5F2FA

Crystal structure of para-biphenyl-2-methyl-3', 5' di-methyl amide mannoside bound to fimh lectin domain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
158
structure length
157
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein FimH
publication title Antivirulence Isoquinolone Mannosides: Optimization of the Biaryl Aglycone for FimH Lectin Binding Affinity and Efficacy in the Treatment of Chronic UTI.
pubmed doi rcsb
source organism Escherichia coli j96
molecule tags Sugar binding protein
total genus 34
structure length 157
sequence length 158
ec nomenclature
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 5f2fA00
5F3FA 4XO8A 4X5QA 2XG5B 5FWRA 5IQOA 5LNGA 3BFWA 3ZL1A 4XO9A 1N12A 1KLFB 3JWNG 4XOBA 5JQIB 5AAPA 4AUJA 1PDKB 5CGBA 3BFQG 3ME0B 3JWNH 4AVIA 1TR7A 1N0LB 2UY7B 4J3OG 4X5PA 4BUQA 3BWUF 3RFZA 2W07B 4AVJA 4XOAA 4X5RA 5FLUA 3ZPDA 4CSSA 3SQBB 5IQMA 4CA4A 4J3OH 2XG4B 5FX3A 2UY6B 3ZL2A 4XOCA 5AALA 2WMPB 1ZE3H 1QUNB 4AV4A 2VCOA 4J3OF 2JMRA 2J2ZB 4AUYA 4AVHA 5AB1A 4AV5A 4AV0A 5LNEA 4AVKA 4X50A 5ABZA 5IQNA 4XOEA 1KIUB 5F2FA 5FS5A 4ATTA 4XODA 4LOVA 2JTYA 1UWFA 3MCYA 4AUUA 4CSTA 3JWNE
chains in the Genus database with same CATH superfamily
3OHXB 3OZ9H 2KH2B 2DQFA 4AQOA 2R2EA 4OJEH 2DI8A 4JZOB 4N2HA 3KL0A 4YSCA 3STZA 4XWOD 3L3KB 3VGDA 1BAWA 4NQEE 2FJGB 5EH1A 4D8PB 4GUPA 2B59A 5INDA 2LLGA 2XWTA 1N10A 2ZKMX 2TSAA 1RQ5A 1MOEA 4GRLA 3DGCR 1GS8A 5ESAB 5J9PB 1NAMH 2JB5L 3LEXB 5BZDB 4M8RA 1HWGB 3IDNB 4GSDH 4J4PA 4TNGA 4CVUA 1IM9A 4G1EB 4JPVL 4XC3H 3MRDB 1X5LA 3VW3L 2NY7L 2HRGA 1HL9A 1QSFE 2VZOA 3HCVB 4TLSA 4L18A 5A2BA 3MBEA 2V8LA 2OJZH 4PI0A 2F5BH 2VDRH 3I3EA 1A7OH 4KK5C 2HKHH 4CMHC 1ZT7A 1I3RA 4E41D 4IU3B 4ENZA 2E7BA 3U0WH 4FHJA 1I7RB 3G5YA 3RTQD 4TKWA 5D71L 1IGJB 5HHXL 3LDBB 1M9WA 2X6UA 3NACH 4MBOA 2X4PB 2BSED 4KRPC 5EPMA 1XL4A 1IKNC 4NUGH 5K93A 2EDJA 5GPRA 4Y2OA 5DC9B 4DKAA 4H20H 1A3RH 4MRBA 5JIMA 2X12A 4GSUA 4JPIA 2XWEA 3QIUD 4G11A 4IHOB 4QAMB 4A37A 3TPUB 1S7XA 3FL7A 2VJ8A 1AR1C 2Y69B 3RWHB 1F86A 2PCFB 4MBRA 3V4PA 3FU7A 3N1GC 1Y1DA 1NLDL 3EFDH 5KVFE 3N42F 4APQC 4NJ9H 1B4LA 3VD1A 3EGDA 1E5CA 3UAAA 5BOJA 4YVNA 3UTZA 1I1AC 3FU3A 5DJXB 4F57L 5J12B 3FO1A 4ELKA 1F3RB 2APWA 1EVUA 2JK5B 2BRRH 2VXUL 4L8DA 4AV5A 1WSST 1AC0A 3VRJB 4RRPA 5JDSA 3OKOB 4MNHB 3PWJA 3CVBA 4GEIA 5DJZB 5DWPA 4EZJA 2BY1A 2F19H 4J2QA 5HDQL 3RE0A 1YHPA 1OLZA 5LGJB 1T4WA 2OYPA 2ZAHA 3L5WA 4UINL 4FG0A 4M1CD 2NX5E 2IG2H 3AXHA 4KVNL 2ATAA 1SNRA 1LEKA 4HJJL 1KZQA 4ZTOL 4WRLA 2Y7QB 5AAMA 1DE4B 2HRPL 1DBJH 2YOAA 5DD1L 5FM8A 2YJLA 4PWEA 1MHCB 1HDMB 3CZUB 4Z7WB 3MRGB 5CP3H 2OTWA 4RFOL 1QO3B 3WKQA 2XG5A 2PLTA 5CZVH 2XI9A 2XN1A 4B41A 2IH1A 5HYJD 1G7LA 2NXYD 2WSKA 4LP5A 3NJVA 4HMEA 4I0PB 3L3OA 4NYLA 5DHYB 1HEJC 1U3YA 5A2FA 3WNIA 2OS7A 5GGSY 1SLWA 1U3HB 3AU1B 3VQMA 4AIOA 2Y5EA 4YE4H 3ZMNA 3B3BA 1BZEA 4Y1AA 3RILA 1F2QA 1RPKA 1T22A 3G9AB 1WYJA 4YDNA 1MCPH 1CURA 4EMZA 2EVHA 1CICC 2PW1A 1Y6NR 1TZHA 3AMKA 2NZ9C 5TK4A 5ICZA 3PL6C 1J8HE 1ZV9A 1YZZA 2WK2A 4PJIB 1EGJL 2QSCL 5ENWB 2HWZH 3B2VL 1TJGH 4HIXH 4GRWH 4Y16C 4LCCB 1X6NA 3PY9A 2HTLD 2Z8SA 1N67A 4JHBA 4KI5F 1QLEL 2P5WA 3HVNA 2NTFB 3ZDXE 3WJLC 2BIPA 4NSKA 4X0KB 5IBUB 4AH2A 5I1DB 2V0AA 3AM8C 3LRSB 2DEYX 3OPZL 3WBDA 2DQJL 2BDNL 4PY7A 3MPCA 2IQ9H 4PJEA 4LCVA 2Q20A 1SXNA 3NYKA 3A4FA 3VH8A 3J2PA 3ZE0B 4FQJL 3QQ3A 3ZDZE 4V11A 4B53A 5IT2H 2N56A 4RESB 5GGSB 5A7EA 1OGTB 5I6PA 4Z7OB 1IO4C 3CDGA 2AJUL 1MFUA 2HPTA 4DFIA 4F7MA 3ZT6A 1KY7A 1XB6A 3WUWG 1MEXH 3NABL 1WAAE 5E9DA 3LKSB 1Z5YD 3N85L 5IBTL 3RWIB 1MH5A 3DBXB 4ZAKD 1LP9A 1WVZA 1R3LB 1PZSA 2NY4D 3P3RA 4JM2F 5HVGB 3T2LA 3WY1A 4UIMB 3OWEA 4JRWA 5ETUA 2V3FA 4CVXB 2BOBB 1A1MA 1XEDA 2VSDA 2VIRA 4HMCA 4NQCD 4UQ3B 5D8JL 4L1HA 2RH0A 3FQTA 5JHDA 3ILQD 5FYJL 5JA9A 4H2AA 4AVHA 2J6EH 3IDYB 4FC3E 2R56L 4UI2A 1TQVA 2RD0A 1OAUL 4OQ1A 2VL4A 5FFGA 5DGQA 2E86A 1D5IH 4C56E 4S11A 4Y4HC 5KVDL 3LH8A 2IQAB 3W0WD 1OGAE 2WZPD 3CDZA 3JTSA 5IVNA 5C7XH 2IANB 1S9WA 4UDTA 3G5ZA 4ZYKA 4QHMA 4LLDA 5IHZB 1WITA 1BFVL 4KXZI 5TPWL 5KUKA 5ALBL 5GJSH 3EZ8A 1DQDH 4A7SA 4HK3J 4MDRA 4KO9A 3FB8A 3O8XD 3KJ6L 1KV7A 1BVKB 1JDDA 3NSJA 2R29A 3LQZA 2V5TA 3E9UA 1AP2B 3T0XA 5IB3A 4ZQKB 1UURA 4NO5B 1BMWA 2GSGA 5I9QB 1FRGL 1FZOB 1NSNL 2X09A 2X41A 5D2LB 2GBUA 4OCYL 4CUCA 4H25B 2X4NB 4HWUA 4NUMA 3TJEL 1RULH 1ETZB 1QHQA 3LN4B 5JO5B 4YO0A 1BQ5A 3O9WA 3QZLA 1S5HB 2NNFA 4L1TA 4MSWB 4Z7QE 1U3ZA 3TURA 4B9YA 2O6CA 4POUB 4Q6YA 5L4FA 5L2JA 3UPRA 3OLIA 2J25A 2KQNA 3QEGL 4WU7A 3D09A 1MELA 1V3LA 1W0WA 4LNVA 5JHAA 3MRFA 3UBXB 1HWWA 3OV6A 4LNRA 4ZFFA 2A5UA 1P69B 3QP3A 3IM1A 1QFHA 2ZYRA 3KPLA 5DMIL 5EO1A 1EZLA 1KTLA 3FCBA 5DVKA 2XETA 5FW7A 3S5ZA 4WDIB 1KGUA 4BE6A 3TV3L 1FZJA 3WLBB 4X9GA 3V0FA 2VQ1A 2ZOOA 1AHKA 4ORZC 2FB4L 3MO1A 3D39D 2BOCA 3M1OA 4QXUH 2JKJA 2HT3C 3H7LA 4LP8A 3SE8L 4BUGA 1UUSA 1W16A 1ZY9A 1LO3L 4Z5RB 2VSKB 3C5XA 2GCYB 2UY6B 5T3ZL 3P2TA 3VG9C 2Q8AL 2NY3C 4CC1A 4F1ZA 3G6DL 4G72B 1MG2C 1G9ML 4KROC 5H94A 2RQ8A 3GI9L 3KEDA 5B1AB 1LM8V 4J6RH 2FECL 2K78A 3S3CB 1S9KC 1IC4L 5DUBA 3PU7A 4D0DB 1AC6A 1FE8H 2QFPA 3C60A 4CVZA 1KB9J 1CFSB 4Y4KB 4HOXA 4AJVA 