3PFUA

N-terminal domain of thiol:disulfide interchange protein dsbd in its reduced form
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
119
structure length
119
Chain Sequence
b'GRSQFVPADQAFAFDFQQNQHDLNLTWQIKDGYYLYRKQIRITPEHAKIADVQLPQGVWHEDEFYGKSEIYRDRLTLPVTINQASAGATLTVTYQGCADAGFCYPPETKTVPLSEVVAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein dsbD
publication title Oxidation state-dependent protein-protein interactions in disulfide cascades
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 23
structure length 119
sequence length 119
ec nomenclature ec 1.8.1.8: Protein-disulfide reductase.
pdb deposition date 2010-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11412 DsbC Disulphide bond corrector protein DsbC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1250 Mainly Beta Sandwich Immunoglobulin-like Thiol:disulfide interchange protein DsbD, N-terminal domain 3pfuA00
1Z5YD 1JPEA 2K9FB 1JZDC 1L6PA 3PFUA 2K0RA 1VRSA
chains in the Genus database with same CATH superfamily
4A2HA 2NY7L 1RUPH 3VYNA 4Z7UF 2GG1A 5JPMC 2JKSA 4OGQC 2W8CA 4CMMB 3VFGH 5KS9B 1QO3B 1OARH 2WXOA 1PJWA 4RGMB 4WEEA 2MOQA 2ODHA 4RRPG 2LOEA 2HX8A 1MWAH 3VMOA 4N5ED 2D7MA 4HPYH 4JFQB 1Q9LA 4PJIA 1BQ5A 3JT0A 2A6KA 1FSKC 3E1F1 3VD9A 2CJ3A 3QNXB 1MFDH 5E8PA 3E1ZA 1HSAA 3EYSL 3JWDC 1O7VA 3VWKD 2YGVA 4OFYA 4XC1H 2FDBP 1WA0X 3SYOA 4KVCL 2VZOA 4NKDB 1LK2A 4XN8A 3ALXA 3FS9A 3VH8A 1J8KA 1MHEB 5LDSA 3SD5A 5MENA 2G9KA 4PJCF 4N8VB 1ETB1 2KDGA 4HJTA 3W39B 1DBAH 2VABB 2VLJB 3U2SA 1JFQL 1T3FB 3HMWL 1ZDQA 1RIUL 1U8QA 1RUQH 5D7LE 2QPEB 2A74C 3GSXB 1F02I 3CSPA 1XXDC 2DLEA 2X4RB 5CJOH 3GMOB 1ZHNB 3E3QC 3G5VB 2ICEB 2VN5A 3EO1A 4PJHE 3ECQA 3E6FA 3VI3B 2Q6WB 2YD4A 4NQCB 2BMKA 1KJ2H 2ZP0T 3FQ2A 5GJSL 2KI6A 4JHAH 4JUTA 4QOKD 3A6BL 1K5NA 4OV5B 3N6YA 3BH9A 5E2UL 3L9EA 3QA3B 2VDPL 2A2QT 4FQCL 2YD6A 1T1XA 2YQBA 1UM6H 3TJEL 4OCRL 3BPNB 4ZUUA 4FABH 1BVNT 4U1SA 2W91A 1HILB 1H8SA 1YRKA 3ETTA 5GIRA 4IBZA 3KZ8A 4P2RB 1RVFH 4K3HA 2WQVA 5FYKE 3VE0B 4AYSA 1XGUB 3CQPA 1OAKL 4WWKB 4WEMB 3BIKB 1U3JA 2IDTA 3U0TB 5I16A 3IJHB 2H41A 3QUYA 5AB1A 3L3JA 5C0DA 1IBZA 3VW3H 1MIML 2NMSA 5B22A 2PWFA 3GSRA 5KSAA 3SYAA 2G0LA 5CJQL 3RTLA 3ELAT 1ZTMA 1S7QB 4HWEH 3O4LA 2YGOA 4YXLL 1QBMH 1KTDA 1NAKH 4IU3A 4LPWA 1IBBA 4N0FB 2YD7A 2EE3A 1G7IA 2FYYB 4G59C 1DYZA 3UPCA 4E9SA 4KY1L 4NOFA 4UU9B 3VVVA 3L5XL 4AQ8A 4WKXA 4PRPA 4JB9H 4PRIB 1R3LA 1EXHA 4H8PA 4XCFL 2E27L 1VCAA 4YH6A 4Z7WF 1RUPL 3FCGA 5HVHC 3WO4B 2VDQH 1QSEA 1J9RA 2OJZL 1EJOH 2XZQH 3TO2B 1E27A 1KJVB 1LO4H 4AYBA 3JWNH 2PW1A 3RVXC 1M1XB 2ZG1A 4UQ3B 4JPKH 1WWWX 3SDYL 2FAUA 2NYZA 1MCHA 3CVDA 2BCKA 5D7IF 4KGJA 4XVUD 4ESKA 2ADFH 2UY6B 5AOMA 1MWAL 3SDDC 3AITA 4PYHA 5EZJA 1RZQA 1UD5A 4HPYL 2EADA 1UWGH 4XPHL 1KTLA 1HYSC 1FQ9C 3BP7A 2DV6A 4UOW1 3FT2B 2PTUA 5IM7B 5JA9A 5AW9B 3VRLE 3OF6D 3OGCA 4B9JA 2KZBA 5L0QC 5CZXC 2ZXEB 3V6ZB 3S35L 4G9FA 4HFWB 2AERT 1K5WA 1EEYB 3WFHB 4AJWA 2QGEA 1S9XA 2BY3A 2PWHA 4ZS6C 5SX5H 2QPFA 3WAKA 3MRNB 1AD0A 2IANB 1AVAA 1VB9A 3VJ6A 1E50A 1QFWL 3KYMB 1G94A 5EO1B 3V0IA 1E4HA 1LP9E 1M6OA 2FO1A 1TVHB 5JR1H 1F45A 1SGKA 3KAAA 2XPGB 1E2ZA 1RJCA 1RUQL 5GS2D 3N1GC 4I48A 1YECH 3HE6C 1N5YH 1QW9A 2OMWA 3LKRB 3MV7D 4KVNL 4LLYA 5DEGA 4Z7QB 1JD7A 3K8MA 3KLLA 2DQIH 3RA7H 1AC6A 1KB9J 3UTSE 3KEHA 3SE3C 1RK0A 4JZNA 4QWWC 5I66B 4M1CD 3NT0A 4O2FB 4GEIA 4UINL 2ROXA 4H25B 5T1DH 2VN6A 2R2BB 4ATWA 1OD9A 3E0GA 4R7NA 4F80A 2XIDA 4QRUA 4I4WA 2C9AA 4AGQA 4FABL 4GG8B 1OP3H 1GGCH 3GB7B 3O6FD 4OH2A 3Q1SH 4RMQA 4XC3L 2L4OA 3D18A 1IGYB 2J20A 3HS0A 2C3GA 5B38A 1TOXA 2XV6B 4FFWD 2P8LA 1OLLA 4KJWD 2X9XA 1I7TA 1A3QA 3PJNA 3NUKA 1A2YB 1UWYA 5D7JB 3K0WA 2V5TA 3KJ6L 3EHBD 3W11D 3MCLH 3K2UH 3B2MA 4PRHA 2NCMA 1NCCH 4CVZB 3X13B 4RSVA 3WLBA 3U25A 3VDCA 3K80A 5ICYB 1ZT1A 3E6HB 2F9BT 5EEYA 3IDJA 5D96B 3QXUA 2WWOA 4QXWA 5K9QG 4ZUWB 1CUOA 1I3GL 4JB9L 3W2DL 1NDGB 5C0IA 2NPLX 2WAHA 1T4WA 5LB1A 3IJ9A 2VUOA 4WCYH 4ACTA 4O58H 2VL4A 1EJOL 4NN7B 1LO4L 3UTOA 4ZUVA 5JW3L 1WAAA 2HT3D 4Y2OA 5C0FA 5I5MA 4JPKL 3EO9H 5MI0B 1T21B 1YPZE 3HZ3A 3G3LA 4HS3B 2RGSA 1S9WB 3EJQA 3RFRA 1HHJB 4CRPA 3D09A 1BZ8A 2C4XA 1UWGL 1OGAA 5F7YC 3MR9B 1S78D 1TF4A 2J8OA 4PVLA 3SOBH 1NBVL 2WGXA 5E4OA 3IFOA 4PJ9A 2IBZY 2Y1YA 4XOBA 4EZLA 2K8MA 3TN0B 2F8IA 3ATFA 5DEFA 5T1KD 5HYSG 4F2MB 1K2DA 1CFVH 3NZHH 5D4JA 4AJ0A 1MW3A 2YR3A 5FFGA 4B5EA 3MJ9A 4QY8A 4XXWC 1YO4A 4QTHA 1PX3A 4KROB 1DE4A 3SBQA 1AJ7L 3UZVB 2I85A 2WXHA 5IB1B 4BFNA 2JQAA 1YECL 1N5YL 2AQ2A 3DRQA 3UBXI 4NQDB 5BJTA 3L54A 4GRWH 5GSVA 4J3VA 2HFEB 1G43A 1YJDC 5FUOH 1HXKA 4I18B 3UJJH 5A2KH 2BINA 5I6NA 4ZXBA 2P80A 3M17A 2H26A 2VT0A 3SDAB 3PAZA 2IAMC 2G60L 3COOA 3MACH 5IK3B 3RVUC 3TVMB 2YQ2A 3JVGC 1TEGA 2H0EA 2NNAA 3IE4A 5GZOA 3KYKL 1RD6A 3CC1A 2DYSB 2OAAA 4B7IA 4HKBB 3JSSA 2E5EA 3I9GH 4UUJA 4WI3A 3V5DA 4D9QD 3MCLL 1JS4A 2DIJA 1NCCL 2Q76A 4QKTA 2J6EH 1DTUA 1NC4A 4NUMA 1D5MA 3LNFA 3DX4A 3GHEH 2V8MA 4X8JA 1LWHA 3LKSB 2OI9C 3SCMA 3SB3A 2VC2L 3IN2A 4FERA 3HNVH 5IW3A 3U30B 1NAML 3CIAA 5IB2A 1P4LB 5HGAB 1ZSDB 3PQYA 1QHOA 5AB9A 1WIUA 3S34L 3PUCA 4O58L 1J0YA 4ZQTA 4L29A 1LWJA 4JY6A 1HFUA 1G4MA 1O75A 2V5YA 1BZ9B 1CFTA 