3PFUA

N-terminal domain of thiol:disulfide interchange protein dsbd in its reduced form
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
119
structure length
119
Chain Sequence
GRSQFVPADQAFAFDFQQNQHDLNLTWQIKDGYYLYRKQIRITPEHAKIADVQLPQGVWHEDEFYGKSEIYRDRLTLPVTINQASAGATLTVTYQGCADAGFCYPPETKTVPLSEVVAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Thiol:disulfide interchange protein dsbD
publication title Oxidation state-dependent protein-protein interactions in disulfide cascades
pubmed doi rcsb
source organism Escherichia coli
total genus 23
structure length 119
sequence length 119
ec nomenclature ec 1.8.1.8: Protein-disulfide reductase.
pdb deposition date 2010-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11412 DsbC Disulphide bond corrector protein DsbC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1250 Mainly Beta Sandwich Immunoglobulin-like Thiol:disulfide interchange protein DsbD, N-terminal domain 3pfuA00
1L6PA 1VRSA 1JZDC 2K0RA 1Z5YD 2K9FB 1JPEA 3PFUA
chains in the Genus database with same CATH superfamily
5AD0A 2XC8A 2DLFL 4JFPB 1RJYA 2QKIC 2VSDA 3L3HA 4MHHG 4K3EH 4UDUB 4XO8A 4M4PA 1M2VA 3DIVA 3ZDZE 4F9PA 3KYOA 1KYFA 2WC7A 2ZYSA 4KK6D 4KGJA 1EJ8A 4W9DC 3RVWD 5I1KH 2P5EB 5I8CB 2IQAB 3AQXA 1T7YA 3QEUA 4QRPD 4UNVA 5F97E 1Z5YD 4PJCE 1W72H 4QJ3B 4EEEA 5DMYA 4RX4D 3KPRE 2UZXB 4PN6A 5I1GL 3BAEL 3ETBJ 5HHXH 3G04A 3MREA 2DI8A 3FB7B 4ENEC 2ICEC 4XCNB 4JDVB 5IHLB 4K5MA 1A6AB 4K5NA 5ID1A 1A9EA 1MHEA 1YEDA 3OMIB 1QNZL 3MMEA 4X83A 3U0TB 3MLXH 4NJAH 1KDJA 1N0XH 5DHXB 4YSEA 1BGXH 2NT1A 1YEEL 5TPWH 3KLKA 1E9PB 5D2LB 1DLHB 3ARPA 4AIXA 1JPTL 1XX9C 1D5BA 1HH9A 5FX3A 5A2KH 1QVOB 3G6JF 3MLRL 4PWGA 5LAXB 5DEFA 4HK0B 2RALA 1TF4A 2ZP8A 3BAIA 2AJXH 2CDEB 1SGKA 3CU7A 4MMXA 4KOBA 3PHOA 4DTGH 5ADOL 3C5XA 1T4KA 4U1MA 4BKTC 5EEXA 5JIQA 1F8TL 1HKLL 4LSTH 3IDJA 3T3PF 3QUKA 3BSZL 1SHXA 5D4QA 4WNJA 4LBAA 1WO2A 2BWIA 3SBRA 4DVRH 2OTUA 5EUOB 1UWEH 5F1SA 3WNOA 4TUOA 1OP9A 1RZKH 3EJRA 3QWOB 5C7ZA 1WPCA 3ZL2A 3HFFA 4KXBA 1MG2C 2YGVA 3HG3A 3DHPA 4HSAC 3O4LB 1IT9H 3LKRA 5E0FA 3ARBD 4NQCA 3ATFA 3PP3K 4YH6A 2Z4QA 4TQEH 5AW1B 1P4BH 1I9EA 5IJVB 2VXSL 5EZLB 1A4AA 3MJ7B 4HLZG 1GPOH 1U2HA 3L2LA 4N85A 5GS0H 1WQVT 1BD2B 3PP4H 5DQJA 5DJ0B 4J3VA 1LLAA 3RNQB 3DUSA 2ZICA 5C0CB 4DZBB 5CM1A 3RTQB 4FNRA 3ARGD 4YO0B 1BFVL 5IGXH 4ABWA 1EBAA 3UBXI 2GIXA 4ZODA 3SDDA 3LZFL 5L8LB 1FZKA 1ZT1B 2ADGB 2AQRA 5FO8A 1NCWH 4WEMB 5IROA 1VIWA 1OT1A 4OU3A 1ZS2A 3KJ4C 4J5VA 4P3CL 4BSWB 3PQYA 1BQRA 4NHUA 5HYSG 4FP8H 4Q74A 1T1WB 1TJGH 3F85A 5EORH 4QYOB 1A4JA 2HX8A 4XHQA 2ALWA 3WKQA 3U4AA 4MNHB 2X1OA 1ACYL 5CEZH 3GSUA 5KBNC 1NCAH 4PJ9B 4ZK8A 2VE6B 2DZEA 2ED6A 4QHMA 4XVTL 3D6GA 3S88H 4U49A 2AJUH 4W9JC 3UABA 2XKUA 4Z7UE 4X6CF 4MDJB 3VYOA 1IV8A 1IC5H 3ES6B 1P1ZA 1OPOA 1FNSL 1U8HB 4PJ5E 4EDXB 4K23H 1CE1L 4Y5YB 5M94B 1S7RA 4NC1E 1NL0L 3NZHL 3UROR 1V3LA 4HFUH 2DJMA 1XSJA 3ENEA 4AQZA 2VYRE 4GYBA 1RU9H 3GINA 5B38G 4YZFE 2CHNA 3SE9L 3VI3A 3ULVF 3CXDL 3BN3B 2FEEL 3GXUB 3IXTB 4HEMA 4JR9H 5MI0C 4S1SL 3S2CA 2J44A 2Y7OA 4L0PB 5GSRA 5L9DL 2WYIA 3EO1A 3PRZA 3D87B 3Q43A 2AJZA 4Y16D 3S3JA 3UTTD 5CILL 3WV0A 1PX3A 1OAJA 3QSKB 2JF1A 4I2XE 1TLMA 1BG9A 4MQXC 5DT1H 3T08A 3CN1A 1ESOA 4AYMC 1MREH 4Z8FH 3E0GA 4RMWA 3EF7A 4LU5H 3F5WB 5DJ8B 5L2KD 4MCNA 5I1LA 4ODVL 3ORJA 4HHWA 4JGUA 5L0QC 3AY4C 2X4SA 4O2CA 1K5WA 4BE5A 1CPUA 3ESUF 4R3SA 1PDKB 1BIIB 1U4FA 2XX1A 2GHZA 2Q86A 2OMXA 4JCLA 1QBBA 2FWLB 1NGPH 1PQZA 2X4TA 4PJBA 5BPPA 2KI6A 4F1SA 3HLAA 4B9JA 2A4ZA 2F19L 3DX6A 1EO5A 1KCSH 1V3MA 2L3BA 1H3PH 2AXHA 3D39E 3SGJC 1KBWA 3E2HC 5C07D 5C0FB 3HI1B 2P5WB 2HWZH 1JV2B 1D9KA 5ADPH 1ZVSA 5D2LF 2DEYX 3RWEB 5EHFA 4RAUB 5B3JE 4RIRA 2PMZA 5T33L 2DQ6A 3OAZH 4QHLB 4FI7A 3HZYA 2V5RA 3ZTNL 4N2OA 2V5MA 4Y5VB 5KVDL 3WN6A 5I71B 3RWFA 5CUSH 2O6CA 1TQBB 3V6BR 4AITA 2YRBA 2IAND 1H3GA 3AW5A 3LN4A 4HISA 4IK6A 5EUOF 4AEEA 3MV8B 3QCUL 2JV6A 4CVXB 3DVIA 3EH1A 4P9ML 4OQTA 3TX4A 3B9VA 3G08A 3X2QB 3EGXB 1LE9A 4OZHA 3AADB 3DVGB 4FLQA 4HZAA 2A9BA 4JFOA 1A7PL 1J0HA 2X0VA 2GG1A 1TQCC 1TQTA 3RE0A 4G7QB 2ATPB 4XNMA 5LBVA 2B9AA 3OAWA 1I3GH 4PUBL 1VFAA 1F2XK 1VPOH 5L6YL 2HJKB 4KRPC 1JNLL 4ANUA 4QRSB 3WNPA 4QKTA 1MPAH 1U8CA 5D9SA 3L7EA 1E65A 4XR8C 4ZOCA 5DFWH 4PYGA 4H26A 4ONGL 5A7BA 5D1ZC 1L5GB 1ANUA 2AMUA 3TOPA 5A2BA 5B39G 1OGTB 1IZJA 4N0UE 4ZQTA 2Z64C 5D7KD 2O6PA 3JYCA 5AEAA 1J9TA 1FPTL 4JY5H 4P5TA 2VDRB 3RU8L 3LDBB 2W65B 1RZJC 2AJYH 5AW6B 4IYKA 5DJCA 4LF3A 4JKMA 3V4PL 2WVVB 5E23A 3V0JA 4A7QA 3K5SA 1TZIA 4GRMB 4JFYA 4JPWH 2LTQB 4MCYB 3K0WA 2ZKXA 1OLLA 5I0ZA 2ITCB 1EO8H 3EH3B 1DVSA 5HGAA 1YNLL 4KZEL 2YOCA 4DP4X 1QEWA 1JF6A 4MAYC 3D30A 3ILDA 3QUYC 2X44D 4WSKA 5EH1A 3IS1X 1PSKH 4BH8A 2XY1A 3PXJA 2AGJH 4JFFE 4L0YA 1HNGA 2N0KA 5HI4C 1IFHL 2OSYA 5E51A 3TBWA 5DD6B 4QXUH 2DPKA 3VU1A 3VG0H 4M43H 4NQXB 1NMAH 2O6DA 1DUYB 2WYTA 1FRGL 4GW1B 2I07A 2RTTA 3VX1A 1RZ8A 3S48A 1LO3H 3CFBA 5G5DB 4P23C 4K3GA 2C7UB 4P2RA 3PGDB 3VG9B 3DJ9A 2R4RL 4AQ1C 1IAKB 4GRWB 4KHTL 2ICWA 4RRPM 2JI1A 3KYNA 1XIWD 1ZS8B 3CFJB 4GUPB 4X6EB 3VJ6B 4JRYB 3FQXA 4XBGA 2WVSA 4PWIA 2DQCL 2OR9L 2R7EB 3GSVB 3P2TA 2X5PA 3PHQA 5CN3A 5DMIL 3DUHA 