3PFUA

N-terminal domain of thiol:disulfide interchange protein dsbd in its reduced form
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
119
structure length
119
Chain Sequence
GRSQFVPADQAFAFDFQQNQHDLNLTWQIKDGYYLYRKQIRITPEHAKIADVQLPQGVWHEDEFYGKSEIYRDRLTLPVTINQASAGATLTVTYQGCADAGFCYPPETKTVPLSEVVAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Oxidation state-dependent protein-protein interactions in disulfide cascades
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
molecule keywords Thiol:disulfide interchange protein dsbD
total genus 23
structure length 119
sequence length 119
ec nomenclature ec 1.8.1.8: Protein-disulfide reductase.
pdb deposition date 2010-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11412 DsbC Disulphide bond corrector protein DsbC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1250 Mainly Beta Sandwich Immunoglobulin-like Thiol:disulfide interchange protein DsbD, N-terminal domain 3pfuA00
1Z5YD 1JPEA 1VRSA 3PFUA 2K0RA 1JZDC 2K9FB 1L6PA
chains in the Genus database with same CATH superfamily
2WZ5A 3F7YB 1QA9B 4XNBA 5ID0B 3KCPA 3L3HA 3NGBB 3SODB 4KVPA 3H7BB 4FQ2H 4KWUA 2J2ZA 1D5RA 3LJ3A 1RIVL 1J5CA 3W9DA 3NSJA 2OXGB 1DJXA 3HJ0A 1W0WA 5JW4N 1IE4A 3BVDB 1TEGA 1OT4A 3CN1A 3M8OL 4PG9B 3MRCB 1URLA 3BP5A 1E27A 5GGVY 3RZCB 3L7FA 3BRDA 1WP6A 4KO7A 3ZQ9A 2YXVA 4XGZA 5FM5O 5IB3A 4U1IA 2R2BA 2B5IB 4JHUA 4PB0H 1IJNA 1C16A 1B90A 1JMZA 4I2XA 1I3GH 3CSPA 1T1XA 3CCHB 5F3HA 5JQIB 4UAOB 3E6FA 4P2AA 4EQ2A 1MJUH 3O6FC 3GMPB 1KCVH 4L3CA 3SE9H 3ARYA 4HEME 3ZRSA 3CSTA 2QQKL 2G60L 2W80C 5ABDE 4P9HC 2HTKD 2NZIA 1ZXKA 2X7LB 3H3PH 1S8DA 2HCZX 4FNPA 3MAWA 2XWEA 4KVNL 3U2IA 2VLRE 1SZNA 2E8YA 4JVPA 5HHOB 2ADFL 1EGJA 3MLSH 1CG9B 2AK4A 3ULVE 1IKNC 3CFMA 5A3IC 2VMJA 5KUMA 3G6JA 4Z7VB 1D6EA 1BM3L 1U92A 4PGEB 5IT2L 3MCKB 5JW4Q 1DJIA 4J3OG 4PJEF 3RGVC 3QWRD 1HH6B 2X4RB 5B7EA 2GJPA 4OUOA 2WIMA 1I9RH 5HHOD 1A1NA 2Z31D 4K3JL 5KYWB 2AGJL 1AI1H 5J8OA 2YRBA 5EU6A 4KNTA 1PZ5A 3L4UA 2ZG1A 2K4WA 4LQ1A 3V7AG 4G5AA 5GGSA 1AD0B 4GBXC 3W82A 1LO5B 5HP5A 3WSQH 4LKCB 3P0VH 5HSFA 1JXDA 5I73B 1OCZB 3MLWL 3MRQA 2GITA 1CE1L 1RHHB 5AOMA 5CBAA 4GFTB 5C0BB 2CDEB 3QGVA 5DJDA 3VI4B 1S7TA 1SYVB 3B1TA 1NCDH 2XXGA 1WPCA 1BVNT 1TOXA 2X6AA 2WXHA 3TV3H 2XY2A 4PLJD 2DI8A 4N8VG 3OVUB 1F58L 5BRZD 1F86A 1DVSA 1HH6A 2X4RA 4UOW0 2ETWA 4WHDA 1J9RA 3INUL 3OR6A 1ZOXA 4KPHL 5F8QC 4WUUB 5KJRH 4GAGL 4NJ9L 2KPWA 1UOKA 3NSYA 3NOIA 1EAJA 1AP2B 4OD1H 4AXWA 4JZJA 1DBKL 4E41A 2VDOB 1MCWW 1QLFA 3VFUB 2VDPB 2V2XA 4JDVB 5DR5L 3BDYH 5CXPA 4OZIA 2C8NA 3O2DL 2VL5B 2YKLL 4LQFL 3ZKND 5JHDB 4KZCA 4NHUB 1ZE3H 3MRQB 5DTFA 5JQ6L 3ZRFC 3O4LD 3U7YH 3RY4A 1ETZB 3DJ9A 2EEBA 3ECVA 3RAJL 1BVKA 2HX9A 3MRFA 1XSOA 2G2RA 5KYNA 1Z5HA 3IJEB 4D3CL 1A64A 1AZVA 5BW7A 5IF0A 1AAJA 2D31B 4FG6D 1NDTA 3W39A 5ECJE 4AH2A 3MV9A 4N0RA 4X8JA 3WLBA 1TZGH 1BD2A 4F7KA 3TCTA 1AYRA 4MJIA 3RWEB 3QDJD 3ZIMA 1XGUA 2V7NB 3N04A 4G8GD 3VFWB 4Z8FH 1FL6B 5EOCJ 1I8MA 3O3EA 5EU4A 4PJIF 3NRPA 2HB0A 4HPOL 4TLSA 5A2BA 2DLFH 4TKWA 3IPFA 1ODAA 4HIHA 4QMEA 2OSWA 1MNNA 4AX3A 3QXTA 3UMTA 4A6YA 3LRSB 3GJEA 2FO8A 1SFHA 5DK2B 1SUHA 1I1FB 3O6MH 3PHOA 2A74C 1EH9A 5C7ZA 3PP4L 1XGPA 1T04B 3BSZH 3OJDA 4F15B 3AG4B 4XNUL 4TVPD 4D9LH 3S5YA 2H6UA 4I7ZC 4JREB 4HWEL 5IWLC 1IFHH 1J9CT 2RB8A 1R3IH 4EOWH 4NKMB 4KKPA 5I1JL 1T03L 4TUKL 1B9ZA 1P6AB 5DYOA 5F0PB 4BSWA 3RRQA 4Z78B 3RFZA 2JB6B 3L9EA 4OM0H 4NN5C 3WUWB 3EO0A 2J56A 1EDYA 4OAWA 3QPXL 2P24B 4D7PA 1ZT7B 4IMLB 5DDHA 4XOBA 5IG7B 2C1PA 2KYIA 3CDGB 5GGVL 3U7AA 4A6YB 2HT4D 3GUTA 1JK8B 3C2AH 1U3NA 4CGUB 3ZMRA 4OLYH 3Q5OA 4P59H 5ICXA 2WNWA 4RWHA 1XVSA 3QIWB 3MLXH 5TH2B 3WJLA 5L9DH 4EQ3A 3FU5A 1L6XA 4YBLB 2Q2LA 3MBEA 5KUKA 4A2LA 1AHMA 4XO3A 2ZJSH 3P9MB 4OF7A 2NX5D 4AWJC 3M86A 1V10A 2OJEA 4B9ZA 4C56D 2F8VA 2D8KA 1DFXA 2Q5BA 3MRRB 2WZPD 5IMLA 2VZTA 3PP4H 3KWVA 4AIZA 2Z8SA 3O6ML 5J7CC 4XMTA 4XNZC 3CLEL 3MRNB 3FQYA 4DAGH 2QVFB 1G6RH 1XGYH 1YEIL 1ZV5A 3MTRA 1BW8A 2HUEA 5DQ9A 4D9RE 3MOAL 3RIFF 5E8NB 4XPGL 5FGBC 4AGNA 3WMSA 2XG4B 4NO2B 3BRGC 1A2YB 3UTQB 1WE5A 2QKIA 4PV8A 1ADWA 2IBGA 4KC3B 2QGCA 1HWHB 4N8VB 4PV9B 1IAMA 4KX7A 5AVQB 1HCFX 2XVKA 3A4DA 4WWKC 5HDQH 2Q87A 3VFMA 5KZCB 1NDMA 2R0KH 4PLNC 4FLQA 5J12B 3QUXB 2AEQL 2C4FT 2BSSB 4XX5A 5D96B 2WCSA 1P5VA 3D0AA 1TQBB 1X5ZA 1IQDA 3OTTA 3BAJA 3IBOA 4QGTA 3KHQA 1GA2A 3O0RH 5E00B 1BBJA 3MFGB 4F8LA 2X1XR 3L4TA 5D8JL 2G9HB 2J43A 4MA1C 2J5LC 3QDJB 2KERA 3PHAA 4G8GA 3W2DL 3SDXE 1CGWA 5BRQA 1MCPL 5E94A 1DBKH 2XN9E 4F1SA 3QORA 7CGTA 1WEJH 2ZWLT 2VM4A 2VABB 3EJYD 1PPIA 5L8LB 5GJTH 2QV2A 4PPTA 3S88L 4RZCB 2VZSA 4EZKA 2WN3A 1UA3A 1IFRA 2EC8A 2J8UF 4UQ9A 4L1LA 1M9SA 4G42A 4NQCB 1H6FA 2HWZH 3TJPA 4DW2H 2BVYA 3IBEA 4OCSH 4C56B 5FKPA 5I1CH 4NQDD 2IOIA 5EUKA 5LGJA 3TA3A 4KKNA 1S7WA 4F7PA 2Z0UA 3QJOA 4WCYL 5B38B 3K2IA 3T1FB 4KXAA 1P4LB 3BUYB 2YAPA 1NKOA 3TO4B 5BMFH 5I6LA 2NNAA 5JXEA 5JPMB 3BH8B 4L4VE 2J3SA 4ZOBA 4J3UA 2QSTA 3ZX1A 4DT2A 5BV7H 3BP4B 4PRDA 3NBNA 3ARSA 4LVNB 1CLYH 1MRFL 1QSED 2A74A 4Z77A 2H1XA 3FUKA 4NNXA 5G4MA 1I8IA 1Y6KR 1LP9F 4PRPA 2VWEC 2PTTB 4L4VA 1NZRA 1NFDB 5DJCA 3SYCA 4UNUA 3CZFB 3QPQC 2BRRH 3HFMH 2NYYD 