5F2FA

Crystal structure of para-biphenyl-2-methyl-3', 5' di-methyl amide mannoside bound to fimh lectin domain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
158
structure length
157
Chain Sequence
b'FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein FimH
publication title Antivirulence Isoquinolone Mannosides: Optimization of the Biaryl Aglycone for FimH Lectin Binding Affinity and Efficacy in the Treatment of Chronic UTI.
pubmed doi rcsb
source organism Escherichia coli j96
molecule tags Sugar binding protein
total genus 34
structure length 157
sequence length 158
ec nomenclature
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 5f2fA00
3BWUF 5LNGA 3JWNH 5FS5A 4AV4A 4X50A 1QUNB 3JWNG 5LNEA 1PDKB 4XODA 4XOCA 4AVHA 3ZL1A 5F2FA 5FLUA 2UY6B 4J3OF 4CSSA 5AAPA 4CSTA 4J3OH 1N12A 4BUQA 4X5QA 4AVIA 4ATTA 5F3FA 1KLFB 2WMPB 4AUJA 1TR7A 4J3OG 4XOBA 2UY7B 4AUUA 4XO8A 5FWRA 2VCOA 4AV0A 2XG5B 4AUYA 4XO9A 2W07B 1ZE3H 1N0LB 3SQBB 5FX3A 3BFWA 5AALA 5CGBA 5JQIB 2JTYA 2XG4B 3RFZA 5IQNA 3MCYA 1UWFA 5IQOA 4AVKA 4X5RA 1KIUB 3ME0B 3ZL2A 4AVJA 5ABZA 5IQMA 4XOAA 3BFQG 5AB1A 2JMRA 4XOEA 4AV5A 3ZPDA 4X5PA 4LOVA 2J2ZB 4CA4A 3JWNE
chains in the Genus database with same CATH superfamily
1HOCB 1USQA 3DGGB 3GTNA 1NUFA 1Q9OB 3EOBA 3OSVA 2EYRA 4KUZL 3W39B 3BKJL 4R8WH 1LLAA 3HI6H 3WHE0 1ZPLA 1J0JA 4PJDE 3ZKSD 7FABL 3DA0A 4UQ3B 2VB5A 4PJ6A 1BQLH 4M6AA 4PN6A 1A6UH 3N43B 4Y5VA 3G5VA 1M7IA 1O7DE 4G9FA 1BVNT 4Z7WA 3D2TA 4R84A 1NCJA 4XO4A 3RL1B 1JV5B 2AJYH 2BVEA 1CXFA 3ZSTA 4LMQE 4YGVB 1TTBA 3EYSL 2HFEB 4H0GA 2VERA 4EOWH 4RGMB 2GTWB 3FRUA 2VUKA 5GZOC 2CJ3A 3LSOA 2VXTL 5AOKA 5C0AA 1E8XA 5GZNA 4UWQB 4G8GE 4QD2E 1E90A 5D7LA 5L4JA 5BV7L 2YA1A 4XCCL 3IKCA 1NCGA 2HVKB 4JJ5A 4K3JH 4YC2C 2C7UB 4ZUTB 3P2DA 1SY6A 1G0DA 2YMTA 1YMMB 1NKGA 3U79A 1DEEA 4LL9A 5I1CH 1YJDC 2AC0A 3VXUB 4AIZA 3QWRD 3JVGA 5DT1H 2BSSA 3DX3A 2ORBL 1DVSA 1P69B 1CMOA 4XPHL 3RZCB 1EGJH 3DPBA 1VESA 4MSWA 4J3WA 4H1LB 2ED6A 2R9HC 4GQZA 4QY8B 4OZFA 3AMLA 5D2LF 2Z65C 2MWCA 4EI6B 1O5PA 4NENA 3CSBA 4P4KC 3F7YB 3TP4A 4JFXB 3KD4A 3FN0L 2Z8WC 4JREB 4A2MA 4JMXA 4TSBH 2P4AB 2DBLL 4JDEA 5EBWA 3WL9B 4R96A 1JNNL 4KTDH 3GMPA 2X3AA 5IQNA 3SE3C 4OF8A 4NPYB 4DO5A 1BVOA 3O3AA 1F00I 1MCPH 5T1KB 3SYCA 3E3QE 2Z93B 1T2XA 4KVNH 3TVMD 4HSAC 2IH1A 1MN4A 3L7EB 3ZUNC 1JVKA 3QPQD 2WQ8A 3KPOB 4G8GB 4RFEA 4YN3A 3ME0A 4AI7A 2E9BA 4YHPA 5DHDA 5I71B 1KCLA 4LVHB 3V4PL 1M9WA 3HLAA 3FOMB 1YJDH 2WLZA 3PABA 3HS0B 4M7KL 1I1AD 1DBJL 5IEKB 3TN0D 4M3HA 4EUPA 3WD5L 3FONA 4QAMB 1QX1A 5C0RH 5J0BA 2GBUA 2VITB 5HDWA 1KXTB 3LXBA 4DJMA 1AHWB 1SYSA 3KMDA 4KI1A 3VFWB 4APXA 3BX7C 1U92A 4IRSB 2HWZL 3NSYA 4Y16A 2X53A 3QJUB 1NCUA 1ET7A 2F2HA 5B1AB 1DQLH 5DXWA 1BXAA 2TAAA 2BZ7A 4FQLH 3WEXA 1P7QB 3F5WB 2GBVA 4LBEB 2WQVA 1Q4NX 1VZHA 2WXQA 1INEH 3VXME 2ZCHH 5GGSB 4CW1B 3RDJA 2VDOL 3GXTA 2ATAA 1WICA 1N6VA 2K6WA 5DA4A 4R6UA 5KVGE 3LD8B 3MRGA 4BFBD 1MUJA 1IU1A 3BUIA 3C12A 1WC7A 3Q48A 4MASA 3UTPD 4PJ9C 1H5BA 1IMHC 3O9WB 3W57A 4Y7OC 4O4YL 4X6CF 4JZJB 2IDSA 4Y0GA 3ZW3A 4PB0L 1TO4A 4NCC2 4NQEE 1P0SE 5JQ6L 2JB5H 4CMMB 4HPYH 1FDLH 3Q9PA 4P5TD 5E1AA 3T0DA 4JO4L 2X41A 1HWHB 2GJ6D 4IKIA 5C2BL 4D9QE 1OKEA 3DX8B 4BK5A 3NBNA 5FO9B 4HLJA 1LQBC 4NQVA 1U3HC 4XN5A 2Q20A 2O5NA 4JG1L 3U9PL 5TH2A 2NMSA 4PCKA 1OSPL 1UUNA 2WAQA 4I9WD 4N0CC 5FKAB 3D87B 2IFFH 4U6XB 4FKEA 4NWTH 3VXMB 1OCCB 3TCTA 1S8DB 1MRFL 2VDMB 3BFWA 1WFNA 1OAQH 3Q9QA 2B14A 1YEIH 2FIRT 3K8LA 4OFPA 4PJCE 5CMAA 2DQJH 5CU5A 3VFMA 1YDPB 3JV6A 4XCNA 1I82A 3GRWA 4CN6A 4NRXB 2Y5TB 4YSOA 1B3IA 4EUPG 5JMOC 4HAKA 1W9XA 3NZHL 2WXNA 3SO3C 1ZLDA 4FYTA 4GI6A 4NQEB 2APWA 1YQVH 2D3VA 2VC2L 3CN0A 1BXXA 1QFUH 3WFCL 1BVKA 3KXFE 5AAMA 1ZXQA 3CPLB 4GRWH 4YSAA 2A83B 1KIRB 4PJIE 3QDGA 1E5AA 2NQ3A 2NY0D 1RIHL 3FFOA 4U3SB 1A25A 5L2JA 1TQCB 1UOLA 2D2OA 1PX8A 1CQYA 2IC2A 1U4EA 3ARGD 