4LLWB 3EHBD 1XXDC 2R8SH 1P7KB 4Y9GA 1QLRB 1CDHA 1R3LA 1WYJA 3IJSA 3ZR5A 1PG7X 3ZE2B 1AQKL 2OTPA 4HXAL 5SWSE 1KN4H 3KL5A 3OD3A 1DO6A 3BH8B 3S5LA 1VAHA 4UQCA 2VLKB 2MTAA 4DN3H 1AZVA 4N9GB 5D70H 5DTFA 5KVGH 1R3HB 1FLRL 3VDAA 3ZE0E 1MCRA 2ZPKH 3CFQA 2XACC 2XXGA 3KYMA 3OG4B 1FVEA 4J6IA 5CIPH 4ALAL 1UA6L 2MCAA 1AZNA 3U9PL 2GSIA 1EFQA 1FZJB 1YO4A 2VW7A 3GJEA 4JO2L 4PG9B 5IB5A 5HPMA 2CR6A 2QLVB 4UWQB 5IEHB 1AD0A 2WY3B 2CK0H 5M95B 4M5ZL 3VM5A 1W8NA 1XDTT 4LVNC 3LJ3A 2X4QA 3LPGA 1QUPA 4J3OD 1MQKH 5I8OH 2Y1ZA 3IJEA 2DIBA 5T1JA 4P05A 3F58L 2J88L 2Q9OA 3WTXA 4FMFA 1E27A 3SJVA 1U0QA 3DXAD 4P4RB 3RPKA 1W6LA 3VFSB 2XZAH 5JIIA 2AJ3B 4M7JL 3IMTA 3SO3B 1QSFA 4J3OH 4KAQH 1OF2A 1EHNA 3BPNB 4K8RC 4E9RA 4FEIA 3KL0A 1DVFC 4UV7L 4UU9A 5GJSL 3IRPX 3GMOA 5SV4A 2GJ6E 3WLBB 3EFOB 1T6WA 2GHWB 2XWEA 5C0AD 3QUXC 4C4BA 2ADFH 1BVLB 2F1BA 2OMUA 3SGDH 1MHPH 1MRFL 4XRCB 2HRPL 1U95A 2E74C 2YMOA 2NNCA 1AXTH 2XY2A 3AU1A 4NKQB 1LJMA 1ZANH 4NXKA 3OAYK 3CDGB 5E6IC 5ETUB 2HT4C 4U1IB 1WAAA 5TF1H 1USQA 1RFDL 4P2OB 1EGJA 5CR1A 4FG0A 3GSRB 1WS8A 4I9WD 2XWCA 3W82A 4Q6IA 4JFDD 2HPTA 1N8OE 4KK8D 2HFFA 1YAZA 2WXKA 3HRZB 3O6FA 3KLDA 3S36H 2C4XA 3QUZD 3PV6A 1U8JA 4YE4H 2E7HA 5JR1L 1E3XA 1QBML 3O45A 1WD9A 3AACA 4KUCF 4J1UA 1U93A 2AQ2A 2HMID 1L9SA 2N1TE 3VGHA 1LVEA 4JKNA 3V8CA 4URTB 1ZPUA 3BKCH 4EBQH 5IOKA 5LNEA 1UEMA 3IDGA 3LZRA 5ANMB 4P2CG 3RG1C 1LK2B 1K85A 3GXDA 2D7QA 4XO3A 3B3IB 1S9VA 1XL6A 4L05A 5F7EL 1FHNA 3BIBX 1DQLL 4LXFA 4CJ0A 3NJKA 1P6FA 2B1HH 1CL7L 1GGYA 3I74A 2YFNA 3FO9A 1JGLH 3QBTB 4E42A 1HYSD 1J9CT 5IBLC 2FBJL 2ZJSH 4KKAD 1K8IA 5B3NA 9PCYA 2VLJB 1AMXA 3TVMB 3CN3A 3DBSA 4EO5A 2GJJA 1K72A 1L6PA 4FA6A 3HPLA 1PBYA 1U21A 1GTNA 4FG6C 3FOLB 3B9KA 5HHME 3HG2A 3SDXB 4K3JH 3VXSB 2K6WA 4JFEA 1KIQA 2VLRA 4A7GA 1MF2L 4HCRA 4L4VE 1AJ7H 4U3XA 2NY0B 4GQ9H 1CXKA 1WVZA 4GIAA 1DBJL 4TSCL 3WIIL 1XEDA 2QPSA 3BH9B 1VZIA 4GRWF 2VDQL 4LHUA 3H2QA 1DVTA 1T04A 2IDSA 4NC1C 1CFTB 1I7RB 5D7HA 5J56B 4ODHH 5LDUA 2H1XA 4IW4C 5DZVA 3PL6C 3T1FA 4GI8A 1S7UA 3HNTL 3VTMA 3OPZL 4JRXB 5I73B 4Z0XB 2H1PH 2Q6WB 3FFOA 1MIEH 5EIIB 1SXAA 2X70A 3T2LA 2A77L 2IQ9H 4ODUB 3VXMB 4QR7A 3VI4B 5IB3A 1BYPA 2AW2A 3GO1L 4MA3B 1JZGA 3ZE2F 1GGCH 1NFAA 3DYOA 1ZJBA 1ASOA 5IT2H 3CMGA 3CDCA 3QXTA 2XFGB 2DLGA 4N0YL 3RWCA 4BFNA 4FQXB 3TO4C 1IAII 4IIQB 2JXMB 4HU8A 4FN0A 1JFHA 5E95B 2W92A 2D3NA 3FFDB 5K59F 3U48A 1ZIBA 2B5IB 5CLZA 4O9HH 4KRMB 2LLGA 3W38A 4N8VA 2BNQE 4ZSOE 1MCPH 4LP4A 1BQHB 1G43A 5DVMA 4U1JB 4AIZB 3W2DL 3ZUCA 1B9ZA 3VFMB 2NYKA 3NCYP 3PJSA 4L3AA 2YN3A 4FRWA 3QHZL 4XNZC 5CZXD 5D93B 4AW4A 4LCIL 4FC3E 5D1QE 4YIQB 3L7FB 2NY5H 1NGQH 4P5SA 3C6LC 1DBKH 5CCGE 3A47A 1E5YA 4PRHB 1UD8A 3BW9B 2JCCB 4RFEA 4TQPA 4Z5RA 4JL2A 1CE6B 4PLJD 3BJLA 1UXWA 5E2TL 3NAAH 3LV3B 4LSVH 3FU3A 2R29H 4PJ8A 3UDWA 2H0PA 1SDDB 3CDFA 3P4MB 1XGUA 4FYRA 3O3UN 1IQDB 1FVCA 2DI9A 3ARWA 4KK5D 1AG6A 5GGVL 2EIDA 2JTYA 3SE8L 3TWCH 4NGHH 3MUY1 5BV7H 5IROD 4AYDC 1D5ZB 1X9QA 3ALXA 3CLFH 3QC5X 3PQYD 5T3ZH 1UA7A 1BF8A 4PY7B 1W0VB 3QDGB 1J1XL 1JJUA 5K39B 2LE9A 4AM0B 3L9RB 1HQ4B 2WJ7A 4M6OH 2LAAA 5B1KA 3FTZA 4PCKA 4G6JH 1F5WA 4YQXL 2EDHA 1A1OA 1SEQH 2BNRB 2ZXAA 3APCA 1V5JA 3CSPA 3MV7B 4FXGA 4G8GD 4JN1L 4BIKA 4JAMB 2W9DL 1IL1A 3FHQA 5IVXA 2OP4L 2G4EA 2VXUH 1EEZB 4H8WH 4JVUA 4BFEA 4F15B 3S3CB 3H7BB 1TVBA 3FFCA 2Y36H 4L1TA 5DJDA 4DGVL 4EN2A 5GS2H 4UAOC 5D4HA 5J8OA 3G5VA 3MYZA 4QHUA 3T1WA 3Q6GH 4PGDA 5IW1B 3FUHA 2J3SA 3OMZA 5F7KC 3IE4A 5DS8A 2NLJA 3BQUA 5T3XD 4QF1B 4YAQB 4FNPA 4HJJL 2FATH 5DD5H 1BIHA 3O6LH 4B96A 2I26N 3ZGHA 3WS3B 1WE5A 2Y6SC 5D1XE 5IQOA 2AERT 5T3XH 3AUVA 4LO9A 3UG3A 1HS6A 4WO4A 1TPXC 1MWAL 3QDJA 1FGVL 3BEVB 1I8IA 3WFEL 1LO4H 2XYBA 2DBJA 3Q3GA 2AQ3A 3IWUA 4U1NB 3ARFC 3HN5A 1JGDA 1MFUA 1L9OA 1C1EL 5AKRA 4MB1A 2Y69B 4WTZA 3SDXF 4CADA 3CWGA 1YMME 4XH2A 4UILH 3OX8A 3RURA 2WB7A 4Q14A 3NQIA 1OCRB 4P2AA 4L1BA 3EJYD 3RJOA 3RKDC 4E68A 3MGOA 3RQ3A 2WBWB 3GSXB 1HIMH 1XTMA 4WUKL 1DQKA 1QNIA 4YS4A 5HYEA 2ARJB 2E6JA 3EDKA 2LABA 5B1BB 1FL6B 5IHHA 3QYMA 2WN3A 4GKLA 3U4KA 1MH5B 1E4KA 2FUQA 5FV2A 5TD4A 2AQSA 1QFPA 3L1EA 1EO7A 4UAHA 4MKTA 3B2DC 1SUJA 3KPSE 3L3KA 1YMHB 5CMAB 1CFQB 4GMTL 3G6JE 3P30L 4ZXBC 2MOVA 1RERA 3D07A 1D9KD 1OHZA 5CJOH 5IOPA 4FFYH 4AMKL 1S5HB 3VI4F 1SHMA 3DBXB 3VRIA 3U30B 3BN9C 3HI5L 1CQYA 4LASH 1EZSA 4AGMA 3MRJA 3CHPA 3M8OL 1L0PA 2XNAB 3ARDA 4NQDA 2CLVB 2WQSA 5E8NB 4LLYA 5J6GB 4B6ZA 1OTUC 4XMLL 5F89B 2AK4B 4QRRB 5JUEL 1PYWB 1XR8B 4X80L 3GK8H 2OXGA 2BVPA 4A37A 1ZE3C 1GAFH 1I8LA 3AMLA 3S5YA 2C8NA 4QRTA 3TBVA 1XZ0A 1RIVL 3CDYA 4PHXA 3TPKA 4WW2A 5TE6L 2CIKA 3MCKA 4LQFH 4F9LC 2WZPA 3VRLF 1E9OB 5BRZB 5HGDA 2KC0A 2FIKB 5CBAA 5DRXA 4DO4A 1JF5A 3WTWA 2PO6A 4BM7A 2EO7A 4FQ2H 1V7NL 2FWUA 1DQDL 1F4WH 1PX4A 4XGZB 4AENB 3TZVB 4GINA 2Y07H 3FQTB 1NFIB 1NAKL 4HS3B 4V1DA 4KKRA 1Q9LA 4U1LA 4YGVA 4N90D 2H9GB 3UPRA 3IETA 4FL4B 4FQPA 1A14H 2EO9A 1YYLH 2IBGA 5FCUH 1BECA 1FFNA 3O3EB 4NWTL 1BQLL 1XB6A 1UD6A 2YD3A 4HETA 5DK2A 3V5DB 4UF7C 5FYKU 1AS8A 1UXMA 1LWRA 4AWJC 2R23A 2Y06H 3F6JA 4LVEA 4DOHE 4IKKA 3L9EA 4X4YB 1ZLEA 4D8PB 3MLVL 2IPUG 2YLKA 1P2CB 2VR9A 4KK9C 3AZUA 4LL9A 4QTHB 2V9UA 1S9WA 1EDYA 1C08A 2JKSA 2V2WB 5DHVH 1RULL 4XMPH 1DQVA 