3PFUA

N-terminal domain of thiol:disulfide interchange protein dsbd in its reduced form
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
119
structure length
119
Chain Sequence
GRSQFVPADQAFAFDFQQNQHDLNLTWQIKDGYYLYRKQIRITPEHAKIADVQLPQGVWHEDEFYGKSEIYRDRLTLPVTINQASAGATLTVTYQGCADAGFCYPPETKTVPLSEVVAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Oxidation state-dependent protein-protein interactions in disulfide cascades
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
molecule keywords Thiol:disulfide interchange protein dsbD
total genus 23
structure length 119
sequence length 119
ec nomenclature ec 1.8.1.8: Protein-disulfide reductase.
pdb deposition date 2010-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11412 DsbC Disulphide bond corrector protein DsbC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1250 Mainly Beta Sandwich Immunoglobulin-like Thiol:disulfide interchange protein DsbD, N-terminal domain 3pfuA00
1VRSA 3PFUA 1JZDC 2K0RA 1JPEA 2K9FB 1Z5YD 1L6PA
chains in the Genus database with same CATH superfamily
5DCCA 5ITFB 3W0WA 3BD3A 3GYRA 5CFAA 4HMDA 3LX9A 3FFDA 3EJZC 3UTTD 1QNIA 2HKFH 4M4PA 5FUZL 2WXFA 1K4DA 1R75A 1R5WA 2F6AA 1ODUA 2BVPB 1YNLH 5SV3A 5GGVH 3HHRB 3G5XB 2R2BA 4FKEA 1U3HC 3PHAA 1A6ZA 3HE7C 2VZTA 2EYSA 5GGTL 3KCPA 3O3EB 4PGCB 4MX7A 3VH8B 5B39G 1EZVY 3IGFA 3RKDC 3QO0A 1F4WH 2BNQD 3M7OA 5IMMA 1R46A 4MJ5A 2ZT9C 1ACCA 5AW7B 5J5EA 3MO1A 4PV1C 4QCIA 3QDAA 4YSAA 1X5HA 4JZOA 5EOCL 3WKQA 1MVUA 2WTPA 3Q0HA 4NQEE 4X6BB 3DNKA 1S8DB 2CO7A 4KXZI 5IMLB 3AG3B 1NBQA 2BY2A 2ICEB 1A6TB 3RAJL 3SGEH 1L4IA 1IB5A 1Z2KA 5LVEA 5EIVA 5E5MA 5LG1A 4JUSA 3O2VL 1B4JL 1BMZA 3DECA 3EDKA 4EI5A 4E0RA 1EEYB 1M56B 2BIMA 2AANA 3C5ZC 5CILH 4UNIA 2CA4A 1NLDH 1N6QL 4EUPA 5KAQF 2XQYK 5DD5L 4HT1H 1KZQA 1FYTD 1LO3H 1U8OB 4ODBD 5CM1A 4ZYKA 1S7WB 4XHQA 5J11C 1G7LB 5F1NA 2B59A 2E9BA 3C6LC 3EG9A 4ANXA 4JM4H 4PJGA 1UUSA 4MQSB 5BZZA 2LFEA 1IKNC 1J8KA 4WI6A 3OJVC 4BV1A 5KBLA 2OYKA 4RIRA 1FNSL 3DPBA 4U0RC 2NSMA 3RB5A 1KLUA 3QIBD 3HUJF 3UAFA 4HUMB 3BH9A 4WQOA 2VJ0A 3GJFK 1M3JA 1AGBA 4D0BA 4D9RD 1N67A 3RNQB 4AVIA 5KZCB 3VWJB 1MG3C 1J5IA 1OAZH 1XO8A 4N3UA 3T77B 4UINL 4HX1A 3FPXA 3TT1L 2OMXA 2X2UA 4N2KA 3F7LA 1I75A 2RBLA 1SY6H 1JPST 4OGYL 5DWPA 2CRZA 3GHEH 3I2CL 3MJGX 3GSVA 1P1ZB 5T1KB 3WELA 2IFFL 4ODXA 3GSWB 4OF7A 3UAJA 5EU6D 1EZUA 2CA3A 5I73C 5LXVA 2ROYA 2L7QA 3ORJA 2OL3B 2B5IC 4OZGE 4WHYH 2OMBA 2BIQA 2EDXA 4AWJC 3IFOB 3BVNB 1MAJA 1V3KA 3LS4L 3MAWA 4YHLH 5B21A 3NYKA 3LZRA 5KWYC 3TBCA 1TZIB 3A67H 2JKJA 2DLGA 3HR5B 1FL6A 2NNFA 2P8LB 1XGUA 1F58H 3I6GB 4JRWA 5KG9A 4N87A 5G4OA 3NJFA 5HDQL 1XCTB 4J3TA 3FW6A 3BSZH 3O6FD 2HLAA 1TZGL 1LO2L 4AJWA 4N2LA 4GAJH 1XZ0B 1G1CA 3UTTE 1TTFA 1WAAF 3TWCH 2MHAA 1G0DA 3DUUA 4U1NA 5A3IC 4AQ1A 1I1RA 1JTPA 3RZCA 2IC2A 3FO1A 2O4EA 3OKEA 4MSWA 3MR9A 3HPJB 5F44A 3UBFA 1UJ3C 3NRPA 4LOUD 3NCMA 2ZKMX 4OD1L 4IHOB 4ILDA 1IC5H 4GBXC 4I48B 4BZ1L 3QCVH 3CHOA 3WNOA 3T0BA 2XKNB 1G1YA 4IBLT 1B9ZA 1PZUB 5I1AB 1GTNA 4NRXA 4HG4K 3CTTA 5HDRA 1HIMH 2VXSL 4E9TA 1JGIA 4JFED 1IEAB 2V4LA 5I1EL 2AKRA 2FO1A 4PJHE 4HZLA 5F7EL 5KW9H 4D3CL 5I8OH 4NAQA 3IGUA 1TJMA 4MJ6B 4LHUB 5EUOB 1OM3L 2UX7A 4J4PD 5BS0A 1IC7L 1B90A 2VTFA 2IMMA 1AJ7H 1KEML 3MZGB 4S0SD 1HSBA 1D6VL 3MA9H 2IPUK 3BH8A 1VESA 2IGTA 4N2HA 1Q94B 5T1LD 4BK5C 3NPZB 3HC2A 4LDLB 4HK3J 2Y7SA 3D0LA 1BZDA 1E42A 4DK6A 2ARJB 1XGYL 4FNSA 4CJ0A 4EI5B 4NO0D 4OU3A 4F2FA 1WT5C 4H88H 3FQUA 1Q9LB 4V11A 4NJ9H 1HDMB 3AY4A 5EBMB 3RRQA 2MCAA 2DKUA 5IW3A 5CJOL 1PW3A 3CCHB 3WTXA 1T7YA 5AEAA 5JPNA 2R69L 1WDAA 2DQIH 3FTUA 4ACTA 4UM8B 2IAMC 4IKKA 3AAZB 4F7CA 4ZS6D 3RPIB 3QEUB 2PW2A 5EG6C 2BNRB 4PWHA 2IMNA 2NXZC 4JN1L 1FLRH 1M7IA 1RLWA 3U1SL 4X7TB 1INEH 3F84A 4HKJA 2VYRE 4GO8A 4X0NA 2DMHA 3ZYOA 2H2PD 5D6DC 1FGVL 1XSIA 5I82A 3OJDA 3CLEL 1I9RH 5KUKA 5T1JA 5JR1L 5TE6H 4M9OA 4MA8L 4HETA 1MNUH 2W1NA 3RNQA 4PW3A 1TMCB 3OKYA 4OZGF 1DR9A 5CUSH 3HG3A 3SKNA 3VXRB 3CFBA 1TQSA 4O5LH 3WKYA 4JJOA 5DTFA 5L8LB 2DWDA 3B7RL 1JF1B 1NCBH 3RY4A 2XETA 4XC3L 5D7EA 2DPKA 3MLPA 1CDGA 4HCFA 4LL4A 4NQXA 5EOCJ 3SIKA 2W81C 4DEPB 2ZOWA 1N19A 1QR1B 4PBDA 1DBKH 3NIFF 3BGMB 3W9EB 5D8JH 2X70A 3C5SB 4PJIA 1VRSA 2UZXB 3NJIA 4XB3A 4AKOA 1L9RA 4OIFA 4J4PC 1I7TB 3ME0B 3O8XD 2VB5A 1KT2B 1DEEA 3FQWA 4G71B 5I6PA 5GZNC 2GJZB 5I1EH 3RWIA 1JZDC 3DIDA 4QRQB 3VA6A 3S96B 3FQNB 3PGDA 1GRWA 1W8EA 4NENA 4J5VA 4MWFA 3HBQA 3TN0C 4X5LA 2D3NA 3AROA 4KAQH 3DO7A 4RMRA 5I8EA 1BAWA 4DK5A 1CFSA 3AG2B 5C0CB 4C83B 3RDJA 3GJFH 4CKVX 4WUKL 1B2WL 3E9UA 3JTSB 3ZY7A 1GCYA 2HSIA 5GS1B 1AD0A 1GH7A 1NAKH 3IF1B 4N6RB 3MRFA 3A4EA 5BO1H 5I5RA 3OAUL 4N8CH 5GRXG 3ELQA 3MRBB 5K9KA 3ABGA 3C6LA 3WFZA 1CD1A 5IESH 1NCIA 4YSDA 3QUMH 2OMUB 3UBXG 2NQDA 4NQCB 1MFEH 2MEJB 4PJ5A 2TAAA 4KMTL 4PB9H 3WL9B 1WS7A 5JMRA 5CGMA 5EEZA 4NZJA 3TVMA 5KS9F 3KHQA 4HYTB 1TJGL 2CO3A 3LYRA 4J3OG 4G5ZH 4LP8A 3MTXA 4YOKA 2WBWB 5FIEA 4AZ8B 5KVDE 4PCTA 1SEQH 3FH7A 3DX6B 1NUFA 4KKZA 4NHUB 3G5VB 3GHBH 4OZHB 3BEVB 4NO5A 3SPVB 2LLGA 4KI5E 5DVNA 1MDAA 4XBEL 5AVYB 4CVUA 2YUXA 3RHWK 3EYVB 1AFVH 1DBMH 2WIIB 1RJLB 1TJIH 3KWWB 1OT2A 2ZX5A 2ZNWA 3EIFA 3FBQA 4NKMB 1SYVA 4NNXA 