2O5YH 3S34L 3PL6D 4PI0A 2ICWB 2MQGA 1AXTH 2KPNA 2X1OA 4MS8D 1BGXL 3FAWA 4LRNH 1IO4C 4MMZA 3QXAB 3O0LA 2XVBA 5DSCA 1IFGA 2AGJH 4AQEA 3ZE2E 4BFIB 3K0YA 3RIFF 4MA7L 1CE1L 2AQPA 1MFVA 1CFSA 1JTOA 1HKLL 4PJCB 2NY4D 2OMZB 4LAQL 4RQQB 3U83A 1IEBA 4G8EB 1ZS8A 3GD1C 3WY4A 3VXSD 3FQNA 3SPVA 3LQAH 4BIKA 4MB3A 1KMGA 3L7FB 3OF6A 1BAFH 1KCVL 4JJOA 3TYGH 1RIVL 4AVIA 4GUOA 5ESQB 2BCKA 1NAML 3REWB 2XZCH 2EINB 4PRHA 4TOYL 3U46A 3V6OC 1M2OA 2DWEB 5ID0A 3WFBH 2J8OA 3KXFB 1GZPB 3EOAA 4RZCB 1DBBL 1BMZA 3LPFA 3OAYH 3TJEH 3WN5A 3EGSB 4F9PA 4F15B 3BSZL 3S35X 3UEQA 5C09E 4B96A 3BMWA 4L5FE 4ZI8A 1K3ZA 1RZ8A 3E8UH 4BZ2H 4L0PB 2Q3AA 2KLTA 4HWZA 3HBZA 2Z8RA 5HGBB 5BMFH 3BPOC 1FZKB 4C4KT 4DQOH 3S6CA 3HHMA 1T5WB 5ACZA 4UTAH 3BH9A 2PR4L 2J6EA 4QMEA 4KWUA 4A39A 2APXA 4AQAB 2E76C 3P77B 5IHLB 4UINH 1IX2A 5PAZA 4HIIB 4NSKA 4O02L 2XI9A 5FOJA 4PY7A 4XAKD 2VKXA 4EVNB 4CVZA 3ZE2B 2EXSA 2DN7A 2OK0L 3CGTA 2WVVB 1ZHBB 4M8QA 1V7ML 4X7CC 1DL7H 3LQZB 5LWYH 2X4RB 2IMMA 3VGHA 2ADGB 1Q38A 4Y4FD 3P0YL 5DUMH 4NQSA 1DE4B 3OTTA 4ZD3H 4ZFGL 2FTAA 1OCZB 4XTRD 3SY6A 4N2NA 3TBYB 1JNHA 5JIQA 4RGOL 4P4RA 1AQKH 4HS6A 4HWBH 4D9LH 5EZIL 1OPOA 3O0RL 3QDJE 1NCOA 4NZTH 5C9JA 1YNTF 1YEGH 2SODB 5BQ7B 3BISA 3GMOB 5DD6A 3LDBB 1U8OB 1KEML 3AQDA 3BP4B 1G94A 4FG6D 1OD7A 3BDXA 5CBAB 3TT3H 5JIIA 2EYTA 4MBOA 3E6HB 3QCVH 1H6FA 2AJUL 4BM7A 1QNZH 2Z1KA 2ED8A 2ZX7A 3A6CH 3V5HA 1QSZA 1GGCH 4X6DE 1E5CA 4FQJH 1JDAA 1LK3L 1NDMB 1NGZB 2WVTA 3JWNG 1FFOB 3Q2CA 4D9RD 1U91A 4K3HA 3FQUA 3TA3D 1VHPA 4JANB 5EU3B 3BPCB 5GJTL 1BEYH 1MPAH 1NTDA 3RNQA 5LGHL 2X70A 1SDYA 3QQ9D 1MCCA 1TYRA 5KSBF 1DFBH 1W72H 5KYUB 1HQ4B 1U8CB 3BIKA 3NZ8B 1NGWA 4HCRL 3UTZB 3WIIL 1GPOH 3QB7C 4WNJA 1HXYA 1NOAA 3S37H 3BQVA 4NRZA 2V5TA 1B0RB 3FDWA 5IJVA 5T1JA 3NJIA 1Z66A 2YXMA 5J12B 1CD1A 4ZXBA 3CMGA 1MEXL 1O75A 3AC0A 3CN1A 1K5NB 1ZE3C 3B8SA 3WJMB 5F89A 4N2CA 5TPWL 2DH3A 3L6FA 1P5VB 1E0OB 1L5GA 2VIRB 4JO2L 2P1YA 4JN1H 3GMQB 4NBZB 5K9QI 3QDJB 2PXYA 2R2EB 3BLPX 4U4BA 4UT6L 4EIGB 5BV7B 2FEDC 5IMOB 5E6SB 1AE6L 1CFVL 5EEWA 1NL0H 3SGJA 4G1EA 4N1HB 5HYSG 4OQ1A 1JUFB 5E9DE 2F8VA 3L8QA 5IW1A 2FDBP 3C5SB 2VISA 4YBHA 1ZXKA 2PTUA 3TA3B 2P5EE 3DUSA 4Y19E 4RZKA 4X6DB 2UZYB 4A63A 4K55A 2XN2A 3FSZA 3WG7B 3HE6D 3OB0H 2XVGA 4OM0L 5BXFA 4U4IA 3CSYA 4ZUVB 1KY7A 5ABAA 4GIAA 2BVYA 1FHNA 4D0DA 5DGRA 1EMTH 1GC1H 1U9KA 4MBRA 3ULVL 1T7ZA 3IU4H 4G80A 1XDTT 3ZXAC 3FO1A 2MNJB 4QXGH 4APQC 2WINA 1TNMA 3IFOA 3BAEL 4IBWA 5DJ6A 1CG9B 1VEPA 2IWFA 4NNYB 5MP6H 2XXCB 4M61B 2V5SA 3S4SA 3UIZA 2YZ1A 4OGXH 4L8BA 3PDOB 2FO8A 4XBPA 5EBMB 3HJEA 3L5HA 2YKLH 4ZTPH 3QIWC 4OJFH 3RUGE 1N26A 1A6TB 4HT1H 5J9PB 1AO7A 4J3UA 4BCYA 3FQ4A 4WI0A 4OV5B 4Y8DC 1E28A 5C6TH 3Q8AA 4YPJA 4BRJA 1L9NA 1NDGA 1QRNE 4PS3A 4XPTH 1CFQA 1ZANH 4E41E 5I8CB 1FWXA 4AKQA 1P9MA 3LZRA 4PBVC 2J8UA 3O4LD 5SX5H 1KXQA 4FTVD 4Z7QE 4K0OA 1G7QA 3TL5A 4G43B 2LU7A 4NFBA 5CEYA 5F8RC 5E6IB 1SQMA 4FNRA 1MKFA 4MVBD 2Z7ZA 5KS9A 3V4PB 5CIPH 5EEUA 3LPWA 2IAMA 5EORL 4KMTL 3VCLA 3FQRA 3SDAA 1JZ8A 4DSYA 3V5DA 2P5EB 4I0PD 1HNGA 5LGJB 3SDCC 5F0LB 3R7RA 1J10A 1E2WA 3LHPL 1IAMA 3L3HB 3VFRB 3VFGL 1E4WH 4MNQE 1RVFH 4NBYB 4A67A 2B1OA 3TOPA 3VMNA 3F85A 1F56A 4L37B 3WLBA 5GRJH 4NM4H 2B9AA 1SGKA 1WITA 1CIUA 3QAZC 3D39D 1S7SB 3UERA 4ALAH 4X99B 1RJYA 2BSRB 3QUMA 1QTPA 3BH4A 1JRHH 3KW7A 5ALBH 1JSYA 3QI9B 4HKJA 2VSDA 2VDOB 3G6JE 4PSPA 4ZFQA 2C3XA 4R4BB 1S7QA 3GHBH 3U7WL 1CZ8L 2BNUB 3HUJE 3JTTB 3LEVL 5GRVK 3H9HB 3QQ4B 5LBGA 3NCWA 3TBWB 3VDCA 1W16A 1XIWB 2VLJA 3A6OA 3RUGB 4IOSA 1M7DB 4JR9L 4ODSH 1WBZB 4UB0H 4GQ9L 3SGEI 5IEHA 1J0HA 1A1NB 4E41B 4KK8D 3K6FA 2B16A 4RX4D 3P11L 3VVVA 1JF1A 5LDUA 4BKLA 1AANA 5F96L 3EO1B 4YL9A 5DZ9A 3F7PC 4YSUA 1SOXA 4LGSB 3N91A 1RK7A 3BEVB 3FQ2A 4MZ2A 3RY5A 1CDIA 2BFVH 4M1CD 3PV6A 1HCZA 1M4KA 2PW1B 4RBPK 2QBWA 4A6YA 1NMBL 1QW8A 4WUUD 1EX0A 1OE1A 2EABA 5F3HA 3B4NA 3IK2A 1MJJB 