4NC1C 4YC2B 4E5XA 3FSZA 2P5ED 3EO9L 3GM8A 5F9WC 4HJ0C 4QOKE 3V4UL 4QRPB 3ZDWA 4FXGB 4PD4J 3IGFA 3QCTH 4F8QA 4HCGA 4NFCA 4XO4A 5SV3A 5F7BA 4Q4IA 5JHBA 2BVOB 4W9EC 3US0A 1PLAA 3H4FA 1GA2A 3CC5B 1BD2D 4S2SB 1WBYB 3OX8A 1RSFA 3ATAA 4A6YA 3FQUB 5IB3A 3W38A 1WUZA 1T0NA 2E75C 4LSTH 4F58H 1BGXL 2VLKD 1M9SA 2CR3A 1UT1A 4W81A 1SDDB 1K3IA 1I1RA 3QJHA 2WOYA 1AZBA 5CGYC 4GUOA 3V4PH 3WFZA 4CMHC 2O1AA 1OCCB 4UNUA 1RKRA 3L3GB 3N3EA 5K69A 4PCKA 2Q7YA 3DXAB 3N1MC 2LVEA 2X1OA 1NCBH 3QUZB 3EFFB 4M6NL 5E9DD 4TL4A 1GYWA 1JNLH 1ZHLA 1L3WA 1WFOA 4DUXA 3P4NB 4Z7UE 1EAJA 3CX5J 4CADB 3K4ZA 3UJJL 1U8OB 1I3UA 1E5ZA 2Y1VA 4YX2H 5JLZA 4LCIH 1HCVA 3D07A 3F5WB 1RU9L 4MXVE 3BEWB 3BGFC 1Q0EA 3NA9L 5DS2A 2XACC 3NCEB 3NCJH 5ENWB 2VITA 1XGYL 2JF1A 2G0KA 3GQFA 2PXYA 4XVJH 3I9GL 3GLDA 5CBAB 4OCYL 1V3JA 1ZGLM 1KYOK 4FOMA 4I13B 5F1SA 3SDCB 1URZA 2WAQA 3HVNA 3VCLB 1NSNL 4X5RA 5TDOA 4KKPA 4F8PA 4XX1E 3MUZ1 3HNVL 4BQBA 3ZKSD 2FUQA 2Z7UA 2CDEA 1KLUA 3DJZA 3L6FA 5I1AA 4GXVH 5CCGE 2TRHA 4LKXB 4OCSH 5CP3H 3QIWD 1OF2A 4RQQB 4WW2A 1LO3L 3MV7E 4YAQB 1C5BL 1FJ1A 4JRXD 1IGJB 1HT6A 3ISYA 3O2DL 3QQ3A 4MMXC 3A6OA 2DS4A 3M1BA 4OGZA 1KBWA 3UGEA 1K8DB 1W8OA 4OD3H 4U1KA 5DR5H 2CO6B 2N56A 4JGUA 3QCTL 3N85H 4TUKH 3NGBB 2R1XB 1J9CT 1B4LA 4IKIA 4LHQB 1FBIL 2CO1A 2VRKA 1MJUH 3IGAA 1MCIA 1LO0H 1RK7A 3AABA 3DX9B 3MV8B 4EQ2A 4YSSA 2ZG3A 4HUWA 4M02A 3MBWA 1MJ7H 1HDMB 3IKCB 4U05A 4F58L 3DETC 2G5BB 5IJVA 3FQXA 4J6RH 1T7ZA 4LNRB 4A7TA 1AGFB 2RR3A 2NY3D 4L3CB 5E0FA 3GJFB 3U1PA 2ZXWB 2E8ZA 3ZTNH 3V4PL 5B3JE 5CLXA 1PSKH 1T1WA 1QLEL 1SM3L 3MCG1 3SPGA 4B0MB 5E4IA 4JDZB 2F7IA 3DRTB 3SDXA 1OT4A 2AQTA 3HLAA 1I75A 3IJSB 5F89A 4Z7WE 1CDYA 5KVDE 4GG6B 5I2IB 1I8IA 4ZUTB 3QUYD 5D1QA 1KUMA 4OB5L 4HWZA 5KSAD 4YBLC 4K9EL 5EU6A 4AQAA 4G8FB 4HXBH 5ANME 3U4BH 1CLYH 4AKOA 1MNUH 5CZVH 4O02B 1MCWM 2ZAIA 2CBMA 4NUGL 5GQBA 3EJYD 4Z7OF 5IFJA 5AVYB 4N20A 1DUZA 3ARDA 3R06B 2CAKA 5D1ZC 3UEQA 4PRPD 1II4E 2ZTBA 3ASWA 5D2LB 1N67A 3BPLB 4GO8A 4XVJL 3WIHL 4BRVA 1KBVA 3G7TA 4X7SH 3M86A 3PL6B 2HVJA 4QEGA 2HJLA 5IMOA 5D1XE 3I2CH 4UQBA 5BCAA 3NSDA 3S35X 1L9NA 1LEIA 4BFRA 5KYYB 1E6JH 4GAGL 2B9AA 1XVSA 3EDEA 2ZKMX 1QZNA 1INDL 2XN9B 4R0LB 3A24A 5L8JB 2BSEA 1RZFL 3KPRA 4GKZA 3N9GL 2DI7A 3R18A 1DVTA 4KOCA 1BAGA 3ESOA 4DPRA 4KRNA 1UACL 1DSFH 3R0MA 3EBIA 3STBA 1IC5L 2QADD 5I74B 3G04B 1MFUA 4OD3L 5CSZB 1YY8A 4LVOC 4IIQA 4MJ2A 1FN4A 3TS8A 1KULA 2WVTA 3BP6B 2CLZA 3PLYA 5GZNC 3ETSA 1K72A 1MJUL 3MODH 4ELMA 4UT6A 4HIJA 3WENA 1CF8H 1MLBA 1KCBA 4UB0L 2XWCA 1C08A 1LDPL 1KCLA 1QWUA 3B9KA 3D69A 4J6RL 4KK5C 4NDMA 4ZW3A 4ZMLA 1WHOA 5ETUA 4D9QE 5DMIL 5B39A 5ELIA 4S1RL 2HA1A 1L0QA 4L8DA 4MXWH 2XWJA 2YK1L 4JVUA 5DK0A 5F1NB 3QQNA 3RVWD 1Z9PA 2JCCF 3EFOB 3U36A 5JIPA 3OSVA 4PLOB 2XPYA 4NO5A 1Q9LB 4GAAA 1HYRC 2VSMB 2A6KB 2XA8L 4IKKA 2ATAA 4CC4C 4IK7A 3KYNA 3P0YL 4YE0A 4RRPA 5E8PB 2XZCL 1EFQA 1LLAA 4IHOA 1HSAB 1AXSB 3FBQA 4JZJC 5DMKA 1OEZW 3VWJD 1QMUA 1ZTXH 3KGTA 3DX7A 3GO1L 1LK2B 4D0BB 4EIUA 1I7RA 4TVSa 4ISVA 2P5EE 4HOWA 3VSQA 2P47B 3FUEA 3QIBD 4QPEA 2TRYA 3NYKA 5C7XL 3P3TA 1M7DA 1MNUL 3HN5A 4OQTA 4XP6H 5CZVL 3U2SB 4X6DA 3TF4A 4M6ML 1U8QB 4FA6A 4HP5A 2ICWB 1COBA 2L3BA 1JZGA 1CGVA 1A6WL 2XVGA 3HG1A 1V3KA 1BD2E 1INEL 1URIA 2F53A 2BRRL 2IQ9H 5D5MA 1K5NB 4G5ZH 3QUXC 3BH9B 3UMNA 2VLKE 4M43H 2EXSA 3DO7A 3CVCA 5DD1H 5DRXA 3EJJX 3KLHD 3FT9A 3ZJAA 4TVPD 4DWHA 5HHOD 4Y9GA 5FEBA 1JGLH 2HCZX 5JQ6L 4WU7A 1ZXKA 4HLJA 3AAZA 3R1GH 1BQRA 3CZLA 5I16B 5HI5C 4PJ9D 5F0JB 3X14A 5E9DE 5DUJA 2ZOLA 4YDIL 1ILUA 3DUHA 5J06A 4OJDH 4R83A 4H26B 4O2CA 5E00B 5I1IL 2X4UA 2WQ8A 1O9VA 4L23A 2BP8B 3FUDA 3DI2B 1G7IB 2GJ6D 2H2PD 3RZCB 1AI1L 3U1SL 5EPMB 4XWOD 4AQOA 2H2SC 4NGHH 5LNEA 3V5HA 4NZJA 2AJVH 4WF7A 2G3XA 2IPKA 4P4KC 3D39A 3R8BB 1QSEB 4DZBB 3HC4L 3MRDA 4HUMB 2PW1B 4EKXA 1D5ZA 2J55A 4Y4KC 3BUQA 2KQMA 2R0LH 4WI0A 1NMAL 2CO2A 4Z3TA 3FTZA 3VSTA 5HPMA 3KG5A 3QO0B 2BCKB 2KZKA 2R69L 1LGVA 1NBZB 4PN6A 2YFOA 3NPSC 5EZJB 1MUJB 1KTKE 3VA2C 3ZZ1A 4YNYB 3CDGA 3GI9L 4HUXB 3K6SB 4L0ZA 1B88A 1IAOA 4K2UL 3WN5A 5CD3A 1E5YA 2GBAA 4PJIE 1E65A 4ZZFA 5GZOD 1AHWB 2LTQB 4G9FB 4D94A 1ZTXL 3U2JA 4HGMA 3IRCA 3GHBL 4EVNB 3RP1A 4WTQA 1AD0B 2VXTH 2VAAA 2Z8VC 2Y6SD 4JRXE 4W70A 1MQ8A 2CNYA 5I1LB 5C09A 1M6OB 4DGYL 4XP6L 2D0HA 3L1FA 1QYGH 1UTDA 3SCMD 3CFIC 2YBRB 1C12B 2LQRA 2M26A 2X44D 4MS8C 1X5JA 4IMKC 3DO4A 4B53A 4DFIA 2YAEA 5F7EH 5G2NA 1JVKA 1JDAA 5DEGB 1M05A 2ZPKL 4MB5A 3SE8H 5BZDB 4RGNC 4W9DC 4G5ZL 4FE9A 2DRUA 1H5BB 2X4SB 4NUJB 2VE6B 4M43L 3QXTA 4UTBH 3MRQB 5IHHA 2R29L 1BWWA 1MG2C 2ADIB 1UJ3C 4FDWA 5CSBA 3ZE2F 5KZCD 5DVOA 3CZGA 1JGLL 3LPWA 3HS0B 2AEWA 4B9IA 1F6FB 1YCSA 4J4PC 1E8XA 2P8LB 2EE9A 1VA9A 1I7TB 3KL3A 1E4WH 3B2PA 1FFOB 3V7AG 1S46A 1H6TA 2UXGA 3EYUL 3RWDA 3WHE1 1A3LL 2AV7B 3ARTA 3IS0X 4FHBD 5HDLA 4PRHB 3S97C 5A16B 3DX6B 4MGXA 1CXKA 2EDKA 4KZEL 2Z4TA 4M4RA 3BP5A 4OM0H 1ZT1B 2UZYA 3CXDH 4FP8H 2VN3A 3FMGL 1QBAA 3DJSA 1Z7JA 2EC9U 4XPFH 4RCAA 3G08A 4FQXC 4PCSA 5DJCA 5LGHL 5I9QC 1MCKA 1X5HA 3WNNA 3ARXA 5FDWB 1MRDH 1GKOA 4AGOA 1XSOA 2UZIH 1T2QH 5GGSA 3MC0A 4P9MH 4PV8B 1K4DA 5C0FB 3ZL2A 4JHZA 1CLOH 2R0LL 4A7UA 1AS8A 4G42B 1NGWB 1FNEB 3K6DA 4JPQA 2PYEB 5B1JC 3UYRL 1VLXA 