B 2R1XB 4HCRH 5EZLB 1KJMA 1YYLL 4XE5B 5ADPL 1QO3B 1CIDA 2HWZH 2WXFA 4Y4HA 4P59H 5DWUH 1V5JA 5F9OH 1UEMA 2CMRH 5CMAB 5KSUB 4PHXA 1O6SA 3ES6B 2ED9A 1NCCH 3VXRA 4Y7OC 1UCTA 3AACA 5AZEH 2RTTA 2VR8A 3B3IA 2PN5A 1PX4A 3RX8A 4EIGB 1G5AA 3KEDA 4BA0A 3S5LA 3IXAB 2UWEB 5HTSA 3S3BB 1UT9A 4AZ8B 2OULB 4UTAL 4GT7A 3EJYD 5BCAA 2FO4B 4PS3A 4X50A 4KDVA 4YEFA 4LCVA 4F7MA 5FFOA 5AW6B 1AHWB 1PZCA 1WHPA 2V9RA 4LL1A 2F53E 3K8MA 1NCWL 4G9FB 4J3OG 4N2DA 1REIA 3O0RL 3GBNH 2Z64C 4LARL 2MCG1 2H3NA 3S5YA 5I6OA 3KS0H 3QO0B 1P4UA 3ML8A 3V55A 4R4ND 4HJ0C 5EBMA 3UZVA 1GJUA 1ET5A 2YA0A 2VERN 1INQB 2DQFB 3E8UH 4Z7WB 5I1HL 5T1DL 3QJHA 4GFXA 2NUPA 1WWBX 3SDAA 3VX1A 3KPMB 1MRFL 3W81A 4YZWA 5CKAA 1JZ2A 2WXGA 1H8LA 2P7TA 1QLRA 1GIGH 4AKOA 1I85C 1OP9A 2WWNA 1KLUB 3DHMA 4AEIL 2PP9A 2X40A 1R3HB 2F08A 1NCGA 4MSWB 2DQCH 3QHZH 1F1DA 4YHIA 4NQUA 2BNUA 3U83A 5IUSA 1VJSA 2GITA 2IAMC 2XIIA 3BT2H 1ES0A 4AEIH 3Q5TA 2ZWSA 4MQTB 3UG3A 1OKEA 1BF8A 1PDKB 2HH0H 4IEFA 3HS9A 4QRRA 5HDBB 3QHFL 4ODXB 3NA9L 3HNSH 4JPWL 4QR7A 3UADA 3QYMA 1OW0A 3EJTA 1MVFA 1QNZH 2FHFA 3JTTA 4ZFFB 4K3HA 1BQLL 3HLAA 2GYSA 3ZTNL 4DTGL 4AIZA 1G9MC 4Y2DC 1A66A 4IOFD 1B6DA 2QVFB 4EIBA 5FUCC 4L3CA 1NEZA 1YMMA 2OMBA 2ZCHH 2DQMA 5IB1B 3S9DB 3QNZA 3V5HB 3JBG7 4NX0A 2A74B 4CU8A 2BRRL 3NACL 3CVHA 2PP7A 2WTOA 1CB4A 4D0DA 5ACLA 1LEGB 1SXZA 4CN4A 1U8KB 5BZWA 3BP6B 4OGAD 5DVKA 3LKOA 1CXIA 3RY6A 4H25B 2LAAA 4IU2B 2UXTA 2HTLD 5E6IB 2IPTH 1VFBB 4L05A 2W91A 2CGZA 1EMTL 4BQ6A 5IHLB 3MJWA 1A6UH 4X5WB 5DJZB 4CMMA 8CGTA 5HDOA 5DR5L 3QE5A 1A3RL 5T1LD 4F5CA 1UASA 4RAVB 1M1XA 4RMVA 2O6DA 3VMOA 3D85A 4WFFE 5DQDL 5E6ID 4ABVA 4W9FC 2VL5A 