3QJSB 2P8PA 3H1ZA 4PLKC 4R2GD 3S4SG 5JYLA 4JVPA 3V8CA 1HDMB 3GS7A 5HHXL 4MNQB 1ZT1B 4ISVA 1VAHA 4YLBA 2BOLA 3CZKA 2QMJA 3JUYA 3GWJA 5TD4A 3UG5A 2XQ0A 2R0LL 1YYMH 1RZGA 1XCTA 2H2SC 3DK0A 1Y07A 3LN4A 4KQ4H 4K9JA 4NO2B 4NZRL 3P2TA 4U6HA 3QXVA 5FOBA 3CH8A 1XF2A 4LHQB 3ZMEA 2YMOA 5GIRB 2UZXA 1B0GB 3G6JB 4XZUB 3CK0L 3NCXA 1SOSA 2EIEA 4PS4H 1J5CA 2JTDA 5LBSA 1TJIL 3HZVB 2I9LA 2DICA 1CBVH 3HUJB 2YSSA 4FABH 4M62H 4HIQA 1Q72H 1T21B 1T3FB 3VCLB 1T89C 1I4FB 2JKJA 4IGBB 2KDGA 4EPSA 3KS0H 5LN8A 3BKYH 4G9DB 2W0LA 1F6FB 1JK9B 1RAMA 2VC2B 3X1NA 1XGQA 4BFOA 1IVTA 4UUJA 4WUUB 4JZNB 3M46A 4UTBA 3OB0K 1A66A 4OQTL 3LMJH 1M71B 2VLKB 1ZPUA 4JFPA 3WGUB 4K15A 3OXRB 4A2EA 3QIUC 1T03L 3IXAA 1KLUA 3RGVB 2CPUA 2Y1AA 4M02A 2YMXH 5EOQL 2C9XA 2DIAA 3ECBA 3LKNA 4XPBL 1BVNP 2BIMA 2JXMA 3MBEC 4JFHE 4PJ5A 4RDQF 4FE9A 4LQ1A 2WYZA 2P26A 3WXVH 3NTCH 2ZUXA 2NR6C 3RY6A 1HYSD 3UADA 2J3SA 2WQSA 4HS3A 1URIA 4JK0D 2ZCKL 4WWPA 4AWJC 1BJ8A 4P99A 4U1GC 1A4JA 3TA4D 3IJYA 3PREA 1X4XA 4KNQA 3UX9B 1PS3A 1D5IL 2G2RB 5B8CA 1MCOL 4F33A 3MV8D 3P0VL 1NDTA 3HNSH 4FULA 5HDBE 1TVBA 4LNVA 3QUKB 1SNRA 2OSYA 4P9HL 4AE0A 5SX5K 1RU9L 3DIFA 2ZKYA 3KPPB 3VG0L 4YE0A 3FFDB 1ZLWK 1T1XB 5T5FA 5JPMC 2P52A 1NAMB 3GTVA 3S36L 3RYMA 5IJDC 3RVXD 1VF5C 3RVTD 3SN6N 4IDJH 1UZ8B 2IFGA 3L48A 1N0XL 4WWNA 5FYJE 3ZGIA 3WFEH 3H4FA 1T0MB 4OF7A 1F4WL 1CLZH 3JWDC 2VZSA 4GW4B 2NYYD 3T6ZA 3QUXD 1A3LH 4ZZKA 4G6KH 1UKTA 1K4CB 2KS0A 2P24B 4PJGE 1JZFA 1A7QL 1ECZA 3TFKC 1JZ4A 5FUOH 3MV8B 5LXVA 4EE2A 3ILPA 2EDXA 2X6CA 2F68X 3EKCA 2XPYA 1JPTH 4O02B 1SM3L 3N85L 5KTEL 2EE3A 3NPSC 3H6JA 3N43F 2YPKB 3MODH 4ZODA 1E27B 2IDQA 5EBGA 5H8DA 1MJ8H 4NXSA 4QJ5B 5T8IA 3ZHDA 3GMNA 2XT1B 1TLKA 3S98A 4I7ZC 3PJLA 1MWAH 1E4XI 4KBPA 2HSIA 1TETL 3KBHE 3ILDA 1OOWA 3N40F 5SV4A 3SHSA 3K91A 1IBGL 1KBBA 3NN8B 1YNKH 5JO5B 4UYPA 5BRZA 4I5BB 3VSUA 2ZP9A 3JWDH 4KMQA 3HMXH 3Q8BA 1QO3A 1CXEA 1WTLA 4A7GA 3V0JA 2COQA 1HNYA 4A37A 2NRDA 1S7TA 4JHAL 2Y1ZA 1J05A 4HG4K 1KN4H 1ZVSA 1HSAA 4I48B 5GSVB 4JFEE 2WBJB 4ZDHA 1XH0A 3LNFA 1TZGL 2VN6A 3QHZL 5D2NB 5I6KA 1UD6A 1CYXA 4N85A 4I3SL 5J1AA 2NY1B 2EDQA 1UH3A 1IAIH 3VD1A 4PV1C 4IMKA 3R06A 2HT3C 5C7XL 4PJGB 4PTUB 4YR6A 3KYKL 4NNXA 4Y1AD 3GSNH 5KVDL 4HYTB 4EN3D 2Q8AL 1KBVA 1ZA3A 4OU3A 4TLKA 3BYTA 4PJDF 3DRQB 3WJLA 2PP7A 3GPEA 3O3DB 3ULVE 4OFYD 2WKGA 5GGUA 3OKMA 1N4XH 2VR3A 4BQ8A 1VFAB 4ERSL 3LRLA 1JGLH 2A77L 3GJEA 3KL0A 3MNVB 4OGYH 4KPHH 1UWGH 4P3CH 2N01B 1RERA 5B3NA 3NCEB 3TX4A 1HEHC 1KF9B 1QVOB 2H6OA 3ESUF 1OALA 2IG2L 5EF2A 1TJMA 3NH7L 4K71B 5DTFB 5ADPL 1LE5A 3MRIA 1M7UA 2R29H 1KOAA 4L05A 3BD3A 3STLB 1QWHA 4FNLH 4HJUA 4XNYH 5AW1B 2XETA 2ADIA 4LCIL 2Z9TA 5L6YH 5C3LD 2JKTM 1S5IH 4I18C 1N8OE 4IU3A 5TJWK 4FXKA 1NGYB 2VRAA 1X5JA 1RV6X 4Y9BA 1KB3A 1M1XA 2V9QA 3IJ8A 4M48L 5EH1A 1FAIH 4XH2A 3H42H 1UXSB 2BY1A 2KZBA 4BSJA 4U7KA 3QNXB 3W11D 4G3YH 1YC7A 3TO2B 8CGTA 3QUGA 1NANH 5D5ME 3WXWH 4HUCA 1O9VA 2E75C 5L8JB 1R0AL 1B9ZA 4XI5C 4AC2A 4JJHA 3BN9D 4HKZB 4OKVB 4G9FE 4PREB 1LD9A 5K5YA 4OB5H 4NJAH 5CKAA 1QA9A 3VWKB 2MCG1 2R2CA 1J86A 4GXFA 4O00A 4WO4B 4QXUL 4XNBA 3HG2A 2BRRL 3B2VL 5G4MA 4Z3HA 1BQRA 4H8WL 5C0AE 2AQSA 5DJYA 3U0PA 2HRLA 2OXGA 3EYFB 1UB6B 5D7LE 1U3JA 2G4GA 4ZPTA 1A1OB 5JOFA 4XVSH 2Z35A 3FCTB 4D3CL 5ITFB 2GT9A 5KVFE 1CF8H 3W9EB 4HS8H 1Z5LA 2EDFA 4HK0B 2D03L 1MFAH 2H2PC 3HNTL 3DKHA 3B5GA 4UV7L 2MQCA 2D7OA 2XA8L 3HN5A 2ICWJ 3KPSE 2EH8L 4LK4A 2QVFB 3UXFA 3QNYB 1U8LB 4LLUA 1FFPB 5CZVL 5J06A 3R19A 4HIEA 1THCA 4EI5A 3EOBB 2R56L 5D5MB 1OSEA 5GXBB 4LLDA 1W0VB 1M6UA 2Z7UA 2DL9A 4PU2A 4FFTA 2CALA 2K1MA 3QXWA 5JA9A 5I1LA 3D08A 2OTWA 3G5VB 5F9JB 1M7IB 3B9KC 4G9FB 5F72S 4Z7WB 2ZYIA 5EZOH 2E7LC 4NO5A 3HAEA 1CGYA 2JQZA 4WGWB 1DQJA 2CGYA 4LVOC 3RJDA 2WSKA 1XWVA 4MKMA 2ITDB 2Y22A 1O6VA 1JHLL 3LSOB 5KBMA 2X1QA 5DEGB 3DMMC 5D72H 3RWIA 5C0AB 3BH8B 3X3GH 5D7LB 1GIGL 4UBDD 1T83C 5C0FA 2Y5EA 