3PFUA

N-terminal domain of thiol:disulfide interchange protein dsbd in its reduced form
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
119
structure length
119
Chain Sequence
GRSQFVPADQAFAFDFQQNQHDLNLTWQIKDGYYLYRKQIRITPEHAKIADVQLPQGVWHEDEFYGKSEIYRDRLTLPVTINQASAGATLTVTYQGCADAGFCYPPETKTVPLSEVVAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein dsbD
publication title Oxidation state-dependent protein-protein interactions in disulfide cascades
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 23
structure length 119
sequence length 119
ec nomenclature ec 1.8.1.8: Protein-disulfide reductase.
pdb deposition date 2010-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11412 DsbC Disulphide bond corrector protein DsbC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1250 Mainly Beta Sandwich Immunoglobulin-like Thiol:disulfide interchange protein DsbD, N-terminal domain 3pfuA00
1L6PA 2K0RA 1VRSA 1JPEA 2K9FB 3PFUA 1JZDC 1Z5YD
chains in the Genus database with same CATH superfamily
2MCPH 4DKAA 3S5LB 4MXWH 2A77H 4JRXA 4IBZA 3JWDH 1TVHA 5E0FA 4JFWA 1M7DB 1ZVSB 2H0EA 5ILTL 4Y16B 1DUZB 2OR7A 2WYIA 3HLKA 3T9WA 2XXMB 2UX7A 2CLVB 4LHJB 1UWEH 1Q4NX 3DUUB 5IG7B 2XIIA 4KITB 2EUWA 3EUDA 4X6CF 2BCKA 2TSAA 5DRZA 2D3NA 5HBBA 1XSOA 2CWRA 3EJSA 5C09D 1OAJA 2DIBA 3D0VA 3OZLA 4XNZB 1S3KH 2AXWA 5D1ZA 4BRJA 2YK1L 5AAPA 4GRWE 3KW7A 4LEOB 3VG0H 3IETA 3VB9A 3WELA 4QNPE 2HFTA 3L3JA 2AAVA 3C9NB 3JWOC 4JY6A 4L8DB 4ELMA 2ROXA 1OPOA 4ZOAA 1TQUA 2WVVB 1FZMB 4G6KL 3NSDA 2BXZA 1CDYA 1P4IL 1QLRA 1RVFH 2FH6A 1RJLB 5JIDA 3CN0A 1TJHL 2I69A 4LDLB 4LL4A 4S0TD 5LAPA 3WTTA 1FH5H 3BT0A 4A7VA 5JHLH 2JIXD 3EADA 3P77B 1MQKH 1H8OA 1OCOB 2WZ5A 3QJHB 3SPIA 1FZJB 5DD1H 3PQYE 1THAA 1EAQA 4RA3A 3VI4E 1DLHB 1CO1A 2YEVB 3SGDI 4XPTH 3JTBA 4DTGL 1U8QB 1OHQA 2FHBA 5AAWC 1KFAH 1YEKL 3ZMNA 3L9RB 1FSKB 1JZDC 1HDMB 2AGJL 2B77A 3H85A 5AOIA 3V6BR 1HTYA 2H1XA 3DGGB 3STZA 5MERA 5HYFA 4OCLC 1KGUA 1OZTG 2DMKA 3IMSA 4KKNA 1X44A 4LSPL 3BZ4A 2NX5E 2J1KA 2W60A 3DDGA 3KS0J 4GUPA 4JN2B 5I6LA 1KNOA 1NQBA 3CQFA 5F3FA 4HEPG 5AB0A 1GZPA 3NACL 4PIBA 1FCGA 3P2BA 5I1CL 3MKKA 1ZXKA 3HR6A 3DPDA 4K3EH 1GGIH 5IKCB 3SD2A 2H9GB 2I9TA 2R2BA 3MDJA 3FOLB 1EO8H 3KR3H 2X4SA 4APQC 4WJKB 3VD2A 5FIEA 4BZYA 1RPUA 1G1OA 2FBJH 5DVOA 3HZYB 4I3RL 1ET5A 1JJUA 2MQCA 3JWOH 4HW6A 4JKPH 5HPMB 1HH9A 1PYWB 3LQAL 5ABAA 3SCMC 3EBHA 1SFHA 3NSFA 5SWSB 2EVFA 1ZHNA 5DR5H 5IQ9B 4CJ1A 3EYQD 2NNXA 1KXTA 5I71B 2WK2A 1XGPA 2VLJA 3INUL 1UXLA 3TEYA 1WSST 5JLZB 1BAWA 4TOYL 1AZNA 4Z6AT 2ED8A 4P3CH 4P2OC 1U8MA 5BVJB 3VXRB 4MMZC 3VSUA 4KJWC 1SDDB 2PO6C 1QO3A 3A67H 1MCKA 1J5HA 5MEND 4YZFE 2BVQA 6PAZA 2WQXA 3SDXB 3B2PA 2NW2B 1PDKA 1HJBC 1PEWA 3S34L 4IRSD 1OL0A 3JYCA 2P48B 2BS8A 1DJGA 3IU3B 4MXVF 1G84A 3Q9QA 3TURA 4LLMA 1OF0A 2BOBA 5T33H 1A47A 5F7WC 1ZDSA 3WKNA 3X3FH 3ILDA 1K8DA 1JGLL 2YHGA 1LNUA 3LNHA 4X9HA 4WDIB 4TVPD 5GRJH 3HFMH 1RUPH 3GHBL 1TDQA 5EN3A 4DW2H 4ODSL 1A02N 4AQOA 3HNSH 4PJ8B 4X4KA 4DUVA 3KYMB 2DQHH 5EU5B 4XP1L 4NS0A 4IJTA 4PV9A 5D5MA 3U82B 3X2QB 4HUKB 2ZX6A 4G8FA 2LOEA 2E27H 4IRJD 3CCHA 1KIRB 1WBXB 2YOAA 3PWJA 3W37A 3S9DB 4LT7A 1QNIA 4DP8X 4QY8A 3BIKB 3EJUA 4XB8A 4M56A 5F3HB 2V3DA 3GLZA 1TZGL 4PGDA 5ANHA 4A7GA 3FTUA 3V6OA 2BOLA 5J11B 5EO9B 5GRZA 1BD2A 5HGGS 1FLRL 1L0XA 1P1ZA 2P43B 1Z6JT 1EX0A 5TE7H 4PCKA 3PHSA 2BY0A 5LGYA 3L3IA 1OAKH 4PJHE 4LKCA 4WU5B 4L0ZA 1BQSA 2BMKA 2YJQA 3VXOB 5HI4D 2CRIA 1D7FA 2VR5A 3PDOA 4QD2E 4OCSL 5CINL 4BFKA 4OLUH 2HWZH 4OGAC 1AR1B 1WK0A 5K59E 3TO4B 2P8MA 4NEHB 4W68A 4KZEL 5EZIL 4FQHA 4P59H 2X1QA 3L3GB 4FDWA 3UL4A 3OBAA 2TAAA 3TBBA 3SD5A 1YVLA 4CVZB 2P8PB 3EJZC 4QI3A 4NYLA 2R69H 5D7SL 1RZJC 1YEIH 1SOXA 5KYUB 1SXAA 3C09B 3BD3A 4HEME 4BE6A 1QNZH 1U3YA 1XFPA 4URKA 2NXYB 1SUJA 3GZOA 3CFKB 1N0XH 3DTXB 4PRDA 4KZDL 4WTZA 1CR9L 5JHDA 1CGWA 1WC7B 3CDGA 3W11C 5K69A 4AYDC 1AGCB 1NIDA 2QV4A 2WUCH 2WXKA 2X4OB 3OJMB 5KZCD 1QMUA 4X5WB 2AJVH 5AW5B 2VC2L 4C57C 4ATTA 4F8QA 5L9DH 4MJ2A 3Q01A 4N2EA 1INEL 4XXCA 2AANA 1E9QA 4W9FC 4YDIL 4BWUA 4YJZL 1L6ZA 2J56A 3HR5A 3PL6D 5F1IA 3F85A 5I24A 4X6DB 2CGRH 2QR0B 2VQTA 4M93B 1OW0C 3WTWA 4A2DA 2B4CL 1KCUH 3L5XH 4Z3TA 2VXSL 3QIBC 1IVTA 2OL3B 5ICXA 1UATA 3CSGA 4IU2B 3VDBA 1SM3H 3FK3A 2NY3C 4N25A 4I2XB 4H4NA 7FABL 5E1IA 1YJDC 1AO7D 3IK2A 4KK6D 2HKFH 4EEEA 1UEMA 4V1DB 3P4MB 3L9EA 3BAEH 4KDVA 1W0WB 4H8HA 1XF5B 2J2ZB 2ZPKH 1D9KA 2WVSA 3CFEB 1NC4B 3BWZA 3FPYA 4PGBA 3HNVH 4HWNA 4APXB 5IEHB 1ZAGA 3FTYA 3GSNB 3ZRFC 1FBIH 1G94A 1RZJH 1SRDA 1XHHA 3QIWD 3REWB 2OXGA 2J1WA 4F80A 3SDAC 3X1FA 5DVNA 4LCVA 3JV0A 3O81A 1KB9J 1I9JL 1UA3A 4H88L 4RMTA 2WAQA 3QDGE 4KJYA 2RQEA 5ENWB 3B7SA 5DJ2B 5JIHA 2PCPB 1R5WB 4Y1AD 1NBZA 4HJTA 3BKJH 1ZLSL 3MBWB 1T89A 3L4TA 3U83A 1KGIA 5HHNB 4PG2C 3V5DA 3LVEA 2BHFA 1DLFH 2ZG2A 1IILE 1Q1JH 3SE4A 1FFRA 4PJIF 1C5BH 3U6XS 1U58B 2P5WA 2GTWB 5E8DL 4ZOBA 1CE1L 1K8IA 2PR9A 4ZMQA 3DVFA 5GGSA 3T4AB 1YHPA 1YJDH 4OGYL 5EPMA 4M62H 4ZX6A 5IV2A 4F7EA 4HHGA 3ZKXC 2PCFB 3TESA 3CXFA 3QFDA 1IE5A 3BPOB 1JPGA 1DVTA 3NJXA 4PWJA 3W57A 5F88A 1C8PA 3HA0A 4TNWK 3TT1L 1L9TA 5FFLA 1D7DA 3RI5K 1LO5B 1AD0A 4KH2A 1EEUA 5B1CA 2C7FA 3FTVA 