3GUFA 4XP4H 4OY9A 5FFLA 4H20H 2VLJE 3AJ7A 2VL4A 1DQMH 4HXAL 2PXYC 4LKXB 2XG5B 4FJYA 4UT6A 3VFPA 2B20A 1S3RA 5D7IF 3BHBA 2JJVA 3UTSA 2FEDD 5DD6B 1WSST 2GBTA 3ES6B 1SRDA 3VXMB 2NLJB 3I3EA 2F53A 2AJ3B 3GS7A 3W3BA 2YSTA 4N0CC 4X9GA 3V0GA 5I76B 3OQ3B 2OMUB 3TEWA 1E42A 1QBBA 3B1UA 1S9XA 2QPEB 4JKLA 1FNLA 3B5TA 2XA8L 2P9RA 5GGRB 3THML 1J9SA 2H3NA 4JL2A 1NICA 4OLZL 2GJZB 4NENB 1KTCA 2AW2A 3FO2B 3PHQA 4WEBL 1UEYA 2CCLA 4UQCA 4GRMB 3FCSB 1BX2A 3X17A 5DD6A 2BSCA 4GEJA 3RWCA 3GXPA 2NY3B 3NJKA 1IGCH 4KKQA 4TSAL 4E9QA 3AGVA 1M7DB 4ZOAA 2E27L 2QADD 4QXUH 4PMFA 2PCPB 1ZAGA 2Y2YA 3SPHA 3WYRA 3FT4A 3NIGF 3O4OC 2Y1YA 1XF3B 3WJLC 3JWDL 4W68A 4PJHA 3BP6A 4ZAKB 3DA0A 5KSBE 5FYLD 3IN2A 1I8AA 4ONFL 1MCFA 4JPVL 4KUCD 2B77A 3W9EB 3FT2B 4ODHH 2XTJE 3ARDC 4UM9D 1Z9PA 2ITEA 1TQWA 5DS1A 4WK2B 3AG1B 4IRZL 4C4BA 1E5CA 4FNUA 1GGTA 2UZYA 4ZAKD 1GGIH 5ETUB 1UH3A 1DE4B 3PDOB 4FQPA 1CD1B 1RP8A 1MHPH 1QPPA 1MPAH 3GMPA 3LNDA 3MOAH 4I9WD 3K74B 4H8HA 2NZ9C 2XETA 4KOCA 3TPKA 5BVPL 1E65A 2PYEA 5A6IA 4CNIB 5JPNB 2X2IA 4LSQL 3EH5B 1WZAA 1VDGA 1E5AA 3W9EA 1MJJB 1J1XH 2OL3H 5I8EB 4Y5YA 2MPAH 1MIEL 2YZ8A 3NCJL 4H1LA 2EH7L 2EP6A 4WJG3 5CCKH 1FYTA 2HH0L 4I3SH 5IJKA 2VE6A 4JM2C 3SJVA 2WKOF 2I07A 3BKYH 1FLTX 1KXVA 4FRWA 3RZCC 4IHBA 4JLRA 1O7VA 1EZUA 1KPVB 3F04A 2WUBH 4PJ9D 4U7SA 3H55A 1KMGA 3GB7B 3VFOB 3V0DA 3MX0B 2W8CA 2XZCL 1YEEH 2CHZA 1YC8A 1NEZA 1QD0A 4AL8L 2R69A 4O02H 5FC9A 2XBZA 2BH0A 2Q3AA 3KPPA 4MB1A 1UKTA 3PUCA 3MV8E 2KC0A 2LU3A 15C8H 3PAUA 5DK0B 2IH9A 3UCRA 4P07A 2FGWH 4F7EA 5CSGA 3ULVF 1BBDL 1L9PA 4AJWA 4K07A 4LB8A 5C0CA 4M6NH 4S10A 4XNUH 2L4OA 4LCCB 4RWYH 4ZSOA 2JXMA 2R1XA 3S37X 1FC2D 5G55A 4CSTA 1MAML 1QYGL 5IHWA 5KJ7E 1KENL 3JTBA 2E46A 5D1XC 3II1A 5DJ6A 3QIBB 3DDGA 4E9WA 3MGOA 2FUTA 3U4BL 1DR9A 3TT1H 3RTLA 2VR3A 4LIQH 3V4VB 4PMEA 2ZCKH 1MRCL 4PVLA 3Q2VA 4YDVA 3FAXA 1J0IA 4G8IA 4OSUH 3L6FA 3BUTA 4R9HA 1DVFC 4ADJA 1QFPA 3T6QC 4BV1A 1O9VA 1RZQA 4P23D 2CO7B 2EXSA 4GIOA 4MQ7B 4FKKA 4L8BA 4O5LH 4J8RA 5IJKC 3OMZA 2G2RB 1HEJC 3QQ4B 3B3IB 2Z4QB 4OKVB 3CUPA 1F1DA 4HAKA 4LE8A 1GYVA 4PS4L 3UTTE 2DLEA 1KGCD 4UMGA 5A2FA 2DMBA 5CAYB 3US0A 4JE4B 4PYGA 3WFDL 2FNBA 3DTUB 3OZ9H 4LCIH 5EG6C 3DJTA 3JWDC 4KROD 3QEQE 5E7FA 1SXSA 4BSWB 4Z78A 4M8RA 5GPRA 1X9RA 3K6SB 1I75A 1TCRA 4CBZA 2UYLB 3GI8L 4OF0A 1LJMA 3O8XD 1EEUA 4JS7A 5KJRL 3T1WA 3DGCR 3TO4C 3CVCA 1UVQB 2IWKA 2CIIA 3UOAB 4JJ5A 2CMRH 2P8PB 3BZFB 5AVWB 4AV0A 1PQZB 3FULA 2A5UA 3POCA 2YIHA 2YAMA 2VKWA 4U2YA 2CHNA 4NT6A 2X4PA 5D4IA 4YSEA 3P11H 3OAZK 4LKCA 3UTTD 1B0RA 4L9LA 1NBZB 1HHIA 1KG0B 5DJ2A 3MXWH 4H0HB 3PWPD 1S7TB 3UCQA 4ZMZA 5AZ2H 3MV7A 2J8UB 2HT2D 4ODUB 1OOWA 1EPFA 4HJJH 5CMAB 5AW9B 3QDGA 4HIJA 5DO8A 1LWHA 3TWCH 1MRDL 3VFRB 4P8QA 4RA3A 2ATAA 2CMRL 4X50A 4MA1B 4F7TB 4QHNA 3MRGA 4PY8I 4FCHA 3NZ8B 1FFPA 5LXGL 5D7IA 3P4LA 4A39A 1ZWIB 4FA8A 3Q8BA 4TQIA 5CCJA 2BC4B 3L5JA 4BINA 3C5ZB 3WIIL 1JZIA 3VXUE 3QI9B 2VL5A 3OMAB 1NCHA 4ZJ9A 4LSPH 3G5VA 5D5MF 3EAKA 5I75B 1OM3L 3ALPA 4UQDA 2P5ED 1AR1C 1WCBA 1KB5B 5LXVA 1EHXA 5E2TL 1OXYA 2AAAA 2BVEA 4NO0A 2VITA 1BGXL 1MJUL 4LXFA 2AZUA 4MYWB 1KBVA 4UUJA 2B1HH 3T0VA 4PB0L 1YAIA 3EOYG 1P5UA 3DROA 3LN4B 5DD0L 3VWJA 1QSFD 1WYJA 3RGBA 3CXFA 1OAYH 3MLUH 4DF9A 2DQEL 2IANA 3LZFL 4I9XA 4DTGL 5DC9B 1RH8A 2WXFA 1J05B 4KDTA 5KOMC 2QKSA 1LDPH 1B4JL 1G4RA 3EOBA 2FB4H 4DUVA 1DBJL 2PNDA 2FWUA 2X2JA 2WO3B 1HAUA 2OI9C 3J8F7 1PG7X 1R4XA 3S4SG 5ADPH 2JCWA 1WG3A 2VLRA 1UB6A 2KZ1B 1YC7A 4HZ1A 3T4AA 5C8JB 4KDTC 3VXSE 5C09D 4WTZA 4Z6AT 4FXKB 5LGHH 5AALA 4M1CC 2EABA 4LVNC 4NM4H 6TAAA 3VG9C 2ZXQA 4RZKA 2VMDA 1X9UA 3JWOC 5SWQA 4LEXL 3VSUA 4AE0A 1NIFA 3QWNA 2EE0A 3VGAB 1T22A 2ZG2A 1RFDH 3QPKA 4JVUA 4ZPTA 4HLZG 3EOBB 4ZMXA 1UD2A 1H0DB 4HU2A 4LRIA 5I0VA 1ZY9A 5E8EB 3ZDYB 1HC1A 4PIBA 5KSBF 3T3MF 3FO9A 5FFOA 3MLYH 1NCAL 2GSIB 3IDXH 2WM0A 4BA8A 5ELIA 1FG9C 4UI2A 2YBRA 3H4FA 2FL5B 4JKWA 1W2KT 5DD1L 4Z0BL 1IC7L 3MGTA 3OSVA 4Y19E 3D52A 4Y16B 5GHWL 2VDRH 3V0IA 4WUUD 1QI4A 1KTLA 2EIKB 2VR9A 4N3UA 4ZW7A 4G6KL 4IMKC 2QL1A 3BZ4A 5D5MB 3AXIA 3MLRL 1FFOA 1EMTH 2CWRA 5GS1A 1M71A 3NT0A 3PWUA 4Y19A 4MVBD 5EZIH 1B0GA 1DVXA 2IMMA 3VFNB 5KAQF 1WISA 1MPAL 3VU2A 2PYFB 3ULUL 1I8LA 3VJ6B 4OZIE 2FX7H 2YPVA 4R3SA 2WBJA 1A6WH 4Z5RA 4LGRB 3KPSE 3WEMA 4AW4A 3WTWA 1UXMA 1SHXA 3CC5A 3H9HA 1T1WB 1MFNA 4WO0A 4YPJA 3QIBC 3L3DB 4JFVA 1WA0X 2CO2A 1KWKA 2CPCA 3HI6H 2VDRB 4G80A 4AMKL 3QIUA 3NEEA 4AQ1A 4DPRA 5C9JB 3WNJA 3LQAL 1CGYA 1XGTA 4XP1H 5IVZB 1NPNA 2DM3A 3BQVA 4R97B 3HEIB 5E1HB 3RPIB 3FT3A 1KTRL 5E9NA 3E1ZA 2E3VA 1ZK5A 1BZ8A 1FORH 3DVIA 2DKSA 4HMEA 4N8UA 4R4FH 4RMBA 3ZL2A 1F8TH 1UOVA 5HJ3B 9PCYA 4D9QE 1BPLB 3QH3B 3HC4L 2GQHA 3V6OC 2X12A 3G6AB 3TT3L 4MAYD 5KVFH 4MXWH 1EA9C 2X4TB 2WWMC 5FW7A 4ZQTA 1GC1H 5E24E 5CGYC 2CO6B 3E3QC 4BZ2H 3F6JA 2FX9H 2FWOB 5C07B 3WN5B 5EC2B 4JFEE 4HUWA 3GHEL 1KIRA 2EIZB 2EILB 4PJBE 4W9GC 5E5LA 5BRZE 2YK1H 2CXGA 1A6AA 1H8OA 3GMRA 1YPZB 1WCQA 2IDUA 2VR5A 3L4CA 2WCPA 2WQWA 2Y07L 4LOUC 3SBPA 5KSBB 1CL7H 4TQEL 2ID5A 4YXLL 3KYNB 3I9AA 3VI3F 3WFEL 1EV2E 5EF1A 4PQXA 4H0IA 1EFXD 5DUPL 2G4GA 1MI5A 4FXGA 4W9HC 1INQA 5EEYA 1EJOH 1RSFA 2F1AA 4ZX5A 1T83A 4GFXA 4HUNB 3HZ3A 3HAEH 3BFWA 1OCCB 4L3FA 