3O3BA 4UF7C 5TQ0L 5ICUA 1BQHA 4A63A 1SLUA 4I13B 3BUTA 2D31B 2WGXA 1FNAA 1H5BC 3P11L 3ECUA 4TVPH 5HBBA 5FEBA 1L9OA 1YEWA 3M46A 1OSZA 3HUJB 2XZQH 4G6ML 4IGBA 1NEZG 4ONFL 5AOZA 1BD2B 2AHIA 5AW1B 3WUWB 4NP4L 4LIQE 4KJWD 5HSFA 1E4WH 4N2EA 2EDNA 3QUXB 2YO3A 5K33A 2P5EB 5IW6B 3K3QA 5J6GA 4PGEB 4JO4H 5CM1A 4PRDA 4X6DB 4LBEA 3L9BA 2BJML 3NK4A 2YPLB 2O30A 3Q6FB 2V9RA 4HH9B 1GPOL 2EZ0D 3OQ3B 5CUSH 2FX8H 1T2JA 1TSRA 3DTUB 2EDRA 1KN4L 2BSCA 1IE4A 2QPUA 2LLLA 2V4LA 4M3HA 1E9OB 2WO3B 2AJYH 2YSSA 4PJ5E 3LKNA 4GAFB 1JK8A 1B6UA 1CXIA 1QI5A 2VDPH 1T7YA 2VL5B 2YGVA 4XMPH 3TZVD 4UT6A 5K39A 4BH7B 3RIFF 3ARFC 5J3HC 4AYMC 5HDBF 3T3ME 5T5FA 2CHDA 1IGFH 3DIFA 3D06A 1KPUA 5JORB 1H3GA 4DZBA 3EUDA 2ZOLA 2F54B 3QIWA 6TAAA 4HIHB 4YDIL 1UD5A 1UB5A 4N0FB 4HLZG 1N2RB 2L7JA 3PS6A 5FYKU 5DD5L 3RIKA 2J1YA 2YMXH 4XMZA 3U1QA 3UEZA 1KJ2A 4AXWA 4E42B 4Z76B 5IOKA 2JQAA 1AKJB 4OJCA 4PWFA 1OM3H 4PRPA 4XBPA 1OB1A 4Z7AA 3KGUA 3RBSA 2CO1A 1E7VA 2Q0ZX 4NCC2 3QPXH 2WTPA 3NCYP 1YPZB 2YBGA 4OZGA 3NFNA 4D9QD 5LCVA 1A65A 4Z18A 2P80D 5AYUH 4ZMPA 3GHBL 2DLFH 4A67A 4P5RA 1A3LL 5IMMB 4KJYA 5CZKA 2ZJSH 5DS8A 3D5OF 1R24B 2R9HC 4XNUH 3OJDA 3L3GA 3MV7A 4TQEH 3VTTA 2D7MA 2WYHA 2D3JA 1KGIA 4EI5C 1QP1A 2DEWX 4X98A 1I85C 5KBLA 1NIBA 5IQLA 3P77B 2YD4A 3VFWB 3KCPA 5BJTA 1P7HL 4JFZH 3CFTA 5EORH 2MFNA 5C0RL 4BK5C 4Z1PA 3QYNA 2VDKL 3OZKA 1SJXA 2IH9A 3FT2A 4ODWA 1B4RA 4FLSA 4K71B 1RJZB 1YG9A 2ZF8A 4BYHA 2E27H 2OL3A 1CFTB 3W11D 3H85A 3V6FB 4EEEA 3IJSA 3CVHB 1HKLL 1A64A 2CO6B 4GO9A 1LEGB 2BW4A 5L9DH 2R7EA 2I24N 3DROB 3ULUD 3WO3B 1OE3A 4JRXE 2CXGA 3W82A 2YD3A 1AIFA 1UQSA 3O45A 1GGIH 3A23A 5C0AD 3DXAE 2GYSA 2R0LL 4O9HL 3PDOB 3R4DA 3Q0HA 2R0KL 4R4ND 2XWBA 2X7LB 4AEFA 2QELA 2RAMA 2ESVB 3ECWA 2YEZB 4M5YL 4U1MB 4ZFOB 4HULB 1HWHB 5IUCA 3UTSA 5L8LB 2F1AA 1L0PA 1YCSA 3K1DA 2CKNA 3B5TA 1B9KA 1EHAA 5AVZB 3OAZH 1KNOA 1P6AB 2BHYA 4XPTL 3VUAA 2WIMA 3KXFB 4XNAA 3I75B 3KPNB 4JY6A 3TH3T 2XIDA 4U6YB 1NEZB 3H8NA 5F7NC 3JZ7A 2FWOA 4DEPB 1DUZB 2OV0A 1WWCA 3GUTB 3B2PA 4Q74A 1XF2B 3FTGB 2BIIA 5CZRA 5FYJU 4LSTH 1I8LC 1KIQB 4KPHH 2X3CA 3WS3B 3BKCH 2DMCA 2L04A 4N0YL 5BQDA 4LKXB 2K3HA 2J1ZA 5F89A 3SDCC 3D08A 1WPCA 3WNNA 4GW1B 5H35A 4KHXL 3ZDYF 3PP4L 3EHBD 1PEWA 3CGTA 4LKCB 1TFPA 3F7QA 4Q9BA 3VI4A 5A3ID 5JYMA 2Z93B 3ZYZA 4HAGA 5C07A 5HI4D 4I8DA 4KK9D 2XTJB 4PWJA 5D1QD 1F4YH 2NY0B 2B2XL 4U3CA 3H3BC 4I1RA 4JGUA 3HRZB 1MWAL 1L5GA 4LOFA 4PJEF 3LZPA 1FNGB 1WBZB 3WL9A 3DJRA 2QVFB 4HH8A 5IM7B 2Q7NA 4WVRA 2UZPA 1R34A 1KCRH 2X0UA 3TA3A 3OVUB 2OMWA 1N7MH 1UACH 2OMVA 1FVDB 4CJ1A 4GQRA 4M56A 3EOAA 4XGZA 1RSFA 2V5SA 3PHQB 2GIMA 4MXWH 4UM8A 1J9SA 4NC2B 3LZOA 4U3HA 3ZDYE 4X6CB 5AB2A 3TXAA 1LP9F 2JXMB 4UILL 5K1VA 4RAUA 3J07A 3GSUA 3WENA 3NJFA 5AALA 5J7CC 2J8OA 2VDOL 2ERJC 3U7WH 3WNKA 4MJHA 2DPKA 1QBBA 2ZXWB 1RZGA 4YSOA 1YC8A 1AIZA 3F7PC 3TIDA 4PJEE 4P2YA 3SDXF 4PLKD 3U82B 4H26B 5K1NA 1FZMB 4M3KB 1T89C 4EVNB 2XWXA 3H1ZA 1X5JA 5LLIC 4EN2A 3GIVB 3BGAA 4QRQA 4N2DA 4UTAL 3EXLA 1WZ1L 3F65A 4J3OC 5IHLB 1SJEB 4BQ6A 2ZSVB 4URTB 3SKOA 2DQEH 1MW0A 1LGVA 2DQUH 3C09B 1KFGA 5E9DE 3UJTL 3E1ZA 2ADGA 3BUBA 1LP9E 4X8JA 1F3JA 4JFOA 1KG0B 1CXFA 2H6OA 3M86A 3FQWA 4G42A 5DEGA 2J44A 3FW6A 2ZXBA 4HXBL 3DOHA 1H9DA 2FEEL 3HAEH 5FHAH 3PWVB 2XWJA 5EOTA 4ABQA 1TJMA 5JHDE 2HUEA 2Z8RA 1GY2A 2I9LB 2FX9H 3IAQA 2FJFB 3GRGA 2X9ZA 1QACA 3EYSL 3FN3A 2E56A 5F44A 5MI0C 1OAZL 1YECL 2CSPA 4HUNB 1AD0B 4LDOB 4N8CL 4RMQA 5F6IC 3WXVH 4BK8A 4YLCA 4Z8FH 3NUKA 3Q3GA 3SGEI 3T65B 4MA8H 3VGAB 3VX1A 5IR1B 1HCVA 3SBWA 2OMZB 1BJMA 3E38A 1YEEL 4AGOA 4BEIA 3H6JA 1XGQB 2PP9A 4QCIB 1O5PA 3E2HC 2VO5A 2GFBA 4AM0A 1WRFA 3PWPB 1E8YA 4KNQA 4HS6B 1ID2A 2OMBA 1SOKA 1GJIA 2Y5TB 1S7QB 4HZAA 2F1BA 1K2DB 4FDWA 3HR5B 2PTUA 3W2DH 2DN7A 3EYUH 1NOAA 3GS4A 4O5LH 4OD2A 1HIMH 3FSVA 2E6JA 3CSYA 5LAXA 2N3JA 4KI5D 2R51A 2G75A 3IU4L 4XWGL 4MQXD 3BPCA 3DSNA 3KPSD 5KG9B 1J9RA 3NDZE 4OCMC 1I3GH 4U6XB 3GM8A 3TEYA 1OAXH 2B4CH 1AYOA 2AQRA 4E9SA 3QUHA 4ZO8A 3VI3B 1RIUH 4LVOB 4WO4D 4U6HA 3SODB 1QSZA 4LSVL 5C3TA 1M05A 1NCAL 5IVXB 3DV4B 2FSDA 3OAZK 4N4YB 2ZCKH 5CLZA 5SWZB 1PAMA 1ZTMA 4YHIB 5F7YC 4BH8B 4R90H 3OL2A 3QUZD 1LK2B 2ROXA 2DYPB 1XX9C 4MWFB 4Z0XB 5JOFB 1BYNA 5ISZB 4UT9L 1ZTXL 3MROA 4PG9B 4N28A 1YEDA 4Y2NA 1QRND 3GO1L 2EDTA 5DZOA 4QLWA 3H55A 1GMIA 1HNFA 3K8KA 1NC2A 2JELL 3QZMA 1KCSL 1WIOA 1BAGA 3QNYA 1USQA 1VJSA 4O58H 1EX0A 4AENA 3EJZD 1WZKA 3HZKA 5KYNA 1H9VA 2GQHA 5FYLE 1KXTB 3IU3A 1D5BB 4P23C 1U8MB 4PCSA 3W81A 3EYFB 5E2WL 1CFQB 5L6YH 1JZ6A 1SMAA 2E7HA 4BKTC 4NQSA 2H2PC 1VRSA 1A21A 3IETA 5CJXA 1N64L 3V5KB 1ASQA 2G5BB 2FJSA 2OYMA 3FHEA 3ULUH 5IREA 3V0WH 2WVUA 4PJHB 2ZYHA 6CGTA 1KIUB 4PGDA 5I5JA 2HJKA 1ZE3C 3MUGA 2HZHA 3BQUC 3VWJA 1JGLH 1DBKL 1B0RA 2CO7A 3CX2A 4RFEA 1QWHA 1DEEB 4CSTA 1AY1H 2VR7A 2XWDA 4U1JA 2CLVB 3CMGA 3TBYB 5CEYB 3ALPA 3GZOA 4LRIA 4BZ1L 3KS0J 2UX7A 2C7UA 3CPLB 1S9YB 4ERSL 2J7LA 3QXAB 4JY5H 3SGJA 2HTKC 4QD2E 3OKEB 1GGBL 3U9UB 1Q9OA 2E59A 3T08A 5D7LA 4JANB 5DEFB 1MHEA 2GAZB 3WKNA 2WGNB 4J3BA 1RVFH 2QADC 2H26A 4HJIA 3EADA 2Z4TA 5CSBA 3T6ZA 2AQ2A 3ZT5A 1CO1A 3ZTDC 3B9KC 4ODTH 5DVPA 1O6SB 5FF6A 1NPJA 5J4MA 5C0CA 1IEAA 3EGSB 2ZCLH 