3WE6A 2AEPH 5DHVA 4LMQE 1CL7I 5JORA 1KIQA 3APNA 4JPKH 1AC6A 1DJHA 3OZ9L 5HHPB 2XXMB 1CE1H 2CLZB 2KLRA 3MSPA 4GW4A 4A67A 3Q1EA 4ZMVA 4HWBL 1KG0B 5C0EB 4Z7UE 2Z64C 3PJLA 4Q6IA 1JNJA 2APFA 5I6XC 3SKJH 1A65A 5ID0A 1AQKL 4YDLC 2XICA 3ZKSD 1IGFL 4X8CA 2HPOA 2GYSA 3FHQA 1K6QL 3I9GH 4FZ8H 1M9WA 1X4ZA 3UGUA 2R0LL 4LVEA 4XNDA 2AVGA 4KUZH 1K72A 2FWLB 4HUUA 4LAQH 3K72A 1I8LC 1NMCC 4P3DA 1XR9B 2GFBA 2NY5L 4FJZA 1ROWA 3L4ZA 1WEJL 5CD5D 2EIKB 2YAPA 2XN1A 4HS8L 3JYCA 1IGYB 1L9SA 4D9LL 4ZW8A 1KB5H 3QJFB 5DRZA 3ROLB 2WUCL 2N7BA 3FHEA 1LEIA 1A25A 2E7CA 2VMEA 3HS0C 3W9DA 4QNPF 3BO8A 2E9JA 4DO6A 1NCDL 1WZKA 3UC0L 4X6FB 4RMQA 4L4TE 3PHOB 3U0WL 4IBTA 2O6PA 3CZGA 5A2BA 5FUOL 1HSBB 1HI6B 2ICCA 4L5FH 3W11C 1A1NB 4QO1B 4FQHB 4BWTA 1MRFL 3ZQ9A 5JOPE 5HYQB 4JY4B 1TKWB 2CNYA 4HEPG 3VFGL 4KRNA 4PJIB 4N0UB 3IFLH 5DUPL 3FQUB 4DKFH 4YWGH 4A7GA 4K8RH 5CD3A 2F5AH 3MRCA 1NANH 3FN9A 3ARDB 3FH8A 4DN4H 1UASA 4FXTA 3RWIB 3QDHA 4MQXD 3Q44A 2P48B 1IBGL 1RURH 3ARTA 4NLAA 3RDTB 2BRQA 4A2EA 1PZSA 2HRPL 4DPRA 3NOIA 3HZYB 4NN5B 2CHWA 4G6JH 3JWOH 3QUXC 3BKCH 5E6ID 3DGGA 1T0MB 3RWJB 1E5YA 1FORH 3HNTL 5I1DA 1HILB 1R1CA 2Y25A 4JHWL 1TJHL 5L7XH 5KYXB 1KN4L 4C4KO 3X1BA 5EU6B 2JKSA 3L3JA 5ITBL 1R34A 4CNIB 5ILTH 4PYHA 5C0CA 1NDGB 2WAQA 2WNWA 5LNGA 2IO5A 2JLPA 3QDME 3EYFA 3TEWA 3OJDB 4N28A 1NKGA 4HEMA 3LVEA 1DJYA 4LL9A 4AE1A 1NCCL 3QRBA 1AD9B 3BFQG 4K8RC 4X6DB 1KTLB 5FX3A 4ALAC 5HYEA 2BVOB 4FA8A 4IOFC 2QV2A 4ATTA 2EE0A 3DOIA 4PS4L 5DYFA 3ULVH 1JK9B 5T33H 4DP5X 1EAPA 1AVAA 4FXLA 1K9TA 1EANA 3A4FA 4FQ1L 4TUOB 1SQMA 4PHZA 5AZ2L 1EHXA 2AW2A 1CCZA 4ZTEA 1OARH 2FIKB 3DI2B 4ZMPA 1QTYT 3WXWL 2XJKA 2Q6WA 3BGMA 2V5YA 3V4PB 4AQAA 3OMZA 1E4KA 1HL5A 4YFLF 3IFPB 3MRDB 3T0EE 3QNFA 4HS6B 5IBLD 3IU3A 3GBLA 3K8MA 4JKNA 4RIRB 5IR1A 1WGOA 1KTKE 4K23H 4XO9A 2Q1EA 1YEGH 5FHBH 2PW1A 4FQJH 3RZCD 4EI0A 1U30A 2CGRL 3NCJH 3WFEH 3QORB 4JDZA 4OR1A 3NIDB 5DEFB 4U7MA 4KHTH 4TRPL 5FYKH 3P0VL 3HPLB 2E86A 4AG4H 4ZUVA 2CLZA 1XH2A 2H1PL 4XXDA 1BMGA 1F97A 3WFDL 1KGJA 5E6YA 3WJJA 1VEOA 1ORQA 4XP5L 4KKBD 1P53A 1XSJA 3WS3A 4F37K 4F9PA 5IVXB 2WIMA 4GQZA 5G5DA 2C3VB 4O02H 3I50L 3LZNA 1BCIA 3QUXB 5IVOA 1C8QA 5ECJE 5K69A 3EOAB 1KPUA 4H0GA 1VPOH 1IE5A 5F1IA 5HI3C 4NQDA 2R29L 1DLHA 4HC1A 5D96C 4A6YL 1YO4A 4U1HA 4WV1A 1TZIA 3GWJA 4YVNA 1MQ8A 1QLEH 4K3DL 3M45A 3QG7H 3S3DB 3BKCL 1SEQL 5EEWA 4L8SB 4N68A 5DK0A 1NAMH 3D7PA 3B4NA 5C2BL 1Q9WB 1A0QH 3L3HA 4N2MA 3P73B 2DKMA 4GEJA 4PTTA 5ILTL 5ITBH 1TMQA 4TLTA 2UXTA 1E27B 2XWJA 4FL4B 4FABL 5F3FA 3LCYA 2XY2A 1G9NC 2Y0SA 3VM7A 2X10A 3PWPB 1TQUA 3S5LG 2WINB 4LL1A 2Z91B 3VFPA 4AVJA 2WXQA 3CFCL 1AC0A 3IJHB 1GS8A 3BUIA 4JEGB 4U1KB 2X40A 5AYUH 3Q2NA 4F15B 1WVZA 3QZOA 2KT6A 3MLXH 1AQMA 4H88L 4KXZH 4NHCH 1I9IL 5ISZA 5EU7C 1VFAB 5IIEB 3B56A 2WUBH 1C12B 3AACA 4FC3E 6FABH 3ZIMA 5DR5L 4OI8A 5FO8A 3GXFA 3F00A 4FQQB 3RX5A 2R4RH 5AB1A 1EX0A 1Z6JT 5CZKA 4OZFA 3GS4A 4TSBL 4YZFF 4QRAA 2OL3L 1AQDB 4YLCA 1XXFC 2BP8A 3H56A 3ZTCC 15C8L 4G8AC 4G8IB 3JVGC 3LS5H 3P3SA 4FHJA 3T0XA 5DU7A 1FG9C 5K1VA 3QNYB 1YYMH 1TTUA 1I8MB 4QYAA 2NY7L 3CUPB 3L4VA 4ANKA 2K6WA 3C60A 4PYGA 3VFNA 4EI5C 5HPMA 1KFAL 2MSPA 3RWEA 2ZP8A 1S2EA 3DX2A 4MA1C 3Q01A 4ODVH 2NY6B 3O41B 1S7QB 3BSZL 3P0GB 2W8CA 5AVVB 3V8CA 4C47A 1G7QB 2EICA 1YEDA 1EFXB 3U46A 4WW1A 4QF1A 5DJYB 2PWHA 2PYFB 1NLBH 1EO8L 5I1JH 1EJOH 3WTYA 5I75B 3FYIB 3FKUS 3IWUA 2F53B 4WK2B 1T3FB 5BZDB 2VDRB 3II3A 1HH9A 1T21B 1PMYA 2VL4A 4KQ3H 4A6YH 1S9WB 4NERA 3SBRA 5J1SC 2Q3ZA 2VUOA 1NC2B 3V6BR 3BQUA 1YEFH 3KVDD 4B9IA 2HG5B 1ZSDA 2Y7QB 2BVYA 3LIUA 4KTEL 2NNAA 2BNRA 1A2YA 4OFIA 1C5CH 3MRCB 4GBXB 4ZFFA 1R33A 1A6PA 4ZZKA 2G9HB 4WWKD 2BCMA 2UUDH 3H85A 5AD0A 5IVZA 3QQNA 4PJBE 2E7LA 4F2MA 3QDGA 4NXSA 4P8QA 2HT3D 2BSCA 4LRIA 3SCMB 2PWDA 1J5OL 1P4UA 1PKQB 5SX4I 3CAFA 3QPQD 3RX9A 1OGAB 5D2LF 3JTTB 3C09C 3SDDA 4BQ6A 2Y2YA 3CX5K 3OF6D 4G8FB 2OJ1A 4P46A 1QTSA 1XXDC 3BLPX 4Y5XC 1KEGH 3MLSH 4DT2A 1ZOXA 4MA3A 2VISA 4JFDE 5ABAA 1XBRA 2PR9A 3AITA 3ZE2F 3QIWC 5FA4A 2ZUYA 4NQDE 1DQMH 1JMXA 1BQHB 4OQ1A 3T2PA 3ZK0A 4UNVA 1P0SE 2DQUL 3HI6H 4OUUA 5TF0A 2DM2A 2G3NA 5F3HB 2PABA 5F0MB 5E00A 5DYOB 3NP4A 3MJ8B 1KYAA 1JWSA 4AUUA 4KJQD 1R6VA 3JWNG 1SYSA 3UC2A 1AXIB 3ZDZE 1ZWIA 1H15A 1YYLL 4LOVA 4PWJA 4YHOH 1SRDA 1X7QB 1BQUA 1P7KA 3D33A 5LBVA 1V55B 4MDIA 1RUPL 1JHKH 4KH2A 4ZS7L 3SQBB 3LRLA 4DERA 1NIAA 4NLHA 3QEQB 5DS1A 5KSAC 4K7FB 5JPMB 4XB8A 4AIOA 3O6FA 3JZ7A 4XPTH 3GMNB 3JTSA 3KL0A 3S35L 2H0FA 4LCUA 4F7KA 4HT1L 2VO8A 4XVSL 4LPUA 4IIQC 2J8UF 3QO1B 2NY4C 3WFCL 1QABA 4NQVA 2WLMA 4X9BA 4FFYL 1DVFD 4WI0A 5LO7A 3KCPB 3O3EA 4PGCA 1MWAL 2OMZA 3QUZC 3O6LH 1BAGA 3EBAA 4IEFA 1UWGH 4XNZB 5IKCB 4LLDB 2WKGA 4Q14A 3AS3A 4KVCH 4AJYV 5DUML 1G6RL 3EJYD 1YZZA 4YBHA 1JNNH 1JGDB 2L3BA 3D39A 2VDNH 4PWGA 2BP5M 4K3DH 4PG2A 3LEYL 1LGVA 1QA9A 5I24A 5I19L 1CDJA 2BP3A 2G4EA 1SMOA 2X7LB 3JT2A 3AC0A 3PLYA 1JZ2A 1RPUA 3SCMC 4XMLL 3BEVA 2VSDA 4YHML 1OSPL 3H42H 4AMWA 2W0FB 3VD5A 4F7PB 1IE4A 3PFQA 5CZXC 1A4JA 3BAEL 3KG5A 1S7QA 3RVUC 2XIIA 4KNQA 1HSAA 3RKDD 3VMPA 1QBAA 4OGYH 5B38A 1XL4A 1OAYL 2Y1AA 4I0KA 5JHLH 3N6YA 1BZ7B 2YEZB 2WZ6A 4LBAA 1DBBH 4U49A 5IV2A 4FFYA 2QVKA 2EDMA 3OWRA 5C6WH 4JFWA 3S7GA 