2A0LD 5FYJU 2NY7L 4P57B 4PP2B 2EXYC 4EN3A 1QYGH 2EXSA 4GQQA 2A9CA 4NO0B 4PPTA 4GKOA 3V7AG 3WU1A 4JO1L 5BQ7B 5L2KD 5D4JA 1HX0A 3A6BH 4HH8A 1AKPA 1KTLA 3D1MC 3P0YH 5CSGA 3FNKA 1CDJA 4K2UH 3BZFA 3GSVA 4XPHL 2O72A 1N5AA 3B56A 1GGBL 4JQXC 2BSDA 1IX2A 4JRFA 3UGEA 1KXHA 3SY6A 3WAJA 2C9VA 5FK9B 1DVUA 1JZIA 1E5AA 2PKDA 3L4YA 4PP2A 3RI5K 4X7SH 3BQUD 3MJ6A 4HK0A 4UUJB 4FQJH 4IBVA 4BK5A 2B1HL 4ELDA 3QI9A 1F4XL 3U2IA 1KYFA 2EO7A 2TRYA 5C86A 3RJQB 1IC4H 1MCJA 3PJSA 4XHJC 4M62L 4TNWK 2HRPL 4BFKA 3MA7A 1BVOA 1AY1L 4F8LA 1LMKA 2QKIB 4M7LT 3RVUC 3V2AR 5IK3A 3QUGA 4X4ZA 4KI5F 3HRZC 5IVNA 4PLJD 2L7UA 4OUOA 3ERXA 3C5XA 4H88L 3TBTA 3PWPB 5JZ7D 1E8WA 1TQUA 3LJ3A 3N1PC 5HPMA 2XKNB 3AABA 4UB0H 2YBRB 4GO8A 4ICXA 3QJFA 4NPKA 5B1CA 2EDTA 1JGLL 5DU7A 3MVSA 1BVKB 1JI2A 4FP8H 3K81A 4MYPA 2E9BA 2I24N 1PQZB 1DJIA 3TP4A 5TQ0L 1TVHA 2FHCA 5C0NC 3GMPB 2ITFA 4YHLH 4C56D 5K9OA 3QEQA 1WRFA 1ZMYA 3FU8A 4XP4L 4G6ML 3LKRB 3IT8D 1I8LA 4PJ5A 2VW7A 5I74C 3UZQB 4LAQH 1RJLA 2VAJA 3BUIA 4K4KA 1EO7A 4TKWA 4Q9RL 2F7IA 3H2QA 4U33A 2EIZA 2H0EA 3ZE0B 1UD5A 4U0RB 5HHVH 1LO5B 3SDDC 1IBYA 4ZUSB 4PJEB 4X4YB 1N4XL 2B9AA 1KJ2L 4KX9A 5MERB 4E9LA 1EUUA 4FL4B 3PWVA 1NFKA 3T3PE 4RCAA 4NLHA 1PLGH 2CO7B 2EIMB 1HDMA 4M7JH 2NUPB 1BFOA 1MVUA 5DD5H 4DVBA 3TZVD 2K3HA 1GGIH 3QFDB 4MNQA 5C0BB 3WY2A 5E00B 1I3GH 2VISB 4MB5A 1HE8A 3IJYA 4M4PA 4Y19B 3RIFF 1HHHB 5DWUL 4A7SA 1T1WB 5DRXB 3LHPH 1KJ2A 4N8CH 4G80A 3PNWB 4R4FH 2FX8L 4DPBX 3QRBA 2VLKE 3UTOA 3V6FA 4ANUA 1DBKH 4GRWH 4O02B 1G7IB 3ESUF 5CGBA 3PHQB 4KDTA 4FG6C 1KIUB 5GSVA 4AZ8A 1U8MA 2XZZA 4EAEA 1T89A 3PP3K 4NKOA 2FBRA 3VFPB 2EP6A 1E9PB 3L3HB 3UJIH 