3L3IA 2WWKT 3IKCB 4KKQA 5DRWA 5E8PA 4AUYA 3NK3A 1MLCA 3UC2A 5CAYB 2BX5A 2NCEA 2C9AA 1AGBB 1UCTA 4DKDC 3B8YA 3T0AA 3QCUL 2W94A 4C8XA 1PKOA 2A2QT 1DEEB 2DI8A 4JFVA 1MFUA 5EO1A 3MC0A 5HVGB 2OMVB 3C60D 2F5BH 3KPSB 1QHQA 2BNRE 3DECA 1UT1A 3BZ4A 4YSPA 5IKCA 5C0IA 3GXDA 4KJYB 3S37X 1DUYA 3BOVA 4F58L 1P2CA 3TT1H 4CC4A 4AW7A 5F7EL 4M5YL 4KMLB 1IFHH 3DPBB 4MSWB 2GTZA 5LHDA 1IAOB 4DP0X 3MLPA 4FFYL 5E7BA 2B5IC 1EWHA 3L08A 4ZS6C 4Y16D 3VXRE 5A3ID 4AXWA 4N0FA 1OE2A 3PHSA 4Z78A 1LO0H 4Q2ZB 1TTRA 1QRKA 1HT6A 4GYBA 4JDEB 4R96B 3GMPB 4JL2A 5T3ZL 3O3AB 3B9DA 3F58L 2CO4A 2MIZA 3DV4A 4D2NA 4PJCF 1KV7A 2IH1B 3DX4A 4LDLB 1E65A 2DLFL 1CGXA 4W9FC 1P7KA 3OAZH 4RFEB 5CN2A 3QUZC 1SYVA 3ULUD 1MCHA 1M2VA 2EIJB 4NRYA 3BT2H 2VDPL 4TQPA 4ODXB 3FS9A 4YHPB 3TO4A 1FN4A 5DD5L 4X80H 4ACTA 5CUSL 4OVUA 3HLAB 1G43A 1L7IH 3KJ6H 1E6JH 1N19A 3PABB 4HJJL 1DVFA 1EBPA 3BW9A 5EN3A 1AD0A 3DO4A 5CSZB 3NFPA 4EUPB 5DJXA 1WFJA 4G7VH 4PJIF 5CCKH 2BNRB 5JXAH 4EBQL 3VSVA 3RTQB 2PCXA 3HAEG 4U33A 4KH9A 2H0JA 1U92B 3OG4B 5I76B 2NY5C 2APSA 2BVQA 2OZNA 2VUOA 4UAOB 1L7TL 12E8H 4M5ZH 4N9OB 3O6ML 3B9AA 4OCXH 2DH2A 5GGSY 3SYOA 3WEXB 1EZUA 2QELA 1OAZH 1AYOA 4ZS7L 2WAHA 1MHEB 1MI5A 1HCVA 2EE0A 5F88A 3L2MA 3ZYZA 5AW0B 3VXRB 3CG8A 5LO7A 3T2LA 5EUOE 3NCYP 2NUTA 5EOCL 4M3KB 3BYYA 3A24A 2GBTA 4I85A 3L1EA 5SWSA 3SOBH 1MUJB 2C8NA 5BOZG 5IT2H 1A21A 1Q9LA 4PG2A 4NLAA 2FJHB 2N0MA 1H5BB 3ZE2F 3ZO9A 1KGXA 1NCDL 2IWGA 4GS7C 1OT4A 1MJUH 1QUPA 4NQCA 4PJBA 3TASA 1YEHL 1S3KL 2ROXA 3DX9B 2FWUA 1T7XA 2G30A 4QRFA 1HEJC 1Q0XH 2ZNXA 3HBPA 3IKKA 4OGAC 3WY2A 4UOW1 1PZCA 1CXLA 3M1CA 3QDGE 2DM4A 5E1AB 3UBGA 3IPBA 5JUEH 3QJHB 4HWNA 4A6YL 2NY3B 1CVRA 4G70B 2ZX6A 2JE8A 3TCLB 4Z0BL 4PJ8C 2XRAL 1LMKA 1S9WB 2XY1A 4PMFA 4V1DE 4WY7H 5I9QB 4BFRA 1K4DA 3GMMB 3FUHA 2NY5H 3FUFA 4NQVB 3WTXA 3BGFC 4PJAA 5IQOA 4XWOC 2NXZC 4FLRA 4GMTL 1KDJA 4CJ0A 4H20L 5CGYD 2GEQA 1GRWA 2ZSWA 1PCXA 5T5NF 3QJTB 5TH2B 4A55A 1FNEA 5HDQH 3KVPA 1TJHH 1OCOB 3WKYA 1GCYA 2X88A 5CBEA 3WFDH 1A7NH 2HRPL 2H8PA 2ZWNA 3V4VH 5TQ0H 2P48B 4P9ML 4XOEA 5FYKL 5I6PA 4KROC 3EOTH 3OAUH 3AY4A 5EUOB 3EFDH 5KVDE 1FZJA 2XZQL 3PGDB 2IH8A 1NFDE 2D73A 2YEQA 4MZ3A 4PGDB 5CMAB 1XR9A 4Y2OB 1HHIA 3IU3B 3JWNE 4WHTA 1H3GA 3RDTA 4XCNB 3JV6B 1ACZA 3Q1EA 2A4ZA 5GQBA 4E9QA 1RSYA 4HCFA 3K80A 4LLYA 3OKEB 2MPAL 4HZLA 1C5CL 1QBBA 1JOIA 2NYZA 1NSNL 1RXLA 4OD3L 4YHLL 4K73A 3VWJC 1BVZA 3AU1A 3QNZA 1BVKB 2J88L 4UTBL 2JF1A 1XZ0B 3W38A 3QDGB 3GDCA 1JFQH 5GS0D 2UXTA 3NCMA 3K2KA 4DEPC 1SHWA 1SXCA 3OZLA 3GDBA 2HPOA 4GRLC 4WJG3 5DR5L 5C6PB 1HL4A 2IQ9L 3D9AL 1QWUA 2PCPA 1EAPA 3A4EA 1FLRL 4TVPH 4HLEA 5EEVA 2XKNA 5D7JA 4MA3A 3S8FB 4IBYA 3GMLA 5GPRA 2VMCA 4F8PA 4NI3A 3V9EA 3ESPA 5CEZD 1WCBA 4ORGA 2ZUSA 3VFUA 3AG1B 4UILH 1VKXB 3VYPA 4OUOA 4X6DF 4QF1A 2PCFA 3Q05A 4AEEA 3LY6A 4Z7IA 4YK4B 2WNGA 4HD9A 3X13B 3L2LA 2CA3A 4ZUUB 4AQEB 1G7IA 4N8CL 5DRZA 1KNOA 3O4OC 2JJSA 3PGCA 3N3EA 2B15A 4M4PA 1CFSB 2A9NH 1CGWA 4XN2A 2P42B 1QKZL 1IEBB 1ZS8B 1IAIM 4YH6A 4FN0A 3FB6A 3FQNB 3SPVB 2DD8H 3MA9L 2YQBA 3H4HA 4IIQA 5IROA 1R9FA 3VDAA 2OJZL 3EUDA 1DDHA 4AG4H 1BM3H 5D1QA 2BCKB 5A2BA 1IE5A 4PRHB 3U46B 1QZ1A 1IEHA 4OTXH 1DBML 2I5YH 5ID0B 1QEWB 1G7JA 2QPUA 1CPUA 3O2VH 2AERT 1GZHC 3EOAB 4YZFE 1J12A 1UFUA 4GQQA 3FTGA 3WN5B 3SB3A 1EHKB 3ECQA 3UYRH 5CLYA 1SVZA 5AW3B 1P4IH 3OB8A 3EYUH 4HU2A 1MFEL 1VDGA 4L8SA 5FM5M 2NT0A 5LUMA 4L1SA 2E7MA 4S1SH 1D5MB 3BMVA 2WLYA 1JK8A 4IS6A 2C9QA 4EJ1C 3AS2A 1KT2A 3CBRA 1Z9OA 4OZ4A 5ABZA 3LX9A 3KYMB 3EBHA 4NJ9H 3CQFA 3UH8A 4A38A 3BH9B 2ERJB 1ITBB 5C92A 4WUKL 3ZPDA 1QTYT 4K94L 4H8UA 2R1WA 3MBXL 5HYSB 3MLWL 4CJ1A 2YC1A 4TV3A 1CD0A 1IBZA 3GSXB 5LN4A 2F9BT 4MA1C 2DM2A 2XA3A 1E5YA 4M8QB 3L54A 4MLIA 4NPJA 1A1MA 2YRBA 1G7PA 2HPTA 1C1EL 2XFGB 1Q1JH 1O5DT 4L4JA 3ZTNH 5F7KC 5HYJA 4NQSB 3EBGA 3QGVA 4GEJA 5TDPA 1H19A 4LE8A 4PTTB 4YBQD 4DPRA 2NQDA 1FFQA 1JNHB 2BVOA 