4Y1TA 4DO4A 5CEZL 2ZSVA 1GPOL 2Z8WC 1E0OB 3EW3B 2FWSA 1HCFX 2D0HA 4U6YB 4OLVH 4EDXB 3LXUX 3VE0A 3EGDB 3V8OA 3HG4A 2O5XH 1DQKA 2C4XA 1BOYA 4HK0A 2VLRE 1OTUD 3KL3A 4PUBL 1F90L 1WAPA 2X4PB 2F0CA 4HAGA 4G7SB 4ODSL 3S97C 4PJ7F 5I1HH 3MGOB 4E9SA 3QQ4A 4F8LA 1KELL 1UZGA 2R2HB 1FIEA 4FS0A 1KCVL 3WN6A 5D1QD 1LK3L 4BWUA 5J3HC 3M46A 4P23A 5L2KE 5ALBH 5J6HB 1I7RA 2JKRM 3QIBB 4TQEH 1F45A 5L2KD 2LOEA 1BZ9A 2VLKA 2AXHA 4KVNH 4JREB 3WIHH 4NQUA 5A1AA 2NZ1A 2YXMA 2ZWYA 1LO0L 3SDDB 2OBGA 4IRZA 3NN8A 2GK0A 1C5DA 1E4XH 2EVGA 4KDTC 1SOQA 4HUXB 5E5MB 2D7MA 1XGRA 1MCJA 1HL9A 3L8QA 2A2QT 1IAKA 3HUJA 5EPMB 4ZRGA 2FWOA 4NQQA 1M6OA 3FQRA 3HAEG 4GAGH 4KUCF 5MEPB 4X2UA 3BEWB 4R4FH 2MQ0A 1IBFA 3PAYA 3DX0A 4C4KT 1L3NA 2XXCB 5E8DL 25C8H 1IT9H 2BSSA 3GDCA 1W0WB 1X7TA 2CJUL 4Z7UA 4NC2B 2YRLA 3Q1SH 3SQOL 4C56E 4XBGB 3X1FA 3ULUD 2HVKA 1ZHLA 2WOBA 4GY4A 4LF3A 2FNBA 3NJXA 3T4YA 2ZP0T 2ZTBA 3MRQA 5EU6A 3QUMB 3QR1A 1B0GB 5MERA 1SUHA 2DF3A 5C07D 3MRPA 2OAAA 4LASL 3H4HA 2O5NA 4A1RA 1OANA 3I84A 4TVSa 1TCRB 4M7JL 5FF6A 2ICWI 3KPLA 5HDOA 4WEUD 1EXHA 2C1PB 4WNJA 5FO2A 1KTLA 2EXWC 3F83A 2DEYX 5E24E 1YRKA 4OLWL 4G9FE 5FOBB 5T3XE 2QL1A 3LPOA 3KPRE 4L9LB 3S3CB 3L08A 3SO3C 3LD8B 5CBEB 2V17H 1XMEB 5E51A 3K6NA 2GJPA 3Q3GA 4FMVA 5CO1A 4GAYB 4IRSB 5E2TL 1DQJA 5B1JC 4PUBH 2GIXA 4P2RB 1CZ8H 2NR6D 4R7NB 5GISH 2ADJB 2XPYA 3BVNA 3HMWH 1E5AA 2E8ZA 1RAMA 3QUZB 5IMKA 4ABWA 2X4SA 3CN4A 3IU3B 3QZMA 2ILLA 5I18L 1BX2B 1GOHA 3EFDL 2Q8AH 4TV3A 5F1KC 5IR1B 5DJ0B 5DRNB 3UBGA 1L0QA 1SMAA 5KVGE 2PWGA 3LQAL 4GQRA 5CS7A 3O4OC 4PSRA 3HI1A 4P46D 3L4TA 4Q9QH 1ZIAA 1F13A 1U6AH 3H9SE 3QORA 3V55A 4GLRI 5HHNA 1FORL 1HEHC 4OJDH 3HE6A 4EI5D 4GRMB 1MHPH 5MI0C 2ESVB 2C7FA 1M2OA 3T04D 2CNZA 4U1NB 4LPYA 3TBTB 5DD6A 1SDDA 1D9KC 3JT0A 3QAZC 1B9KA 4G9FA 1ORQB 5C0CD 2W5PA 5D7JC 4OCXH 2FO4B 5HYJD 2EYRA 5BQDA 5C0CE 5L4FA 4JFSA 4PJIF 1GC1H 4N25A 5M7QA 5D1QE 5LHDA 1UXLA 4IKLA 1OAQH 1TYEB 2ZXBA 2Y4SA 1RZIA 2Z7ZA 5HGHB 3EOBA 4L4VE 5GS1C 4ODWA 1F3DH 3D51A 4JDTL 4MQ7A 3VGDA 3MXVH 4L4VD 2FL5A 1I7UB 3GJEB 5FCUL 4A04A 1SGKA 1MN4A 4V1DB 4HIJB 1T2QH 2Q7YB 1IFGA 3RL2A 1YQVH 1D6VH 2GSGB 3V6FA 4KOBA 4GW5A 4KZ0A 4PJEB 1J1OL 1G0XA 4HKXB 2QPUA 4QOKE 1CR9L 3VRLF 2AABH 4I3RL 1YN6A 1DBJL 5IB2A 5BV7B 1JFQH 2IWFA 4UAOC 4XPAL 3N2JA 1U3HA 4RWYH 3T6WA 4DTGH 3NSFA 1NDMA 3QEQE 5CCHE 3PGFL 4K73A 4IU2B 3EBGA 3PDOA 1OP5K 2YAFA 4GT0A 5CINH 4HPYL 1WF5A 2FJUB 1KTRL 4WW2A 5DI8B 1EGJH 2FECI 5FXCH 2C7UA 4KO6A 4G1EB 1R3HB 2ZPKL 3KYKH 3PCYA 1J1XL 5DD1L 2H0PA 4ZQKB 5HJDA 3VXPB 2NX5B 3FT3A 3WJLC 2G9HA 3GXDA 4C59B 2A9MH 2EIMB 3O6ML 1IBYA 1RUKL 4POZC 4XZUA 5K93A 3UP1A 4B3EA 3PV6A 5EU3B 3UEQA 2NDGA 4JZOB 2EJ1A 3T4YB 2IH3B 4HUWA 1FSKC 4EKXA 1TO5A 1AO7D 5D96B 2ICES 2WBXA 3DV4A 2B1HH 4TUJB 2APXA 2A74C 1U21A 3OZ9H 4PIRF 3PUUA 3DGDA 1G7MB 3PXJA 3CFUA 1BVLA 2Z31A 3B9KA 2WVVB 5EZOL 1SBBA 2XIBA 3C6LB 3L5IA 4Y2DB 4PLKD 3APFA 3IJ9A 3ASWA 1G7JB 1GC1L 4DOHB 4F5CE 2NPLX 2Q7NA 3E38A 1SHMA 1QBLH 3GKWH 4JMXA 1UACH 1CE6B 4NJAH 3N0PB 3TVMB 1MJUL 2L4OA 1Q4NX 5LXGL 1C8PA 3NSXA 5DJZB 5DHDA 1ZHNB 4HK3N 1BD2B 3BUBA 3TJHC 3ARBD 3GJFB 4OQTA 1EWHA 2YKKA 3P9LB 3W9EA 4X8XA 1SVZA 3GKZA 1ZHKB 25C8L 2HT2D 1MF2H 1WA0X 2CAKA 2CO4A 3HVDA 3JWNH 4D7PA 1SOXA 3QWNA 5J13B 2F54A 3B6SB 4OZHA 1KT2A 4DW2H 5I5MA 5AB2A 2ZXGA 4KJPC 4OT1H 3IDYC 1MNNA 3JV0A 3M17B 3QXTA 2BOLA 1FVEB 4AYMC 5K59F 2O5ZH 5JHAA 4NDMB 4HJ0D 2CQVA 2DMGA 3CC5A 2E9WA 4Y4HC 2NW3A 5C8JA 3FTVA 3NABL 1HZHH 4LNRB 1O6VA 3L3DB 4J1UB 4I85A 3TBVA 2X4QB 4C4BA 2YXWA 4AMKL 5I8EB 1ACXA 2R29H 4QTHB 5DQ9A 4OH2A 3MDJA 1EO7A 4AC4A 1N70A 1T2JA 3IRZA 2R7EA 3BC9A 4FP8L 1CL7H 3VMOA 5CSBA 5I6MA 5KVEL 3PGDB 2ED6A 5E5UB 1CD0A 4WENB 5E1QA 3WLWC 4BZ1H 5IGXL 5K9KB 3ZT7A 3FK3A 4JFDA 3E9TA 4MNGE 1BQLL 1JGEB 4M93B 3P2DA 2X2YA 1UH3A 2DDQL 4TNGA 5CGYD 3AB0C 2DAVA 4FXKA 4XPBH 4GKNA 5KZCD 1MVFA 1D9KB 3QRGH 3DXAD 2W0FA 4LARH 5T5NG 2Y2WA 2QHRL 3U9PL 4OIIH 2OZNA 3GMRA 3L6FA 3V52L 5EZIH 1G7IA 3BUYA 4CDHA 2EDLA 3TA4D 4NGHL 2I9TA 3NZSA 5E70A 4JR9H 2EEFA 4HKXA 3CDGA 2G3XA 1HAUA 2NXYC 5DXWA 2XWRA 5IB4A 5KANI 2A6IB 4GRWB 4OAWB 4QRPB 4S1RL 3KVQA 1XSKA 3DTXB 4BK4A 2QVTA 5DGQA 2G60H 5IVXE 2X09A 3D08A 5IJDC 2X1PA 2JFCA 3TASA 3TBBA 3L5XL 3TBTA 1HEZA 3P9MA 3D69B 4XMPL 4M6ML 2VW4A 3JVGA 2WLZA 3BP6B 2X87A 4K3EH 2PO6B 1RK0B 2FJSA 3UYRL 2VZ3A 2YOAA 1RZ7L 3PV6B 4G7VH 1RK1A 3V6ZB 4J3WA 4OT1L 2Q86B 1MRDL 2YC1B 1INDL 3ILEA 5D1ZB 3A4AA 2I60H 5ALBL 5FKAA 2R1YA 4G80B 1J48A 4FG6C 4M8RA 3O81A 3U30B 4AOFA 4KJYB 1OOWA 4G9DA 1E2ZA 5FDYA 5JO5A 2OM5A 3LKRA 5F7EH 3L1EA 5JYMA 5E8PB 1SXNA 3MQIA 3FT9A 2ORBL 2NY1D 1FZMA 1GKOA 4H20L 5FFGA 5GGSB 3PU7A 2V9UA 3KPQB 3GMMB 1BFOB 4XMTA 3MRMA 4X6DF 4CU7A 3RYMA 2BZ7A 1F56A 4HKBA 1TNMA 1OAUH 3V9EA 5DEGA 4AT6B 4ZMZA 2AS5M 4JDEB 4NOBA 1BREA 5DRWB 4OD1H 4HOZA 2P43B 4RWHA 1NINA 1NMBL 2LU5A 1A6UH 2ZKHH 4F7CB 4ICXA 3MBEC 3WMQA 4EDWL 1X7SA 4FQ2H 1OOAA 1C7SA 1R3JA 3RZCB 2G4GA 4MNGB 2JB6A 3DXAA 2D7TH 3BGFC 1ASOA 3CFDA 5IWLC 3TP4A 4YHNB 1YEKH 4H8VA 3SDDC 1FNEB 4O58L 3NZHL 1FZKB 3SKOA 4JM2D 2DIBA 3GZKA 3TNNA 4H8PA 5C0NC 4GIPD 4B41A 2JJUA 4DEWA 2VDRH 3T0WA 3ARDA 3BISA 3O9WD 4WJ5A 4LEEA 1T5XB 5ID1B 5CJ5A 4A2HA 2OMTA 3V0EA 2C9QA 3V6OE 