1X5LA 3ES6A 4PJ5D 3VXRB 3GBML 3EDEA 3BPOB 3V9EA 3LQAH 4UV4L 3TA3A 3ZTNH 2BIOA 3VI3E 2V2XA 1XCQB 2CXKA 3K1DA 5FV2A 1AS7A 4LSVL 2FBJL 3WE6A 1JFQL 3WIIL 2JV6A 1S7QB 2Z31B 2B4CC 3SD2A 3RA7L 3BUTA 1EUTA 1BIIB 5AENA 4JANB 4YDNA 1MFDH 4ZUVB 4JPVH 1GOHA 4M00A 4W4NA 1UH4A 2VDRL 2WLIB 3SIKA 3FO0H 5FYLE 3ME0A 3Q2CA 1X7QB 2X28A 2V7NA 3PAVA 5EF1A 1R3JA 2O6CA 1MRCH 1P1ZB 5I76B 5M7QA 1G7HB 4Z1PA 1J1XL 3VCLB 4BK8A 4PJ9D 1P5VB 3T2NL 2ATPA 4QD2E 2VAAA 2V3DA 3CN4A 4XNUH 4NQSB 2EACA 2X3BA 2VOTA 4UT6H 5E8EA 4DKEL 5KVEE 4QDGA 3CVIH 4QNPF 2AXGA 5IROC 4LQ1A 4ERSH 1OZUA 4MDRA 4ZW6A 2AF2A 3KLKA 1C1EH 3BIBX 2CLZA 1T7ZA 5GS0L 3WFHB 3LXAA 4OLUL 1JGIA 2E0PA 4HBCH 4AKPA 3H9ZA 2W65B 5BMFH 2M2DA 4W9IC 2AEWA 3MA9L 5TE7H 3L5IA 2ZXEB 3FTZA 4KY1H 5EA0L 2WZAA 4Y2DA 4U6XB 5I1KH 3E9UA 3LNFA 1RPKA 1SXNA 1GW6A 2DQEL 2X4RA 3DRTA 4NQXA 5B39B 3RX9A 3NIDE 4ZI8A 5KUMA 4JM0A 1HESA 4XCEB 3ETSA 4D7PA 1G7QA 2WUBL 4GKSB 3QWOB 2JH2A 2O26U 3FBQA 2RB8A 3VVWA 2WGXA 2YQGA 2HAZA 1M3IA 1LK3H 2C3HA 5E1GA 2NCEA 4ODTH 3V0JA 5KW9L 5LBSH 3V0IA 4A2MA 2QQQA 2Y0SA 3QQ9C 1UYWL 1DP0A 5L2KB 4ZTOH 1AIFB 3NIDF 3RFZA 3T6WA 1WFOA 3FUMA 4L4VD 4BQ9A 1VGEH 1K4DB 5DMKB 1GTFA 2JF1A 4BQBA 1RVFH 1OEZW 2WQVA 5IQ7L 1B9KA 3GHPA 1DQQB 5LAXA 5E1QA 4L5FH 2K45A 3BC9A 5KVGE 1UEYA 2DV6A 3O6ML 3VXSA 1MCIA 2CHDA 2DYRB 4YWGL 1EEQA 3BMVA 4MB4A 5FOBB 4KHTL 5I8CB 6PCYA 4WHCA 3IDMA 4CVUA 5MHSE 4NNXB 3QPXL 2JQMA 3THML 2AITA 4KO9A 2IANB 5DD6A 3NJNA 5JOEA 1OM9A 3F6IA 4AUYA 4UAOB 2C9PA 2TAAA 3GSOB 3QHTC 2VM3A 4XNYH 1JSYA 1WBXA 2EDEA 4OZHA 3WTXA 3QEHB 1SQ2N 1Q38A 4JM2C 4DW2L 2Q7YB 3U1SL 5AG8A 1OCOB 3KJ6L 2WYTA 3JXAA 4R7DB 3H4FA 