1TQUA 4X98B 5FUZH 5DHMC 4CMHC 1H3WM 1OK8A 2L0DA 4H5SB 5C2UB 1QSEB 2QBWA 3RIAK 2D8KA 1KTDB 3CSTA 3NCWA 4Y4KC 1I7ZA 1CLZL 4XP4L 4ZDHA 1FH5H 5JORA 4WVRA 1G87A 5DQ9A 3ZDXE 4MX7A 3ZMEA 4NKIL 3EYSH 3MRLB 2ZWLT 2ZCZA 3EH4B 2XRAH 4GG6E 1ZMYA 1GYAA 3PAYA 4P2RD 1HHJA 2R0KL 3L1OH 5E6RB 1JP5A 3CZJA 5JXAL 1S7XB 1PPIA 1NICA 1E28B 4TSBL 2VR3A 2IOIA 3KPMA 5C6TH 4E36A 4JO1L 1F42A 1FWXA 4Y4FA 4BELD 2IH9A 2B0SL 2ZXCA 1FC1A 2QDWA 1NFDB 3QQDA 5DWUL 3V6ZB 4UZUA 2Z31A 4TVPD 4U3CA 5CKAA 3DV6A 1KBGL 2CJTA 5EWIL 1DSWA 3HC4H 3DK2A 3VDBA 4BFIA 2W07B 2P49B 3KDMB 4F1ZA 2RHEA 3BVDB 3E9TA 1I8MA 2B39A 1FIGL 1B3JA 1E4HA 1J0IA 2J25A 3IFNL 4HC1A 4K9EC 5BXFB 4NRZA 5EULV 2CO4A 1TO4A 5EA0L 2EDBA 4QNPE 2UV3A 1I3VA 5DRWA 1A6VH 3ZTJH 1T5WB 2NYYD 2J43A 4HCIA 3PE9A 2OMVA 4M8QA 3ZX1A 2C3VA 1UOLA 3LZNA 2FGWL 4JY4B 4ZTPL 3A3YB 3SYOA 4F7PA 2NY4D 4QCIB 3GNML 4XP9L 3S8FB 1TKWB 4PGBA 3BPOC 1TMCB 2RIKA 5DQDL 4M8RA 3ZPDA 1B4JL 3OC8A 4AGPA 1WC7A 2FH8A 2EKSA 4R2GD 1DSFL 1CDIA 3RZCB 1PW3A 1RL1A 5ALCL 2P28B 4NIKB 2DD8H 2H6PB 4HKXA 3CVDA 2NXYC 1ODUA 1FYTB 4EDWH 4U1GB 3DSFH 3TN0D 1KJVB 2J56A 2EIJB 3WFHA 2D7TH 4M61A 1OQXA 2ODHA 2PABA 3OKDB 4G9FE 4MA7L 4WFHE 4FG2A 4YEEA 1JHLH 3LRGA 3ARSA 3D05A 4EOWL 5AVWB 3H42H 2VMCA 4NZTH 2BIIA 1B0GA 2ZSWA 3HZMA 2IPKA 5KSAC 3T8MA 2ICES 3CN0A 3MACH 3BX7C 3HC0B 4KROD 2YAOA 5HGBB 3ROLB 1DQML 1UM4L 1TQSA 5C0CE 4YHNB 3FS9A 2WBKA 4WKXA 4KC3B 3G5ZA 4JFHE 4OGXH 4GIPD 4FERA 3CXFA 4NAJA 1WTLA 4UBDD 4XMUA 4ZPVA 4GKNB 4OD2B 5PAZA 2BCKB 3FC8A 1UZGA 2D0HA 2DQJL 3GI9L 3IYLW 1WA1X 3MRGA 4UOW0 5D1QC 1D5MA 1GC1L 1INQA 3X11A 1A0QL 4FFVD 3W3BA 4DO5A 3NPSB 5CZRA 4YSCA 3N85H 1MRCH 2OJEB 4TULL 3KWWA 1NPNA 4NRYB 1IM3B 4EIZC 3V4PB 4AQAB 3TYGH 3EH5B 5DYOB 5CBEA 5H94A 2AABH 2A9CA 3NABL 3UBXB 1X5HA 2VXVH 4OCRL 5ISZE 4KRPD 3K3QA 5MENE 4UI2A 4PPTA 2EKJA 5EO0B 3VXNB 2B14A 2PTTA 5CHNA 3GBML 3DMMA 8FABA 4X0KB 4UQBA 2LT9A 1MOEA 4ICWA 2XZQL 1QFUH 1BAFH 4MXVF 2EVIA 1BX2B 1LD9A 3B9KD 1OE2A 3WFBL 3GRWL 3QUHA 2OSXA 1NCDL 4S1RH 4WHYG 2OI9C 4JFED 2VLRD 2XWBB 1S9XB 3T5WA 2D31B 1B4TA 1JL8A 4EJ1C 5F93C 1RZJH 3QNXA 4GSUA 4QHNB 3VFOB 4Z77B 2ZX9A 3UTZB 3QUYD 2BERA 4XPFH 3K8MA 2VQTA 1NFDF 4ZFQA 4X7DC 1MHHB 1BM7A 5EB9A 5FGBC 1X44A 1M7XA 43C9B 3V4VH 1CXHA 3FAXA 4TNFA 3RLSA 1X7QA 5D1XC 5F9WC 4JLRB 2VERN 1I85C 2F61A 1Z9LA 2ZCKH 1J8HA 5D8JL 3L3JA 4AUJA 4OR1A 5EBWA 1FCCA 3U2SA 2Q8BL 1VSCA 2WLMA 1P4LB 1JHTB 3C5ZA 2X40A 1J1PL 3EOYG 1ZA6B 2GBVA 2XIBA 4RA3A 3BKMH 2D3VA 3VXUB 2JB5H 4XAKE 2EXTA 4K7PY 1NPJA 3TJHC 1VGKA 4RISH 4PG2A 1CDYA 4R0LB 2PXYC 1JSYA 3BCDA 3LQZB 1OW0C 1XH3A 1KCRL 1VCBC 2JKTM 3TTYA 4X7FC 3BO8A 3WSQH 3IVKA 2VDKL 3WNNA 1I31A 3EOTL 2HTKD 1KYUA 3NPZB 4N6RB 3V55A 4G7YH 3SPVB 1Z66A 2BSDA 2N59A 5J1AA 1YDPA 3TBSA 5LNGA 1WBZB 1WCBB 1LM8V 2VMFA 3O4OC 5C6PB 1YY8A 1HDMA 1O0VA 2FX7L 1U2CA 2P26A 1CC3A 5I5RA 1DQQB 4KMTH 4BZ2A 3EYOB 1U58B 4IRJA 1UT2A 4M1CD 2MHAA 3A6OA 2W80C 3PCYA 4N3TA 2Z91B 3JTSA 3CH1A 3FN0H 5FHAL 3MV8E 4MA1B 1N19A 4IS6A 4OGAD 1BLIA 4LCUB 1TJIH 4OV5A 4LOVA 5FO7B 3O2DL 2EDJA 2EE0A 3PWJB 4PJ8D 5CINH 3RX7A 2ATKB 3N1PC 3V6FA 2QQNH 3ZYZA 1JS4A 2OMZA 1SLXA 1BA9A 3CDZB 1ROWA 3UYRH 3IDIA 1A4KA 5BW7A 5B7MA 2EDEA 4ZUSA 3U7YL 1ZSDA 1MHCB 1CI5A 1A66A 4JJ5A 1RK0A 2V3FA 3ZW3A 2ZUSA 3HZKB 4TNVF 1EIBA 3TA3D 3PNWA 1BEYH 2G2PA 5GGUA 2IAMC 4BXSV 1UH4A 3INOA 4L8BA 4PWEA 3L6FB 1G7HA 1N5AB 3UJTL 5HI5D 4NO3B 4YHKH 2J20A 2QPEB 1H3TA 3AQZA 3FFCD 2GKIA 2JSFA 1S8DA 1S4IA 2R1YB 3FXIC 4K8RH 4B95C 3OPUA 4FQ1L 5FKPB 5HVHC 4X5XA 5E6ID 2BDNH 3DV4B 2HT4D 4M7ZC 5B1JC 3VA2C 2AMGA 3SZ6A 4QYAA 4XMWA 2F5BH 2WN2A 3L48A 3MRKB 1BCIA 1BZEA 4Y5XB 3P40A 1MFBL 5BRQA 3TEUA 4F58L 4DGYH 1X9UA 3OXRA 1ZDQA 3PF2A 1NEUA 2VZ3A 5JHDB 5KOVC 1ZLUH 4CUCA 2JKIS 3K71B 3K46A 2NNAA 3OR7A 2YIHA 2GITA 4LLUA 2EYRA 2VSCA 2VMDA 3BP7B 3QDJD 4M1DL 2DM3A 4AZ8A 1CURA 1NCBH 4ZMQA 3LMJH 1CD1A 5HJ3B 4GBXB 5JW5A 1UEYA 1AKPA 1JNHB 3UADA 4G6FB 4PVNA 5KJRH 3MNVA 1X5GA 3CCHA 2D0GA 3S4SA 4L8SC 2ENSA 2YPLD 3NFSH 3V8OA 3ESOA 2NR6A 3GQFA 1EXUB 4PRDB 2AQ1A 2FT6A 5CIPA 1T2JA 4H1LA 1C12A 2VDQB 5DHYA 3GUTB 3BZEA 5CGBA 2H7WA 2CDGA 3TBBA 3EBIA 1MCSA 3PWLB 1IBFA 4OIIH 3M6DA 5BMFL 1UQSA 4GAGL 3CMOH 1KTLB 4Q9QL 1PKQE 1WFMA 4PJEA 3MRMA 1EH9A 2Z1KA 1LK3L 2VLKE 1UD3A 5AL0A 2BP3A 1MXGA 3ZO0A 1J5OL 5CP3A 1WUZA 3ZE1F 5F7HA 3ARDD 2FHFA 4TOYL 3KBHE 5KN5B 4OCLC 3MFGB 3OKNA 3TEYA 2AF2A 3VSTA 2HRHA 1N7ML 3GHEH 4NC0B 3WTVA 4IRSC 4N1EA 1J87A 3P3TA 4R4BB 5J0BA 4NT6B 4E9QA 2O30A 2PPCA 5CLWA 1NIFA 2UWEB 2EDXA 2VQ1B 1E5AA 3HMXA 2I5YH 4DUVA 5KTEH 4I3SH 3F05A 1HHHB 4LRNH 5DJZA 1WWCA 4TMPA 5HYSB 4ADGA 35C8L 3E7JA 3MUGA 1SBBA 1U91B 4FNUA 1Y07A 4V33A 5H8DA 2VITB 4Z7QF 4ABVA 4OM1L 3TO4D 2O5ZL 3LXCA 2EQDA 5GRWA 3GWJA 5HYJB 3I75A 3C09B 3KYKH 3UG5A 1DBML 4FXKC 1IMHC 1MJJB 3E6HA 3FUFA 4EVNB 3U6RB 3ASWA 3TCLA 4KXDA 4WTWA 4K5OA 2XWTB 4WUUA 3MV9E 3F6LA 2N0MA 3KEHA 3P4OA 3AS2A 1MFAH 4XPTH 1PX8A 2FSDA 3PWPE 4DW2H 1CI3M 2NNRA 3DPDA 3V9CA 2N7BA 4X4KA 1AE6L 3RNKA 4LHUG 3T65B 1IC4H 3GJFK 1KEMH 4UQ2A 5D71H 3SCMB 3Q8EA 1B90A 2H0JA 2R83A 3QIUC 1AO7A 4IOSA 3RUGB 5B38B 1H8NA 4OB5H 4WCYH 3MA9L 2WQXA 3X12B 4W6WB 2AJSL 2V8MA 3QQ9C 5G4NA 5BOZG 1DP0A 2R39A 2CO7A 1N26A 1OCOB 