4JFZL 4K3DL 4S1DC 1YUKB 3EZ8A 3W0WA 1NUDA 3IGKA 4CBZA 4HS6B 3RUGF 4XP5H 3OSKA 2NXYB 1N64H 1VLXA 1SN5A 2OMUA 4ODVL 4NAQA 1HCYA 2GUOA 1KCWA 5LG6A 1N6QH 1TSHA 4JPKL 2WLIB 2FBOJ 1JN6A 4Z7QF 2PXYD 4R90L 3Q1SH 3GS0A 2OI9B 3MGOA 2PCYA 2EECA 2X89A 1BX2B 1KTKE 4Q9BA 1WS7A 3O8XB 4I4WA 4Z77A 1UTDA 1IC1A 2YARA 1DLFH 1FNSH 3CFDA 3I6GA 5D4HA 1OW0C 3FQUB 4DGUA 2UX6A 2H6UA 3RIFK 4ZOBA 4MHHG 4EDWL 4LGPB 4C55A 3LRMA 4RA3A 2IH9A 1HIML 2WLLA 3WEOA 1NGXA 5I1AA 4FRWA 2PYEA 4N4YB 3Q43A 1S5HA 3BIKB 1XH3A 3WNMA 1NGWB 4FEIA 1MY5A 2EVGA 4NRZB 5IJVB 2WOYA 5MERB 1CD1B 4ZXBB 3SE6A 5EDXA 2E9WA 2BVPA 1LDSA 3G6JF 5T3ZE 4F92B 3KM1A 5F89B 4L9DA 1YEEL 3L6FB 3AQYA 2ZONA 3QRFM 1HS6A 3HUJF 4RCAA 1VERA 5EIVA 3II1A 4TNVF 5EU7C 1L5GB 4HOXA 4PVLA 3MNZA 2JCCA 1G6VK 1RJLA 1AO7D 2EDJA 1KXQE 3C6LA 3MGTA 4POZC 5D7IE 3ARYA 4K8RH 1T2QL 1NCAL 1QSEE 1MFMA 2VISB 4W9HC 1N59A 4KRPB 3SYPA 2H1PL 3DUSB 3PWPE 4FZ8L 2ATPA 3CC5A 1OV8A 5K93A 1NBCA 3FPXA 1N6UA 3G7TA 2W88A 3PV7A 4S0TD 3WNJA 4KZ0A 1HZHH 4AYMC 2J44A 1DJSA 3CSYB 1RZQA 2VDQL 4PWFA 3TF7C 2V37A 3SE4C 5DD0H 2F53E 1D5BA 1Z9SA 4P23D 1X7QA 1OAXL 4G80B 5IJCC 4L8CA 4KZEH 1NICA 3FO1B 4Z9KB 2CPCA 5DJ6B 5I5IA 3MYJB 1GTNA 3UC0L 4CGTA 4YXKL 2CHDA 1CYGA 4EIBA 1Q94A 2BIQA 3WFHA 4L8BB 1AQ8A 2VJ8A 4GSUA 4XBPB 4FLHA 3ELAT 5L9DL 5E1QA 3ZLQC 3EG9A 2DYSB 1JGIA 4WI0B 4XXWA 1E28B 1U8NA 1J8HA 1NDGB 1TTFA 4JHUA 1CFQB 2X7LA 4UAHA 1G1YA 1W0WB 2VLJD 2J8UB 1SXAA 3IDJA 4HHAA 4WFED 4ZW7A 2ZCLH 2VDPB 4MAUH 2F8OA 2BOCA 3O81A 3SPGA 4Q9RH 5D7IB 1MHHA 1DSWA 1NBVH 2XN9A 4TSCH 4DHLA 2IAMB 4JKKA 2WZAA 5DC4B 3FQRB 3GHEH 4IU2A 4TYUA 1I3UA 1T20A 4WNSA 3SDAB 4BH8A 1UM5L 3AGWA 2V4LA 3V5DB 3PWPB 2XG5A 5T3XE 1U8QA 4XWGL 1J1OL 2WXLA 3GSUA 2F58H 4R5XA 5CZXD 4OZGE 2OYKA 5C70A 5BVPL 3MLVL 2QFRA 1PSKH 1WO2A 2YD9A 4LRIA 3VH8B 2CDGA 1JYXA 5DJ2A 2HLFD 1GTFA 3OL2A 4XOBA 3WLBB 2PO6D 3ZO0A 1BWMA 4QJ4B 5MENE 3MLZH 4LO9A 4XCYA 3WIAA 5B39A 2HMIC 1RJYB 1SOQA 4X9BA 5FYKE 1MREH 4MYPA 3TYFA 4HKJB 3U48A 1WCQA 2ZIDA 2A74C 4DW2L 1YEFL 4JX0A 1FH5L 5BJTA 4X0KA 1S7QB 4O2EA 3WIHA 1EJOH 4ZNEA 1TSRA 3NACL 4MXWL 3VGAB 1XTLA 3UZEC 1DQVA 1UWEH 5ISZA 4R26H 5HDBF 4G6MH 3V0IA 4NKOA 2WCPA 5IEHB 5DFAA 1IB5A 1IKNC 2D7QA 4PP1C 4MJIA 5ICXA 3QUHA 1JF1B 1BD2A 2VQ4A 4HXAH 1I8UA 3E8VA 2DLTA 5IV2A 3W9DA 1HHJB 2PPCA 1YZZA 4LP8A 1X9UA 1JBJA 2BW5A 4HWUA 3BFOA 4ZTOL 3QUYC 4R97B 4RLDA 1ROCA 3PV6B 4YGAB 4A6YB 2ENPA 3HFML 4IBUA 1A9EB 2YPLD 5F3HB 2Y23A 4KQ3H 3SE8H 4IMLA 4PJ5E 2P8PB 2VDLH 2VXUL 1IC5H 3FU7A 1WBYA 4QO1A 1XD1A 5JHDA 2JB6A 3G6DH 2LAAA 2AQ2A 4OZGB 4ISVB 4XP1L 5FDYA 3NSCA 1N5AA 2MCPH 2ZXBA 3VG9B 1RZJL 1RK0B 4F8QA 3IBEA 3LN4B 1RZGB 1XCTB 2XDHA 2YBRA 3LZOA 2OYPA 3V7MA 2QADD 5MENB 5FHAL 2WYTA 4U6HB 4YFDB 4PJGF 5FOBB 1XF2B 3RB5A 3MNMA 3RB7A 4PAZA 1YYLH 1PIGA 4QDGA 4D9QD 4L29A 1CXKA 3IDMA 4UIKL 1OANA 2I9LB 5LDSA 1S4IA 2WXJA 3DVGB 1L9PA 2BNQA 2DQCH 2Y25A 4KHXH 1ITCA 5ALCH 3GLEA 4FQLL 4NNPH 1NA8A 4QTFA 4S2SB 3UYPA 5J13B 1MXGA 3Q6FB 2BK8A 3FU3A 3MO1A 3NYKA 8FABA 4PRAA 1TJGL 2OFQA 3RNKB 1XGQB 2JELH 1RD6A 4TQ8A 4UUJB 5DVNA 1TVDA 3EH2A 4RGMC 3QQDA 4JFPB 4NIKB 5KYWA 3PIQA 1X5YA 2L7EA 1JZ6A 3TBSA 5HGDA 3GSVA 5B39G 3IXAB 1KLUB 1U93A 3T65A 1MCKA 4HMCA 5MI0B 1ZLVK 1NCHA 2FIKA 1I8AA 3LKNB 2JXMB 4PJ5B 4TULH 5IMKA 3RIKA 3SPJA 1WYJA 5I1JL 3T6XA 2GKIA 1OK8A 3WKMH 4HS3B 1VZIA 4GUPA 3OR6B 2X4OB 4TL4A 2XG4A 3IJYB 1BREA 1IGYA 2WKOF 4GI9A 5JPNA 5E2WL 3L3DB 1A0QH 2LU5A 4LSSL 5K9QG 4A2GA 5B8CB 3E9TA 4F33B 3FSOA 4NIYE 3ZHNA 5KEZA 5I8KH 4MNHA 1ID5I 1F1AA 3V95A 3RZCC 5F7HA 3ULVF 3LKPA 1EEZB 1UA6H 1DYZA 2CXGA 3DIFB 3VD4A 2Y1YA 3G6AA 1BFOA 1U8IA 4NKIL 3EBIA 4DCQB 1N8ZB 2B8OT 2YUXA 1SOKA 3BE1L 2WVSA 4FKKA 4JREC 4AGNA 4P57A 4G82A 3VW3L 2BVTA 3M17A 2GTQA 1OAKH 4LSVH 3NMEA 5ENWB 4DT2A 1CUOA 3D4GA 3VI3A 4FQ2L 2GVYA 4KY1L 3M07A 4MJHA 3FB8A 4ODTH 4DETA 1MRCL 1EFXB 2E6JA 1FJ1B 4K7PX 5DWUL 2D3NA 5E51A 