3HOGA 4LVOB 5C0GA 4NO3A 3RI5F 1T1YB 3Q3GA 3LKOB 2JQZA 3NCEB 3OKDA 1ZJBA 5CN3A 4E5XB 5IJCC 3K6NA 4M9OA 1AMYA 1V7MH 2YPLB 4XNQB 4RAUB 5GGQH 4NNPH 5HHMB 1JYVA 5EIIG 32C2B 3CFMA 3T1FA 4GP5B 4KMQA 2FQGA 3AFLA 1FL3A 3GI9H 3P02A 1Q72H 2AZAA 2UX6A 3HRZA 4FNTA 5GGQL 3JVFC 4EI0A 3H9SD 1KCWA 1LEIB 3WXWL 3X3GH 1W0VB 2CG9X 4JFTA 2E56A 4TMPA 5GZNC 3L48A 2FSDA 2QV4A 4EUPA 4AQ1C 4QOKA 3FONB 2XN9D 3TH3T 1JNLH 1PS3A 2WQ8A 3EOAB 4HAKA 3HR6A 4RGND 4ZMLA 3EYQD 3UDWC 1HWGB 4GKLA 1XSKA 3MOQA 5I16B 4R97C 3SBRA 4QXVA 3WUWG 2ENQA 3APMA 1WGVA 2BZ7A 1SYSA 3PF2A 3UTSA 1ZY9A 1M05B 3GQFA 4M61A 3WNKA 2BS9A 2CUMA 1O0VA 3GBLA 1GCFA 2QADB 3P4NA 3U2SB 2X4PB 1NBVL 4NJAL 2EXYD 2ESVB 4W9EC 3TOPA 4U0RC 1G0YR 4LLDB 3SYCA 1AXSB 3MZTA 3Q8FA 1QLRB 5D1QB 3WHXA 2E7LC 2LT9A 3MLTA 4ZRGA 1MJ8L 1L9RA 1NBZB 3D33A 2GUOB 3NCFB 2DQFA 3CQPA 4NUGH 3TT1L 5CBEB 1OARL 1AO7A 4YIQB 3RNKB 3G9AB 4HA1A 3KNBB 4QOKE 3P3RA 1EK3A 1IBFA 5L88H 4M61B 3AWGA 4K7PH 3GZKA 4MJJA 3U6RA 4F15C 2D0FA 1IKOP 2EH7H 1AHWA 1HZHH 4P5TC 2CUHA 3FS9A 4WVRA 2CCLA 4HUNB 3HNTL 3BGFC 1HHKA 4Q97A 4Z3IA 4EBQH 1F1AA 4WTZA 1LQSR 2CO2A 1KNOA 3PLYA 3QUHA 1E65A 4AY0A 2OCJA 3TBWA 5J11C 3HC0B 4A67A 4Z7VF 5HP5A 1AZVA 4XB7A 3WENA 3T5WA 5JW5A 4NN5B 5IFJB 4X80H 5E4EB 1T2QL 3MRRB 1EFXD 5C0DA 3RIAK 3ZR6A 4PRID 4LFHG 2P8PA 3NZHH 3L08A 3WAKA 4L8CB 1RPQA 2X6AA 2NY3D 1U41A 1T89C 1Q94B 3ZGIA 1ETJA 1SJVA 1HE7A 4NQCD 5F1KC 3R7QA 5GZOC 1A7RL 2X89A 1WWWX 4A38A 3N91A 3UMTA 4AC4A 4BKLB 1I9JH 1IVLA 5EO0B 5G4MA 4GXVL 1NDMA 2PCXA 4ABWA 3BN3B 4FNUA 3TEYA 3O3BA 4EIZC 5AOKA 3CHQA 3FF8A 1HKLH 1OAYH 4GI6A 5GJTL 3RDTC 1Y07A 3D69B 1FFTB 2W9DL 2GTZA 1J9TA 2P24B 