3T4AB 4LLMA 2WLKA 2O93L 3ZRSA 1HU8A 1XB3A 1V3KA 5IG7A 1JXKA 2XWJB 2ISDA 1ITCA 1NGZB 4XCCL 5CP7A 4NQUA 3VWJA 5EC1A 3D3VB 1E6JH 4N87A 1AD9B 3BYTA 1PIGA 1KPVA 3RGVB 3BE1L 3QORB 5TFSH 3TPUA 5KZCD 4IGBA 4QXTA 2BSRB 4RBPK 1IKFH 4M4RB 5CJXC 3S96B 4NRXB 1C5CH 5F7UA 3VW3H 3VFVA 4UT6A 5ALBL 3WO4B 2IGFH 2BHZA 3RB5A 4AVKA 1KLUA 1KXQE 4ZAKC 3UTSA 5GS1B 2AQQA 5FLVA 1MFCH 1WHPA 1MWAB 3NSFA 2J8UE 2XHNA 1QSVA 4XTRC 4ZT1A 2Z31D 5DD3H 4UTBH 3P0YL 2E3VA 4IRZA 3VXSE 2F18A 2Y7QB 3FZUC 5F44A 4NN6C 3ISRA 1I1AB 4EQ3A 1HEZB 2QT6A 4G3YH 1IQWH 1NMCC 5I66A 3FQ2A 2H26A 3HG0A 3CVIL 4Y5YC 2V17H 1R5VA 3KPNB 3S37L 5E1AA 1PZ3A 3M07A 1J8RA 1RHFA 1N4XH 3CSYA 4DKFL 2BP8B 2XBTA 2ENJA 1KJMB 4KX7A 2A6JB 4AH2A 3OKMB 3DURA 1NOFA 1OAXL 2NW3B 4XMXA 3F6IA 5D4JA 3KGTA 3MC0A 3WUZA 4HOZA 4TNEA 4Z78A 5I1AA 5EDXA 4MWFA 1UACL 4N1CA 4QRFA 3ARFD 2W9EL 3OGCA 4Y2DB 2VDLL 4EXKA 1SY6A 1A1NA 1KGXA 3LKNB 1ETZA 4E9TA 2DJUA 3ARQA 5I1DB 2CE6A 2EIZB 3RKDD 4JFFD 4EAEA 1JWMB 2J1WA 2CJUH 1KSRA 3KPQA 4Z7OB 1OHQA 1OXYA 5H35B 3LN5B 3MXWL 3GIZL 4N0CC 5IREA 4RDBA 5HGHA 3G5YB 4LKCA 3H3PL 1GW0A 3B5TA 4WW1A 4YDVA 1URZA 3RDTC 5TGBA 2CHXA 3BUIA 1RZ7L 3W5MA 4LCYB 1ZA3A 3LEXA 1OB1B 2RD0A 3CAFA 3Q05A 3LZLA 4FKHA 4XXWC 4MCZA 5B39B 4PRBB 1UASA 1PLBA 1FBIL 3UTQA 3DO7A 4WFFD 3K91A 3ZT7A 2D2CC 3TYFB 5E6UB 2H47C 2IEPA 3BHBB 4PJDE 2A5UA 2E6QA 2R4SL 3IJHB 1NM4A 3VDCA 1T22A 1OD9A 5IKCB 4AIEA 5SWZB 2FJHA 2E47A 2VDOH 2Z34A 4PRHE 3H6AA 3AGWA 2JCCE 2NUTB 4UM9D 2EJ1A 5I8CA 2KT6A 3WFDL 2P7TB 2EYSB 3MI6A 5EZOH 5JW4R 4WV1B 1T2QH 1YJDL 4KJPC 2UZXA 1S9YB 1UGKA 4L8CB 5KS9B 4Y5VC 3LRMA 2CM6A 3MLUL 4KJQC 5I5JA 1C8QA 3FW6A 3KNBB 3SDCB 2MFNA 2ZX8A 1N6QL 4XCNA 5I71C 5M7QA 1CDUA 1TQBC 3HAEH 3SE4C 5KSBE 3IFPB 3E3QE 1OAZH 3AG2B 3QDGE 2MKLC 5D5MB 4FNQA 4HUVA 1KT2B 4YDJB 4X2UA 2X4NB 1RURH 4YSAA 5L4JA 1A22B 3HBPA 4JQIA 2CXKA 3HA0A 1M71A 4B5ZA 4JCWA 4E41D 4OJEH 1ZE3H 1DLHA 3FB6B 3RUGF 3WJLC 1O5PA 2BNRE 1BV8A 5DC0A 1KG0B 1TQVA 4DEPB 3BIKB 4IM8A 3ZU8A 2MCPL 4HK0A 4JG0L 1R5IB 3IGAA 3GS7A 1GVIA 3DMMD 3TESA 5T1KB 4OFYA 5G4MA 3C60A 3WIHL 3BGAA 4RWHA 5LAPA 3BP6A 1DL7H 5EU5A 4DCQB 3MRRB 1SHWA 5CWSA 4IOIB 5D7EA 5KVFE 1IIKA 4QT5B 2Q87A 2D0FA 3QWOA 1KXTA 1JZJA 4WHTB 2Z8SA 1WFTA 1USZA 1MIMH 1ND0B 1U42A 3FF7A 4YXHH 4TXVB 1P53A 4L29A 3ZN6A 5TQ0H 4ODXB 3TJEH 1FF5A 2HUHA 5MHSD 1W0YT 2FJGA 3FB5A 1IKOP 4J2QA 1A64A 3WS6C 4LSUL 1U4EA 1ZTXE 3OLIA 4O00A 4PP1C 3UH8A 3DUUB 2IBZX 2LTQC 3BFQG 3CZEA 1F58L 3DJZA 4R97B 5DMGD 3ZKNC 3CXHJ 4MBOA 2QKIA 4NO0B 1EHAA 1DYZA 4K7PH 3LB6C 1BD2A 3S3PA 1OCZB 2WO2B 1U92A 1Y0LB 3E6FB 4FLRA 5CR8A 5DJ0A 4AV5A 1Z0MA 4O5LL 3ARUA 3NJHA 3FTGB 4Y4KD 5IJKA 1J8HD 5EFIA 5CGYD 1L9RA 4G2AA 3SKJL 3HC3H 4XNYH 3B2XA 1RVFH 1ZT1A 4X7EC 2EXYC 4I0CC 3N5AA 5H37H 2BMKA 1AQMA 3CZFA 4BSWA 2G5BB 4X9GA 1UADC 3VH8A 4AQ8A 1ADQA 1MNUH 4OLXL 4QYOA 1F4AA 3VG9C 3HPJB 3PU7A 1FNAA 4PJ9A 2YPVH 1F3JA 2CJ3A 1U3HB 3TONA 4OLZL 1G7LB 3FT3B 3U36B 3NCJH 4Y9CA 4UOW1 4HJGB 1C7TA 3HG1E 4YDNA 2IJ0C 4PSPA 1NJ9B 3N0AA 5A2CA 2JWYA 1K8DB 4FXLA 3C87A 4CC4A 3DRTB 5C09A 3WY3A 1SM3H 3VNYA 4Z7OF 4P2QB 5HHMD 3IDYB 5AOJA 1FAKT 3DDFA 4M3KB 4AEHH 1P6WA 2AK4E 2XVKA 3F12B 1QRNB 5CD5D 2R9HC 2GSMB 3QJFB 3RYMA 1ZVNA 1ADWA 4K9EH 3CFKB 5GRJL 2O4EA 3IXTA 2XQYG 1LEGB 1EWHA 4OKVA 1H3UA 3VVVA 5I18H 1HSAB 1IC0A 3VE0A 2WLLB 5DC2A 1OF0A 1CWVA 1UD4A 2BP0A 2W0LA 1Z5LB 4GLRH 5BRZE 2CMRH 2QADC 2B3RA 3SPHA 1U33A 4Z3JA 3QEQE 1AC6A 3F5WA 1E0OB 1KCKA 1LO0H 2CCLA 3P9MB 4N3UA 1LEIB 1A1MA 2R56H 3LOWA 5DHVA 4W81A 3TXAA 2C9VA 1WBYB 3R7QA 2ZKMX 3MUJA 3FT1A 3MKKA 5ICYA 4UQEA 1PDKA 1BIIA 3MN8A 1N8ZB 2BH0A 5KVEE 4G80B 3KLHC 2HFEB 4CGUB 4HUNB 5KS9F 2AV7B 4KKPA 4XHJC 4GXUM 1LE5B 2GTWB 1GRWA 3TASA 2X2UA 5F7DA 1I8AA 1LP9E 2YOAA 1NBCA 2WB1A 5GGTH 4NERA 2WLZA 2YAEA 5D5MF 4WEBH 1AP2B 4KV5F 3MUHL 2HCZX 3REVA 1H0DB 1IFGA 2P5WA 2IANB 4M6MH 4QY8B 2O5NA 4JVPA 2R0ZL 5T1LB 1J5IA 4F7CA 1B6DA 2O5XL 2A6IB 1ZT4B 3KE0A 2UUDH 4KKLC 1QFWI 4JHWL 2LFEA 4DUXA 2G75B 5B8CA 4HIEA 4OFVA 5ILTH 4UQDA 3QRBA 4L5FE 4BH7A 4XMTA 4MXVE 3NIGB 1JYVA 1EGJL 2FH6A 1M42A 3ARTA 5D1QD 4GG8A 3ULUL 3O0RL 1LGVA 3VA6A 2NXZC 2WANA 3LKQB 3MJ9A 3TJPA 2BFGA 1ZKAA 4P2YA 4CMMB 2NOYA 4U2ZA 3TBCA 3TP4A 3CVHL 5DRNA 1D2PA 4KI1A 1HQRB 1J05A 1TO5A 2DY2A 2NR6D 3EGXA 2D7OA 4KKCC 2DTMH 2FT7A 4MS6A 1OPGH 5AVVB 5EEYA 1U8IA 3DVGA 2FBRA 5HPOA 5C0BB 4M6AA 1IVTA 1LTXA 3F00A 1A6PA 1NKOA 2JH2A 2GT9B 5C08A 1AKJA 4KVNL 5KBPA 1A6WL 5HHOB 3EBAA 2HZHA 4PJGE 1F6AB 2CIIA 4N2FA 4D94A 3ESNA 1SFDA 4QRSA 4YHLH 3J27A 4Z7VB 1U3ZA 5I1HL 3G6DL 1A7RH 3DIFB 1DDTA 4B3VA 5AYQA 3TVMC 1CMOA 1A25A 2F54A 4Z7WB 3AY4A 2BOLA 2R69L 2WNGA 5D6DC 3NCFB 4ZTEA 2R59A 5GQBA 4DP8X 3RAJL 3LZOA 3MJGX 5DF0A 1KJ3L 1HCYA 3MRFB 1JZ6A 3KR3L 2Z6FA 3R8BB 2ZAIA 4GAYA 2XYCA 4Q9CA 3MGTB 4CKQA 3VFTA 1GKOA 2X38A 5D7LB 2CBQA 1L6XA 1GJWA 2X88A 1MCHA 2YK1H 3H9SA 3O8XD 3UTQB 4OZIE 2CKBH 5CCKL 1F11A 2L7EA 4L4TA 4FQIL 4GP4B 4CGTA 1UJ3C 2FGZA 3EYVA 3GMLB 4QAWA 4M6NH 1QO3A 1T4WA 3PDGA 1INEH 3DYMA 3EOBA 2IALA 1XIWB 4N26A 1GS8A 1RPQA 4NKMB 5DD6A 5IFHL 5DI8B 3UIYA 4A2EA 4ZD3H 2F5AL 5INDB 2GK0B 5L88H 4GW1A 2VQ4A 1R33A 4X7TA 3RX9A 2F1AA 1WP6A 4I18C 4PHZA 3AAZA 3CNKA 4B9IA 1YMMD 1RD6A 2PXYD 2BS71 3BP5B 