1XDTT 4OQTA 3N43F 1R6VA 3QUYB 1A7BA 4OUUB 3V5HA 1XAKA 2OZ4A 1U93A 3GMRB 4PW9A 3T3PF 5TF1L 4EIUA 3WIAA 4WJ5B 5H37G 2OW7A 3AQZA 1TTUA 1ZPUA 3MRPB 1NUGA 3QIUD 2J6EA 4QXUL 4TMPA 3NPSC 3PNWA 5EO0B 3V4LA 4XN1A 4TF4A 2NCMA 3RG1C 1XD1A 4GMSH 3FB7B 2R8SH 3FUEA 3PWJB 3EYVB 5K1VA 4AYFA 5FPIA 1C1EL 3U9PL 2R83A 1Z5YD 3RVVD 4DW2L 3U4EB 1YLBB 2NY2D 1BP3B 3CFBB 4FHJA 4S1QH 4AQAB 3VRLF 1GZPA 1FV1A 3NK3A 3JT2A 5F1NA 5I30H 5KVGL 4RDQG 3QNYB 1KY7A 5DWPA 4G1MB 4DIXA 1N8ZB 4RGMB 4P2RB 2VN4A 4FHKA 1DDTA 3DV6A 3FRPA 3PL6A 4LF3B 2KLTA 4QDGA 3OJMB 2JCCA 1FJ1A 2GAZA 4J7RA 2X2UA 3X1GA 1TNMA 2NYYC 2OP4L 5E99L 4HKBB 2NUPA 4FCAA 1E8WA 1WZ1L 5I1KL 2A0LD 4IRSD 4J3OF 4JHZA 5HY9A 3VM7A 2JQZA 3U1SH 3OB8A 2VO8A 4YN3A 4GBXA 4AQAA 4Z7WA 4JO5A 5F89B 3KWWB 5D6CB 4L1BA 3ARBC 1JHTB 3KNBA 1MFEH 3GSVA 1SN0A 5IQ7L 3UEQA 4P4RA 2DWSA 32C2A 1E9PB 1FAKT 3QUMB 2YPLE 4YQXH 1O5DT 3PL6B 1ZMYA 1VENA 4YEFA 5E1IA 2G2NA 2DQFA 3BLBA 3I84A 4HX1A 2F19L 4W70A 3VQ1C 3G6DH 1BFOB 2PN5A 3CXDH 2OQJB 4LCUA 5DRZB 4I0PC 5ESAB 2F7OA 2LT9A 3A6BH 5C86A 3S2AA 2Z92B 3BEWB 2A6KA 5EORL 1CLZL 1QFHA 4DETA 1N0XL 3BAEH 5E4IA 1TMQA 4UV4H 1XH1A 1EUTA 3NJFA 1HL8A 4ZFQA 3W38A 4UTBL 1TLKA 2Z0BA 1NDMB 1T5WA 1G7PA 4UDTB 4LLVB 4WEEA 5F6IC 3SE4C 2X1OA 1E8ZA 4AY0A 1IAOB 2Y7QA 3F7QA 1XGPB 5IGXL 2V0AA 2APXA 3GSUA 3WY2A 5CLXA 1SLUA 1T04A 2HG5A 5CO1A 3CXDL 3DX8A 5E00A 4QRPE 4NZJA 1RZJL 5GRXG 3MREB 4HKJB 1XR9A 1MCCA 2EXWD 4MB4A 4NNYA 4J39A 2A6KB 4MS6A 1NGWB 1E28A 1IAKB 1TKWA 2BOLA 5I74C 2BDNL 4QXTA 1X5FA 2FH6A 3I85A 2DQGH 4DK6A 3GD1C 5J6SA 3P9LA 5BZWA 5TDOB 5CS7A 5T5FA 1RIUH 1Y07A 1TMCB 3CHSA 4WO4B 3C2SA 5TQ0L 4GW5B 1IFHL 2WHVA 5CUSH 2VQUA 4Z7OE 3GXDA 3HC3H 1KGJA 3BPNB 1QASA 4XNQA 4UT6L 3TX4A 4JMXA 4Z95H 3QO1A 3IDJB 3K72A 3DX8B 3ZDYF 2EZ0C 5HGHA 1CYXA 5A2IH 3MGOB 5KBDA 1S4IA 4B50A 5DSCA 3LKNB 3NG5A 3GZQA 1Y0LA 4XNMB 4WI9A 5GRVL 2K3TA 3Q3GA 3OB0H 2PP8A 3DMMA 1DQIA 2GW5A 5IVXA 3SCMD 2F8IA 2FJHA 1UWGL 1G0YR 2YD0A 3DV4A 4IOIA 4ENZA 4GUOA 1FCCA 4WHTB 4AYEC 2E9JA 4BUQA 5EFIA 1BAFH 3D08A 2ZAHA 3EKCA 5E4EC 3CZSA 2X40A 3D05A 1UM6L 3GJFH 1NINA 4X42A 5F7AA 3B9AA 4UT9A 3G9VA 3LKRB 3D4ZA 4JGNA 2B39A 2BNUB 3VGHA 5A43C 3VXNA 2D3JA 4IGBB 3T77B 4PSPA 2NY0B 1OGTB 3WG7B 1HH9A 1HCYA 4FJ6A 1TYJA 2ORBL 1Y0LB 3RPBA 5D1XE 3C2AL 2X9YA 3BEVA 1U8KB 3VI4F 4AQZA 4IMKA 3VD4A 2XVBA 3D3VA 4IK6A 1MAKA 1WV7T 1VEOA 4YSSA 3N44B 3APMA 4PB9L 4OF3A 2CIKB 5TE4H 1YEDA 3T8XA 5AOZA 1K5WA 5B3SB 2C9AA 1CXEA 1NPJA 1D5BA 5D93B 1C08B 1CFQB 5FIEA 2AK4D 2PCFB 3TYGH 3UBXB 4BK8A 4Y2DD 5C0DB 1R9FA 3K0YA 3QS2A 3S37H 4L3EE 2VABA 2GSGA 4GKLA 3APNA 5GRUL 4WHYH 4XXWA 3L9RB 4J1UB 5HDRA 4F37K 5MEPA 3R06A 2BNRB 3RX9A 3T6WA 2MOGA 5G2NA 1MH5B 3VRJA 4FNLL 1TXKA 3MV9E 2W94A 5CNHA 4MNQE 2IBBA 4MLIA 1RKRA 4HP5A 4XMWA 1RJZB 3ZIYA 5LKNA 3ARGC 1KYOK 2BSRB 3LV3A 3NDYE 2XWRA 4RAUA 1RJCA 3IJ7A 4X5PA 3T4AC 1U4FA 2B1HL 3OR7A 3FUFA 3RU8L 4AENA 1GC1L 2MHAB 1H6EA 1CFTB 3CN2A 3NJIA 3D9AL 1D9KD 3GYRA 4MXWL 1EAQA 2H0FA 3DX4A 2PPCA 2PR4L 3IE4A 4PR5B 4MNGE 4KZDL 3DVGA 1E4XH 3S97C 4ZD3H 2QZQA 4M8QB 4ZW5A 3M17A 3ETBF 1DN2A 3UTZB 1H3GA 1Z9OA 4PB9H 4PJ9B 2Z3FA 3MLSL 4LESA 1BOGA 2V5YA 4JFWA 3PS6A 4YXHL 5C08A 4OGYL 5H35B 1W0WB 2F5BL 5H4YA 3HTLX 1T2JA 1GZHA 2O30A 2YEZA 3IPEA 5KN5B 3ULUF 1S7QB 4LPUA 4M03A 1D6VL 3BYTA 1JVLA 1NMBH 5EC1A 4QEGA 4R8WH 4YZFE 4GO9A 1VLXA 1WC7A 3ARED 5E6IA 1E4KC 1T2QH 2OW6A 1AANA 4G9FB 3DX7A 5KG9B 5DMIL 4HG4J 3ISYA 3LB6C 1X7QB 3C08L 4OB5H 2OMBA 4XN2A 3RNKB 2OYLA 3D2UB 1JWMA 1KBGL 3OLGA 3P73B 1E8XA 1SOSA 4PJ8B 2ISDA 4QO1A 5CJ5A 5DMYA 3ESMA 1IBHA 1S8DB 2AV1B 4OTXL 5AL0A 3FO1A 1NEZB 4F7CB 3KL5A 4YR6B 2OYKA 3V5KA 2IWEA 2GCYB 3FFDA 3HPLB 4IOFC 1CPUA 3QO0B 1P7QA 1U21A 5KVGE 5L2JB 1C12B 2PP7A 3II3A 4Z0XB 8PAZA 2WANA 1T1XB 2PYED 2WNGA 4Y4HB 4ICWA 4Z0BH 4LVHC 5EH1A 2CKBH 2ATPA 1NCAH 1TZIB 4PJCB 2MSPA 1L9MA 4MMYB 5C6PB 1EBPA 5AAPA 1ZHNA 4MD4B 4OQ1A 3D51A 1CE6B 3ARFB 3QDGE 5FYKU 5KYUB 5IROD 3FMGL 1LO3H 2AV1A 2AI0H 2X88A 2EDMA 1KJ3L 3FPXA 5DD3L 4FULA 2WXQA 4AM0Q 3LEXA 1XX9C 3DBXA 2YMXH 2BVQA 4CBPA 4U4IA 1OB1B 4HC1L 4PRNB 4V1DB 4CVZB 2YFOA 5FYLH 4UIKL 4UQ2A 4HIXH 5L6YH 4NPKA 1G7LB 4PTTB 1Q38A 5C0CB 2JKNA 1DSFL 4V33A 1FO0A 1BLIA 1U8NB 3KPNB 4IKNA 4MLSA 1X4XA 3UG3A 2C3GA 2N59A 3D07A 1SDAB 3W0WB 2CKBB 4MMYA 1CL7I 3H4HA 1N2RB 4FF9A 5F1SA 3LN9A 4EI5D 5ADOH 3PXHA 4OGXL 5I1HL 1KTJA 4WWNA 5CN2A 1XIWC 2X41A 4HKXA 3IGKA 4LCYB 4XVJH 1R75A 2FUQA 4AJVA 3U4BH 1UUSA 3I2CH 3EDKA 2D7MA 4FFWC 5IUCA 4BJLA 3HHRB 2Y36H 4OUUA 1AS6A 3C08H 4O2CB 3MROA 3EBAA 3MJ6A 4P23C 3P2BA 4LOVA 1KPVA 5DJYB 5DGQA 2VW7A 4MS8D 4UINH 4A2HA 4P04A 1CDJA 1WZKA 2CM5A 2G75A 3PWNA 2PO6B 4JMNA 3UADA 3WNKA 4BZ2A 4DOHB 4QRTA 1XR8B 3HMWL 5FS5A 2VLLB 5AVTB 3AQXA 2Y7SA 3BGMA 3RQ3A 3CH1B 3D4YA 1REIA 3RZCD 3PHSA 3V55A 4HIXL 2BP0A 2GAZB 5FUZL 4Z7WF 2O5YL 1F3DJ 1NMCC 3PREA 2EZ0D 2R9HD 2H32B 4XBEL 5ANMB 5J56B 1ZT4B 1K8DB 4OZFG 5HI3D 3DHMA 2XQYK 4MD0A 5E4OA 3RX7A 5T3ZE 1JTTA 5F1NB 4OZHA 5DJAA 4M1DH 3IU3B 3UFIA 4PBWD 3TIDA 4UTAL 2WXNA 3RBGA 4EN3B 5J6GA 2CHDA 1M2OA 1AVAA 2BJMH 4UT7L 1VACB 2DZEA 4PJCF 2HH0H 4I3SL 1NTDA 3MOQA 1N9PA 1J8HD 5EOQH 4X0KA 2OL3L 3DX9A 3FB5B 4MDIB 1ZJAA 2MKWA 3CPLA 4Q7DA 1RD6A 1DLFH 5D7IB 