4YE4L 5BS0B 2OZ4A 5CM1A 3QORC 2VZTA 5FAAA 1UD2A 2VB5A 3CUPB 5IUSA 3LZLA 1F11A 4Z7UF 5CIPB 4MXQD 3GBMH 2KLSA 3K6NA 3BPLC 4Y9CA 3IXTB 4EXKA 2IQAB 4HSQA 1IVLA 4GQPH 5D2LF 4BSVA 4DK6A 2M83A 5HYQB 4K9JA 5C07A 3EO9H 5EEWA 3D18A 3F58H 1U8HB 3Q2WA 2WD0A 1KYFA 5ESAA 2E59A 3STBA 3TP4A 1YEGH 1XMWA 3T2NL 1AYRA 2P47B 3NCFB 4YLCA 4PRAB 1ZHKA 5AALA 4JGJA 3WJLC 4KI5F 3L4ZA 1ZIAA 1W15A 3K8KA 2O93L 3AXLB 5EU3B 2NY0B 2YD9A 1WP6A 4MS8D 3D4CA 1QTPA 4ZTEA 3VD0A 2MCMA 3TYGH 1A65A 4JRYA 1QBMH 3MXWL 1JD7A 3FONB 5KS9A 1XF1A 2W0PA 3ZKQD 1IM3B 2XXFA 1E2ZA 4U4BA 1X5AA 5D2NA 2WLHA 4CILA 4NUMA 2F54D 5INCA 3S97C 2Y07L 1OIOA 5HDBF 1MRCH 1SMAA 4P5MA 1A6VL 3PDGA 3AG4B 5INDA 3ZDYE 4F7PA 5JHDE 4YXKL 1JK9A 4K8RC 3T0XA 3K4DA 1DHKA 1R3LA 2DTMH 4PN6A 4MNQB 4WFED 12E8H 4FQJH 1QPXA 1NMAH 5GISL 4DGVL 1JPFA 4D0CA 5CKGA 3BVWA 4ERSH 3WFHB 3QXAB 5AZ2H 2XWJB 3FN9A 3WV0A 4Z8FL 1TKWB 4P2QB 1MAJA 5F21B 2J8UB 3V9CA 1TFHA 3NGBC 2VAAB 5EU6B 3SHSA 1WD9A 3QAQA 4PJFF 4C4KT 2V8MA 3KCPA 1JZEA 5JPMC 4GRMB 5FF6A 4KI5D 2WTPA 4HKZB 3T6QC 5TQ0H 1TZHA 4LCUB 1BBDH 3EFDL 4JO4H 3N41F 2G60H 1JYWA 5HHXL 3VXSA 2YO3A 3HC3L 4YBQC 5JDSB 3HB3B 1J0JA 2V9RA 4MNGB 3AG3B 2QHLA 4OIIL 3T0ED 3VTTA 3ISWA 4P23D 3WNNA 1A6AB 4D7PA 1TQTA 2PPEA 3EO1A 4G7VH 3NESA 4FCHA 1L5GB 1XR9B 1PZCA 1YDPB 3F01A 1AQKL 3IU4H 1AACA 1KV7A 1JZFA 3MBEA 4MRBA 5TTRA 4DO6A 1AZUA 3AB0C 1SOSA 4G1MA 2WXNA 2Y25A 3A6BH 3DOIA 3TA3D 3OKEA 5DD3H 1BJ8A 5LGHH 1FYHB 2JELH 5CR8A 4DP6X 1GS8A 1TMQA 1JGVL 5IMKA 1OSEA 1NDGA 1V3LA 2E7MA 3CLEH 4ODTL 3GMQB 4RRPM 3PFUA 1A7RH 2CBPA 2GG1A 4K8RH 1GW6A 3MLXH 5FGCB 3CFIC 2OXHA 1A4JA 5J56B 2LU5A 3NFPA 3SGKA 4UBDD 3E6HB 3FO9A 4AH2A 5I18H 2VR6A 1ACYH 1N67A 4FULA 4OFIA 2IGFL 4RIRB 3LKPA 2GIMA 1JDDA 3U30B 4P4KA 1BOGA 4F8PA 3LNDA 4J8RB 2EC8A 1AYOA 3TN0C 1E4XH 3VU2A 1G6VK 3T2PA 3PIQA 2AQSA 4A7SA 2ZSWA 2IADB 3ZGHA 2P5WE 2VDQH 3B8YA 5E5MA 4OV6F 1FPTH 4D8OA 1S7TB 2NYYD 5TPWL 2ZQKA 1Q9WB 1NICA 5EIIA 5C0JB 5LWYL 2CO2A 5EIIG 2DYSB 3LPWA 4PRNB 4IHOA 1Z5YD 1MHHA 3H54A 4RMVA 1RZGB 4G6JH 3LH8A 3U9UA 2OZ4L 2VISB 1OM9A 5J1SC 3ELAT 5C0BE 4M4RB 4GFTB 2ZOWA 3BUPA 5T1MB 3VGAB 5D7JA 1NEZG 1MLBA 4LLUA 2CQVA 3E38A 2VO8A 1KY7A 4HZLA 1DJIA 5HI3C 3SKUD 2FZ3B 5L0QC 4OM0H 4PSPA 4P5TD 3RWEB 4PREB 2OMYA 2XWEA 4KKAD 2VW7A 3V4UL 5BJTA 3JXAA 1T1WA 1M7IA 1Y18A 2DLTA 3LEYH 4N9OB 4P5KA 2PWFA 1CE6B 2IANB 3BH9B 4XC1H 3UJJL 4W9CC 1ASOA 2WIMA 4I8DA 2A38A 3B1TA 1CD1B 4LSVL 3UTSA 4ZW8A 3SE9L 4YHNB 3QQ4A 2WC7A 3P30H 3UC2A 1T1YA 1A5FL 4HSCX 4AEIL 5KVFH 2ZUVA 1EANA 2EXWC 1PZ5B 3H4HA 1ZLEA 1NGYB 1CQKA 3H42H 3NJNA 1SLUA 4MAUH 2UVFA 5DRWB 1VFAB 3FO2B 4UOW1 5EA0H 1RHHB 1FYTD 2AK4A 3RZCB 2C7UA 4FFWD 5BZWB 2IFFH 2WWNA 3GO1H 5CBAB 5IW6A 3BZFA 5D2NE 2EVGA 5IR1A 1CDCA 5HJ3A 3QWNA 1IE4A 2MKWA 3SDDC 1GY1A 2N0MA 1RZKC 3E6FB 3MZGB 4X7DC 2ARJB 4Z3HA 2CBQA 1DBML 2GAZB 5E94B 3VWKD 1E9OA 1OY3B 4AMKH 1S2EA 5IMOB 2O26U 3ZDZF 1ZWIB 5KN5B 2VQ1A 5I1LB 1KC5H 2XVBA 5HYJE 4GSQA 4J4PD 4AIEA 2WWMD 2ZICA 1A3QA 3TBSA 3TZVB 3HN5A 3BVXA 1KXVC 4QXGH 1DQLL 4RWYH 4ZFQA 1JZJA 2NY2B 3OJDB 4NQDB 3PHQA 1EJ6A 3Q6GL 1OP9A 3BH8A 4JY5H 2O6DA 3OC5A 3TYFA 3VX0A 2ZWSA 2FWOA 3ENEA 3IDXL 2XIDA 3WDHA 1G7JA 1WO2A 4KXDA 4P07A 1YCSA 2GJPA 3DBXA 1AS7A 5CXPA 3UBXI 1XCTA 2LT9A 3L08A 5FUCC 5BZXA 1UM6H 3POHA 2WXMA 3IFOB 4MQXC 2QKIA 4ETQB 5IHLB 5J4MA 2ZWYA 4WF7A 2E7LC 1HT6A 2R0LL 3FUHA 1USZA 1CGYA 3VU1A 3ZE0B 1VJSA 2O5NA 1KIQA 3MFFA 1S7RA 1TSHA 3H1ZA 2HX9A 4HWBH 4GKZA 4R4ND 4A04A 1BF2A 2X12A 3GDBA 3H9HA 3EYUL 1OKEA 3HJ0A 4LPCA 4OLWL 4PJAE 4YSPA 4BHUA 1A6PA 3UG4A 4MYPA 1XQ4A 1NC2B 5IHZA 3BPCA 1CF8L 2IWEA 4EIZC 2OCCB 2WLZA 1PFOA 4CU8A 4UU9B 1J1XH 4IRZA 4KROB 3CFCH 4HUXA 1W72H 4F33A 1RZQA 1BFOA 3KPOB 1ZT1B 4Z78A 3CFNA 1XBDA 5JPNB 4JFHD 2YZ1A 4KOCA 1BF8A 1U2CA 1RZKH 1NUDA 3ULVE 5EC2A 2EDTA 3P2DA 4YDLC 3RWGA 3L7FB 3WLBA 4AT6B 4GIAA 4HOZA 4PWKA 4QTIL 2ADIB 2NUTB 3KPSA 3BCFA 3NQIA 1AS6A 3K1DA 1KN2L 1XGQB 1VEPA 4TUJB 3WBDA 5D1QB 2GVYA 2YRBA 3ZHDA 3PWVB 1EIBA 1M9SA 5GSVB 5I75B 3PP4H 5E95B 1TPXB 4WSKA 3LKOB 1WTGT 4I48B 4LQFL 4ZX5A 2R0KH 3JV4A 1U6AL 3P0VL 4QHNA 3DSFL 4X6BA 4P2RD 1BLIA 3BO8A 5DUML 3QUXD 3OAYK 2H2PD 1J1OL 1KTLA 1HKLH 1DVZA 1OOAA 3N40F 5DJ6A 2ZF8A 3AU0A 4IU3B 5A6IA 1M2VA 4QHLA 4WWNA 1V7NH 2W8CA 1E8XA 3LMJL 1QFWI 2BRRL 3L17A 4EMZA 3NIFB 1TQSA 4HKJB 2D03L 4KHTL 5AOJA 1CLCA 4WHYH 1UZ8B 4JFZL 3GSWB 2ICWB 2WCGA 4A2GA 5E9NA 1KLFA 1JPEA 5IMLA 2DD8H 3RTQA 4OT1H 1LLAA 4JMNA 4JFDE 3WAJA 3AY4C 3MGOB 5DFAA 3MA9L 2IH9A 2CBMA 3AMKA 3WENA 4EOWL 1ESOA 2VLKD 3C5ZD 5GS2D 3WYRA 1XF4B 5JQHC 2PYEA 2CJ3A 2YSSB 1X3DA 1U92B 3WEXB 1RZ8B 3LSOB 5IQLA 3KPNA 5AOZA 3LD8C 1F1GA 1UB6A 3ZE1F 5CP7B 5HYSA 2YMXH 5CUSL 1EDYA 4MAYA 4QGYA 4WFHD 1A66A 1YAIA 4JHAH 3AQYA 4XCFH 4M48L 3O2DH 1UD8A 3ARGB 4KV5E 3WKQA 5EF2A 1BQHA 4L4TA 1SJVA 4U6TA 1BQHG 2NY4C 5CILH 3HG5A 4MJ5A 2V7NB 5LDSA 3I6LD 1MUJB 1I1AD 4JJ5A 1FV1B 3QDJB 3VXMA 3IRZA 1DQIA 4Y2NA 2WLLA 4F2MA 1KPUB 2OMTA 4ZMWA 3QCTH 1J1PH 2R4SH 3CZJA 3FMGL 4GG6A 2E0PA 3NJLA 3ZZLA 3L5IA 3D39E 2GT9B 3LQZA 3MU3A 3QA3A 5DMIL 1LVEA 5HVWA 2HMID 3MJ9H 3VW3H 4N0UA 1G7MB 2ZUQB 5CCHE 3H53A 4ZQKB 4JFXB 2EEFA 3TT3H 4QF1A 4BSJA 1YZZA 3PWUB 2X3BA 5BO1H 5L2KD 5E2UL 4FFZA 