5F2FA

Crystal structure of para-biphenyl-2-methyl-3', 5' di-methyl amide mannoside bound to fimh lectin domain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
158
structure length
157
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antivirulence Isoquinolone Mannosides: Optimization of the Biaryl Aglycone for FimH Lectin Binding Affinity and Efficacy in the Treatment of Chronic UTI.
pubmed doi rcsb
source organism Escherichia coli j96
molecule tags Sugar binding protein
molecule keywords Protein FimH
total genus 34
structure length 157
sequence length 158
ec nomenclature
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 5f2fA00
4AVKA 2JMRA 3JWNG 4LOVA 4XO8A 1PDKB 3SQBB 5FWRA 4AUYA 4X50A 4X5QA 4XOAA 5AAPA 5IQOA 4AV4A 4CA4A 1ZE3H 5IQNA 5IQMA 1TR7A 3RFZA 4AVIA 1N0LB 4X5PA 4XO9A 2XG5B 4AV0A 5FS5A 5CGBA 3ZPDA 5JQIB 4AUJA 1QUNB 5LNGA 1N12A 5F2FA 4AVJA 4BUQA 4AV5A 3ZL1A 5FLUA 2JTYA 2WMPB 5FX3A 4AVHA 3MCYA 4XODA 3BWUF 4CSSA 3BFWA 4J3OH 5AALA 5LNEA 4CSTA 3ME0B 2W07B 4XOCA 1UWFA 4X5RA 3BFQG 4XOBA 5AB1A 4AUUA 5ABZA 5F3FA 3JWNE 2UY7B 2XG4B 2J2ZB 3JWNH 2VCOA 3ZL2A 4J3OG 4J3OF 1KIUB 4ATTA 4XOEA 1KLFB 2UY6B
chains in the Genus database with same CATH superfamily
4YUEH 2Z4QA 2J8UF 4WW2B 4GMSH 1QBBA 1OCWL 1KXTB 4LLDA 3FW6A 3VXSA 1ZGLB 3BP6B 1WWCA 2VXUH 2ZX7A 2DBJA 2EYSA 1J0JA 2A83B 4Y2OB 4MKTA 5HJGA 4I8DA 1JZDC 4DQOL 4FYQA 5F3HB 2HX7A 5IHBA 4JQIL 3O4LD 1FG2A 2ZD0A 4K8RC 4CILA 1DVFC 1JFHA 1AR1C 3QVAA 1S7RB 4FS0A 4UAOB 2D7TH 1U8PB 4LZKA 4WU5A 2WLJA 1VKXB 1WIUA 5HGHA 4FI8A 1E28B 5KZCB 4QHUB 5CFAA 4X4YA 5KBMA 2A5UA 2QHRL 1NWOA 4LLQB 2E6QA 2G4GA 2J8HA 4CN6A 3E1F1 4G7SB 8PAZA 5DK0B 1HKLH 2EDMA 4FN0A 3PIQB 1SJXA 3F5WA 4A37A 3RL1B 3OKDA 3ZDWA 2YQ3A 4MYPA 3DX8A 3MRJA 4V2CB 2XJKA 4ZD3H 3BAIA 1D6VH 5GS0L 1MCOH 2UY6B 4QOKA 2GY5A 3T08A 1EDHA 1JZ3A 1I85A 4LAQH 4NQXB 5DURB 5EZLA 3T09A 1M1SA 4A7QA 1LK2B 1T7WA 2VL5B 4JO5A 4UQAA 2X4QB 5TDNB 3NCJL 3LKNA 3AROA 1ZA3B 2P24B 1HHJB 5B1JC 1F58H 3ME0B 1MW1A 5HPOA 3HVDA 1UD4A 3PJSB 2QKSA 4BGDA 3FFCE 1UZ8A 3EOAB 2R23B 1OANA 4YDIH 1JK9B 3JWDL 3O2VL 2JJTC 5DRWB 4BFJA 5E7FA 1CZ8H 1BD2B 4IBVA 1XGRB 4AE1A 1VAHA 4NFBA 2YFNA 3GSRB 1G7JA 3R1GL 4CJ1A 3QHZL 2JIXB 1I7RA 3LDBB 5D5MB 4XBEH 5T3ZH 3DSFH 2ZOLA 2WMPB 1MCEA 5ICXA 1PKOA 3DMMB 3TVMC 4M8QA 4LU5L 5DYOA 1TCRA 1HE8A 4XCYB 4U6YA 2EDRA 2VIRA 3OHMB 3O6LH 1KTDA 2HTLC 4HH9B 3BLPX 4A39A 3KDMB 3GLEA 2D3NA 2OL3B 4TUJB 4U6HB 4C57C 1ITBB 2VDQH 5CD5C 3MV8A 4WI9A 3ETSA 2VXSH 4OZGF 3UG3A 3H3PL 1H8LA 2J44A 1INDH 3KPQB 3MRJB 3HE7B 3HJEA 4UAHA 3X3FL 2FATL 5ES4B 2PO6A 4KAQL 2UX7A 2I07B 2A73B 4XPHH 2KZ1B 3WNLA 5ACLA 3MODL 4O2FA 2IPTL 4WTWA 4BSWA 3V7MA 2AXGB 3GBEA 1QSVA 4MXWH 1JPSL 1YN6A 1MOEA 1WSST 1HDMA 1SM3L 2C3XA 1G0YR 5KAQG 2QQKL 4ZMNA 1TCRB 2QSVA 3FJTA 4NXSA 1WP6A 3PWPA 3GHPA 3I9IA 3WJLA 3MRQB 1KCUH 3TFKD 5KVEH 3Q5TA 2NTFA 4H1LA 2A1WL 3LV3A 4LSUL 1M53A 2R23A 2Q2EB 3GSNB 5F1NB 4J39A 1BMWA 1EHNA 4Z7OE 4Z8FH 3VGDA 3GZQA 1MFNA 4PJXA 3ZBMA 2V8MA 1SF3A 2AVFA 3MAWA 3RTLA 1ETZA 1N8OE 4PREA 3ZKQD 1DQLL 1CGSL 3LB6D 4I48B 3LEVL 2EC8A 3O2DH 5E8EB 1C1EH 2IFFL 4LSSH 3D3VA 1OAUL 3VXPB 4AWJC 3C60B 5T3ZD 1R0AL 4M1CD 3AS0A 4YHPB 1EJ6A 1GGIL 4XWGH 1EQWA 2VM4A 4X2UA 3LCYA 1K72A 3WE6A 4LP8A 2RGSA 2PTTB 4JQXC 4QXGH 1MVFA 1P7QB 4EUPB 3C2AH 2GABA 2MNUA 2OK0L 3D4ZA 3W2DH 3KWXA 1TETL 3H42L 3DV4A 3IM1A 5F9JB 1AE6H 1NCOA 1SMOA 4FKHA 3D2UB 3NAAH 1OGAA 2P46B 2AI0H 3HC0B 2N4IA 4S1QL 1NANI 1U58A 4FG6D 2QPEB 4XCEA 4AMKL 3TESA 3CLFL 3KR3H 1YEDA 3SE3A 2PPAA 3U30B 1BM3H 4YBLB 4JCWA 1HH6A 1QASA 1KJ2A 1ACZA 1VFUA 4MA1C 1GMIA 4OZIF 3B9KB 2OL3A 4U6HA 3TBSA 1KEMH 5AZEL 1D6EA 3SCMC 4JRFA 1GA2A 5D5ME 4YO0A 1TSRA 1E5ZA 1XEUA 4Q4IA 4ZQKA 3HHRB 4JN1L 4G82A 2YXMA 3EOAA 4TNVF 2X4NA 5MERA 2PCYA 2X1PA 1IAIL 2IOMA 2NY4C 5HI3D 2OTWA 4R83A 5ABZA 3LD8B 2X4QA 2DD8H 4PJ7F 5GS0D 3ZMNA 2F5BH 1E42A 3SHSA 3IFPA 4DO4A 4M7KH 4MHHG 5I30L 1JK9A 4YEEA 3TVMA 3N04A 3ZSSA 5G5DA 1KGIA 1URZA 2EINB 4AH2A 4LLYB 4O2EB 2I9LB 4YK4C 3NSDA 3P3UA 4HZAA 2OXGA 2F6AA 3HFMH 4I2XB 3EG9A 1LE9A 4MDJA 2DQEL 5JZ7D 2CDGA 3DYPA 4ZPTB 1ZLVH 1U91B 2FNWA 4UOW1 3UGXA 1P4UA 4F2MB 4YDVB 1MHPL 3J07A 4JJ5B 4JKNA 1SQMA 2YUXA 4UU9B 4JY5H 1J1OH 3W11D 2VO5A 2EDYA 5AYUL 1JV2B 3L3DB 4FTVE 4N2OA 5IB5B 3AGWA 1NFDF 3DX8B 5SWSD 5FK9B 2VDOH 2EDNA 3D1MC 4G6KL 5D93C 4LE8A 5C92A 3H8NA 3VD4A 2BZCA 1DJGA 2G60L 3OKLB 4GO9A 4O00A 4BFRA 2Y6SD 2BHYA 1GVIA 4FXGA 3U9UA 4Y4KD 2VZ1A 3T4YA 1RUML 1KLGB 1KJ3L 1MPAL 3B37A 4FFWD 1L9SA 1PZUB 5E8PB 1J8HA 2EDLA 5LNEA 4XHQA 5KVDL 5DHVB 5IJCC 4JO4L 4HZ1A 4GMTH 4YSUA 2ZCHH 4WNSA 3I9GL 3V4VA 1QKZL 2DW5A 1HZHL 2R9HC 4AKQA 1BG1A 4FULA 5LG1A 4K7PH 1U8LA 1CL7I 2E7LA 1IL1B 2XN0A 4NP4L 4N9GA 1JG9A 3CXHJ 5IMOB 3MDJA 4NFDA 2OSLA 2PW2B 1YEWA 3OAZH 1KCWA 3Q2NA 1OAKL 2DYSB 5C0DA 5CWSA 4LCCC 2NY3D 5EN3A 3MCLH 5E9DB 2RTTA 1KJ2L 1I85C 2LTQC 3QUML 4H1LH 4MB4A 4PJCB 3KNBA 3PXLA 2EE0A 3FCUB 1KOAA 1X5ZA 4JZJB 3T4YB 3SPVB 4Z23A 5IESH 3O0LA 4PBVC 2NUPB 3BPLC 1E9PB 5KVDE 4Z76A 4U6XB 4U2ZA 3RDTA 5I71B 1IU1A 2AAVA 5C09E 1MCLA 4FC3E 4WFGE 1R3LA 1U8KB 1E3FA 2BSDA 3SDAA 3ILPB 4N6QA 3NRPA 4NYLA 5KN5A 