3NPSB 4G8FA 5JNYA 2F53E 7PCYA 4F33B 3B5HA 3JZYA 1CGVA 1LXMA 5DHVH 3CHOA 5IESH 1G7QB 1KXTB 3BESR 4Y5XB 3DURB 4DKEL 5IG7A 2WLLA 2YD7A 1HL5A 2Z9TA 1A5FL 1JHTA 2W88A 3JWNH 4OZGF 1HN1A 1M2VB 2IV9A 3L3KA 2NY6B 4YXKL 3B3IA 1MXGA 2BOCA 1ZGLP 3IJ9A 5GGSB 3TBBA 3MJ7A 4M7ZB 4ZQKA 5J9PA 2HLEB 5DFVD 1TQCC 2HJFB 3UROR 3H1ZA 2UXFA 1A3RL 3NP4A 4QHKJ 1P53A 4KK5D 1A9EA 4O4YH 1KLFA 3TIEB 3JWNG 2HSIA 1RLBA 5B1CA 1HKLH 4Q89A 1E9QB 2GK0A 1UQSA 4XAKD 4HJ0C 2IWGA 3VYPA 2IG2H 5DEFA 1GIGH 4YNYA 2OX5A 4X6DF 4JFDE 3SGDI 1RK7A 4E2OA 2EYTA 2WJ7A 4QT5A 2LAAA 2O6FA 2R69H 4FXGC 4R2GD 3ZXAC 1T7XA 2Q8AL 2ORBH 1GGCH 5FO7A 4BZYA 3C6LC 3ZO0A 3X13A 1VADB 5A7BA 1V27A 1NBYB 4FTDA 3VWKC 1DDHA 4WTQA 1ZDQA 1ASQA 4NO3B 4WEBH 4BHUI 2J73A 4QKXB 4HUUB 3CN3A 2LABA 2DJMA 2VM3A 4ACPA 1MHEB 2FQEA 2BCKB 1R5VB 5JA8B 3PQYD 1OT1A 4GB9A 3DK0A 4HU8A 1NGXB 3VU1A 5BXFB 1BPVA 3QUXA 3U9WA 2C4XA 1JGDA 3T6XA 2O5XH 3TJEL 5LQBH 1E43A 1MDTA 4JRFA 4M7ZC 5CN1A 3MZGB 5KVFL 2EICA 3S34H 1L9SA 4FNLH 3CC1A 1RUPH 3V6OE 2F8XC 3UJTL 2Z4TA 1KCSH 3F12B 1PLBA 3OXRB 5D1QE 1JVOA 5DI8B 5TE7L 5I1IH 2HJLB 2HVJB 1H5BC 2BNQE 5E8EA 1V8HA 1J12A 1QUPA 5IB2A 5AB2A 2ZUWA 1GIGL 4NKDA 4DHLA 3MMEA 4XVSH 5HI4C 2XKUA 3ELAT 2UZPA 2VUYA 1HKLL 3WXVH 4LDCA 4K94H 3LRKA 3IAPA 1J1PH 3UGEA 3SCMA 2OA9A 3ZTEA 2E7BA 4HAFA 4FP8H 4PN6A 5MI0C 4GSQA 3QIUC 3Q2NA 3EBGA 2YGVA 5K9KA 1NCOA 4UINL 2VITB 4PJXE 2F8OA 1BFSA 3LKOA 1AR1D 3IJ8A 1MHCA 4BGLA 1RUKH 2YSSA 2ZONA 2JKIS 2EDEA 3RVVC 1RZJH 1KT2B 3DUSB 2HT3D 3KR3L 3BMVA 3RDTC 4NQXA 2XTLA 1G9MH 4DEPB 3APCA 1P5UB 3DROB 2RQ8A 1JPGA 3VWKA 3IT8D 3MUGB 1IBGL 3UZEA 4FADA 3TJHD 1RZGB 1KYDA 2YD1A 4F3FB 2A7BA 2VDRL 4E9YA 3MRKA 1YAZA 2A4ZA 2VXUH 4DK5A 1OAXH 2N7SA 3LKSA 3VFGL 1IAOA 4HCIA 4XZUA 1W72A 5DD1H 1H5BA 4JFZL 7PAZA 4NM8H 1RUML 4WW2B 1YYLL 1X5KA 1ZA3A 4JG1L 4APXB 2CDFB 2F58H 1JXKA 5C6TL 4GXVL 3M1CA 3RPIA 1EFQA 3ILEA 4PRAA 1E5ZA 3L9BA 3BH8A 3U30B 3CZUB 4KITB 1NFDE 2P5PA 1YCSA 3I6LD 1ZD6A 5D1ZC 3ZTNL 3UBXA 1U8JB 3DPBA 4W93A 1KUMA 4KK9D 5SX5K 4AVIA 3FMGH 2VSMB 3A24A 3QIBD 3BIAX 3L9RA 4J1UA 4LBEA 4MQXC 4XMPH 5A1AA 2QFPA 1AZZC 4XWOC 5KVMC 1IBBA 2A83B 5K93A 1NFDA 3SY0A 3VD2A 2BP8B 5IW6A 3WTUA 1BIHA 1IARB 4FI7A 2R4RH 3RY6A 3F83A 3TGXA 3SB3A 3SOTA 4DEPC 1CTOA 3HMWH 4OZFH 4LVOB 2A9NL 3HMXA 4J3OC 1W0VB 1AZBA 1TEYA 2AK1H 5DUBA 4WGKA 5G4OA 4U1KA 2OP4H 4Z76B 2JV6A 4OJCA 1FNAA 5AKVA 1SQMA 4H8WL 4NRXB 4M61A 1N7ML 2PWHA 2HPTA 1F45A 4JG9A 5DRWA 1OF2A 3OZKA 3W1ZA 1Q0XL 2JI2A 1PL3A 2XWCA 4ONHA 3MPCA 4WSGA 1QRKA 5GZNA 5C6TH 3RY5A 2BSEA 2BIQA 1NMCB 5HHQA 4P4KC 3A0OA 1JZ6A 4LCCC 1PZCA 4MCNA 4YHZL 4JY4B 2XACC 3RL1A 1A1OB 3ETTA 4PJ7E 1UEMA 4M8VA 2XLLA 4IRSB 5CF3A 4JM2F 3GTNA 3KBFA 4RSYA 4Y4KC 3DSNB 5F9WB 4WUKL 2N1TE 3GZKA 1DBML 2BINA 3BXNB 2YC1B 3UBHA 5BPPA 3RTQC 5JHLL 3L8QA 3LH2L 4WI5A 3TTYA 1TU2B 2VISA 1U95A 1XCQA 1YEFH 4ADIA 4ZW8A 2ZCLH 3QXWA 3FL7A 5TF1H 1GKEA 2KS0A 3WFBH 4ZNEE 4F7PB 2A6JB 1WA1X 4NCDA 2NSMA 3SYOA 3KPOB 4YHLL 1BZ9B 2WMPA 1WTLA 2FX8H 3ZKNC 4JRYA 1R33A 3UTSE 1ZLSL 2ZX9A 3RUGA 5MEOA 1LK2A 3ULUC 2ADGB 1PZAA 4BK5C 4MB3A 4YZFF 1KEMH 3L45A 1Q90A 1YYCA 4DGYL 1H8NA 5I1IL 1PSKH 1XSJA 1B9KA 3BN3B 2J1YA 4KHXL 1ACCA 4I2XB 2VMCA 5AZ2L 4LLWB 3RL2B 2BVPB 3DETC 4OLWL 5HYJA 4HA1A 4E9RA 1KBBA 5IY5B 3RFZC 3WEOA 2QADC 1YEJL 2XNAA 1VAHA 5I30L 5KVGH 3IFNL 1N10A 3G6JB 4Z7VA 4JFYA 4RBPK 3OJVC 5AAMC 3GWJA 3S35L 3MBXL 3WELA 3FSAA 2WUCH 3E3QE 1EEZA 4FQJL 1YY8A 2C7UB 3E8VA 4ZUSA 1B2WH 1ZVYA 1VKXA 1WBYA 2OMUA 3RTQA 1CF8H 2QQNL 3IDIA 4O2CA 2DWXA 3B2VL 4OH2A 4U33A 3GB7A 4CL7A 3MX0A 2HYMA 4F24A 2A0LC 2BHFA 2WB1A 4QRSB 2BFGA 4ZMVA 3ARBB 3OHXB 4UAHA 1M4KA 4Y2DC 3ZPDA 2XIIA 1C5BH 5AW7B 1PFOA 4AMKH 4GQZA 1FVCB 5T5FL 3L6FB 1DCEA 5AG8A 4OCXH 4LBAA 4BFIA 2ADIA 3D18B 5D2NE 1MFMA 4AL8C 3GMQB 3GXNA 3WEAA 5TFSL 3CBJB 4HWBA 4P2CG 1Y7VA 5TDPA 4QRSA 1HINL 1N64L 5IMKB 1UKQA 4YR6A 5HGAB 3BPLB 3RWFA 1FFNB 5DZPA 5GSRB 3SO5A 4E41B 1X5IA 1XSIA 4Y88A 3KYMB 5B3NA 1CBVH 4HQQL 5GGQL 4XX1G 2BSBA 3FRPG 3NFNB 5D1XA 4E41E 2VO5A 1ZKAA 1WFUA 4W9IC 2D31A 4HIPA 4K3JH 4U3XA 2XSKA 4M6NL 5CHNB 3SYAA 2ATPB 1CTNA 5F3BB 2G9KA 2NW3B 3SKMA 4XI5C 4L8BB 4K5LA 1RIUL 4KGLA 1F5WA 2BLFA 3EDFA 4HKBA 4JDTL 4Z7NB 1TF4A 4X98B 1UT2A 2DJSA 4K8RL 4P3DA 4UU9B 3GFUA 3GF8A 4A68A 2P8LA 1I7UB 4PP1D 1JZ3A 1H3VA 4IBZA 4KAQH 4X6DA 3V95A 1B0RB 3LVTA 1WHOA 1YEEL 4X9BA 2ZSWA 5AKRA 4QRUA 4F80A 4KRPC 2R29A 1YVLA 2BFVL 4I85A 4JG0H 4LFHD 4PEEA 5IV2B 5JO5A 5K9OB 3EJTA 2EVJA 1MEXH 5J0BA 2KDYA 5E6IC 4QR7A 1DFBH 1R3IL 3BVNB 4URTB 4EOWL 3EJUA 5JXEC 2CKBA 1W6LA 4QLRA 4X6BA 2MPAL 3NCJH 1NJ9B 2XWJA 4NB7A 1A3ZA 3LKQA 4E0RB 2VDMB 1N6QL 2DL9A 3CJJA 2GUOA 3H8NA 3RFZB 4ODXB 4XXDB 3NIDF 5DHXB 1B6DA 1DJGA 3QS3A 1CQYA 1UWGH 3H9ZA 4WK4B 2B4CH 1FCGA 2J8OA 1AD9A 1LO5A 2E5EA 3RLSA 4J23A 3MR9A 4FFYA 4LARL 1HS6A 1QWNA 1WIUA 5DMKB 2ZSWB 3SCMC 5EZIL 2XPYA 2TSAA 2ZD0A 3HZKB 4NSKB 3GNMH 4FQ2L 5DD0H 4AYID 3BPCB 1KLGA 3GK8L 4Z1PA 1HK6A 4ZZFA 4QIRA 2KLRA 2HRHA 4X6CA 2NY3C 3WY3A 1G5AA 4CMMA 4HS8L 4ODSH 1FFRA 4OU3A 4DQOH 3FCBA 4M3HA 5MEQA 3DX3A 4GSDH 1HCVA 4POZD 1HNFA 5J1AB 3ARZA 3JV6B 4RRPG 4P5KA 3MBEB 2WLKA 4NO3A 1YUKB 4L8SB 4ETQB 2VDPL 3D50A 2KDGA 1U8PB 3U2SA 4I4WA 5CP3H 1CR9L 