4WJ5B 1R0AL 3FQWB 4L8SA 1OGAB 4YBQC 5FGCE 5E1HB 5L8LB 4WENB 4K7PH 4ZSOA 4X5WA 2Q8AL 1G84A 4MSWA 5IOPB 4Q56A 4YK4C 4F92B 2H47C 1HHIB 2WPGA 2PXYD 5MERA 2ITFA 4H5SA 3UZQA 3T6ZA 2OP4L 3AXLB 1LO5A 3BN3B 3GSWA 1RCYA 1C16A 2WINA 2MJWA 1ZANH 4KHXH 5I23A 2CHZA 2B14A 3MYZA 3KVPA 5HYSA 1XT5A 4QTHB 1BFOB 2BCMA 4Z5RB 3PJSA 3QJUB 3ZTEA 3EJPA 3KPOA 2P8MB 1NMBH 1ROWA 1JG9A 4JFZL 5DJYB 4DP2X 1EA9C 3QE5A 2QSCH 4I3SH 3SE8L 3ZTJG 4A7GA 3JTBA 5BJTB 1HEZA 4M4PA 2X6BA 5GSVB 3LPPA 4NERA 4DTGL 1E28B 3MLZH 4ZFGH 1E90A 3JUYA 1BQLL 4ZXBB 3LZOA 4B9PA 3U9WA 1ZY9A 2DLGA 5I1KH 1LQSR 1QOKA 4YDLB 1Q8MA 3AVEA 3UAFA 5GGSY 1USQA 4OT1H 3RTQA 2E86A 5JDJA 4TTGA 1E4WL 4JFFA 4OLZL 3OAUH 1T6VN 3BZEB 4XOAA 4TVUA 4X4XA 5I0DA 3QUGA 2KBGA 1AACA 2ZUQB 1NC4B 4LBEB 4PG2A 3BKML 1VKXB 4X8JB 1BVNP 4JAMB 3PHQA 4WFGD 1QSFD 3WL9A 3POCA 1Z0NA 3CFCH 4XN9A 4NO3A 5FYJU 4XPFL 4WU5A 2QT6A 2I24N 4DFHA 4GRLB 5D7HA 4R9HA 5ERWA 1D6EA 2ORBL 1MRDL 2D03H 4OLYH 3WIIH 4AYGA 3TYGL 2Y36L 1T2QL 2GABA 4JY6B 3JBG7 2PYFA 4E5XB 4P4RA 5FGBA 1CLOL 1OE1A 5ACMA 5L88H 3FU9A 2R1WA 4Z1PA 1N7MH 1F1DA 4H0IA 4GYBA 1BVKB 3HEIB 3DROA 2XKNB 3NJLA 3TOPA 5A7EA 2GB2A 1AFVL 4ABWA 3L16A 5JW4M 4TVPE 3RU8L 2BVPB 1SYSA 5HHOE 4YUEH 3ESNA 2HPTA 3GFUA 3OX8B 4BUGA 3BLBA 3ARDD 4GRMB 4A6YB 1QRND 3WUWG 3S4SG 1X5GA 1OZTG 5DHDA 2GT9A 1EHLL 1NCGA 2FD6L 2YRLA 5GGTA 5C9KA 1YA5A 3MRHB 1S7RB 2PO6D 3T77B 5GS0D 5LXGH 4TUUA 1ZANL 4KHXL 5EB9A 4JW3A 1RULH 4XPAH 1AR1C 3A3YB 5FYLL 1JNNL 4QRRB 2GJ6E 3DOHA 5MEPA 4JMXA 2H1XA 4XGZA 1GCFA 1NMBL 4HD9A 2B2XH 2BSED 1A4KB 5FUZH 3BGMB 5TPWH 3E2HC 1EO5A 2QSCL 5AAMA 4KH2A 1ZHLB 4IJ3B 2X12A 3V6OC 1J5OH 1A1NA 1F13A 4JFEA 4MJ5A 4OVVA 3OKLA 1BM3L 5GGVH 4PJFA 1NCHA 4TTDD 2CDFB 1A7PL 3MRRA 1TNMA 1N8ZB 4MRBA 3V4VH 4G43B 2D0FA 4A1RA 3SGDH 2OJ1A 5HI3D 3WXVH 5AW0B 3MHZA 1LD9B 1VCBC 4HAKA 3B9KD 4MDJA 3PHAA 3BWAA 1SY6A 5TDOB 3ERXA 1EQWA 4TNWK 4FC3E 3GLEA 3IU3B 3EBAA 4BIKA 1BBJA 3L3KB 3CFCL 4WV1C 3VRJA 3WS3B 4B27A 1CFQA 4RMVA 3RNQA 4RZKA 2BY1A 3ARWA 5DLMH 4AQ1A 1X5MA 4DCQB 5I1AB 4PSRA 4FADA 3LHAA 1KBGL 3DECA 1UA6H 3Q9QA 4NKOA 4YFLI 2WLIA 5TQ2H 4B9KC 1A3RH 1MLCA 3CV5A 4NUPA 5T3XD 1U30A 2DM4A 1XZWA 5L88L 2IV8A 1WSST 1QZ1A 4Z7AA 2H1PH 1WV7T 3M1BB 4MZIA 5BPPA 3Q2WA 3I6KA 5EF0A 4GS7B 5I17A 2HH0L 2H32A 3QJSB 4HLZH 2EO9A 4K3EH 4X99B 3W9DB 5KS9F 1HH9B 5B4MD 1Z3GL 4K8RD 4LARH 3IK2A 3W37A 2O5XH 3IGAB 4EJ1C 3FN0L 1YEFL 5FW6A 1DJXA 4H8WC 5I19H 1T83A 3QHZL 3RDTA 4HUWB 3K4AA 4OLUL 4OF6A 4ZMYA 2V8LA 1F90L 3T4AA 3EIFA 4JFWA 2J4WH 1L4IA 2Z1KA 4ZPTB 2C1PA 3FZUC 5LCVH 4OZ4A 3RRQA 2RCSL 5DC4B 1F3RB 4MAZA 3T0DA 1N18A 4OW6A 1RULL 1IVTA 3DX2A 3LXUX 1NUFA 2K1MA 1KG0A 3OR7A 3SKNA 3OXRB 2PPDA 2JQZA 4U1NA 2FWUA 3SDXB 4YO0A 1XZ0A 2ZUYA 3HLAB 4S1QH 4N0UA 4ETQA 4ZX4A 2NY4D 5TPWL 3BAWA 3FTXA 2ZCZA 1IQDB 5IROC 3GUTA 1H8NA 2A3TA 3LD8C 4EAEA 1TZHA 3B3BA 3WJLC 1I8IB 2V2XA 1XIWA 5GSRA 2W80C 5D1QB 4X4MA 3IS1X 3ULSA 5EMYA 4HWZB 3S6CA 3VI3F 2CLRA 4BFBD 5EU6B 4Z3IA 1KXTB 3LZPA 4HUKB 4P46A 5LNGA 1JAEA 1GTNA 4BFIA 3ECBA 4LL4A 2YD0A 4J8RA 1QUNB 4Q74A 4FCAA 4APQD 4HEPG 5LBGA 5CZKA 1FRGH 2ZX7A 3V4VL 1DUZB 2F19H 4JM2A 2BXYA 4LKCA 4LSRL 1DVZA 2JWYA 4FTVA 3WXVL 2QPSA 4C57C 2W1NA 1RY7B 2HVJB 5IMOB 2HJLB 5BUAA 4DKEL 2IGLA 4GMSL 4EDXB 3OWEA 2WWKT 3AREC 2DLTA 3MRBB 5JPMB 2C7UB 4JKKA 4GKNA 4J2XA 3KS0H 1GL4B 1QBLH 4LLAA 3RVTD 1ETZB 3KPRB 1JGUH 4DP0X 3FCUB 2Q3AA 3QAQA 4DESA 3VFPA 1CVRA 4YXKH 5E2TH 4ZMTA 1EGJL 2NNFA 5IJDC 4J3SA 1JV5A 1FSKB 3SQOH 3L1OL 5G55A 4UI2A 4DQOL 4DERA 1WBXA 1UA7A 2MCPH 1IVLA 3O41B 5HYJE 1YY8B 3ARYA 4MA8L 3DYOA 1FN4B 4NHCH 5C09D 3TBTB 3ZYOA 2EKSA 3EJCA 5DD3L 3REWA 3ZE2E 5EEUA 3SE4C 2FB4L 3QI9A 2E4FA 4BQ9A 3SIKA 4DEPB 5B1AB 3GC3A 3VXMD 1WZAA 3IFPA 3QXWA 4J7RA 2GUOA 1UXWB 3GWJA 3IDXH 3GTVA 5ITFA 2A74B 3D69B 3MNZB 1D2OA 2FEEI 2AKRA 3C9NB 5C0AA 2YPLB 5B39B 5DK0B 5T5FH 2XWJB 1CL7L 5EBGA 4R5VA 5JIKA 1GS6X 2EYRA 3EOYG 5M94B 2YKLH 2X70A 3D85B 4GQ9L 1R46A 2QTVA 1NCWH 4IRSC 4WFGE 2DM7A 1QSFE 3DX0A 3U9UA 3FRPG 4X4KA 1GGBH 3VNZA 4S1QL 2JKIS 2B0SH 2JQMA 4AEFA 2VLJD 3N0PB 2FECI 3CH1A 4IHOB 1BLIA 1B6DA 3HG4A 1ORSA 3DO3A 3PV6A 5A40E 5KTEL 1ORQB 4FJZA 1FLTX 4OKVB 5K59E 1H8OA 4OVUA 2Z35A 4H2CA 5JHAA 4PGCA 4U1IA 4NQCD 3IGKA 2K45A 2FZ3A 2YS4A 1M7DB 1TTFA 4KO6A 3LX9A 1GH7A 4X6DB 5IR1B 2YBGA 1FRGL 3QHTC 1OW0C 3LN5A 1DSWA 5GRZA 1HCFX 3ULUD 3MLYL 2JI1A 3HG1B 2P43B 1RLWA 2BNRD 4P2RD 5IY5B 3ZT5A 2F53B 2SEBA 3FPXA 3P0VH 4KQ4H 1LM8V 1QRNE 2FQGA 3EYQD 2VR3A 4HHAB 5D5MB 3MLRH 1JF6A 1HE8A 5CILL 5HVHB 4X80H 1BZ7B 4KI1A 3F7RA 4LOUC 4QRAA 2DMKA 2JELL 2WUBH 3IDGA 5DS8A 1HWWA 1TQSA 4WKZA 5IV2A 1U8JA 3IWUA 4POZD 4WU7B 1RLBA 3CAFA 2WBJA 3LV3B 2QQKH 3E9UA 5GGQH 2OMVA 4YXKL 3SJVB 1P6WA 3C6LA 1UB6A 1KBBA 2ZOLB 2MQ0A 4J23A 3T09A 1T5WA 3SQOL 4UNIA 1IKNA 1WFIA 2CJTA 3G5YA 3HZVB 5L0QB 4I1PA 4ZTEA 4M3JA 2DLFH 2QHLA 4YIQA 4O2CB 4F57H 5EEZA 3V5KA 3BQUA 2ZAGA 3V95A 3WNMA 3L13A 1AQDB 1RQ5A 2HSIA 1NGPL 5LAXB 3BKJH 2R7EA 4PAZA 4BFGA 2WJ7A 4A2DA 5LGYA 2IPKB 5TH2B 1YYMH 3EYOA 3IDXL 3I75A 3IKKA 3MRDB 3Q05A 2WKLA 1D5ZB 2WYZA 1VZIA 3CLEH 3HE6B 4TQHA 3T8XA 4UF7C 3T2LA 5C92A 4G3YH 1ADQH 1A0QL 4C83A 3NESA 5E5LA 1MCPL 5GGUA 3TIDA 4L5FH 3S37H 3S3PA 3TFKD 