1M4KA 1M42A 5AOLA 1IAKB 2CHNA 4KWUA 1WZ1H 4LHUA 2Q8BL 3A6OA 1QW8A 3PPSA 3WNNA 2JKTM 5J06A 4Y5YA 3PWNA 2B1AL 5H35B 4F8NA 4X50A 3GTVA 5DA0B 1YVLA 1OW0C 1QBMH 1MLCB 2NZ9D 1MFUA 1Q94A 1JD9A 3B9EA 1MJJB 2H5UA 2NW2B 2VUKA 5DUJA 1Q9WA 1M1XB 3GSXA 3UYOD 5IVNA 2L04A 2P4AB 3EAKA 4UTAL 3KLHD 1ZT1A 1AY1L 3QWOA 1ZK5A 4XODA 5D72L 1G9MC 2XVGA 2X4UB 5FK9A 1HDMA 3QQXA 4UOQA 5MERB 1MFNA 3UOAB 5DJDA 3T2OA 4OI9A 4R7DA 12E8L 1KY7A 2HJFB 4D0CA 4JQVA 3POHA 1TYJA 4HAKA 4LQFH 2OL3A 5TPWH 1F1GA 3VFWB 3A47A 4Z76B 2ZUQB 4HZ1A 3RVXD 2CDEA 2OTUB 3TVMC 5MHSE 1I4FA 3E2HB 4M7LT 2GSMB 3OBAA 1UXSB 1A4CA 4NFCA 4KTDL 1SLUA 4BXSV 4X7CC 2Z31D 4N8UA 3ALPA 1HN1A 1Q1JH 1TVHB 2FHCA 3U83A 2RCSH 4HSQA 2W9LA 5E9AA 3IFNL 4OZ4A 5FYKD 2A6JA 3CXFA 3N91A 4JO1L 4X83A 2NZIA 4CGTA 4EDWH 4N8VG 2Z1KA 1CQYA 5JHMA 1B2WH 2IPTH 2YR3A 1FNAA 2BMKB 4K15A 1DVFB 3MROB 3GRWA 4ZW7A 1I9EA 3THML 3CE1A 2B9BA 4MMYB 4Q7DA 2WXJA 4Z7VB 3NFPB 1CS6A 1UWXH 1V54B 3TIDB 1OXYA 3C6EA 3FDWA 1MCNA 4WU7B 1UFGA 1WJ3A 4HIHB 4X9IA 2D31B 4PJGE 1M53A 2FT7A 1KSRA 5SX4H 1S3KH 3F8UB 1AHKA 2C9UA 3U6RB 4MRCA 2HKAA 4B3VA 4LASH 2GTZB 3Q7JA 4PJFF 4CSZA 5CJ8A 4ZNEA 7PAZA 4OZIA 2F7QA 1ZT7B 3MLWH 3MRJB 5F96L 3U0TB 4X80L 4HDIA 1OWWA 1QNZL 2G5UA 1I9RL 4IBSA 4TS6A 4KTYA 2XX1A 2RTTA 2OSWA 4JN2A 3WTWA 2EDRA 1CF8H 3TCXA 5KEZA 2E59A 4XCCH 4UZSA 4BE5A 1HEZB 3D0VB 4PS7A 3UADA 3ZTJG 2R1WA 1OB1B 3DV4B 2H8PA 1V7NL 3KJ6L 2QVMA 1V3JA 4KJWD 2H7WA 4P59H 4RFNC 3QEHB 5ICZA 4HHAA 3QDMD 3F7YB 5CHNA 1W91A 4AXWB 5BOZG 2DRUA 3IJEA 3C87A 3EJSA 4EI6A 3RBGA 4WFHD 5TDOB 2W91A 2EVHA 5FGCB 1GYUA 3ELAT 1VF5C 1BXUA 3P30H 5F9AC 5IBUG 2AQ2A 4Z0BL 1RHHA 5JUEL 1TPXC 4MCYB 4FQHA 1KBGH 4MAYA 43CAB 4TPRL 1HCYA 2A6KA 3BH4A 1TDQA 3MLTA 3O3DA 1JS4A 3IMTA 3OKLB 4ODTH 4BWWA 3SYOA 2WHVA 2PP9A 2YSSB 1H0DA 4UU9B 4IOSA 2FJGB 1LO0H 1Y07A 5INCB 3VGFA 1VZIA 2F74B 4I77L 4LLMA 5ANMA 4M8VA 1DFXA 1AI1H 5H2BA 5ACLA 2CRIA 1JVLA 1IGJB 5LNDA 4JFFE 3F58L 2WXMA 4YHIB 4WCYH 2FIRT 4BYHA 2AQ3A 4X4ZA 4AQEB 3S0PA 2VWEE 5FYJD 1NAMA 1TYRA 4NUJA 5IQLA 2NCMA 1L9NA 4OGZA 3K4DA 2BIOA 5CSZA 1U93B 3FFDB 3J8F7 1YHPA 5EORL 2X1QA 2VLRB 3U4EA 2IWGA 4XNXL 1YYLH 1FFTB 2VDNB 5JW3L 1ZSDB 1JI1A 3IDIA 2R2BB 5BRQA 1NQBA 2QKIC 5I76A 2JVUA 3QJXA 4XPAH 4K94H 3ARFD 4LO9A 4NO3B 4PFEA 4LSUL 3VI4F 1CR9H 4WKZA 1MREL 2MOQA 1CE6A 2EVFA 1XCQB 4IIQB 4LBEB 1CB4A 4PY8I 3T8XA 1UVQA 4CSPA 2Z6FA 4PRPB 2VISB 2GW5A 3VGBA 3DO7B 1MFVA 2WLIA 3G6JF 1S7SB 3ASNB 1INEL 1ASQA 3G9AB 2GG1A 2FYYA 4OUUB 4HQQL 3PY9A 1KGYE 4YWGL 4TNVK 4M6OL 1UG9A 3REWA 3H2PA 4XNUL 4IRSD 3WEMA 1MCDA 3LQMA 3KJ4B 1UQSB 5E99H 5C0RL 1JNNL 4NGHH 1UCBL 1XGQB 5EO9B 4X9FA 4UIMA 4GKOA 3US1A 2DM3A 3D4CA 5D5MF 3NSYA 4BELD 4JO3L 1FO0B 3ZXAC 1EZLA 1K5NB 5DJ2A 5DQJA 4Y9BA 3HMXA 5IUCA 4Q2ZA 1KEMH 1FHGA 4LOEA 5I2IB 2EZ0C 2HN7A 5E7BA 5L4IA 3ZDZF 4Y1AE 4GP4B 3P11L 4PJDE 3M8OH 5F7DA 4GRWH 5BJTB 5C9JB 2MCPH 3LKPB 3UTPE 3C08H 3WEXA 2XWTB 2W65A 3S36X 1ED3B 3FB6A 3QJSB 5D7LE 1CD9B 2HB0A 2GY5A 1EPFA 1IU1A 3HG1A 1DLHB 1ZLWH 2VZUA 1RZFL 3KS0J 1I3RA 1R24B 2R9HD 4MNHA 1WCBA 4GJTB 5F7WC 4NKMA 3WE6B 3QIUD 2ITCA 1W8NA 3KPPA 4S10A 5C0JB 4HMEA 1YLBB 1O0VA 5JHDA 1MXDA 4P4RB 1MW2A 3PV7A 4FZ8L 3ULUF 4F58H 4EF3A 4QR7A 3P73A 4PTTB 1I3GH 3F7YA 4JFZL 4Z9KB 3ZE0E 1CJYA 3FQXB 4J3VA 2F19L 2VMDA 3MRKA 2WW8A 5DZNA 1ML0A 5FDWB 4UQCA 5FEBA 4YFEA 2PXYB 3TNMA 3SE8H 2I9TB 3EFOB 3GFUA 3WUZA 4DVRH 3LNHA 4N85A 2AI0H 3VFPB 5AENA 3VQLA 4UBDC 1AXTL 1RULH 2GJJA 2XX0A 4X5QA 5I0DA 1G87A 2VXTL 2FR4B 5A16A 4KX9A 4O9HH 1IM9B 3HUJB 3DSNA 3QZWA 1X5XA 5JOEA 3BDXA 3I74A 1NL0L 4ZSOE 3M88A 4GUQA 1H0DB 1E28A 3D2UB 3QK0A 5J12C 4JM2B 2WBJC 2OR7A 4MXWL 5D7HA 1MHCA 4G11A 2UYLA 2FECL 2BNQA 3WY1A 3RGVB 2ZNXA 1IM3A 3HC0B 5AOMA 4AIZB 3CCHA 3RL1B 2ARJA 3VXUA 3ESUF 5LBSH 2OMYB 4XOAA 5C71A 1G6VK 3O45A 3LQZA 5EZOH 2XI9A 1ZANL 2EH8H 3QCTH 5HI4D 2AGJL 1E67A 1OB1A 5TQ0H 3K71B 3C60B 4IOIA 5F9WC 5FYLH 4ZUUB 2B9AA 2VE6B 2X6BA 4L23A 3W0WD 5FV1L 5FO9B 2K78A 4OCYH 1JPGB 3KD4A 4QDGA 4F8OA 4P5MA 4IMLB 1FBIH 1GSMA 3EBHA 1M7IB 5D93B 1EIBA 3MGOA 5AW8B 2G2RB 1IQDB 3DUHA 3CH8A 5AAWA 4JFXA 1NCHA 5IZ7A 3BZDA 2E7HA 3GB7B 3LKNA 2NY3D 4PJDF 2AV7B 3AADB 3UCRA 1RZFH 3K3QA 4P9MH 4FD0A 1QBML 5JIPA 3MLTB 3O3DB 4ECNA 5E1IA 3GIVA 3ALWA 3VFOA 4ALAH 2CKBL 4QHNB 5MEPA 4KZCA 1MSPA 3EXLA 2BY0A 5KTEH 2PP7A 4BQCA 4XZ4A 1QRNB 1HOCA 1OALA 3QXAA 1UKSA 4ZXBA 4DPBX 1HQRA 4AEHL 5C09B 2OL3H 3KS0H 1NMBH 2MCMA 4ZMYA 4LCCA 1LO3L 4L0ZA 3ULVD 4Y1AD 3WU1A 1MJ7L 4I2XE 2YQBA 2Z0BA 4AE0A 1N68A 2O6FA 2YWZA 3IMUA 1BQHG 4OJYA 4OFQA 4EXPX 4XP1L 2BSSB 4YBQC 5T3ZH 4AV4A 3O3UN 3UH8A 4BSWA 3BVXA 4B6ZA 4YPGB 3MV9D 4F5CA 3QDJD 2P46B 4F9LC 1DDTA 4APQA 4IGBA 2R1XA 3P9WB 5BQ7B 2UWEB 2RCSL 1URIA 4BFBD 3WFHA 2CXGA 1LVEA 5DJCA 1Q9KA 3IFNH 3WBDA 4H8WL 5AL0A 4G6AD 2KPNA 2WNXA 4L9LA 4O2EA 2ZAGA 5EHFA 4HWUA 1T0NB 2CCLA 4XAWH 2UY7A 4B9ZA 2JELL 1OGAE 3KPLB 2XDHA 3VDAA 1F4XL 1PY4A 4L8CB 2VDLB 3V0VA 3ZL4H 4EAEA 1YN7A 2Q2EB 1ZPLA 3GSXB 5KJRH 1LJMA 1Z5LA 3MLRH 4XBMA 1FFOB 5HD8C 4PWEA 4WU5B 1WP6A 4MDJB 2F9BT 4AUYA 1C5CL 3L4WA 3QWQB 4GW5B 3HC4H 4U2ZA 5C0AD 4GP5B 2CBTA 1QOKA 5ECGA 2X2HA 4YC2B 3JSSA 2CR6A 4B27A 3KGUA 1CICD 3UG4A 1JG9A 2WCSA 1MFBH 2BVQB 1HHIA 3N44F 