1RZIA 3EFOA 3FU6A 3L1FA 1JN6B 4OLEA 4M61B 4S0HA 3BZ4A 4HKJB 4GIOA 3SDCD 1TQTA 3TO2B 1DLFL 1P4IL 1NBYB 1ULVA 5HTSA 2OMBA 3R0MA 1OSZA 4TULH 4NGHL 5E2JA 1NKGA 1BJ1J 4G8IB 3WIAA 2XN2A 1HOCB 3C5SA 3T6XA 2QHLA 3AJ7A 5E8OA 1OOWA 2CO6B 2XV0A 1ZDSA 3GJEB 3B5HA 3DXAA 4KO7A 1F4HA 3WJMA 1BFTA 4R4BB 4FFYH 3T6VA 1CVSC 5FHBH 2DQJL 4OCRL 3O2DA 1ESOA 4HC1A 3UEZA 3WTWA 2WXQA 2QADB 2NY2B 2EDWA 4QWWD 4UOW0 4PQXA 3K80A 3D8MA 4B53A 5ESAA 5HGBB 3VG0L 3OWEA 5CSBA 1KCBA 3ECVA 3P4OA 4W68A 4WI3A 3S2AA 4TYUA 2NZ9D 4D0BB 3KAAA 2C7FA 5D1QD 1R34A 1NAKH 2FZ3B 3D85D 3QEQA 3I3EA 4LIQH 1S3RA 3VB9A 3OPUA 2FWUA 3HI1A 5FWRA 2X53A 4KJQD 1YMHA 4K2UL 5DVMA 3SGDH 3B5GA 1I8LA 4RDBA 1AD0B 3WJLC 4AMXA 4WW2A 3K74B 3MV8E 1MNUH 2FR4B 4JLRB 2EXSA 1XWVA 4UAOC 2R2HB 3V0VA 2F7RA 3CPLA 4FFWC 2CLZA 2XY1A 4L3EE 1A6VL 4HX1A 1SBBA 4KX8A 3ECWA 2P8MB 4YWGL 3D48R 4YDZA 1KBPA 2FTAA 2BNUB 1FJ1B 2H1PL 3BZFA 3ROLA 5CJXA 3QXWA 3AY4A 5I8OH 2CO2A 3NSXA 4YPGB 4IMLA 3HAEG 2AZAA 5L9DH 4FQCH 3LH2H 2GC7C 2VXTH 3V6OA 1RXLA 4HKBA 4M7LT 1E6OL 2O6CA 3FT1A 2BVPB 2PW1A 5L7XH 3BD5A 1J7VR 1UM5L 4W4NA 1OF0A 3N9GL 2WVUA 2WQWA 4XB8A 5A2FA 3ULUD 1VADA 5CU5A 4DQOH 1NEZG 4GXFA 3WY2A 1BYNA 3GXUB 3W37A 3CE1A 2F53D 2XN9D 4TQIA 5HHOD 4RMRA 1CMOA 4UT9H 4ABQA 3EOTH 4KTYA 3D4GA 4YZWA 5ANMB 4WJG3 3CZNA 3UTSA 5I2IB 1ZHNB 3F7LA 3P4LA 3N43F 3Q5YA 3TJEL 3WDJA 3W0WE 4Z7VA 5ESVA 3WEMA 1J1PL 4JKPH 1TUPA 1UATA 1KT2B 2V2WA 1WCBB 5AUMB 3VQ1C 2EEBA 4HU8A 1CYGA 5JO5A 5B7MA 1U93A 2RALA 4XPAH 5LUMA 4Y19D 3QYNA 2F68X 3L5XH 1EAJA 2VYRE 1QR1A 3SGEH 2Z8SA 4JRXA 4X5XB 4WDIA 4A2EA 2NW2A 2Q3XA 1RKRA 2ZX6A 4GW5B 1MFCL 3STBA 5DGQA 1DJWA 2WWKO 4J3SA 5JOFB 1USQA 2I25N 2PMZA 2EAEA 4ERSH 2PUQT 4DN4H 3FU7A 1DEEA 3JVFC 3TH4T 3OR6B 1UCBH 5L2KB 2ZOLB 4KKZA 3CX5J 3QQ9D 5FUCE 1C16B 1ZT1A 2PLTA 2Q3ZA 4LLUA 1BBJB 5EUKB 1CCZA 2P5EB 1AI1H 2XV6B 5GS2H 1OF2A 1Q1JH 4G5ZL 2MIZA 1KC5L 3T2OA 4A1RA 2GJ6E 3TBCA 4Q9RL 3K6DA 4WTZA 4Z7WA 4ZMPA 1F00I 4XP1H 4NQCB 1E8XA 4XO5A 2YPLA 2WTRB 5I1DA 4JFDB 4ONHA 2VW7A 3P4NB 2D2CC 1TTUA 3FUHA 1NAMB 4RMUA 2LU5A 1CLCA 2NR6D 5BRQA 4L9LC 2V6HA 4YHKL 1I1AB 2TSAA 3SKMA 5I0DA 1A6UL 1QVOA 2ZSVB 1B0RB 1OIOA 2HJKB 5I6KA 4KQ4H 4WWPA 4HWEH 3ISRA 1Z9LA 4FFVD 3D12B 2ZOKA 3QAZC 2VMDA 2UWEF 4KX9A 5GGSB 5E9NA 5CM1A 1DDTA 4X50A 1ONQA 5AFAA 4O02A 3A23A 1Y18B 4L4TA 4M9OA 3ARBC 4P5MB 5AOZA 3LRMA 3ZPDA 2KMWA 2J4WL 1U42A 3ARBB 3SKNB 2BCMA 2DWXA 2BOLA 4LOFA 4M56A 3P9MA 1V3MA 4FNQA 2O30A 3LIUA 2VDKH 3LQZA 4G9FB 1EX0A 1VIWA 5EV7A 4JDTH 5HHQB 2A73A 1NANH 5D7IB 1DQJB 4YGVA 5LAPA 4PTUB 1WHOA 3BGFB 1TYRA 1UJ3C 5C0GA 2OMTA 3BGFC 3GRWA 3V6OE 1T4KA 3PP3H 4E42B 2QSQA 2NR6C 1EHLH 1O6SB 5D1QA 2H3NA 4PPTA 5HBBA 3MV8B 3FHAA 3ZMEA 2CHNA 4AVIA 3DTDA 2HKFL 1OPGH 4QRAA 1GW6A 3VFWB 4G3YL 4JFDE 2Q0ZX 2MQCA 3ULAB 5KSAA 1K6QL 4LESA 3GPEA 1L6ZA 3X17A 1RMFH 4NNXA 3VFPA 4JW3A 5DRZB 3QDJB 3DUUB 3U2SB 4Y5YB 4FGMA 4ACPA 3MRNA 4IGBA 1OE3A 5JIKA 2E9BA 2WLYA 2XWBA 1CXEA 5FKAB 1QBLH 2AQNA 3ZVVA 1D9KA 4N2KA 3GSRA 4D7BA 2DEYX 3WGVB 4BZ1L 2VLRB 1AZNA 3RJDA 2WOYA 4JFFD 4N1HB 4RH4A 5BVJA 4OGYL 2NY2D 5DJ2B 5C8JA 3JTSB 1GZPA 3AQXA 1QLFA 2AK4D 1SXSA 3GHBH 2W38A 4I87A 1AQDA 3BH4A 1A9EA 4LSTL 1BIIA 5F44A 2ZKYA 5AVRB 5D1ZB 4GUPB 1QSED 2G2RB 5I6LA 3EKCA 3QULB 4GKSB 3H7BA 2EYTB 4ZO8A 2GHWB 3C09B 4L8BA 4F2ME 1FL3B 4X7TB 1QD0A 3MRGA 5TPWH 5DUMH 5DUBB 1NFKA 3RYMA 1BVNT 1DQTA 1F4WL 3BKYH 4M4RB 4MMXA 4AGPA 4EXKA 3NFPB 4Z7NF 1AJ7L 2DTMH 2G5BA 1I9EA 1Z5HA 1TYEB 5ICYA 1QWNA 4K15A 4KKLC 2IAMD 3QH3B 1EZVY 3ULVH 1T03L 3IGUA 1N5YH 1E5AA 2J1YA 5B8CB 2P8PB 5JIMA 1N67A 3DDGA 2BS71 2DQHH 4K9EL 4GJTB 3MLSH 4HIXH 4NM8H 5F1OB 2EACA 4E9SA 1RIVL 3D18A 5JOPD 4NXKA 3VWJA 2WP3O 3UC2A 1EXGA 5HHME 1L7IH 2CJUH 3KVQA 1YAIA 4NQEB 3OR7B 1E28A 3ML9A 2NY1D 5D7JB 4NYLB 1EEYB 3OQRA 4FZEH 5EBMA 5HI3C 4F7TB 3QDGD 1MCCA 4BFEA 5JXAH 4G2AA 3EXLA 2D31B 4LBEA 1Q0YH 3G9VA 3VFOA 3ZT6A 1F3RB 4JM2D 5DHXB 1PCSA 1AY1H 1U8NB 4K3HA 1TJHH 4O5LH 3HG1D 5PCYA 2DYRB 4AZUA 5IOPA 3MFFA 4UZGA 4F7KA 3VW3L 1SYVB 3GMMA 3LKPA 4TTDD 2XXGA 1WITA 2LVEA 4PJDE 4PRID 4IIQA 1T1ZB 3ZLQC 4QJ4B 3VXTA 5GRUL 3OAUH 1S5HB 2V2TA 1D9KB 3EJTA 4PJ9A 2CLRB 1N6QL 4FD0A 1I7ZB 4CU6A 3L2NA 5CD5D 5I6NA 5LBSL 2NY5L 3CDYA 3SPGA 1BVKB 3DVIA 2E7CA 5FUOL 3UTOA 3IGAB 1YMMA 1GJIA 3VH8G 4H8WH 1GC1C 2HRPL 1F8TH 4B9ZA 4H7VA 4FEIA 4Z77A 4ZSOB 2EIKB 4MQXD 3QIBB 4XZ4A 5IM7A 5ANHA 2C9XA 3WS6C 2FWSA 2BNRE 4GUCA 2OCFD 3QDAA 2GIXA 5D6DA 3HS8A 3RKDC 3QDHA 4HCRH 1DJXA 3BP5A 5DDHB 5E00B 4ZS6C 2VLKB 4MJ5B 4WWOA 1T5WA 3IVKB 3WJJA 2FJUB 3GMPA 1M7IA 4JGNA 4NIKB 1X5GA 3MCLL 1UYWH 3QPQD 4GRWF 2AQRA 4JANB 1IAIM 1RL1A 5BS0D 3MLXL 1MFBH 2QKIC 4KKAC 4XCCH 4XB3A 4KQ0A 5D1ZI 2P44B 4IHBA 3DX4A 1MG3C 4L4TE 5JW4R 3R19A 2ZKHH 1EEYA 3NEEA 1LP9A 4O4YH 1TF4A 5CN3A 1J5IA 3KHOA 2AXFB 5CJOH 3C12A 2OP4L 1TENA 2WM0A 4OD1H 1Y07A 3H1ZA 2A0LC 1K85A 2E3VA 4HF5L 1M9WA 4KO9A 4XNQA 1KTKE 5AW1B 4JPVL 2ZUUA 2OXHB 3QEHB 1CFTA 2W60A 1DBAH 2WK2A 4KK5C 1NUFA 4HJUA 3X1FA 2NXZB 1KEML 1DQJA 4YGVB 5AZEH 2CDEA 4LMQI 3MUUA 2DH2A 3AAZB 4JFVA 4S0SD 2AXWA 3HI5L 1A3QA 4JE4B 1BFOB 2VE6B 3H9SA 3N55A 1UH2A 4N90E 4U6YB 1JPFA 5ABAA 3TA3B 4MXQC 3ZE0B 3BDYL 3FRPB 