3BCFA 1PZDA 4UIMA 4GUQA 1NAKL 5ACLA 3NCJH 5I71C 1RUQL 1ZGLA 2G9HB 2HKFH 3TU6A 1U8PB 2R2BB 4XP4L 1B6UA 2D7TH 3QJOA 3HS0C 4IOFC 5C0ND 1DZBA 5K1VA 3ILPB 5D5MF 2ODHA 4OAWA 3K5SA 5ICZA 2X12A 2CA4A 2B9BA 1WISA 2JI3A 2WXPA 3BWZA 4MMXA 1OF2B 2QLYA 1RQ5A 4WNQA 3BI9X 3KLSA 3IN0A 4H1LH 2AMGA 3QS2A 2UWEE 2A4CA 4OCMC 5C09D 1QR1A 4IRSC 4ENEC 4AQ8C 1VFMA 3RX9A 4QTHB 2XFXA 3CQPA 3IAQA 5GJSL 5K9JH 1A3RL 1EEUA 4X7EC 4BWUA 3ZZ1A 1KBWA 2HP4A 4QR7A 3GSWA 4NN7C 2JLPA 4YAQA 1NFKA 3AT9A 1IGTA 3N04A 2Y72A 5EIIA 3BP7B 4B0MB 2AGJL 3WN6A 3CDGA 3PWNA 3VXPB 3KVDD 1J88A 4DWHA 5BRZB 1IGIH 2JKSA 3O9WC 1HE7A 1AKJA 4M00A 3FUEA 2QDVA 3MV7D 4JZJC 4S0HA 2P7TA 4N28A 4N2HA 2X09A 4U1SB 5E70A 1EHXA 1S7TB 3VQ2C 5IGXL 3F7VA 1ZVSB 1OPGL 1F45A 1HSAB 3SKOB 1I1AC 3SIKA 2WZ0A 4LSQH 4ZDHB 3QZNA 3EYQC 5HYQB 3OKKA 2X4PA 2ALWA 5J1AB 3D07A 4OD1H 3CZGA 2YGQA 4XO8A 3LKSA 2E9GA 1G0YR 3LRSB 2X1PA 1ZA3B 5A2CA 1QR4A 1AR1B 1XHHA 4PW4A 2JJUA 5IF0B 4CAGA 4EZLA 4YX2H 5HI4D 5TGBB 2EE6A 3FQXB 5DO2D 2OL3A 4JAMA 4NPKA 3QRBA 5D96C 2A73A 4M6OH 3OKMB 5BW7C 1V3LA 2VKWA 2V17H 1FL5B 3HG1E 4FLQA 2UWEB 5ABDE 1DUZA 5GGTA 3LV3A 1NBZB 3GJEB 1A64A 3PJSA 4K23H 3VU1A 5GRZA 3ETBF 3OMNB 3K74B 5EWIL 3W3BA 5D1XA 2E27L 4QHNA 5AB0A 35C8H 3BQUB 4LU5L 3B34A 2P44B 3U0TA 2YK1H 1EO5A 1IGCL 1KJMB 1YPZA 1LE5B 3LNEA 3MRIB 2AZAA 3I50L 4ANUA 3IM1A 2XXFA 4Z7OB 1DVYA 1SN0A 6PCYA 4Z95H 4U1HB 3ZL2A 2K9FB 4BSVA 1BV8A 2ADIB 1RUPL 2JJTA 2Q2LA 3UBXI 4N8PA 3OGOE 4Y9FA 3SKUD 1TVHA 2QQKH 1F4AA 1INDL 1M1XB 3C5ZA 3DPDA 4ZQTA 5J6GA 4XH2B 3LHAA 3QORB 3HJ0A 4V11A 5CILL 3UAFA 1S78D 3T71A 1I75A 1WGVA 1VCBC 1G7LB 1AQKL 2W92A 2IH3A 3UTQA 5TE4H 1MNUL 4MDIA 4P5KA 4EI5D 1HHGA 5E8OA 1TQCC 4P59H 3BVUA 2VDQB 4FMKA 3AWEA 2YA2A 2OJEA 4QPEA 5EIIG 1PEWA 1BBDL 2EEFA 2G60L 3LS5H 1UOKA 1QHPA 1BOGA 2IANE 5CGTA 3T2PA 3HG1B 4KKNA 1VSCA 4PV9A 5E9DD 2OW6A 2ZKMX 1O7SA 2VDMH 4NOBA 2NSMA 3PP3H 3MROA 4X2UA 4OJAA 3U0PB 1C7TA 4JGNA 4Y19D 3INOA 3THMH 5KVGH 5C0CE 4IIZA 2EXTA 1UM6L 1NLDL 3UTTA 1EAJA 4Z7UA 2GT9B 2P5WA 1GGBL 3MLUL 5EU6E 2OR9L 4CSSA 1FYTA 5J6HA 1CTMA 3BAJA 4NAJA 1FAKT 3V10A 4F2FA 3S37L 4A1RA 5C0EA 1KC5H 4KX8A 4Q9CA 4FI8A 2HFGH 2QQNL 1P84K 3SYQA 3U1QA 4LLUB 3GJFB 5J4MA 4BELD 4HIEB 5HHOA 1V10A 4JKMA 4PLJD 4PJFE 1CE6A 4RFOH 4X4XB 1P4BL 3U4BH 3QJFA 1QBML 4LLDB 4LBAA 4NI6A 43C9A 1HK6A 3POCA 2DKSA 2MJWA 2O61A 1UACL 3ARGC 1V7NH 4F15C 1RZPA 1RI8A 1GGYA 1JGUL 5EIQA 5I1LB 2GABA 4YHYC 1JZ7A 4H0HB 3PL6C 1QRND 4GOSA 4MS8C 4NO5B 4PYGA 1B0IA 2WZPA 2YZ8A 3FK3A 3L4CA 1H8NA 3BHBA 4M1DH 5GRXG 5KN5A 2IANB 1IM3A 5EUOF 2O6DA 3Q5OA 3T9WA 4BK8A 2GITA 2W9LA 3RWIB 3FTUA 4YHOH 2NY4C 3OM3B 1DJZA 2IGFH 5C0FB 4YSSA 1WPCA 5E8PB 2Y2WA 3IU4L 1MLCB 1KCUH 4HPHA 3F04A 3VRIB 3BAXA 4QXGL 5AWNH 2DWXA 4L3EA 3GLAA 4WKXA 3DBSA 1N5YL 4TM9A 1NEZA 4Y5YA 3TO4D 3G5YA 5DMIH 1XO8A 3GZQA 2FJGB 4PWJA 1J1PL 1WFMA 5KVEL 1JWMA 3BZ4B 5JLZA 5IKCB 5C0IB 1WUZA 1DUYB 2J1KA 4PJXA 2AEQL 1P2CB 4PJFB 4KVCL 1XSOA 2Y2YA 2NTFB 3EF4A 4LARL 1EXUB 3L9RA 4I89A 2GTZB 4A7VA 2ZCZA 5FYLD 1MI5E 4F5CE 4DGVH 4N0FB 4Z78B 2CD0A 5DO8A 4XGZA 3UPRB 4JG9A 3QXUA 3L4VA 3QG7L 4BV1A 1CURA 4XRCA 1UZGA 2NY2B 4OIAA 5T1DH 3DUUB 1P7HL 2QR0A 3P4LA 3WCYA 1MWOA 3DV4B 4JM2A 4ZW5A 2IPTH 4PJBE 1NFDF 5SWSD 4YL4A 1P7KB 1F97A 1R47A 2IGLA 1SYVB 1FVDA 4RMVA 5LXGH 1B4LA 4HXBL 2EDHA 1QBAA 4EQ2A 2WUBH 3V6FA 2EACA 3TO4B 1H3WM 4NQCD 4UM8A 2GBAA 3EJRA 4GPVA 4P4KB 4DTGH 5KYYB 3D5OF 4ZSOE 1HINH 2F74B 3NJLA 2KH2B 4XTRC 1DVFB 1OM9A 2P28B 3BW9B 5CEXB 5J12C 1AD0B 5FUZH 3IDNA 3NFPB 3LH9A 5DJXB 2L3BA 3MKKA 4UT7L 2QQQA 1I7TA 2Z91A 2CK0H 5ADOL 2BIIA 4TLTA 3NRQA 3VVWA 4KTEL 5DURB 4J6RL 5A2JH 4FAAB 3D4YA 1E3XA 1I53A 4L5FH 1HXMA 4C56A 2R4SL 5C07E 2R0WL 1LDPL 1MI5B 2EP6A 3CHXA 2R1XA 5BZZA 2BH0A 3WTWA 4BK4A 3PP3K 4L3CB 4OJYA 2NUTB 3D2UB 4PR5A 3TA3C 1FPTL 5SWSB 3MLYL 1Q9LB 1TLMA 2AVGA 5FW6A 1J48A 2G0LA 4HX1A 1NEZG 2IIJA 4KUZH 