5IY5B 3BFQG 5AD0B 3S8GB 4UU9A 3RLSA 3QHZL 5CBEA 2ICEA 1XVSA 1RZ7L 2BNRA 4DUVA 1DVFA 1LDPL 4JKPL 1NFDE 1JNJA 4QHLA 3QEQA 4L3FA 5TQ2L 3QUYA 4V2BA 4HISA 1CN4A 1XH3B 4XH2B 2CRZA 1W72H 2DD8L 1Q72H 2W07A 4PG2C 3MOAH 2G2NA 3PGDA 4DGVL 3H3PL 5I76A 4OZHA 1WIUA 3KJ4B 4FLHA 5F7WC 4YE0A 2QPFA 2CKBA 1NCUA 1FDLL 2P8LB 3QJXA 4PUBH 5EUOB 4M43H 2Y4SA 4G70B 1IRAY 3L17A 3JVGC 5B1KA 3QG6A 2J8UA 4N3UA 3NJGA 2BZCA 3VWKC 3ARBB 2H4EA 5BQ7A 5T1LA 3X1NA 3UGEA 3R4RA 5JLZB 4GINA 4PRPE 4MB1A 3KLAA 3ZBMA 4YHMH 5A40E 1GSKA 4JCMA 3CLFH 4OZGE 4BZ2A 2Z7UA 4K7FA 5J1TC 4OV5A 1VACB 2NY1B 5CINL 1X7QB 4QIRA 4MAUL 4HFWB 4YHOH 3IXTA 1MXGA 5AKVA 4KKLC 1Z3GH 4AQ8A 1MY5A 2WZAA 3S34H 5EOCL 4G6KH 1G9MC 4MA7H 3FO2A 3F7KA 4Y4FB 3GSNB 4P3DB 2EEFA 5E8PA 1DVYA 2P48B 4BKLA 4F9PA 5TDNB 4ZMTA 3WTYA 1Z2KA 2F08A 4XMWA 1XIWB 1AJ7L 5IWLC 1OAQL 1RERA 4AMXA 4XCYA 4BQBA 5BS0B 5JIQA 3SE3C 2WNWA 3CFBB 5IB2A 1L7TH 5A6IA 5IJBC 1T6WA 4WKZA 4E9YA 1QEXA 1VAHA 4WW1B 3GBDA 5FO9A 3NZUA 4HAFA 3UC0H 3UTPD 3VXRB 5HD8D 3M8OH 2A83A 5IEHA 4U7KA 1S3KL 1KIRA 4AIZB 2X28A 5CJQL 4HUWA 1UTDA 2EEAA 4K9JA 5KS9B 4MASA 4OLEA 3NIDF 3MRCB 2A6KA 1TVHA 2CGYA 2X6BA 1WWWX 3AREC 1RLWA 3BWZA 2WW8A 4E9WA 1AQMA 3L4UA 3NFPA 5J11C 4HBCL 5E5MA 5KSAA 3VB9A 1PZ3A 3FB6B 1BZ7B 4XN9A 3VFRB 4EAEA 4EKJA 4FFVD 5KJRH 4IIQC 4IKKA 3UTSE 1PLAA 1G84A 1AR2A 4JRYD 4NJAL 5DI8A 4PJGA 1UYWH 5FFOA 2ZOWA 3BXNB 4N8PA 2CJUH 2OTUA 3BH9A 2H9GA 4X5XB 1ERNA 3NIDE 3VI4F 5BVPH 2H0JA 2G3MA 1E9PA 5C0GB 1T4KA 5E4EC 1TR7A 2X4RB 3CFDA 2BP0A 1BW8A 4HS8H 1YNTA 1DQJA 1FO0L 3B37A 15C8H 4Z7IA 1UXLA 1X9UA 3MXVH 3QFDA 4TNEA 1ETJA 4YFLI 4JJOA 4FCHA 3RX9A 5JIPA 4PBVC 4S1DC 5E6SB 5EN3A 1A9EA 3T5WA 4AL8C 4MQ7B 4PS8A 3QDHA 3I85A 5E9AA 5ICXA 2IAND 1F0LA 2WUBH 3RUGF 2ITFA 1ILSA 2Q5BA 2O72A 2OSXA 4Y2DA 5DFVC 3TYGH 2PO6A 5B7EA 3VI4E 2ZOKA 3O6LH 3MKKA 4WEBL 4MKTA 3B8YA 3RPIA 1RJYB 3CZKA 5AG8A 4TSCH 3BSZH 3Q8EA 4IRZH 5KOVC 5E2VH 4TQHA 4PRBB 3VG0H 2IPUG 3F8UB 1DVQA 3FFCA 1NA8A 3IFLH 1IQWH 3S3BB 5KSBA 1TJHH 1IM3A 4Q14A 5FA4B 2XRAH 1CDHA 2MOGA 5FECB 5D4IA 3DVGA 3NRPA 5AB1A 4AYFB 3P30L 3D33A 4DOHB 3B5HA 3QAZB 3DWTA 1DL7H 4PCTA 1VF5C 2LABA 3QQ4B 4UYQA 1RUQH 1G1OA 2PPDA 4EE2A 2IPKB 4PSRA 3FT4A 4A2LA 1KLGB 1SFHA 2BY0A 5E1GA 4EI6B 1G6RA 1PZ5B 4HKXB 3GHEH 4YSSA 4H0LC 2P42B 1RUML 2MNJB 4JCWA 4AYID 3BW9A 3FOLB 1LVEA 5KN5A 5HYJE 4LGSB 4P2OB 1XF4B 1VFBB 3H2WA 4PJ7A 2WWMC 1IAOB 2PWEA 3CCHA 3RWGA 3I6GB 4XP4H 4HGWB 4H0IA 1XDTT 4NWTH 5IQOA 1GZQA 3BFOA 1T5XB 3EW3B 3T09A 1LILA 2CRIA 4BWTA 5EU3B 3QCVH 4BSWA 3Q2VA 1UENA 3MRBA 4D3CL 5IMLA 3TF7C 1WFMA 5EB9A 4JMXA 1WWBX 5CN1A 3TYFA 5F1NB 4OFVA 5E03A 5H8DA 3JUYA 3L4CA 2IEPA 2P5WD 5EC1B 4Z7UB 3FFOA 3RY4A 3LKQA 2ZCHL 4L8SA 1QSEB 4F8QA 4MQTB 1DJGA 4BFBD 1IU1A 4I1NB 1MXDA 3VFOB 4Y4KD 4WW2C 1Q1JH 3MX0B 5DTFB 4A7QA 3NAAH 4PP1D 1KLUB 1BXXA 4HUVB 4PRIB 3SYQA 5I0VA 1R3IH 3STLA 3TOPA 3W56A 2Y24A 4U1NB 2V2XB 4JFXB 3RPBA 3QJHB 3TJHD 1AI1H 3P4LA 1SEBB 2ZUYA 1A6VH 4CSSA 3AACA 2NYYC 3PWUA 4MNGB 3DO4A 4NKMA 1BD2D 4YFDB 2Z92B 5I1JH 3WFEH 3QUXD 2A6DA 4JFDA 2VMJA 5EO9B 2CK2A 1DJIA 2IPTH 5F88B 3TEWA 1AO7A 5EBWA 3MXWL 3C5ZA 3V9EA 1NGPL 2P26A 2YPLD 4YDZA 1MCRA 3GRWL 4P5TB 3HZMB 4R97B 4DKDC 4JKKA 3KPQA 2V9TA 4RZCB 1XFPA 2ZYIA 4B9KC 2VABB 5CJOH 4I89A 5CR8A 3W0WE 2IWEA 3BVXA 2WKGA 4TUKH 3N5AA 1OZUA 3F7RA 3P0GB 5EO0B 1MCOH 3UG5A 3VVVA 3WY3A 1WZAA 2EXSA 1RZIA 3FUNA 4NO0B 5JYLA 3RVWD 4ABVA 1PVHA 3S98A 4GBXC 3QJFB 3O2WL 3BC9A 4J28A 3HNVH 4XMKH 4LU5H 2XVGA 4WQOA 1RJLB 1S7UB 3F84A 4L3EB 1FG2B 4DP4X 3DUUB 3LSOB 5C08B 3HKZA 1YMMB 2D7NA 2F54D 4I3SL 4JDEB 5EC2A 1FORL 2FYYB 1NCHA 4RAVB 3FKUS 4UBDD 4RGNE 3DHPA 3HG3A 3QRBA 4S1RH 3SPCA 2HFFB 3AGWA 3MLXL 3L95A 2I9TB 2AK1L 4JZJB 2XIBA 3LKOB 3PFQA 5F3FA 2XTLA 3T1FA 3SSGA 1NH6A 1O7VA 2QMKA 2B1AL 1ETA1 1NDMB 5EA0L 2EYSB 4PB9L 4IKNA 4MA3A 3NSFA 3MNZA 4X9BA 2XQYA 3NCYS 4IMKC 4PGBB 5CF3A 1LO0H 2WXQA 4CU8A 1CVRA 3MYJB 5JXEC 4XNXL 5HY9A 1FNLA 5FYKD 2EIZB 2J4WL 1A7QL 2VDLH 3LVEA 4KX8A 3NZHL 3RVUC 1JWMB 3KLDA 3BUYA 5J8OA 5JHLL 4FX5A 3BAEL 3JVFC 5TF1L 3L3KA 1MAML 3X14B 4AQEB 5A2CA 2K70A 5D93C 3SYPA 1G43A 4JKWA 4NDMB 4CILA 3QQXA 4NM4H 4GFTB 1N26A 3ORJA 4TNVF 1T03L 5F7DB 1UKQA 5LG6A 3PF2A 5DD3L 4PJ9C 2WXKA 4OZHF 3IDNA 4CMHB 2UXVA 2LVCA 1G87A 1XGTB 1FFPA 4GB9A 2A9MH 3EBGA 2J8UF 4JM4L 2LE9A 1XHHA 3V9FA 2BNRE 3QFJA 1K5WA 2IAAC 4QXGL 2X4OB 1SQMA 4WWKC 3TFKC 1A6ZB 2GBTA 9CGTA 5FO2A 4HC1L 4KRPB 3WS6A 5CKAA 1Q9LB 1KYOK 2ESVD 4MAYD 4PP2B 1CMOA 1R9FA 5D2NA 1FNEB 4OZHE 1WJ3A 2APSA 4IGBD 4NI3A 1BEXA 1FNSL 3ROOB 3KXFD 4ECNA 2CE6A 1TTCA 5KUMA 4HKZA 2J8UE 4P5KA 3BLBA 3IT8D 4GIAA 3RRQA 1HQ4B 2AVGA 4U1GC 2IO5A 4APQB 5K5YA 4JE4B 4LQFL 3V4UH 2NNAB 1UVQB 3T0WA 2VLLB 1BZQK 1SDAB 5C0FA 3X13B 4HUXB 5J13C 2R0ZL 4FLQA 3OKMB 1I1AB 1Z9OA 5AW0B 3SHSA 3K80A 4KKAC 2YXVA 3NRQA 1UOLA 3WN5A 1C5CH 5L2KA 1Z5LB 3DVNB 4H2CA 4PVNA 1GIGL 4ZUUA 1LE5A 5F7BA 1XR8B 2BCKA 3CV5A 3HS0A 4JAMB 1BQLH 3ZTJH 2R1XA 3L3HB 4Z7UF 4NIYE 2XTJD 3MOBL 4NZFA 3FCGA 5EDXA 2NY0D 4NCDA 5D9SA 2ZP9A 1ZCRA 1NBVL 3SDAC 5JOEA 7TAAA 2OA9A 2AXFB 5D7IB 3P3TA 1ITCA 2FATL 5DYOA 3ESVF 1S7VB 2AAVA 4EIZC 2RCSL 3D18B 3PE9A 2HFGL 5H4YA 4NRZA 