1FNGB 3BQUC 3C2AL 1F2XK 3QDJA 2BOCB 1VZGA 1KMGA 4XT1C 1CYGA 2VT0A 4JY6B 4JZOA 4JO2H 3T2NH 1T1WA 3EYFA 2QSCL 3QQDB 5CEXB 1PSKH 2VZSA 3QJXA 1I1AA 4OCNC 5E9DA 5IF0B 3O9WD 4M6ML 1FC1A 1G84A 1EJFA 2K9UA 3A4EA 2YD0A 2Z7YA 1XGRB 2I32A 4YBQD 2W92A 4D9QD 2EDRA 1I75A 4RGNC 3LN9A 2UUDK 4B9CA 4M29A 2UYLB 4G7VL 3GMOB 1XCXA 3LRHA 1Q1JH 5HYJE 1OP3K 5C6WH 4OLXH 3DURA 3CC1A 4HJJH 3B5GA 4OZGA 4APXB 1JNNH 1LD9A 3ZLQC 3RE0A 4XVTL 4XMKL 1NC4D 4H26B 5J56B 5JW4Q 2ADJA 5E8OB 4BDVA 3HHSA 3CVHL 1Z9SA 2AEIT 1L7IH 4N87A 2GSGB 3OJMB 4XMKH 5I73B 4JFDA 2KPWA 2D03H 2JCWA 3BP4A 4WWOA 4A6YH 2IMMA 4L48A 1Y18A 3UBXI 3O9WC 4IDJH 1S8DB 4GKSA 4MJ2A 8FABB 4NENB 4WU7A 5EUOB 4A2LA 3L4UA 3APNA 1RQ5A 1ZV9A 2IBBA 3K6OA 4OU3A 1IE4A 2WO4A 4TQHA 2J8OA 4XO9A 1T1XA 1JWMA 2QADD 1HHIA 2LVEA 2QPFA 4WSKA 2DEWX 4PVBA 1AD0A 5HPMB 2QL1A 1YEDA 4OBRA 4Q14A 3BYYA 5D4IA 2AS5M 3PJNA 1C7TA 2QPDB 2IH9A 2W60A 3S0PA 2CLZB 1YPZE 5T3XE 3OJVC 1LMIA 3SPVA 5JIQA 2PPCA 4KH2A 3D25A 5E94A 2AXGB 1E28A 2GPZA 1RIUL 4DP7X 2XG4A 3LQAC 3PIQB 5EOTB 1SFHA 3WFEL 3SE8L 2NPLX 1NGQH 4G8GE 4JRYD 5F7EL 2IBZX 4ONFH 5AAMC 3A23A 4S0TD 5C70A 5DZLA 5DC9B 1RZ7H 1BGXH 4LVOC 1U95A 4Z7NF 4G7SB 4H1LH 3LQZB 4K71C 5AVZB 4AUUA 4DO4A 5CILL 4YGAB 2B1OA 4X98A 4X9BA 3UAEA 3UEZA 3BH9B 3MREA 3DETD 1YUKB 4M43H 4RFOH 2DJSA 2YD4A 5IKCA 2M83A 1E4WH 3TA3B 1A65A 4UQ9A 4IIQB 4XR8C 4POUB 5C3IA 2EDQA 2WQXA 4QJ4B 2J4WL 3KEHA 4GIOA 3KWWA 3NRQA 1DJWA 4CU7A 1BAFH 1Q9WA 3L1EA 1JD7A 3JUYA 3QR1A 4FG0A 1RUAL 2AEQH 4EDXB 3HMXL 3SKNA 2MCMA 2UY6A 2OSXA 5IEHA 3QUXB 3V5KA 4JFFB 2V5RA 4GP8B 2QKSA 4PRHA 2VXSH 1ZLVH 1OP3H 3PAYA 3VB8A 4MASA 1W72A 5KVEL 2Y1YA 