4H25B 1KCBA 4PWKA 5JQ6L 5DVMA 1AR2A 3WNPA 3Q6GL 3QUZA 4UOZA 5IMKB 2IWKA 4PRPE 3BE1H 4MJIB 4LPWA 4PJCA 4AGOA 4K2UL 1KYDA 3KLHC 1RZ7H 1PY9A 4G7VL 1ZGLM 4G70B 4NCC2 4IK7A 3HC3L 3QCUL 4ORGA 3B34A 2AERT 3IDYB 2Q8BH 4EBQH 1IKOP 5GGSY 5I0WA 1K4CA 4L3CA 4BKLB 2EYRB 1RL1A 3GSOB 5H94B 3HR6A 2YQ3A 2CGRH 3NCJL 4TNEA 1QQDB 2CO6B 3OLIA 3VFRB 3L2LA 3P0YH 2W38A 5D2NC 3EH1A 3ZZLA 5DVLA 1WCBB 2R2EB 2UX6A 1FDLH 3NJKA 5F7YC 4NT6B 1OGSA 2G75A 1F3JA 5DJXA 3VFMB 5FB8B 4ZMQA 3GTTA 1N0LA 2AJYH 4Y19D 1NUNB 3WTTA 2E47A 1WZAA 4TSBH 3RWHA 5LAXB 1BAFL 1XEDA 4QHUA 2BSBA 5L9DL 3T2NH 2LVCA 5KSBA 3TBYB 4FFZL 4LIQH 3C2AL 4R8WL 2ITDA 3TNMB 4D9RE 3N9GH 2VSCA 4HFUH 1A6UL 2ZKHL 1MLBB 4HWNA 2F7OA 3L2NA 5CD5C 3DPDA 5E08H 1H15B 1SPDA 2ID5A 1SDYA 5CINL 1OM9A 5DRZB 1OCWL 5FECB 5IFAL 4JHZA 3SDCC 2A4EA 4A2DA 3EJYC 3FAWA 1ZHNA 4UOW1 2Y6SC 3QJHA 3QQDA 4OCNC 3E8UL 2X1OA 4MJ4A 3QUZD 3WD5H 1NEZA 3T0EA 4P23C 1IO4C 1IFHL 3FQTA 2N0KA 2IPKA 3L48A 2ZCKL 3GMNA 3OV6A 5DZJA 1YQ2A 4M6NL 5C7ZA 2ZAHA 5IOPA 5JORB 1PG7L 2JSFA 3FUKA 3QHFL 3O4LE 3U46B 3BUDA 1YEFL 4Y9EA 3ZHKA 1B4LA 1H5BA 3IGAB 4TKWA 1IBDA 4DVBA 1HNFA 2JNZA 1UD8A 4WFED 1G1KA 3L3DA 1HOEA 1WBZA 2ZCKH 3AUWB 1QFWL 3TBVB 3OQRA 2ICWJ 3WAKA 3LEXB 1Q8MA 2EIDA 4HWZA 5HYJA 1UA6L 1S5IH 4N0UE 4ZJ9A 4Z8FH 4MVBC 1J9TA 4RDQF 2EIBA 4PTUB 5I1HL 1J8SA 5HGAA 4NRZA 2P24B 1KJ2L 2GIYA 4HUUB 4M8QB 4OLZL 4IJ3C 4AQZA 1MW3A 3VX0A 2NSQA 3L1OL 3SGDH 3CGTA 1T83C 3O0LA 2FYYB 3V2AR 3LNFA 4GRLB 5KANG 5C0FB 4AKPA 1H8OA 1YYML 1T20A 4N0CC 2ZJSH 1A66A 1WH0A 2DYRB 2IBZX 3T2LA 3ZO9A 3ES6B 1TU2A 5EO1B 4NAMA 2YPLD 2ERJC 5HI3D 4XN4A 2W0LA 4HS3A 3WIHA 4B9GA 5KVEE 1R0AL 1J5HA 2BVEA 2NY7H 1P7QD 3H2WA 4BFKA 5E6IB 4LSPH 4L2YA 1UB5B 4NO0B 3FTGB 2I69A 5IB1A 3D48R 2H4EA 4AIEA 5LBGA 1MY7A 2XN9B 2XBTA 3K8KA 2Y06H 2M26A 4NM8L 1EUUA 1N5YL 1M71B 2NQ3A 2WO3B 3BN9D 3BT2H 4UM8A 4R4BB 3QSKB 1TR7A 1FPTH 1CURA 5C8JB 1T5KA 1AY1H 1E40A 2GCYA 3DUSB 5INDA 1CL7L 2P52A 1S46A 3BDBA 3OSVA 4LP4A 1QHQA 3PF2A 2BSTB 2BY1A 3B2PA 1BZ8A 3DIFB 3P9MB 3BT0A 1PX8A 2A3TA 4TSAL 4UUJB 2YD4A 3GNMH 3IKCB 5F7AA 4IDLA 4U1GB 3ZRCC 4KQ0A 3SKNB 3VXRA 1JDDA 5E1HB 1U3HD 2X4RA 4LLAA 4AYEC 2VRQA 5F0LB 5BOJA 1E8XA 1KZYA 1Z9OA 3MUHL 3VFSA 1TEYA 4TF4A 4FF9A 4TUUA 4W93A 1UA6H 3POCA 1DQLH 3S5YA 4Z8FL 3UYRH 2H0JA 3V0VB 1ND0A 3UJJH 4DESA 1XF1A 1XX9C 1FQ9C 3FT2A 8CGTA 2I9LA 2WLYA 3PAUA 3PL6B 5DWUL 1IC4H 2BERA 1UYWL 5JW3H 5L4JA 1E6OL 3ZKQD 5I1AA 4LESA 2ICEC 3SJVA 5ERWA 3ECVA 5JA8B 3ALXA 1QWUA 2I85A 2FUQA 1PZ3A 2Z8VC 2J1KA 1CYGA 1UJ3A 2HPTA 2E27L 5GIRB 3TEUA 5IWLA 3IGKA 3X12A 4FZEH 4HZLB 4PRDA 3EYSL 3T3MB 2XBZA 2EUWA 4G8GD 1CGVA 3EO1B 1NEZB 3GZQA 1O9VA 3H9HB 4IIZA 5DMKA 4KVNL 4FL4C 4OCXL 3GXUB 2DN7A 2C1PA 2ZYHA 1RMFL 3MNWA 4HQQH 4PJ8A 3HKZA 4U1SB 5KSUA 4BJLA 2CKBB 1J10A 4ONFH 1CXLA 3G08A 1I8MA 3MXWH 3IJYB 1HTYA 4NT6A 2I27N 3OX8B 3EADA 3QHTC 3U4KA 1N8ZA 3FO2A 2X0VA 4X5WB 1GJWA 1AHWB 3F6IA 2VITA 4G9DB 4U3SB 4GT7A 3WJLA 3N1MC 3EO0B 3QXDA 3SB3A 2DLTA 2O1AA 2J8UE 2VQ4A 4JFEB 4PW4A 2ZSWA 4AM0B 3CNKA 3SDAC 3QNYA 2MKLC 3IDGA 3GIVB 4G80A 4NUPA 4YXLH 1VLXA 3I9IA 3D6GA 2DLHA 3Q8CA 4JBSA 2GI0A 2YGVA 1NIEA 4MXVF 2EH7H 2IGLA 5I66A 3DDGA 1WITA 3NACH 3PGFH 3P4LA 1JFQL 1A02N 3OHXA 2P49B 1LO4L 4N9GB 1PKQE 4W9KC 4X8JB 1DQML 5GGSA 2XZZA 2WINA 1RJYB 3SDXF 2G2NA 3OXSA 2VMJA 2DB8A 2R0KH 4NM4H 3EO9L 1E5UI 4PJAA 1HH9B 1CYXA 1U58A 5D7LB 5B39A 1YY9C 5GS2H 3CFQA 3BSHA 3IFLL 3C8DA 1OT1A 1AKJA 4FYQA 4OCMC 4N2NA 2C9XA 1UM6H 4P04A 5GXBB 2YWYA 3NCFB 2DBLL 3LB6D 3SKOB 3GTNA 3FUEA 1P6WA 1OD7A 2BSRB 2UZXA 3FBKA 1RUPH 2OZ4A 3V7AE 2XN2A 4TTGA 2JI1A 4MYPA 1F02I 3QUXD 5E6IC 3UABA 2X42A 4OJFL 4WIQA 4R90H 3DO4A 1NBVL 3T4AC 1T7VA 3CDCA 3ERXA 5FYJE 3TV8A 3QYNA 3PG2A 5A7EA 5D2LE 3C6SB 2FEDC 3HAEA 5B1CA 3U4BL 1FFPA 4JCLA 2WVUA 3AXLB 4JKPH 5GGVY 4EQ2A 2CUMA 1F11B 3OAUH 5AVWB 4P2CG 1HHHB 3FONB 4JB9L 5C3TA 4X6FA 2KQNA 4HX1B 4KI5F 3UYPA 3TM6A 2HFGL 3NFNA 3PE9A 1WSST 3S3SA 3TIEB 2PCFB 3AREC 1DZBA 4JGUA 1S7VB 4ZW3A 3VAEA 4PVMA 3CVBA 3KYMB 1P5UB 3KLLA 3X3FH 3X11B 4H1LG 4UDUB 1WUNT 1YEDB 5GJSH 3O8XA 3O6MH 5CEYA 5E8OA 4L29A 2C1OB 1U91A 3K6SA 5DD3L 1FSKB 4M1DH 4OLUL 5H35A 1IGFH 2VIRA 2YK1L 1SY6A 1YUHA 4JFFB 4K5PA 3SKMB 3M07A 3D3VB 5I18H 1F6AA 4KUZL 2H9GA 3NRFA 4MD4B 3N5AA 2VLKE 3ISWA 3CVHL 2DJMA 1DBKL 1WBXA 5D7KE 1U36A 4HAFA 4OCYL 1R5IA 1ZT1B 1I4FB 1S3KL 4Z5RB 1QPXA 4L4TD 1HHGA 3DX9A 1U8LA 3AQDA 3L3JB 1CE1L 4WDIA 4U0QB 4A63A 3KLKA 3QZLA 4DPCX 3PDDA 4HWEL 4J2XA 3H9HA 4WI0B 4NN7B 3SPGA 2UZIL 4NNYB 1YQVL 3BH9B 2OXGB 5IQNA 4QNPE 4JGNA 1MJUH 4GSUA 5IB5B 1LHZA 4R4ND 3NGBB 4NNPL 4HPOL 2XZCL 3IKCA 4OZFH 1JGDA 2ESVA 1UM6L 3FSVA 2HMID 1N2RA 5BNXD 4W9HC 1WV7T 1TVHA 4H0IA 4JFYB 4RFEB 4CC0A 3SEPA 4LRNL 1KGCE 3TBSB 1EVUA 4E36A 4TVPL 4ZPVA 1XIWA 1URZA 4KV5E 4N8PA 4XVJL 1XIWD 1AZCA 1IVLA 1U8HA 2J1ZA 1JV5B 4J3OD 1TFPA 4IU3A 5J12B 1W15A 2QELA 3QUML 2GY7B 3TLRA 3OZLA 4J28A 3MRDA 2DJ4A 2KZWA 3M1CA 1EA9C 1A7PH 2EDOA 5I0VA 2B14A 1BMWA 1O7VA 4Q6IC 3F65A 3TF7C 4UOW0 5E2WL 2DWTA 1ZCRA 3G6AA 1ES0B 4XNZC 1OPOA 5F89B 1BVNT 2Z35B 4KK9C 1PQZB 2A77L 3CPLA 3OR6B 3OLEA 3WEOA 3CZSA 4FG0A 4FQ2L 5DK2B 5DJAB 3T3PB 2NY2B 4G6KH 3EJZD 2GITB 1H5BB 1DQQA 3TBWB 3PJSB 3KLQA 3EOTH 