1M57B 1KNOA 1XEDA 4M7KL 4L8DA 3FUHA 5DT1L 2E27H 1BVKB 2ARJQ 3K2MC 4AEEA 3BAXA 2BWDA 4KFMA 4F37F 5DHVA 2UX7A 1ZSDB 3MV11 2W60B 4AM0B 5K9KB 2ZF9A 3M6DA 3RWJA 4PJDB 5TK4A 4IEFA 4NM8L 4QRAA 1T5KA 4KK6D 2YD8A 4R97C 5DQDH 1RZJC 3DGDA 5EF2A 3VFGH 4NZTL 2D03L 3ESVF 4GG6E 2NY5L 3QZWA 3V4PB 4BXVA 2UV3A 4U0RC 2NLJA 4F9LA 1KIQB 2FR4B 2J44A 3UP6A 4HJJL 3SEPA 2ICEB 2QQQA 4PV9A 3LN5A 3TURA 4XXCC 4WAFA 2G5RA 4PY7B 4JO1L 1NUDA 1BZDA 5DZJA 4L8DB 3UAJC 3H9SE 4Y2NA 4HLJA 2CLVA 5C08B 4ZTPH 5JIKA 2K45A 3MACH 3SPCA 5K9JH 4WI6A 1IC5L 1JNNL 3VXNB 3T77A 1J8HA 2W0PA 4KVCL 1F4AA 5ANHA 3RWIB 3VXUA 4CRPA 1ACZA 4N2NA 5EPMB 3ZE0B 3DDFA 2YD6A 3L3GB 3BAKA 4GUPA 5LNGA 4XPHH 4CKVX 1J1PL 1NMBL 1R46A 5I8CB 3O3BB 4FTVA 5KG9A 3DXAE 3VYOA 1JPGB 5FLVA 4PWEA 2O6EA 4MMZA 1PG7L 2LLLA 1BMZA 1JWUB 1QOKA 4U1NB 5BVJA 1CLCA 4CC4C 1M6OA 3PFQA 2H26A 4X5WA 2HJKA 2WNXA 4QJ3B 4MNGB 4FTVE 1ND0B 4FEMA 1YPZF 5FUOL 3VG9B 4YGVB 5F0JB 1Q9WA 5LGJB 3EO1B 5HGGS 3QI9A 4JK0D 4N2BA 4UZGA 3QNXA 5EWIH 5D9SA 4X5LA 1B3IA 3ESUF 2CR3A 2P5WB 3GRWA 4Q58C 3RKDD 1P7KA 3M7FB 3ARFD 1DZBA 2F1EA 3C6SB 4AKOA 2ZCHL 2I9TA 1IB5A 1OTUC 1NLBH 1WH0A 2IPKA 4AIZB 4EI0A 3E6FB 4YHOL 3ASWA 3WJJA 3VGFA 4I3RH 1YN6B 1T0MB 4J2XA 2QLVB 3P3TA 1PY4A 4RAVB 1U2CA 1AOHA 5JMOC 2F7RA 2X6BA 3UPRA 2ESVE 5GSVB 5ICZA 1CXKA 1MZYA 1RPKA 4NBYB 3P11L 4QRRD 2OMYA 1CD0A 5F6HI 4EI5A 4ZX3A 4F5CA 4XC1H 1KFAH 3DVGB 1XV8A 5EU6E 2QEJA 2WSPA 3EFFA 4HPHA 3DNKA 2IANB 3WAKA 5I6KA 4UILL 2Z6FA 2HA1A 2IG2L 3F05A 4OFDA 3PPSA 1JZDC 3DTXA 1XF2B 1PKOA 4NQQA 2GI7A 1FH5L 4L1SA 2JB5H 2QHLA 3Q5TA 4G1EB 5FB8A 4DQOL 1EJOL 2XPZA 2ZCZA 3MKGA 3MODH 3PE9A 2P7TB 3QCVH 4GO8A 4JFFD 3CV5A 1S7QA 1TZHB 3A23A 4CAGA 4YXKH 2X4QA 4MJ2A 4HDIB 1F97A 1S5HA 4OFIA 1A6AB 4CUCA 1RXLA 2EO7A 4B96A 5E94B 1YY9D 4ODWB 4JFTA 4Y8AA 2WYHA 4ZUTB 4XNYL 3BKYL 4OJFL 4DAGL 3PPEA 1YYLH 1EAPB 1F4XH 4R4BB 4UQIM 1MCSA 1UXSA 1Z3RA 4U1SB 1MLCA 1ANUA 1DJZA 2Y5TA 1FN4B 1S7VB 3QQDA 3V9CA 1UGNA 3VG0L 3X1EA 1PCSA 1J87A 4X83A 1H5BB 3AU0A 1EHKB 5C0AB 3QIWC 5F9OH 2A6JA 1F4XL 3MC0A 3ML8A 3IKKA 2ZJSL 3GSXA 4F2MA 3PJNA 3QW9A 4F7MB 4XGZB 4Z3EA 2XY1A 4MNHA 4PP1C 3BIKB 2VLME 3B56A 1CFVH 4FKEA 1MHPL 5EU7C 5L9DL 1V3MA 3H6AA 1U8JA 3DPBB 4W6WB 5KSBA 4Q9RL 2H9GB 3IDNA 1CGUA 3L5WA 4MS8C 3ZT7A 3HKFA 1FYTD 3DO7A 2EC9U 2V4LA 3CAFA 3MV01 1WBYB 4R0LC 4XP1L 3WTVA 5ETUA 3GMLA 3NRQA 4XXCA 3QJUB 3KXFB 5SX4H 1NUNB 5B1JA 1BBDH 1AO7E 3DOHA 4XMUA 5HHNB 5BOJA 4J5VA 43C9A 5FO9B 5I0DA 3HUJF 2HVBA 3STLB 3VXQB 2OM5A 2V9QA 5AYQA 3WXVL 3ZE2E 4A63A 5HBBA 1MF2L 1XBDA 4NKQB 3U30C 4J8QA 2J71A 3JWOL 2VDQB 4APQD 3B6SA 1ID5I 4K5MA 1TCRB 4JLRB 2P1YA 4NXKA 4Y4HC 1CXHA 4PGBA 1QBML 2C9PA 2V8LA 3WKYA 3ZGIA 1A7OL 1PYWB 4GYBA 1JV2A 1FYTB 1ZLEA 4J4PA 3MXVL 2NCEA 1OV8A 3FTGA 4Y16D 1QLEH 2FO4A 1FYTE 1PZ5B 3V6OA 3STZA 4ZG1A 2V9TA 3K2KA 3ZDYE 5JQHC 2YLKA 3IFOB 1AD0A 1UD4A 5MHSD 2IMNA 1N67A 3ASNB 1CIUA 3D34A 4YBQD 1ZGLB 4R96A 1C9SA 4G3YH 2BNQA 3VG0H 1E5BA 4M7JL 4WV1B 4POZC 4OF5A 4NKMA 1KBKA 3C9NB 5D2NB 4FLSA 1XF4A 3MYJA 4PTUB 2XIBA 5HYSB 5FUOH 1SDYA 3C5XA 1DUYB 3GBDA 1M7DA 4OCLC 2GBUA 2ZYIA 4UOJA 5FYJE 4JANA 5SX4I 4BSJA 1LD9A 4HIQA 1L3NA 4FQ1H 1RSYA 4IKJA 2J6EH 2JCCB 3O6KH 5CSZB 3C60B 2AMGA 3L95A 3IS1X 5D7SH 3ALWA 1ROCA 2VQ4A 4LMQE 1JXJA 4Q4IA 2WAQA 3TONA 4ENED 4HOMA 3PG2A 2WBJC 1A7NH 3T08A 2BC4A 4RVBA 3F62A 1MFEL 1AHWB 1T7WA 2QFRA 5DFAA 5IOPB 4JL1A 1QSVA 3X1NA 1ZT4A 4L29B 1G9NL 2AV7A 3S96A 4AV4A 4OZIB 4MCYB 1JGIA 4GO6B 2QBWA 1J5OL 3LQZB 2Z65C 2NY4C 2WUCL 4MA3A 2VJ0A 4BUHA 4IRJA 1MI5E 4OM1L 4IU3B 4L18A 1BJMA 2WXGA 2IQAB 3UDWA 4PGCB 1CLYL 2OJZH 4EN3A 3AG2B 4XC1L 3TV3L 3L3JA 1SDDA 1UFGA 5D4JA 1PLGH 5EUOF 4R6UA 4HX1B 4HHAA 3VWKD 2V33A 4PP2B 4K8RD 4W9ZA 3KYOA 4HCRH 3P0VL 1QO3B 1U3HB 5FGCE 4XN9A 2PABA 1O6VA 2QVIA 2I25N 4N5UA 4KXBA 2GUOB 1C7SA 3BT0A 3GBEA 1KBGH 2IAMB 4XO5A 2FYVA 1PBYA 2YPVL 2B4CC 3OQRA 4L8SC 1QQDA 4PVMA 4YHKL 4OIIL 5GGTA 2B8OT 4BFBD 3ILQD 2XRAL 1AC6A 1AI1L 3T65A 2FTAA 2ZAGA 1D2OA 4LCWD 1T5WB 2CO1A 3C6LB 1ZTXE 3G08A 1SHWA 2WLIB 3PDGA 2DQ6A 1SJEB 5D71L 3BKJL 4PJGF 2NXYD 3QEQA 4HW6A 4OZGE 5HJBA 2H6PB 3TNMB 4IBUA 3CK0L 5M95B 3HBGA 4LPTA 1KJMB 5TGBB 5LAXA 1OSEA 1ORSA 2JI3A 1D5IL 3S5ZA 5KYXA 2RD0A 4NO5B 3ULUD 1THCA 2BSDA 3QNFA 2EVHA 1A22B 2WAHA 2A73B 3RB5A 3CDZA 4H8VA 1G94A 4FEIA 1NC2D 4HT1H 4IKIA 1DBMH 4RZCA 2BVUA 4MQSB 4UNTA 2L0DA 4BFIB 3VD7A 4PJFF 2JI1A 3QORD 4BZ1A 3MV7B 4NP4L 1I1AA 2X2HA 1VGEH 2AERT 2E47A 2AVFA 3LNIA 4ZBJA 5SV4A 4CKQA 4EUPG 4XCFL 1NBYA 1TENA 3WL9B 1MRFH 5F2FA 5AZEH 4FZ8L 1NWOA 2EQDA 2YPVH 1Q9OB 4JN2B 1MCKA 3QRGL 4B6ZA 2DH3A 5KS9B 3I2CL 4FA7B 3M8OH 1KCLA 2EDNA 4P5TC 4A6YH 3D30A 4HCRL 5JPMA 1QTSA 3BT2L 3BW9B 1R1CA 3BP4A 4PRDB 2A6DA 2R2EB 4U31A 1FL3A 2UZXA 3ZMNA 4PJEB 2ICEA 2ZKHL 2WTPA 3ZSSA 1BVZA 5FO8A 1N6QH 2LE9A 4ZUWA 2CLRB 3HE7B 4PJEE 4MZRA 1OAUH 3P4MB 5I19H 1QACA 1ODUA 4ZFOL 4XO4A 2D9QB 2NR6D 4KV5E 5HYJE 2ZKXA 3HC0B 5I1EH 1CQKA 2VSKB 2BNQD 3K80A 2H2SD 3VXRD 2E0PA 3MV9D 1EAOA 2KZWA 4F8PA 4OLYL 2A4EA 2LR4A 4KNUA 4QCIB 1U33A 3OXSB 4ELKA 4R26H 1JNJA 4NOFA 2WKOA 4MQXD 1MI5D 1OEZW 3FU6A 4FYTA 2XA3A 4LMQI 5IV2A 3ES6A 2GJ6E 5IEHB 3CVHH 1UC6A 3IU4H 3NSCA 5DJZB 4DGUA 2CCVA 5CFAA 1SM3H 1S7RB 4TUKH 