5GRUL 3SE6A 4HUWA 5FYLD 3P9WB 3RU8H 3WLWC 4HLZG 1KCWA 1AD9B 1NGXA 4AM0Q 4W6XB 1HE7A 1I4FB 4JFFA 4QRQB 3MACH 1WCBA 1TJIL 2HT4C 2MQGA 2C9SA 2YMOA 4XGZB 1A7NL 4NN5B 2GI7A 1FNSH 2IH3B 2RCSH 4FXLA 4NZ8A 4RFOL 4A6YA 5F7EH 4PYGA 4XMKL 1P4LA 4HDIB 2Y23A 4NM8L 1KT2A 2AEIT 3ZBMA 5AVVB 4F9LC 3PWPA 3V6ZB 2BJMH 4CC1A 4N8PA 1B0WA 3X17A 3O6FC 4O02H 1GYCA 1K72A 3OX8A 3ZE2F 5FCUH 2WBWB 4KVCL 3I3DA 4HXBH 3T65B 1MI5B 4IRZL 4MZ2A 3EJCA 3P9LA 1WEJL 1ADQA 1CICC 1QWHA 5FHAL 2A0LC 1XIWD 3L5WB 5AZUA 3U0TA 1JPSL 2ATKA 2VM4A 4O2EB 4KTDH 3QWQB 4G5ZL 5JIQA 4GKOA 1TZ8A 4FLRA 5CZKA 5I30H 5I1IH 1FFNA 4HS3A 2SODB 2O72A 1A3LL 3L4CA 4Y2OB 4L4VB 2OX5B 4CSSA 1RUQL 3ME0A 2KMWA 3DDFA 1PD1A 3L3DB 5EB9A 2ZIDA 3O6KL 2P5EB 3V4PA 1D5ZA 5A2BA 5C9JB 4ELDA 2JJWA 1LEGA 1R24B 4I9WD 2HB0A 1ADWA 4YGVA 3HE7C 1YPZE 5T3ZH 2WGNB 4PCSA 1AZRA 4JFEB 2V2TA 4WKZB 2AVFA 5B39B 3KYAA 1QATA 3PGCB 1I8UA 2CM5A 3LV3A 3MRKB 3QVAA 1FI8C 1D5IL 5FHBH 4OAWA 2OJEA 4ZX4A 2NW3B 3O6MH 4FNRA 1KLUA 3DV4A 4OJFL 4N1EA 2QVKA 5GRVK 2ED6A 4HS8H 3FUJA 5JIIA 2HLEB 3WS6C 4KRPC 1CDGA 2E7BA 2PXYC 1OAUH 1IL1B 3NA9L 3WY2A 4BBWA 2SEBB 1EBAA 4UT6A 5C2UB 3MV11 4I4WB 1INQA 2I32A 4DEPC 4J3OG 2QMJA 4HMDA 4AUUA 5CNHA 5DEGB 3IMBA 4E41E 5A7BA 3KPLA 4J3SA 4XMUA 1J05B 1BJ1J 5KG9A 2AZUA 2P8LB 1BVOA 3PY9A 3BUIA 3LRMA 5D1XC 3RWDA 3TTSA 4GO9A 5SWSD 4ZPTB 1QRNA 4NWTL 4UT7L 5GS0L 3IFLL 3WIIL 3W0WE 3NZ8B 1D3CA 1K9TA 1KTCA 4LZKA 4D8PA 1JZ8A 4HC1A 4X8CA 3OHMB 4YWGL 4RDQF 3HZKB 1MFCH 3VXRD 4AZUA 3IRCA 2CIKA 4MJIE 3WCYA 4X6EA 5BPPA 4G8GD 3LEVL 3RWIA 4IMKC 2RBLA 3QDMB 4J5VA 5CSGA 2R27A 4QMEA 5DQ9A 3HPLA 4KMTL 1GW0A 3ETSA 5HGAB 4JDTL 4DP5X 5GS1B 1UACH 4PFEA 3UZVA 3NFNA 3ARDB 2I7OA 1HHHA 4L0PB 1OAXH 4N1CA 1I8LA 4GKSB 1AZBA 2PPFA 2WN2A 4ACTA 5HD8C 1A25A 3MOAH 1JF1B 4N0UE 4HF5L 5T3XH 3FQXB 4IQHA 4JHWL 3NJJA 4HJJL 3PG2A 2VDLL 2NNRA 2QQNL 2BSSA 3MUZ1 5CN1A 2XY2A 3BN3B 3L3OB 4FFZL 5HHPA 1FO0H 1CLZH 2KKQA 3K5SA 4N85A 1JFHA 1YN6A 4OD3H 2AEPH 5FB8B 4TPRH 1IAOB 2BNQA 5C7ZA 4J3VA 1KB5L 3QQ3A 2AJ3B 2BVEA 1HS6A 2W5PA 3RY4A 3CPUA 2KZBA 4JHUA 2IBGA 3RWCA 1P1VA 1KTKE 3OR7A 2NLJB 5GZOD 1U3NA 4A6YL 3O9WA 5A3ID 2B0SL 4R96A 1HAUA 3B9KA 4I87A 4NZDA 4YAQA 3ABLB 4MMXB 2NT0A 1CC3A 4LASL 1MFDL 4LSTL 3SOBL 5E00A 4ENZA 4XZUA 5FKAA 3OHXB 2G9HA 3CXDH 3U25A 5KBKA 1BQLL 5KBNC 3QAZB 4Y5XB 1HNFA 1SZNA 3I9GH 3QPXH 2EYRA 3WJMA 3US1A 1OAZH 2K6YA 5I8OL 4Z77B 4QCIB 4NPJA 3KLAA 1J9SA 1K5NB 2P26A 4OLXL 3ARYA 1ORSB 1V3MA 1YNLH 4E42B 3LVTA 4UT9H 1ADQL 1AR1D 1UVQB 3RUGB 1KJVA 3ZHLA 4LSRL 2AAAA 3S8FB 4H7VA 1QFPA 1Q94A 1NCCL 3E9UA 4HFWA 4FQ2H 4KKZA 2A6DB 43CAA 1LP9E 3NP4A 4Y8AA 1HYSC 1TLKA 3B3BA 1WQVT 3TBTA 1KTDA 3F7QA 2EYSB 3B2MA 3T6XA 1VA9A 1MCIA 4GP5B 4UQ2B 5AUMA 3VXQB 1T7XA 4Y19E 2NXYD 4PI0A 1JF6A 2NY5L 4PJEF 3H2WA 3AVEA 3B9VA 3MLVL 4GRLC 4PJDA 1S8DB 1QP1A 2Q8AL 3ORJA 3PHOB 3Q43A 4HG4J 3S5YA 1JIBA 2VZUA 2R15A 4UQ3B 3ULUL 3GUTA 5KVDL 1FORL 2YRPA 1TJGH 5C8JB 1ZS8B 2FYYB 3EJQA 1BPLB 1V54B 2X28A 3K72B 4N0CD 2DMCA 3D2TA 4OM1H 3D2UD 5DD6B 2Z91A 5JQIB 1S7UB 2X4RA 4X8JA 5E51A 4EN2A 5H94A 7CGTA 3M1BB 1QSFB 2L0DA 1QZ1A 5K9OA 5LUMA 2GQHA 1UXSA 2VMCA 4HK3J 4MCYA 3V4VB 3K6SA 4H1LB 5CEYA 2Y36L 4KKLD 3F8UB 3GSVB 1EERB 4UT6L 1WWCA 4XXWA 4ZXBB 3E0GA 2O5YH 1GIGH 2GSGB 3QPQC 3EKCA 4ILDA 4V1DD 4L29B 2BNRB 6CGTA 2APWA 3VI3E 4AYFB 1LO3H 4U1HA 3HN8A 4L1HA 4GBXD 3TNNA 1B0GA 2IH1B 2F74A 3H9SB 4RSVA 4B97A 2WSKA 1OGAA 4TQ8A 3AAZB 5IK3A 5ADOL 3KH4A 1QRNE 3LS5H 2NNFA 4R8WH 3ZYZA 3WGVB 5A1AA 3GPSA 3FQYA 2G3MA 4RAUB 5IBUB 4HC1L 3TC9A 4LVNC 1WRFA 5C09A 4JE0A 3QJTB 4L1LA 4XBPA 4BZ1A 2WJ7A 4OVVA 3H3PL 5IVXE 2G5BB 1OT2A 4N9GB 5D6CB 2I27N 4HWZB 4I77L 2YEZA 3PS6A 4DVBB 2KDGA 2ZCLL 3WAKA 5KVGE 4P46B 2VXUL 1C12A 3JT0A 2EDNA 2ORBL 4YHLH 2Z1PA 1QASA 1KJMB 4L9DA 3HG1A 1UD4A 5EF3A 1CF1A 2Z6FA 3LPGA 2HG0A 3VFWA 4YK4C 3TLRA 4PJCF 3DTUB 1I8IA 3GSXB 3TV3L 4HJIA 3VD9A 2JIXA 2XA8H 3HUJE 3QEHA 3SO3C 3NFSL 5ICZB 1Q72H 4MZIA 2I5YH 1XGUA 1UB5B 3UPCA 4F37K 4NOBA 2OMVB 3Q1EA 1QZNA 3T3PE 3FCGA 3TVMB 2KPWA 4P9HC 3GS7A 3THML 4QAWA 5FEBA 4DGUA 5I2IB 1QLEL 2HT2C 1BWWA 3MNMA 5C70A 4W9ZA 4J27A 4Y16C 4W6YB 2FO4A 4G6AC 1OV8A 1JK8A 1HXYA 2G4EA 1XR8B 5E5UB 4OKDA 3QP3A 3L3KA 4X6CA 2AC0A 1MCLA 3R06B 5KVMC 3TGXA 2J8UF 4OZFA 5EORH 4OUUA 4ZUWA 4PRHA 2DI8A 1PKQB 5EH1A 5KTEH 1E4WL 1AHWB 2N1TE 4EUPB 3RGHA 4O4YL 3WMQA 3OKMB 1E4JA 5H8DA 2XRAL 4OFYA 3S3BB 2X88A 2B1HH 2NY0D 1XBRA 5HI5C 4HBQA 4XRCB 3IGFA 3S5ZA 1TCRA 3DRQA 3FQTA 4UOZA 3H3KA 5I66B 2IWGA 3C08L 1OAYH 2G3ZA 4WNQA 1BFVH 1YC7A 2MTPA 5IFHL 2AXFB 2GIYA 1A7OL 1O6TA 1PD6A 1WAAF 2K7PA 1IM3D 3FZUC 2ZCKH 3SE3C 1TOXA 5DYFA 1RLWA 2DQCL 3G6JF 1NFDE 3ARBD 2B1OA 2Z4QA 2Y2TA 4RQQA 3LRSA 2YKLL 3QIBD 4X7TA 3H2QA 1U8IB 1Z66A 4U0RB 5IWLA 4CVXA 4NBYB 1DBBH 5LGKA 1BXUA 1FVDA 4WO0A 1RMFH 1T7WA 4P9HH 4DCQB 4QRSB 3QQ9D 4MD5B 3KVPA 3GIZH 5JW4N 4MNQD 4ODXB 2ZF9A 1AGDB 4IRSA 3K81A 2R1XA 2DV6A 3JVFC 1JHKL 3VYOA 4EF3A 1ZT4A 4U1LA 5B7EA 1RUKL 1S9VA 5DRNA 1C16A 4S1RH 3KDPB 2WP3T 1F02I 3J7HA 5C3LD 3VRJA 1D6VL 4WW2B 1QSEA 1JZ5A 3DHUA 3LZPA 4ONFH 3MYJA 1YMMA 3IN2A 1NCTA 2JQAA 3A22A 3EO0B 2VIRA 1RURH 5GGUB 4ADGA 2XQYK 4DK5A 1SF5A 2C1OA 2XQYA 4WEUD 3B2DC 3FFCE 2VDMH 2XQYG 