3BKJH 4GKSA 3RFZA 4NQCB 4PJBB 4NZ8A 5D1ZD 2IOMA 5AAWC 7FABH 5L2KA 2PYFB 2QPFA 5AZUA 3KLKA 3SJVE 3RDTD 2OA9A 2CIIA 4TL5A 4DK3A 4GT0A 2D3LA 2JKXA 2L8AA 4YDMA 4ZW8A 3EDEA 1YYML 4N25A 2JKWA 4GP5B 4OLVL 3X1EA 1A47A 4KI5D 4FQQB 1HAUA 3EYSH 4J3OC 4ODWA 4YDIL 4ZSOB 4YZWA 1FYHB 4YE4L 4HJEA 5J11B 4X5PA 4OIIH 3EFOB 4YZFF 3VAEA 2XPGA 2XWRA 4PJ9B 1K4DB 3LZNA 2VXTH 4L3FA 4OF3A 4MA8L 3WS3B 4PJAB 3SDDD 1OD9A 4M62L 2HFFA 1SMOA 4JM4L 1AQHA 1FNEB 5BV7H 2CCVA 4XCCH 2IDTA 3ZSSA 1GXEA 5CBEB 3N1GC 1ZDQA 3IAPA 3BVNA 2H8PB 5IR1A 5D7JD 5I1DB 3N06B 3IF1A 2R0ZL 5C07B 2FVNA 2H6PB 5E6IC 5LKNA 1A3QA 4DVBA 5H4YA 4LCVA 3PWJB 2CBOA 5I17B 2GSIB 3SYAA 1FZJB 1IQDA 3RVWC 4X9YA 3RDTB 2BP5M 2ORBH 3HI5L 3NA4A 3LZFL 5FYJD 2Y69B 3UP6A 2ZUYA 4LLYB 4WWKA 4LKXA 4XPHH 5J6SA 2J6WA 4JPSA 4NQDD 2V9UA 1UJ3C 2X6MA 4HZLB 4HD5A 2G3NA 5D1QE 1OTUC 4BSWA 2BERA 2FE0A 3NJHA 3SJVB 3ZHLA 1T1ZA 3B9EA 1EDQA 4TNGA 3AU1B 3QNZB 4J3OH 3APMA 2G9KA 3CIQA 5JYMA 3FN0H 3HPLA 3RWDA 3UTSA 1OAYL 4KXZH 4K5MA 3NQIA 3QI9C 4AJ0A 3VYOA 1S9KC 2DBLH 1T22A 1JNNH 4UT9A 2AKRA 3HS9A 3MJ6A 2HJLA 3ZKMD 2FSDA 1ZWIB 1XIWC 4XB7A 1EAPB 1N68A 2HX8A 3KL5A 2E6PA 4MA3B 3GMLB 4IKKA 1ODUA 1WCBB 4ORGB 4MVBC 4FDWA 3V6OE 4E68A 4MCZB 3PU7A 3V4PH 2Q8BL 3SQOL 3AABA 5I66A 3ZJAA 2DWDA 2PCFB 4I0PC 4M7KH 2OSXA 3HG5A 1DBJH 5A1AA 4K5LA 5EOCJ 1KACB 2EEBA 5F6HJ 1G7IB 4FYQA 3WD5H 1MVYA 4IDJL 4TUKL 1IC4L 1KNOB 2F5AL 3O6KL 5DRZB 4BEIA 5IIEB 1KXVC 1BF8A 2K0RA 5DS8A 5DHEA 3VFPA 5E7FA 3WTVA 3DDGA 3QPXL 1F42A 5FK9A 3FB6B 2G75A 3IDXL 4XHJD 4OT1L 1CICA 1DDHB 3RVVD 4J39A 2CBPA 5D1QB 3TPUB 5KOMC 6TAAA 1MDTA 1T6WA 4XE5B 5HYJD 5H35A 2VDOH 5F71A 1G7JB 2FD6L 3NJVA 4UOW0 5DQ9B 4P2AA 4P46A 3RG1C 4E9XA 1F3JA 3FTGB 3RTLA 2VXQA 2AS5M 2DYRB 1IAKB 3W0WD 5A43C 4O4YH 3MTXA 2J8UF 4OFKA 3R1GL 4KK8C 4CA4A 3OAWA 5BPPA 5K69A 4QKTA 4ZQKA 2GI7A 2VN3A 2CAKA 4IS6B 4JG0L 4NGHL 1KT2B 5D7IF 1PNDA 5JDSA 4OZ4B 1KGCD 5JQ6H 1S3RA 2ZX5A 1BYNA 4M1CC 4JDVA 4JKPL 1SBSL 5AQ0A 3VTTA 4AV4A 4JO4H 2QQLL 1YNKL 2X89D 4YDKH 4ONFL 5C2BH 4WWID 4X7SL 2F1BA 4XHQA 1BZDA 2YC1B 3DX6B 2ZG2A 3SBWA 2Y5QA 2DYPA 4FS0A 3U9UA 3RGVC 4QTIL 5LAXA 4ZFFA 1A1MB 4JG1H 1G7PB 1KBKA 3U9PH 4R4ND 5A2LH 4Y9EA 3L4XA 5JW4R 2LW3A 1OSPH 2PYED 1KYOK 4NM8H 5TDPB 5MEQA 5EC2A 1G9ML 4RETB 4LL1A 4H8VA 4PBDA 4PV8A 3MRNA 2DEWX 2CNZA 4X8GA 4YO0A 4RMQA 1M6OA 2PMZA 2JIXA 1SMAA 2BVOB 4QRSA 1MRFH 4AENA 3W0WB 5E5MA 5IFHL 2BIPA 1ZEAL 2DJSA 2XTJD 1JZGA 4L2YA 1E4KA 1QSFD 1NINA 3VSQA 2OMUB 2GUOB 3HG0A 2DKUA 3U2IA 3HHSA 3FTXA 3QZLA 2E8YA 4P2OA 3L16A 2GJPA 1Y1DA 3STZA 5C3IA 1KCRL 3NZHH 1OP3K 4OGYL 2O5ZH 3SGDH 3L1OL 1RP9A 1WZAA 3LN9A 1OSYA 3MGOB 1HL5A 2IADA 2VC2H 4FYRA 5E5RB 5C9KA 1A2YA 5KVEE 3WFCH 2ITFA 4NT6B 3CFDB 3PP4H 3I6GB 4WSJA 1I7ZA 1PL3A 4WFGD 3VE0A 4Z76A 4I1PA 2QPDB 4ZMAT 3OG6B 1JWSA 1RIHH 2WLLB 4DGWC 1NGXB 5I1AB 4IYKA 2BINA 4OZGF 3U36A 2PYEB 3RPIB 1S5HB 5GGTL 1XH3B 3DVNA 2ETWA 2EQDA 2DTSA 1CS6A 4R4FL 5F7MC 2AITA 4TTGA 3S34H 2V2XB 4UQ2A 5H2BB 3RWCB 1BZOA 5G4NA 1NPJA 2XKSA 2BVPB 4MD0A 3JBG7 4NKMA 4JN2B 1BGXH 3QR1A 3OQ3B 1PY4A 2FX7L 2O72A 1NEUA 4WHYH 1J8HE 1BFVL 1JXDA 3CFMA 1WT5C 3HC2A 5ANMA 4MA7H 1E8WA 1CE1H 2VZTA 3C6LB 4JCWA 4NJAL 1U0QA 2WLMA 2P8MA 2X4QA 2R59A 1IQWL 2X4UA 4LAQH 3S8GB 4RGND 4UNUA 4ZUWB 1JPEA 5B1JC 3BZ5A 3QXDA 5BZDA 4N5EC 2YWYA 1J8RA 2CHXA 4NCDA 4GQPH 5E08L 1AGDA 1N59B 1SFHA 1KCVH 4HGWA 1RIVH 4TUJA 1NAMH 3CC5B 1MCEA 3RVXC 4TOYH 4QAWA 3US0A 2EVFA 2XN9D 3RVTC 1UEMA 2ZKHL 3I74A 4LP4A 4JRLA 2LGNA 2YLKA 2QZ5A 1DBBH 1CFNA 1JMXA 4F37F 5CLXA 4C47A 1CF8L 1D5BB 1Z9SB 2BHZA 3BSZH 3UAAA 4L8CB 3C8KB 3QUXC 1ZHKA 5ESVA 5HHMD 3KWXA 4F9LC 5DHVA 2E4FA 3N41B 2WBJC 3CX5K 1E4XL 4I3RL 4WU7A 5D2NC 5LCVA 3WFHB 3OVUB 2F8IA 2NY1C 3ARDA 2PR4H 1T0NA 4AYID 2FO4A 5CWSA 4DEUA 1DLHA 1Y0LB 3CD4A 4NOFA 3MRLA 5H4ZA 3K1DA 5KZCB 4O02H 2JV6A 1NGQL 1J8HB 3T1FA 4M7ZB 3RKPA 3Q44A 3QO0A 1A9BA 2X7LB 