3GEFA 1QHQA 1BBJB 1WWAX 4A7GA 4DVBB 4JPKL 5CCKL 5C0ND 1C08A 2D0HA 2AITA 1JFQH 2MMXA 2BNRE 4MCZB 4TNGA 5AKSA 4DO6A 3KBEA 4KKLD 4N28A 4NQXB 4RLDA 3HC0A 4XB3A 3SDAC 2EXYC 2R23B 4JFQA 4N25A 1SXZA 4XCCH 5EU3B 1Q9WB 4L1TA 4RETB 1JP5A 3T0BA 4GG6F 1MRCH 1QFWI 4DEUA 1SXNA 2BNRA 2GHZA 2QPDB 4XNYH 4ELKB 2VN6A 3HZKA 1HILB 4WQOA 3RWGA 2Y1ZA 2WK2A 1T1YB 1VGKA 4NZDA 2XWTA 2FGZA 1MCOL 2N7BA 1F4YH 1FNGB 2OMZA 2VRAA 3NFPA 5HYQB 2CBTA 4APXA 1XZ0A 3F7VA 2R1WB 4JY5L 3QDMB 3AXHA 3ALXA 4KY2A 4Z95L 2O26U 3WNMA 2YPKB 1IKNA 4NLAA 3MODL 3LNFA 4BRJA 2V3EA 1A9BA 1P1ZB 2Y1VA 3NZ8A 2E7LC 1AGCB 4Q9CA 4JO3H 3O3UN 5EV7A 2DRUA 1QI3A 1TQUA 3T04D 1DFBL 3SKNA 3V8OA 2VDLH 3QEGH 1AC0A 4FQQB 3WHXA 1MFDL 2DDQH 2FGWL 4D0BA 2L7UA 5F9JB 3IU4L 3RAJH 3ISRA 3HZVB 2BFVH 3FU8A 4JG0L 4P9HL 4ZUUB 3JWDH 2GKIA 5JQ6H 3CFJA 4N2CA 3LCYA 3X1FA 1OALA 4BH8B 3UERA 4R26L 3QULB 4M9PA 1TEFA 4FQXD 5BV7B 2AHIA 2NY1D 3HUJB 4H0LC 3SE3A 1BWWA 1JCKA 3K6OA 5DUBB 2BRQA 2BIHA 2NRDA 5GQBA 2PMZA 3S3SA 1U93B 3KPSD 5TF0A 1QW9A 5BCAA 4L5FE 2I5YH 4LSTH 3TO2B 1MIEH 5IQNA 4JHWH 1GS7A 1KIQA 3K3QA 4XB8A 5EN3A 1YY8B 4S11A 4ZUSB 5C0IA 2FR4A 3ZTDC 1YEDB 3P2TA 3T8XB 1QP1A 2FEEL 3P54A 2L04A 3BAEL 4PJ5A 1KIPB 2NTFB 3VRLE 2DYRB 3WFHB 2MEJB 4OLEA 3TF4A 4J2QA 5E1QA 1FVDB 1O6SB 4HPOH 3WTSA 1VFOA 5T1KD 3VFOA 3UPAA 1GGCL 1IBYA 3MNWB 3BPNC 4R4NC 3BMWA 1AGDA 3L1OH 1MY7A 3AS1A 4N2IA 2APWA 4ZSOE 3EF7A 1INDL 1D7CA 3BPOC 4K2UL 3V0VA 3ERXA 4BXSV 4WI0A 4AKQA 2DN7A 4P3CH 1DVFA 4Y4HA 1K4CB 5JIMA 4OCXL 5F3HB 2A9AA 2YBGA 1MW3A 2BRRL 2VW4A 1OAKL 1A3RH 5GGSY 3QJTB 4QLWA 2WOYA 2SODB 2V37A 3KH3A 3SYQA 4A1RA 2MCMA 2QADB 4XR8C 3QCTL 4FQLL 2ADJB 3QJHA 5LWYH 4CSZA 4YE0A 5I17B 3EXLA 5F7EH 1KZYA 4BUGA 3ARUA 3TCXA 1G7JA 2PWDA 3IMWA 5I71C 5F44A 1DQQA 5ITBH 4EPSA 4L4TD 1A6VH 5HHOA 4ODBD 4JHVA 1FFTB 3BDXA 2HUHA 4GKZB 4JFFE 4GAGH 4GRWH 3U1QA 3OL2A 4O2EB 4PJBA 3WE6A 2VDOL 1HHJA 1U92B 4PJGA 5FK9B 4PGEA 3DX0A 1R5IA 4QY8A 3FONB 2OV0A 3LVEA 5E8OB 2NW3A 3SKMB 4QGYA 4ANXA 1L3WA 4IYKA 1I9JH 2GJRA 1U91A 1U8IB 1KJVB 2ATKB 2BS9A 2JSFA 4UT7H 5GJTL 1TYEB 3O4LE 4JRXB 4LPWA 3O11A 3PHOB 1A8ZA 2HP4A 5I17A 2WLNA 4N1HB 4S0SD 5ANMA 4WJ5A 1QR1B 4KV5F 4FFVD 2IPUG 1HKFA 1OWWA 1IBZA 5C0BA 5I1LA 4HOXA 2AF2A 2GITB 2CA4A 3RTQB 5LWYL 3OLEA 3VO0A 4E9LA 1PAZA 2G75B 1E0OB 3CFTA 3PWNB 2B9BA 1S78C 3QQ9C 4LLDB 1J5OH 3GKZA 2VDML 4FQIH 4HLZH 5ALCL 1O9ZA 1XCTB 4LLQA 4Q2ZA 3A4FA 1R3JB 2EDXA 3B7SA 5F88B 1IGIH 4NP9A 2AJYH 2FO4B 4JJ5B 4WW1B 2VMEA 5EIIB 3N40P 1WWCA 4ONGH 5E2UH 2OS7A 2WXLA 3OZLA 4K2UH 4PGZA 3BDBA 1JMXA 4X99B 5HYFA 4JDVA 4BFGA 2ED7A 2CM6A 3DV6B 3WFEH 4L29A 3ZTNH 3QZLA 3LSOA 4YL4A 4BWWA 5BV7L 2YRZA 5DTFB 3V0WH 5DHMC 2WLJA 5FW8A 2FCBA 4OZHB 1F41A 2XN2A 1NCIA 2X4UA 3U25A 5I9QC 1AACA 4I48B 3GEWB 4JO1H 4NSKA 4WCYH 4YWGH 1DHKA 4PJFE 5TDPB 4M29A 1DZ0A 3PJSB 2XQ0A 3QI9D 4Q9BA 4TQHA 4GY4A 1P6FA 1IV8A 1MCEA 2HJFA 3NA9L 4TNFA 3MRGB 3GSXB 4UOW1 4WU5A 1DSFH 3FN0H 1ZVSA 4XVTL 1CIDA 4PGDA 1HL9A 2O4EA 4S2SB 5FYLL 5C7XL 1BSIA 4QXGL 4L8CA 5JHBA 1JBJA 2CBPA 4UBDC 1Q0XH 2DTML 3FQNA 4AEIL 1I1AC 1TQVA 5KSAD 4ZRGA 4HZAA 1WFTA 2E7CA 4AI7A 3QJVB 1MAMH 1QYGH 1JPFA 1CLVA 3T2OA 2NXZD 4LOEA 5IKCB 1SDDB 4LCYA 2CLZA 4Q6YA 1YHPA 3V7MA 3EOAA 3GXUB 1DQLH 1H9VA 3B43A 2OMTB 2W92A 5DD5H 1F6AA 3SDAD 4UUJB 3KM1A 3I6LE 3KPTA 2JB6A 4OF6A 2MWCA 3BC9A 3KJ6H 4NS0A 4WUUE 3I6KA 4WNQA 4AYGA 3AAZB 1L0PA 1IQWH 5TPWL 4ANKA 4O02L 5L4JA 1PKQA 1U0QA 5EO0A 1X5JA 2XN1A 3MSPA 4OTXH 4UM8A 2HKFH 5LBGA 3TN0B 5F6IB 5J6HB 3GSOA 1JAEA 4H26A 4PRHA 1JWSB 3E8UL 4IBSA 5DI8A 2V9RA 2PLTA 3VD0A 3WL9A 1KYOJ 1YNKL 5D4HA 2O5XL 4PRHD 3K4AA 3TJEH 3X2QB 3QPQD 3GRWL 4AEHH 4GQPH 1A7QH 3UGXA 1HHKA 3SBWA 3EH1A 1OB0A 2VDOH 4AMWA 3LXBA 4JZNA 4GIAA 1NAKL 3X3GL 3MLYL 2YN3A 3BFQG 3VFRA 2CE6A 4RMWA 2X9XA 5JHDD 4OZHF 4DO5A 4GQ9L 2I69A 3RGHA 3AMKA 4FFTA 1M53A 3O2VH 4M5YH 5D7JA 5E8NA 4H26B 4PRHB 2CNZA 3IETB 5E0FA 2WKLA 3BAYA 3OKMB 1EWHA 1UM5L 1KIUB 4CU8A 4E0RA 1CFNA 1R0AL 1L9NA 2XPGB 3RWDB 3C6LD 5K69A 1UXWB 4I13B 3FS9A 1UT9A 5LCVA 2X4SB 1XIWA 3TYFA 1E4XL 3TCLB 5HHPA 1YEWA 2DQTL 4IU3A 5LGHL 4NC1C 3D9AH 4I88A 1PVHA 2FL5A 3QAZC 3IVKB 1I1FA 1BQKA 4ZS7H 4NWUH 1UA6H 1VFBB 3BW9A 3MBXH 4KMTL 3TWYA 4QNPE 4XNXH 1RAMA 3RU8H 4L0PB 4HWNA 2WXOA 3GZPA 4KQ0A 3EFDH 3KDPB 4G6AD 3WD5L 4KRMB 1CD8A 4GSUA 3L2MA 1CL7L 3V7AE 4HJUA 1KDJA 1QO3A 2WLYA 4Y19B 3SBWC 4KXZH 3IF1B 3AABA 2X89A 3QXAB 1Z7JA 2P8MB 3P30L 4G8GB 5FA4A 4DGVH 1KCUL 3LIUA 4AQ1C 1BA9A 1HXYB 1U41A 3N1QC 2XT1B 1C5DA 2A2QT 3SD2A 1VA9A 4MXVF 2NSXA 4P23A 2BW5A 3AXLA 4BSVB 4YHOH 5D2NC 3FOMB 1CFBA 1X5GA 2IH1A 2HTLD 4RMVA 2EDTA 3FTXA 3FCSA 5A2LH 3AT9A 4ZZKA 5IW6B 1AO7D 4H7VA 4ISVB 1CTMA 1S2EA 4D8PA 3E7JA 4YDNA 3CSFA 4IOFD 5EF3A 1XF3A 1BJ1H 3NIDE 1R24B 4G6ML 2GCYA 4ZYKA 3FFDB 4ICXA 3QDMA 4YH6A 4Y1AE 3TLRA 1BEYH 3LH9A 4CC4A 4OBRA 1VCBC 1P4LA 3BUYA 2P8MA 1AIZA 1RZPA 2R2HB 1R17A 2AQ2A 2ZCLL 2XU9A 4NRYB 4GXUM 4QXTB 4XHJC 5I8CA 2A3TA 4KU1A 4HWUA 5DJ0A 3BDYL 5HYJD 3MRNA 4FXKC 2VDKB 2EIMB 4KBPA 1PLCA 2TRYA 2ZOOA 4RMQA 3CG8A 3GMMA 3MJWA 3TFKC 4CILA 4U7KA 4G2AA 5BS0E 2F54B 3ZE1B 1B0IA 4XX1E 2Y5TB 1IEAB 5SWSA 4G6FB 3CPUA 1P4UA 2ZOWA 4Y0GA 1UD8A 2W65B 1YJDC 1ONQA 1VCAA 2HRPH 1G6RB 3RDTB 1O7SA 