2YLHA 4HWBH 4OZFG 1ITCA 1EEQA 4ONFL 4X99A 4JFDB 5DZOA 5E2VL 1FFNB 4KROD 3VG0H 3MBXL 3MYZA 3P3RA 4FTVE 4JN2B 2YD8A 4NYLA 4K9EL 4Q4IA 4W70A 4XWGL 2D2CC 4APQC 4CW1B 3FB5B 3KCWA 3ZOAA 5KVFL 1MWAA 3WJMA 4JS7A 1BYOA 4GFTB 5IB2B 3SDXE 2OTWA 3JV4A 3R1GL 4Q0XL 4E9XA 3QA3A 2PYEE 5FKPA 4LBEA 4WWKC 4ODTL 4WWPA 4PCYA 4FCHA 5E5RB 4C56B 4R84A 4FMFA 5E4OA 4MCYA 1S7TB 1HILA 4JO5A 3WKNA 4QXTA 5GGTA 5T5FA 1VZGA 2JK5A 3RAJH 3CSFA 1M57B 1AIFB 1MHEB 4QHLA 4JQIA 2K0RA 1Z3RA 4MASA 5HHXL 4OZHE 4O02B 4AMXA 1JE6A 4GAFB 3IN2A 4J3SA 1QEWA 1BLNB 3GRBA 4FQXB 4WTXA 1U8IA 4M6MH 4R2GB 3MX0B 5E6SB 3UBXB 4U6VH 1KIPA 4AH2B 1BVNP 1QATA 1WFUA 4MB1A 4NO2B 4DQOL 1WWBX 4GBXD 1EHNA 3ILDA 4XXWC 1XGTB 1JNLH 1NCDH 1NAMB 3CHSA 1A4AA 3MLYH 4NQDD 5CCJA 3FTSA 1NANI 2FH8A 3F7RA 4FCAA 4GI6A 1U93A 1Z9SA 3INOA 1PG7X 4Y4KB 4F8TA 1QSED 5B1AB 3S4SA 3GBML 3CX2A 3GSQB 1ZY9A 3GUFA 4QAWA 2ZUUA 2VDPH 4MXWH 2GB2A 1GVIA 5FKAB 1BFTA 2CLRB 5KN5B 2E7MA 1G9NH 3VD4A 4P0DA 1XV8A 3A22A 4LLWB 2B16A 5EOQH 3C75A 1E5ZA 4NDMA 1CC3A 5AW4B 3RTQA 3SKJL 3S88L 1PTZA 1MFAH 4BKTC 4OLEA 4UT9H 5I8OL 1UM4H 1HT6A 1EH9A 5E2VH 4DSYA 2WXRA 3DJZA 1TVDA 1X9UA 4TSCL 3PL6D 1MCKA 4YIQB 4NO3A 1PFCA 4WJG3 5D93C 1QSFA 3SZKC 3WFBL 2NY4D 3CSGA 4P23D 1D7BA 1AQ8A 5K33A 3RVTC 4FI7A 1UZ8B 3NP3A 1CLCA 3VD1A 5G5DB 4YSEA 5C07B 4N2BA 6FABL 3HI1B 1ROCA 4OCRH 4WWID 5DUBB 4DETA 1R0AH 1TSRA 4HVBA 3VCLA 2PP8A 4IMKC 4WTZA 1WZMA 4HIIA 3P4MA 3MCG1 3QI9B 1SXCA 3V9CA 5I6OA 1UTDA 2V7NA 2ED8A 1AACA 1I7TA 3S8WA 4PJGF 3BN3B 2J4WH 2R0ZL 2VDOH 3CFNA 5INDB 1DCEA 3HMXL 15C8H 1LWJA 4JG0L 2XG4A 5AD0B 1I31A 2IOIA 2ZCLH 3QFDA 3AGVA 3D2UD 1YAIA 1DDHB 4F92B 1CXHA 1UT9A 3D05A 4UQIM 4E42B 2X89A 3VWJA 4MJID 4AENA 5EZLA 1HHGB 1NGWA 2QPDB 4UV4L 4YSQA 4RGMB 3MROA 1DLFL 2A9DA 2ORBH 1A9BB 5L8KB 1RZKH 1TIUA 3ARBB 4L4VB 5FR3A 1P69B 5GPRA 3DX7B 5AAPA 2WVTA 1F3RB 2ADFH 3TIDA 3ZKMD 4CC4A 4GB9A 3MLUL 5KSAB 3Q6FA 1V05A 3WY4A 5C0DB 4QY8A 2GSGA 2I60L 4N90D 1UADC 1NC2D 1XQ4A 2LW3A 5AW9B 4AX3A 5BVPL 2NX5E 3UTSD 1AJ7L 4KTEH 5GRYA 2B7DT 2XN9D 1WWCA 1FYTE 1J0KA 3OG4B 3A3YB 3WY3A 3NG5A 3ZUNC 5FYJL 5ACMA 2MQGA 1T4KB 2WP3O 3C8KB 4N8VB 2EH7L 2CIIB 1AGCB 1YNKL 2FE0A 3REVB 3ZN6A 5ICYB 4JFFD 3EFOA 2GTWB 1TQBC 3TA3B 4X5RA 2DQHH 1WHOA 2CJUH 3KL5A 2XZQH 1J88A 2HTLD 2PNDA 2VDRL 4ZFZA 1SBSL 1W6WA 5F96H 2DTML 1U58B 1A6WH 3L7EB 3RB7A 4C4UA 3HS9A 1FNLA 8PAZA 4IJTA 3SYCA 5EN2A 5C09A 1OAKH 4RDQG 5FHAH 2IQ9H 2BSRA 4DN3L 3C5JB 3VXNA 4D8PB 3VJ6A 1RFDL 3OPUA 1BBJA 3IKKA 5KS9E 2NUPA 2PTTA 3B1TA 1DP0A 2OJZH 2GKIA 4IKJA 2CIKB 1CN4A 1PG7W 2W94A 4L9DA 1T83A 5JW5A 3U1SH 1PYWA 1CYWA 1TG8A 3AXLA 3WSQH 1E9QA 5IW1A 2R4RL 3RY6C 1F11A 3MBWB 1NOLA 1ET5A 2P5PA 2WJ7A 1QFPA 4XNMB 2PETA 4JQIH 3OB0H 1HQ4A 4OM1H 2ENQA 2YRPA 1JRHL 1QW9A 3PXLA 2D31A 4Z0BH 5JUEH 3X11A 1BD2E 5EWIL 2QQNL 1YG9A 4HIJA 5EOCH 3UAEA 3UCQA 4H2CA 3QNXB 4YIQA 4YLQT 5IY5B 2YEZA 5IV2B 1G7PB 1EAPB 2WSKA 4JFXB 4PLKC 3P4NA 3T3MF 5IF0A 4HU8A 3AB0B 2ZOTA 1IRAY 1U8KB 4JHUA 2APVA 3UTQA 4WZ9A 1PSKL 3ZL4L 1GGTA 2NT0A 1BJMA 2E74C 3BP5B 4WK0B 3DK0A 3NZ8A 5DURB 1FLTX 4UT7H 1OSZB 3FCSA 1JJUA 2XSKA 3UTPD 1Y6NR 2FTAA 2ZWLT 2V3DA 2MWCA 2NXYD 2Z8RA 5DF0A 3HZYA 5FGBA 1NBZA 3V0WH 1X7QA 4YHMH 2QDWA 1CDUA 3VGAB 1OQXA 1L9PA 3WUWA 3INUL 2Y5TB 3FUIA 2CM6A 2YAHA 4MCMA 1FH2A 1Y18B 3SY0B 2W88A 4FE9A 2BIHA 3P1VA 4D9LH 4U4IA 1DO5A 2B20A 2YBGA 2I5YH 3K0YA 4TNWF 4CSSA 1ZD6A 3G6JA 4Z3IA 1N6UA 2LU4A 3LIZH 1CXKA 4GSDH 3WTSA 1AP2B 2D0GA 2XOTA 2SODB 4LSDA 2XN9E 5E7FA 3L45A 3O3AA 4NQEA 3RWFA 1L7IL 2BS9A 2DIAA 2OJZL 3UX9B 2F74A 2IH9A 3QZPA 1X44A 3QG6B 4OV6F 4TNVF 4P5TD 1JUFB 4AYFB 3K2UH 2VN6A 3GZOA 2YPKB 3T1WA 2PUQT 2ZE0A 3AMKA 2Q6WB 3LH8A 1S7UA 1FLRL 1IEAA 3IGLA 1PZCA 3K6FA 4XE0A 2O61A 4JPKL 4ODUB 1G7IB 3QJHB 2V7NB 2Q76A 3V4PL 4ZAKC 5AW3B 1J0JA 1K8IA 4KK8D 4Y8DC 3EDFA 2ZYRA 5FW7A 4BFJA 1A7QH 2VM9A 5DQDH 5CCKH 5EU4A 2X5PA 4OV5B 5CF3A 2XPGA 5I9QC 5CUSL 3RUGA 3TH4T 3U9UA 5JZ7D 3GBDA 5FWQA 1FVCA 1W9XA 4J8RB 3JWDL 4IM8A 4XXCA 4BEIA 1PZ5A 3RVTD 4Y1AB 4HC1H 5HGBA 4O2FA 4XAKE 2BHYA 2W95A 1MCWW 1EXUA 3ROOB 2GPZA 4BD4A 2D0FA 5DJ6B 2VXVL 1CICA 4DEPC 2R1YB 4EEEA 4BE6A 1RZKC 1DVYA 4KI1A 2V9TA 4P4KB 4W9IC 2AXJA 2R4SL 2XVKA 5DFWH 4YMPA 3VD2A 2YEVB 1U8MB 2ATKA 3GMPA 4PJ9C 2IANB 2M2DA 4QRSB 1FZJA 4TQEL 4JPVH 1MW1A 1J5OH 5C07E 1I1FA 1BD2D 3QULB 5GGRY 4EOWH 3CUPA 4GKNB 3GPSA 1T03H 2GJ6B 5K59E 4YO0B 1F5WA 1OT4A 2ZCHL 1SHXA 1RIVL 4DJMA 3NJGA 1LP9B 3BZEA 3L3KA 1XH1A 2WQSA 2ZAIA 4LHUG 3FCGA 1E50A 1KMGA 4Y5XB 5E9DD 1EJ6A 4P5KB 4Z7OB 5IW6B 4NBZB 2K6ZA 4L1BA 1Y7VA 3LEVL 1RY7B 4APQD 3LQZB 3SGEI 4GSDL 4LCWD 5IESL 2QLYA 3KPMA 5ID0B 2X6MA 2JI3A 3IDNA 1KWKA 3NACL 1Z0MA 2IQ9L 3E6FB 4RAUB 3SKUD 5EIQA 3V0DA 2VAJA 3FB6B 2DW5A 3N0AA 5DC4B 3RVWC 4X7DC 4WHYG 4MTMA 5FA3B 2C8NA 3T0EB 2IJ0C 2IQAB 2EDWA 4HALA 5L88H 1XF5B 5F88A 2Y07L 3MLWL 3SN6N 3H2QA 4XB7A 5IOPB 5EF3A 2EZ0D 2YARA 4GUPA 3QA3B 4FG2A 4FFTA 4UOJA 1GGUA 2QR0A 2CCVA 3ZRFC 2BP0B 4NRZB 4HUVB 3U36B 2V2WA 4URTB 2WXKA 3BAIA 1SJMA 3CPUA 3QS3A 1OGAD 4QJ4B 5JR1H 5EFIB 2QQKH 3O8XC 3BKYH 1NZRA 4HWZB 1KCVH 4LCWB 4BIKA 1U3HB 5DD0L 2QMKA 5FM8A 1UEYA 1XF3A 3NCXA 3SBWA 1RZGB 5C07A 1HCZA 4CJ1A 1CGSL 4KI5D 3OGCA 2A9NH 4NQEB 3RWFB 5LGHH 