3HB3D 4P3DA 4XC3H 4KNUA 4IRJA 4IIQC 1DFBL 1H3VA 1UH4A 1W8OA 3DRTA 4PJBF 1M6UA 3CWGA 3WFEL 2I24N 2UZIH 1DQJA 2W07B 1F3RB 4NQCB 5LDUA 3MFGB 1G7IB 2LTQC 4GNKB 2JCWA 2F53E 4GRWB 2DMGA 2JV6A 1WITA 3RZWA 1W0VA 4RAVA 3F12B 3WTXA 3ZDXE 4NBXB 4NC0B 3NQKA 2VDKL 3QHZL 2CH8A 1CLOH 3FCTA 2WWKO 3N1GC 1F6LL 4NFBA 3UDWA 3F7YB 4RMWA 4JR9H 1UWXK 4XCCL 4BZ1L 4J7RA 5F0PB 2JKWA 1Y1UA 4FQXC 4XMLH 2YPKB 1A1OA 3N85L 3V0VB 1I82A 4EN3C 3GRWA 2PW2A 4S0HA 4IK6A 4XCEB 1FDLL 4FN0A 3OKKA 3Q0HA 2VLRD 3PQYB 4J3XA 1EUTA 5GPRA 1ORQA 3VI4B 1T80A 2CAKA 2K4AA 4DESA 2ICEC 4DVRL 4JNXA 2QHRL 3HG1E 3E8UH 4BZ2H 1CFSB 1WWWX 1N70A 3X1EA 2EDJA 5C0ND 1MCQA 5GRXG 2OW6A 1KACB 3VFGH 1IC4H 1BEXA 2E9BA 3GKWH 3K6FA 4ENEC 3BT2L 2JMRA 1MDTA 3U4AA 4M7JL 3VGHA 1SJEA 1I7UA 2Q76A 4AEEA 4BK5C 2MQ0A 2VUYA 3CPLB 4RFEB 2PPAA 5EN2A 5ID1B 1W0YT 3H4FA 3MLYH 2VR4A 4JVPA 3SQOL 4DIXA 4M5ZH 5LXGH 2R56L 2C8NA 4JN1H 5L7XL 1EZSA 3TH4T 4KU1A 2LLGA 4N8UA 1RH8A 3NUKA 3E3QE 5C0CB 2JE8A 2YEQA 4U6HA 2BZ7A 2EEAA 5ANMB 5B1AB 3PL6A 2Z92A 4N0FB 1OTTD 2HPOA 2PTVA 4O58L 5ACZA 1OSPL 4PGZA 1ZPUA 2PABA 4PMFA 4PSRA 3LB6C 1H8NA 1KCBA 3R19A 1FC1A 3HG4A 1QBBA 2R1YA 3WY4A 1MHCA 4XB7A 2WMPB 1LO0L 4AYMC 4F1ZA 4Z7NF 1MEXL 3L7EB 4HIXH 1I9RH 2G2RB 1AO7A 2IAND 4Q6IA 1UZ6E 1IMHC 1HH6A 1RK1B 4KOBA 3J27A 4NX0A 4PD4K 3BUYB 3MCYA 4I18A 5IJVA 3D07A 1PSKL 4PLKC 4G80B 4F7MA 1WZ1H 4CMMB 2BSED 1ETZA 3WN5A 2VJ0A 4URTB 1IFHH 5E8NB 4K7PL 3RZCD 1T21B 3QIWA 4M9OA 3FXIC 1FNEA 3RPIA 3QZPA 1M3IA 4LLYA 5JUEL 4L18A 1O5PA 2EIZA 4KQ3H 5HGDA 3LN5B 4JPVH 1PZ2A 5L8KB 3IDUA 3EDDA 1DJYA 3MLPA 1GPOH 1DDHB 3SBPA 4IEFB 1BAFH 2FB4L 4NN7B 4Y1AA 1GKOA 3H9ZA 4D0DA 2VXVH 1IC0A 3QB7C 2W9DH 2PYFA 2Y7QB 1HYSD 5JA8B 1RZPA 1ZLDA 4NQDD 3HZ3A 1JNHA 1EO7A 4DEUA 5KYXB 1F00I 3ISYA 5I0WA 2CR3A 3WIFB 2E56A 3BIBX 3QUZB 4XN5A 3UO1H 5LG6A 2GSMB 1A6WH 4M6NL 1I1YB 1AGFA 1YEJL 3CDYA 3U48A 2ARWA 4ZNEA 1XTMA 4WKXA 4AEHL 2YAMA 5DMYA 1PLAA 1MCOH 4PJ9A 4TVPL 1HSAA 1YMME 3LHPL 4TUKH 1NCJA 3JV6B 5CCGE 2EEDA 1BQ5A 4E5XB 1DVFC 1G6RH 3TF4A 1CGUA 2FX7L 4M1GH 3PWLB 2BCKB 4IBUA 3RDTA 2YA1A 4LLWA 1F56A 4KXZI 3U7YL 1NC2D 5SWZE 3ABGA 3D0VB 1QFWH 5TGBA 4WEBL 4KROD 3M7OA 5D1ZB 2OTUB 4NZTL 4OF5A 1NLBH 3CMGA 3D85A 3IETB 1S5IL 1IBYA 2J43A 3DVIA 1G0YR 1Z9LA 3OKNA 4JY6B 4R2GD 5JNYA 2FL5A 4GEJA 4U31A 2P24B 4Y4FA 5GGQH 5EOQL 3BEWA 1MQ8A 1T2JA 2E46A 3MXVH 3QUMA 3SKNA 5I0YA 2FX8H 2OSXA 4M5TA 3BP6A 1NMBH 2CMRL 2APFA 3L9YA 3HMXH 5LBSA 1U3HA 3FTZA 4FXGC 2W95A 1ZTXE 4HPYH 3UJTH 3VXUE 3KYKH 4L37A 1XH3A 5CFHA 2OFQA 5PAZA 5TDNB 5CZRA 1PU0A 1PNDA 3HRZA 4PJIA 4ZUVA 3FPXA 1MW1A 4XAWH 2VWEE 3Q8EA 4PRIE 2VC2B 3MC0A 2OL3H 4PWGA 2MCG1 3L1GA 3TWCH 3V95A 1N7ML 5HI3D 3NN8A 2F54A 1TXKA 4HVBA 1BG1A 1G0XA 3Q48A 2ENQA 2KT6A 2XX1A 1FRGL 2CBTA 3CGTA 2K9UA 4GUPB 4PP1C 1DE4A 1KNOB 1BQKA 3GXTA 1B0RA 2EIDA 1GZPB 2YLHA 2XVLA 5I6OA 1YY8A 2LW3A 4EDWL 2EC9T 1ML0A 2I9TB 2R2BB 1WZAA 4Z7UA 3VUAA 3HI1B 2ZXQA 4GAGL 5DWUH 5E8OB 5F8RC 1QBAA 4FL4C 5E8PA 1I8KA 1MNUL 5D2LA 3LAFA 3TJHD 3UAFA 4OSUH 2PPDA 1Q0EA 3I75A 2FGZA 1YUKB 1AI1H 1HH9B 3RE0A 3TU6A 2I60H 2N3JA 4F7KA 3SOTA 4F9PC 3CVIH 1TJXA 4QJ3B 5BMFL 3N3EA 4X7SL 1H6FA 4DAGH 1E4HA 4K5NA 4XO8A 2BO0A 2Y6TE 3TIDA 2GC4C 3O4OC 3QI9C 4RLDA 1XGPB 1T5XA 4JRLA 1JWUA 4UV4H 5GS3A 4P23A 3QDGB 3SPVA 2DQMA 4I5BA 2ADJA 1U8MB 5J1TC 3ETBJ 4LESA 1ZLWK 1N64L 1QO3B 3N42F 1CXKA 4PVMA 2JJTC 5DK0B 1CG9A 5B7MA 3TA3A 3HS0A 3QDJD 2XZZA 2YBGA 3BRFA 7TAAA 3AC0A 4PBDA 3MUGA 1CU4H 1MJ8H 4EAEA 3DA0A 4W9JC 3L6FA 4XNYL 5FK9A 1L9RA 5B4MC 1A9BB 2WQUA 2YFNA 1K8DB 3AU1A 4FX5A 1LNUB 2DQGH 2YWYA 3KYOA 4NQSA 4YSOA 3GBNL 5EC1A 2MNJB 2UUDH 4ZS7H 4BINA 2H1LM 5ELIA 4PB0H 1ZT7A 2V5MA 4JM4H 2X89D 3Q1SH 3DOSA 3A3YB 2EYTA 4PJFA 4PV9B 5D5MB 1CVSC 4G8FB 3WD5H 4XP6H 1MCJA 3D6GA 4FHJA 3CCHB 1TQCC 4DO5A 1CGSL 1LTXA 3PWJB 4ANKA 4KH9A 1UA6L 3Q44A 4N90E 4QY8B 3GXDA 1JRHI 2ZXWB 5AYUH 3C5XA 1GC1L 1XSKA 3DJ9A 1KYDA 2D2OA 4OKVB 5FYJD 1BD2B 5K1NA 2DQFB 4NSKA 5FYKD 4QHUA 4YQXH 1P1ZB 3WXVH 1NGQH 1J5CA 3CVHL 3L3IB 5FOBA 3WO4C 1FL5A 4LKCB 2BMKB 1FQ9C 2N59A 2X1XR 2XTJC 4FQQA 3PDOB 4MDJA 5G55A 4WGKA 1E9PA 5IIEA 3ULSB 4HXAH 2A5UA 2F1AA 2P8MB 4D9QD 5KSAC 4OLEA 4P5TA 2EDLA 5TE6L 5AEAA 3OTTA 3UAAA 1M53A 4PBVC 1L6PA 4YXHL 5SX4I 5J13C 2ZKHL 3KAAA 4ORZC 4AUYA 2JLPA 1ZSDA 3LJ3A 3SBWA 5B3JE 3MLZL 2X7LA 4GW4A 4LLQA 5JW4Q 5ABZA 4M3KB 3BH4A 3C8DA 3KVQA 2IPTH 4F3FB 2MWCA 5AENA 1NGZB 1ZD6A 5CMAA 5JHDB 3CDGB 4KTEL 2P5ED 2AQPA 4JAMA 5D70H 3S98A 2BHZA 1FYTA 4M03A 3NCEB 4DZ8A 2R4RH 3F5WA 3OPUA 4CN1A 3OMAB 2IV8A 4PBWD 4B9ZA 4YIQA 1T66D 2YD2A 4JFED 4UANA 1E9QB 5BV7C 2D7TL 2YN3A 4JDZA 2XZAL 3S36H 3HR5B 2VLMD 3X13A 3EGDA 5F1IB 1FE8H 2A99A 3VWKA 3RJQB 4OR1A 4CNIA 2C34A 1ITBB 4CRPA 2Z35A 2WBJB 2Y7OA 2Y5EA 4J4PA 3T09A 4DOHE 2VN5A 1NCNA 2HH0H 4UTBH 1IEBA 2D3JA 5ICXB 3IAPA 2WB1A 3A0OA 2BDNL 1PL3A 4LU5H 5DJZB 2VZ3A 2X1OA 4JQIH 1MIML 2KLRA 1DQKA 3FU7A 5HDWA 3UYRL 3SYPA 2YIHA 2HFFA 4DO4A 3FT3A 2FJHB 2AABH 1Y6KR 2COVD 1D9KB 1MWAH 1P7QD 1W91A 4KUCF 2HP4A 2FNWA 2YARA 4PGBB 5IOPA 1KGCD 4KUZL 3K74B 4A2EA 5IHUL 3O11A 2XU9A 4JPIA 2GBAA 1I53A 4PR5B 2V9QA 4PJ7E 3TH2T 2OXGB 4HIHA 3RFZA 2MHAB 2FIRT 5FUZL 3B9EA 4H25A 1MF2H 1NBCA 4KJYB 4UINL 3U7WH 