4EN3C 3EIFA 1KTBA 5K9JL 2ZYHA 5E9DD 4Y9FA 1B4LA 1OB1A 3SQOL 4YIQA 3D69B 4D0DA 1Q94B 5K33A 1JF5A 2WVVA 4KH9A 2E86A 3B34A 5G5DB 4ACTA 2C1OB 4APQB 2IPKB 1KACB 3FJTA 4PHXA 1A1NB 1KN2L 3PUUA 3ARFC 3S7GA 3A4AA 1PSKL 4ZUUA 1DLFL 3T6ZA 4FFZH 1P2CB 2I07B 3D12B 2B2XL 1S78D 2HWZL 1KEML 5GS1B 1BZ9A 3PWVB 2DEYX 2GUYA 2UY7A 4YBHA 1L6PA 3LPGA 1ONQB 4ZX6A 3OGCB 5AOLA 3WUZA 1SPDA 2JKWA 1OZTG 3WBDA 1AGDB 2G5BB 3Q7JA 5CGYD 3HN5A 4KI5F 4Z5RB 4OLXL 4N2DA 2YMXL 3QDAA 3VI4A 2BDNH 4FHBD 1A1MA 3FQUA 3HS8A 4L23A 4X5RA 5C0FB 5G5DA 1BFVH 2NY7H 2HKHH 2ZUTA 2Q7YA 4KKAD 1CUOA 3CH1A 3CNKA 4OLXH 5F97E 4L4TB 4LEXH 4QKTA 3D0LB 4ZSOB 4XOAA 2P47B 2H3XC 4JKPH 4N2GA 5IGXH 3FB6B 2DMHA 2O93L 2ILLA 1CFQA 1ZLUH 4APQC 2J8HA 3QXDA 4XCNB 3NACH 3RVTC 1OAXL 3TV8A 5AYTA 2IALB 3BWAB 4HJIA 5ES4B 2DOCA 4ECNA 4I18A 3FFCA 4PSRA 4JFHD 4LPXA 1MREL 3L81A 3IGFA 2YOCA 4XBPA 3SY0B 3MRFB 1JIBA 3P77A 5ICUA 4Z0XA 1GXEA 2WP3O 1KWGA 1S7VA 1I1YB 2BO0A 3EJPA 2I32A 1OHQA 5M7QA 4Z7WE 3RP1A 2BP5M 2LTQC 5FV2A 2B1OA 1ZSHA 4NN5B 3BP7B 1IKOP 1M1SA 1FJ1B 1YA5A 3OHMB 5EEZA 4OFVA 4MJ5B 3TBTA 5F9DC 4GS7C 5DYFA 5LLIC 1XGZA 2K0RA 1RK1A 5CZXD 1GHFL 1L4IA 1ZHLA 1VF5C 3SKOB 3FHAA 1G7LA 4PTTA 1NWPA 2XFXA 4D9RD 5I1AB 4DPAX 4AUYA 4OJDH 4Y4FD 4P2OB 1BGXH 3SDDB 5I16B 5C0RH 4K7FB 3VFTA 3DO7B 1KN4L 2VRQA 4NQTA 4N90D 4UQ2B 1OTSC 3L3KB 3UTOA 1S9XB 4FXTA 4IRZA 4RX4D 2F5BH 4NCC1 1I3UA 3ZUNC 5GRJL 2WO2B 4FI6A 4U1LB 4V1DD 3CZJA 3AS0A 3NIFF 3DJRA 4H2CA 3DVNB 4LCUB 2FT6A 3OHXA 4LHJB 4MA7H 3KW7A 4K9EH 1CVSC 5AWNH 3UEZA 5E08H 2HMID 1THAA 4GPVA 4HS3A 1FGVL 5EIIA 3B9VA 5DUMH 2OCJA 2WINB 5IK3A 1PZ3A 2Z35B 1IM3D 1KPUA 2D73A 3NFNA 1YO4A 5D1XB 5D7JD 1OSPL 3EGSB 2XWBB 3B8SA 4E5XB 2FBRA 1KTKE 3IAQA 2XRAH 1UD3A 3IFPA 2ZWYA 2XTJB 3BPLC 1NOFA 4N2OA 1AQMA 1UT1A 4YHKH 5AVXB 3GLAA 1SXCA 5E8PB 3V6FA 3BUDA 4U6XA 1NSNL 4GRWF 4U1JA 4NZRH 4FL4B 5BVPH 2N3JA 3AM8A 2NSQA 4MD0B 4GNKB 2YN5A 5HGAA 1QWUA 4NHUA 2FRGP 4JRWA 2GHWB 3HBZA 3COOA 2C9VA 4IOSD 1MDAA 2QPUA 5GSRA 4QHPA 4WW1A 3NFSH 3MYJB 4PTUA 1MG3C 5T1LA 3S37L 4BFOA 5HYSA 4QRPB 1KB9K 4OCNC 3D2UD 4H4NA 4R7NA 3MRIB 4AVJA 2FJUB 2MNJB 4H25B 2AQ1A 4JPVH 3V79C 4X6BB 2RFXA 3ATBA 1MJ7L 3QFJB 4HD9A 4M93C 1U58B 3GLZA 4QAWA 4UANA 5ACZB 3MUZ1 4B41A 3RILA 2AK4E 3GI8H 2Y3NA 4N2LA 3IXAA 1DP0A 5HVHB 1IILE 5DUPH 1ES0A 1JN6A 3QXVA 4X80H 5E6RB 1I7UA 2DS4A 1J0HA 4TSBH 4WSKA 3S5LB 3O2DH 5D7HA 2GY5A 1W0YT 4TSAH 4WWOA 4XPFL 5AB1A 4XNDA 1AQ8A 4PI2A 1HWGB 2OSYA 3X3GH 3QUMA 4OD1L 3L3JB 1RY7B 2VLKD 1QG3A 3QORC 4LK4A 2IEPA 1IBDA 1DO6A 4ZNCD 3OJDB 4KPHH 1IQDB 4ZXBC 4D2NA 3B7UX 3GC3A 1CICA 4G3YL 1UJ3C 3GBMH 3OKOA 2J4WH 1NANI 2VN5A 3WFCL 5EOQL 1G0DA 2O72A 1KLFB 3TIEA 4KJQD 1G0XA 1JD7A 1MQKL 1G87A 3LHAA 3LS4H 1U8QB 3Q6FA 2E7MA 1YNKH 5I71B 1NCDL 3HPJB 3EYOB 1CC3A 1UYWL 2LLGA 2K9FB 5ERWA 5GIRB 4X4ME 2VC2H 2IH8A 3VSVA 5CEXB 5B1JC 4XMLL 2DIAA 2I9LB 4GMTH 3T65B 4UDUB 1G9NC 3KPMB 3WIHH 43CAA 2DYPD 3GINA 5JPNC 5DEGA 5IBTL 3VE0B 4I4WB 1KOAA 1FORL 1E9QA 2GK0B 2GBVA 1VFMA 1YMHA 4JGUA 4R4FL 3WKQA 4FABL 1A6UL 4BK5A 3HVNA 3L3IB 3WNOA 2Y7QB 2W9EH 4C56A 4WFFD 5DJ6B 3FCTB 1I7RB 4NC1E 3WEXB 2O5YH 1U8MA 4HBCL 3ZLQC 4FYQA 4QHNB 2GJ6B 2W5PA 1R5VA 1GYCA 1X5LA 2DLIA 3CX2A 4ZI8A 4MCZA 3MRRA 4C56E 1IGFL 3T3ME 3T71A 4KVCH 1RV6X 2Y4SA 5DO2C 1QFWM 2IFGA 3AB0C 4C83A 2GSMB 3H2PA 2AXGB 1A6PA 3GBLA 3KPMA 1RURL 3R4DA 4CC0A 4GUCA 3VI3B 2A83A 2FSDA 1DEEA 3V4VH 3US1A 4ZTPL 3B2MA 3QUHA 4RNRA 2G0KA 1SMAA 5IESL 3ILDA 3SDYL 3KPLB 5GZOD 3LH8A 2E56A 1IM9A 3OF6D 3QEHA 1TVDA 1A6ZA 4KDVA 5KYYA 3JZ7A 4R83A 4F8NA 4OCSL 1OOAA 5A2CA 4JUTA 4X7SH 3EZ8A 4POUB 1I3GL 1UWYA 3MJ8A 4ZS6D 1Z0NA 1CFTA 1XFPA 2UYLA 4W9EC 1E90A 3LOWA 2ZP0T 5GZNC 5LBSL 2MPVA 3MUUA 4OGAC 1CI5A 4BKLA 2FJHB 3FTSA 5FO8B 4A2MA 3CDFA 1TYRA 1XIWD 1FNSH 3A6BL 3TBVB 1EX0A 4HULB 3OB0K 3F65A 2Y6SD 1BOGB 1JG9A 3CHPA 2D7NA 2IAMD 3AWEA 1ESOA 2BNUA 1J8KA 2WWKT 4XOCA 1EXUB 3FO2A 3PHQB 4BCZA 1SLVA 5CUSL 1UB6B 2VLRB 3JV4A 5JHDE 2D3LA 4DP4X 5C8JA 4MAUH 5HHOE 4G7VH 4JRXD 1HJCA 3OC5A 5J1SC 4GSDL 1NM9A 4CJ0A 1WUNT 2I9TB 3EJZC 1XGRB 3QSKB 4ZFGL 3EYUH 1JPSH 3IFLL 4MXQC 3NCYS 3P3RA 4UILH 2VERA 1ADQL 5DJZA 1X3DA 1EZLA 3UTTB 2CIKA 4QJ5B 1VSCA 4R7LA 5HHMB 3GSOB 3T3MB 4BFKA 4PAZA 2IF7A 3PLYA 3WGVB 4GT7A 1JYWA 4PUBH 3E2HC 4GP4B 1EEQA 5CM1A 3L4WA 1E40A 2YQ3A 4TNVK 4CDHA 4N3TA 2BP3A 2GSGB 3W56A 5LBSH 1EJFA 4WI2A 2Q7AA 2IXQB 5CBEB 3BQUD 5KANG 3VGAC 4XAKE 3R06B 1MW1A 2D2OA 4UZUA 1GJIA 3CFIC 3G5WA 1CYGA 2I24N 4YHNB 35C8L 3H9SA 4YUEH 1SYSA 4KI5E 5C9KA 3MZTA 3WY1A 5I1GH 2GI0A 4YWGL 4D94A 4AOFA 1EO8L 3AWFA 5JIDA 1NL0L 4UIKH 4J3WA 1KFGA 4G70B 1BQHA 4I0KA 5FA3A 3ZDZB 1P2CA 3ZVVA 3ATDA 1CE6A 4WWKB 3G6DL 3UPRB 4XO9A 3FPYA 1W9XA 1KXQA 4P2OC 3VFNA 2VAAB 4QHMA 5D7IE 1KPRA 4U05A 4FQLH 2BIIA 2HMIC 1VESA 4D0BB 1L9RA 5MI0B 1VZGA 3VGBA 1SMDA 2WY3B 3WEBA 3HCVB 3QNZB 4YDIL 1MLCB 3GPSA 3EJRA 5A6LA 2CKBL 4N9GA 4G8GE 1TNNA 1J8HE 4P3CL 1LGVA 1R5IB 4QY8B 3SDXA 4HWEH 1BVOA 3FQ4A 4FLRA 1D5XB 1IEBB 3AFLA 2FEDC 1F11A 1IC5H 1ETB1 3EGDA 3NRFA 2I60L 4HHGA 4KTYA 2FK9A 2JIXA 3F8UB 4FABH 3Q01A 4U7MA 4CVXB 4DKDC 3WTTA 1SJHA 3H54A 3U46A 2F1BA 1DCLA 4YVNA 1JUFB 3PV6B 2APSA 4UTCA 2V3DA 4HEMA 5D96C 3CHRA 5I18H 2ADIB 2VC2L 