1KTKE 5G5DA 3O41A 2KZBA 4LAQL 3LQMA 1UTDA 5C0DA 4FQXC 1K6QH 4P9HC 2N7AA 2GAZB 2MNJB 4GUPA 1EX0A 1K2DA 4IIQC 3ETTA 2A3TA 1A3QA 2VLME 5KYYB 3ECBB 4H2AA 3NJJA 1CF8L 2A73B 2B5IC 2YBRB 2R7EA 4LMQI 1WBXA 1JE6A 2PPAA 3JWDL 4FHJA 2IGLA 2VDPH 2YQ3A 3M1BB 1HINL 5BZXA 3L95A 1P7KA 2XN9D 4NN7B 1BVKB 1ZHKB 1AO7D 4IOSD 5D7IE 3KPSD 2D03L 1MAMH 1MRDH 2BC4A 4MQSB 4OD1H 5J6HB 1GZPB 5FM8A 3BH8A 4J8RA 5D93C 3L3GB 4PY8I 4UB0L 3D69A 4ZG1A 4PFEA 4C83A 2X4OA 2IWGA 5EBMB 3D09A 4FQHA 5FYJL 1CK0L 4N9GA 1NANH 1YN6B 4WGVB 2RAMA 3BIAX 3MRDA 2AXFB 4MGXA 4OZFH 2XTLA 2FX8L 2HLEB 6FABL 1HEJC 4NKDB 3STZA 5KSUB 3S34H 2VO8A 3RA7L 5IEHA 1QHOA 5FAAA 4RMSA 4LCCB 1T89A 1TSRA 2Z65C 4QOKA 5TH2A 1EHLL 3NEOA 2E86A 3NJMA 5AVZB 3GHBL 3EGDB 3E3QC 4DVBA 5EUKA 3H2PA 3V4VA 3PHAA 5ESVA 1QR1A 3VFSA 4E9SA 3A0OA 4BEIA 3QEHA 4U31A 1FH2A 3CZLA 3NIGF 3RFZB 1TZGH 5A40E 1AR2A 2VTFA 1ITBB 1CD9B 1HH6A 1N9PA 1H8LA 2H2PC 3E38A 2WWMC 3HKFA 3WLBA 4NO2A 1BVLA 3NH7H 4F15C 2Z8VC 4L9DA 1RHHB 1YAIA 2OA9A 3IU4H 5C0JA 3BUTA 3WEXB 1XXFC 5CU9A 2EUWA 1DJXA 1S7TA 4P2OA 1E8XA 4JANB 1CGSH 1AY1H 1FSKB 4OI8A 1RUQL 3JYBA 4CSPA 1L6ZA 1KBBA 2EE3A 4LARH 4FI8A 4Z7NE 3KS0H 3U79A 3MBEA 2EC8A 3OC5A 2IBBA 3RWIB 3L9YA 5K69A 3FJTA 2ITDA 4TTDC 3B8YA 2AC0A 4PS4H 2F8XC 3RTLA 1RJZB 1NUFA 3TS8A 1XGYH 4Z7VF 1AGBA 3N9GH 2YS4A 5JDSA 4JO3L 3QG6B 1GMEA 1XF2B 4X9IA 1XWVA 1PKOA 1E67A 2VXTL 3VXUE 4CU8A 1BZ7B 1H9VA 1R3JA 4GSDL 1A4BA 5AD0B 5K5YA 2XFXA 1BM3L 1AR1B 3L3HB 5MEQA 3CZSA 4U0QB 1M2VB 2BRRL 4XWOC 1KC5H 3RVUD 1I4FB 1IGIL 3AXLA 4ELMF 1BFTA 1VADA 3ULVD 1N3NA 4PJHE 3CIQA 3GIVB 1JAEA 4FA8A 4FHKA 3FBKA 4DQOL 5JXEC 1G9EA 3F01A 3KPRA 4LEBA 5FB8A 2A9NH 1NFKA 4PGCA 4LOEA 2CG9X 1AHWA 1ZV5A 4M02A 4ORZC 1NCHA 1A4CA 1NAMH 3G04B 3MREB 5AWNH 1UH3A 3MBXL 4FLHA 1HOCA 3ISWA 3ULAB 5J12B 4YHZL 1LEKA 3SDXA 1A9EB 1MHEB 1YEDB 4QWWC 4DP1X 2P5ED 3T0WA 4JM4L 3V52L 5EEVA 2PP9A 3ULSA 1CYWA 2EH7L 3X1FA 3Q5YA 5F7WC 3PDOB 5HI3D 3ZKMD 3JSSA 3RVTD 3QUXA 4RETB 3U7AA 4AL8C 3MLYL 1HH9B 2V7NA 2WGXA 5DEFB 4ESKA 5CFAA 4H8HA 3D4CA 4OTXL 4MMXB 3T2NH 3PHOB 3LEYL 4U1MB 5ICZA 1CN4A 1EUTA 1XB8A 3P0GB 4XXCA 3B2UC 2W88A 4JRXA 1F3DJ 4Z0XA 3P3UA 1KYOJ 3IDJB 2ETWA 5E0QA 4WWOA 4BUGA 5DDHA 3GZQA 3L08A 2FJSA 4ODUA 2OTUB 3L3DA 4AK1A 1KY7A 4TUOB 4RGNB 3HUJA 4MA3A 1PMYA 4MJJA 3GEWB 3FO2B 2GY7B 1GGBL 2LHAA 3TNNB 5LGJA 2I60L 5B22A 5IVZA 4TNGA 4OFYD 3LKRB 5FYLD 3SDYL 4NQCB 3V0IA 1A6UH 1CBJA 2Z4QB 3O2WH 4J3OG 1JPGA 5AYUH 1PLGL 2GY5A 2YQGA 5F9JA 3C6EA 2HFGH 1XF3B 4N2LA 2GTQA 5FYLH 2Z0UA 3C9NA 4FL4C 3GSWA 5ESQB 3O3BA 1GMIA 4EF3A 5I1JL 4ZI8A 3A4FA 4RFOL 3O4LD 2C9RA 1BQHA 3GBNL 1I1CA 2Q3XA 3DUSB 3UZQA 5KG9A 1S7VA 3ZHLA 1B2YA 3ETBF 4PJ7E 4BSVA 3QQ9D 4W9LC 2J1XA 4BRJA 2XV2A 4NO5B 1T0MB 3F7YA 3IPEA 3MCYA 1LYQA 5FV1L 3GTTA 3IAQA 3ME0A 3SDDB 4AGQA 5LCVA 1FZKB 2DB8A 2GI7A 2A7BA 1TCRA 3PFQA 5JPNC 4MNGE 4FJZA 4ZUTA 4K2UL 1BD2D 1F2QA 5KYUA 3BW9A 3BLKA 2DYRB 1SJXA 4FKEA 3D9AH 4NHUB 1NGYA 5C0CD 5TE4H 2J5LC 5JHLH 3HVDA 2A9AA 4XAWH 3F7VA 4HALA 3LKOA 4XBEL 3RTQD 2XU9A 4K3EL 1A4JB 1ZLWK 1XCTA 1Z6JT 3SE3A 2EUZA 4XZUB 4NX0A 3BYYA 4YSTA 3GSUB 3Q8BA 3UGEA 4CSTA 3OKLA 2VH5L 4QHMB 1YEGL 2XI9A 3DOSB 5I1KL 1MNNA 5BOPA 3WTSA 3HE7B 3AITA 2BVYA 2EDDA 4WTQA 1W72L 3UAJA 1K3IA 3GI8H 2JMRA 2PPFA 2YUZA 4NQVB 5HHXL 1IAIH 1HQ4A 4XTRD 3SY0A 3T8VA 1S7RB 2ROXA 1AC0A 4M5YH 1VGEH 2DN7A 4PJ9D 2WHVA 3FRPA 1ZTMA 4QHPA 2OMBA 4ETYA 4L1HA 3GTNA 2WXMA 4F93B 1ZOXA 2R1WA 2MOQA 2VDLB 2ZG3A 2MPVA 3QAQA 1RIUH 1SDAB 4NJAL 3T6WA 4E0RA 1N0XL 2W94A 3CTTA 4MJHA 3C2SA 5IQMA 4GQQA 5TPWL 1ROCA 4WNSA 4DN4H 1RUPH 3Q2CA 4PB9H 5ERWA 5GSRB 1TVHA 5C09D 3WE6A 3S37X 2Y1YA 2AJZB 2YQ2A 3BI9X 4ABUA 1ASPA 2FO4A 4CN6A 5FA3A 2AJXL 2ERJB 1B0RA 4WGKA 1BF2A 5I1LB 1RY7B 5DJYA 5IFJA 2UWEE 4LSTL 3ABLB 1ETB1 1DBBH 1NSNH 2AQPA 2DEWX 2X05A 5CJ5A 4O2CB 2X4SB 4ACPA 3QHFH 3K6NA 4DVRL 3I2CH 3L9BA 5JDJA 5KAQF 1UWEL 4R3SB 3BEVA 3ZZSA 4CDHA 3SBWC 2Q86B 1IUZA 1JWUA 4BA0A 5IW6A 2OMXB 1OOWA 1NEPA 4JFXB 3BD3A 3IJ9A 1A65A 4RZCA 4I3RH 2BSCA 5HYJE 1IT9L 1PQZB 4FF9A 5I75C 3HJ0A 4PJBB 1YN7A 4TQEL 4XO9A 1P4BL 3HLAB 2XVBA 3MCG1 1GR7A 2HKAA 3NCXA 3MV11 4WLCA 4EN3C 3DX6B 4P57B 3ZTDC 4IIZA 2DWDB 2BOCA 4A67A 2KPWA 3LNHA 4U6HB 5GJTH 2X9XA 4I77L 5K9JH 1JGVH 3FTXA 4HD5A 4ORGA 5GS0L 4HCFA 4Z76A 5C86A 3HC2A 3PP4L 2ARJA 4RIRB 3NJNA 1FL6A 3ILEA 4N8UA 5FYKE 5I76B 1MH5A 3HZYB 2CHWA 2V9QA 2WYHA 1M3IA 3F62A 4NQEE 1I7UA 5IGXL 3BRGC 1SMOA 4YK4B 4YVNA 1YMHA 4TS6A 5CMAA 3RWFB 1B88A 2QQKH 5IHUL 2H0EA 2P5WD 1NCWL 3HBZA 1KBVA 2DICA 3LD8B 3LN4B 3VFPB 4NQSA 2GPZA 4UTBA 1J5HA 4FP8L 5E2VH 5EOTA 3UPAA 3G08B 3CVCA 1TJGL 4HJ0C 5EORL 5T8IA 3KWVA 4XMKH 3ETSA 4KJQD 1NC4A 1PU0A 3DTXB 4OZHB 3FSZA 3T2PA 1LE9B 3D3VE 3UAAA 3QXDA 5CEZL 5I6LA 4JFOB 4FFZA 2OR7A 1NCAL 4JFZL 5KVMC 2EC9U 5E8NA 4YHOH 4JO5A 3S88L 4CKVX 2YPKB 1T5KA 2AJUL 4NUGH 4XNMB 3GKWH 5GGRY 4APXA 4QRRA 1XR8A 4YDIH 1IC5L 1P69B 1VFAB 4KH2A 4UQ9A 5D96C 2APVA 4ETQA 1KCLA 5I8KH 3QNZA 3IGLA 4X9HA 4RAVB 1U8CB 3VTAA 3L7EB 1AYOA 4F5CE 5KJ7E 4YL9A 3WENA 4H26B 4HFUL 4WJ5A 3SQOH 4G43A 4P59H 1KPUB 2R0WL 4NM8H 4P5TB 2J8OA 3QIWC 4NAMA 4NI3A 3VM7A 3QI9C 2AAAA 1MDTA 3QWRD 4KUCD 4JR9L 4HS3A 4LF3B 4DK3A 2VC2H 1JXFA 4N1HB 5I6XC 