1U8PB 2EDLA 4X5WA 5T3XL 4CMMB 1YRKA 4Y19A 1A7QL 1F4HA 1F3JA 3W39A 1YC8A 2IH1A 4G8EB 1KTDA 4Y8DC 2JKRM 1GIGL 3C6LC 4UQDA 5E56A 2WXOA 3MGTA 4G43A 5CSBA 2YC1A 2Z4QB 3OVUB 1A22B 4XMPH 5CSZB 2P47B 3QDGD 2HMIC 2X1WL 1R0AH 4N25A 2OQJB 2OQJA 3TT3L 4PRHD 1NWPA 1MCSA 5IFHL 5GRUH 3BP7A 3QJQB 3IFLL 4JS7A 3KJ4B 4PJXF 3W57A 4YHOL 2FRGP 4O2FB 4PCTA 2P8LA 2DLFH 4B27A 1U8JB 2NYZA 4OD3H 3HBGA 4QHNA 2EDFA 1YEFL 3RL2A 3BP5A 5E8DH 3ZGHA 1RK1B 2XTJE 4LNRA 3QBTB 3EJZD 3RILA 4KZEH 3A4AA 3EYOB 3QEQB 4FTDA 3CCHA 4W4OC 3SE6A 3O2DH 2AJSH 1EFXB 3WE1A 3GMPA 4JFFA 4Q2ZB 4X8JB 3QUXA 1UXMA 3GNMH 5FYKH 3IF1A 1PSKL 2IPTL 1K85A 1OWRM 3BE1L 2WAHA 4RX4A 1X7TA 3MBWA 4JFPB 4MZ2A 3UC0L 4Z7OE 4CJ1A 4OCRH 4YSUA 5KSBE 4ZMVA 1B2WL 2XJLA 3CX5J 4FNSA 2JXMA 4AMKL 3Q43A 4L0ZA 4DEPB 3ZTJG 4N9GA 3B7YA 4PW9A 4X8CA 4JFWA 4R5VA 4DZ8A 1DQMH 4BQCA 4HIXL 5FGBC 3UBXA 3OAYK 1QFUH 2VLRD 5F88B 4AQ8A 4M1GH 3KXFA 2ZPKL 1RUQH 1TQBC 4HV8B 5CHNA 3MREB 1VPOL 1CYXA 3JWDH 1K3IA 2NLJB 4UQAA 3QO0A 1K5NB 2R0LL 2ZCKL 3Q13A 4M3KB 4HMCA 3CZUB 2NW2A 4PB9L 3U0WL 4D0CB 2APXA 1T7YA 4D0BB 2VMJA 4YSPA 1WISA 3ZDXF 3K0WA 3H55A 1CICC 1EX0A 1D7CA 2FO4A 2E74C 3TXAA 3W0WB 4PRPA 4IRSC 4KJQC 4CKQA 4ZX6A 1ZV5A 1QLEL 3CVBA 1O7VA 3KR3L 4N68A 4WFEE 3RPIB 3U9PH 4E9WA 4QHPA 3P9MB 3A4FA 3SO3C 3U4EB 3SPVB 3WEBA 3RIFK 1MH5B 1NAMA 1WDAA 4JJ5A 2BIQA 4FOMA 4UM9A 1SRDA 2XN0A 4JKKA 5D5MA 5DURD 1SLVA 2J6EL 4HWBL 1AD0B 4YXKH 3HZKA 1I1AC 1JPSH 4K3DH 1JI1A 4R7VA 1KN4H 3GSXA 4R5TA 4UMGA 4UBDC 4WUUA 1OE2A 5BJTB 1T0PB 1L9MA 5BZZA 1AGFA 4OI8A 5DJYB 2R23B 2WTRB 3ELAT 4PJ8D 2H3KA 4E9YA 2P80D 5IQMA 3QEQE 2Q9OA 1R3IL 4OIBA 3HI1A 4X6CF 4PJ9B 