2YXVA 5FFLA 4NZUH 2I26N 2H41A 4MKTA 3DHMA 5EOTB 1MIML 5IMLA 4JZJB 5B1BB 3VRIB 3S98A 3A6BL 4GAYA 3HRZC 4NPYA 4Q56A 3R8QA 1JUFA 4TUKH 4YXHL 4I0PC 2ED9A 5FHBL 4AYFA 1L6ZA 1YEHL 2WMPB 2ZCHH 1JF6A 4GRLC 4UDTA 3S37L 5AW2B 1NC4D 1T03L 2FJFA 2ZX8A 3LDBC 4AIXA 5A6IA 4FMKA 3DWTA 3QEQD 4U3XA 4OM0L 2A6DB 3M1BA 1K8IB 1BZOA 1CTMA 4KKLC 3HVNA 1D5MB 2J3SA 2K3TA 4J27A 3KGSA 1XGQA 1FNEA 3TJEL 4J3OC 4HULB 3H6AA 4LE8A 2RFXB 4ES8A 5GS0L 2WVVA 1G5AA 4IMLA 2YGQA 5DSCB 1P4BH 4Y2DD 3WHXB 5DDHB 1QRKA 4PJ7B 1NBYA 4N1EA 5GRJH 3U2IA 1PBYA 3OMAB 2AC0A 2F1BA 3SPCA 4K07A 2VKXA 3WKML 4OFPA 3HN3A 1P1ZA 5T1KA 3CBKB 1NPNA 3CZKA 1CBVH 4J8QA 4R4NC 4PRBA 4H20H 4P3CL 4WY7L 1NCTA 4JFEA 4OKDA 4QMEA 4LRIC 4XH2A 3EYVA 3QG6A 1J05A 4Y4HB 1FL6B 4RQQB 2WVSA 5GISL 2GJ6A 5TK2A 3ILPB 4NSKB 3CV5A 4NP9A 1W16A 3UTTB 2E4TA 4OF5A 4OZIB 1DE4A 4M3JA 3LRHA 3TESA 3BRDA 3JTBA 5CIPH 3ZTDC 2HLAB 3ARFB 4JKMA 4BKLA 1P5UC 3ZSTA 3JV5A 5C0AB 1GGCH 5GS0C 2MHAB 1YMMB 2PO6D 2HJFA 4XBEH 5CU5A 3WEAA 5HD8D 3QUKA 1IZKA 4TULL 3ZE1B 5F1OB 5IBTL 1I9IH 4FFVD 4I0PB 3D0VA 2E6QA 4PB0H 1W72L 3AMLA 1SNRA 4MSWB 5HDBE 1DHKA 5GGUB 3L5XH 1KY6A 3OLDA 3NJMA 4XOEA 4J8RA 5C92A 2MPVA 4RLDA 3VFUB 4I1NB 1A9EB 3D5OF 3MNMA 1GS6X 4M6AA 3KPSD 5IW1B 2C7UB 5CLWA 4ZK8A 1T0NA 1ZANH 2EH8L 4QY8B 5T3XL 3J07A 3GDBA 1AZVA 6PCYA 3V7MA 1KJ2H 3ZUCA 3L3IA 1OAXL 3WO4B 2EQDA 1RUQH 5KYWA 2X9XA 5FYLL 1DYZA 3RDTA 1MCBA 1S78D 1VKXA 1QLRB 4U3SA 1FGNH 4KXAA 1I85C 1T4KA 3C8KA 1RIHL 2H6OA 2JV6A 1AE6H 1HHHA 2CIIA 35C8H 1BECA 3UAJD 1E6JH 3W5NA 2HUHA 4MNQB 3OX8A 1GHFH 1LDPL 3VD0A 4ZUUA 3DJSA 3LN5B 2XRAH 3HG1E 4DGYL 4MRBA 3U0PB 3UGEA 4PJFA 1KENH 3MGTB 4RISL 5EDSA 1QUPA 5EC2A 2AITA 2ZONA 3ETSA 5B8CA 2ADIB 4ZD3L 3PUCA 1VFAA 2GVYA 3HLAA 1CLYH 3S9DB 1L6XA 2P80A 2NYYD 3DJ9A 4JRXA 4E9YA 3P69A 1KUMA 5HYSA 4D8PA 5DHYB 1AANA 3D3VA 2HRHA 3TYFA 3B7UX 4F93B 4P3CH 4WY7H 4OCSH 1EERB 1FN4A 4PRAB 3K4AA 1G9EA 1PKOA 3VI3E 4ZFOL 1OSYA 4H13C 4GXVH 4RNRB 2O6EA 4TQIA 2WLNA 3ZU8A 3ATFA 2YK1H 3C2AH 4R8WH 1J0ZA 1N0XL 4B53A 5JOFA 1A0QL 1U8NA 3LN4A 3I6LE 1JYVA 3MRPB 4AKQA 4PLJC 2GT9B 3D2TA 1UATA 4RSVA 3FRPG 4ZO9A 4HGKC 1IGML 4HV8A 2AFNA 1AQHA 5IB5A 3G9VA 1IARB 4JR9L 4ELMF 4LKXA 4XWOD 5KBPA 3M8OL 3RPKA 1LK2A 3KXFD 1WA1X 3VI4A 2YMOA 3CVIL 3QNXA 4CC4C 2X6UA 3LV3A 4NRYB 3H42L 5FOBA 2PF6A 5D71L 4IQHA 4PIBA 1BFOA 3SE4A 3AQXA 3CC1A 1OAKL 4H8QA 2FK9A 2WAHA 5T3XH 4BZ2A 4TN9A 1KF9B 5ANHA 4YHLL 1AYOA 2HJLB 2YA2A 3DX4A 5HDQH 4ZT1A 5I5IA 4I18C 2OLDA 5JNYB 3VACA 4ENZA 4FI8A 5I1KH 4TSCH 3HS8A 3QDMA 4LSRH 2VIRB 1TQVA 3GXIA 4NJ9L 3F5WA 2Z7YA 4YNYB 5BPPA 2JB5H 3NCBB 3AZUA 5E56A 4UDUA 2AMGA 2AABL 4I3RH 2YAQA 4KQ4L 3FQNA 4RA3A 4L3AA 1AYRA 5FO7A 2GSIA 2VSKB 3B1UA 1ICTA 2ADFL 3WY2A 2OPCA 1QYGH 3FQ4A 1FAIL 3V4VA 5J1AB 4GLRH 4L3FA 4M7ZC 3BESR 5KYUA 3S35H 3V5DB 1XB8A 1ZA3B 4PG9A 2BOCA 3MNVA 4WHTB 3VFGH 5C70A 2JJTA 2YIHA 4HJUA 2HH0H 3CLFL 4Q6IB 2H6PA 4F91B 1YEWA 3IF1A 3B9DA 5KYNA 3L9RA 5KOMC 3B2VL 1NPUA 2AK1L 2GJ6D 3DTXA 2XWTA 4PGJA 1TLKA 1EV2E 4KK9D 1I53A 4LHQB 2ATKB 4XC1L 3VH8G 3VO0A 2I9LB 4N0YL 1H3PH 1AMYA 1I3RB 1R24A 1U8PA 2XJLA 3AT0A 3COOA 4FLRA 4JE0A 4MNHB 4XPHL 5F3HA 3KR3L 2Q87A 3RY6A 1UVQB 5AVTB 1XIWB 3W2DH 3MRFB 1T2XA 5JHDD 5KG9B 2MNUA 3VI4E 1N18A 3ZO0A 2DD8H 5HDWA 3QIUA 3UERA 4JZNA 2O93L 2YRZA 1OP5H 5KYYA 2YLKA 1LP9A 3B2XA 2CHXA 4DGVL 3BZEB 5HHMD 4XXWA 1CPUA 5C2UB 4JQXC 3HG1D 3IWVA 1IFRA 1QHOA 3SQBA 1EDQA 1ILSA 3NGBC 4B0MB 1EBPA 2JK5B 1JWUB 1BBDL 2H3NB 1VHPA 4IS6B 3TS8A 3HTLX 1RU9L 1IJ9A 4CN1A 3HS0B 1KXTA 1GPOH 4NWTL 3N44B 3RILA 2X44D 1A1MB 2AXFB 2X3CA 2I7SA 2NY2D 4XX1E 3F85A 2F08A 1UD4A 2JTYA 4MD0B 5HYQA 2WWKO 5IOKA 4ALAL 4RGNE 4G82A 1OKEA 3EYSH 4WUUA 2A9AA 3G04A 1WZLA 3PJSA 3S4SG 4TNFA 1ZLSH 2WXLA 3BFWA 4PJCE 5C9JA 2OK0H 3GZPA 3MUZ1 3QQDB 4P59L 1DQIA 4MS8D 4HJGB 4OLWH 3WGVB 2BMKA 3B9AA 2CCWA 1KG0A 4LXFA 5C0EA 5CCGE 1QFWI 3ARDC 2X1XR 1KULA 2EUXA 5GJTL 2VXSH 2DWYA 2UWEF 4HIPA 1RZQA 1JGLH 3GINA 4JRFA 4R5XA 5KS9A 4ORZC 4Y7MA 2XFXA 2AJSL 2F1EA 1WBZB 4N4YB 1KFAH 3HZMB 3MBEA 2HKHH 4H5SB 3X3GL 4QLRA 5C6TL 3FU5A 3SO5A 3MLUH 2C3GA 4OD3H 5ENWA 4B9CA 1URLA 3UG5A 4L8DB 3B5TA 4AGPA 1KB5A 2VDMB 5IK3A 3V0HA 3W57A 1BFVL 1EAOA 2MQCA 4LU5L 1UJ3B 3S5LA 5JYLA 3R0MA 4PV8B 5DJZA 2QPFA 4L37B 3ARDD 1JK8A 4Q8BA 5I6LA 3ZDXE 2WLKA 4X6BA 2VRKA 2VJXA 4UMGA 4YLBA 5H37H 4J23A 4X9YA 3G6DL 5F9OL 1R3HA 3VXPA 3B8SA 4XMXA 1XF5A 5F88B 3ML9A 5E00B 2BIIA 2D4FA 1PLGH 4HKJB 4E68A 3LH2L 5JDSA 3VQMA 4H8WC 5JQHC 3MUGB 3H3KA 3EBIA 3KLAA 4EOWL 5LDSA 5B8CC 4W9EC 1BBDH 2R0WH 3SQRA 3N43B 4JPVL 5EH1A 1PFOA 4TQPA 3TPKA 4HUWB 1TQCC 1ZTXE 5HVFB 3UYPB 1OW0A 4X6EB 5TDOA 1CFTA 2IANE 4ZTPH 1NTDA 1Q72H 2HX8A 3QPXH 1KB9J 1VADB 2HVJB 3L9RB 2HYMA 1BV8A 4LLUA 3MRNA 3DVNA 4NBXB 2ZSWB 2WCPA 1F4WL 1X5GA 4BFIB 3LOWA 1ORSA 1V8HA 4L29B 2D4DA 3V9FA 1COBA 4G7YL 4EZJA 2C9PA 3CU7A 5HHVH 3X3FL 1WRFA 5DMIL 1XTMA 3KM2A 2YFNA 3FOLB 2XUWA 3VMNA 4WTZG 4H25A 2QGDA 1XL6A 1G9HA 1H9VA 3QPQC 1HNYA 1QSEA 1E27A 2XWJB 1PLCA 5KBKA 3VXSE 2DMCA 1A8ZA 1JZ6A 3MLZL 4ZW6A 2WBKA 3B2MA 4N6QA 2BDNL 4BSJA 1NGYB 3OHMB 5GZND 4Z1PA 1ZT4B 4PEEA 1RQ5A 2IAAC 5BRZD 3L16A 3LXAA 2X3BA 2AXGA 3HB3C 3V5DA 5LKNA 2X4QA 3WO3B 2OXHB 2ED7A 2XVBA 2VQTA 