1YYMH 2H9GA 4JFYB 4N2HA 3DYPA 4K9JA 5HGAB 5DT1L 4Z8FL 2H0FA 1DTUA 3O3EA 4LU5L 4TSAH 5DUPH 4YEFA 3Q2WA 1L0XA 5E1IA 2R2BA 3MSPA 4YDZA 3WI9A 3V5DA 1XD1A 3AS0A 5SX5H 4BH8B 1DEEA 2E76C 2GC7C 4XCFH 5F7NC 2DQUH 3TBWB 1I9RH 5JQIB 2K4WA 1C5BL 5E5RB 2ZP9A 4X4YA 2VDRH 4C4KT 3UL4A 4ZS6C 5AALA 5BZDA 1BREA 1SN0A 1L7IH 3JV0A 3NIFE 1NGPL 4R96B 4C57C 1RZ8B 1Y7VA 4WJG3 3X3GL 3CFBB 3KM2A 4ODWA 4P2RB 3GJFA 2V2TA 2OX5B 1KCSL 3J07A 1H3PL 4NHCH 4YHIA 1KCWA 3HIZA 3GXPA 1CR9H 1QSEA 4E9WA 4Z7OE 3DX3A 2ZOWA 4XBGB 3VD7A 3B9DA 2HWZL 4KPHH 5ADPL 1IGFH 2YUXA 3D4YA 3VWKC 3W56A 5BS0B 3QQ4A 1FGNL 3PHQB 1A3RH 1ACZA 2L7JA 1SOXA 3SGDI 3U0WL 4LBEA 2J1KA 1RMFL 5SWSA 2WNWA 1PG7H 1R3LB 3IJSB 2J55A 2UVFA 3U1SH 4NENB 1UURA 3FO0H 4X8CA 5CUSL 4JRYD 1PF3A 2C9AA 2HPOA 3S5LB 1B4LA 1NIDA 5DWPA 1DR9A 2HVKB 3LS5H 3NZ8A 1CGTA 5I16B 4N2BA 3U1QA 1M53A 1NCOA 5DTFB 1JTOA 2I85A 4TVSa 3W0WB 1M56B 2ZQKA 4MYWB 4KVPA 2BSSA 2DWYA 5FA4A 3KYMB 4LLQA 3FPXA 3HNSL 5FGCB 1JTPA 4LK4A 3FU8A 2W07A 2VM9A 3KDMA 4RVBA 1KJ2A 3GJEB 1GCYA 5IB5B 2QMJA 4MTMA 5HPMB 1XF1A 1AD0B 5CZKA 4F8OA 1WHOA 2R9HD 3WUWG 4Q7DA 2X4QB 3HHSA 1MEXH 3TLRA 1VPOL 3IAPA 4PRIA 4U0RB 5D5ME 2OJZL 1SMAA 3N55A 4JQXC 5EO1A 1MPAL 1XTLA 1WAEA 5C9JA 1E27B 3SJVB 4HJSA 3MU3A 1T5WA 3HMWH 2VW4A 5AAWC 1YRKA 2C4FT 5K9OA 3GKZA 1E43A 1QSFB 4XNAA 1I9IH 5SX4I 4J4PC 2HAZA 2Y7NA 4UU9B 4AYEC 1BBJB 3GMOB 1QKZH 4JY5L 4A66A 1WWWX 3UGXA 2AJYL 5H4YA 2BVOB 2CRYA 4LSPH 4A63A 3V0HA 1U95B 1PEWA 4ZOAA 1JN6A 3AU1B 5CZVH 1HFUA 4JPWL 5FOJA 4FJYA 5G2NA 3RZCA 4OZHF 1EO8L 1SBSH 5JTWA 3ZTEA 2F08A 2H6PA 5F6HJ 1NC2A 1TETH 3HHMA 4Q6IB 2VZ1A 1FYTA 1UUSA 2HFFB 4BSJA 4GT7A 3O6FB 1PSKL 3B7RL 2AGJL 3CVBA 2OJ1A 4IKNA 4DGWC 1JZ4A 1HL9A 3CVHB 2WXRA 5E9AA 1CXIA 2B3IA 2DL2A 3OKDA 4QXUL 1CICA 1KTJA 3VG0L 4WEEA 1Y1DA 4M43L 4J1UB 5I6KA 5DUBA 1NMAL 1U93B 4P2OD 3SYAA 2YKKA 3KVDD 2E9WA 3QFGA 2YPVA 4DFHA 4PRAB 3BAKA 4MQTB 3QPQC 4C4KO 1LO3L 2PPEA 3EBGA 3I9PA 3PGFH 4Y5XC 3UJIH 5HGBA 2ZWNA 1Z9SA 4UM8A 4UOJA 3UAFA 3IDGB 3O6KH 3VSQA 2YWZA 1QHQA 4NZUH 3IPBA 1S9VB 1OTSD 2ZXWB 2A1WH 2MEJB 4GKNA 4WY7H 3S2AA 2BCKA 4D0CB 5K9QG 3CUPB 2Q2EB 3R06B 2GIMA 3D85A 1D6VH 2OTWA 2BY2A 1AZBA 1M7DB 4HK3N 2QPUA 4X9BA 2R8SL 3KHQA 1TMQA 3FO9B 5I8EA 5MERA 1BWMA 1HWHB 1OD7A 3IKKA 1K8IB 4PV8A 2VN6A 4HS8H 1KN4L 3VFWA 1ZEAL 3HPLB 2YWYA 4NRYA 3SKUD 4BK8A 4AQAA 5I0DA 3LRLA 4PS7A 4EZJA 3RL1B 4DN3L 1EVTC 5JPMA 3H0TA 2IPTH 3UBXA 5D70L 5KVGL 1GYVA 4L4VA 4MXQC 4OCWH 2ZPKL 1CFSA 3W37A 4MRCA 4OVVA 2IPUK 2VLRB 4Y1AB 3DA0A 1FG2A 1UWXK 2NZ9C 3QUMA 2VLJD 2PETA 3N42F 4PJIE 1EDHA 4LHUB 2CK0L 4ANKA 4IMKA 3EO0A 3UTTE 4PBVC 2ZNXA 4DFIA 2BIPA 4U3SA 1MQKL 3U82B 3VXSD 3AJ7A 3L3OA 2O72A 3ABZA 4KRLB 5L2KE 2E27H 2WTRA 2XWBA 3FCGA 1COBA 3AT0A 5GGTA 2NY0D 2XZAL 2X70B 1R3KA 2MSPA 4BE6A 4XNUH 2FLMA 3DGGA 2M26A 5IB3B 4OCYL 2DLEA 1TTBA 4KAQL 4QHNA 1XGQA 4AT6A 2OMWA 1S7QA 5CLXA 5IFAL 2ZSVA 5LGYA 1UCBH 4XB8A 3ZTJG 1PLAA 4B9PA 4EIGB 2ADFL 1MHHA 5FUCE 4I89A 5GS3A 1MHPL 2BCMA 4JRXD 3QK0A 2EZ0D 2BSEA 4J28A 43C9A 4EUPH 1AXTL 5HHNB 1UOKA 3HRPA 3M1CA 1ZANL 3K81A 4JLRA 2NDGA 4PS3A 5I6PA 3VXMD 5TF1L 4MCMA 1U3JA 1BJ1J 2G0KA 3WMPA 5C07E 4LL4A 4NUMA 1P5UC 3QXAB 4XI5C 3PPSA 1JHTA 2OYKA 2SODB 3HMXL 5SWQA 1IILE 3S36L 1HI6B 4Y1SA 4FTDA 1S3KH 4AYFA 2JKNA 4YE4L 3C09C 4Z0BH 1N59A 4MB5A 5LWYH 4E9LA 1J5CA 4R0LA 2EXSA 2ZOTA 3KYAA 1UUNA 4HWZA 1HL5A 1X7SA 3LQZA 4PLOB 5F71A 1A6ZA 2EEBA 5DJXB 2WNXA 2IANE 1IGCH 1X9LA 4P9HH 1OP5K 4NZRH 1Q4NX 1BAGA 3HFMH 2IGTA 3BKCL 4H4NA 4RFEB 5GGSY 3MRPB 4AEIH 3M45A 1OCCB 4ZPTB 1BQKA 3QIBC 4N68A 3PUCA 3MNDA 4FQLH 4PJ8B 1FO0A 4PMFA 5JQ6H 3Q1SL 2NTSP 1XGUB 3SCMC 2H3KA 1FVCB 1OM3H 2TSBA 1U30A 3BFOA 4LLAA 2Z91A 3MLZH 5CU5A 3SDAB 1GJIA 2B1HL 4PRHD 1WAAF 3UO1H 3QPXL 4QRUA 1JGLL 4LIQE 2CPCA 3ULUF 1F6FB 2ZJSL 4OM0H 4XE5B 4G7SB 2ADJB 4YWGH 2JJSA 5FW7A 1EV2E 3QZMA 5IK3B 1A1OB 4G8EA 1P0SE 4YVUA 3WE1A 5I0YA 1BF5A 1IL1B 1UZ6F 3RGVC 4K3JL 5IVXB 1N64H 1ZK9A 1E5BA 5D7KE 5LDSA 3QDGD 1TVBB 3FFCB 5DJDB 3T2OA 1HXMB 2UYLB 2X12A 1P4UA 4ONFH 3UAJD 3VGDA 3EXLA 4GQ9L 4QHUB 2RBLA 4P49A 1OAUH 4KNTA 4WI6A 3HZKA 3IF1B 3GYRA 4Y19B 2DMBA 5LHDA 2NLJB 3DTUB 2C1OA 3BQUB 4OGYH 2BNRD 3MV7D 2WWMD 4ODHL 5GS1C 1PZBA 3L6FA 3NJVA 4Z7WE 5D1XA 4FFWC 5EPMA 4S11A 2OMYA 4PV9A 2VM3A 4F3FB 5IF0A 2H1PL 2R1YA 2D4FA 4AY0A 1QLEL 4RGMB 1MIEL 2VGLM 2XG5A 4WNQA 2IQ9L 4A7SA 2TRHA 4WO4B 4ZW6A 1JVOA 1RV6X 1YZZA 1I8IB 1MWOA 5D7LE 3EW3B 2Y2WA 5FM4A 5FO9B 1EHKB 2HRLA 4OT1H 3AU0A 5IT2L 5DUJA 2QSTA 5CLYA 1FVDA 1FYHB 2DH3A 3QQXA 3B7TA 5AVSB 5ICXA 5E1HB 2C3XA 4TLTA 5KVFH 4F2ME 3K71A 3UZEC 1WA2X 2GBAA 4Q4EA 4XH2B 3OX8B 1NBVH 4M29A 4K0OA 1E4WH 4OSUH 3TFKC 5KBLA 4A7GF 3BP7A 3D0LA 4GS7B 2VZUA 4N8CH 3MR9A 4GBXA 4X9FA 3HR5A 5HSFA 1OP3H 1AQ8A 4N2NA 3SIKA 2IDTA 3QW9A 1JNHA 4LPXA 3VXQA 2BZ7A 4ZX6A 5IESH 1HHKA 2H2SC 4JDEB 3W39A 3VD9A 1D7DA 2DQMA 2G9HA 5IB4A 2L04A 2DLFH 1ZTXH 4PJAF 5DS2A 1K9TA 3MCLL 4OZFA 4A04A 4KQ3H 2R15A 2GEQA 2NY5L 1NGQL 4HH9A 1ZLSH 5JXED 3TEXA 3PJNA 5IOPB 5E7BA 1NCTA 1DBKL 4KO6A 2HA1A 3VRIB 5CS7A 1CG9A 1A8ZA 4Q52A 2HJFA 4KK6C 3MRJB 2IV9A 2IH1B 1RCYA 3KD4A 1G94A 5HDRA 2F7QA 4DKAA 3GMQA 4NQDB 3SKNA 4M3JA 3TWCL 2LOEA 3APNA 4LLYB 5BV7L 3FHEA 4OLWH 3CLFL 