3KBFA 2IAND 2W65B 3MYJA 3QJFA 1KELH 5BRQA 3MRJB 4I5BB 5ID0A 3UG5A 1IAOB 2Y7QA 3LRMA 5CD3B 4LCWA 1ZVNA 3SGDI 3RTQD 1CFSA 3NJHA 4LEXH 2EXTA 5DHMC 4JFFD 3RGVC 3K0YA 1B3JA 1NC2A 2GVYA 3D2UA 2EEBA 2NY6B 1JZHA 3C87A 3GI8H 3QXDA 2W9DH 4WI2A 3MXWH 1JPTH 2E4TA 4S1SH 1S7UA 5B21A 4AITA 3QJXA 4RAVB 2Y07H 3VXOB 1KN4H 1FVCB 2E9JA 3OKOA 3GNML 3UAJC 3VG0H 3HOGA 3RL1A 1DVFC 1ZKAA 3HPJA 4LHJB 2OJEA 2ED7A 4N2AA 2AJSH 2VH5H 4K7PX 3P0VL 4KQ4L 4B9YA 3R19A 1P4UA 4ONHA 4P2YA 1J0HA 3IU4L 4LLQB 4DF9A 2WW8A 2X88A 4LRNH 1G7JA 4MDIA 2G75A 1KGCD 2XICA 2VDKH 3BFWA 4ZMPA 1G1YA 2KPWA 4BWTA 2WUBL 1E8ZA 2B4CH 2Y2YA 4O02L 5CO1A 4I2XE 3OPUA 5JOPE 3BDYH 5AW6B 1EZUA 4JO3L 2QQKL 2WXLA 4NBXB 2OYLA 4P2OA 4QJ4B 2BHYA 4PG9A 1IC4L 1IGML 4PR5A 2A4CA 2DL9A 4E9XA 3Q06A 1A7NL 4CJ0A 3KCWA 1FH5L 1MFEH 4F57L 1L3NA 3S36L 1F4HA 2G30A 3BP5B 4J3BA 2F7RA 4X6CB 3OJMB 1RK1A 4H20L 3Q44A 1MI5A 4ZFOA 1NICA 2TSAA 4S0HA 1OOAA 1FZKB 3EJZD 2CHWA 2AXHA 5TFSL 3ZL1A 1KJMA 1KPUB 5I6LA 4JLRA 5KYUA 4AQEB 2F7OA 3VXSA 3MA7B 2WKOF 4XNQA 4WWNA 3SYPA 3UBXG 4A2LA 3BUYB 1A14H 2WWMC 4AKPA 1ADQL 5HJBA 1TQBC 2A6DB 1B9KA 3A0OA 3L2MA 3CZSA 4U6VL 1VADA 4QHKI 4HPHA 4G8EB 4L5FL 3FCTA 2YLHA 2WTOA 4Y4HC 3SGEH 3VFOB 2N7SA 1NEZB 1Q0YH 1RIVL 3HCVB 3J7HA 3ZK0A 3KVQA 5IMKB 1BXVA 1QWHA 4LO9A 3L17A 1Q9KB 2CCLA 4MWFA 2AJZA 2YD5A 2BSTA 2A9MH 2IAMB 2XBTA 4JG1H 2H1LM 3ZE0B 4NRYA 2X9WA 1KXVA 3BH8A 2VR8A 4QRQA 4LEXL 5H35B 4NNYA 2WMPA 3DMMC 2FHFA 5MERB 4JKWA 1LO5B 4X9HA 1J0KA 2W9DL 1GZHC 3GSWB 3KNBA 4PWHA 2WINB 4AMKH 1RUAH 2BC4B 2WXMA 4RSYA 5I1GH 1GS7A 3KVDD 5HYSB 3PJSB 1EX0A 1TQUA 3D87B 1P7BA 1T1ZB 3F58L 3GXPA 2OI9B 3SDAD 1B0RA 3VXRB 4ODSL 2Q0ZX 5I76B 1HHGB 3VXME 4ZD3H 3IETA 1CXFA 2AJSL 3ELQA 2VH5L 1SJEB 3TT1L 2LGNA 1FNLA 1WA2X 3HFML 4KVPA 1HEZB 1YAIA 5JORB 3MTXA 1CGYA 1KIUB 1MCSA 3VMPA 4WWOA 5JW5A 3IJ7A 5CUSH 4RISH 1BVLB 2J25A 5DJ6A 3PP3K 2OYPA 1TSHA 4I77L 1DVQA 4L4VB 5E99L 5F9WB 2B4CL 2ZOUA 3FFOA 1WYJA 3SN6N 3BDYL 4P3CL 5I8OL 4LCVA 4D0DB 2WTPA 3BISA 4PTTA 3D4YA 3VQLA 1F4AA 3I02A 3RIAF 2QQNL 1DDHB 2VLJE 4ZS7L 2X4NB 1U8NA 4K23H 3OKYA 5TD4A 2FK9A 4W9ZA 1X7QB 25C8L 2IQAB 5D6CA 1MFEL 3HW7A 4ICWA 1A21A 1EIBA 1CT8A 1IAKB 3HUJA 3P2TA 5E6RB 2C4FT 2ZXCA 4EMZA 4NQCE 3RPIB 3GSNH 2G3ZA 4OZHA 4YHZH 1EMTL 1MRCL 3EO0B 3VXTB 4WI5A 3CMOH 3TWYA 4ODXA 4NO3B 3POHA 1WE5A 2F54B 1PG7H 3TA3A 1MH5A 5ERWB 4V2CB 4UT9A 1CXLA 4CMHB 1HZLA 2QLVB 1MCWW 1N10A 4PP2B 4CSSA 3O6LL 3ME0A 1JK8A 3ULUE 2IPTH 2VERN 4HIHA 1KJ3L 3C6EA 4XOEA 4P2RE 2BNRE 1PU0A 4P4RB 1G9MH 4WO4D 1U58A 3QG6A 3GXFA 3LNGA 4PCYA 4NKMA 4Y89A 3WFCH 4PJ8C 1MN4A 1TEYA 2P45B 3GT6A 3NJKA 4DGIH 1ZLUH 4IMLB 2VLMD 1Q0YL 4WK0B 1BQUA 2WIMA 4IM8A 5FHAL 2HKAA 3AC0A 4NJAH 1TQCC 1ODUA 5JYLA 1BQHG 4NP4L 4KX7A 1B3IA 2G5UA 4ZSOE 1IQWH 2NSQA 3DXAD 4JKPH 3O3BB 3QUZD 2DKUA 4OZIA 3S8FB 3TT3H 1JYVA 2UXVA 3GIZH 1TTBA 3KS0J 4V11A 4AW4A 1SHXA 2EEFA 3DDFA 4FFTA 4GG6F 5EEVA 4TVPH 4AMKL 4NO2A 3PWNB 3WUWA 3S4SA 1UOWA 5D7KD 1J0JA 3ARFD 3FU3A 2FBOJ 3QUKA 4ZTOH 1N6VA 4YQXH 1LJMA 2O5YL 4WV1A 1T2XA 2AVFA 4ZD3L 5T1MB 1TVDA 1XGRB 2FX8H 1Z9LA 3QWRA 4M7JH 5TDPB 3OBAA 1K4CA 4C54A 1A1NB 5D2LF 1AKPA 2H0FA 1KB5B 2QKIC 3MJ8A 4UZSA 15C8L 2K3TA 4RISL 2ESVA 2NXYD 2IVFC 4C56A 4PJFB 4UNTA 2YD9A 3B43A 1P7HL 3TPKA 1NCIA 1HC1A 1M3IA 3RY4A 3MJ9H 3GBNH 4JVWA 4MMXB 4NKIL 3QEQB 2NW3A 5K1NA 2IANE 1ZA3A 2FQDA 2VRAA 4NZRH 4GLRH 3NDZE 1WAPA 2YPKA 3RFZA 2Y0SA 1NCUA 4FI7A 3DIDA 2EVHA 3IYLW 2OPCA 2YLKA 4FNPA 2RALA 3DYPA 4XN1A 3WXWH 3O6ML 5K1VA 4BH7A 2WK2A 4M93C 2A1WH 3JWNC 4LIQH 4YHZL 43C9B 4FFZA 3MREA 4UIMA 3SYCA 5BXFB 3LS5H 3N43F 4OF7A 1CFQB 4G7VH 3V8OA 4AQ1B 1PG7L 3EDDA 4MD4B 4MMZC 1L6ZA 4IEFA 1A6AB 3OMIB 3ROOA 3WFDH 3DVGA 4JREC 5DURD 1ZS8B 3U4EA 4BHUA 1U3HC 3KPSB 1ROCA 3BAYA 3AUWB 4R2GD 5EU7E 2J8UB 3LQAH 2JKRM 2OMYA 1IGTA 3BXNA 4PRBB 1DBML 1CR9H 5DVLA 3GBLA 5D71H 1KGCE 1KYUA 2D7NA 4L0PB 3N41B 1SEQH 3NK3A 5BQ7A 4HUVA 4NNXA 3DSFL 5IQNA 5LJYH 1YNLH 1N0XL 4MZRA 1SHMA 3PABA 3RDTB 5C08B 1IQWL 1U95A 3T4AB 3QS3A 1WS8A 5D1ZB 5FX3A 1AIFB 5TK4A 3V52L 4QRSA 2OMXB 1TTRA 4OZ4B 3Q43A 2JKNA 1E7UA 4W6WB 4V1DA 4LSQH 3HBQA 2PCFA 3ZT7A 2XIBA 3QVAA 3OR7B 1CXEA 3WNIA 1SYVB 2O6EA 3X1EA 4QI3A 3ATEA 4G8AC 4U1NB 2HMIC 3AY4A 3GXTA 4YO0B 1HIMH 3GKZA 3SPHA 4TLTA 4A6YH 2WBJD 2E7LC 3QFGA 1W0WB 1L5GA 1AGEA 1XF1A 2O72A 1XIWB 1A9EA 2WSDA 3GSUB 5I71C 2ZSWA 3BZDA 4MHHI 1UVQB 3LYRA 2I9TA 5DF0A 3RBGA 4DEWA 1SZNA 3QFJA 1MW1A 4BFIB 3ECBB 4F2ME 3GBNL 2K6WA 3QXAB 3DJ9A 5EO9A 2RA1A 1RZKL 1SN2A 1YY9D 4LVOB 4JM2B 1S5HA 4LKCB 3H3PH 1DSYA 3DA0A 4YFDB 4M5SA 2QGCA 4N2DA 2P9RA 3O9WC 4FTVB 3HI6H 4GAYA 1WK0A 3BAJA 5C7ZA 3NABH 4HEPA 2X2YA 4JQIA 5EULV 4LCYA 3WXWL 3ZKMC 1J9QA 2Y4SA 3HJ0A 3KBEA 2EDLA 1KFGA 1YEIH 3RB5A 2QVFB 1UT9A 2ITCA 5DJ2B 4B6ZA 3AACA 3C5ZC 2FJSA 1NPUA 2XXGA 4Q9QL 3SGEI 3BUPA 4DOHB 4I7ZC 5F6IC 3LS5L 1PZ5B 5IEHB 3DI3B 4AVIA 4G7VL 2OSYA 4PHZA 3VFPB 3WFDL 4WGVB 5HY9B 2CO7B 4AY0A 1P0SE 2JJTC 3H6JA 5SWQA 1GGUA 1MCQA 3D4ZA 4LCWD 1JV5B 4B95C 4NZTL 3LQMA 5IOKA 3MFGB 3U82B 2FO4A 3LQAL 2XDHA 4JZJB 1CCZA 1NC2D 3AT8A 1T4KA 3CVHA 3SQRA 1J9SA 2K9UA 2FLMA 4L37B 4UIKL 5D71L 3WGUB 1XL4A 2I07A 5EBWB 3WS6C 4A37A 1I8LA 3QI9B 3MROA 4LPVA 4P3DA 1GHFH 2X4PB 