3MUY1 5LQBL 4LCCA 2KZBA 4JUSA 4U1SA 1KIPA 2NTFA 1L9QA 3S5LG 1ZE3C 3DIDA 2B1AL 1BJ8A 5I24A 3HMXH 4N0UE 1W72B 4AW7A 4PBDA 1RJLA 3I02B 3S88H 2JLPA 5EC2A 5C07A 4JGMA 1D9KA 3TS8A 5IJBC 1ZGLM 4UQ3B 5T1KA 4ZNEA 3AADB 2DEXX 1P7QB 1HE7A 3L17A 4J6RL 4KKCC 4MFHA 1WWWX 4GMSL 4TNVF 3V0VB 1AQKL 2W38A 3LXUX 2VR8A 4G8IB 3VXSA 4AQEA 1GMIA 2CUAA 3O3AA 1BDYA 3MLTB 1LP9E 1NEPA 1GAFH 2R0LH 4MQTB 1LO2H 4DN4H 1YN6A 1JV2B 1I4FA 4KK9C 4OCMC 1M3JA 2VLJA 3DIVA 5CJXA 2YUWA 4K7PY 4OV5A 4HJTA 5EU6B 1OVZA 1CFSB 2NX5E 1T3FA 3KS0J 3V52H 3N43B 4FXGB 4PRHE 4UU9A 4ZD3L 2DYPA 5H37H 1CDYA 3DI3B 4I1RA 3B9KB 1B2WL 4ABQA 5EO9B 3OC8A 5JR1H 3U79A 3C5SB 4XMZA 3CFEA 1H3UA 2MTPA 4Q8BA 3F7LA 3Q2WA 4GKZA 2CUMA 2K3HA 4XTRD 3QWRA 4AZ8B 4KFZC 3IDGB 3H9HB 3WNLA 5JO5B 1P69B 4XPGH 4OCYL 1F13A 5I18L 3QJFB 4YLBA 2C7FA 5E9DB 2G2PA 4PJHE 3V6ZB 1XL4A 4UM9B 5K1NA 1JYXA 1IZJA 1ZHKB 3GTVA 4NN6C 2DKUA 4YHIB 3RDTD 3ME0B 2XIDA 3JUYA 4LNRA 3IDIB 1Z3GH 3TVMC 1FZMB 4XE0A 5HGBA 5K39B 4DGYH 3IJHA 2V3FA 2FX9L 2IFFL 3UBXI 1U6AL 1CURA 1OP9A 4PJAB 1AXTH 2BX5A 2YPLB 4KJPD 3TYGL 1ETA1 4ILDA 4LSDA 4IGBD 2CJTA 5DD5L 8FABA 3QH3A 1KCWA 2G3XA 3BO8B 4MZIA 4N8CL 4QF1B 4G6JH 4XHJD 3LRLA 1I1AD 5KSAC 1TKWB 5CMAA 2NY3D 1ZLVH 1JDAA 1RJYB 4JFPB 1KLGB 1COBA 1FVCA 4LRNL 2PPDA 4JANB 3JVFC 5TDOA 4LF3A 1FLRH 1UWXH 4UM9A 3V6ZA 4KVNH 2ADYA 2FNWA 2E9GA 4MKTA 1ECYA 3OLIA 3GXFA 4RDBA 4P2QD 2WZPA 2WO4A 4MWFA 2V5TA 1WVZA 5LCVL 3IDJA 2E75C 3K72B 4PJ5D 1UOWA 4XWOD 5J3HC 4E68A 4ETQA 4ZOEA 4WDIA 3CZKA 3FN9A 3DI2B 3LPWA 5D1QA 4HH9A 3X3FH 1I3VA 3GRBA 2V5SA 4HCFA 2XC8A 3G08B 4RBPH 1BZ7B 4XODA 1KBWA 4OR1A 2F7QA 3EYFB 3NYKA 4YHZH 4ZMAT 3PQYE 4XPTL 3IWUA 3FOLB 5LHDA 2XZQL 2FHBA 5AQ0A 3MA9H 3ZDXB 1A4BA 2V2TB 3QXUA 2P3YA 1IC4H 4EF3A 3G5ZB 1N5AB 3WN6A 3CPLB 3ARDD 5LNDA 4YS4A 1F90L 3IXAB 2F18A 1JGEB 2P49B 4J27A 2EDDA 3EDDA 3GIVB 4GAJL 5D2LB 2VZUA 3SDDA 1XIWB 3TYFB 1WFJA 3O8XB 1QSFE 2CDGB 4F58L 2VLKA 2L3BA 3ZKQD 3F6IA 4LLVA 3LTVA 4Q4EA 1HHHB 1XMEB 4KKAC 4MMZC 1XF5A 3T2QA 4IDJH 4IRJD 5E4AA 4N0FB 4DWHA 4ZOCA 4M5TA 5E2TH 1NBVL 3RVUD 3CVHL 5DVOA 2R15A 1YECH 1HAWA 3KLAA 3N1MC 3SQBB 2Y1AA 4YDLC 5DJXA 4LQFH 2VMFA 1NBZA 3QUZA 1K72A 4M5SA 3Q6FB 4XHQA 4KO5A 5DR5H 3CMOH 1YG9A 2GEEA 5C09E 4DKTA 4XVUD 3AAZA 4YDMA 5ID1A 4XH2B 4BBWA 4MMZB 3TBWA 4MJ4A 4C83B 1JWUA 4M6AA 1XWVA 2V17H 2NQDA 4OLZH 1QPXA 5C6WH 3UAJA 4UTBA 4GW5A 5D7EA 1LO4L 5KANI 1QABA 2QGDA 3IWVA 1ZWIA 1UWEH 1EZVY 4JKNA 4GSXA 1IBGH 3Q0HA 4TUJA 5E95B 4C47A 2GJ6D 5JIPA 3M07A 1BZOA 1GRWA 5EZJB 4JPIA 1MCLA 4CMHC 4D0CA 2UVFA 5AOJA 1B4JH 2BSRA 3JVGC 3OXSA 2NY4B 3O9WA 1DBAH 2DQJL 4P2QA 4RESB 3BVUA 4KTDH 3VGDA 3SDCD 4UNVA 1KGWA 3O6FB 3ZZQA 1FRGH 2GC4C 2Q8BH 2X09A 3W11C 2W0KA 2DMGA 4QYAA 1HZHH 4YDKL 3D0VA 3ARXA 3MRIA 5KZCD 4KX8A 2XBDA 3BZ4B 1MLBA 4ORGA 5F3BA 1E4JA 1TETH 3MDJA 2CKNA 3HFML 1TT6A 5ANME 3LB6D 1IEAA 3MNVA 2NR6A 5F6HJ 5GGRA 2HJLA 4IIQC 4GQRA 4U49A 5L4FA 3CXHJ 4Z7QE 5KYYB 3US9A 3VJ6A 4X9YA 1H3PH 2APFA 2F54E 2OTUA 3O9WB 3FFCE 1SLXA 4WV1C 5CJQL 4RX4A 2Q10A 4PRBA 1U8CA 5HDBF 3E6HB 5BMFL 3OM3B 4Z7AA 3D3VB 2EDFA 2EEDA 5D2LF 1AS7A 3HS0B 3P3UA 3SDDD 1PEWA 2VZVA 2X3BA 3SE9L 5PCYA 1JVKA 5BUPA 3TEZA 1DJYA 3L1GA 4GOSA 2WCGA 4M7JH 1H9DA 3OF6A 4KI5C 3DO3A 1K2DB 5DZVA 1V7NL 4JHWL 4A66A 4EKXA 3NZUA 1C5DB 3IXTA 4NKIL 3SKNB 2I5YL 2R23A 4ZUTA 4NI3A 4UQAA 3P9LB 3OPUA 4YPGB 3QQXA 3KHOA 3KVDD 4P23B 4DQAA 5MP6H 2B14A 4RMSA 4R4BA 5AL8A 1TU2A 2B7DT 4AKPA 2H45A 4TL5A 1UCBL 3RA7L 2FQFA 4X6CF 5H94A 1ZIBA 3MJ9A 1JSYA 5T3XE 1O9WA 1VIWA 3FQXB 3FRUA 1A0QL 4P5MB 2R0WL 5E5UB 3LQAH 1ZJBA 3D06A 2XOTA 1GGBH 1MJ8L 1Z9NA 4IU2A 3RI5F 4Q6IC 2DQTH 1G7MB 1N3NA 4XI5D 4ANVA 3MJGX 5IVXB 4MSWA 2LFGA 2HT2C 4PJEA 5IQ9A 2EAEA 5D9SB 3OKNB 3I6GB 3MLPA 1J11A 1LO0H 5FGSA 1R0AH 1TJGL 3PWUB 3VD5A 3UJJH 4GAAA 1ZLVK 1MVUA 3SGJA 3FF7A 3WFDH 3BSGA 3LKRA 3GSWB 4EI5B 4GXVH 2Y6TE 1TVBA 2DY2A 2VH5H 4ZK8A 1MFUA 1RUMH 3LZOA 3QUYA 4P46C 3RVTD 4Z76A 3V5HB 3CVBA 2IANE 1WAPA 4FERA 1G7IB 3FO0L 3PP3H 1J1XL 4EN3D 3S3PA 1K4CA 2ROXA 3D2TA 4OZFB 1UJTA 4LSQH 5JUEH 4QOKB 4DVRL 2X28A 1QFUH 5DUML 1HI6B 2XVLA 3BPOB 3IK2A 4OIBA 2BY3A 1A02N 1DUZA 1TFPA 5FDYA 1IX2A 2CLVB 2ADJA 4AGOA 1OAZH 1HCZA 4PVNA 3ABGA 3K8LA 2LU7A 5C0DA 1HX0A 4XN7A 3FQWA 1NGYA 5I2IA 2F2HA 4G8EA 1PNDA 1RFDL 1UURA 4A7GF 3HG3A 3KL3A 5MEPB 2MCG1 4OQTH 2F54D 2LFEA 5BRPA 5KJ4A 3CH8A 3AM8C 2CK0L 2J72A 3BX7C 2FIRT 1EBAA 4K71B 4N4YB 4ZMWA 1DQLL 1T66C 2CO6A 1G9EA 3GIZH 4FTVB 3EJQA 2FATH 1BF5A 2IBZX 4QRQA 3CIAA 4U6YA 4HF5H 1PNCA 2NW2B 4N85A 3KPOA 1A6WL 3NCWA 1FAIH 5CJOL 2K4AA 2A6IB 1AQDA 3BQUA 1T83C 5IB4B 3CFCH 2XZCH 4P0DA 1HT6A 1QSEE 1ND0A 5EZPA 1G7JB 4Y5VB 3WENA 5IP4A 2AC0A 2Q86B 4R7DB 2Q7NA 1BWMA 3F84A 4A6YL 3R7QA 3QG6B 1OQXA 4ZS6C 3RE0A 1OF0A 3S34L 1T2XA 2ZXWB 3KNBB 3QRGH 4G9FD 5GZND 3NCMA 1FZJA 3GXIA 2P42B 3D1MC 3MRDB 4FZ8H 5BZXA 4ABVA 4OGXH 3KLSA 3DXAD 1U8NA 2Z7YA 3BD4A 3KPNA 4G6KH 4XE5B 5HHMD 4DFHA 1TVHB 2CGRL 4GI6A 4F33A 5IBLD 2XA8H 3V2AR 5I74B 1Q72L 4DN3L 1GW6A 3NACL 2YD5A 5BZDA 5KVDH 4M1GH 3BN9C 1G7HB 5DRZA 1WIPA 4F8TA 3VB9A 2P8PA 5E70A 1TUPA 4OJFH 5JYLA 5T3ZD 1RK1B 2F7IA 2BOCB 1U3JA 5E6IB 4JQXC 1J0ZA 2VLRD 2VAAA 3O81A 4WI4A 4NC2B 4OLVH 2CRMA 2IBZY 2O5ZH 2YUZA