4LRIA 3BAXA 5T3ZL 4XP6H 5EN2A 3QNYB 1IGMH 1J0YA 1GL4B 1EAPA 2X6UA 2BVPB 2HVJB 5HYIA 4AC2A 3EZ8A 4IQHA 4MKMA 3AB0C 1FNHA 4M6OL 3DXAE 3I3EA 1OAQH 2D3JA 4G6JL 1XZ0B 4WV1C 1SEQL 5JW3L 4OZGE 1UWFA 3C6SA 4ZFOA 2CIKB 3C75A 2WLYA 3VTTA 5HGDB 2AK4D 2VXUL 4H8WL 4HUMB 4QRRD 5DRXB 4R4BA 2PO6B 5CBAB 2Y36L 4AL8H 5C0AE 4ZMPA 4BK5A 3BSZH 2YRPA 3Q6GL 4HF5L 4V1DB 5L4IA 1Q9KA 1Q9LB 4U1LB 4YGVB 2JCWA 3UXFA 3UPRB 3HTLX 2YMTA 4MJIA 4X4XB 5EU4A 4EKXA 2DWTA 5HYSA 5BUAA 5DD5L 1FFNB 5HVGB 3NCYS 1O75A 1KACB 1CDBA 4DEPC 3L4CA 4I9WE 5DK2B 3TZVD 1TU2A 2YA0A 4M5SA 4G82A 2VXSH 3SPCA 1OOAA 1K4CA 1R3IH 4P5RA 3RVXD 2I32A 5JMOC 3O9WA 5AKVA 4B5EA 1LO4L 1MSPA 2R23B 3I85A 4WF7A 1JV5A 5AB9A 4L8SA 2XWTA 1MW3A 2NCEA 1BEXA 3K74B 1ICTA 1L3NA 3BC9A 3GSQA 4XT1C 1S9WB 1C08B 4YFDB 3FT2B 2GCYA 4UILL 4Y2NA 5IVXF 1QPXA 3T65A 4PTTB 5KVEH 4JPIB 4WAFA 5B38A 1CBVH 3FULA 2WOBA 4F7EB 1HIML 3QZWG 1I7ZB 4ZDHB 5F8RC 2AZUA 3BRFA 3T4AA 4GG6A 5JORB 2P8PA 5DQ9B 1RSFA 4B7LA 4MX7B 5FPIA 1CGWA 1U8LB 3K5RA 4R97C 3G7TA 1HHJB 2FNBA 3QJRB 4MYPA 1ACYH 3AY2A 3X1GA 4XC1H 1QSED 4B9FA 3GZKA 2WKOA 1KWGA 4XVTH 2NDFA 4Y4FB 1AD9A 4HWBH 4FFYL 4AYID 1QX1A 2CH8A 3QQDB 1UB5B 1MZYA 4HUXB 3DVNA 5ECGA 4LASL 4L5FH 4LCWB 3HJEA 3DV6B 3MUZ1 4KTGA 1QRKA 1JGUH 2EACA 4LEOB 4NRXA 3S96A 1CE1H 3EJQA 1NCNA 4JNXA 2JI2A 4GKSA 3CFIC 3AC0A 3S8GB 1MWAA 2GSGA 3KS0J 4P3WA 1I8MB 2XA3A 1HKFA 4M9OA 3W81A 5IVOA 5KANI 1NDGA 1CGUA 4NRZB 1CVSC 3A6BH 1KCBA 3HG4A 1WH0A 1ADQL 3IM1A 2VR4A 1GAFL 5FFGA 2FQDA 1VZHA 5DRWB 4HKZA 4KVCH 2CRIA 1HEZA 2QR0A 3GRGA 1H3VA 1A9BA 2DMCA 2VAAA 2WIMA 2OMVB 5TDPA 4LQFL 1BOGA 1UWYA 4JPKL 1CDCA 2C3VB 4M8QB 4F7PB 4BFGA 3JUYA 4FQ2L 4FULA 4PGBB 2BP8A 1F4WL 5KJ4A 3GDBA 1E2VA 3IDYC 2Y07L 1WC7B 3OKMA 2EKSB 3PAZA 3JZYA 2ZUQB 1A14L 4B9GA 2IXQA 5EEWA 2X9YA 4FMKA 5C1MB 4Y2DA 3KPLA 3QIUA 4JHZA 4HKXB 4P46A 4I0PB 3LKNA 5E9DA 3ML9A 4G1EA 1N18A 2G60H 3FSAA 3LHPL 1UJTA 1PVHA 5FUCC 1JWMA 3A22A 4M61B 3V79C 3SKMA 2Y06L 4IBTA 4JHAH 3RZCD 4C56A 3MKGA 4I3GA 4LOUD 1YEFH 5H35A 1A3ZA 4WHDA 1B0GB 1SN5A 2ZSWB 3HZMB 5EU3A 5T33H 5D1ZI 1FYTD 2RB8A 5DEZA 4PR5B 4LCYA 3ZTNH 4KXCA 3HS0C 5FUZL 1GC1C 3QE5A 3GBLA 1DJZA 2C4FU 3O3AB 5CJXA 4ZUUA 3TYFA 1HILA 2F0CA 2VLMD 2JVUA 3EDDA 1FAIH 4PBXA 5C0GB 4UTAH 1W6WA 4HHAA 4NKOA 3MRGB 5IKCA 3WTUA 3EYSL 1INQB 5SWZA 3X11B 1CCZA 4QLRA 2I9LA 2XRAL 3BWUC 3HR6A 3WJJC 3PQYE 4AYBA 3QULA 3L1OL 1V7ML 4HZLA 4JREB 3KGSA 3EJTA 2XLLA 1HHIB 3LPPA 4RFNB 3B4NA 4TQ8A 5LN8A 2CD0A 3IMUA 1HT6A 3D2UA 5GIRA 1MDAA 2C9PA 3JV4A 5CBEB 5KS9A 1GHFH 5H94B 5ISZA 4K55A 5D2NE 5MENA 4HS6A 3SB3A 5JZ7D 3QS3A 4G8GE 2A4EA 4FQCH 1KB5H 1HESA 2DQHH 2X3CA 3TNMB 1RZFL 2PTTB 5CHNB 3HC4L 8FABB 1KT2A 1SPDA 1KLFA 2X4NA 1BPLB 3SY6A 2P4AB 3UG4A 1IM3D 3DX2A 1EMTH 5I6OA 1JOIA 1LD9B 5T1MA 2F7RA 5AOIA 4HWUA 1KG0A 3WN5A 1IBDA 4XC3L 4OIFA 2CZNA 1R5IA 4QO1A 3VRJA 3VI3E 3V4PH 1OANA 3OXSA 2PYEA 1A6VL 2CO2A 3RL2A 4ZNEA 2X87A 3PXHA 2LVEA 2PKDA 3MRQA 4HEME 1OGPA 2HLFD 1WCQA 4P99A 1CFBA 4DCQA 2HH0L 2KYIA 1HVXA 1CD0A 3QNXB 5J1TC 1AZRA 3FQ4A 3OSVA 3PABA 3W5NA 4L8DA 4RCAA 4KI5F 4O02H 2W60A 4WHTA 3BZ5A 5F7BA 3DGCR 4YNYA 5DVNA 3BKJH 1IFHH 4DPRA 5HY9A 1LDSA 1UHVA 4Y2OA 1O6SA 1Q9WA 1X7QB 4BZ1H 4ZS6D 5F6IB 5J13C 5JOPD 1YVLA 3HN3A 1BXVA 1ZJAA 3M7OA 5LO7A 2DD8L 3AQYA 3N43B 2YGQA 5EBWB 2Y25A 3U2SB 5AW3B 3T6XA 2NY2D 5KYXB 4D0DA 2IBZY 3EJCA 3IJ8A 3C5ZB 3T6QC 4EDWL 4NO0A 3DSFL 2R4RH 4KHTH 1KEGH 4FZ8L 2BSED 4KJYA 1Y0LA 4PJBE 4TUUA 4MRBA 3GPEA 1JHLL 1OSYA 4NZTL 1XH3B 3VD5A 2OR9H 3IVKB 3BO8B 1XIWC 1QD0A 3ZVVA 4W9ZA 5KSVA 3MACL 3V6OE 3J8F7 2GVYA 3KGRA 4O2EA 5J1AB 1YDPB 3IKCA 4IBLT 3TBSB 1TTFA 2N56A 4AUUA 1FJ1A 4OGXL 1HDMB 3EHBC 2WXNA 3WKNA 2MQCA 1R46A 4S2SA 3ZGIA 4RLDA 4IRJB 3HPJA 2PCXA 2MHAB 4JCMA 3SOTA 5I0WA 1TTAA 1WITA 4KH9A 3CH1B 4GRLA 5KW9L 2LW3A 1D2OA 2C26A 3FT3A 3U36A 3A24A 3N85L 4YE0A 1MRCL 4CN4A 3U9PH 3V6FB 4JO2H 2B4CC 4OZHE 1SEBA 1K8DA 2OMZB 4NN7C 3SGKC 3TYGL 4D9QE 4EI5B 2QEJA 4RZKA 3VMNA 3QUGA 1BVNP 5EBGA 2WOYA 2P24A 2ZAGA 1A4KB 3UZVA 2NW2A 3ZKXB 1OY3B 2M8XA 4R4FH 4WWKB 1C16A 4P2QA 1BBDH 1NZRA 4JDZA 2OL3H 1ZSDB 1KFGA 1QRNA 1F00I 3OG6B 5AZ2H 1CXLA 2I7OA 4JJ5B 4Z3TA 1OL0A 1RK0B 2CCVA 3AREB 4NFBA 1MFMA 4YFEA 2Q20A 3L4UA 3PNWB 1R5WA 5GGUB 3HAEG 1BAFL 4N90E 3C08L 4OBRA 2WM0A 2MJWA 5DFAA 2WLLA 4L8BB 1KIRB 4AEFA 4PLNC 5HYQA 1MJ8L 5I24A 3K72A 4B41A 1Z5LA 1JZ3A 2H6OA 3ZHDA 5C0RL 4I13B 4TUJA 5E2JA 2HRPH 1S8DB 4LCCC 1BJ8A 3WS6A 3L4ZA 4RWYL 1LEIA 1EVUA 4KHXL 4PMEA 4GUQA 1NGWA 3K6FA 4G6MH 1WBYA 2YHGA 2F53B 1RFDH 4KKNA 4LP8A 4JKWA 4AKOA 5AVYB 4QRAA 4F7MA 2RCSL 3X1BA 3IMSA 1N8ZA 1R75A 4XPFL 2HFEA 3OXRB 2YD8A 2ZYIA 5FKAB 1LE5A 3V4VL 5GZOA 3AMKA 2NNXA 1MFVA 2MKWA 3OR7B 5JR1H 1EDQA 2N01B 1QBMH 2EYRB 4KK8C 3UC0H 4CN1A 1T66D 3P1VA 2XPGA 4XE0A 4OLYL 1AP2A 4AZ8B 3QUZC 1CD1B 1F86A 3QPQD 3WMQA 4POUB 2JJTC 1KF9B 1ZLVH 1KZYA 3P11L 3BKML 1OAKH 2L4OA 3JT0A 4X9YA 3WKPA 5JHDD 3MNVB 4H8UA 1FN4A 3BSHA 1FSKC 1IE4A 3CCHB 4TF4A 3S4SB 2C9QA 3D33A 4MD0A 4N2AA 4P2RE 4RISL 3L5JA 2VRQA 2K9UA 4GMSL 1PY4A 2BHFA 3TURA 1GZQA 2YKLH 3X3FH 5CIPB 4ICXA 4NP4H 4LKXA 4YX2L 3EJJX 4GBXD 1HZHH 5FGRA 3C5JA 4WK4B 1XR9B 1CL7H 3HB3B 1OEZW 4MJ6A 4P4KA 5DHYB 3BZEB 4G7YL 1I1YB 1GGIH 