5HHNA 3ARSA 3BN9D 3DPBB 1A6PA 2H32A 4OLWL 1CD0A 5GHWL 5JMRA 3SDYH 1RFDL 4HA1A 3R7RA 3F5WA 5E1AB 4C47A 4NM8H 4R5TA 2VN6A 1RL1A 4N22A 1DE4A 1GHFL 1B0WA 2P8PB 2V3DA 2KYIA 4JO3H 1MCDA 2HKFL 5TDPB 4Z7WA 1B0IA 3MLSH 2EAEA 5AAWC 2GI0A 1YNTF 2H3KA 4TQ8A 1QO3A 2FL5A 2UY7B 3RZCB 5DU7A 5EBGA 3FT0A 1A4JB 4R5VA 4NQDA 3WEXA 3KPRA 3QISA 3TBCA 1BG9A 3KDMA 3RIFK 4B3EA 7CGTA 3AZUA 4XPFL 4I0PA 3QH3A 1CICB 4ZS7H 3PDDA 1K3ZA 3PL6B 1G7MB 4OFPA 3QEUB 1U3HA 3AU1A 4UUJB 1AQDB 4PJGE 1F58L 2IH3A 5GRJL 5I8OL 5DR5H 4N0UA 5JW5A 5EEYA 5IMKB 1N6QL 3DETD 5I6OA 4MMZC 3JWDH 2WB1A 3QE5A 1HC1A 4BSJA 4EOWH 4MMYB 4HEPA 3HR6A 2DQHH 2IALB 3ECQA 5TH2A 1E5AA 1DVTA 4NKOA 3Q8CA 1KJMA 5ENWA 4DW2H 2CD0A 2QKIA 2EABA 2Z8WC 4YHLH 2LLNA 5LBSH 2WXOA 2YA0A 3B2UC 5AW8B 5IESL 4OB5H 5KSBF 3HVDA 5I8KL 4RDBA 4AYEC 5CCKH 1HHGA 1K6QH 5IIEB 3A4EA 2VERA 3CFKB 3RY5A 4EZKA 4WK4B 2YGOA 3BO8A 4LCUA 2I7SA 5DRXA 4TLKA 2QVTA 4LEEA 5CEXB 3QUMA 3AROA 3BE1H 1NL0L 3K72B 4JS7A 5I1HH 2EH7L 5JQ6H 3U36B 5JPNC 1GYAA 5C0DB 3MRKB 1P9MC 1V7MH 4ISVA 2X3BA 4NN6C 1BVLA 4F2MA 4LARL 3TBTB 5I2IB 4HBQA 1EEUA 1QLFA 1ZEAH 3QB7C 1TTFA 1ONQB 4GMSH 4K94L 3MQIA 1MFAL 1MJ7L 3FFCE 4R7DA 3M88A 3CHRA 3EJSA 2R29H 4JHAH 1TU2B 1FFOB 2VZSA 3GSRA 3P69A 3R06B 3FTUA 1G7QA 1QKZH 2AJ3B 4LCIL 4UIMA 4OLYL 2MTPA 5ADPH 1CTOA 4G43A 3VFUA 2DQCH 4WFHE 1CFNB 3CZEA 3EOYG 3KNBB 3QNZA 3PYCA 2P52A 4QLRA 1IAIH 2N7BA 4KDTC 3L9EA 5FUCC 4XPHL 2E9GA 3QW9A 4H5SA 3C12A 2AKRB 5B1BB 4R7NB 3PIQA 4NFBA 3QRLA 5SWZD 4FG4A 4W9FC 3WEMA 4FMVA 4MCMA 2DYPD 3FQNA 3RGHA 1NCDH 3S3JA 5ISZD 3MLRH 5FV1L 5JZ7D 2VRQA 4X7TA 1K4CB 2PABA 4OIBA 1P6WA 3LKRA 3ZTEA 1GW0A 2DH3A 2BFVH 3QDJA 4PJ7E 4IRJC 3GQFA 1JNNH 1TQSA 3V0AC 1XGPA 4X6BB 1UM5H 2LU7A 3NIFB 2HLFD 1I9IL 1TVBA 3JZYA 3ARVA 2ZOUA 1ZVYA 4HOWA 1ASPA 1BVKA 4GQQA 2PYEA 5I18H 4YXLL 4M93C 2OZ4A 3NRFA 3VYPA 2IWGA 4ZQKA 5IG7B 1HAWA 3CN4A 3NZ8B 4NO5A 3MLWH 3RDTA 8FABB 1PTZA 1ULVA 2YD6A 3VYOA 3GBNL 3L5XH 2GHWB 1Q8MA 1TKWA 2CIIB 3EJPA 4GAAA 3PAYA 2R15A 3IMUA 1S5HA 3LPOA 1NMCC 1DN0B 1SDYA 2WQAA 4CNIB 3L81A 1NMAL 3CLEL 4PAZA 1ES0B 2CUIA 4KTDL 3IGLA 2EEDA 3TTSA 2PKDA 3NSDA 3MU3A 2MTAA 4N2FA 2K9FB 1MIMH 4FNTA 1CL7I 4WDIA 1F6AB 5D5MB 2JVUA 2UZYA 2VXVL 2YAMA 3F7YA 4ZMYA 3BKYL 4CAGA 3ZZSA 3K2UH 4LCWA 4ILDA 3EXJA 4FXKC 4LB8A 3WTXA 3VG9B 4GI9A 2NY3B 4DIXA 1E90A 4JFDE 4F7CA 3E8VA 5EU4A 1JNHB 4ZSOA 5HDRA 2F74B 1AO7E 2ATPB 1AMYA 1V8HA 5IHBA 2GJ6B 4G8IA 1IEBB 2N1KA 4LVNC 3V8CA 2MHAB 1J5OH 2AQ3A 3ZW3A 4DVRH 4N9GB 5DJYB 4FQ1L 1IBHA 1R3KB 4PJCE 1XXFC 4HETA 3BPNB 2UUDK 2XZCH 4X5LA 3RWJA 4AUUA 2ADJA 1OO2A 3MAWA 3BZDA 5GGTH 3T2QA 4KZDL 4O02L 4UT6H 1E5BA 2R1WB 3JWNE 1QG3A 2BS8A 1NUNB 3GMLA 2I07A 1EUUA 1AHWC 1KC5H 4FQHA 2QT6A 3HFMH 3PREA 4JB9L 5T5FH 1H6FA 1I1YB 1JSYA 2D03L 3E6FB 3BZFA 4XTRC 3ZRCC 4EIUA 3HUJA 2ARJB 4F7TB 1MIEL 3OGCB 2NUTA 4IS6A 4K15A 1RURL 4KX7A 2VDML 2ZPKH 4RX4D 5C7ZA 3WUWA 1HN1A 1NBZA 1UC6A 3KEHA 3GZQA 4PFEA 1JCVA 1P4BL 3ARBD 3NN8A 4G59C 4LPTA 1YQ2A 1JPST 25C8H 1J8KA 4ZX6A 2N7SA 5TK2A 4DN4L 4PCKA 1K8DA 3EYOA 5IVOA 1MW1A 3WFZA 4MCZA 2R23B 5LCVH 2Z64C 3ZKMC 2H41A 2NY1D 3IMTA 1IVTA 4WFFD 4XVSH 3CFCH 3DOSA 4AKPA 4MD0B 5DURD 5IROC 4DK6A 3ARFB 4F37K 1KWKA 1Z6JT 4HZ1A 1A8ZA 4MMXA 3OBAA 5I6KA 1X7TA 4ZMVA 2EC9T 4XNBA 3WELA 2AS5M 2NNRA 4Y4FD 4S1QL 1QRNE 1CDGA 1U8LA 1XD0A 1L0XA 1GGYA 3AAZB 1E4HA 1R17A 1F42A 3MA7A 3IYLW 3SQBB 4BH7A 2AEIT 1NC2D 4DHLA 1VESA 1XIWD 3OF6A 2FO4A 2NY5C 1PKQA 3V5DB 3SE9H 3CXDL 2AK4A 5BS0D 4K5OA 1SY6H 1NGXA 1Y18A 3SGKC 1ESOA 1WCQA 1U91B 2GIXA 1LNUB 2YJQA 3RZWA 2DJMA 1AZRA 4TSAH 4KKRA 1QATA 1QWUA 2VISA 3EJQA 1U2HA 1UZ8B 1OHQA 4FQQA 5AOMA 1KB5L 2QSTA 2HH0L 2W60A 1SYVB 1ZGLB 1AKJA 3CVIH 2ICES 3WIIH 4BXVA 5IQ7H 1XR9B 3CNKA 3LVTA 4XRCB 4JO2L 5AW5B 5BZWA 3VDBA 3PABB 4LL9A 3UJJL 4EQ3A 5DRWA 4NKIH 3QFJE 2PXYB 4AYSA 2J43A 3WHXB 4EI5B 4DP7X 1N8ZB 5T33L 4X4YB 2P24A 1PG7H 2XN9A 3JV4A 3L7FA 4NRXA 4OY9A 1SOSA 4XAKD 1A4CA 4Q6IC 3Q1SL 5D2NE 1NIEA 2BSTB 5DZNA 4ZFGL 1JMXA 1MUJA 3LS4H 2JFCA 1JGVL 4ZDHB 1SLVA 4I2XB 4PU2A 5TFSH 3FUDA 1T1XB 3EO9L 3RX8A 5HI5C 3DSFH 1JF1B 4NZDA 1CE1H 2JLPA 3VFWA 4J3XA 1AMXA 1FBIL 3PHOA 4AEHH 5FOBB 4QJ3B 3QQ9D 4KJQD 1QTPA 1WFNA 3LZFH 4MKMA 1MKFA 3ASWA 3UCRA 1R19A 1DFXA 1MRFH 2WNKA 4GQPH 4H8QA 3RU8H 4DJMA 2K8QA 4M4RA 2IMMA 4YGVB 2CO6A 5L2KE 1KTBA 3DUSB 1LEGA 2VT0A 2VH5H 4JFFD 1RUPL 2G30A 1EDQA 3MGTB 2O5XH 3NMEA 2AABH 1AXTH 4YSPA 4YR6A 4P06A 4M62H 3WIHL 1FSKC 4YHZH 4UTBA 3MODH 3ALXA 3QEQD 4TPRH 4D2NA 2VQTA 3IFPB 1JHLH 1TIUA 3CIAA 5CEZD 3PDOA 2F68X 1YEIL 3JSSA 1UZ6E 4L1BA 3MRMB 5A2AA 2X7LA 3VMNA 2NSQA 1AGCA 1KENH 3U46A 2K45A 4Y5XA 2XKNB 1NUDA 2GBVA 3UYRL 2H1PH 3WSQH 4I77H 3V6BR 3FZUD 3OM3B 4FLRA 5CSZA 3T0AA 4I18C 1YNLL 1ED3B 5D5MF 1FHNA 5E6IB 3L4TA 4E5XG 3W39B 4LFHG 2EO7A 4G6JH 4K5NA 1TQBC 1EGJA 3AG4B 3Q06A 4G6AD 1FH5H 1JOIA 3SDCB 1UD8A 3ZHKA 1IBZA 1A02N 1QPPA 3H9ZA 3RWCA 4DH2A 4XXCA 1OEZW 1A14H 1MW3A 43CAB 1YA5A 2KLTA 4W1TA 4Z7WE 4J5VA 2BCMA 1B0GB 1MLBB 2PYFB 2WXJA 4XE0A 4R4BA 1OOAA 1C12B 4OLZH 3JBG7 3ILEA 1JHKL 2W0FA 3FCTB 3CSPA 4PHZA 3TVMD 1JFQL 1TO4A 1G7PB 3FONB 3HA0A 3KPRE 4NQDE 1KT2B 2WVSA 1R5IB 4LKCA 1A22B 1WBYA 4JQXC 3M45A 