2O6FA 5E2VL 3A6CL 1WISA 4LSDA 4LRNH 5KBNC 4PJFF 2W5PA 1MJJA 3CDZB 5HDQH 5TD4A 2DQUL 1CDCA 4JRXB 4X5XA 5L8KB 4HUVB 2FYYB 4AIXA 2Y25A 1AQDB 2BFVL 2PTTA 2R7EA 4IK7A 2IDSA 3RPBA 3UJTH 3G6JE 4PS8A 1HESA 3G5ZA 2NNAB 4FCAA 3R18A 2ATPA 2WZAA 3H7BB 1JNLL 2NR6A 3G6AA 4PVBA 2AK4E 3MV9E 2ITCB 5DLML 1I8AA 5FYKD 2ZWNA 2AGJL 2ZWYA 4XBGB 3GSVA 3DKHA 4IIQC 3L3GA 3MJ6A 4RAUA 2V2XB 1FRGH 1Z3GH 2IVFC 5AKVA 3UTSB 2FL5B 5I2IA 1GZHA 3FQUA 4M5SA 1UWEH 1P84K 2CAKA 4GW4B 1ZV5A 1H3WM 1M05A 2LLLA 4BHUI 4NB7A 5F7WC 4MB5A 1ZEAL 5T1DL 5DJ8B 1WAAF 4PJ7B 4WF7A 2GY7B 4O2CB 1RSFA 4XMLL 2OV0A 1S2EA 4G8GD 1ZE3H 1REIA 1CFNA 3ECQA 5EZOL 5I9QB 3SDDA 2R8SH 4HUWB 4PRNA 4KMLB 3RJOA 4TRPH 2QV4A 3QZWA 4PJHE 1AQHA 1LEIA 2O61B 3HZVA 5D7IA 1FNEB 4FQPA 1T80A 1XL6A 3TBVA 3MRDB 5D71L 5E1GA 3OC5A 2C9PA 3FT9A 2KDYA 3HPJB 2IPUK 1E9OB 3VGAB 1FIGL 1J8HE 3GHEH 4ZNEE 1AZCA 2H3NB 2ENQA 4LCIL 1B4RA 4WZ9A 3HI6H 3L2LA 4L37A 5EU6A 1ND0B 3S3PA 4DVRH 5D4IA 4YAQA 1T22A 4YJZL 1AZZC 1ZPLA 4JZJC 1ZAGA 3B7YA 4ZUSB 5TGBA 3QWRD 2R9HD 2RD0A 2ZOKB 5I5JA 3GC3A 3L4WA 5AG9A 4Z5RA 4MRCA 5E70A 4PJ9D 1FVDA 5L88H 1DANT 5D2NC 3TBTB 4LPCA 3E3QC 1OOAA 4L8BB 4GSRA 4HXAH 5I73C 1S7WA 5F7FA 4HEMA 3GGWA 3KS0H 1G0DA 4P23A 3OB0K 4M7LL 1JFQH 1J1PH 3OJMB 4CGTA 4URTB 2Q20A 4JMNA 5KVFE 1CFQA 4U1KB 2K3HA 3S8WA 2ZIDA 5D7HA 4MJHA 5IMKB 5EEUA 3ES6A 1RZQA 2VZSA 1ZHLA 3IJYB 4NX0A 1JGEA 3SPJA 5EIIA 3RTQA 3SB3A 2R4SL 2YD5A 4XBMA 2K6YA 1JGLL 2BSSA 3RGVD 3T0EC 3UTZB 1J48A 2BS9A 3LKSB 4R4ND 4HS8L 4U1GC 2IBZY 5C0BE 2LE9A 1QWHA 4PV8A 1RJZB 3MLWH 3QIWD 1CD9B 3QNYA 5F1KC 3FRUA 3VD3A 1WFOA 4K71C 5DS2A 1G7PA 4BCXA 1U95B 5DMGD 3DXAB 4BRJA 4Y4FB 2MNJB 4XX1E 1MCNA 4JRWA 4UV4L 4PTTB 3QDGE 4ZMWA 3K6SB 1NCBL 1NCCL 1PZCA 3CFKA 3L4CA 1A9BB 4XNMA 1N68A 2V37A 4YC2B 2XQYA 3BZFB 3ROLB 2A4EA 3ZDZF 4W81A 1HINH 2QQLL 5MP6H 2WQSA 1P1ZB 4BK4A 3TBWB 4TTGA 4Y5YC 5ITBL 1NQBA 1RSYA 1K2DB 5IVZA 1DBKL 3RVWC 1AGCA 1T1XA 3X1BA 4DESA 3U0WH 4PJGF 3SGKC 3A0OA 4XXCC 3U48A 4WHTB 1LDPH 1LQSR 2B5IB 2B16A 2H4EA 4N0CC 5F3BB 3F3HA 4JFSA 3LSOB 1OARH 3SE4A 5FYJE 1WK0A 3MLYH 3WENA 5AZUA 3IDIA 3MNWB 4NKIL 3S37L 1THAA 5BJTA 3Q01A 2OZ4H 4JFYB 5DMKA 2ERJB 1F2QA 1CDUA 2AV7A 2XKNB 4QKXB 2FO4B 1PLGH 4R7NB 1HVXA 2JE8A 1DVFA 3BPCB 4F20A 3N50A 3WNIA 5IJBC 4L3ED 4NNPH 1WBXB 2EDKA 3FU5A 1N2RB 4FKEA 2XACC 4YDLC 5E94A 4PJIE 5EEVA 5CIPB 1A4KA 1BQHG 2F2HA 1CLOL 4Y19A 2R0WL 3EJZD 4YFLF 3WLWD 5EO1B 3TO4B 5E8NA 3Q9QA 1OLZA 2JKRM 1Z7JA 1H3VA 1JZ4A 2EEXA 5D2LA 3JUZA 3KH4A 2VSKB 2F53A 2IH3A 1CDGA 3ARWA 1T21A 5DLLA 3D09A 3ZYOA 1NBCA 2AJVL 5F89B 4LF3A 3ARFB 5J1SC 4UM9D 4BK5A 1A66A 2YLHA 1PLCA 3AT8A 5I76B 3FNKA 5D4QA 1Q9OA 1KPRA 4IOIB 3VI3F 3FU7B 4YDJB 2YKLL 3UPRA 4QY8A 2Y2YA 4OGQC 3PGFH 5K9KB 2FIRT 3I6GA 4P2OA 1JYWA 5IQ7H 3GSQA 4Z76B 4ZFGH 1RZIB 3EBHA 3EFFA 3QBTB 3UTTE 1MLBB 4BWWA 3D0VA 3RWHA 3NCWA 5IBTH 1HSBB 4G83A 1RK0A 4P2QE 4XMKL 1ES0A 1NOAA 3GSOA 4G7VL 1JYVA 2NYKA 1JERA 2WAQA 3RGVC 2WQUA 4OQ1A 3SJVE 3T0ED 43C9B 5GGTH 5KS9A 1RCYA 4Y5VA 1EJFA 5C0EB 3VXRB 1SHSA 4F9LA 3A4DA 1SDYA 2HX8A 3BHBB 4PM1A 4IRSA 2YQGA 2I9LA 1AQMA 2R0ZL 4IBZA 1ZY9A 3TNNA 5T33L 1PTZA 3UACA 3POHA 1PD6A 3HUJA 2Y2WA 5EU4B 4G1MB 3QHFL 2P5EE 3H3KA 4OM0L 4PJEF 2MCMA 3BT2L 4Y89A 1UD8A 3EDFA 1D5RA 4LHUB 2EDDA 4CGUB 1LEKA 2Z65C 4LDOB 2W81C 4OZIE 4OIFA 3IF1B 1IL1A 1CS6A 1ID5I 1OP5H 2DTML 4MHHI 4I18B 1NGPH 1E6JH 4TVPE 3H2WA 4IGBC 1YSOA 1U8IB 2YPVH 2W94A 1WLHA 2X2JA 3EH4B 3MCKA 4OZ4B 4QNPF 3VGBA 1OL0A 1Q72H 2YAHA 2Y9RT 2DQHL 1DFXA 4JY6B 3Q2CA 2O5YL 4LQFH 2FGWL 4MCYA 1M3IA 4LKXA 4TPRL 3K7UA 1X44A 3TBSB 1RV6X 1XAKA 3OG4B 3LHAA 4AUYA 1TZOA 1XGUA 3D69B 1QNIA 1N64L 2Y7OA 3D25A 1EZSA 3VNZA 2YGQA 1SBSL 1VACA 1WH0A 1JIBA 4P3DA 5IUSA 3ESPA 1EFXD 5BQDA 5IIEB 1MHCB 1SHMA 2UZYA 5C0CA 4ALAC 5ERWB 4CC1A 1N6UA 3SYPA 1XCXA 2CQVA 3D39D 4UTCA 2F53B 2IH3B 5J56B 2DLHA 3C60C 1BECA 4PJCA 2A9MH 1EXUA 2RHEA 1MXDA 1UA3A 4ZTEA 5K1NA 1X6NA 3U4BL 3QISA 1LK3H 4X5QA 2BJML 4N5UA 5F8RC 4LLYA 5I1HH 35C8H 2XTJB 3NCXA 5DMKB 5IEKA 1D7DA 4HUXA 3PHQA 4P5SA 1JL8A 4IBYA 3CFDA 5JXEA 4BBWA 1TFHA 4TL4A 3O9WA 5E8EA 3BUIA 4LHUA 2YOCA 1A25A 1DL7H 2B39A 1FVEB 2X2YA 3HAEH 5ACZB 3CDGB 3D33A 4Z0XB 1PG7X 4A7VA 4G6AC 5EEZA 3BSGA 1BFVH 1G6RH 5I6PA 4YXHL 3RL2A 4F33A 2DQGH 4NC0B 4WEEA 4DHLA 3NSJA 4G8GA 3RGHA 2QHRH 3A22A 4F2EA 1NFDA 5TGBB 4U1NA 3OKKB 1HL4A 1X7QA 4NO0A 3W1ZA 5AVUB 1GY1A 2JI3A 2VR4A 4G7YH 4AGMA 4OFIA 1YDPB 2NNCA 3EGSB 3RNQB 5EHFA 3PV6B 1T89C 1Q9LA 2P48B 4X6DE 5EC2A 1G5GA 4ZD3L 3V10A 3WXVL 1H8NA 3FUFA 3IJSA 2IFFH 4LSSL 1KCSH 4P04A 4YSQA 4A6YB 2ICEB 4LPYA 3TIDB 2I24N 2JKIS 3SE3C 4AQAB 2BRRH 1S46A 4P3CL 5SWQA 2ISDA 1HFUA 5ADPH 4XZUA 2JV6A 3R0NA 1TIUA 3KPSB 4QF1A 4GKNA 1XH2A 3ARDB 4OTXL 3GJFH 4G7QB 1HHIA 1IGJA 3GEFA 3O3EA 4JGJA 1PSKH 3GMRB 1MRFH 5DJ0A 5G5DB 1ZLVK 4QAWA 2BSSB 5GGUA 8FABB 3MRLB 4I48A 3QUZD 5BUPA 3QP3A 1JHLL 5KSVB 5AOIA 3RZCD 4GQ9H 2NY2C 3SCMA 1XXDC 3BH9B 2F1EA 4DEUA 1A1NA 5HI5D 4DP1X 1VFBB 5LAXB 5LGJA 5SV3A 3ZKNC 2FK9A 3BEVA 1RP8A 2DL9A 3FAWA 3DBXA 4Q9QL 3ARUA 1QLRB 4OD3L 1HHGB 4LB8A 5EIIB 3AMKA 1NSNL 1IBBA 5B7FA 4KX7A 4GAJH 3GMNA 2DMHA 2DMBA 2AEPH 5KYXB 3AG2B 3ET9F 5G2NA 1YJDC 2NTFB 