1FNGA 4CVXA 4HJSA 3IFPB 2GUOB 5F9AC 4LL9A 4G83A 4MX7A 4I3RL 3IPFA 2J56A 4I88A 2A99A 1NOFA 4XP1H 4DAGH 1JZ2A 5HYEA 2AKRB 1S3KH 3ILQD 3NIFE 5SWZB 2OZNA 5JHDB 4HGWA 3I6GB 4LSQL 3D33A 3RIAK 4LRIA 5HGGS 3JV4A 3QUXB 2ICWJ 1OO2A 3PWVB 2FJHA 2RFXB 3S36X 3U9UB 3GS0A 3LH2H 2VO5A 4QRPE 2L7QA 1HIML 4Z0XB 3RIFK 1EJFA 3VM5A 1QABA 4X50A 4L9DA 4KZCA 3BUTA 4A6YL 4MJHA 4WRLA 3BRGC 2XT1B 2E6JA 4DH2A 3T8VA 5E8NA 3FRPA 1J12A 4IU2A 4JFXA 2FATH 2L7JA 2WBXA 1A6VL 2XNAB 2Z35B 3S3CB 4GFXA 1P53A 3X1BA 2DB8A 2FZ3B 5JO5A 1Q9OA 4W1TA 4A63A 1FFPA 3W0WB 3QIUC 5FB8A 1KNOA 3P3YA 5GGRA 2VLME 1KCVL 2CDGA 3UYPB 4ATTA 1R3JB 3S37X 1E8WA 3GXUB 5JIQA 3O8XC 1C8PA 4XHJD 1OM3H 1F86A 1E6OH 4CW1A 1JXKA 1A47A 1E2WA 1L7TL 3HI6L 4XP9L 4EN3A 4DUVA 2SEBB 3HZYB 4LSSH 4PJDA 3NABL 4U6YA 2FWSA 1NFDA 3HG5A 3DXAE 3GJFK 3LSOA 3VXSD 2EIZB 4JY5H 1VPOH 4P4KB 1YEGH 1TO4A 1HNGA 2D0GA 3DKHA 4P05A 1HQ4B 5LG1A 4Y4KB 3WMQA 4W9JC 5IV2B 1D5XB 1U8JB 2HKFL 3C60D 3RWCB 3B6SA 4AE0A 4FHJA 1F2QA 1HXMB 4F7TA 1PY4A 4UTCA 2BZ7A 2FWLB 3MGAA 3NPSB 2OMVB 1OPGL 3QT2A 1UWEH 2NY2B 2OK0L 3RL2A 2EE6A 3FKUS 3VX1A 2OR7A 2XHNA 1U33A 5AUMA 5I73C 3BQUB 3TO4C 1ZGLA 2J2ZB 2R9HD 2YD2A 3QC6X 2H6OA 4IBUA 3FQ4A 3HPLA 3BZFA 3LDBC 1IM9A 4WEUD 4OD2A 4HBQA 4YGVB 1ASPA 4K7FA 4KKAC 4DKTA 3LVEA 1FYTA 1HWGB 3TYFB 2YPVA 2QMKA 3QDGD 3QP3A 3T8XB 3LTVA 1S3KL 4FNQA 3C2AH 1LNUB 3CMGA 3O3EB 3ISWA 4C83B 3A22A 5DZVA 4RGNB 1SJXA 4R8WH 3TIDB 5KN5A 3LPFA 3E8UL 1XTMA 3LH2L 4JRYA 4OJFH 4GLRI 4ZI8A 4JZOA 4LAQL 5EUOB 1UJ3B 4N5UA 4UT6H 2DWDA 5KUMA 2CK0L 3MGOA 1CFSB 1QQDA 1GVIA 3GHPA 5IWLC 3RWJB 4XXCC 4M5YH 4FQIL 2FATL 2ZP9A 1DQDL 3D2UB 2OMTB 3OTTA 4ENED 4JPSA 2FR4A 1FF5A 3QXDB 1KLGA 5FKPA 1WDAA 1VACB 1HNYA 2VTFA 2YA2A 4PJ7B 2MCMA 3RY6A 1ED3B 1HVXA 1A9BB 3KYOB 1UZ6F 3CXFA 2F08A 3L3OC 3RL1B 4EE2A 2WLLB 2OJEB 5D8JH 1KPVB 1GGIL 3BDXA 4XRCA 5CLZA 2COVD 5T3XH 1IM3B 4LSSL 2BP0A 4AWJC 4ONHB 1CB4A 2VMEA 3X12A 3GBML 4WHTA 2NY1D 3L2NA 4PRAA 3U7WH 1YEGL 1G7JB 2G4EA 1N2RB 1KCSH 3VVWA 5I5IA 3QNFA 2G75B 1EDYA 3Q8CA 4GG6E 1E42A 1M71A 3NSJA 5BV7H 3G6AA 2AJXH 4OQTH 4K8RH 4YLQT 7PAZA 5KWYC 1BIIA 1B9ZA 4R3SA 5BVJA 4MNHB 2VB5A 4R4BA 4P23A 3JXAA 1BJMA 1I8KA 3O2WL 3DHPA 4P2OB 2NOYA 4JEGB 3GSVB 2WB1A 4KV5F 2VQ1B 4PR5B 2FHCA 3BI9X 3KPNB 3A6CH 4C55A 3CSGA 4NCC1 1TTAA 3O3AA 4MZ2A 4HMDA 2YN3A 3BZ4A 1JPGA 3HHSA 2C3VA 4JFDA 1MI5B 1MEXH 2K7PA 2VISA 3MCKB 4FTDA 2PYED 3A67H 1HKLH 3VI4A 4NWTH 2NX5A 2GCYA 1F6LL 2QHRH 1OKEA 1TENA 2Q1EA 4EI6A 4TQIA 1PLCA 4DNLA 1KJMB 3H1ZA 2R2CA 4W68A 3KWXA 5E7BA 3HRZA 2QLYA 3QWRD 4EI5A 1J88A 2HUEA 1GZQA 4PLNC 2ZOTA 5E1QA 3JWOH 2EYTA 1NMCB 1VADB 3HLKA 3JWDL 4R8WL 2ESVD 1CZ8H 3ILPB 4C56D 3TF7C 1QA9A 5DA4A 4TNVF 2OBGA 1CGSH 1RPUA 4U0RB 3BT2H 4UT6L 2BSTB 3CBJB 4U3XA 5BRZB 3EOAA 2YUZA 3AS1A 1OQXA 1PG7X 1HXYA 4NRYB 5F96L 4YN3A 3V79C 4IOFD 5IFAH 1MZYA 1UKTA 1TMCB 2FSDA 4LCWE 2GI7A 2J88H 3WKML 5C97A 1E8YA 4V33A 5I0XA 3KNBB 1NBYB 1F4WH 2P4AB 4Z7VA 2XCMC 3WGVB 1EFXB 1AO7B 1EEQA 1XF3A 1KC5L 1WCBA 3VFSB 1HI6B 1B2WL 1BMWA 1CS6A 3FHQA 3DV6A 2AK4D 1J1PH 3MRLB 5DS1A 5D8JL 2X2IA 1CVSC 5I8CB 1CWVA 4BCXA 4IBYA 1WICA 5IIEA 1UD2A 4FQ1H 4I0KA 2GUYA 3O45B 2OX5A 4UQDA 4J3OF 1BXAA 2QFRA 5DJ6B 5F70A 7FABH 1KEGH 3AU1B 2N59A 3WE6B 1D6VH 3Q13A 2PPEA 2DOCA 1G9NH 3GIVA 5BV7L 2AJXL 1FI8C 2IALB 4FYRA 1DZ0A 2Q86A 3VM7A 1JPSH 4WY7H 1NJ9B 4P5RA 5IFHL 4PTTB 1H3WM 1SBSH 3V0VA 4DUWA 1CICC 3VACA 4JFSA 3B7SA 3OQ3B 4IRJC 3K6OA 4GRLD 1U4EA 4H1LG 4XBEL 5D7SH 4JGMA 5D6CB 3ABKB 3F01A 4KKLC 1NFAA 4XR8C 1I3VA 3K1DA 2GSIA 3HUJB 3ILDA 1JV2A 4JQVA 3THMH 3ZDXE 5K33A 3ZO9A 2GPZA 3CFNA 3SPVB 5AWNH 3K74B 3B9EA 4V1DD 4DVRH 4NEHB 3ZYIA 4AC4A 1M7XA 4LEOA 3IDYB 2DM3A 4PVBA 2NYYC 2R0KL 4PJEA 4NWTL 3WTSA 3TA3B 2QHRL 5GRUL 1TXKA 4BINA 1AR1B 2VW4A 3CN1A 3FN9A 1NCAL 2IBBA 2DI8A 1MDTA 1HKFA 1P7QA 1DN2A 2VCOA 1ACYH 4XNUL 2NSXA 3SO5A 1U58B 3QG6B 1D7FA 3BAKA 4LPUA 5IB4B 4NKMB 3II2A 4NC0B 2WD0A 3JYBA 4PIRF 1CZ8L 5TF0A 1ETA1 4QLRA 4HGKC 3BSHA 2DICA 3QDJA 2KPNA 5EC1B 3GSOB 2DF3A 4G2AA 1PD1A 4A7QA 4S1DC 2HJKB 2KLTA 2HLEB 2VMDA 3CU1A 3LRLA 3ULUH 1UM5L 2CK2A 4IRZH 4NBYB 3T2QA 1DQJB 4M7KL 4QRRD 1QG3A 4WJG3 3SDXF 1LDSA 4Y5YC 5EDSA 2AW2A 2GAZB 4IBSA 1H3XA 3GXMA 2NTSP 1UASA 4OZIB 2ZD0A 3BN9C 5DVMA 1BQHA 4YWGH 1I9RL 1NCOA 3CFEA 4KNQA 2CMRL 4NO2B 3FB8A 3UPAA 4BZ2L 1RPKA 3K6NA 1GAFH 3JZYA 4HOXA 3T6XA 4HF5L 2P5WB 5HD8D 3LRGA 1J1PL 1UCBH 3QUKB 3MOAH 1P69B 2ZUTA 3H9SD 1F97A 1D5IH 2CGRH 4OIBA 4RMWA 4WV1B 1FFQA 5BS0D 4MBRA 2DYPA 1K4CB 4K3DH 1O7DE 4FQ1L 2GI0A 1CF1A 2QGBA 3AROA 1IAIH 3MJ8B 4R26H 3KDMA 3QDGE 3OLIA 5FR3A 3CFKA 1KEGL 2BY0A 3D9AH 4G6AD 2WXIA 7FABL 1BAWA 1M1SA 2R56H 1G9NL 1ZVHA 5ESAA 3DK2A 3VU1A 4BZYA 1JPST 3SY0A 4ZX6A 1DBBH 4M1GH 1JPSL 3QHFH 1MOEA 1TTCA 4PM1A 2VWEC 3O2VH 4JDVA 4BEIA 5I1HL 3LIZH 2X6VA 2BIOA 4XVTH 2V4LA 1DVUA 2HTLC 5D7SL 3S5ZA 3T5WA 4PWJA 1A6ZA 1JUFA 1RJYB 5JQIB 2I60H 2A7BA 3RJDA 3CFJB 5GPRA 4BH7B 1AKJD 1G1OA 2H8PB 2FUTA 4NLHA 1YUHA 2F1BA 5AWNL 1R3IH 3C8HA 3MREB 1XF5A 2V9QA 1HK6A 3MUY1 3MBXL 3U7YL 1DFBL 1YUKB 1M57B 4OI9A 1S7XA 3GLZA 3IDIA 5F93C 1FC1A 5AKSA 4PW3A 4Q6KA 2VXVH 5FFOA 1CG9B 3AS2A 1T66D 3BE1H 5DO2D 1ZV5A 4GIOA 2FBJH 4MAYC 1S9YA 1Y6KR 3MLSH 2HG5A 