1MFDH 2X4SB 3II1A 4QI3A 4CBZA 3NA9L 3JUZA 1ORQA 1Q9WB 5LHDA 4N0UE 5JTWA 4PTTA 4R3SB 3V8OA 4NERA 4LOEA 1WWAX 4PR5A 4RWHA 4N86A 1MFMA 4AMKL 1OCOB 4K7PL 4N1CA 3CDCA 2L7UA 4PJIE 3PJSB 4WUKH 4J2XA 4KTEL 1EAOA 2X40A 3PHQA 5CD5C 1INDH 2RHEA 2O5YH 4WHCA 2GK0A 2XT1B 4X6CA 1MREL 2VC2B 2FLBT 3UO8B 3DI2B 5F96L 3ZU8A 3MZTA 1QSED 3W57A 3MBWA 3VFGH 2N01B 1PSKL 4BELD 2HA1A 4YIQA 3BWAA 4ATWA 3QO1B 5I1GL 3VXPA 2XN0A 2WBJC 2AXGB 4H26A 3ZE0E 3DRTA 1S46A 4PRID 3MNVB 1MJ8H 1HJBC 1M7DB 2NR6A 1SJEA 1FCCA 4H0GA 4JDTH 5GJTL 2F7OA 2VITB 5FO7B 2AGJL 2AJVH 1KCUH 5E99H 3B9KA 3TO4C 5MHSE 1UCBL 3TA4D 3GXIA 1NGZB 4GY4A 4WIQA 4KK6D 1E2VA 1GY1A 4MD4A 4E9RA 5IB5A 2BXYA 1K5NB 4NQVB 4F27A 1BPLB 5F6IB 4XBMA 3MUUA 4XP6H 3O41B 4PRAA 2X05A 3U0PB 4QT5A 3O2VH 5LVEA 3LIZL 4HS3A 3WOVA 4P5TD 1ACZA 1TMCB 5CNHA 4R6UA 5E00A 5HJ3B 1X5ZA 3E2HB 2R2HA 1E27A 2CDGA 3WUZA 3N41F 7FABL 3S5LA 1G7JA 1RIVH 3JYCA 2PP8A 5I1LA 1MHHA 2JNZA 5PAZA 1C16B 4ZO6A 3SYAA 1HXMB 5CILH 1J5IA 2ZAGA 4LL4A 3APMA 1OT2A 4FZ8H 4DUWA 1CU4L 2KERA 1F1GA 3MRHA 4GT7A 4HCRH 4MLSA 4NO0D 2MSPA 3BPLB 3QDJE 4B9IA 2ICWJ 3Q6GH 3LH2H 3ZOAA 1F1DA 1WP6A 3MNWA 3S3DB 2AI0H 1S7QA 3JVGA 1BZ9A 3OLGA 4XCNA 4JPKH 5DRZB 1WEJH 4U1HA 4L3ED 1H15B 1T0NA 4XPAH 1MCBA 4IDJH 5C08D 4MYWB 5KANG 3E1F1 4P59L 4GG6B 4FTVB 4PV9B 5B39G 2JIXA 1U3NA 2YZ1A 2CDEA 1L3NA 3HPJB 3L6FB 4GSXA 4HIIA 3RVVD 5KEZA 3SY0B 1OGSA 5GGVL 1MQKL 4L5FE 4Q56A 2MPVA 1SF3A 4XVOA 2HFTA 1HAUA 4HMDA 2DBLH 5T3XD 2CBMA 2PETA 32C2A 5FLVA 3QULB 3HI5H 2E76C 3CBRA 2BSBA 4OCXH 3HI1A 3VI3A 3GMOB 4P2RB 4AW4A 1S6NA 5F3HB 4B97A 4E5XB 4EN3D 4LVEA 5AQ0A 4GXVL 4DP6X 3SPVB 3MCKB 1QNZH 1RU9H 4BFJA 1LQBC 3OKNB 4LXFA 3P0VL 4OLUL 5JOFA 3V52L 4FQ2L 4XO4A 4DGYH 3DURB 3N9GL 1BM3L 1F4WH 4Q52A 3BH8A 5F8RC 3SE3A 3BAJA 1ZSDA 4P23B 4FE9A 3OLEA 2WLJA 4HIEB 3WKML 3FQRA 2F58H 2FHFA 2JCCB 3CU1A 3DYMA 3IPFA 3V4VB 4LCWE 2OJ1A 3AS0A 3QJUB 4HPOH 1C7TA 2MPAL 3FOMA 5FCUH 3FYEB 4KAQH 4N25A 3QUKB 2W65A 1HHIA 2XXFA 4ZSOE 3GGWB 1CFQA 1CZ8L 1JI1A 5IK3A 3DMMC 4K8RL 4WNJA 1CGSH 4QTIL 2VDQB 4K3DL 3BQUB 1U8IA 2WZ6A 2R4RH 2GC4C 4KK5D 4J3SA 2DW5A 5LNGA 1EJOL 2Z7ZA 4H1LA 3MRQB 4FZEL 3ZL1A 4Q6KA 3V0HA 4PJHA 4WJKB 1KIUA 4G8FA 3ILPA 1S78C 2A6JA 3G5WA 3VXUA 2EEBA 2XPZA 3K2IA 1MJUH 4XB8A 1EO5A 2EIKB 5BMFL 3AXIA 5EEWA 3ZTNL 1CG9B 4YHPB 4KDWA 5DC4B 5CEZH 4IDLA 2B5IB 2D0HA 1HZHL 1ND0B 3MLTA 5C6PB 4KRPD 1MLCB 3BIKB 1QR4A 4NNYA 4NWUH 1A25A 5CEYA 1YY8A 2PR4H 5ECJE 1HZKA 2QADB 1CF8L 2N59A 2GG1A 2NYZA 3CPLA 3HUJE 3TS8A 2CKBH 2E7LC 2NW3B 3NSCA 3QXAA 3C8HA 3OKDB 3PGCB 1AR1D 1BD2E 1BZDA 1EQWA 4LMQI 4FS0A 3OJ2C 4JANA 5I6XC 5BVJA 4GG8B 3EGXA 4KO6A 4APQD 2P5EE 1AGEB 2WLNA 3ARXA 1KCKA 2AJSL 3VGGA 3P0YL 3ARRA 1I7TA 4KQ0A 4XAWH 3IFOA 2AVFA 1I1AD 1ZANL 2ORBL 4PBDA 3BDYH 4O2CB 5E4AA 4TNWF 1OANA 4JPWH 3KYNA 1DBMH 1C5DA 5IJCC 2IDTA 3NIGF 4G7YH 4IW4C 4K4KA 5D96C 5HGBA 2WIIB 3KDPB 1KGCD 4WLCA 2ZUUA 3UH8A 5DGRA 4M9PA 2WXHA 4J3OF 4CDGC 2IDFA 3EOTL 5IFHL 3TBSB 5C0EA 4N2CA 1TYRA 4Y5VA 3BGMA 4NGHH 1PKQE 5IHUL 4OUOA 5EZJB 4AOFA 3VWKB 3D69A 1A0QH 4XN2A 4D9RE 3VD7A 4L3CA 4C57C 2F54E 3I6SA 4FNLH 1V3MA 3VFTB 1E65A 1S7RB 4XNQB 4OF6A 2R2BB 4GW4B 1KYOJ 5FA3B 2WM0A 3HE6C 3V0GA 5B39B 3BRGC 2C26A 3EOBA 2HX8A 1CYXA 3L5JA 3TNMB 4KOCA 1T3FA 2L7EA 3MGOB 5D6CB 1HI6A 2NLJB 4N90D 2DM2A 4U1SA 1KPRB 4MB4A 1OPGL 5IFJA 4XN1A 5AZ2L 1G9NH 1UT1A 2BP5M 2OMYB 3GBMH 1L4IA 5MERA 4JFYA 1V5JA 3R8BB 3ZMRA 4AT6B 2AFNA 4NBXB 5IV2A 4XE5B 5EIVA 1YEJL 4OBRA 1JV2B 2IC2A 3F6JA 1CICD 5DC0A 4XNMB 5AUMB 3MLPA 2NZ9D 1MDTA 3PL6D 3WGVB 4KH9A 3FF7A 2HX7A 3OLDA 3OHMB 3H7BB 2IDSA 1NINA 5TDNA 4MD5B 3GMNA 5FYKE 5I0ZA 1SJHB 3MFFA 5ADOL 4Y16D 3FO9B 4XP1L 3FFDA 2CCLA 1PBYA 2YRBA 3Q2WA 1ZHNA 5J1AA 4AJ0A 1UGKA 2OFQA 1JZ3A 4M00A 4XOBA 1GAFH 2WO2B 4MNQA 2HLAB 5GRUH 4WTZG 3QORC 1A6TB 4Z95L 4OIIH 4HP5A 3VXRA 3WY4A 1AVAA 3AREB 2J5LB 2Y2WA 2GY5A 4OCNC 1XGYH 2BMKB 3BEWB 4ALAL 5LGHH 5J11B 2C3HA 2O5ZH 5HGHA 2X38A 3KLHC 1UD3A 5F1IA 5AVSB 1A2YB 2V9UA 4UTCA 1G9EA 1IKFL 4IIQB 3T2NH 3AWGA 2CJTA 4PJFB 3BP6A 4FI6A 5HHOA 2X44D 3A0OA 5GIRA 4YNYA 3S48A 3MA9L 4AIEA 3TP4A 2IGFL 1NAML 5BV7L 5IQMA 1MFEH 4Z3TA 3D3VD 3QWNA 4GSDL 5E4EB 5HXMA 4L8CA 1UCTA 4PJAF 4EDXB 5C0IB 3ZKNC 3HN3A 4ES9A 1MWAA 4QHKJ 4JPSA 4N5EC 1HINH 4PLJC 2L0DA 5E70A 2GSIA 4BK4A 4X5XA 4AQAB 3KXFE 5KSVB 1MCHA 4Y4HD 1P7BA 2F5BL 5C0GA 3S36H 2GJZB 3T0DA 2HKHL 1IGYA 4XNZC 1Z3RA 4AKOA 1R3HA 5IZ7A 3IDMA 2OQJB 3HG1A 3ULVD 4GS7B 3U0WL 2UZXA 3BP5A 4DFHA 5K9OA 2ICCA 4MQ7A 2CWRA 4XXDA 1DSFH 2NZIA 4PTUB 1BIIB 2BC4B 4NUGL 3F62A 4UQ2A 3ARDB 5IF0A 4IQHA 3T77B 1O75A 1A3RL 3RG1C 3R1GL 2MNWA 4UTAA 2XTJE 1RJYA 2IAMC 1B4JL 5LDUA 1WICA 3ZSTA 4BSVB 3IFNH 1CYWA 3EJUA 4W81A 3HBZA 3PHAA 3CN0A 3SPIA 3US1A 4NJ9L 3DX8A 2QL1A 5D72H 5GGRA 3SN6N 2NY2C 3IDIB 3OKKB 4YBLB 4HVBA 5GRVK 1B2YA 5FECA 3QJRB 4MLIA 5AW3B 4A39A 4P46A 2A0LC 2NY6C 5CHNA 5FYJE 5I66A 2CQVA 4QYOB 3X12A 4NQXA 4X6CE 1PGRB 1W9XA 2HX9A 4PS7A 3L1EA 1THCA 2YFOA 4WTWA 3IVKB 3MV9A 2XCMC 5KVDE 5EF1A 4GIOA 1IC5H 4ETQB 4HKXA 2KZ1B 4JFEA 3QZBA 4OKDA 4F33A 1CF1A 1LQSR 4BFIB 1PDKB 2IG2L 3O6FA 4P2OA 3VU2A 1J0ZA 2O5NA 4OM1H 5FUZH 1IAOA 2HT3D 1MRDH 4HZLB 5EFIB 