1KENL 1UADC 2HLEB 3DVFA 2P9RA 4W4OA 1EIBA 4PRIB 4P4KB 1BCIA 4YL4A 1TU2B 3MYJB 5D7JC 4ZX3A 3MLSL 2QKIA 5L2JA 4FJYA 3TBTA 3IXTA 1DEDA 4PYGA 5BS0A 2FCBA 4NLHA 5EZIH 1NDTA 3QHZH 2X28A 4PRAA 4CAGA 2EE9A 5EO0A 1DSYA 4DJMA 3RHWF 1E8WA 3OTTA 3TIEB 4PGEA 3H9SE 2EIMB 2YWZA 1BQUA 5CEYB 5JNYB 1P5UC 2B7DT 4L48A 4Z7IA 2W65B 4P4RA 1N59B 2GYSA 3DHPA 3MBWB 1ID2A 5EU6B 5CLTA 4FQIH 4LL4A 4X7DC 3BMWA 4I3SH 3JV4A 3UOAB 3UZVB 5DYFA 1WAPA 2APVA 1WGOA 2LFGA 5E5MA 4YDVA 5TF1H 4AYDC 2H9GB 4JG5A 2E27H 1FNEA 4N2IA 4QRUB 1IC7H 3E6FA 4PV1C 3SKJL 2WKGA 3FRUB 3ARDD 1EK3A 1KELL 4XVSH 2WMPA 2HLFD 2NY3B 4HWBH 4ENEC 2Z93A 3O9WC 1ZS8B 1KGUA 5I18L 1EJOH 1I3RB 1N19A 2DQCL 3LN9A 4KO6A 5CILH 1XMWA 4KRLB 4UDUA 3QA3B 5IQNA 1E67A 3W81A 1M05B 1U8MA 4Y88A 1DZBA 2V7NA 4AZ8A 2IBZX 1RPUA 3G5ZB 2CPCA 5B1JA 2E4FA 5BZZA 3GPSA 4H1LG 5TK2A 1QI3A 5CINL 3U4AA 4MJ6B 1SJEB 1VCBC 2OTWB 1C8QA 5HDWA 2QV2A 2XKSA 2M83A 4Z8FL 4JO3H 1EBAA 3HVNA 2AQ3A 2A6JA 4AENA 1NIAA 4MQTB 3GGWB 4EN3B 1X5JA 2VWEC 4GSQA 2Z34A 1MLCA 1IEAB 4AXWB 2Y07L 1PLAA 2P42B 3GS7A 4HIHB 2V3FA 1NTDA 5CZXC 4F7MB 1KTJA 5IG7B 2WIIB 3ISYA 4UBDD 4UV7H 4DVBA 3RWGB 4KMTL 2Q76B 3QFJB 3VXUD 4PJBA 4L4JA 4X6DF 4QOKB 1QEWA 3CAFA 2XZAH 1JK8A 4XWGL 2EQDA 4K3DL 3L7EB 4B27A 3EUDA 4F58H 4ZFZB 4L3CB 5E6IC 3CZGA 1GTFA 2IQAA 3V0DA 5CD3B 1WG3A 4NI6A 1AZBA 4NN7C 3FL7A 2DLIA 5KG9B 4F8PA 3DO3A 2Y6TE 3QS3A 2ICEA 1OP9A 2FHBA 4Y2DB 5L8LB 5F9DC 5HHVL 1FSKC 1KG0A 1JUFB 2RFXA 3WEBA 3I6SA 2G3NA 4QHUA 2PO6C 5TDPB 3TA3D 4HS3A 4JEGB 3HPLB 1ZVSB 4NOFA 3VSQA 2GFBB 1AD9B 1KEGL 4J2QA 4JPWL 5SWZB 3T2NH 5G4MA 2P5WA 3A6BH 4AVJA 4E0RB 4C55A 2APTA 4FJZA 3BJLA 4Z78A 4JPVH 1MCBA 2ITEA 4CSTA 1SVCP 3OV6A 1QI4A 1I1AC 1J05A 3VA6A 4GO8A 2Z4QB 2WQVA 1F90H 2DDQL 3VYNA 1MRDH 2VDRL 2NYYC 4OCRH 5LDUA 1CGXA 2CWRA 5E95B 4H2AA 1OALA 3OR7A 5D7JA 2X4OB 3T5WA 5FW7A 1E7VA 1RZKC 1ZGLM 3LKQA 4JN2B 3ORJA 4FTVA 1OCZB 3FU9A 2ZOUA 5DJCB 4CDGC 5C0EA 1NCTA 5GRXG 4NBXB 1OW0C 1NMAH 1I8LC 2DRUA 1WD8A 3TASA 3GXIA 3B9VA 4DERA 1OP3H 4V1DB 4OCMC 3P0VH 4MXWL 5C0NC 3ZDYB 3RZCC 2CALA 3QUYC 1CGVA 4WO4D 2OR9L 5DDHA 3EFDL 2W9EH 4KUZL 4P3DB 1P7QD 2HFFB 2VDNH 1PKQE 3RTQC 4S10A 4PCTA 1X5LA 1KJVB 2X9WA 4BH8B 4YDJA 4MMXB 3VXNA 5EORH 5KVEL 2X4TB 4X0NA 2B77A 2HFEA 4ZX6A 3I9GH 4Y1AE 5JA9A 3MR9B 4QOKD 3HRZB 5AYUH 5CLYA 1I1FB 1OKEA 1UVQB 2XRAH 2IALB 1H5BB 1XGQB 2XVBA 3DMMC 4XO4A 3FUMA 4S2SB 4AJ0A 4K23H 1Z3GL 4L1SA 5LWYL 1QYGH 1QUNA 4NEHB 4XC3H 3F83A 2XHNA 2YMTA 5C2UB 3LTVA 2FX9L 4FDWA 25C8H 1IFRA 2OMVB 3NJKA 2OW7A 4XMLH 1M71A 3INOA 1W80A 2X3BA 4FQCL 4WJKB 1F3JA 2JJUA 5IBLC 7PAZA 5IFHL 3PABA 3VYOA 3EJQA 1RPQA 4NIYE 4R4NC 2K70A 1KB9K 5D7SL 4Z7OB 4UTBL 1M9SA 2ALAA 3NJIA 3KYOA 4QTIH 2DI8A 15C8H 9PCYA 2C3VA 3EYFA 3HE7C 1XGQA 1W91A 2AI0L 2IBBA 1JZ8A 3LXBA 4PGBB 1KJ2H 2ARWA 3ECBA 3DTUB 3VH8A 4AQ8A 4D9LL 5A2LH 1DBMH 1JE6A 4ZMTA 4KBPA 2K7QA 4FE9A 2X44D 3BPNC 1MWOA 1UWGL 1UEMA 4QRBA 3M45A 5HYSA 1KTBA 5A6LA 1R3HA 2IG2L 3KPSA 1MUJA 2FJGB 4JRYB 3OJVC 5BRZE 3KJ4B 1GKOA 4FZ8L 2XQ0A 4BE6A 4M7LH 4MBRA 4E5XB 1A3ZA 4LPWA 1R1CA 5I1GL 4AQEA 4RMSA 1N9PA 1XH3A 2R69L 1CBVH 4PI0A 3WTVA 4XMPH 1MN4A 1QSEA 1SGKA 1YVLA 3ZZ1A 1YDPA 1PEWA 3JWNG 5E1QA 1V3LA 2VZTA 5C0RL 2BXYA 2F5BL 1MCIA 2O6EA 1R3IL 2WYIA 5IF0B 2HZHA 3TT3L 1BQ5A 1NAKL 4UT6A 4BK5C 1X4XA 2OMUB 1I1AA 1CF1A 4GSUA 2QADC 4QXVA 1QW8A 3QPQC 2R1YB 1AI1L 2PPDA 3CBRA 5KBLA 1ET8A 4G6AD 4AGLA 5GSRA 3HAEA 3APFA 1HIMH 2DIJA 5FUCC 1S5IL 3V8CA 4E0RA 2YPVL 5GISH 4B9IA 5ACZA 1MSPA 3LAFA 1HJBC 4XN9A 3PQYA 4LRIA 4WUUE 3PL6B 3DOSB 4AG4H 3RFRA 4EDWL 5C9JA 1NCBH 4PG2A 4FXTA 3SO3C 2YD9A 4UQ3A 1D5BA 1CFVH 2CD0A 4QGTA 4NPJA 3H6JA 3IGLA 2QMKA 4LLWB 5F9OH 1PCXA 1RIHH 1S7WB 3VXUE 1EAQA 4YHKH 2MQ0A 1KPRB 2NMSA 4IOIA 1LLAA 1S9WB 1U33A 1A6UH 4P46C 3C87A 2A6DB 4GB9A 4CSSA 1ZLSL 1EBPA 2ZXBA 2W8CA 4IKKA 2HN7A 2VR8A 3JTTB 4KTDL 3SDCB 1MNUL 1OT1A 1EVUA 1G7HA 3KXFE 1MHCA 4ZFZA 3G04B 3M7FB 3RWDB 2VZUA 2DJ4A 2G75B 3CN1A 2HJFA 5EZJB 4EQ3A 4JR9L 2JCCB 1QMUA 2WLLA 4G11A 1BWWA 3MLYL 1IAMA 1SXBA 1XHHA 4P5MA 3WTXA 1QR1B 3LX9A 1BYOA 5H94B 4ODXB 3U2JA 5D7KE 1ZT7A 5C0FB 3RP1A 2ZF9A 4S1DD 4MCNA 2JELL 4HPYL 4U7SA 4P5RA 3H2PA 3HZKA 1G87A 1SDAB 1HU8A 1UJTA 2HX9A 5FGSA 3TBYA 3ZE1E 3NK3A 1BZDA 1DJZA 3ALXA 2R0KL 4D8OA 3KL3A 3VI4F 5TE6L 5B4MC 4A67A 5D1QE 3V0WH 3UBXI 3WUWG 4B0MM 4GKZA 4R26L 4G42B 5CUSH 1EO7A 4HP5A 4XPAL 4K7PY 3PS6A 2XWDA 5DD0L 4ZI8A 5FA3B 4B5EA 2JQZA 2VAAA 3BIKB 2WVVB 4E2OA 3D52A 3OSKA 3HKFA 4DP5X 4F93B 2KPWA 1XR9A 3DETD 4X6FA 2AJSH 1KYOK 4NJAL 4OBSA 3SE8L 4MMXC 2BIPA 4U1IB 2EECA 2O1AA 1IAOB 4RFNC 5DTFB 5HY9A 2BMKA 1I9RH 4LCUB 1QO3A 4QEGA 1OZUA 5HI4D 1YN7B 4HD5A 4JPIB 4J4PA 3HHSB 4R96B 4Z7UF 5FKPA 3TEUA 2IWEA 5KSAB 1C12B 1DO6A 1XB6A 5K33A 3INUH 4F2FA 4ISVA 2APBA 2EUXA 5DHDA 1PSKL 5LGKA 2NW2B 4LCCB 1B9KA 2JVUA 4V1DD 4GAGH 1FPTH 2ERJC 3RVXC 5L2KD 1JPSH 2SEBB 5DI8B 2FEJA 5DJYA 2J43A 2ALWA 3KBFA 2ZG1A 2EVFA 3RVVC 3UABA 3JWDC 2AJ3A 3MRDA 4UIMB 3TBVB 1ADQA 3ZHFA 3VTAA 3C6LD 2EVGA 3AXLA 1YC8A 3O3DA 4DZBA 3VG9B 1XGTB 4P5TD 2GB2A 2TSBA 3H7LA 4R4FH 4C56E 5CCJA 4KVCH 3FF7A 1ZVNA 3PDOA 4XVJH 1TR7A 2FZ3A 5A6IA 4NN5C 4FXLA 5JQIB 3W9DB 5EFIA 5B3JF 