4TTGA 2Z8WC 1G5GA 3CN4A 1VAHA 4UV7H 4ZMVA 2UWEE 3KBHE 4L5FE 4TRPL 5IGXH 5B21A 4YPGA 4P2AA 4E9YA 1T5WA 4G9DA 1IT9H 1NBZB 3QDMD 4H5SA 4NJAH 1C5DA 3ECBB 3WLWD 1K2DB 4BFGA 2NY1B 4ONGL 2VXQA 4F93B 5LKNA 4JZJA 3AM8C 4YHZH 2H41A 1N8ZB 5D7IF 5BV7H 2PR4H 3V5DB 3QARA 2E9JA 3S36X 3CFJA 2P7TB 3IJYA 3ARDD 2YR3A 3NAAH 3HHSA 3AT0A 2OK0L 1ZHBB 4HKXB 4CADA 1RPQA 4ZFOA 3IJSA 1LXMA 1HESA 3ULVC 3VRLF 2P5WB 2QFRA 4AGQA 3TZVC 1NCWL 1K8IB 1NH6A 3QXUA 5GGSB 3QJXA 2X9ZA 5IV2B 4F7EB 3FFOA 4ODHH 3TCXA 4ZZFA 1BGXH 4QJ5B 2TSBA 2OSLB 3KLDA 5F88B 3FT4A 2R8SH 4KUCD 2VZVA 4M1DL 1U4FA 4DZBB 4FYQA 3LKNB 4P2RA 1AD0B 1CICD 1HVXA 4W4NA 5ALBL 3QUXA 3QHFH 3P3TA 2GITA 4R97B 3ESPA 2CO3A 1OWRM 5C0BB 5I0ZA 4AIZB 2RALA 2VXTL 5HHOD 1Q90A 2AFNA 2O5ZH 3IDYB 1SY6L 4BSVB 3ESUF 1B4JH 2G5RA 3U36A 3D18B 2F58H 5CP3H 3EG9B 1XGRB 3BQUC 3VM5A 4LL9A 2WXLA 1ZHKB 3T2OA 3CSBA 3K2UL 4HAGA 4X5RA 1MAMH 4C4UA 1YEFH 3PV6A 3I9AA 3C5ZA 2JB5H 3ZDWA 4GY4A 1BMGA 2A6KA 3HAEA 4JRYB 3NJVA 2Q0ZX 4IOIA 5KS9B 4WIQA 2UX6A 4PCTA 1MCWW 2IAMA 2CNYA 3HNTL 3KHQA 4JCWA 1OARL 4DKTA 1U8KA 3ULVH 1IAIL 1H3PH 5I74C 2XA3A 5D2NB 5DHVH 1MFBL 1YEDB 4JANA 4NKIL 2FGWL 2BP3A 1ES0A 4R0LA 5INCB 4XO3A 1XV8A 3U2SA 4F7PB 4P5MB 5DSCA 2DLIA 5J12C 2YD8A 5T3XD 2ZOLA 4LLVB 3CN2A 4DETA 1JK9B 3NCXA 4XI5D 4Y4KC 3DX9A 2JKSA 5CJXA 4XH2A 3TASA 2ICCA 3ZTNH 1R3LB 4AGOA 4NP4H 4OLZL 1I1AA 5KBLA 4ECNA 1ZMYA 3T0BA 2X0UA 4G6FB 1DN0A 5D7KD 4BCZA 4Z0BH 3B2UD 3POCA 3HKZA 2V5RA 4D0CB 5J3HC 1G7QA 3PUCA 1ZVHA 3UGXA 4IKKA 4NQTA 1AXTL 3MLSH 2CK0L 5F1KC 4NGHL 3AS2A 1BM3H 5FGSA 1QHQA 2UZXB 5D7LE 4ZTOH 5I8KL 2VDRB 3SQBA 4XN8A 5IEKA 3KCPB 2CJUH 3MUUA 1X6LA 2J88H 3GS0A 3HZMA 1TZHB 1UEYA 4P5RA 1R9FA 5L2KA 3X11A 3VQ1C 2D3LA 3V0FA 4OF6A 4OIFA 4LIQE 5E7FA 1RD6A 2IQ9H 2EC9U 2BNRD 1NFAA 4L3AA 4I0PC 2IDSA 4PJAB 1TTRA 3VFTB 1LK3H 3S2CA 3S5LG 1WFUA 2OLDA 3EJYC 5IFAL 5JR1H 5D71L 3KBPA 1R75A 2F7IA 1DUZA 4QHMA 3K6IA 3MBEB 4BUQA 4Y5VC 3ET9F 4GKNA 4DKDC 4G1MB 1LM8V 3FH5A 1LJMA 4U1IB 4U3CA 1G7PA 2CLVA 3OKEB 3AWGA 5DT1H 3UTPD 3DUUA 5ID0A 5IG7A 5DC4B 4YN3A 4YDKL 3S3SA 2XWXA 3GMMB 3PDDA 4WJG3 1DQML 4DJMA 5IMKB 3IMUA 4H2CA 1U95A 4GI6A 1NMCC 4XMWA 4EQ2A 1BAGA 4BH8B 2OXHB 1A4JB 1A14L 2EADA 3ARGC 3VB8A 1CXIA 3NFPB 1CT8A 2R29H 1DEEA 1G43A 1Q0XH 3FO9B 3HEIB 4AH2B 4LPUA 2MRYA 2VXQL 4P46D 4LPTA 5H37A 2Z0BA 1XIWA 3LKPB 2ZZUT 5H37G 4P4KB 1BOGB 3C9NA 3KMDA 2UXTA 3MCKB 3BVDB 3FB7B 2JH2A 3JUZA 4WNSA 3PIQB 1FZMA 1II4E 3DETD 2YPLE 5DXWA 4BELD 4ZFOL 5E6RB 2VDOH 1RJLA 4POZD 3JT2A 2K8MA 3TJEH 3VGBA 2EUVA 5GXBB 3WUWA 4GQQA 3DBSA 3P77A 1FZJA 2FD6L 3APCA 4MWFA 4AX3A 3GMPA 4IHOB 4NHCH 2CO1A 2DAVA 4GAFB 5DI8B 3TO2A 2E9IA 3TVMD 1MHHB 3NIGE 3WXWL 3QR0A 3T1FA 2FWSA 1HN1A 4G7YH 3GYRA 1QTSA 3FSVA 2X6AA 4G7QB 4JFDB 1E5ZA 4J6RH 3P3YA 4NCDA 4MKTA 5D7JB 4ICWA 1SLXA 1MLBB 4LLUB 1XGZA 1T0MB 4AVKA 3FO1A 1F41A 1KB3A 5I1JH 4HZLB 1GOHA 4FNSA 2ZKMX 3LZFL 3OAZH 1T83A 2M2DA 2OMYB 4RZCA 5BJTB 2GEQA 1M7IB 1Y18B 2NTSP 5IKCA 4X50A 2H9GA 3GRBA 4WW2F 2ZAIA 4P5KB 4UYQA 2CSPA 4YHYC 3UTSB 4LCWE 3NSYA 4YO0A 1QQDA 2XBZA 2RQ8A 3UACA 2VO5A 2AEQL 4YLBA 1BZQK 1VZIA 3PHAA 3UROR 3OQ3B 2C7UB 4JKMA 2G2NA 3QC5X 2WLYA 2RHEA 5SWSA 3MNZB 3STLB 1S9KC 5AB9A 1C7TA 3BZFB 5IW6B 3WKPA 3IYLW 1TEFA 3CZSA 4QNPF 1DSFL 1WT5C 3GPEA 2B2XH 1AZCA 5JHLA 1GCFA 3VXRA 1AFVL 2H3XC 1SDDA 1TVDA 4YHKL 2VQ1B 2PW1A 2H32H 4G8GA 3TBSB 1JUFA 1GYVA 3REVA 4H40A 1GGBL 3MRQA 5LAXA 5I1GH 3PHQB 4TQIA 2WAHA 1LO2H 2NUPB 3LKSA 3BH8B 4Y5YC 3TYFB 4UB0L 4KJQD 4F7CA 4HULB 3IU3A 5C0DB 1G7JB 4U7KA 4IKIA 3FRUB 3VI4F 1CDIA 2X4UA 4HPHA 3LNEA 4UF7C 4YX2L 4Z95L 5F7UA 5KSBF 1OTUD 3DLQR 3RGVD 4PWHA 4PS4H 4LKXA 4K5PA 4O9HL 1CQYA 4P0DA 5KYYA 2BP8A 2I26N 2QKIB 2WBXA 2DWDA 4KDWA 2E7DA 2ZTBA 2UXFA 3MLUL 4UTCA 3RWJA 4JJHA 4ZD3L 2R0ZH 2PETA 3EYOA 1KIQB 3MFFB 1S7RB 5FYLL 3QFGA 4GKZB 1KEGH 4MA7H 3H9HB 1KIRA 2YGNA 1SFDA 5EOCH 5IHZB 3BPCB 3NABH 5A7EA 3C12A 3ALPA 3K2MC 3NEOA 2HSIA 4HUXB 4F33B 5LCVA 1BFOB 3O3DA 4Z78B 1U8JA 2WNKA 1S4IA 2Y1ZA 1DJWA 3F05A 1UM5H 5EC2B 3RWGB 3WLBB 1AHKA 1M6OB 3LNIA 3PAVA 5KSVA 3IJEA 4N1HB 2WO3B 4XWOC 4X80H 2FR4A 2JNZA 3VXOA 3T0WA 4AVJA 2W9EH 1RCYA 2HX8A 3VXTB 4M5YH 5BNXD 3A6CH 2DM7A 4JFPB 2KQNA 1HOCA 4BKLA 4M43H 2WQSA 3PQYD 3W39A 2OBGA 1Z7JA 4BH7A 3EH1A 5GS1C 3Q7JA 3O45A 3AJ7A 4OF3A 1YPZB 3NCMA 4QHNB 5FW6A 5G4OA 4CVZA 4X6BB 2O4EA 4XP4L 1HNYA 2P8PA 4YZFF 3VFRB 1KN4L 4ADIA 1RIVL 3OV6A 5DJ8A 1JZ7A 5KYUA 3FHEA 1KTLB 4R3SA 2YUWA 3LX9A 5D72H 3C75A 5FOJA 1M2VB 4U1GB 1X5IA 4QHLB 2NX5D 4OD1L 2K4WA 5EZJB 1LQSR 4FG0A 2FT7A 2X4OA 1N6QH 2V5YA 4B9GA 5J89A 5HI5D 1JI2A 4NN6C 4PV8A 4Q58C 1KLFB 1SMDA 3D05A 5IMLB 3S4SA 2KZ1B 1N4XH 2A77L 4NQXB 1SF3A 5K1JA 3RTQB 3T4YB 1F3DJ 1MZZA 1NLDH 3D2UA 1JF5A 4LVHB 3BWUC 3ZKND 3FZUD 4EXPX 2QR0A 1E50A 5C08E 5FO2A 2WIIA 2F18A 4HIQA 1CFMA 5DQDH 1HYRC 3KPNB 4QWWC 4IOSD 5F0MB 1UB6B 5JW4M 4I2XA 5CS7A 5C7XH 4P2OA 2VMJA 3W0WB 4JG0H 2OMBA 4LEEA 1NCGA 3N2JA 3AT9A 5HYSB 4MQ7B 1MPAH 1W0WA 2H47C 2VZOA 4WWID 3QNZB 1ED3A 2J2ZA 1DDTA 4N0RA 4GBXA 3T04D 3APFA 3JZ7A 4TLSA 4M7KL 4L4TB 1HZKA 4PJHF 4TULH 3F2LA 2JI1A 5L4FA 4KTGA 3ABKB 3QEQE 3CHPA 1EVTC 5AW4B 4N2OA 4JJ5B 4NO0D 4XPHL 2H0JA 1BOYA 4KXZH 1D5MA 4F2MB 2WLLB 1JBJA 