1RFDL 3GLAA 1JYXA 1U3HD 1TCRB 1WCQA 4PRPE 2X7LA 3JT0A 3DSNA 3LNGA 3WDJA 5C07E 3ROOA 4EVNB 2QDVA 4NB7A 1TVDA 4H26A 1DSFL 1B0IA 3SE4C 3AITA 1EXUA 3C60A 2JJSC 2V3FA 2XFGB 5E9DD 3VXOB 1TUPA 1MCHA 3D3VE 1WO2A 3BP6A 2Y1ZA 2P5PA 3JWOH 2QVMA 3GSNB 4BFIB 1KBGL 4NUPA 5IFAL 1JRHI 4F7PB 2VDRB 4QTHA 3FQNB 3GMOA 3KCWA 3WOVA 5F9JB 2E9WA 5D5MB 2VLKD 4RESB 5CP7B 5FM5O 2OXGA 1BREA 3U30B 2E76C 3K80A 4I0CC 1HZHL 4L3CB 5DFWH 3BZ5A 3N2JA 2XTJC 1I3RA 3QZNA 4UZUA 2G5UA 3ZYZA 5LQBH 3NEOA 3SE9L 4R96B 1U2HA 1KJ2H 1H5BA 2WOYA 2AXFA 2CJTA 2J56A 2D3JA 4IHBA 1MCOH 4N8VG 2FECL 3OJ2C 3I3DA 1F4YL 3IMBA 5C8JA 4JPSA 5E2UH 5IHHA 4JUSA 3FO0L 5DS2A 3D06A 3QEQD 2BSCA 2DD8H 1XIWA 4PRIA 3O2WL 5B38B 3VWJA 4XNMA 2O5YL 4FQ1L 1LP9F 1OPGH 1HCZA 4I77L 2V8MA 5ISZE 4JY4A 4P2OB 2DJMA 2MOGA 3ZL1A 1A1OB 1T5XB 2WJ5A 4OIIH 1XF4A 4J23A 5SWSE 1AZRA 4KITB 2DLIA 3JV6B 4BSWB 1KC5H 5DS1A 1DQLL 5AWNL 2J57A 4Z7QF 4UTBH 1M7UA 4JHVA 3WMSA 4BZ2H 5IMLB 4NAJA 2YRBA 5IWLC 4GKNB 5KSAB 4KKAD 3ZL2A 4YDLB 3K72B 1BZ7A 1OLZA 2J43A 3EGXB 4RFNC 2BNQD 1Z7JA 4BIKA 1CD1A 5MENB 1KIPB 4XC1L 3P2BA 5IBUG 2IH3A 1SY6A 4PGBB 3GIZL 4LNRB 2PW2B 3BDYH 4OKDA 2Y3NA 4DZBA 5FHBL 4EPSA 2EDWA 1G9HA 1VADB 2VC2B 3U7YL 3OX8A 2CAKA 5BUPA 1VKXA 3CDYA 3HC4L 1FUNA 1N4XH 1RULL 3CBRA 1M2OA 1UENA 2W9EL 2DWSA 2I60H 4M48H 4J7RA 4EVNA 1U3NA 4GW1B 4PREB 1XL4A 2JLLA 2DTMH 1FFQA 1UZ6F 5JHDE 1RULH 5LWYH 2ERJB 3ZHFA 2IH1B 4G8EA 4PG2A 3VAEA 2G5RA 4PWFA 4EDWH 4LSPL 3UZEC 3GXFA 4ZMPA 3MA9H 3MACH 2BHYA 4HC1H 2A7BA 2EKSA 1CLOL 1WEJL 4H0IA 2HFGH 1BQRA 1AGBA 3JQOB 4WHYG 3N85H 3WNNA 3MDJA 4K15A 2GG1A 1CFQB 1YYCA 4FP8L 1HIML 3B1TA 4KROD 4MJ6B 4TUUA 2OL3H 