1ACXA 5GGSA 1DQLH 4GG6A 1NAMH 1G9NH 2Y0SA 3KYNB 4PJCF 4LPVA 3L4VA 2EDTA 5BW7A 4P2AA 3AQDA 3R8QA 4AYMC 4CMMA 3GSVB 4AUUA 2R69A 1TQSA 1EJ8A 3FT2A 3GDBA 2J5WA 4L1TA 2CIKA 2D03H 3X12A 3WJMB 1DVTA 3F12B 4JE0A 5E4IA 4PP1D 2DM4A 3M17B 4C58B 5F7NC 1OCWH 1K5WA 1LO4H 4HLZG 2VNCA 3QIWA 4MA8L 3CPUA 2AJXH 2YKKA 4XO3A 1OTSC 3QB7C 4DPBX 4H13C 2OFQA 4QHKJ 5CS7A 3G04A 4L0YA 4LK4A 2ZX5A 1IE5A 2VN4A 3VTMA 7FABL 5L7XL 2JXMB 4RZCB 4PY8J 3HZMB 3GSXA 1WA0X 2QVFB 3STLA 3ZL2A 1UOVA 2Y5QA 3RPIB 4DKEH 5I1HL 4PLJC 4XVUC 1KCLA 1JCVA 4AYFB 3F01A 4PTTA 3ARYA 5E5RB 3SPHA 2Z31D 3MXVL 3OVUB 3DVNA 1QHOA 4YLBA 3QXAA 2N7SA 1ECYA 1IAIH 5CMAA 3QWQB 4R84A 4W6XB 1HKLL 3VG9C 4S1RL 5D2NE 3HOGA 1H8SA 4A7UA 2GTZA 5FB8B 3MRKA 3MGTB 4GXUM 2F18A 4GBXC 3HRPA 1S9KC 1LO5B 3LZQA 1TZ8A 1XT5A 5CAYB 1AD0A 4A7SA 2XI9A 3BN3B 1JNNH 3CVHL 3HS9A 3VB8A 3UYPA 3AWEA 2WXPA 3K3QA 3EHBC 3PQYD 3PL6A 4L1BA 2EEAA 2A38A 2XG5B 1XX9C 5D70L 4UZUA 4J1UB 2E74C 3CWGA 2GVYA 1OHQA 3A4EA 3U6XA 1A4JA 3CH8A 5HXMA 5LGHH 5HVGB 5DXWA 5F0LB 2LLGA 1J11A 2CH8A 4F58L 1KGYE 3RWCA 2BOCB 2F1AA 3SDDD 1BHGA 1OD7A 5TE7H 1G6VK 2LABA 3HC2A 2WGNB 1RULH 2G2PA 3UMNA 2JLPA 3BSHA 1II4E 1U4EA 4OCYH 1YUHB 2EKJA 1KC5H 2LVCA 1G7MA 3DX1A 4YGAB 2Y7SA 2YRZA 4M61A 2FGZA 5CLXA 1X5HA 1L7IL 2CJUL 4Y19E 5FDYA 1ASOA 2IXQA 2JCCA 4E5XA 1MNNA 3LQAC 2OXHA 1W72B 2NY6C 4LSPL 4JHWH 4TNWK 3DMMD 1ROWA 3MGOB 3O6LL 2AEQH 2VUYA 3I6LD 5MENB 3IGAA 1Q0YL 4E36A 2VXQL 2FJFA 2X0UA 3U36A 2ZJSH 4Z95H 5SWSE 2C4XA 4LDLB 1KV7A 5GGRA 1N26A 5FO7B 4NP4H 1CFNB 5EF1A 1CE6A 2PP7A 1LE5B 3VWKC 4KQ4L 3WKQA 4NI3A 3NIFE 5I0ZA 3CU1A 3S97C 1CBJA 1T04B 3D05A 3GTTA 2DDQH 2MSPA 3M8OL 4P5TB 2F1BA 4ZX4A 4U6XA 5BMFL 1JDDA 2W59A 3HIZA 4XN5A 5ECJE 5HDQL 2J56A 4M93B 3C5JB 3TN0B 3FB8B 4R5VA 1W0WA 1TMQA 3BGAA 3GMPB 4Y5VB 3VXSE 5CZKA 4QRQB 1ZLUH 4BFGA 1BMZA 4G8EA 1SVZA 1U2CA 3Q8FA 3HMXH 4P3WA 1HXMA 3ZRFC 1S3KL 1D6EB 5LDSA 2ZZUT 3X3GH 4Y4KA 1IB5A 4H2CA 4FQXB 2C9UA 3II1A 3EJPA 5IHUL 3U6XS 2OR9H 4GUQA 3T1WA 1PVHA 2IDUA 3OMAB 2QT6A 1MH5A 3HS0A 1MREH 4NNYB 4FNLL 4JPKH 4N28A 5DRZA 5C08A 1FRGL 5FXCH 4H40A 5GRJL 4CADA 3OLIA 2PCPB 4PJDA 1MI5A 2CHXA 5JORB 3JVGC 3CSYA 1N6VA 4I1RA 3VXQB 2O5XL 1L7TH 1QEWB 3LZNA 2TRYA 1BVKA 2YAEA 3U9UB 1U8HB 2UYLB 5MENE 1A6PA 4FNTA 4NKDB 3FB6B 1W16A 1HH9A 1FH5L 1EWHA 3N06B 2X12A 3K8LA 2PO6D 3V55A 3G5VA 1BD2E 1T0PB 4KDTC 1BW8A 1UOWA 2E8ZA 1FNAA 1R5VA 2IADB 3QWOB 3QXDB 4AIEA 3RNKA 4ZFOA 5BXFA 2AJUH 1VJSA 5BNXD 4H25A 2I60H 2H0PA 3KPPB 1JHKH 2VDQB 3P3TA 1E4HA 3ILDA 4LCIH 4BGLA 4S1QH 2E9GA 3PHOB 43CAB 2RBLA 5GZNA 2MWCA 1TMCB 1KPVB 1XTMA 3MCG1 4Z7VF 1MDTA 1ONQB 2KH2B 2NZ1A 3PL6C 4LAQL 2HB0A 3KYOB 2BS8A 2VR7A 2X4OA 4K3GA 3DJ9A 4WKZB 4HBCL 1LO2L 4WUUB 2YEQA 5A43C 5BZDB 1Z5LA 3L3KA 3MJ8B 4RGOL 4I89A 1SDDA 1F4WH 1WCQA 2YUVA 4RA3A 4TSAL 1NCAL 5FM5O 3D51A 1VFMA 4X42A 1QSFD 4YSRA 1L9QA 3GDCA 4LT7A 4P49A 3PWLA 1F3JB 1XB8A 3K2IA 4HSCX 2HKAA 2PCFA 2MCPH 4ZZKA 4BHUA 4X6CA 3GUTA 2PWHA 5JTWA 1AGCB 1T1XB 5HYJB 3ZW3A 4AVHA 1A6VH 3PP4H 1CTNA 1QABA 1MF2H 4BZ2H 3FULA 4NHCL 4DN3H 1U6AL 1XF1A 4PJ5D 4U1HA 1UA7A 4HCRA 4HS3B 2D2OA 3GM0A 1GC1H 3IS1X 4L8SB 4AYGA 1QFWL 5EEWA 3GBNL 4W9DC 3IDMB 3BC9A 3DNKA 2DLGA 3MBED 4HJGB 3K8KA 1C5BL 5CGBA 5C0RH 1F11A 1IC1A 3QRGH 5B1BB 5L2JB 3HC0A 4X7CC 4BH7A 2UWEE 2XY2A 1RK7A 3WSQH 3X11B 5JR1L 4I3RL 3RDTC 1I8IB 5AVWB 4PRIA 3D39B 4F7CA 1MHPH 3TJPA 3KE0A 3BPOC 4DKDC 1DJHA 4V1DE 4EQ2A 4FF9A 2P5ED 4HWNA 1T1WA 2FATH 3OZKA 4KAQH 5IKCA 1WIOA 3GEWB 1UG9A 3GQFA 3NZHL 3AITA 5HDBF 5GRUH 4G6KH 4JM2A 1HHGA 2FQDA 4PR5B 3HG5A 1UB6A 1WPCA 3PQYE 4JHAH 1I7TB 1E8YA 4WUUA 3EJJX 4KTEH 4E9VA 2QQKH 4GEJA 1EEZB 1KFGA 2YAMA 1Y0LA 2K45A 4MNQD 4R2GD 4LLVB 1JVOA 2XFXA 4P2YA 5HDRA 2HKHH 3HE6D 3SKMB 3UTTD 5DT1L 2JKWA 1LMKA 3S5LG 5HPMA 4OCLC 1U3HA 2G9HA 1NMCC 3C5ZD 5JUEL 4EI5B 1GL4B 1BA9A 2JB5H 2BSED 4BSWB 1SQ2N 4OCWH 2X4RA 4ZW5A 1BVNP 3HBZA 5I0YA 3CMOL 1AD9A 4U3SB 5JHLL 4KZDL 1TTRA 2XSKA 3FN0L 1KGCD 2W91A 3MLUH 3MRHB 5A40E 4YLCA 3ULVC 4AK2A 1ADWA 3VSTA 2WB7A 1L5GB 4W9LC 3IMRA 4JG1L 4LRIC 5BV7C 4F3FB 2DN7A 4UMGA 1GCFA 4FQJL 1LO3L 2PCPA 1D2PA 4OCSH 2EVHA 4B97A 4QXGL 2H2SD 5T1LD 2I85A 1TZHB 2IWGA 4EKJA 3OXSB 2E75C 1Z9SB 1I53A 4PJHA 4FL4C 5AW8B 1YNTF 2OK0H 1CE1H 4KKNA 1FZKB 2JIXA 1IZKA 5TJWK 2WUBL 4L4VD 2GEQA 1ZS2A 3ZE2F 5IJVA 1N7ML 3PWUA 1DUYB 4TUKH 5FS5A 5KVFH 1A6AA 3ABLB 4ZNEA 4JB9L 4DVRL 3IAGC 2XWRA 3QUYB 4POZC 4FQQA 4W9JC 5LBVA 4DO5A 5B39A 3NQIA 1FFPB 4GOSA 1UD6A 2FR4A 1B2WL 3DARA 4KJWD 5D5MA 3CN4A 5I1LB 3WAKA 5ESVB 4U31A 4RDQG 3SDAC 2NCEA 4F9LC 1HWWA 2VXVH 1DQML 4YHYB 1EEQA 3L9RB 1V7ML 1OSYA 4NWUL 3GFUA 3CC1A 5FHBL 5AAPA 3WNMA 3WBDA 3RX8A 1UZGA 3WCYA 4N2DA 5LG6A 2IPKB 2OMNA 3VG0H 3LRKA 4PHXA 4KH2A 1CL7L 4PB0H 4BDVB 4F9PC 3BYTA 4P5KB 2F7OA 1LK2A 4GKLA 4A2DA 4NT6A 1BFOA 2VE6A 2ARJB 3NJNA 5DC2A 2V9QA 1EGJA 1PZSA 1J9RA 5FUZH 1FFQA 2Q7NA 2OSXA 1ANUA 4QJ3B 1NGPL 4GRMA 4HJ0D 3K2KA 5JHDD 1W0VB 2H26A 2VLJD 3OKYA 2IGTA 2BINA 3VRLE 2QPSA 1V3KA 3DX7B 1CICA 1BLIA 1NBYA 2KLTA 3MRIB 1CXFA 3OJ2C 4YZFF 3QEHA 2B1HH 2DQMA 5GRYA 5F0JB 1E4WL 1FZOA 2H0EA 2P5PA 3N5AA 4DGIL 2WGXA 2ZWZA 4WSJA 5DJ6A 1A6WH 1RZGB 2I5YH 1DQDH 1N64H 3IMTA 