1IB5A 2ZP8A 3BKJH 4J3WA 4OQTL 3VFMB 4C4UA 2X4TB 2X4UB 4HGWA 3L54A 3WFHB 2VLJB 4PJ9A 2NY3D 3K71A 1T1YA 2BSSA 5AENA 4KROD 2FBJL 1NICA 5T5NF 2CPUA 2MNUA 4P07A 4W6XB 1DCEA 3BZ4B 1JUFA 2GJ6D 4H8WL 4W93A 4ZPVB 4Y19B 3UAJC 4JM2C 4Y9CA 1JTTA 4L8BB 1GVIA 4NNPL 5A6LA 4PRHA 1D5XB 1SRDA 2C7FA 4XVTH 1XSOA 3Q9PA 4X4XA 3L48A 1MCPL 5I1IH 4FFZH 2NW2B 4YDLC 4QRRB 5D6DA 1UH2A 4WTXA 3PWPE 1R5WB 3FMGL 3AT8A 3H9SB 4PBWD 4UT9A 1Q94A 3WE6B 5GS2D 3BP7B 5F7HA 1ZLVH 2HWZL 1TJGL 4HIXL 5KTEH 4U1NA 2AQ1A 5BO1H 3CPUA 1J1OH 1NTDA 3IAGC 4C8XA 1CDYA 1KACB 4JQVC 3GZPA 4V2CB 2GKIA 1CBVL 1R75A 2QR0A 2X2YA 3T3PF 3I9GL 2IQ9L 3WTWA 2C1PB 3N2JA 5LXVA 1JBJA 4HQQH 4JREC 4LASH 5AOJA 4HSCX 3ABGA 3DVIA 2HRHA 1WZMA 5KYXB 5IT2L 4Y7OC 1GKOA 2VMEA 5F88A 5T1KB 4BQ9A 2DI7A 2YKLH 2LU3A 3VI3E 3ZO9A 5T3ZE 5IB1B 1JXDA 2A73A 5C0BB 2XZZA 4POZC 5IVXE 5SWSA 3SPGA 4DKEL 2ETWA 4UZGA 3G6JA 4GBXB 4GAYA 3ARFD 3GMPA 2UZIH 5J3HD 5SX5H 1WD9A 1YMHA 2EKJA 1QFWI 2DMKA 3T3PE 1VB9A 5D1ZB 3U2IA 3UXFA 4EO5A 2NUPA 1CT8A 1CL7L 4ORGB 4UANA 5EO0A 1K4DB 3RWEA 2DWXA 4M7JH 1MFBH 3BVNB 1DN2A 2B9BA 3RY6C 5EIIA 1RIHH 4TQPA 1ZLSH 3BMVA 2W9EH 3QAQA 3ML8A 3WO4C 3GIZH 3PGFH 4BZ1A 1D5IL 3EG9B 2A4CA 5H2BB 5EZOH 4CC0A 2VDNB 4JNXA 1MI5B 1YMMA 5I71B 2EACA 1U9KA 4J3VA 2B1HH 2Y5QA 5MP6H 1NANI 1TZIA 3CC1A 1CTNA 1DVZA 1WZLA 1XMWA 2JJTA 1DSWA 4TTDC 4GP8B 1KBGH 4GXUN 3RPKA 5GS0H 2EUXA 3LKOA 2PF6A 1DQDL 3DUHA 4CADB 3FPYA 1OD7A 4NFCA 3HS8A 3RWDA 3MRIB 3CTTA 1A6WH 4XX1G 4NIKB 5KYYA 5DHDA 4PJHE 3SJVA 4ZUWA 4OF5A 3O6KH 2R9HD 3IF1B 3GXNA 4GSQA 2PXYD 1U0QA 1SYSB 1PW3A 4EI5D 5FO8B 3O2DH 2APBA 4YQXH 3TT1L 3MRPA 3HBQA 1WK0A 4EKXA 1EERB 2J1KA 4JJ5B 4S2SB 3MYJA 3G6AB 3PWNB 3UIYA 4F8OA 1D9KB 1CXLA 1RULL 3O6ML 3VSUA 2MQCA 2EIZA 1P4UA 4FXGB 1QYGL 3B9DA 3OG6B 3L7EB 3GMMB 1HHHB 2JWYA 2QHLA 5DMGC 4DP5X 1I7UB 1THAA 3F05A 3CJJA 5JW4N 1SM3L 4LSPH 1OTUC 3N0AA 1JF5A 1VCAA 4RQQB 4LPXA 3UPCA 4D0BA 3CZFB 1A9BB 4WWKB 1QEWB 1MF2H 2APXA 2WHVA 4ETYA 3NCWA 4QOKB 4JW3A 4U1LB 5JMOC 1CVSC 4QTHA 3CVDA 5CIPB 2NNCA 4H88L 1QQDB 4G5AA 1HYRC 4QHUA 4GO8A 4OFDA 4P0DA 3RIAK 5E1IA 4BV1A 1W0VB 4OUUA 4KJPC 4G7QB 3B34A 3G5XB 4XMTA 2NSXA 5DK2A 2JKSA 1S7SA 4GRLC 4PP2A 3V79C 4J8RB 1WV7T 1WFJA 4J6RL 4U1GB 1LJMA 3QDGB 3FU6A 4N2KA 5LXGH 1JMZA 1JJUA 5T1MA 1LL1A 4J4PC 4U3SA 4L4TB 2X6VA 5E6ID 5EUOE 1X5XA 2COQA 1NOFA 4OZ4A 3U48A 5J13B 1WC7A 3D25B 2QGDA 4AKQA 3ATEA 4PS3A 3SDCD 2EVIA 3WXWL 5AOKA 3FSAA 3MBEC 2C3GA 5L88H 5EUKB 4OFYD 3T6WA 4Z7VF 1EBPA 3F7VA 4GLRH 4Y5YB 2VLLA 3ZE1B 5I30H 2ZXAA 4PJXA 4OF8A 5JOPD 4P2QB 4FABH 3OKMA 2EH8L 2XZQL 1DJWA 1N12A 3SDAB 1CXEA 4WW2F 2VM3A 1Z5LA 3MRRB 3DVNA 1OHZA 1F2XK 1PNCA 5A43C 3W38A 4CW1A 4EXKA 5DZJA 2ED7A 2WZ5A 3QJSB 3OAUL 4JO4L 1KIPA 5HHPB 5EMYA 5ACZB 3ME0B 4OCSL 4WI0B 3RJOA 4ZMQA 1D3CA 3K6FA 4ICXA 3NFSH 3FT3B 2FX8L 4EDWH 4WFED 2OP4H 2XN2A 5SX5K 3BVTA 1WT5A 4GO6B 4ZO7A 2AK4D 3MRNB 2VLKB 3WTTA 4FQXA 1LK3H 4F58H 3KZ8A 1B2WH 2BHZA 5IJVA 5J6HA 1S7VA 4GW5B 3QQNA 4PREA 3WNMA 3GJFH 2A74A 1E4KA 5I1EH 2VDRB 5FKAB 3WFBH 2VDPL 3PUCA 5GZNC 4MVBC 3VXRE 3DPBA 5I17B 3LTVA 1UXWB 1FO0A 4UV4L 3DO7B 4WV1C 3SCMC 4R4FH 1EEYA 1EZSA 1VADA 4J3OD 4ZTPL 3QUMH 2CMRL 5HGAA 1J05A 2DL9A 1K8IB 1NDGA 4JDVA 1BVOA 1IT9H 5GS2H 1UA6H 1TVDA 2B8OT 3ZE2B 3EIFA 5FB8A 5AB9A 3RZCA 2WMPA 2GI7A 1NGYA 1RUAH 3ZYIA 1NCTA 1HSBA 2ZX7A 5FCSH 1I4FB 4JG0H 4I9WD 1TQUA 4OCRH 4MMZB 1EJ8A 1T1WA 1HSAA 1H8NA 2XN9D 5AW9B 5C09B 2H45A 3KYOA 1OM3L 3UABA 1O7DE 1G7MA 2E4FA 3WAKA 3T0VA 3UCQA 1U4FA 2GTZB 3A67L 5F3BA 5IMKA 3RB5A 3U6RA 4G9DA 2K3TA 3ABZA 3PHSA 1Z9NA 3DTXA 4DGIL 1MCKA 5F0LB 1F4XL 1SUJA 3NBNA 5AYUL 2CGRH 1M57B 5MENB 1H19A 5DHEA 3TNNB 1CB4A 3E3QE 1EMTH 4BKSC 2CA4A 3HG1E 4JE0A 5B7FA 2FSEA 2PW2B 4XNUL 5TDOA 4FNRA 3VXMA 2QHRH 4M8VA 3GSOA 5JPNB 4IBZA 3QQDA 3DA0A 2DWYA 2AV1B 3CFEB 3K2KA 1P5VB 4EBQH 4X6FA 5ABAA 2P49B 5DK0A 1VFAB 4FQIL 4XVUC 3ZX1A 5DD6B 4K2UH 3THMH 4A7UA 4LK4A 3I50L 5FDWB 1G4MA 3X1GA 1P1ZA 2WYZA 3KGTA 3QO0A 4Y88A 3TBTA 5F8QC 2FIKA 2BVEA 5HJBA 1N4XL 3V10A 5HP5A 3F12A 2XV2A 2EE6A 3P4OB 3NOIA 3UMNA 5DHVA 2AAAA 2O6DA 1RI8A 4FTVD 4S0HA 2I60H 5F7LB 2TAAA 4UIKH 3C8KB 1P7QA 2VJ0A 3R06A 3IPBA 5L9DL 2K7QA 5DJAB 1CLOH 1Z7JA 3E9TA 3KBPA 5CGBA 4F7KA 3T6VA 3IKCB 4DOHE 1JRHH 1GGIL 4LPCA 3D8MA 1IBGH 4OM0L 3RGVA 2BSRA 1L7IL 2MMXA 4RZKA 4I3RH 4P2RD 4C4BA 1I9JL 4PW4A 3ULSA 4A04A 1PFCA 1QBMH 1GC1C 4IOIB 4LFHD 1TETH 1C08A 3GSXA 3MV9E 3OKLB 1QSVA 1VCBC 2EO1A 2WZ0A 1BP3B 3IBOA 4IRJB 2ZG1A 3LNGA 3CH1A 1RZFH 1P7KA 4YPGB 5BPPA 4WJG3 2DQIL 2I69A 4A6YH 4P23D 2XVLA 4NKQB 1NCIA 3L2NA 5T1DH 4D7PA 2YWYA 4ADGA 3OMAB 1QI4A 1G7HB 1RP8A 1QTYT 1BFOB 1T0OA 4M93B 5DJ2A 3VXTA 3JWDC 4W9EC 2H2PD 2FJUB 2LAAA 3OJVC 2FZ3A 4HX1A 4LSTL 4I0CC 4KPHL 4HV8B 1H3WM 4G1MA 1GS6X 2A6IA 2V5RA 3ES6B 4U1IA 3T4YA 5D1XB 2V2TB 2YLHA 1FLRH 5F1OB 3P9MB 5E2UH 1T20B 5IG7A 2H6PB 1NMCB 1RK0A 4FGMA 4KQ4L 3GHPA 3BQUD 5C2BL 1UWXK 3ELAT 2VE6B 2M1KA 1F4YL 1JS4A 4YDKH 5IJKC 2G9HB 3GRWA 1EANA 4JL1A 2WXRA 5ALCH 1XWVA 4V1DA 1JTPA 3DLQR 1EXHA 1QSEE 4Q6IA 2YXMA 3GJFK 3PXJA 4H4NA 3U7YH 3D2UA 3D51A 5CXPA 3S37X 2X6AA 1RSYA 3MCLH 1PMYA 2X1PA 4TXVB 3L3IB 2DRUA 1KTDA 1J0KA 4WFGE 4FXKB 3BN3B 