2JTDA 1NANH 2OMTB 3NT0A 3IDGB 3OVUB 4U1KB 1F0LA 3GFUA 4E9TA 5F9OH 4GG6B 3MGAA 5I26A 3ES6A 3UBFA 5JXED 1GS7A 2Y69B 1VZGA 3QA3B 2R2EA 4S1SH 2EE6A 2N0KA 5TQ2L 4ZW5A 3ILQC 4N0UB 1R5WA 1IBGH 3MJ7A 5I9QC 2F5AH 3FN0L 4LLDA 1X4XA 2ZUUA 3C8HA 5EEZA 4ZW3A 2IMMA 3I50H 4QF1B 2XN2A 3DI3B 4ZPVB 4NBZB 5ALCH 3CSPA 4DUXA 4NAJA 5A2FA 4KK8D 3QUZD 2AQRA 4PLOB 1WA1X 3Q8FA 2EIBA 2QADB 5HPOA 1NGXB 4N6RA 4HBCL 2L7UA 2UZPA 1JG9A 4JFFB 1U58A 1CYWA 2JJSC 4QRBA 1WCBB 2GTWA 5GGSY 2R9HD 4FQ1H 1OF2B 3UOAB 3LEXA 3MPCA 3T4AA 2JJVA 1H5BC 4XCYA 4QRUA 4WI4A 4S1QH 4A6YB 3B7RL 2PCFA 4A63A 1M7XA 1W16A 1P4LB 4S1DD 1KT2B 1NGPL 5BRQA 5JQ6H 3QG7L 4GO8A 3PWPB 1RULH 4P4RA 2BIOA 1Q8MA 4C56E 3VD7A 5AW2B 3OX8B 4UI2A 1JTPA 2AV7B 2Q6WA 1MRDH 2ZJSH 5IQ7H 4JKLA 1F90L 4MS6A 2EDWA 3P9LB 5LCVL 2BFVH 1BQUA 2X10A 5CIPA 2W88A 1BEYH 4XVTH 5DZVA 1NCBL 1X5YA 1IKNC 2IQAA 3ARVA 3HS9A 2OMUA 4X4XB 3U0TB 4AV5A 1QFUH 1HL5A 1KELH 3CH8A 4TSBL 4AGLA 1TSRA 15C8H 1PLGH 2MPAH 5J6HA 1KCKA 2OM5A 1ZJAA 1PY0A 3FB6A 4HS3B 1JWMB 1IIKA 4IJ3B 5F70A 2A9ML 3AXLA 1EUUA 1YEEL 3ME0B 3CFBB 4Y9EA 1VZHA 2C9VA 1DP0A 3ARFC 3V4PB 4N2FA 1D5ZB 1WIOA 3MCLL 3UXFA 3FONA 2DJ4A 3DROA 4PJCA 4RDBA 4YGVB 5KW9L 1IM3A 4BYHA 4NHUB 2EE2A 4RGNB 3I9PA 3V4VH 4KVNL 1RK7A 3ARBA 1RU9L 2V2TB 5AOMA 3T3MB 1OW0A 3LB6D 1KGXA 1SXCA 1S9YB 1OT1A 2YD6A 3QIBA 4K23H 4RAHA 4X5XB 2X6BA 5DU7A 5DVMA 1RSYA 4OZGE 3HI6H 3I6GA 2OJEB 4OAWB 3COOA 1JS4A 2NSQA 3DV4B 2M8XA 2EVHA 1YQVL 5D4JA 1EZVX 2F68X 3CFDA 3FYIB 3C2AL 3SKJL 3P2TA 4XN2A 4L3CA 3NPSB 3P0YL 4MNQA 1TU2A 3GKZA 4AG4L 3QSKB 5A2KH 5LB1A 1INQB 1NKGA 3DUSA 5CGBA 5FFGA 1AOZA 5F6IB 4ABVA 4S2SA 1GGYA 2J8UA 3G5VB 3KPLB 3VI3B 1FP5A 2XJLA 1GXEA 5KG9B 1RFDL 2A74B 4XP5H 5JHAA 1IKFL 5E0QA 2DQIH 1VFBA 2A2QT 2E86A 3O41A 2VL5A 5SX5H 1I75A 1AHWC 1IC5H 3P9MA 1QRNB 4LCUA 4DPBX 1SOKA 1X5KA 2KPNA 3BPNB 3MV01 1BWMA 4XP9L 1GMEA 2AJXH 2PTTB 2TRHA 4D8PB 3WFBL 1A6AA 1RK0A 3QDGD 1WHOA 3W9DA 1WUNT 4IBTA 3CZGA 1CD8A 1C1EL 1WAAA 3JYBA 4M7ZC 1BREA 2CG9X 3QJFB 3ZY7A 4D0BA 5KVDE 4K0OA 5KANG 4PG2A 2CIKB 4X6EB 3G6JA 2CA4A 1VESA 3PWNB 1XL6A 2IDUA 4MB1A 3FQ1A 3GSNL 2CHWA 2Z9TA 3MGTA 4D7BA 5IB1B 3TM6A 1WZKA 1Q9LA 3BEVB 5DQ9B 3HPLB 4PW9A 1NBYA 1SHXA 2F5BH 5LVEA 4V2CB 1MFEL 4PJEE 3CJJA 3P1VA 3UZVB 3NFNB 3Q3GA 1HHHB 3H8NA 5HXMA 1B4RA 3HI5L 1XGYH 3GMQA 4HHWA 5C0RH 5T1DH 3B9AA 4DQOH 4JZOA 2ITCB 1LYQA 4FQIL 3E6HA 2GUOA 1DQQA 2J12B 5CKAA 4F58H 3I02B 2BSSB 2NY7H 3LKRB 4K3DH 4N2NA 2DJUA 4RIRA 1KYOK 2VLRA 3B5GA 4FZEL 3WKML 1AANA 3QORA 3ZDYF 1YN6B 3LN4A 1OSYA 4WO4C 3PF2A 1SYSB 2BNQB 4JPKL 2IADA 4DN3H 25C8H 5JOPE 5LQBL 3EYSL 5FGRA 2X05A 1KEML 3RWCB 4PBXA 3MREA 1O7DC 1S7TA 3OR7B 1DQDH 2B5IC 1LEKA 4BCXA 4TMPA 2VE6A 3O9WB 4XMVA 4LCCB 3QJQB 4R96B 4XPAL 4WWOA 3IFNH 3O2WH 3B9KB 4A2LA 2ODHA 4YAQB 3WJLA 4HSAC 4PJBA 3RQ3A 2VDNB 4K71B 2NDGA 5E00B 4XZUB 2G9HB 4G9FE 3EH4B 5AW9B 3TBWA 1I3RA 4A2FA 2HJLA 5E99L 3KGTA 2OP4L 1L7TH 3MBXL 2IAAC 3WJMB 1HQRB 1BFTA 5T1KD 1CGTA 5I1KL 3UH8A 4NZRH 3NRQA 3IGAA 3O8XC 4JG1L 4DKEL 1CFVL 1Z5LB 1B88A 2R0WH 4KC3B 1K3ZA 3TPUA 3E3QC 1RUAH 1J9RA 3RWEA 4HFWB 5GJSH 1H3XA 43CAB 3D30A 5IJKC 3BLPX 4H20L 3WTVA 4M7LL 1NFDB 1I7RA 1P9MA 4ODUB 3ZLQC 3TNMB 4AGPA 4AKQA 2BP0B 4ZS6D 5KVEL 4MMYA 3VAEA 3NYKA 5AUMB 4QXWA 1VIWA 2JB6A 5G4NA 5ABDE 1PZ5A 2BSEA 5B8CC 4K2UH 5JHDD 2N4IA 3RY6C 2QFPA 1KJ2H 4MCZA 2DEYX 5TF1L 3ATDA 3EZJB 4XVJL 3RZCA 2E4TA 3SGEI 2JTYA 3AQZA 3TEXA 2EE3A 4PY7B 1KPRA 5ILTH 3GUTB 3X3GL 3MNWA 1KXQA 3IKCB 1ZGLP 4YDVA 2R7EA 5ESVB 2IOOA 2ARJA 2Z91B 4X8JB 4XN7A 1BVNT 5H94B 1BIIA 5K9OB 4K15A 2Q3XA 5I1LA 1IGCL 2WBJD 2XSKA 3QI9D 4NRYA 1UXSB 1LD9A 2ZX5A 3G08B 3IDJA 2Y3AA 4MCYB 4YBLB 3K6SB 3FQNA 5CEYB 5E23A 1HZLA 3OJDA 4NQDA 3UPAA 3WNKA 5BUPA 5AB2A 4GI9A 4NIYE 2XPYA 2CXGA 2DBLL 2YK1H 1JGUL 3DMMC 2GUYA 2WQ8A 1B6DA 3F7VA 3SYCA 4U1HB 4F15C 4R7NB 1EK3A 1OALA 3LQAC 2XUWA 5IW1A 1B0GB 4G6KH 2RGSA 2F74B 3B3IA 5GJTL 3IVKA 1OGAB 1P4IH 5IK3B 1UENA 1PX4A 1TJHH 4UAOC 5I1EL 3EO9L 4OCWL 1PLCA 3ZL4L 1AG6A 5JXAL 1IUZA 2OTPA 3ZDXB 2WANA 2D0HA 2VDKB 5E2WL 5A2LH 1CDHA 4H8QA 1L0PA 4DTGH 1NC2A 4YEEA 4K5LA 4WHTA 4XBPB 5ECGA 5C0AE 5FO8A 1YEKH 4OU3A 5CU9A 1O7VA 2WXIA 4UQEA 2AGJH 1ZT1A 2YEZB 4YLQT 2NY1D 4P5SA 3DGDA 3KEDA 1MCNA 2K70A 3LY6A 4U33A 4AQEA 2IF7A 2CO4A 4N2AA 4LSPH 1E2VA 4MCNA 2LABA 2XG4B 3UZEC 4M9PA 3HG1B 3VFWB 3TFKD 3NACH 5I1CH 5I5MA 4BUGA 3GI9L 4MJJA 4BXVA 2P5WD 1I8IB 3RKPA 5MHSE 1OK0A 3NRPA 3UBHA 2JIXB 4LPXA 3QEHB 5F44A 2WWKT 3HOGA 1JZ2A 4UIKH 1JFQL 4J3WA 1XGUB 3WG7B 4I3RH 1EQWA 4F1SA 1OWWA 4JHVA 2XNAA 2VITA 1E8ZA 4OJYA 3AABA 2VL4A 3LQAH 1G7LA 2V6HA 4Y4HB 4ZMNA 4RWHA 4LRIC 5AW1B 1SLVA 1P2CB 1JK8B 5C0BD 1Q38A 4FC3E 3L3KB 1EEYA 3INUH 1GGUA 3FCBA 4X6CB 1I8MA 1OE2A 2O1AA 1DBKH 5D7HA 1QFOA 2GABA 4TOYH 5JYMA 4PJBE 4HKJA 1XD1A 2J25A 4OZFB 3SY0A 3V0IA 4OUUB 2AJSL 2G60L 4ZUWB 4ZNCD 3O3BA 4B3VA 4PRHB 4BFFA 2ICWA 5IB5A 1LDPL 4HWBA 4WGWB 4A37A 2IBZY 4V2BA 2GBUA 3S34H 1I1CA 3MGOA 2NY6B 3WFCL 1XF4A 4Y7OC 5IF0B 4PG9A 3IU4L 1TCRB 3DRQB 3FQTB 3IE4A 4JGMA 3SIKA 2YSSA 1S5HA 4WNQB 5E6IC 3LSOA 4UOW0 3SDDA 1VADA 4MLSA 4A1RA 1JGLH 5JIMA 2H1PL 1A7QL 3GHBH 3QQXA 1WA0X 4G8IB 2Z4QB 1T1ZA 2Q2LA 3LRSB 2WM0A 2CKBA 1EJFA 2Q3AA 