4FQLL 3Q1SL 1GYUA 5EULV 1MFEH 1KXQA 3S96A 1M42A 4M1DH 4ETYA 4MJ4A 2L3BA 3ARGA 4AQ1C 3ZYIA 4WKZA 1JGDA 2NCMA 2GHZA 4MD4A 4D0DA 5JXED 4EKXA 2BSCA 1R5IB 3KYMB 1YEIH 3C6SA 4NRZB 1TVDA 3HZ3A 4V11A 5ILTL 5K39B 5KS9B 4HIJB 2DM7A 2CKBH 3CHXA 3T3PF 1T0MB 2XNAB 3ELQA 4D9RD 5I17A 3RAJH 2OZ4L 1OWWA 3KWTA 3NCJH 2YJQA 3L95A 3IDJB 3ECUA 4MBOA 5IW3A 1IMHC 5IEKB 2VLKA 4G70B 1R5VB 1T89A 3EOTL 2ICCA 2WZ6A 4P5TA 2YBRA 4LVNB 4KKLD 3WN6A 4PJEA 4DKEL 5J6HA 4JRYD 4B7IA 4KDVA 4NZTL 1AOZA 4DQAA 2G0KA 4OV6F 4WI6A 1WFUA 2FQFA 3ARZA 3NIGE 2E7HA 3RB7A 3KPLB 1DVZA 4HPYH 2WO3B 2FUTA 3V6FB 3AM8A 4IBLT 4NQDB 3UG4A 2XDHA 3CQPA 5BQ7B 4YBLC 3E2HB 1TZGL 5H2BA 3GUFA 3WNPA 5D2LE 5E1HB 5IVXF 5C0JB 2F54A 5JXAL 3SOBL 2H32A 3Q6FA 4HFWB 4HUMB 3IETA 4QHMA 3FB5B 3S35H 1KTRL 2BO0A 4W70A 5IEHA 1N2RA 1KY6A 1T1ZA 3MUY1 3QQNA 3VFNB 1BSIA 2XZZA 3Q2WA 3NCYP 3V0JA 4L8SC 1NL0L 1Z3RA 4ANVA 4ZUVB 4AH2B 3NFNB 3I9PA 3EHBB 2WN2A 2YAFA 3EOYG 4XMKH 2DWYA 3QYCA 1UH4A 3VXRA 4TTDC 3O8XA 4V2BA 4ZTOH 2X4UA 2WVTA 1G9EA 5FO2A 4HLEA 4QHLA 2R51A 3CUPA 3BESR 2WBXA 1BLNB 1KIUA 3IETB 4QHMB 1NCCH 4PVMA 5DF0A 4I77H 4LQFL 1FFNA 4LNRA 2IGFH 4IOSA 1TJXA 4ZYKB 4HW6A 2QZ5A 2E59A 5GZOC 2WLKA 3FO9B 5E2TL 2AXHA 2X9XA 3QUXB 3EUUA 3TCLA 3H9YA 4YDKH 4OZIA 2DQDL 4HS6A 3CSYB 2FHCA 3A67L 5FA4B 3IYLW 1CD1A 4N0CD 4UF7C 2WYZA 5DD6B 4TF4A 2HFFA 1RUAL 3J8F7 5SWSA 2FGWH 1XGUB 5I19L 1NMCB 5JQHC 4DP6X 4P2QD 3F7RA 4JDTL 3HTLX 2OMXB 4NQVA 4I0PD 2HPOA 2DYPD 1GGYA 4IDJH 4K9EC 3JWNH 3T8MA 3W0WD 2LQRA 4GLRH 4JKLA 3AREB 4MAYC 4XP6H 5F96L 1EHLL 5AOMA 3P2DA 4FHKA 4Q4EA 1BX2B 2QTVA 1YPZF 4OZFH 1S3KH 3S4SG 1DBBH 4XXDB 3QEQB 2ZCLH 1UC6A 3J2PA 4H26A 3ATAA 4QHLB 4OI7A 1DVFD 3VWJC 5CGYC 3JYCA 2OCJA 2IEPA 4I4WB 3MRNB 2F74A 3MUJA 5JW5A 3BSZL 3MZGB 4NCC1 1JD7A 4JFED 3HC3H 5EBLA 1F1AA 2APSA 4ALAL 3MNVA 1H3TA 1F1GA 4HC1H 4MRBA 3VQMA 3QNXB 2RJMA 4BZ2A 4XN7A 2KT6A 4FFYA 2PPEA 1BEYH 1ZHBA 3GYRA 4N26A 5MEQA 3GLAA 1RLWA 3UIYA 3KLKA 4Y1AD 3MUZ1 2QR0B 4HALA 3V2AR 2AS5M 3SJVD 4F3FA 3FTWA 3VFVA 4MAYD 3VD2A 4XP9H 4F2MA 5BQ7A 5FR3A 5HHQA 1XQ4A 1G7PB 3ZJAA 4TQHA 4HGWB 1WZMA 2OX5B 3RY6C 5F7KC 4DPCX 2ZOWA 4BSVA 4OZHB 4G9DB 1N70A 3SBPA 2D3JA 3UO1L 1AHMA 3UTZA 4ISVB 3ULVL 1T03H 3Q8EA 4UTAL 2CR0A 5J6GB 2MH4A 2MEJB 1LO2H 3HHSA 2AJZA 3H4FA 4WWID 4AEIH 3BXNA 3BN9C 1DANU 2GEEA 2PWEA 2Y1ZA 1KBKA 4N2AA 2CJ3A 5IMLB 1JZ2A 1OGPA 4HIXL 4NM8L 2CXGA 5E94B 3K6FA 4JY4B 4Z9KB 4D3CL 3MRCB 4AL8C 4J23A 4F37K 1I7TA 2VITA 3DI2B 3LPWA 4N24A 4YR6A 1AR1B 4LHJB 2AMGA 2J8UA 5T1LB 3FQ4A 2PKDA 4FZEL 4ODHH 4NENA 5I23A 5IMOA 5J89A 3A5VA 3W39A 2AQPA 3MUGA 1SRDA 4X5PA 5JIQA 3MLVL 4HCGA 1HHJA 4YAQB 3E38A 3Q05A 3LNFA 3ZDYF 1OGAE 3VGHA 4JKMA 5CBEB 2ZXCA 1QFUL 3RPIA 2B15A 3GTNA 3QRGL 1CFMA 2B4CL 3DV4B 3MFGB 1OW0A 4GQZA 3RX9A 2OJZL 3UZVA 3QR2A 1UXLA 2ZF8A 3FTVA 3T04D 4QTHA 4FG6C 4XMXA 1CICB 5A7BA 3PNRB 2WZPA 3FT0A 1ICTA 4HXBH 3UAJA 2FAUA 1IVTA 2BJMH 2OAAA 1DO5A 1YEHL 5CEYA 1IJ9A 3ZTEA 4DGYL 2W0FB 5I1KH 3VDBA 2EYRA 5D7JD 4XVSL 4YHNA 5KJRH 2HVKB 1KIQA 1XXFC 2JIXD 4LLMB 2HAZA 1JVKA 4RFOL 2ZYSA 1FNFA 3KPRB 3FQWB 3UJIL 3I75B 1A14H 4RISH 4NJ9L 4FERA 1BFVL 4PJXB 1NICA 1U8OB 1P4IH 3OXRA 4OFDA 4CRPA 1QFWM 1WWBX 5IHUH 3FQTB 4M6AA 4X8GA 1S8DA 2J8OA 3H85A 4OCWL 2Q86A 1XIWD 4I5BB 4APQB 3ES6B 5GS1A 3HR6A 2QEJA 1KB5B 3ABGA 3PDOB 4ES9A 4NO3B 4HWZA 2N1TE 1OY3B 4OQTH 2QDWA 5GRVL 1JGUH 4F15C 2YPVA 1ZSDA 1PNCA 4P3CH 4ZW7A 1GJUA 2OKMA 5CINH 3IFLL 2EIZA 5DSCA 3S0PA 2IPUG 2OL3H 2XBDA 3MJGX 8FABA 3VI4E 3P2BA 4QJ5B 1GOFA 1UQSA 4MNHA 5EB9A 5JW3H 4WUKH 1KCRL 4KKCD 3DV6B 4W4OC 4TNFA 3MBEB 4HKXA 5AVVB 4WUUD 5FM4A 4Z3TA 2HLFC 3CBKB 2EUVA 5F72S 4F7CB 1H3PL 5EG6C 1DQVA 5KEZA 1J0HA 2ITFA 3L3JB 5DUML 4OSUL 3BE1L 2AC0A 1CU4L 4G6FB 5HD8D 5TFSL 3WUZA 3X1GA 2GPZA 5IVNA 2GT9A 3D34A 2VW4A 1IKOP 3B3IA 1KFAL 3MVSA 2QQNL 4PJBE 5DJAB 1PU0A 2YPKA 3PDDA 3OLDA 3QZWB 3AADB 5AB9A 3AUVA 4GKOA 4L9DA 3RILA 1NBVL 1GH7A 2B1AL 4ANXA 2EDJA 3FUIA 1C8PA 3BAYA 5I1EH 3FB8A 4NWUH 5DHMC 3AW5A 4PGBA 3G5XA 3MGAA 2J8UE 3ARQA 3AZUA 4LRNL 4S1SH 1XIWA 1WUZA 2NDGA 5ISZA 4UQIM 2VXQA 3WY3A 3FCBA 5C07D 4LSVL 3V9FA 3CFDB 4EZMA 4JPQA 3EJZC 1DUZA 5EU5A 1ZT7B 3L4UA 2QSCH 1JPTH 1OTTD 4QWWC 2AQ1A 4KGJA 5INDA 1Z0MA 3PUUA 1D5ZB 4LPXA 3NJHA 3LNDA 2W9EL 3EGDA 1RIUH 3WEAA 4OGAD 4F57L 4KRPD 4X5LA 3AY2A 2DH3A 3MMEA 4RAHA 1S9VB 4LVNC 4UCFA 1JZIA 2YZ8A 1UVQA 1RJYB 3N1GC 1I75A 3QWOA 3LPGA 2IMNA 2XVKA 1O9WA 3DROB 3DXAE 5K93A 2XTJE 4NKMB 3BWUC 3VGGA 4L8CB 1MH5B 2VUKA 2CLVA 3T2LA 5DO8A 2Y1AA 5I8KL 2UXGA 1CICD 1S7RA 3DJRA 5GS0C 4FFZH 3IJ7A 3PPEA 1KTDB 4MCZA 1COBA 1FA4A 4IS6B 4WHCA 1A7NH 1H3UA 1KPUA 3KXFA 2LFEA 4W9HC 4Y2OA 4RSVA 4DWHA 3DYOA 1V55B 1RUPL 2YIHA 3KNBB 4JKWA 2NY1C 1WFJA 3JQOB 4MJ6A 5ILTH 4IM8A 4YEFA 1K3ZA 4DTGH 4XOEA 3UPAA 5HYEA 1N0XL 2ZG2A 2GIYA 2Y1VA 3FSOA 4G5ZH 1BD2A 3SOTA 4AYSA 2WWOA 3AU1A 1CE6B 1M7UA 1LE5A 4RGNE 3BVVA 3WFEH 4DUVA 1YEGH 1KCVL 3FFCD 3KPNB 2XPZA 2WQRA 2K78A 2BHZA 3ZRSA 2CDFA 5E9AA 1QRNE 2RMNA 3HN5A 3HUJF 1KBWA 5J6SA 3FSZA 4U4BA 4JCLA 1UEYA 3DK2A 3LOWA 1Q94A 3D4CA 2VL5A 3RQ3A 3FH5A 2ZKHL 2ENSA 4U1MB 5BO0D 4OB5H 1TQBB 4O4YL 5J12B 4ODUA 1KWKA 4TVUA 4MB3A 5E6ZA 5I73B 5LCVA 5IB2B 