4MXWL 4QRAA 5GGUB 3WN6A 4ELMB 1D6VH 2DWDB 5I8CA 1DEDA 5I1KH 1CD1B 3VRLF 2QADD 3G6JF 5EU6B 4AW7A 3WTUA 5FC9A 1VFUA 1DVXA 4U4BA 4UB0H 4BCZA 2YAQA 5HYIA 4PEEA 4MX7A 1KYDA 3O9WC 3QG7L 4LVNB 2EIJB 2YGQA 4YAQB 4QRFA 2VXSL 1JNHA 1RHFA 2ATPA 5F0MB 4AQ1B 5I0DA 2X53A 1FJ1B 1FFQA 4HWZA 2CBPA 1WBXB 5DVOA 1SBSL 2DQEL 1U58A 2DQUL 2WCGA 4JBSA 1NMBL 2IADB 4JPVH 4BFGA 1OW0A 1ZLUH 3VW3H 2C9PA 1U8PB 2NY7H 4IMLB 3G6JE 3EBAA 4UM9A 1HEZA 1UKTA 1XSKA 4N9GA 1AHWB 2IV8A 4TUOB 4RRPM 1NJ9A 1PLCA 2WWOA 2ATKA 1Z9PA 1KXQA 3IJYA 3ASOB 3M07A 4NBYB 1JYWA 2FX9L 2DDQL 4BXSV 5IHWA 4I18A 2OXGA 4N2BA 3CHQA 1DJZA 2BX5A 4X6EB 3LKPB 3G9VA 3HRPA 3FCSB 1E30A 3E6FA 3IDXL 3O11B 5D71H 4I85A 3GFUA 3VWKD 5HHXH 3FQUB 1KDIA 3UGXA 3WXVL 5I15H 1EEZA 3VJ6B 4FNUA 3WDIA 4LL1A 4MRCA 1YMME 4F7TA 1HCFX 4XP9H 2DQ6A 2YUWA 4YHYC 1BA9A 5JHLA 2VC2H 2A38A 1BLNB 2EUWA 3DIDA 5I26A 1BG1A 1E43A 4E41B 5CWSB 1FNHA 3C60C 4J3OH 3RTQB 2VR8A 3QIBA 3VFSB 2WWKO 3ESUF 3CZSA 3MV11 3MREA 3MCG1 1TZ8A 3C9NB 4GRMA 3BESR 3EYUL 4KKLD 4XCCL 4O5LL 4TL4A 2NOYA 1PPIA 1HIML 3OR7A 2XUWA 3QJVB 2FHCA 3F01A 2EDFA 3BZEA 3KWXA 4IOSD 4O2FB 4AE1A 3S88H 2WP3O 3Q48A 4F57H 1HH9A 4UMSA 5EF0A 2NQ3A 2EICA 1I1FA 4JPQA 1TO5A 1KXVA 5BO0D 4HC1A 2FT6A 4K23L 1JG9A 4LAQH 1E8WA 5HDQH 3ZR5A 3E7JA 3JV6A 1JGEA 4AGPA 1U8CB 2ZCKL 2MOVA 3SKMA 4UINH 2NT1A 4R90L 3FRUA 2EYTB 4DVBB 1WLHA 5K9QG 5E24E 4KVNH 5CMAB 1ZK9A 2BK8A 2J21A 3DX0A 4ZTOH 2HG5B 3CVCA 3ARED 2MCMA 4KKNA 5C92A 1VFMA 3T8XB 4PW3A 2HRPH 3GLAA 9PCYA 3ALWA 5DQJA 5E6UB 1DQQA 4O58L 1ZHKB 3L9RA 3UYPB 3IMSA 4P9HC 2FE0A 5IKCB 3VXSB 2Y7OA 5D7EA 2GITA 3BH4A 4L1SA 3V6ZA 1ZV5A 1UOWA 2OMNA 4OVVA 3LN5A 3QIWC 4PJXF 2BNQA 4E9LA 1N5AA 4DAGH 4YS4A 4G8EB 3ULUL 3B2MA 5C8JA 1UB6A 3FN0L 5A2LH 4DPAX 2H47C 4ZDHA 1SBBA 4I2XA 2F5AL 3GSVB 3EH2A 4PV8B 2NXYB 1FYTA 2I85A 4S1DD 4LCYB 3MSPA 3ZZ1A 5G4OA 1JGLL 2QSCH 1T7WA 2VLRB 3GJEB 1AY1L 4HJTA 1OT1A 4KI1A 5FOBA 4KVCH 1QLEH 2XY1A 2YPKA 1CFMA 1F13A 1TZAA 3L4ZA 4PJXE 4Y1SA 5DFVD 4R7VA 1PYWA 1FSKB 1UXSA 2BDNH 3QC6X 4G9FB 2DLGA 3VFVB 1DP0A 4APXA 3PQYA 1MY7A 1D7FA 1S9VB 4JY5L 2C4FT 1VZIA 5FKPA 3VU1A 2QGEA 3M1BA 1MCIA 1JXKA 3DDFA 4PWGA 1XH2A 2ARJQ 1RVFL 1Z0NA 2AJUH 5E0QA 1MAKA 1BXVA 4ODTL 3G5VA 3IFPA 1DLHB 3NABH 1ZLUK 5IBTH 5I1CH 4ODXB 5DDHA 3MRMA 2ZCLL 3QI9A 1RZQA 5JIIA 3RGBA 1LE9A 5C86A 1O9WA 1J18A 1TQBB 3ZKSD 3MRJB 3VXQA 1ZE3H 2VDQH 1ZGLP 4HKJA 2ZXDA 2VCOA 3PAUA 4LEOB 4MJID 5I8EA 5CJ8A 5DWUH 2E6PA 3OXSA 1OAUH 2OJEB 2O93L 3N1QC 4MA1C 3RNQA 3UZVB 2W59A 4ZAKB 3RDJA 3TN0A 4S1SL 2NY4B 2XJLA 3FTVA 4QAWA 5BCAA 4TNWK 1W72L 2R4SL 3HAEG 4P5MA 3IJHA 3CFJA 4N90E 3MOAL 2Q8BH 1NBQA 4FJYA 1QW8A 3DX7B 3LEYH 2WWMD 3VQLA 43CAA 1WFIA 4G8GB 3HHSB 1OF2B 2YHGA 2BOLA 4AYDC 4L4VA 1VEOA 4PUBL 2CDFB 2LAGB 2UX6A 3EYQD 4UOW1 4M43L 5TPWH 3QT2A 5ALBH 3FONA 5C9JA 1KT2A 2BVPB 1IL1A 2F8VA 2WLIB 5DJ6B 2VZTA 1TMQA 3MV01 4LPYA 4YHML 1SXCA 4A2GA 2FECI 3S8FB 2HJLA 1C9SA 4QXTA 4EUPA 4WEMB 3R7QA 2Z6FA 5JIKA 1A9VA 1FRGH 3IJEA 1D7DA 4OAWA 4Z3JA 3CWGA 4YHOL 3GSQB 4FYSA 1ZA6B 4DCQB 1A1OA 35C8H 3DECA 4Q4EA 4Y19D 2DIAA 3PJSA 3AQXA 3KWWA 3TJEH 4PJ8A 5GSRA 2CM6A 4OGXH 3O8XB 4G6KL 3FRPG 4MA7L 3VFPB 3VXME 2WBJB 3VQ2C 1J86A 4OJDH 3X3GL 5C97A 1ZT1B 3EJTA 3IXAA 1IQDA 4E68A 3QEGH 2RBLA 1KJ3H 3ESMA 1QA9B 3GMRB 1U8OA 3JWOL 4MB3A 3H9SD 3PV6B 4PJDA 4AC2A 3Q01A 4B60A 5IEKB 5MEOB 2NYYD 5H4ZA 1L7TL 2CLZB 1AXSA 3CN2A 3TO4B 5DMIH 3AQYA 4OZIB 4WJ5A 3UC0L 2EXTA 5GSVA 5HHOD 3TA3C 3M8OL 3T6QC 4NO3B 2G4EA 2BWQA 5TGBA 1NLBH 4IRSC 3ISRA 2OSLA 1A66A 1T5WA 2NPLX 4QY8A 3BRDA 4OIFA 1WS8A 1NGZA 4IHBA 5A16A 4P57A 1TF4A 5JR1L 1OZTG 3TO2B 1K5NA 1I7ZB 4PSPA 5T1KD 1KWGA 4LDEB 1MW2A 1TOXA 3OTTA 4YSTA 2Q8AH 3A6CH 3LMJL 3G6DH 5C0BD 1G9MH 3I02A 3T6XA 1WISA 4NO2A 3ULVE 1LO5A 4KMQA 1BBJB 3FSZA 4GBXD 4KZ0A 4YBHA 2R0WH 2CJUL 4PGCB 4N0CC 3LCYA 5D1ZD 1QUNA 3GDCA 1ZLWH 4LF3B 5TQ0H 4R7XA 5BVPL 5KVMC 2FBOJ 1Q38A 2J2ZA 4XXWA 4Q9RH 3NSYA 1Q1PA 3EO1A 2ZONA 4I5BB 4X8XA 15C8L 3P11H 4A38A 3FUKA 3LB6C 3MXVL 3NIFE 4IJ3C 3IN0A 3H9YA 1H15A 1JPFB 3L5HA 4ONFH 4UOW0 1MI5D 3C2AH 3LJ3A 4PV9A 4QRPB 1MCWM 1V3KA 1EFQA 2FH8A 3HPJA 2WUBL 1NCBL 1QLRB 2DM3A 3B5GA 5LBGA 3FBQA 1J9TA 3ARGC 2YBRB 3TYGL 3SBWC 3EJJX 3ZQXA 3QULA 4GI6A 1L6XA 3SZ6A 4H1LH 2YD2A 4LSSL 2A9NH 1KPVB 1OV8A 2GIYA 1GPOH 2VYRE 5MEPA 1WCBB 4NOFA 3NGBB 5F3HA 4E5XA 4Q9QL 3GK8H 3O4LB 3S97C 2C1OA 2Z1PA 3IFLL 3HFFA 2ROYA 1LMKA 2XFXA 4LLVB 4WNQB 5E94B 3NQIA 4LLUB 5JXED 1PG7X 1I8IB 1BIHA 3EFOA 3I6KB 1C1EH 2ZQKA 2NXZC 2XRAL 4TUJA 3HAEB 1D5MA 2Y3NA 3CMOL 5D7JA 3RVUD 4O02A 3DURA 3TWCL 3BEVB 1DL7L 1ILUA 4GKNB 1D9KD 3OB8A 1RUQL 2WVTA 5FGRA 4Q58C 4HIEA 3DMMB 4P4KA 4AL8H 2HRLA 4JG1L 1LWRA 4ZFZB 4PYHA 4NOBA 4YDIH 3HZVB 1AGDB 5IUSA 3PPSA 4IBLT 1MFNA 2WLYA 1INEL 4U6VH 2K7PA 2XPGB 1RK7A 4ZUTA 4KNUA 2FR4B 4F5CA 4BFEA 1WTLA 1SHMA 4NNXA 2Q86B 1SJMA 1KJVB 4FQPA 2Z7WA 3GS0A 1CQKA 4WWKD 4XP4L 1XF3B 4Q89A 5B3JF 1AGFB 1QFWL 3TFKD 1FH2A 2R69H 4NWTL 1MCLA 4J1UA 4QOKD 3QDMB 2NX5A 3GHBH 5J06A 1A7BA 4DETA 1OCRB 4MZIA 4EF3A 4FQLL 1A3LH 4FHKA 3MJ8A 1FL3A 1OOWA 5EBLA 3W9DB 1ZSHA 5DA0B 4JHUA 3V0VA 3KM2A 3HE7A 4RGNC 1CPUA 2X5PA 3P3YA 3UTOA 3W37A 2BWIA 1Q9KA 1F4HA 