1B90A 3QJVB 4K3GA 2OMYB 4GQZA 3ZRCC 2HRPL 1IGFL 3O11A 3LD8B 4NCC2 1SVBA 4HG4J 4JO1H 4JO4H 3QPXL 2P42B 4W9HC 5FM5M 3UO1H 5BQ7B 4LQ1A 4Q58C 1JGDB 5IQ9B 2IO5A 1OM9A 4PJXF 4TNFA 1EAPB 5KJ4A 2ZOKA 3GMNA 3HB3D 4HT1H 5HJ3A 3PDDA 2FJFB 3IRZA 4IDJH 1UEMA 5T3ZL 3UIZA 4X5XB 1QLRA 4AEEA 5J0BA 5B8CA 2BX5A 1JI1A 5IVZA 3OAZK 1MFNA 4NX0A 4N2LA 3KWUA 3GM0A 4AI7A 2IMNA 4P5TA 4QRSB 5E2WH 4DP1X 3SE9L 4YSUA 2EDMA 3H7LA 4YWGL 1QASA 1UH4A 2I5YL 4AYFA 5HHXH 2GTZA 4ZAKC 3DVNB 5FO7B 2NZ9C 4M5TA 4UV7L 1GAFL 1DQLL 2E47A 5IQ7L 1IC7L 4YHKL 4HU8A 5C3TA 3AREB 3LEVH 3P3SA 1AXTH 4XN7A 2FX9H 4PV1C 1SFHA 3BVTA 5AVTB 1DJYA 2PYEE 1D5IL 2NDGA 3MDJA 4TN9A 1Z1WA 1DJWA 2K78A 1O9WA 1REIA 3QW9A 4WNSA 4WO0A 5D70H 4K3DL 4H0GA 4KPHH 4AL8H 4WI7A 1XHHA 3ARBC 2ZXGA 1CFMA 3OB8A 3OR6A 2ZSWB 5GGTH 2ICEC 2F74B 3BVNA 3D9AL 4L4TD 1TO5A 5D5MF 1P7KB 3DOIA 5CEXB 4AGLA 5L2KB 2M83A 1KY7A 3RKPA 2XTLA 4MCYA 4C56E 2HJFA 3EF4A 4GJTB 2W92A 4XCCH 1FPTH 5KVFH 3LRHA 2E6PA 1IM9D 1S5HB 3MTRA 4HALA 3TWCL 4P57A 5C0BB 4XVTL 4M56A 4YZFE 2BM3A 4HIXH 1PNDA 2BS9A 1DQQB 2I60L 4LCYB 1YEKH 4WWKC 5F8QC 5D9SA 5DI8B 2UY7A 1D9KC 5FCUH 2PR9A 3X3GL 2ITCB 5KSVB 3WKQA 3EYVA 5F9JB 2C1OA 3F6IA 4QUOA 4ZDHA 1BYPA 3FDWA 3MNVA 5FUCE 5LBSL 3CXHK 3T8MA 4ODHH 4RDQF 5MHSD 1MHHB 3BEVA 3TURA 4OF0A 4JRYD 2AK4E 2VDOH 1TJGH 4QHLA 2E7BA 4AUJA 2BXZA 2PTTA 3J2PA 2NRDA 4Y7OC 1EXGA 3MLSL 2FO4B 4HSCX 1RFDL 5DWUL 1R3HB 2HRGA 2X40A 4DP5X 4H8VA 1SY6H 4WDIA 3CVHB 4JO4L 4KI5C 4HH9B 4OUUA 3ARGC 4AGNA 4QTFA 2YPLD 5DD5H 3UO1L 4GAJH 1OAJA 1ECZA 2YMOA 1AS6A 2R23B 4ZOCA 2WYTA 2Y22A 3MROB 4XCYA 1C5DA 4P3DB 5AYUH 4GP8B 1FNGB 2NR6A 2B5IC 4JJ5B 4LASH 1OB1A 5C6TH 3X11A 5CCKH 4GAFB 5CP7A 2X3CA 3P4MA 4MX7B 2NY0D 1XCXA 4AZUA 3Q6FA 4KV5E 1GY1A 5DYFA 3UCRA 2VZTA 4IBWA 4PVMA 3CQQA 3CN0A 3US9A 4IOIB 1A7RH 1ZRUA 2DWYA 2NUTA 3QJOA 2JVUA 2OMZA 5IF0A 1CTNA 4WEBH 5AW7B 1P1ZB 3NZSA 5DZJA 1U21A 2H32H 3FU8A 5DQJB 1TDQA 2DQ6A 4NNPH 4JUSA 3LEVL 4V1DE 1MCOH 4PWKA 3BX7C 2OL3H 1HINH 1E4XL 1A7QL 2Z31C 4LMQE 2FTAA 3NH7L 4P23D 1MPAL 1FFNA 3ZVVA 4HIEB 2RHEA 1JZ7A 1MW2A 1RUMH 2BW5A 3FRPB 3P9MA 4BCYA 4JFXB 2LABA 2YXFA 4CAGA 3PDOA 4ZX5A 3GDBA 2CH8A 3ENEA 4HUNB 3H3BC 3LNIA 1Q9OB 3FK3A 3EJTA 1FFPB 1VGEL 5C0EA 3HFFA 5FB8B 3DJTA 4UILH 5JHLL 2EXYC 3FT3B 4P5SA 5FA4A 5GGRB 3UPRA 1GIGL 2CDGB 4N26A 3RVXD 4AOFA 2X28A 5I1EH 1T20B 4KDTC 1TITA 4J39A 3GK8H 4N5EC 5ACZA 2NX5D 2E76C 2I7SA 3QDMD 3SGJA 4QRRE 5AVXB 1CGTA 1FAIH 2Y06L 1NFDB 3SDDD 2IC2A 1YEKL 4GY4A 2DH2A 1KB5L 3AQDA 5INCA 4EI5D 1HYSD 1J8HD 1QNIA 3OLGA 4D8PA 4MB3A 1NINA 2CUMA 4YPGA 1NDMA 5FA3A 5CZXD 1F00I 1H3VA 4J8QA 4X6CF 3S88H 5LLIC 4QHMB 1TJGL 4KXBA 1IKOP 3H9SE 3NDYE 3PGFH 2X4OB 1ZLWK 4Z3EA 5BS0E 1MVYA 2WZPA 5K9QI 5DGRA 5CZRA 1ICTA 4DO4A 5IW1A 3ARQA 5DUPL 1SY6L 3DJRA 4TQEH 5IWLA 2EIMB 4N86A 4EBQH 3RGVB 3U6RB 3GXIA 1MCCA 2E7HA 2J12B 5F0LB 4XZUA 3ZY7A 4PUBH 1JCVA 2JTDA 2V37A 4FG6C 4QWWD 4GSDL 3STZA 1XBDA 4IK6A 4YBHA 3F64A 4K7FB 1AZNA 5CCKL 1U8HA 2VGLM 1FYTB 4QHUB 4HJEA 4GW1A 2V7NA 1BDYA 1DVFB 2H3XC 4U6HA 5CHNA 3ZE0F 3G6DH 2ZNWA 4QAMB 1C1EL 1IAII 2A6JA 2F5BH 4KXZH 4LSDA 4YHLH 4V2BA 1SJHA 43CAA 1T6WA 1CK0L 3TN0C 1WD8A 1Y0LB 2B1HH 3QEHB 3CZUB 4XX1G 3X3FH 2W88A 5GJTH 2CUHA 5C71A 2X87A 4W9IC 4W9LC 3VYPA 2IDCA 5AKVA 2VJXA 4HLZG 2MNWA 1W8NA 1XSJA 3KPLA 2DWDB 1ZMYA 5CS7A 3CQFA 2ZCLH 5E8OA 3U4AA 3MGOB 4UWQB 5K9OA 4KROC 3Q2LA 1MFVA 4OIIL 3TONA 2FGWH 2GBUA 3FQ1A 5DDHA 2CIIA 5LBVA 2L7UA 2BIHA 5FKPB 5FLVA 4XAWL 5EWIH 1MKFA 4NWUH 4BFEA 1NOLA 4UILL 4YJZL 5D4HA 4DJMA 6PAZA 5I1EL 4I18C 2Z64C 5IREA 3GUFA 1XEUA 5IB5B 1ILSA 2IADB 4XRCB 1AANA 4Q9BA 2VQTA 4U1LB 3FF7A 3NCBB 2Y5QA 3MNWB 5G5DA 2BP0B 4UYPA 4U1JA 4TOYL 3X12B 5L7XH 1KZYA 1VZGA 1FO0A 5T1LB 1NH6A 5G4MA 4Z3JA 3QWOB 2X6MA 4G6FB 4RRPM 5FO9A 4P2QA 5KYNA 3LRKA 3FFCD 3L9YA 3ULVH 2HT4C 4Z95H 2DLIA 3G6AB 3QDJD 1OPOA 2I25N 1WT5A 4O4YL 1P5VA 4R4BB 1IFHH 4Y4HB 4XMZA 3CDYA 4X7DC 3TZVA 1I8MA 4M61A 1I8KB 3RX7A 2XVLA 3JTSB 4H8HA 3PNWA 5DRZA 4ZW6A 4QCIA 4ABQA 3K91A 2WSKA 2KLSA 3OB0K 2O93L 2XY2A 5DLLA 3OZKA 4OFDA 4M1DL 3QNYA 4OQ1A 4TQEL 5KBMA 5A3IC 2X3AA 4NM4H 1N70A 1HQRA 3DMMB 5ID1A 1ZT4A 5C9JA 1V55B 3MMEB 4L4TE 5K9KA 2YN5A 3UC0L 1ZS2A 4JFDB 1EXUA 5EF3A 1HHKA 2ID5A 5ISZB 1AZZC 3VI4B 1YMMA 4RZCA 3IMUA 4FXGC 2BDNL 2G2NA 3FB6A 3O6FC 2VM4A 2B3RA 3BAEL 2AXFA 3NJVA 4KRPD 1EO7A 4WHYH 4Y5XA 4G7YH 2D2OA 2AI0L 1G9HA 2GIMA 2K0RA 2EC8A 2X89D 2IAMD 1LWRA 3NQIA 4FFWC 3ZDYE 3OAYH 2B08A 5EZIL 4YHLL 3EBGA 2EYTB 4ZW7A 3QJTB 2ED8A 3VRIB 3EGDA 3FAWA 3EHBC 3X3FL 5GJTL 1I8AA 2LFEA 2Z8RA 1TZIA 4J28A 3WTXA 1QA9B 3T0EA 4FQHA 3UBXB 3ABLB 4IS6A 1Z5HA 4LLDA 3IMBA 2E7MA 5MHSE 2WUCL 2E3VA 2VM9A 4JRYE 1TZAA 2BPBA 4XCNB 1J05A 2Y72A 4FD0A 3NTCH 2ODIA 3EYFA 3V0WH 4LGPB 5A2IH 2DMHA 1QD0A 4Y19A 1S9KC 1AHMA 1CI3M 1KCKA 4G9DA 1N5AA 2WLMA 3S5LG 5EN2A 2L8AA 4HIPA 4JO8A 1NL0H 4XPGH 5F7HA 2EVJA 1XF3B 4MB4A 1KIQA 3PG2A 1JMZA 4NAJA 1AD9A 3ZO0A 1PZDA 2YPLE 4IGBA 2GTWA 1BX2A 2RB8A 1IEBA 2Y2TA 3DV6B 4X7TA 5DD0H 4F8OA 2NXZB 4PJXE 4LVEA 1CE1L 3N2JA 5CSGA 1FDLL 1U3YA 3QZWG 2DTML 1S78C 3UTQA 2OQJA 2WQXA 1F2XK 4D3CL 4MZ3A 3TASA 2OX5B 4HV8B 1H3PH 4PGDB 5HHMD 5F1KC 4J3XA 4Y2LA 4NENA 3QEUA 3ULVL 4HDIA 1NANH 