2Y22A 4B0MM 1NH6A 3QXWA 1HINL 4JDZB 5DEFA 5EU5B 4E5XA 1D5BB 1L7TH 3D30A 2UWEA 4P5TA 1I3UA 1XZ0A 2BO0A 5AYQA 5EIIG 1YPZF 4XCFH 3UFIA 2OMWA 3O4OB 4EQ3A 5KSAD 1TQCB 1RP9A 5B3NA 3TIEA 4FQ1H 4XH2B 5ISZD 4MNQA 1GGIL 4LSVH 1DL7L 4JG9A 1GC1C 4OD2B 1F1DA 2C3VA 4WI9A 3Q9PA 5FGCE 5K9OB 5MP6L 1AXSB 3RVXC 1WISA 4F7MA 4XAKD 1LE9A 4XMLH 5H37G 4L8BA 5F1IB 1N26A 2V8LA 3MLSL 5IP4A 3MGTA 2AK4B 2NYZA 4BDVA 3MFFB 3QAZB 3CFEB 5E1AB 2XZQL 5AL8A 1F6FB 1KJ3L 1EGJL 4HH8A 3TA3A 5DO2C 5BCAA 1N8ZB 3FO2B 4UYQA 4UT6L 4N26A 1P4BL 5BZDA 2BY3A 4I4WB 3GI8L 2CH8A 3Q8FA 4IOSD 1H3TA 3ARVA 3T3PF 1PGRB 1NBCA 1TTBA 1CFMA 2FWOB 4GKSB 4HA1A 1CI5A 3C8HA 1HXMB 3L7FA 1EEUA 2OK0L 3BKMH 2OXGA 3FCSB 2KZBA 3BH8B 1PCXA 5F6HI 3UJIH 3O2WH 2XHNA 1TTGA 2D9CA 3ZDZB 2EDEA 4GMTH 2VRAA 1B6UA 1INQA 1BIIB 2QGEA 2H45A 4BKSC 1S5HA 3BVUA 3NAAH 4PMFA 5A40E 1KXHA 4PJAB 2NNCA 4LHUD 3VXOA 1HZKA 2FEEL 3V79C 2DY2A 3HHMA 2OZ4L 4UMSA 2F2HA 2VXQH 3KLSA 4RMTA 3QO0B 5IMMB 4YHYC 3E7JA 3FZUC 1ZIBA 1VADA 1F3DJ 3ZHDA 3BX7C 4JKKA 3IDMA 4WAFA 5KSBB 4XVTH 4BRJA 3HG5A 1E9PB 2P5WA 2QZQA 4V1DD 1X5KA 5DHXB 1L7TL 3PDGA 1N64H 4JM2A 3KM1A 3MRMB 3K8LA 1CDIA 4N2IA 2H32H 2K9UA 4G3YH 4PPTA 5CZRA 2BS8A 4MD5B 4I88A 2OX5B 1PEZA 1ULVA 4ETQB 3L3GB 5IJKA 4MAUH 2DYPB 1AO7A 4OQTH 5A7BA 4JPWL 4R7NA 3EHBB 2WOYA 4UCFA 2I07A 4PV9B 5EIIB 4J3UA 5EEXA 2ZPKH 3KYKL 3MKKA 5KVFH 4EBQL 3L95B 1UT1A 1AGFB 2ZX9A 4NZRH 4Z23A 1B0IA 3RFRA 1PNCA 1U8KA 1EO5A 1RUMH 4WCYL 3KLAB 4M4RB 5DLLA 4X6CA 4XMWA 2OULB 1GYWA 4BCXA 5MENA 4X6DA 2WQVA 3EF7A 4Y2DA 1UCTA 1NJ9A 4BFRA 4QHPA 3LQAC 4GW4B 1X5AA 1JK9A 3ZL1A 1KB3A 4JGMA 3EFFB 3MV8D 1X5LA 2AK4E 4GXFA 1II4E 3DIFA 4WEBL 3RZWA 2ZKWA 4OJFH 3BN9C 2Y07H 5EO0A 2GHZA 4QUOA 1HESA 2NXZB 2P24A 4WI4A 4F1ZA 4R2GC 1MZZA 4HF5H 3T08A 2G0LA 2CUIA 2YGNA 3CLEH 3T77A 3DV6B 3UROR 4PJXE 1E3ZA 3Q48A 3RUGF 2EE2A 3HG1B 3SGKC 3W0WE 2WYTA 1QEWB 4XP9L 1E90A 4F37F 4QWWC 5DJ8A 1JZ7A 1BG9A 1I85A 2F7IA 4G6JL 4Y16C 3RA7H 4JKPL 4L4JA 3U82B 3IN0A 4ZXBB 3CFCH 1ETZB 1IAII 1JZJA 3NSDA 2ODHA 4S1RH 1SXZA 1AGEA 1DQTA 1L9QA 5C0BA 4P5KA 5IW6A 5HJ3A 1B2YA 4X4MA 1UJTA 1RI8A 3E0GA 3EZ8A 4KDVA 2OMNA 3K2MC 5FUZH 3KPMB 1WAAE 2R7EB 5B1KA 4KX7A 4R4BA 4XVUC 2ETWA 1IM9A 1RZJH 1TEFA 3IMSA 4BUQA 1UACL 1QP1A 2P45B 3D9AH 4B5ZA 2PPAA 1DBAH 3VE0B 4TYUA 2B4CH 3UC0H 3HE6D 5CJXC 1OE1A 2P28B 2NY3B 4N86A 3LZLA 1Q0EA 3QVAA 3S5ZA 1TF4A 1MWOA 1FJ1B 2N3JA 3B5GA 3DYOA 5EULV 3PWPD 1BG1A 4JHAH 5HHPA 1EFXD 3L2MA 1HVXA 2QR0B 1AS8A 2PXYD 1INQB 2OR9L 4RX4D 2ADGB 4GH7B 3DO3A 2X38A 3PABB 1ZXQA 3TBWA 3F3HA 4KO5A 1UZ8A 1TETH 4KQ4H 1EZVX 1H3UA 4PY7B 4MNQD 1NAML 2BRRL 3RTQD 3X3GH 1R47A 4AYGA 4HUXA 4KKRA 4KZDH 3X2QB 3AXHA 5FYJH 3A0OA 4YFLI 4LVOB 1S78C 1XEUA 5GRJL 3FB5A 1NUGA 1AOHA 1OE3A 4OZHF 1J1OH 2L7EA 4CRPA 1AOZA 2A99A 4O02L 1QSVA 3GMOB 4K8RD 1OP4A 4PVLA 4I9WD 2IALB 3EJCA 2DIJA 3IDNB 5IFHH 4G8GA 2JH2A 5JDSB 5HGDA 4EDXA 4HLEA 2XV0A 4CMMB 4PJ9B 4A2FA 3BO8B 2HJKB 2VDKL 2UXGA 1NGZB 2NQCA 2J8OA 1U8IB 3O6LL 3CFKA 3ARBA 4JJ5A 4PY8J 4Z6AT 4AY0A 3HPJA 1HL4A 3BGAA 4HGWB 3E6FA 3MMEB 4ZO8A 5BUAA 3N1GC 2WLHA 3F01A 1XGTA 2JJTC 2F53D 5ICZB 3BZFB 5HHOB 2V2WB 3AABA 1G7HB 1A3RL 1Q0YH 1S9YB 2R15A 4JHWH 3VXUD 2XG5A 5L7XL 3CQQA 3FUMA 3GHEL 1MCFA 3I2CH 3MBEB 2TSBA 1VFBB 4B7IA 3KPNA 1LMIA 1PIFA 1MLBA 1IC7H 4XP4L 1L5GB 3BPNC 1CGSH 2DWDB 4A2MA 4UTBL 4XCYB 4YH6A 4K5NA 4LDCA 3S8FB 2QLVB 5AWNH 4OF6A 4NUQA 5EWIH 4PWFA 4YSOA 3V6OC 3A23A 1RJZB 1KB5L 2PPDA 5JIDA 1WWWX 4F58L 4KKCC 4PJIE 4Y19E 5I16B 2Y7MA 1YYCA 4Z3EA 1MVYA 1E8WA 2W9EL 1JF1A 1G94A 5ANMB 5D1QA 3RPBA 4M3KB 1A7RH 1K8DA 2VABA 3CZUB 1YEJL 5BV7C 4NC0B 4O5LL 2ITEA 4WFGE 2YD2A 5FUOH 1NGQL 3O8XB 2HXAA 2AEOA 1KXVA 3PYCA 3UMNA 1H8LA 2CD0A 2JWYA 5HVGB 5FGSA 1A6VL 3HZ3A 2AJYL 4K7PL 5JXED 1J5CA 1AGEB 1T89C 1T4WA 5IFJB 1V7MH 4JM2F 3V0GA 3QEGL 1BAFH 1XB6A 2WB7A 4FQJL 5ID1A 4ZDHA 2NY0C 5BVPH 2V3FA 4G8EB 2F58L 1TCMA 3AAZA 3B2UD 4N2CA 5AZUA 5MI0B 4A7UA 2PW2B 2E76C 5HYIA 4JFQB 5ESVA 3DVNB 3BCFA 2HTKD 1JV2B 4ZUWA 1DJWA 1JPTH 4M02A 2VN7A 5LBSL 4OJCA 1C12A 2ERJB 4KKAD 4O51B 2XWEA 3BP7B 3TX4A 3Q8AA 1PDKB 4MMZB 2I25N 4MDRA 3Q3GB 3LEYH 5AYUL 4X5XA 4ENEC 3ETTA 3H0TB 1SJVA 4IRZL 2VH5L 2OSYA 2VR4A 2HLFC 1B0RA 3GJEA 1JPTL 1S7SA 4F7EB 1IC1A 2NMSA 3BAKA 5CZVH 3RLSA 4JO2L 3V0FA 4ODUA 1CGUA 1PG7H 3KPRB 5C7XH 3RL2B 5FYJU 3N41B 1UYWH 3B2UC 1HZLA 2A9CA 4BUHA 4IRSA 1AKPA 4B9YA 3OM3B 1CG9A 3FFCA 3GMLB 1VB9A 3KPTA 3MKGA 4Y7OC 1MCIA 1I8KB 5F89A 4B95C 4O00A 4G1MA 4QHUB 2Q9OA 2MRYA 4I9WE 3HE6B 3WJJC 1W0VB 4ZOCA 1SY6L 3GM0A 2VR7A 2YA0A 3QPXL 4XMKL 1GJUA 4Q58C 4RQQA 3C5XA 4NXKA 3QJZA 2FSEA 4NBYB 1J8HE 2DQEH 3QORD 5AVUB 4YHKL 3V5HB 1NBZB 5DFVC 3T0ED 4JM0A 1E2VA 1E5BA 1R5IB 3DX3A 3O4LB 5TE7L 1AMXA 2BWIA 1JRHH 1MCPL 1QSZA 5DLMH 5AAWC 5TF1H 4AW7A 2P44B 2VR3A 4JFPB 4QXGH 2AAVA 4UQ3A 4A68A 3P0VH 2N59A 3SE4C 1L6PA 3ZRSA 4IOIB 2VCOA 3GGWA 1DLFH 3LTVA 3MRGB 1E6JL 5EMYA 3LSOB 3LZFL 4GNKB 3Q13A 2Y06L 1KBGL 4P2OB 4KRLB 2B2XL 1BF8A 4JVUA 4NKOB 3KDMA 3T0EC 5L6YH 3KPNB 1NCWH 1IL1B 4G72B 4KKQA 3ET9F 1BLNA 2ENJA 3OF6A 2Y69B 2LHAA 1N4XH 5TJWK 3AS1A 1DSYA 3NJLA 4KTDH 1WYJA 2CK2A 5FW6A 4EMZA 4OFYD 4FTDA 1HNGA 1R9FA 5ESAA 4UT9L 3K0WA 4QXTB 4ZUSA 4AEIL 2X4OA 5MHSD 3VX1A