2MIZA 2QPEB 4CKQA 3CZJA 5CJXC 3C6LA 4G7VL 5B3JE 4L4TD 3P9LB 3OKDA 1FN4B 1DJSA 1RHHB 5C0RH 2W1NA 2VDKH 3X11B 5JDJA 4Y89A 3R0NA 1E6OL 3NAAL 4ZZFA 2BY3A 4KKAD 1NC4D 4Z7NF 3BT2H 4K9EC 1R3IL 3VWJC 1GZPA 1H0DA 1U30A 1W8OA 1KB5A 3OGOE 3ZO0A 1KGWA 4P2QD 5D96B 3WKPA 1A6VL 1HKLH 3KL3A 4HKBB 5SWSD 1IFGA 3H9HA 5E8NA 4NN7C 4LRIC 4X5WB 4HWBH 3SDAD 2OR7A 1FAIL 3D4ZA 4NQEB 2GUOA 5I1JL 3WFEL 1KF9B 4HJ1A 3SGJC 4O9HH 2IPTL 5DA4A 1BVNP 4A2HA 2LTQC 2R0KH 4KO5A 2A9DA 1GRWA 2OMXA 5I1AA 1BQUA 1PX8A 4M5YH 1CQYA 4Z7NE 3ZRSA 1EJFA 3FO0L 4HWEH 4HOMA 1O6TA 4QNPE 1E9QA 3HC4H 3SDDA 3HE6B 1JZ5A 2XIIA 3D85A 4R0LA 4ZODA 4R8WH 3LQAC 2VLKD 1QSFB 4XPTH 1ZLWK 5ESVB 5TE4L 2HXAA 5C0AB 2V2WA 3VFTA 4TUKL 3KAAA 4HCGA 3TC9A 4NKDA 2ICEC 2YARA 2H0FA 1BDYA 2P28B 3BFWA 4YSAA 4GAJL 3LH9A 3O3UN 12E8L 1CGTA 4LP4A 1DVFC 3MGOA 4LLMA 1DR9A 3QUYC 4KXDA 4N0YH 3SJVD 4DTGL 5BUGA 1DFBL 1FIEA 2VLME 4ZOCA 1AS7A 1A5FL 3L3JB 2FEEI 3G04B 2CRYA 2GEQA 5EZLA 5I74B 1DJXA 4S1RL 1HTYA 1U8HB 3SPVA 2P46B 2JI3A 3WIHA 2BNQE 3NJXA 2YD8A 5B1JA 1PX3A 5C09D 3TH4T 5AUMA 1P5UA 4O51B 3V95A 5CP7B 1MWAH 1DANU 1N0XH 1OGAA 3LXAA 1ACYH 1YJDC 4TL5A 1I8MA 4JFUA 3GSWB 3MLZH 4I2XE 2ISDA 4F93B 3B2UD 5INCA 4AG4H 4FADA 2HVJB 4U05A 2YA2A 3KYAA 2UYLB 3N1MC 5MEND 1E28A 4XNDA 2BIOA 4H8VA 5D1QB 4HD5A 3ATAA 3CH8A 1BX2B 1A6TA 4ZPTA 2XG4A 3COOA 4C4KO 3CUPB 5F9JB 4IBTA 2W80C 4WSJA 4LLYB 2VDOH 2X9YA 2ENPA 4N2OA 4M3JA 3VMOA 4AQ8C 3B8SA 1W72B 2VDLL 4DQAA 4QO1B 1E2ZA 3IS0X 3US0A 4W9DC 3N42B 5T8IA 4BDVB 2J6WA 4ZW8A 2M8XA 1NPNA 4I48A 3S4SG 4BIKA 4UTAH 4PPTA 1F11A 4PJFA 5EN2A 5AVUB 5IW1B 5I6MA 3UJTH 4NX0A 4Z78B 1OARL 1QFOA 5AKRA 5EU7E 2AQPA 1IBYA 1S8DB 3ISYA 5SX4I 2V33A 1XCTA 3SE6A 2AQSA 2KBGA 1E40A 4XNZB 4HXBH 1T21A 1ID5I 2A9ML 5H37A 1N3NB 1HHKB 5L4IA 1M3IA 1FL6B 3CK0H 3F7LA 3QHFH 5HPMB 3EYSH 2IMNA 5JW3L 3ZJAA 5F7EL 4WK2B 1A3QA 1JZDC 1YECH 4N8CH 4ZUVB 4KZEL 5IB4A 4CKVX 3LRHA 5ANMB 2J71A 1VHPA 5KSAC 2C3VA 4IRJD 4KQ3H 4J7RA 5JOPE 1YEEH 4OGZA 5SWQB 2IAMB 3GTVA 4XHJC 4L4VE 4JG9A 4PTUA 2FEDC 1J8HB 4JN2A 3ARDA 1TQWA 3NZSA 3EF4A 2C3WA 2ITDB 2N0KA 1JCKA 1A1NB 5G55A 1L9RA 2DI9A 3V4UL 1XF5A 1A3ZA 3T2PA 2EC8A 2WCPA 4FFYL 4N20A 4UQEA 2NY6B 2XYCA 1M7IB 4PJDF 5I5RA 3V5HB 5LUMA 2JI2A 4DO4A 1I1RA 3IU4H 4GNKB 3KPMB 4WFEE 3GTNA 1C5CL 1SXAA 1X44A 2EXYC 4MCYB 4B0MB 2IXQB 3LZLA 2GHZA 3W11C 4QGYA 1VKXA 1AD9B 7PAZA 4IBVA 1S7TA 4N2AA 4QYOA 3LIZA 2X3AA 1N0LB 1NCAH 2DQDH 4MJ6B 4Y2DC 5DJ0B 5SX4H 2PO6C 3TIEA 3RX7A 4LHUA 2LGNA 1NFKA 3KVQA 2KMWA 4PJDE 1IE5A 1ZTXH 1U8NB 4XNYH 5ITFA 3QWRA 4CC4A 4DPBX 1HQRA 1XGRA 1R5VB 1MCSA 2CIKA 4UYPA 5I82A 3X3FL 4NQQA 2BVQA 2OMUB 5EU6D 2D7TH 2ADIA 4O4YH 1OLLA 4NM8L 5I1IL 4HFUH 4JO3L 4PWHA 3GD1C 4JM2B 2BVTA 3HW7A 3GXDA 3IGFA 3PWLB 3MLSL 2IOIA 2CLRB 4D0CA 1HXYA 2BVUA 4TVUA 1U36A 5AKTA 2ZTBA 5DJ8B 3TCLB 2NCMA 4YDLB 2QZQA 4J6IA 4M4PA 5DCCA 4KITB 1QRKA 5FOJA 3MI6A 4XBEH 4WU5B 5K9JL 5BRZB 5LQBL 2Z91B 5DR5L 5IQNA 3UBFA 5DJDB 1V10A 4NRYB 2L8AA 5IBUG 3KPOB 1DBKH 5CLXA 4EOWL 3RJQB 1HZLA 1U8QA 1JZ4A 3SKNB 2B20A 2DQHL 5KYUA 3UG4A 4AITA 1YO4A 2YGNA 1RP9A 4BZ1H 4DW2L 3T4AA 1YSOA 5LBSL 1ZA3B 3S4SB 4Z7QB 2JCWA 1EFXA 1GCYA 3BVUA 5CCKL 3AABA 1YEGL 1E8ZA 2HSIA 2OI9C 3QNXB 1MCNA 4LLWA 3BE1L 5I1HL 1VFOA 1YAZA 3ZKMD 5JIDA 2DMHA 2OXHA 5JQ6L 1BLIA 4L8SC 4BM7A 2HLEB 3BGFC 1YN7B 3X1EA 5IROD 4IEFA 4LSRL 4PLKC 4WEEA 5IVZA 5I16B 1PZAA 5HGGS 4P2RE 4HOZA 1TLKA 1RK1A 3UX9B 4Z77A 3UERA 3CZLA 1MNUH 1SVZA 4XZ4A 2ZKWA 1QKZL 5ERWB 2IDQA 3SGDH 1RAMA 5ADPL 1NCCH 3CSBA 4G80B 3RL1A 1LDPH 2BNUA 3WO4B 2DQCL 3TBVA 2BVOA 2ZKHL 2VR9A 5TQ2H 3UG3A 3IRCA 5GS1A 3D9AH 1X5AA 1IGMH 2RMNA 2Y25A 1IAIL 3UZEA 4HXAL 2YPVH 1JYXA 4BFFA 1JV5A 5GZNA 2JCCE 3E6HB 3H3PH 4DGVH 3IGAB 3C5ZC 3JWOC 3KW8A 5CSGA 3EG9A 2W9LA 4WV1A 4Y9GA 3SCMA 3NQKA 4JRXA 1PD1A 4N8VG 1FDLH 2X70B 3TLRA 3V7AG 1EHXA 3MLRL 3DXAA 1MJJA 1PIFA 3FH5A 4JO5A 5KYWA 3RKDC 4U2YA 4F5CE 2Z31A 1HNYA 5FYKL 3QA3B 3VB8A 4BFOA 1JNNL 1CFVL 2P44B 1T04A 2EINB 4TVPD 1UM5L 1MVYA 4CMMB 1YDPB 1QPKA 4RSYA 2G3NA 3JWNC 3AADB 2WY3B 2ENQA 3DX6B 2WO4A 3CN3A 1EXGA 1IIKA 3MR9B 5CINH 1OWWA 4GKZA 3VXSD 3INUL 5E4OA 5LDSA 4HUUB 3BZ5A 3O3AA 2QKSA 1OP3H 1ORSA 2QFRA 5I18L 1SYSA 2JKXA 3VTAA 1S9XB 4Q4IA 3MLWL 4LPWA 4AYGA 4YFEA 5EOCH 3UBXG 5LAPA 1F3DH 3FTYA 3CVHL 5HI5D 7PCYA 4HWNA 4KXAA 1AJ7H 3BUPA 4M9OA 1OAQH 1AE6L 2D0FA 3S36X 4FKKA 4HHAB 4UTBL 3ZTJG 5B4MC 3GMQB 5E8OA 3L1OL 4CSZA 1ODAA 2H3XC 3MUY1 2EDDA 4QTFA 4PJ5B 2Z4QB 3ZDXF 2VLRD 2D8KA 3WNLA 1PJWA 3C5SA 3C2SA 4ZFOL 4IKJA 4CN6A 1S3KH 3EO0A 3EAKA 4JKNA 1O9VA 1BPVA 3I6LD 1ZHLA 4WUUA 3Q8FA 2EILB 3CC5A 3C5JA 3ZDZF 4G9FD 4Q8BA 2DQFB 2R2EB 3CZFA 4L9LA 1ZRUA 3K2UL 3STZB 1JWUA 4DUXA 1X6LA 4GUPB 3CXFA 1F5WA 2F8IA 4KVPA 5INDB 3VFNA 2XWTB 3DBSA 1WAAF 2OZNA 4HBCH 4GRLB 2Y6SC 5BOPA 3QCTH 3WMPA 1UJ3A 3VH8G 1IM9B 1MNNA 1OAKH 4KNSA 4K73A 1QTSA 5HDBB 2GJRA 4ZG1A 3QDGA 1YC7A 3MBEB 1F8TL 5GS0C 2V6HA 3EFFA 5LNDA 1ZT7B 5GGTL 2IOMA 3U30B 2F8XC 1JZIA 1X7SA 3D25A 4F24A 3FT1A 1I3RB 5DJCB 3I2CL 1G5GA 3G5YB 1N19A 4JRYB 1EH9A 2XV6B 2L3BA 4CVWA 2RFXA 2ED8A 2JKRM 2VDLB 3DJTA 5EPMB 1OSEA 4G8GD 3S35L 3WS6C 2FRGP 4DEUA 4GKSA 4ODVL 3JTTB 5D2NC 1TCRA 2AEQH 4WEBH