1PYWB 2P5EA 3R0MA 1Z5LB 3RWDB 3MOBL 3U4EA 3MV9D 2CCWA 2OZ4H 2BVQB 4YGVB 3TWCL 1B0RB 1A3LL 1CDBA 4NI6A 3CSFA 4CVZB 2P1YA 4O2CA 2AQ3A 1DZ0A 4RGNB 4UQ2B 3S88L 4MA8H 3ARYA 1FFOB 4JPVL 5SWSB 4HEMA 1XF3A 2YN3A 2G60H 4Z7UF 4UOW1 5E0FA 1I9IH 3KLHC 1S7TA 3EZ8A 3LDBB 1L9SA 3SQBA 3MLPA 4YBLB 1G9NH 1XMWA 1RKRA 1ZLSL 4FNLH 3OR6A 4IGBB 1EAQA 1SHXA 2HT2D 5D7JD 4MVBD 1HINH 2RCSH 4GS7B 2DI7A 5E1AA 3QCUL 3PL6D 1PZUB 4XNZB 3PDOB 5SX5K 5CO1A 1B0GA 1NCTA 3FO1B 5EU6D 2H32B 4KVNL 2C1OA 5FYJH 4M7KH 2WXIA 1A21A 4RGMC 5F6IC 3QDGA 2FLMA 2AQPA 2VN7A 1MHPL 2WGNB 1HYSD 3ZDYE 4U31A 3JSSA 3L5WA 1DBKL 2HJFB 4OLWH 3Q0HA 1VDGA 2GC7C 1UA6H 4BUQA 3A6BL 3LCYA 1YEDB 1LDPL 3MJ8A 3ZN6A 4FQXA 2XX0A 4LVNB 4AYBA 4HEME 5D1XA 4TNVF 4BZ1H 1UURA 2AJYL 3GTNA 2WVUA 5E24E 4WTXA 5AG9A 3VD5A 2X6CA 3W37A 2KC0A 4OF7A 1JYNA 4X6CA 3K4ZA 4HUKB 4OCXH 4OGAC 4HIHA 2XA8L 3VGHA 3HI1B 2I9LA 3Q9QA 3IRCA 1INDL 5IBTL 2F68X 4X6DB 3EUDA 3GMLB 1XO8A 2YAMA 3UTSE 3ALPA 3HHSB 5K9JH 4N0YL 3SQOL 2G3XA 3FQWB 2VKXA 4HFWB 5ES4B 4I1PA 1R17A 4UQEA 1A8JH 1CE1L 2IG2L 5D9SB 2Y06L 2HT3D 1FPTL 5TE6L 5CFAA 2Z8VC 1IAKB 4Y9CA 4UDTA 3S37H 5GQBA 2VMEA 4N4YB 1YN6B 4XCNA 3O45B 1NAMH 5C0BE 4E41D 5TE6H 1OSYA 4I48A 4M48L 1UH2A 4DGVL 3MMEA 4U1KB 5KBMA 2WCSA 3RG1C 2WANA 4YFEA 3MLZL 4GAGL 4PRHB 2Q2EB 1H3PH 3PP4H 1EWHA 1JPTH 3F7LA 2VR4A 3GSNA 2VDOB 1N70A 3PDDA 3BRFA 1NFDB 2D7NA 4MRCA 4V1DD 1D5XB 4AYEC 4HZAA 4NAQA 4WAFA 5EOCL 2BOBA 2YPVH 3RGVC 5CJBA 5FB8B 5CBAB 1GHFL 3ROOB 4DESA 1UOWA 5KYUA 4XVUD 2C3GA 2V2WB 3FYIB 4IHOB 3CMOL 2RQ8A 4DCQA 1JDDA 2VZVA 2FGWH 3O4LD 4I18C 2IXQB 3CFQA 4LCUA 2PABA 5AQ0A 4UQIM 1T04A 4Q9RH 2KQMA 5I71B