3ZSTA 4X7TB 3ULVF 4XP1H 4UDTB 4CVXB 4XPGL 3MLWL 1ZTXH 1FVDB 5HYJD 1MCEA 2V2WA 5CJOL 3TWYA 3EH2A 1Q1PA 5C0EA 1P5VA 2DQUL 1MUJA 2ESVE 1F58L 2XN9E 2KERA 5GGVL 3RL1B 3QDJA 2J44A 4IRSB 4R84A 3WNOA 1KG0A 1KPUA 4IGBC 1HL4A 1S78C 2R1XB 1TZGH 3BUBA 2H0FA 4K3JL 1ZT4B 4U1LB 5DRNB 1C16B 1CUOA 4NB7A 1KCRL 4UYPA 3ZK0A 4PJ9C 2UY7B 1FLRH 2GT9A 4K7FA 4AENA 2NYZA 4OQTA 3VRJB 1UASA 1QSEB 2IJ0C 5JZ7D 4OTXL 3PUUA 3MYJB 4LSQL 1YMMB 3NSCA 4IDJL 4X6FA 5CINH 1QFHA 2VIRB 3F6IA 4OCSH 1UWGL 1XZ0B 2FJFB 1P0SE 3PWUA 4HZ1A 2C1OB 2IPUK 2X89A 4WCYL 1PMYA 2KLTA 2J72A 1BG9A 1F97A 2VQUA 4KRLB 4Y2DB 4P3DB 2IPUG 4FQPA 2NRDA 4IRJB 4AC2A 4KZEH 1ROWA 2W92A 5EZIH 1I7ZA 2FHCA 3BESR 3DRTB 4AV4A 1HU8A 4JPSA 4Z7NE 4N68A 1BMWA 4GMSL 1B2YA 3DX2A 2D73A 2FDBP 3MBED 1J0IA 3ZRSA 1GAFL 5D7SH 3MV9E 3MCG1 1TVBA 4IK7A 1AQ8A 1FVCA 1W0VB 4RAVB 3F83A 3V6ZA 3BP7A 3K80A 4KZDH 1CR9H 3KDMA 4LHQB 3T08A 3FCTB 4HCRH 1I85A 1CIUA 2IPKA 2ZWLT 5KVFE 4GXFA 3OKYA 4Z7VE 2OYMA 2VC2H 4M02A 1A1OB 2IDTA 2DPKA 5DF0A 1INEH 2ZOUA 1CXHA 1EHKB 2OMZB 3CH1A 2AQNA 3EYVA 4FYSA 4YDIH 3OKKB 3QZNA 5KEZA 1ORQB 2ENYA 4S10A 4CAGA 4X98B 5CJQL 2PKDA 4XOBA 1RIUL 2B4CH 1R0AL 5DFVC 1YA5A 2VXSH 2FHFA 2BIQA 3NJIA 3HMWH 2OX5A 3V6FA 3FT2B 4HA1A 7FABH 1ZA6A 3OJ2C 3L3DA 1XCXA 1QAWA 1PAMA 2H2SD 3BQUD 3EOTL 2WY3B 1SJEB 1UJ3C 3FQUA 4Z7QE 2Q76B 1B2WL 2W81C 4FD0A 5KZCB 5CHNA 3AY4A 1JDCA 4GQZA 3QNXA 5FGBA 2HRLA 1QI4A 2WXPA 3IDMA 4JFEA 4WKZA 1R5IB 1TQBC 5B39G 1X9LA 5DEFB 4U6HB 2BVPA 4JFDD 3MRKA 2Z92B 5I82A 5D7JD 4GSDL 3L45A 2J71A 1RZIA 4HUUB 4H88H 1D7CA 5E4EC 4B27A 5JIKA 2RMNA 3DV6B 1BHGA 4PRPA 1N26A 3F7RA 4M29A 2CRYA 2ZX9A 3OAUL 1MHCB 4GSXA 1DANU 2VCOA 4EBQH 2HFGL 5C2BL 5EDSA 2UXVA 3II1A 5E2TL 1AO7B 2BHYA 4I4WA 4Q6IB 3NK4A 3HW7A 4EZKA 1LWRA 3TBVA 1PIGA 1ZLSH 3U1QA 3VRIA 2OZNA 4ANWA 4GUQA 3MV8E 4I18B 4P2YA 3IBOA 4X9FA 4ICXA 2IWKA 4X7FC 3C60C 4KMLB 4PTUA 2C1PB 2KBGA 4Q9CA 4DPCX 4AV0A 2H3NA 1P7QA 2P8LA 1ETZB 4F7MB 1MFUA 1X5GA 3ZKMC 3WY1A 3MNDA 3R1GL 5F7BA 5HJDA 1OPGL 3CD4A 4N2LA 2R59A 4ZPTA 2GJ6E 3CE1A 3QIWB 5E8DH 1NZRA 1CE1H 5DO8A 4PJXE 2NTFB 4W9GC 3KW8A 1TNNA 3DTDA 4OGYH 5T8IA 1FNEB 3RPIB 4DKFL 5HVHC 4LLYB 1CFQA 3MUY1 2CKBL 3FHAA 4OBSA 5HGDB 2YMTA 2WLKA 3HZKA 3D39D 3W82A 2VR3A 2WOYA 3A21A 3TT1H 2IMNA 3NZHL 4Y1AB 4PU2A 2A1WL 2VRKA 1X5XA 4NPYB 4OZ4A 3QDMA 4YE4H 5FKPA 2PYFB 7PAZA 3B34A 4WENB 1JNHB 1FFOA 2OJZL 3FUMA 3KXFE 5HGAA 1OP5K 3EJYD 4PJGE 4R83A 5CCKL 2D9CA 3T8MA 5FUCE 4X2UA 5D96C 1SXZA 3MUHL 4AEFA 1AGFB 3LDBB 4N5ED 4NQEE 3UIZA 3TEWA 4LOEA 4HGWA 4OQTL 5CZXD 4A7QA 3HE6D 3T2NH 4BQBA 4PW4A 3DSNB 3EYFB 1A4CA 2AVGA 4QRPE 2HA1A 3TBCA 3GXFA 4KK5D 4AK2A 2CDGB 1OTSC 1PJ9A 3HBGA 4ODWA 3RDTB 3FH8A 4FFVD 5TK2A 3TONA 3MXWH 3B5HA 3L1FA 4LLWB 4PGCB 1CICA 2EH8H 3L3HA 4IOFD 3ZTCC 5I0XA 3KCWA 1F13A 1JPST 2AS5M 5BXFB 5TGBB 5HHOA 1UJTA 2NLJA 4M3JA 2Y06L 3D85B 4NZUL 5AW6B 5FYJL 1UOLA 2FO1A 4M8QA 2R83A 2Y07H 3OKNB 5FYKL 2FL5B 4MMXA 3LXBA 4HHAB 1A6VH 4YDNA 3QJRB 4Y4FB 4HJEA 4YXKH 3BEWB 2L7EA 4Y5XA 3V8OA 4JPWL 3QUMB 4Z3FA 3SKNB 1MW2A 3ZOAA 5D7IA 5GSRA 1U3HB 5GISH 1XEUA 2W9LA 4DGVH 4L05A 1PG7L 4L37B 1XH3B 5CILL 2QGCA 3TXAA 2O5XL 3RLSA 3MRJB 4PJIB 4ZUVB 2A6DA 4ZW6A 3M1CA 4M1CC 1J12A 3U4BL 3SE4C 4QTHA 1EJOL 4CVWA 1JPTL 2W59A 2K8QA 2VUKA 2EYSA 4BSWA 2F54B 3EFDH 4XHJC 1FZOB 4UQ2A 1CI5A 3BX7C 4TQEL 3F6LA 5HHXH 3HC3H 2IVFC 2PXYA 2I7SA 4HJ1A 4OIIH 1S8DA 1CFNB 2X38A 1NCOA 4DOHB 4HAKA 1MFNA 3OC8A 4Y0GA 3QZBA 4UQ3A 1FO0A 3BUTA 3HG0A 1AQKH 5DMGD 3VFSB 4JO1L 3LQMA 4NRXA 4Z7UB 1A7BA 5C8JA 2DQDL 3AS0A 3K72A 3UAJC 1AC6A 3P54A 5D2LB 1S7UA 4E41D 2E76C 3I75B 4EI6A 1JGVH 4LCYB 1O0VA 1FLTX 2HJKA 4EI5B 2WN3A 4ODTH 2ZCHL 4PRPE 3QZWA 4UMGA 1WBZB 4PY8J 3KEHA 4PY8I 4H1LA 4TL5A 4H1LG 4BXSV 4XO4A 3TIDB 4ES9A 2C9PA 3W0WD 1JWUB 4QYOB 3GSOB 2IGFH 2BNRA 2W38A 2WZ0A 4P23B 3LKQA 4NENB 3SPVB 2HTLC 5EOTA 1U8NA 4F5CE 4X4ME 3QIUC 1DJZA 5I8CB 4MJID 4GPVA 4FNUA 3PPSA 1PZUB 5AVRB 3T6WA 2IXQA 1GMIA 2VDPB 2ZYSA 3BGFB 4RNRA 2X42A 3TA3B 4NWUL 1N18A 5HDBB 1XSIA 5TPWH 4CMHC 1L0YA 5LWYH 4OGQC 4RAUA 1KYOJ 3CHRA 5IBUG 2E4FA 4WFEE 2D4DA 4POUB 3L6FB 5FK9B 2BHUA 1B90A 1KLGB 3GSQA 1LP9F 3BGAA 3KYOB 4DVBA 5D6CA 4NQSB 2WLMA 1EWHA 2OZ4H 4BM7A 1KB9K 4P46A 1MCFA 3QC6X 3PFQA 4FA6A 4R26L 3DX8A 1BF5A 3QR2A 3DOSB 4YOKA 2EYTB 3OLIA 5T3ZE 4Z7WF 2QADD 3QCUL 1HHIB 2TRYA 3L13A 4WWKC 5HGBA 3V4UH 4PJ5E 4NQQA 1IZKA 1SJXA 1TR7A 1QWNA 2DICA 4JFFD 2HLFD 1MCRA 1CTMA 3BWUF 3N41B 3V8CA 3UJJH 3AS3A 4LSVH 4DEWA 3UERA 1YY9C 4NIKB 3SE9H 3VCLB 4OVUA 4U3SA 3RVUC 1A5FH 4NSKB 4AEIH 2K0RA 4QHUB 3VGGA 2QQKL 3L54A 1IB5A 4GJTB 1A6UL 4OCMC 1FL5B 3C8KA 3GTVA 4FQQB 2XPGA 2P1YA 2IEPA 3FU6A 4MDJB 5ERWA 5LLIC 4DH2A 1E9PB 5IIEB 4N2GA 3R06A 3SPJA 1J0HA 3EHBB 2DN7A 2FLBT 1MW0A 2G5UA 1DBMH 4P5TB 1RIHL 2XACC 3VI3F 4KQ0A 2OA9A 4HIPA 2VH5L 1ZKAA 1E5UI 3DYPA 4UQAA 1KWKA 1M1XB 4LCIL 3G5WA 4Y88A 3VWJD 2ZWNA 1ZSDB 1ZLVK 4JREB 3MOBL 1KDJA 4ZO9A 1DQLH 1O9WA 4EUPG 1JOIA 2X7LB 4LLQB 1TT6A 3FB8A 3Q6GH 5AVSB 4Y19D 2DW5A 2FEJA 3KPRA 2XLLA 3IDXH 4WUUE 1VF5C 5CMAB 3DNKA 4F8NA 5CF3A 4M61B 4JAMB 5EUOE 4K7PY 2CGZA 3X1GA 3VRLE 2AXFA 2C4XA 4DZ8B 2YD7A 3FQ4A 3F5WB 1IV8A 3F84A 4QRAA 1Q9OA 1UACL 2E6QA 4YIQB 1UC6A 5IVXF 2ERJC 