5IW6A 5HHVH 4DP0X 3GSXB 4N2HA 3DIFB 1YEKH 3HCVB 2IAMA 2DQIH 3DX2A 4P2OB 2JK5B 2VQTA 1DBML 1LD9A 3EGXA 3C08H 2F54E 4PG9B 1L0XA 4JJ5A 4ZDHB 1YYLL 3SYAA 4X7TA 3P0YL 4HK3J 4PAZA 4CDHA 5GJSH 2UY7A 3WEXB 2ADIA 1OP5K 1AZRA 1NKOA 5IWLC 4K8RH 4RX4A 3WNOA 5KYWB 2EVJA 1S9VA 3INUL 3APNA 3M17A 5BCAA 4FABL 2R1WB 3NFSH 3W39B 3HZYA 3HI5H 5FW6A 4NQSA 1NA8A 4P9HL 2YD6A 1WV7T 3BAJA 3CXDL 1IEBB 5EMYA 3CZEA 2ATKA 3NMEA 4QI3A 1S5HA 2X70B 4OJCA 5GZND 4XX1G 4EMZA 4MAYB 1G6RL 1ZSDB 4KXBA 2A6JB 4ORZC 3RIFK 4AENB 2X3CA 4MD5A 3FZUD 5JQ6L 1KMGA 4FQ1H 3HG2A 3MTXA 5C6TH 3DSNA 5IQ9A 3BH9A 2FIKB 3TT3H 1J9SA 4MXVE 2AK4A 5F9OL 2Q8AH 3ZT7A 1NCGA 2ESVE 1T66D 2C9AA 3NJJA 4HUNB 1U8JA 5BVJB 1BQLH 2GJ6B 3GJFK 5FV2A 4Q52A 4J3OH 3X14A 3D06A 5DHVH 4R8WL 1J18A 1FORH 1F3DJ 4JO8A 3ZL4L 4K94H 5ADOL 3BZ5A 4XE0A 4L8DB 3MRFA 4Y5YA 1KJVA 5KG9A 4JDZA 3SCMD 2NT1A 4XVOA 2RCSH 1E4WH 1NCWL 2PYEE 3NCBB 5L4MA 3IJ8A 4QPEA 1FYTE 2CO7A 3UO8B 4X9HA 2JJWA 4FFVC 4WSKA 3VRJB 4AEHH 2W0FA 1LO4L 1G7QA 3Q48A 4UUJA 2WIIA 2YOAA 3NCMA 1A9BA 3RBSA 3NCYS 3L3HA 2MQGA 5MEQB 4XP6L 5F96H 1DE4A 3FT4B 4ZG1A 4YS4A 5ENWB 2VISB 3NZ8A 2ZPKL 2RAMA 3P2TA 2GJJA 3FCTB 2BVEA 4PV9A 3CVCA 4NAQA 5E8DL 2N7AA 4QKTA 4X9YA 4OFKA 4F37F 3FF8A 4AEFA 4OIIH 2J6EL 1UT2A 3EYVA 2ZXEB 2E6JA 4XCNA 4XOBA 3Q9PA 4P4KA 2FBJL 1QZ1A 1J5OL 4HCIA 3ZRCC 5FIEA 2AEPL 3WU1A 4UQEA 1BXAA 5DFTA 3RUGE 4NO3A 4WENB 3MNDA 2WQ8A 1JDAA 1ZS8A 3V52L 5J06A 1PL3A 3OHXB 3IGKA 1ZIAA 2XWEA 5FFGA 1CURA 3CN0A 5J6GA 1C7TA 1U2YA 3D07A 1NC2A 4HK0B 3VO0A 3FQWA 1IIIA 1AXSB 2YC1A 5K1VA 3MRKB 3VWKD 5B38G 3MRMB 3OXRB 1NKRA 1AQ8A 4JL1A 1USZA 1WC7B 3CLWA 3JV4B 4LGRB 4QR7A 5C0AA 3OR6A 2H1LM 1AG0A 5EDSA 1BFSA 3QI9B 3ZUCA 1TYJA 3S88L 1PY0A 3KPMA 3VWKB 2WLZA 2KZBA 4QIRA 3CVDA 4FQIL 4WW2F 5E2UH 3SPCA 3RFZB 2HT4D 4MA3B 4O51A 5FKPB 4KO5A 4OZHA 4JM4H 1O6SA 5IG7A 3MV7D 2Y5TA 2BHUA 3QJXA 5D7KD 5I8EA 3UAJD 2LAAA 3ESNA 1Q72L 4YLQT 3U1SH 2AITA 3EDJA 4MMZB 4XP5H 1AXSA 3OC8A 1R24A 5JPMB 2VR6A 1PMYA 4UZSA 2H3XC 1S7UB 3FU8A 4PJXE 5FUOH 1SLWA 5IGXL 2Z7WA 1CTMA 1UD2A 3O2WL 5AW5B 1OAZH 3KLDA 4BKLA 2CNYA 4JFPB 1KIUB 5I6XB 3LXUX 4QRTA 4YHML 1JWUA 1UXMA 2XWTA 2WTOA 4EDWH 1RUQL 3M7OA 5D9SB 3DYMA 1SXAA 2Y5EA 4S1DC 3S5LA 4M9PA 4U1NB 2B59A 3IE9A 4RNRB 3U0WL 5IB1B 1C9SA 3P11H 1IC5H 4O9HH 1LL1A 2ZJSL 4Z95L 5C7XL 5JHLA 4XODA 4E41B 4NQDD 2W07B 4MA8H 1MVUB 3IWUA 4BQ6A 3C8HA 3KCPB 4NQEE 3A4AA 2R29L 5IEHB 2X88A 2WNWA 2HTLD 4BINA 3QJHB 5AYTA 4UINL 4OF3A 1K8IA 1RUAH 4K71B 2FJHB 1JWUB 5FO8A 4HUVA 5CZVH 1C5DA 1IE4A 4FMKA 1XGTA 3IDXH 1QBMH 2DWEA 2Z31C 4WGKA 3FTZA 5DVLA 5INCA 2R4RH 1A2YA 4IBUA 4X7SH 4BSVB 2J21A 1A65A 2A99A 3LB6C 5D4JA 1IBHA 3FH8A 4HAKA 3TZVB 4M29A 1MEXL 2QPUA 3MI6A 3ESVF 5JHDA 3WL9B 2O5NA 1KB9J 5T3ZE 3S6CA 4PJEB 2BK8A 1H19A 1DBBL 5K59E 3QXVA 1A21A 2H47C 1LM8V 4KJPC 3ROOA 2C3VB 3EYFB 1NUDA 2A6DA 4RVBA 2A6KA 4XH2A 4I18C 1FZJA 3MV9B 2UXTA 1BQRA 2BC4B 3ARSA 4AITA 5D72H 3HC3L 3WIIH 3BIBX 1B9ZA 2AV7B 1R5IA 4P23D 2DMCA 5D70H 3UTSE 4KNQA 1GPOL 2WXKA 4Q74A 1UM6L 4OZFA 4Z7WF 4QTFA 4G7VH 4MNGB 3PHQB 3P9LA 3QEUA 3O6ML 4NAMA 3SYQA 4OUUA 3IMUA 5HHXL 2BNQA 4HV8A 3SQBB 4WCYH 2NUTB 4AQ1B 4K94C 2GC4C 2OL3L 1IGMH 3OF6D 5D93B 5DHEA 4PP2A 3CVHH 3NZSA 3BZEB 3NCFB 3PU7A 2ADIB 4B6ZA 2VW6A 3QG6A 4C4BA 5FF6A 4C83B 1K4DA 4FXGB 3IPEA 1TVBB 3EO0A 3BE1H 43C9A 1MAMH 2D0GA 1YNLH 1MHHB 1UA6L 3UPCA 1QRND 3PJNA 4WWKA 2BIMA 4GAJL 1X7SA 2ZG3A 1UUNA 2BVQA 5HYSB 3L8QA 3RKPA 1GXEA 4AEIL 3WUWB 1GHFL 4ODWA 3GSQB 3IGFA 4OU3A 4KC3B 1UFGA 5D6CA 4OCYL 1H9VA 4DW2H 4TPRH 3MO1A 3VU2A 1G7HB 1KJMA 1PF3A 2JJTA 3LEXA 5HDLA 1BZEA 3MBXH 3PCYA 3SYOA 4ZYKA 2CDFB 2ZX9A 1UTDA 3V7AG 5T5FA 1AANA 5D71H 4Z3FA 1SBSH 3V0VB 3BOVA 3VM7A 2V9UA 5FC9A 5KSAC 3CSBA 3UTTB 1BG9A 2VH5H 2RIKA 3I6KA 3PRZA 2IOOA 4NZRH 3SDCC 3O8XB 3T0WA 5J4MA 1URIA 1TXKA 5D1XC 1M71B 4X7FC 3HMXL 4Z7NE 3HI1B 1CTOA 2DLTA 3LRGA 5I16B 4YFDB 2NLJA 3UCRA 1QFUH 4MNQA 4P05A 1XGZA 2VAJA 1IC7L 1SFDA 2QVIA 1TEYA 2I32A 5I15L 5L88L 3TM6A 4G6JL 3DPBB 1RQ5A 1KLGA 1BF2A 4A2GA 3QYMA 1KYDA 4PBWD 1OGTB 4YHIA 2ATKB 5D8JL 5I8CA 3RVUC 4H8UA 3MRIA 2EIDA 1SLVA 5FECB 3DUHA 3JWOL 2CO6A 4KOBA 5CJQL 5T5FH 4RESB 1UD5A 3COOA 5JDSB 3D2UA 3BUQA 3V0HA 2ZWKA 1TO4A 3C5ZB 1HL5A 3JSSA 4E5XG 4PY8I 4GAYA 3MR9A 2X6CA 3H6AA 3TEXA 2NYYD 4HS8H 3LH9A 4M1GL 2NSXA 4LCWB 4GT7A 4LMQE 3I3BA 1JXJA 1QACA 2WXMA 4X80L 5K9JH 3FN0H 5E8NB 3F84A 4XNUL 3UZQB 4KV5E 4JN2A 4XNMB 2EEFA 5HYQA 2YEZB 4BXVA 3QIUC 4OF8A 3FONA 4AM0A 3RWFA 1C1EL 4PREB 4BDVA 1JV5B 1A47A 2CGZA 1MCSA 3L4TA 4J2XA 1EDQA 3GXDA 1G7LB 1QPPA 1I3GH 3LZLA 4R2GC 5I5RA 4XBGA 3QQDB 5I9QC 3ZUNC 4NN6C 2WSDA 1YNKH 4R90L 3DECA 2UZPA 1JHLH 1QSFB 3FBQA 3JTSA 3M1CA 1KLUB 3WKYA 3TA3C 1MJUL 4XB7A 4WHDA 1YYML 2HG5A 4N0YL 4Q9QH 1GC1L 2BXZA 4PD4K 3CVBA 3I3DA 4ILDA 1CU4H 5JPMA 3V4VB 1MAKA 2VDOB 3BWSA 3OXSA 3SQOH 1SLUA 4XCEB 3RDTD 3TT1L 5CLWA 1ZRUA 2R27A 3ABZA 4X0KB 2MCPL 1ZK9A 1IGFL 4PU2A 1VDGA 2BSBA 1DBJL 4HT1L 1EZUA 3IDYB 3FO0H 2ED7A 3QZMA 1I9IH 3QFJA 3TIEA 2YRLA 2BVOA 4G9FD 5E51A 2XZQH 4FABH 5L0QB 4L8SA 2CSPA 2X6MA 4ONGL 1U6AH 4LCWD 1UWXK 4J6RH 5G4OA 3S8FB 1Q9KA 3QFDA 1NC4A 2W60B 3CDCA 1TTFA 3LMJH 2FB4L 3FSVA 