1GC1H 1BQSA 3A4AA 4HPOH 1Y6NR 2Q86B 1K8IA 1FVEA 2ZSVA 4PJ8B 4Z76A 1IFHL 3L3IA 1SF5A 4R5XA 3VFTA 3V0VB 3FQRA 1TJIL 5CGYD 4HWBL 1BQKA 1TQCB 3H2WA 2UX6A 1XO8A 5H94A 1G9EA 5GRVL 2XVBA 3LKNB 4XCEB 2FEJA 8PAZA 1IGCL 1UB5B 1JV2B 5DUBA 1N68A 2J8UF 1OSYA 3TPUA 1HEJC 4H1LA 1CD1A 1N3NA 3BFQG 3T3PE 4LEOB 1VZHA 4PJEB 2XTSA 1KJ2B 2R2HB 4XH2A 3N41F 3RIKA 4X9BA 2Y23A 5EO0A 2NX5E 5KYXA 1MHCB 1P7QB 3TCLA 1R5WB 5EIQA 3H9HA 3H6AA 3QDME 1DBJL 2CA4A 3SKUD 4QXGL 1NGXA 2JI3A 4I0PA 2ROYA 4AEIL 3DTXA 3U0WH 2EVGA 1J8HE 1JRHL 2M2DA 4JR9L 5DTFA 4YSOA 3D34A 4Y1AB 1ZEAH 5EBMA 2QKIB 4JKLA 5CLWA 1QNZL 3NJIA 4XE0A 2PP8A 2O5NA 3AY2A 3PFUA 3EJRA 1EZLA 3WIAA 3CZJA 2ATKB 1YNTA 4YHIA 2IG2L 1X7SA 2OXHB 1LE5A 1YN7B 2VMJA 3QRBA 3HNTH 4FQ2H 4NN5C 4W93A 3K5RA 3V0WL 2YC1B 3QDHA 4DEUA 4NQXB 1BQHB 3KPPA 4RFOH 4CVUA 5AB2A 2NZ1A 4XMKL 3GINA 4Z7VE 2VDQB 4KHTH 4M93B 1TYRA 1I9IH 1FV1A 1WHPA 2B8OT 3RWGA 3V0JA 1NWOA 4XNZC 4FLHA 3U1QA 3V0GA 4DT2A 3CSYB 1E4KC 4JM2F 4JDTL 4MMZB 2AXGA 1FIGL 4X98A 4FFYL 1Z6JT 2WXKA 1H3PL 4MLSA 3M7OA 3BESR 3MLVL 3BPLC 1JK9A 1RJZA 1QPPA 2YRZA 1XR8B 4MJID 4TSBH 2QDVA 1J1OH 5J7CC 3AJ7A 4GQRA 5FHBL 2HX9A 2X2UA 4J27A 4HPOL 1IAIM 3DETD 1PFCA 3RG1C 1NIFA 2PTVA 2CM6A 4CC0A 3WY3A 2X4TA 4JM0A 1VEMA 1KIPA 3HZKA 1D5BA 5C2BH 3RUGB 4WUUD 3KR3H 4WLCA 3HMXA 1A6ZB 1JUFB 2EC9T 2YGPA 3NFNB 4KXZI 1JP5A 2B15A 1HEHC 3P30H 1Z5LA 5EU5B 5FKAA 1XGPA 4BCZA 5C07B 4M8VA 2WQAA 4EEEA 4L9LC 3T04D 3OSKA 5F3HA 12E8L 3I50H 4O9HH 5KVEL 3WEMA 4CBZA 2A9DA 1R9FA 1IEAB 1PZCA 3ZTJH 4PJGB 5EDXA 1AG0A 3IF1A 3V8CA 1LEGA 5B7FA 3KGSA 3S3DB 1W8EA 3IDIB 1FP5A 1LP9A 5K9JL 2DQGH 3K8KA 1P9MC 3GMLB 1W15A 1NIEA 3WY4A 1S9YB 5EIIG 2HG5B 2OYKA 3KL5A 5C08D 2DQFA 3OWRA 1Q0XH 4PBXA 3OQRA 5AZUA 4ZMZA 1T5XB 3INOA 3U0WL 3P2DA 3IFNH 4MHHG 5I71B 5EIVA 4Z23A 1G7QB 3GRWL 4DPCX 1BAFH 2W9EL 3FFCE 1IBGH 2A9BA 1U92B 2AV1A 4UDUB 5AOLA 5K39A 5E1AA 3UCQA 4IYKA 4BK4A 4P3WA 3QDJE 4K15A 1PLGL 3NPZB 4X6CE 4UT9H 3DV4B 1VFBA 5CINL 1FGVH 4XI5D 3MUJA 2WLHA 3HNTL 4M9OA 5IVZB 4ODVH 3EOTH 3KPTA 4P5TB 3O9WB 4BZ1A 4RFOL 1DJZA 1Y18A 2KS0A 2YEQA 3N06B 1I31A 3HI5H 4TQPA 1BXXA 4WUKH 4AYFB 1UADC 1X5LA 2E46A 4KXCA 3NEOA 4P59H 5CEZD 2WZ5A 3APNA 4GP5B 4PGEA 2VO8A 4UV4L 1F4YL 3C5ZB 3B7YA 2XLLA 2HLFD 2DQDL 3N55A 2AHIA 1IZKA 2B4CC 4N1HB 5AZ2L 3T4YB 4QHNA 2XC8A 3WHXB 3F12A 4HC1A 4FMVA 5DYOA 2WZPD 5GZND 3QCUH 4JMNA 2CGZA 1RZJH 5E8EB 5CGTA 3QEGH 3ZZLA 4QRTA 2TAAA 1ERNA 5ALCH 1VEOA 1NFKA 4MCYB 3FCSB 1YMHA 5C0CA 2HJFB 3FSAA 3J8F7 1QKZH 2JXMA 3K1KC 1YPZA 2ZCKH 3BDBA 3WLWD 5ADOL 5IVXA 5IZ7A 4UCFA 4EN2A 5ABDE 4QXTA 4TRPH 4J6IA 3FJTA 3E7JA 2DQCL 1ZV2A 4M00A 2R59A 3KR3L 3NAAH 5E5RB 3OZ9L 1CI5A 2UY7B 3M1CA 4R7XA 3SKOB 5FECB 3WI9A 2ZXQA 3I50L 3QUYC 3V10A 1MELA 4JG5A 2VDMH 5KSAC 2ZXBA 2GK0B 5CMAB 5HI4D 3UABA 4ZUSA 4JRFA 1CD9B 4ZODA 3VGAC 3F3HA 4GRWB 5F1IA 2O61B 1MFBH 4G70B 4QHLB 4YDKL 4GMTH 4E9LA 4M6AA 5DUML 1XCQB 3AQXA 4B9GA 3AB0C 4WGWB 2Y1AA 4AQ8C 1ZLDA 3O81A 3CVIH 1WFUA 4AIOA 3PHOB 3M6DA 1VFAA 2UUDK 2BLFA 1EJ8A 4FQJL 4KFZC 2RAMA 1Q0XL 2WWNA 2YWYA 4F3FA 4WDIB 3PPSA 3IFNL 1ACZA 2K6ZA 3BKCL 1EK3A 4FFZH 4XMXA 1BAFL 2F8OA 1IBGL 4LE8A 3SPIA 1NKRA 1RI8A 1ZT7B 3NCXA 4NCDA 5H37G 1C5DB 2R4SH 3AWFA 1YEDB 1ID2A 1H9VA 3QIUB 4MLIA 3X11B 1OZUA 2DEYX 4KFMA 5TE6H 5JZ7C 5CP7B 3OKDB 1NGYB 2GJZA 2F54E 3BP4B 5EUOF 1L0YA 3O8XB 4GW4A 4KUZL 4L1TA 3QH3A 1ZK5A 5BZWB 4CDGC 5I15H 4R96A 5KYWB 5IHZA 2OMZB 3HI5L 4RMSA 4X6BA 1RJLB 1UQSA 4P59L 1G6RA 1MREL 4P2QD 5DK2A 4DO6A 3OAZH 1NANI 4ZFFA 1W0VA 3VWKA 2PMZA 3K2MC 1KPRB 3QBTB 4PJ7F 5I1JH 1W9XA 5BVPL 5FPIA 2GEEA 2VLRD 3RAJH 5DT1H 3TZVD 2OCFD 1FFNB 4LSPH 3C75A 3ZE1E 3UTPD 1T0OA 3PDOB 4U7SA 3ROLB 4XBMA 1S7SB 2G2RA 2DQEL 3LMJL 5KVGE 3FT4B 3QEGL 5C8JA 3HC0B 5C0EB 4WIQA 4P4KD 2N0KA 4KXAA 3UPRB 5I73B 4Q2ZA 2XZZA 4QOKA 3TO4B 1QATA 2JKWA 2MRYA 1XL6A 4TRPL 1H15A 4GW5A 4NQEA 1YNKL 2C9QA 2OXGA 1IIIA 1ZA6B 1FA4A 4DGWC 4RMUA 3CLWA 4RWYL 4MBOA 4G6JL 3QORD 3HS0C 1IGIL 3MUUA 4PJBA 3N50A 1TZGH 1ZHBA 4WFFD 4A7VA 5DC9B 4D8PB 1TUPA 2YARA 4YPGB 3GMPB 5CEYB 1NDMB 1JHKL 2P7TB 4NXSA 5FA3B 2WGNB 2VZVA 2P8PA 4DPBX 5L2JB 2CLVA 3W56A 3KXFD 2VDRB 3T0ED 3H7BB 2W60B 3E80A 5I30L 4YLBA 3MRMA 4ORGB 4TL5A 4OI8A 4QT5A 2F5AH 1RZGA 2VM3A 4HCRL 1ZLVK 2AABL 3CVIL 5IW1B 4JQIH 4H8WL 1TU2B 2CJUH 3RZWA 1W72A 3VNYA 1RZ8A 4MJIE 1CIUA 3I9IA 1BFSA 4Z7UA 1HZKA 1UEYA 4K3JH 4RGND 3DTDA 2R4SL 4WAFA 4IGBD 3APMA 1U8KB 4HFUL 1IKFL 1A5FL 3FQNA 4PY7A 5E8DL 3TNMB 4QGYA 3FUFA 5JNYA 3L3OB 5J6GA 4U6HB 5CHNB 4YDJA 4WUUE 2A6JB 4PJ9C 3MJ7A 1GZPB 3QFDA 4JPIA 4N2BA 4E9YA 4ZNCD 1ZVSA 4YDZA 3Q9PA 1MW0A 2ZCHH 5C3IA 2EE0A 4L8BA 5ADPH 4J4PD 4LSUL 3VXUA 4P07A 5DRWB 4LPYA 5PAZA 1ONQA 1J5CA 5AZEH 2BFVL 3W1ZA 4QF1A 5LKNA 2QQLH 5EOTB 1OGTB 5DSCB 1OL0A 4W4OA 2UX7A 5K9OB 3BD5A 1FG2A 1KGWA 2R0WH 4LSPL 4PJCA 2APTA 4EOWL 2ZAHA 4PB0L 3RNKA 2ZICA 1SVZA 4UAOB 5ESQB 4AEHL 1PAZA 5ECJE 1TQWA 2ZE0A 4FQXD 5C08E 3ZKQD 1PS3A 1PG7W 1G87A 2A77H 4Q0XL 1U42A 2OW6A 4LHUD 4ZQKA 2IIJA 3MV7A 4CU7A 1LILA 4GSRA 3QULA 5D2NA 3V6FB 1RSYA 4ZXBC 5AOJA 1EVTC 3MLXH 5KG9A 1U8PA 4HX1A 4KKCD 3DIFB 1AQHA 4M9PA 3VQMA 2D7OA 4TSCH 1MRFH 4FEMA 1R5VA 1FO0B 4YBQD 2AEPH 1QUPA 5GZOC 5HYQB 1TJMA 4KKBC 3LRSB 