2F8OA 4J3TA 1BPVA 2Z7WA 3TIEA 2ZX8A 3OXRA 2ZP0T 1ERNA 2ZYRA 1QW8A 2R0LH 4JDZB 3CX5J 3X13B 3EGDB 4R4FL 1UM4L 1U8IA 2XKUA 1QYGL 1EEZA 5I6XB 2DMHA 5D7LB 1LHZA 4CNIB 5T1LB 4YHIA 2Z35B 4OLWH 3EYUH 3ETBF 4HH9B 4AY0A 4MD5A 5I15L 1CF8H 4ODXA 3DJZA 3M17B 4TSAL 2MOGA 3HUJF 1J8HA 3FU7B 1GH7A 3RP1A 3O0RL 4XX1G 5HSFA 5D1XE 3AREC 3SZ6A 3FT3B 3FCUB 5F2FA 1E8WA 4Z76A 3ZYOA 3RGVA 2LHAA 4WW2A 3T3PF 2ZUWA 4QTIH 5C6PB 5I28A 3OPZL 2B1AL 5FFOA 4JPIB 4CBPA 1QRND 5F0LB 1KN2H 2EXYC 2NQCA 35C8H 4HIHB 1ZEAL 2Z8RA 4JFSA 5F1NA 2FBRA 4H25B 4HKBA 3ILQD 1F3JA 1I1RA 3PGFL 3LTVA 4LSSL 4LQFH 4FABL 4R5XA 3P0VH 1U6AH 2W07A 1S9WB 3GMRA 3DSFH 3K91A 2OMWA 1WUZA 4YPGB 1YSOA 4AVIA 1HAWA 1PX3A 5DUMH 1AG0A 4H5SB 1C5DB 3QWOA 4KMQA 1J1OH 2QTEA 5IVOA 1TETH 4JZJB 1S3RA 2VRQA 3F12A 3CFJB 3RVWD 1M7UA 2EDQA 4BCYA 3DO4A 2QGBA 3HHSB 5IHBA 4OH2A 1PCXA 3IBEA 2BRRH 4CADB 4QEGA 3F7YA 2D03H 3IJSB 4KHTH 3BHBA 3K8MA 1B0IA 4JFZH 3K46A 4B7LA 3E2HB 2EQDA 3GK8L 4EKJA 3GXMA 5DMJB 5DQJB 3OF6D 2CUHA 4AIXA 4XCEA 3B2VL 1ETJA 2EUZA 4TYUA 1MCPL 3PQYA 4KGJA 3VI4A 1HWWA 5KSBA 3VXPB 3FT4B 3AACA 1OSZB 2EIEA 1EMTL 4P2RB 4ODBD 2FBOJ 2B39A 2NXZC 1CLVA 3QUXB 4MLIA 2GITB 4P2CG 5TK4A 2YOCA 4RA0C 1GKEA 2FJSA 3DJTA 3MI6A 3E1F1 4L8CB 3D3VA 3CIQA 4IBLT 1CZ8L 5DGQA 3SGEH 4FG6D 5CUSH 2NX5A 3FCSB 3B9KD 3DYOA 3CPLA 3DPBA 3PXJA 2F8XC 3UEZA 4M48H 2D7QA 3U36B 1D5BA 1E40A 3DHPA 1DZBA 1T7ZA 3HC2A 3BE1L 5D8JH 4TKWA 2YPVA 4LCWB 1SHMA 1U8CA 2K3TA 2FLMA 4GOSA 4GUCA 4DP1X 1BQRA 2VJ8A 5TH2A 4LOUD 5C6WH 3GB7A 3PV6B 3HLAA 4MVBC 4W81A 2C9UA 4BK8A 5A6LA 2A6KB 3FMGH 3HAEB 4IS6B 1GZQA 5IQMA 3JWDC 4IOIB 1NKRA 2XJKA 4KKBC 4N0YL 5DMIH 2IAMB 2WMPA 4IOSA 1U8KB 1TUPA 2G2RA 1GL4B 4ZX3A 4K5OA 4XTRD 3ZL2A 2HG5A 3RG1C 1LE5A 3CSFA 4JANB 4R0LB 4XWGL 4Z1PA 3KG5A 3BUYA 4N2IA 3QUYC 5IBLC 3RPKA 5E2UH 2OTWA 1R1CA 5GRUH 3U2SB 5KYNA 4G80A 3KPRE 2ZOLB 2XQ0A 5A2IH 3P4NA 4AC4A 5CEZL 5BOZG 1I1AB 1TJIH 3QEGL 3ZKSD 4YHLL 5B3NA 4NO0A 4F24A 4FI8A 1DN0B 1MIEL 1EFQA 1A7NH 1JL8A 4ZMPA 4RFOH 1CJYA 4XMKH 5KSUB 4NM8H 4OZHE 5JXEA 5F1SA 3VG9C 3IJ9A 1IBHA 4N3TA 1JXDA 2XA8L 3D52A 2OJ1A 1R17A 3SQBB 4UTAA 1Q72L 5IEKB 3VGFA 4MB5A 1JYXA 1HL8A 4KVCH 3HZMB 3S35L 4IIQA 4UQBA 1THCA 4IRZH 5LNEA 3X11B 3EXLA 4AL8L 3PJSA 1HCZA 3RTQC 3QUZA 1WEJH 1OB1A 3FFCD 1X5LA 3FUDA 5FHAH 5DJAB 4FCAA 3MRBA 1I1YA 3MRIA 4R9HA 4YHPA 1JPSH 4ALAL 4LSUL 4EZJA 5I5RA 5ESQA 4G5ZH 3QFJE 1AMXA 2OULB 3ARPA 4BK4A 4QHMB 1UQSA 4NPKA 3ZE1B 3RFRA 1FNLA 1OGAD 1TTFA 1OK8A 5AVYB 1A3LH 4GKNB 4AMWA 2Y2YA 2F53D 3JV6A 3MN8A 5GS0C 4ACPA 1RUQH 1G7PB 4K9EL 3MRRA 4E5XA 4FTDA 5ID0B 4E5XG 3PWLA 4MAYC 4IBWA 4FQXA 1DZ0A 4J2QA 5I1AA 3O6KH 1U95B 3UBXA 3MRCB 2FEDC 1ANUA 4FZ8L 4PJHA 3SYAA 3V2AR 1NM4A 4EN3A 1RAMA 4X4YB 3DX0A 4HJUA 3AY2A 2Z31C 2LLLA 1K4DA 4G7SB 1CT8B 1UXWA 3MRLB 2AJUL 3QQDB 1DEEB 4A7TA 1KBVA 3DC0A 1MJUL 4LGRB 4OGXL 4NUJA 2OTUA 1UZ6F 2EDRA 4NLAA 2GEEA 1I9EA 3OAYH 1XIWB 2OI9B 1E7VA 3NCCB 4YUEL 1D5IH 1MCDA 1XF2A 2P24A 3HG1D 4OJFH 5EU7E 2V3FA 5L8LB 1FAIL 4XR8C 1EHLH 4B9YA 5DYOB 2CKNA 3WUWB 4BK5A 3NA9H 4HEMA 3ZXAC 1KGWA 1JXFA 5EO0A 5CJ5A 3FH7A 4LNRB 2NCMA 3MRGB 3BP5A 4MWFB 5TDNA 3GMPB 1A3RL 1E6JL 2LFEA 1JDAA 5KSBE 3FQWA 3QJVB 4E9VA 3TO2B 1RERA 4XXDA 1A9VA 3O8XD 4OBRA 3T1FB 1BVZA 4LVOC 4Y4HD 5EF1A 5L6YL 3LZRA 1EXHA 3CDZA 1SPDA 4NWTH 4UT7H 1WGVA 5GS0H 3IFLH 3WIIH 4HISA 3D3VE 4GW1A 4KKCD 3FO1B 4GKLA 2HRPL 2FX9L 3S8GB 4YWGH 4L9LC 1PVHA 3ZE2B 3D48R 1NJ9A 4RZCB 2XX0A 3ARRA 1M56B 1QSVA 2O6PA 4YC2C 4DGIL 3FS9A 3ZTEA 4PRHD 3HTLX 3QNYB 3LEVH 1DBAL 3HI1A 3CNKA 4LRNL 2YPVL 5E8OA 3IGUA 3Q2CA 4OFYD 2H26B 4KMTH 4YO0B 5J57B 2NY6D 1EAPB 1QQDB 3GI8L 4JDTH 3K2IA 5IVZA 3NDYE 1PS3A 1AS8A 2FH8A 4JFTA 4JEGB 2C3WA 1ZTMA 1A0QL 2F7QA 1B9KA 3BGMB 1Z3GL 3PU7A 3QXDA 3FU8A 4HF5H 4JHWH 4HJJH 2AV1A 2VDLH 5BVPH 1BMZA 4B41A 1ACXA 5AL8A 1NIBA 4HT1L 4DP7X 3QDGA 4FFZH 3WHXB 2NY5C 4ZK8A 3QULA 4NKDB 4HLZH 4K5MA 2NNCA 2PW1B 1IC7L 1K85A 1PBYA 4C47A 4G8GB 2RJMA 1JUFB 2OYLA 1KB5H 3REVB 3NJKA 3MRQB 5LAXB 5DK0A 4RGNC 1I3UA 1T04A 4RFNC 3ULUC 2E3VA 5JOFA 3LKSB 4FXKC 4OB5L 3E8UL 4KY2A 3LH2L 4ZW7A 5D93C 4F7CB 2B0SH 1FNFA 4P8QA 4BEIA 1IGTA 1ND0A 2X4UB 1CGVA 3QDAA 1MFDH 1A9BA 4LASH 2BWQA 4LSTH 1NCAL 4WEEA 3SOBH 4UTAL 1BQLH 2ZXBA 1DVFA 2NR6C 1QSED 4XCNA 4LKXB 1XAUA 5KYYB 1J11A 2BP8B 2QGDA 1YMMD 2DWDB 5I8OH 1VACA 3RWJB 1T5KA 4OLXH 1IGIL 1DBJL 4J3OC 1YAZA 4LLAA 4I1RA 4M5ZL 1DL7L 3EYOB 1ADQH 5F6IC 1I3GL 4Y2DD 5K33A 1WE5A 1UFUA 2A6JA 2X4TA 4LSRH 5F7HA 5G5DB 1NCCH 3X1BA 1KCVL 1FG2B 1FGVL 1TLMA 3S37L 3WS3A 3D51A 4W9KC 3ZSSA 3G5ZA 4AJYV 2AQ2A 2ALWA 1KBBA 3DVNB 4M8RA 1E5CA 4WU7A 4ZMZA 3O3DB 4KPHL 1U8JB 4OKVA 4HPOL 3ARUA 2DQFA 2FLRT 4ELMF 2NY5H 2DS4A 4JDVA 3MLVH 2Q8AH 3SDXE 4HMCA 3S0PA 3IJEB 4TNGA 3RNKA 5C9KA 5HHME 4FXGA 2CXKA 5KSVB 1KWGA 3TH3T 2FR4B 3UADA 2ENSA 1VGEL 5T1KA 1HK6A 2X40A 4WTXA 2WVTA 4YBHA 1F4XL 3FT0A 3ULUH 1M9WA 4XBGA 5KVDH 1MFAL 4LO9A 2HVKA 1FJ1A 3VXUD 2XVKA 5TDPA 4HX1A 4BKLB 1HOCB 3ULSA 2QLYA 4NP9A 3W39B 4BH7B 1HHKA 2E7CA 3O45B 3O4LE 5B7FA 1U8PA 4ZFFB 2X70A 5LNGA 1L9SA 4I7ZC 4R90L 5DJ8B 4JPVL 3EBAA 2Y36H 1CXFA 4R3SB 1G9NL 4UT6H 4F3FA 4J3OH 3X1NA 3NH7L 1NGZA 4WV1C 1JGIA 4GT0A 1DVXA 4Y1TA 4WTZG 1JXGA 3RL2A 1LE9A