1R9FA 3SGKA 5BO1L 4ANUA 4XXCA 3QUKB 2XWJB 1I7RB 2F61A 4AQOA 3FUDA 3MLTB 2YC1B 2OMWB 1H15B 3VFSA 5CJ5A 3QIUB 4KNTA 3HZVB 2OM5A 4DK3A 4U1LB 1ERNA 1GW0A 5CUSL 3P4MA 4JM0A 4PB9L 4FTVB 5JPNB 1AR2A 1CGYA 1JRHI 5I66B 3MKKA 4QXTA 5DQJB 1X3DA 4YHPA 3PGFL 4XMTA 2V9TA 3O3BA 3CFBB 5DJ8A 3AACA 1JWSA 3QAQA 3OGCB 3IFNH 4JM2B 1TKWA 1M6UA 2ZICA 3ME0A 4XVTL 4AX3A 4M3HA 1KGJA 4NKQB 4WFFD 3O6KH 4RBPH 3QUYA 3SKOA 1WA2X 3ZKMD 2L8AA 3RGBA 4K5LA 1QR4A 4TLSA 4MJJA 1NCWH 4UWQB 4OT1L 2GSGB 3VI4B 3APDA 1I8IA 3RNKB 1YHPA 1SY6H 1KIRB 1A3RH 4A7GA 1IAII 3P4MB 1OTTC 1Y6NR 3EJRA 3OPZL 1FVCB 1MQKL 2FYYA 3DO4A 2XC8A 4UT6L 3C5XA 1W8EA 3CFKB 2YS4A 3NABH 3B3IB 1CI5A 4FNPA 1BREA 4M8RA 1U21A 2CIIA 4YH6A 5DJDA 1YO4A 4M7ZC 5F7EL 4Q9RH 2IQAB 4TUKL 4LPTA 4NWTL 4KZEL 3J27A 1JMXA 3AM8C 3F7YB 5F9JA 4HZLB 1RJZA 1PIGA 3SDDB 3ULUC 1O9ZA 2EDEA 2X38A 4Y1TA 4CJ0A 4JFQB 4LARH 1F86A 4OZHF 4PJAB 3VI4A 7PCYA 4IRZA 3ZKMC 5MEND 5DHYA 3KDMA 3G6JB 4GQRA 4CA4A 4DUXA 3KPMB 4N87A 4P46D 1BXUA 1NCAH 1NLDH 1QFWI 4N68A 3BUYA 4JDVA 4UQ2B 4X6EA 5F1IA 5T5NF 4E68A 4N2GA 4YE4H 1MWAL 2AK4B 3ABMB 1VESA 4TUUA 2HFTA 3UZEA 3UTQA 1AGBA 3LHPL 1OP3K 2WBJB 5AW0B 4PJ5E 5IMLA 5KVFL 4DGVH 4TNEA 4BZ2L 5HVWA 4PLJD 2W9DL 1GKEA 3WDHA 2B4CC 2PP8A 4KKAD 3RZCB 1RZ8A 2O72A 4Z3EA 1KTCA 2DMGA 2NQ3A 3CMGA 4JG0L 5TTRA 2WTPA 3QDJD 2DI9A 2GTWA 3VGEA 5M95B 2L0DA 4G8FB 3WS3B 4U05A 1U4FA 5AB0A 4KHTH 1YPZA 35C8L 1DVYA 3CC5B 1OTSD 1KGCE 3K6NA 1GZHC 2PXYD 4TULL 3LN5A 4NGHH 5EF0A 4HMEA 2Q6WA 3VNYA 1FCCA 5CP7B 3OKDB 2OYPA 1GTNA 2NY4B 4LFHD 5E2WL 3O0RL 3U4KA 4RIRA 5ABDE 1QNZH 2OW6A 3G6JF 2Y3NA 2NZ9C 4ODWB 2ED8A 3LRSA 2QGBA 1XV8A 5ID1A 2CDEB 2WLIB 4LSRL 4ODTL 2X2IA 3ULUE 3CVIL 2BRQA 2X6UA 3KVDD 2NY4D 5DEFB 1LEIB 4XCFL 4HFUH 2FT6A 2EADA 4A7GF 3FQNB 1DQDL 4W9CC 4F27A 2A6IB 1MZZA 1DDHA 1BV8A 1CFTB 3VX0A 3PWNB 5JQ6H 4PRAB 1Q94B 1TG8A 4FQ1L 1D5IL 5K9QI 1LDSA 3NH7L 4NSKB 2OMYA 4U1HB 4FOMA 4Y2LA 1RFDL 3E6HA 1HOEA 3LJ3A 3MV9D 3MYJA 2FLRT 1DN2A 3E9UA 4LVEA 4DK5A 1YEIL 3HS0B 4L5FL 1E4KC 1UM4L 4DKAA 3MRFB 3MACL 3S3SA 4ABVA 1JWSB 5DA0B 5I16A 4OLXH 2HG5B 5EU4A 4U7KA 3P40A 3VXSD 1I82A 4I9XA 2PTVA 4L9LB 4WHYH 4KZDH 4APQC 3E1ZA 5JPNA 3VRLF 4YBQC 4FQLH 1HWGB 4WFHE 3LDBC 3NIGB 3JWOC 1R6VA 1FO0A 3F58H 2BP5M 1FZJB 1MCWW 3FS9A 1GYAA 3P0GB 3BP6A 5L8JB 4IHOA 1O7SA 5K5YA 1T66C 5I0XA 1UGKA 4ZFOB 2MQ3A 5D7SH 3FOMA 2AJZB 3VD5A 2JMRA 2CKBA 3OB8A 3GI8H 3HNTL 3IDNA 3POCA 3RWFB 3RWEA 5GGVY 5EZLB 1IM3B 1TTAA 3AAZA 1A4BA 2X9ZA 4U0RB 4AGOA 5HDOA 3JZ7A 1R17A 1AGFB 3S7GA 1GOGA 4JFFA 1BOGB 2OA9A 4OBRA 4EBQH 1W6LA 2AW2A 1AO7D 4YDNA 5EA0L 4P2CG 4M48L 3MOAL 2GTQA 4C83A 2H6PA 5FF6B 4YBQD 3TV3H 4YZFE 1GAFL 4YSPA 4HAFA 3M8OH 4BE5A 5CCKH 4AUJA 2PCFB 3HCVA 1KIPB 3B1UA 1KZYA 1I3VA 5KSAD 1WBXA 5GS3A 1TZGH 2VMEA 4CN1A 1JSYA 4ZTOL 4JRLA 3ULVF 2O4EA 2V5SA 1W9XA 1YECH 2AV1A 1EAPB 2R69H 2UZIH 4PJFA 3U7WL 3CU7A 4BEIA 5LN4A 3S9DB 1HT6A 5GPRA 4AT6A 1OB0A 2WNXA 1YCSA 2D0HA 3L3IB 3QI9D 4X5WB 4PLOB 3PHOA 4HJ1A 3TYGL 3B2VH 3MV01 3OAWA 2OSLB 4NUJA 5HHMD 2VR5A 4PJBF 2DY2A 4XXDA 1BBDL 1MREL 3QXAB 2GCYB 4WTXA 4HWBL 2YEVB 5FGCE 1HZLA 4NO5B 3VXME 3BKMH 3QFJE 4WIQA 5DD5L 4AYFA 4UIMA 3A67H 1L7TL 3UCQA 2HT4C 3G3LA 3IJHB 3S36X 5DWPA 1EZLA 5FYJU 2AHIA 3B7RL 2IJ0C 4EI6B 1NDMB 4PLKC 3VJ6A 1RK0B 5JYLA 2XXMB 3SDXB 5CMAB 2JI1A 3ZQWA 5ERWA 2QL1A 4IRJC 5TQ2H 3VXQA 1TEFA 2DJMA 4CN4A 1QW9A 3WHXB 3EJCA 4XXWC 3FB7B 3VD9A 5F88B 5D55A 1MFEL 2DL2A 1I1YB 3VXOB 1U0QA 3L3OB 4I0CC 3KBPA 4NKMA 3NYKA 4Q6KA 1VGEL 5C70A 1F02I 3U46A 3UMTA 1JPGA 3MRMA 3T0AA 2BY1A 1P9MC 3BN9D 3L4XA 3RJQB 1WHPA 2CIKB 3CIAA 4R3SA 1SXZA 4KK9C 3SPIA 1XCTA 5MEOA 4J1UA 3MA9H 4GRWE 1ZJBA 3P3YA 5CBAA 3C6SB 5AVYB 2ADYA 3BWAA 4ZT1A 1OQOA 3F6JA 4FP8L 4HKZA 3KD4A 3LZRA 5IMKA 4OLZH 4M5YH 6CGTA 4Y7OC 3TVMB 5KSBE 1FL5A 5KJRL 3BZEA 3NT0A 1DFBL 5BV7B 3HNSH 2VL4A 5TF0A 3W9DA 2XPYA 2V7HA 4Y5VC 4MZRA 2D7QA 1VLXA 1NUNB 3CZSA 4NUGL 4OUUB 2R0KH 4IGBB 4QYOA 1MF2L 3F85A 3KBHE 5HGAB 2FYVA 3FN9A 3TNNB 1UJ3A 4EPSA 5CHNB 1MY7A 3BP7A 3X13A 5SX5K 3TU6A 3ZE1B 3LSOA 1FG9C 1MFDH 3EO1B 3DXAD 1U30A 3U6RB 4YHNB 1DSFH 1YEJL 1A1OB 5FYKL 1S78D 1PJWA 3S36H 1N5AB 2ITDA 2ADFH 5K9JL 2G75A 1KJ2B 1F90L 2VO8A 4KJYB 3T0BA 4B7LA 5D7EA 1JI1A 4DSYA 1MRCH 1RI8A 3V4LA 1A0QH 2ZKMX 3ZL1A 5EOQL 3KPSD 4OF7A 3LIZA 2HPTA 1B4JL 5DUBA 2NY5C 3UC0L 2A0LD 4DAGL 4XE5B 4Y4KC 3HZMA 4YL9A 2XA8L 2BY3A 5BZWB 3SKNA 2WZ5A 3TJHC 5DUPL 4JZOA 5KW9H 2BP0B 4KI5D 3RFZA 2F58H 3L6FA 5J6HB 1SUJA 4XO8A 4GW4A 1JRHH 4JHAL 5AEAA 3JWDH 3O2VH 4MGXA 1MJ7H 5EU3B 5T3XL 1BWMA 3BQUD 3D0LB 2JJSA 3AREC 1AZVA 3BVTA 5D7LB 2NTSP 1EV2E 2NRDA 4HMCA 3BYYA 1AIFB 3JV0A 5CF3A 4MAYA 1OV8A 2VXQH 5I82A 1UD3A 3D87B 3N42F 4NUMA 4N2LA 4ZO9A 2VKWA 5HHMB 4Z7QB 2OYMA 4OW6A 2HMIC 4QXUH 2LHAA 4IEFB 4Z7UA 5GGQL 3UFIA 3CCHA 4XX5A 1AKJA 4I5BA 2Q86B 2X0WA 1E65A 4BKLB 4OJAA 3L6FB 2X7LB 25C8L 3L7FB 1FL5B 4J8RA 5FO9A 3WN5A 1T22B 3M88A 4PJHB 5GGVH 2ZXDA 1TQUA 4N8VA 2HSIA 4GP8B 1LO3H 2VR9A 4Z7VE 3W0WA 2ZCZA 1B4TA 1MW2A 2F08A 5HYJE 3VD0A 2NXYB 3GRBA 4LLMA 5FCSH 4AL8L 2IPTH 4AW4A 1DQIA 1HN1A 1FAIH 3EFOB 4XPGL 3GXTA 5IBUG 4KHXL 2N56A 2Q3AA 2YQBA 1A22B 1Q0XL 4UI2A 3PGCA 4DUWA 1YQVL 5EIQA