4XN5A 2PW2B 2FWOA 4DKDC 5FO9B 4M7LH 4EXPX 4I0PD 3BSZA 1IBHA 4YHOL 2Y6SC 3LQAC 4L1SA 3HUJF 1A66A 3PAUA 4MNQB 5CEZE 2F0CA 2ZUQC 2HLAA 3UDWA 3B8YA 2EDHA 4HZAA 3SCMC 3EFDH 5T33H 2F5AL 3PNWB 5DRZB 4QCIB 4HJJH 1JZ6A 4GUQA 4K4KA 3B7RL 3CPUA 2D4DA 3L3DA 3T6WA 3B2VH 1T03H 4X2UA 3QNYB 3LN4A 3C5JB 1JPEA 1HQRB 1MAMH 1ZT4B 5C9JB 4Z7WA 1PKQB 1V10A 35C8L 5J1AB 1HESA 2J57A 4QIRA 1HHKB 4K3JL 3N40P 1Q1JH 4NI6A 2EACA 3A4FA 1BLNB 4F33A 1P2CA 3QAZC 1A6UH 4RESB 3KCPB 3IGUA 2R2EB 3DHUA 5ANMA 4NRZA 5D7IA 5GRVK 4F7CA 3W9EA 2JB6A 4C4UA 5BRZD 1UCTA 3GBDA 4L1HA 2ZX6A 4PS8A 1RL1A 3RWIB 3CVHL 2ADGA 4HKJB 4AW7A 5BO0D 5DD6A 4JFOB 2WN2A 4OCWH 5D1XA 5T1KA 3D6GA 1AO7D 3LQZB 2QQLL 4DPAX 5F21B 3HC2A 5IHWA 4KQ0A 2X1XR 5J12C 5J3HC 1J05B 4A04A 4XN2A 2AJYH 3MV9D 2YPVH 4LB8A 4EPSA 4Y19B 1T1YA 1CICB 1ZSHA 4QDGA 2JJUA 1E9PA 4IRJB 5K93A 4K9JA 2FH8A 2UWEB 4X9GA 4FG4A 4XNYH 5FYJD 4HCFA 3MLUL 1KIQB 2XFGB 1JE6A 4MA3B 5SWZE 4CGUB 1MF2H 4LOEA 2GTWB 5JHDE 1BX2B 1SLUA 1IEBB 1VFOA 3RWHA 5IT2L 2D9CA 3PGCA 2APXA 4HZ1A 3S5LA 2YOCA 3UFIA 4NQVB 2OZ4A 1NEPA 2LLGA 2OMBA 3IAPA 2DIEA 4M8RA 2OQJB 3HRPA 1MRFL 4M7LT 2H3NA 4OAWB 4RAUB 1G7LA 2PXYC 2ZYSA 4G8GD 4M7LL 4C4KO 1NBQA 4F37F 4BGDA 2VIRA 3QZWA 3CN2A 5EU3B 4LP4A 4PJAF 4P2QE 1FVEB 4OLXH 4BUQA 5BNXD 2R1YA 1YQVH 1N59B 4F15C 3FTGA 1RERA 2MHAB 3PV7A 3W0WE 1IC1A 3Q01A 1A6PA 4ZTPL 3FQRB 1TTUA 2NSMA 2B9BA 3H0TA 4PJ5D 3OHXA 2VLRE 5FWRA 4FLQA 2CXGA 3MOBH 3QSKB 3B2VL 1S9VB 1PZ2A 3LJ3A 2P52A 3T0VA 3ZDZB 1CYGA 3UTPE 4Y5YB 1FL3A 1MZZA 4ZYKB 3CNKA 5DUBB 1BW8A 1MAML 4WW2C 1I1CA 3JTTA 3BJ91 1TVBB 2B7DT 1CGXA 1N3NB 5F1OB 2UZXA 2WQUA 4HQQL 2P5EA 3WFEH 4GS7C 4NFBA 5KBLA 4BFFA 3PP4H 3MO1A 3CCHA 4KQ3H 5EO0B 2FX7L 3TCLB 2EDJA 2FBRA 4MD5A 5D7LB 4NJ9H 1CXHA 1WZ1L 3L5IA 3WD5H 4PJHB 4WFFE 5DTFB 1F6AA 1WITA 4PP1D 1U8LB 2J1XA 4M3HA 4LMQI 5C0CD 2CJSA 4DK6A 1KYDA 1TKWB 4AUYA 3KXFE 4FYTA 3T0EE 2P5WD 3VFNA 2WNKA 3FQYA 5AVVB 2AJYL 1MAKA 2J73A 2WJ5A 1T0MB 1CXIA 4R7LA 4FS0A 2DQJL 3ZL4H 3BD3A 3TBWA 4XNYL 1FE8H 4QTIL 5D1QC 5A6LA 2FSEB 3HHMA 4MMYA 3TJHD 1E9OA 5EFIB 2P28B 3BW9B 3P4OA 1TYJA 1OCOB 1XH2A 4YSQA 4RGNE 4XNBA 4QXVA 5KSBB 1H3TA 3RWEA 2LLNA 3ML8A 1ND0B 3ECUA 1P4BL 5H4ZA 3US1A 3X1NA 4B5ZA 1DJSA 1J0ZA 1E3XA 3ARDC 5IHUL 5CWSB 1V7NL 4ECNA 4AJYV 1RJZB 3Q0HA 4L8CA 1SXCA 3H9ZA 5LWYL 4JFPA 4L2YA 4XNMA 1OAXH 1J8SA 1HZHL 2I7OA 1F8TH 5E08H 2WXGA 1YQVL 1F4XH 2QFPA 3FZUD 3UROR 3FOLA 4PJ7E 1KIPB 4HZLA 4KUCD 4DGVH 2OW7A 4HXAH 4XB3A 3O0RH 1LYQA 1ZOXA 2WXRA 2NLJA 4L48A 1Z5LB 2C3HA 1XGPB 3QUMH 1ZDSA 5HDBE 2DPKA 3B2UC 5F3HB 1GXEA 5D6DA 2H9GA 3B2DC 3NIDB 1WLHA 2D8KA 3BPCA 1SXBA 3QIWA 5IROD 4J3TA 2FL5B 2XN0A 4NQSB 1Z9OA 4JRXA 3TBBA 4ZAKB 2HYMA 3WFEL 3PWPD 1X9RA 1L9TA 1ZAGA 4IIQC 2QPDB 2NW2A 4FQLL 4GKLA 4KQ3L 4QAWA 1NTDA 5C0GA 4R4NC 3S9DB 2JK5A 4NZUH 4F2EA 5I18H 4DEPC 3A4DA 3EDJA 1INQB 1FIEA 4ZMNA 5HI3C 2C3XA 3T3ME 4W9KC 3I6LD 1GR7A 1S7WB 3ARBB 3B9KC 3CDCA 3IXTA 1SEBA 4DHLA 5F9OH 3UTSB 1SOKA 5KBPA 5EIIA 3NSFA 2AV1B 5K39B 1U8MA 5GRJL 1CU4L 2FQEA 5SWSA 4JFYA 3OPZH 2BVEA 2DWEB 4X6EA 4PMFA 3ARED 2BSRB 4NQED 4HULB 3MRKA 4N2EA 3MX0A 1KIRB 4O51B 2AJ3A 3FH5A 4HS6A 3S98A 3WSQH 1Y18B 2XPZA 1DBKH 1JGVH 3QG7H 2JIXB 1FE8L 4HKZB 4BH8B 1CFBA 3ZGIA 5JIMA 4E9VA 4PGEB 1D9KB 4UQIM 5EORH 4E41A 1WH0A 1O6SB 3MKKA 2IH3A 4OLWL 1XGTA 5DZLA 1UUNA 5FM4A 3K3QA 2DQHL 5BV7C 5IP4A 4K8RC 4QMEA 4QHNB 2GIXA 4KMTH 5JXAH 1E40A 2DKSA 1E4JA 5DYOB 4N9GA 5BRZE 1T04B 1NFDF 4QRTB 4LCCA 1KDJA 2YQ3A 1QTPA 1YMHB 4KJYA 4PTUB 4AT6B 1YYCA 2JXMB 1YPZB 3FB7A 5H2BA 4AIZB 1T6BX 3HAEG 3ARGB 1AO7E 5TF1H 3VD2A 4QXTB 2EECA 2Y7SA 1WA1X 2QR0B 5E6IA 3UG4A 3VFGL 1FZMA 2YEVB 5E94B 1OARL 3CU7A 1EBPA 3AWEA 2B5IB 2DKMA 2EDBA 2EDYA 2NY4C 2VLLA 4IRSD 4MQXC 3FOMB 3MV9E 5E2JA 4IQHA 4D0CA 3KD4A 5BOPA 4F7EA 1MFDL 1Z2KA 4JCWA 5AQ0A 3O6KH 3JWOC 5FYJE 3VXUD 2V2TA 4ZUSB 6FABH 4XC1L 4HWUA 2HVBA 2YMXH 2GFBB 4APQC 2DWXA 4JNXA 2VSKB 1PIFA 3H55A 2Z31B 4NAQA 3VGDA 2RTTA 3NJJA 1DBAL 1MFMA 4U7MA 3MV11 1S5IH 3S3JA 4BSWB 2ALWA 4OZGE 2MCAA 1T7XA 3SPJA 5CD5C 4G8GE 4YGAB 5CJOL 5F9OL 3AMKA 3KGRA 1TJHH 4WGKA 3EH1A 1KJ2L 4JHAL 3H42H 4GPVA 4RFEA 3MFFA 5AD0A 3KLAA 4U33A 3D0LB 4LOUD 2XG5A 3DPBB 2GJZB 3M45A 4FL4C 1UM6L 2XQBH 3GSNA 4GH7B 4PJ5E 5H37A 4TULH 4R96B 3WN5C 3WSQL 1DQKA 1LEKB 1YEEH 4LF3B 2BK8A 4X6BB 1RVFL 5DK2B 1W0VB 4NZDA 5AYTA 2NY6C 3VWJA 5J6HA 5BUGA 3VD1A 2BHUA 3VW3L 1UM4H 3V6OE 1G9NC 2R27A 4L4JA 3QIBA 3B1UA 3ZN6A 3NFPA 2RJMA 1X5KA 2XG4A 4HWEL 1QBML 1MHPH 1NAKL 4RLDA 5HGBB 3SZ6A 3U9PH 2WLJA 4GUCA 3MA9H 1F56A 2P1YA 4XMTA 4WJKB 3OGOE 5C8JB 1JWSA 1LTXA 1MCDA 1WD9A 1NAMA 3CDZA 1I1AD 1OK0A 4JPVH 1KEMH 2PCPA 4Z78B 2AAAA 2VDQL 3C6SB 4Q2ZB 4QOKB 2WBWB 2XZQL 4N25A 1JTTA 5AOIA 5TF1L 5C0CE 1AE6H 1HOCB 2FVNA 2OXGB 1JF1A 5IVXE 3GKWH 3BIAX 3GTTA 4LLWA 2OSWA 3PF2A 1YC8A 2P5WE 5ITBH 2CNZA 4Y4FA 5KVGH 1FVDB 2ADFL 4FXKA 5HHOA 4JKMA 4U31A 1UXSA 5E4EC 2FQFA 4JN1H 1OB0A 5F7DB 3L1GA 3O4OB 1CFNA 4MCZA 4ALAH 3CN3A 1SN0A 4ZPVA 3LS4H 1YZZA 4LT7A 4MA1C 5AVZB 3GMQA 4UQ9A 6FABL 1HH6A 2P8PB 2CBTA 4RNRA 2Q7AA 3MBED 2EEDA 5D1XD 3MRMB 2NTFA 5LGJB 3R7RA 3N1QC 4ZW5A 2CRYA 2YSTA 3VI4F 1NCNA 3B56A 3ULUC 4MAUH 2GJ6A 5J9PB 4L3ED 3MZTA 4U4BA 5JR1L 1AMYA 2BY2A