3NQKA 4N20A 1TQWA 1ZT7A 2CDGB 4XPAH 4ES9A 3H3BC 4TVPE 3NACH 1VA9A 3EJPA 4JZJC 1R24A 4TNWF 1ERNA 4YXLL 3OL2A 1AIZA 1T0NA 5A2FA 1EZVX 3EJZD 1Y18A 1J9SA 2I25N 4KKAC 4PJEB 3MRMB 4MXQD 3FN0L 5H37G 1U2YA 4NOFA 2EEFA 4TLKA 4TQIA 4XPBH 4Z1PA 3N43F 1CU4H 1G6VK 1Q0XL 4JY6B 5BO1H 1O7SA 1D3CA 25C8H 3GMPA 3NTCL 3NUKA 5CINL 4XCEA 1F6AA 1DBJH 4N2EA 2A74C 3WIIH 2IOOA 3UP1A 4Z7VA 3VD1A 3OKNB 2DKMA 3UYRL 3QGVA 1A3LH 3DIFA 2VN5A 4NUQA 1GOFA 2YZ1A 4ZMYA 3U2IA 4XBPB 3H9HA 1AS7A 1WFJA 1QFWH 2HTLD 3RILA 2NZ1A 5DJZB 2DRUA 4ELMA 2KH2B 4ZFZA 3WLWD 2P8LA 3QR1A 1QSFE 1BMGA 3MUGB 3AWEA 5TE7H 1G9HA 4HPOL 4YHKL 3PWNB 3QFDA 4NZFA 3G5WA 4NDMB 4K8RL 3RPBA 3I75B 3FUJA 1IBBA 3M46A 1A21A 3NK3A 4MMXC 2BDNL 4FKKA 5L4FA 3Q8AA 2VIRA 3WTYA 1AANA 1BLNA 2F5BL 3PXLA 4MJID 3MV9A 3TCLB 4J23A 1WG3A 4PCYA 1FUNA 5DI8A 1ECZA 4HIPA 1OSEA 3MDJA 4HSCX 4WUUB 4DGYL 3P4OB 1MFEH 4PP2A 5HHVH 3CFEB 5I30H 2X3BA 4UQ2B 1I9JH 4HEPG 1UYWL 1TJXA 1UENA 2ZP0T 1AO7B 3LNEA 4HMCA 3DX9A 4C4UA 2KL6A 3LMJL 2GAZA 4MZIA 4EIUA 3VFRA 1SJHA 2CO7B 3ECBA 2R1XA 5DEJA 2XQYK 5F0MB 3BGFC 2NQ3A 4YZWA 2DIEA 3NFSL 12E8L 3SCMD 3VWJB 1BVKA 4EIBA 1JCKA 3SE8H 3ESVF 1EXGA 3F64A 5FECB 5J6HA 1N12A 1GZPA 1T1YB 4X7SL 1HJCA 1RP8A 1KPVB 5I9QB 1LHZA 5FYKH 3TPUB 4KKZA 1OGAA 4IGBB 4QXTB 4KK5C 3F83A 3SDDC 5C0IA 5DYFA 1UZ8A 3EJSA 2V9RA 5IROC 2J6EH 3BEWA 3WNMA 5DSCB 1RLWA 2XQ0A 4GAFB 4OIIL 2BNUB 2GBUA 2XTJD 5TK4A 1QLEB 3D3VD 3UTSB 5LCVL 2DF3A 5D72L 4NKDA 1CIDA 5KSUA 4UNIA 2E8YA 5JHMA 1C9SA 1KNOA 3QORD 4GJTB 2D9QB 2NUPA 5GRVL 2PW1B 4JFEE 2VLRE 1QQDB 1EQWA 1ZGLP 1IAIM 5I66B 1Q1JH 1E7UA 2H26B 4HJJH 1AQHA 1HOEA 3QO0A 1T83A 4JKLA 5FW8A 1VF5C 3DRQA 2FO8A 4HXBH 4HYTB 3CSYB 3BVVA 1F02I 3RZWA 4NNXB 5I1EH 3IEAA 5HDBF 1EJ6A 5E8EA 5F6HI 2ED8A 2I5YL 5KTEL 4I3SL 1I1AD 4LRNL 2W0FA 5B1AB 3WFEH 5F7YC 3RY4A 5E00A 4Z78B 5I1AB 1M6UA 4MWFB 3KM1A 4I18A 2KERA 1WZ1H 3OGCB 1L0QA 3B34A 3BUPA 4JKKA 3SGEI 3K2IA 5FDWA 3DECA 4PJEF 4R84A 5DO2D 1THAA 2FR4B 5LBSH 5IBTH 2Z93A 4J3OF 5DMKA 5CSBA 1JK8A 2Q7YA 3WDHA 3G6AA 3AM8A 1TITA 4NZ8A 4FXTA 1AGFA 1SRDA 4WUKH 1RJZA 2YQBA 3F84A 4MJ5A 3WY1A 2G2NA 5C9KA 2BLFA 3F2LA 4Y2DD 5HGHB 4LKCB 3RIKA 1CZ8H 2H2SD 1MFAL 2WXOA 3EJYC 4XPTL 4YDVB 4DW2L 3FTWA 5E9DD 5TGBB 2BHUA 3C8KB 3LEXB 2WZAA 1I7TA 1IC4L 1KEML 5JA9A 2BO0A 3QZOA 1BZ7A 4O51A 4PJDA 4GMTH 3ZL4H 4U6YA 3BD4A 4OB5L 3DO7B 4WCYL 2QFPA 3ZBMA 4C56D 1J0ZA 1MCDA 1JFQH 2O5YH 1HAUA 1I4FA 3HI5H 1ZHLB 5AW2B 1T22B 5D7JB 2FJHB 3LKPB 4D2NA 3GIVA 2EXWD 2VZVA 1D9KC 4KXZH 5DZPA 3V6OC 2EUVA 1IGYA 3HI6H 1E6JL 2Z92B 4J27A 1AXSA 4YK4C 3APMA 5E8PA 5TFSL 1VEOA 2KQMA 5SWZD 1IKFL 4EI0A 1LO5B 4ZUWB 2C3HA 4K5LA 5I82A 3LD8C 1C5CL 5F96H 2YRZA 5L7XH 1VDGA 2H8PA 3VW3L 1BQSA 1IEBA 4HUVB 3PJLA 4DT2A 2IGFL 4HIXH 4PCSA 3OLEA 3OB8A 3MRBB 3WEMA 3VAEA 4A1RA 2ZF8A 3INUH 1M71B 3PDOA 3SDCD 4PCTA 3O2VL 3IPFA 5CD3B 5DD3L 4UTBL 3QHTC 1EEYA 3K6DA 3IGAB 4OZFG 4YXKH 3FFCE 5GISH 4HVBA 3TBYA 3MBWB 3RFRA 3C60B 1KELH 1MCQA 4L3EA 4G3YL 4FFZL 1IQWL 2NTFA 3BP6B 5EU5B 3R1GH 5CWSB 4U2YA 2V17L 1X5MA 4JM2B 2UY6A 4KO9A 4BQ6A 1N4XL 2NRDA 3FO2A 4TNWK 1KXTB 3SQBA 4MB3A 3TNNA 4JN2B 1D7BA 2YD0A 5T1KD 3OAZK 3BKYH 1BYNA 4L29B 4P5TC 2H3XC 4X7CC 4H8PA 5I74B 3DDGA 1AACA 1KB9J 2FJGB 3FB5B 2QQLH 3QDJE 4W9GC 4ERSH 3P4NA 4N0FB 1XF3A 2K4AA 1L7TH 3GMNA 1AVAA 3MJ6A 5ESQA 2QKIB 1UM6L 4P5MB 1WFUA 1U92B 1F90L 1S7SB 2CJUL 3WUWB 4YDMA 1GSMA 2YPLE 4O2FB 3WNIA 3CHRA 5K1VA 5EFIB 4KDWA 4UQIM 1JPSH 3Q8FA 4XP4H 4NO5A 2X6BA 1T0MA 3WXVH 4GLRI 2PWFA 4HGMA 2FB4H 4LVHC 4NKIH 1R4XA 2CUAA 4M62H 1YLBB 4NO0D 4Y88A 2R0KH 3QO1A 1SXBA 1UXSA 2OMNA 2BMKB 4MZ3A 4Q4IA 3CZFB 2VL4A 1SLVA 1YY9D 2J12B 4AX3A 3GXIA 4RA0C 1JZHA 3VH8B 3I6GA 3CE1A 4PM1A 3APDA 5GRXG 3V0VA 2P47B 3V0AC 4XZUA 4HUCA 4RDQG 5DWUH 2NSXA 5LJYH 1F3JB 2VDOL 1S78D 3HG1A 3EFFA 1GSKA 3DOSA 4I4WA 5EWIH 2H32H 3HE7A 4JS7A 3FUDA 1JZFA 4DGUA 3LRKA 5EZOL 2WQAA 1G4MA 4TV3A 1T2QL 4E9VA 3BDYL 1M1SA 3GM8A 5LGHH 4WI8A 1IBHA 3WL9A 1LL1A 4NQVA 2IDCA 4MSWA 5FDYA 5EZIL 1ZHNA 5C09B 2X42A 1U3HD 1P7QB 3IN2A 4RMTA 1KCUH 3EDFA 1OAZL 1HX0A 4OAWA 4HZ1A 4YC2C 1RURL 4LHJB 1L4IA 4X6FA 4N2CA 3EGSB 4OKVB 4ZX3A 4I5BA 3AQDA 1L9QA 3VE0B 3IMVA 2NYYC 3FRUA 2BP0B 4P2QD 3CV5A 1RUMH 2WBJA 3HOGA 1QRND 1EFXA 1YEKL 2WUBH 2YJLA 4KX9A 3V95A 4YSSA 5AB0A 2EABA 2NY4C 1A1MB 5DHVB 2YD1A 1DL7L 1KJ2L 4H40A 4V1DE 5ALCH 2PWEA 5LKNA 2CRZA 2OCFD 5ICYB 4S10A 4R2GC 3QT2A 1DSYA 1P7BA 4HK3J 3TBTA 1IO4C 1MI5B 3CU1A 1VJSA 5IHBA 2WINB 3N41B 2QGBA 4JFXA 3IK2A 2UY7B 2ZONA 3DROA 4TL5A 5F7DB 4LSQH 4YXHL 4MA7H 1DJHA 3K1KC 5TQ0L 3TJEL 2JIXA 2WBXA 3S35X 1PZSA 4XPGH 3NA4A 4K3HA 3TN0C 4P57A 3KJ4B 2DWDA 1PGRB 3GF8A 4U6HA 4R5XA 3REVB 3OR6B 2J8HA 3ASOB 2MWCA 2BSTA 4F7CB 4XOAA 1DQMH 4K7PL 1OLZA 4Q0XH 1U8MA 2EDRA 5GZOD 1U8OA 5I76A 5B8CB 4Q6IC 1WZKA 3FUEA 4HIEB 4KROC 4BH7B 2I9TB 1DCLA 2O6FA 3ZDYE 1DBAL 1WF5A 3HC3L 4IU2A 3NBNA 3KPOB 4GG8B 4ZW5A 1RAMA 1FDLH 1MFDH 4P3DA 4UBDC 5T1LD 4ZX4A 3VFPA 4JM2F 3BMVA 4KMQA 4HIQA 5HTSA 4H0IA 2ZX5A 3LVTA 2EDNA 5DRNB 3IDMA 1J05B 4FFVC 3RDJA 2JQAA 2WQ8A 1U8IB 4Z3FA 3DTXA 4DK6A 3NDZE 3WIHA 4H44C 3RWJB 2OZ4H 3X14A 2YPVL 1UG9A 4M56A 5KWYC 4I7ZC 3H6JA 4G9DB 4L1DA 3LXAA 2YPKA 5C08B 1AKJB 3GBMH 3THML 1QWNA 4PJFF