3V0AC 1QACA 3D3VD 4MJIE 3BPLB 4ZJ9A 5ISZD 1MJ7L 2WMPA 4HHAB 1UA3A 1ACYL 2APVA 2YN5A 2FX8L 4JQVA 2EICA 2BOCB 3RHWF 3U6RA 1G9NL 1MHHB 4PJ7A 3P0YH 5K33A 5A6LA 2X3CA 1J5HA 4H25A 1BCIA 4IU2B 3WY3A 4BH8B 3F6IA 3SCMD 4ZFGH 5D72L 3K4DA 2OJ1A 2XG5B 5DMGC 1RHHA 4ZFZA 3MRCA 4K71C 4NC0B 3RA7H 1CWVA 1TTGA 4RGOH 3TJPA 2P8LA 4Q58C 3GSUB 4JFSA 5HHMB 5JHDE 3V2AR 3VGBA 3O0RH 4RIRA 1EAOA 3C09C 2WQXA 5D93C 4YFLI 1WIUA 3I6LE 2CDGB 2B1HL 2ICEA 4MXQD 5DJ2B 1KEMH 2DQEL 4XCYB 5B39B 2DQUH 3KCWA 1EHNA 4N2FA 2AJUH 5DK2A 1KZYA 2WN3A 3GXIA 1Z5HA 3FO0H 4X0KB 4EN3C 1KGWA 1J5DA 1NJ9A 3DWTA 4O2EB 1LK3H 4HKBB 2V33A 2ED7A 3K6OA 4TNVK 4KFZC 1Q9KA 2AV7A 4AH2A 5LGHH 3MRQA 4DP6X 3EHBB 3WS6A 3GLDA 3VTMA 3W5MA 4MJIB 5ICXB 4BQBA 3ULVC 4HCRH 4B95C 1BD2B 4JO1L 4WO4C 3WIIH 5IV2B 3W9DB 1LO0L 5EZLA 1RZFL 4X6BA 5E99L 3QIBA 5IM7B 5LAPA 3MBWB 2A9CA 1MEXH 4GAYA 5I8OL 4K5NA 2AF2A 2A9AA 3F3HA 5J7CC 4QWWD 5TPWH 4ENZA 1A7RL 1HNFA 1ERNA 2WXIA 3FU7B 1WBYB 4JO2H 4ELMA 5JHDB 2JB6B 2XWTA 3T0ED 3H2WA 3MVSA 1RL1A 2J73A 3L4YA 4KDTC 4YHIB 1U58A 1WAEA 4UT6H 1QTSA 2V9TA 4LOUC 2FBRA 3KJ6L 4U1LB 1AE6H 1CFVH 3B2XA 3W11C 2YBRB 3LEXA 1AXSA 1EO8L 4G7VL 2EYSA 5JXED 3GM8A 1DQML 1U21A 3CFKB 4QRRD 1A6ZA 1KV3A 3BN9C 2FZ3A 3FTSA 3IDMB 4OM0H 2X5PA 3DIVA 3LOWA 3HBGA 1OO2A 2BNQB 3HI1A 1H3UA 3L3GA 5K9KB 2UWEF 4DGYL 5A7EA 1K85A 4PVMA 3UYPB 5D71L 3ULVH 4Y5VC 3L95B 4GKNA 4KXBA 4ZOEA 3MO1B 8FABB 2IPUK 4PRAB 4GG6A 3ATAA 3BAEH 3I02B 3WI9A 3FQWA 5A6IA 3ESOA 4Z7OF 4NKQB 3QQDB 4K7PL 4AMWA 3LNIA 3OJDA 4JO5A 1T5XA 3GSVB 1PF3A 5GZNC 2O1AA 1T1YA 3QG6A 1U93B 3T65B 2W07B 4DKTA 5E8NA 2FQEA 2PTTA 3EJZD 5CP7A 3QZBA 5IMKB 3F7KA 3T8XA 1LEKB 4L4TA 1SJMA 5AYQA 1XVSA 3CZFA 1HE8A 3F83A 1DSYA 4B9GA 2V9RA 2VYRE 2ESVE 4GUPB 3NCBB 1A7BA 3TJHD 2XG4B 1S9XA 4W9DC 1LGVA 3CVHL 5JPNB 3CAFA 2VDRL 1DANU 3N55A 4KMTH 5EORH 3JVGC 4NUJB 3K46A 2MKWA 2RFXA 3BP5A 3P1VA 1DN0A 4MNHB 3LHPH 3VFGH 4OSUL 2D4DA 3S7GA 3ZDXE 3GUTA 1QABA 3G6AB 3MV9D 1U8IB 2C9RA 4U1JA 5ERWA 2FRGP 2R69L 4AT6A 4Z7VA 2LVEA 4J8QA 4P57B 4U1GB 3M17B 4CKVX 1MRDL 3HR5A 5ID1A 4Z8FL 3LKRA 5GGRA 1F4YL 2XIBA 2ROYA 5FM8A 1JVLA 4NBXB 4ZX5A 3KR3H 4OZHE 1JGDA 1WAAA 3U7WH 1CZ8H 2JVUA 3LEVH 5AW4B 4HP5A 4AQ1A 4DN4L 3AITA 2ICES 3AXIA 4KRLB 5IHZA 2OXHB 2OKMA 2Q0ZX 1D5RA 4JR9H 3C2AL 4UIMB 2AXFB 1IZJA 2WKLA 1X44A 4GQ9H 2DQFA 5F1IA 5I0DA 3C6SB 2WB1A 2Y7MA 3P11H 1KCSL 4GXUM 3IDYB 4QRQA 1NMAL 4PJEE 5GSRA 3QJXA 5EDSA 2ESVB 2V7NA 5F96H 1O0VA 4JFDA 4OAWB 4WU5A 2GIXA 4NC1C 3U4AA 1AZRA 3VFVA 2ZUQC 4NP4L 1E4HA 5BUGA 2FBJL 3P4OA 1NMBH 4ETYA 1E4JA 2OAAA 1YCSA 4I88A 2C3VA 4TLUA 2AVFA 2WW8A 1QR1B 3PNRB 4Y16C 2YO3A 5A3IC 2XFXB 1BJMA 4UAOC 3UAJA 4YXLL 5ES4B 5FB8B 5MEPA 5HHXH 3ZDXB 5D1XE 2PP9A 3CU1A 2AK4E 4RISL 3I9AA 1KLFA 3LYRA 3QWRA 3GSWB 4YAQB 1YPZE 2R0LH 5CJXA 1IGTB 4KJPD 5EIIB 4NZRH 2OP4L 2TSBA 2X2HA 1EANA 3CDGB 3KLAA 1XR8B 3OX8A 4JCMA 5FFOA 3KHQA 3Q06A 4GXVL 4UNIA 3EH1A 1H5BC 1YN6B 5FWQA 3ABKB 3CK0H 3ULUC 4RMRA 1AKJB 3NPSB 1TJIH 4OZHB 2R15A 1LM8V 4F3FA 4XBEL 1OP5K 2WVUA 2HUHA 3GEWB 3ZTJG 4JUSA 4WJ5A 4R0LA 1ID2A 2I07A 4P9HC 4WO0A 3FAXA 1GSMA 1OTSD 1C9SA 3OKKB 2FH8A 2X4PB 1LP9A 3C5ZD 4IM8A 1CIDA 2NW3B 4PRBA 4EUPH 4ZX3A 4PJFF 2IGTA 3LKSB 2NY3C 3TVMA 2VQUA 4JY4A 4OQTH 2VXSL 4L4VD 4BK5C 4KO5A 5I9QC 3LZLA 3CZEA 3DXAA 1AQDA 3A3YB 3D09A 4YEEA 1T03H 1SJHA 4JAMB 1NEPA 5EOQH 2UXFA 1DUZB 4MKTA 2FWSA 2MMXA 2B08A 3PJSB 1TFPA 4WKZA 3U4KA 1E2ZA 1ODAA 4M1GL 3TN0A 4N0RA 1MG2C 1XGUA 3COOA 5D1XB 3AQZA 2ZCKH 3Q2WA 3U0TB 3NSXA 5K59E 1LTXA 1YPZB 2ARJA 1MH5A 2CR6A 4AYFA 3UTTE 1X9RA 2VXQL 4R3SA 3UROR 2ZICA 2IEPA 4Z7UE 1ZMYA 2P5WE 4ELKA 4WQOA 1SF5A 1TG8A 4BSVB 1D5IH 1MCOH 2OM5A 3P0VH 1MOEA 3CLWA 3OLIA 3D50A 3RPKA 3HVDA 4L3AA 4Y4KA 5E2TL 5IBLC 4P9HH 3KYAA 4B7LA 1NCCL 4AOFA 1RU9H 4UQCA 5J6GB 5DHXB 3VG0H 4OLYL 3KPNA 4E2OA 3DOIA 3FCBA 5AAMC 5AUMA 1A6AA 4AVHA 4IW4C 3P02A 4XB8A 2Y4SA 3R8QA 1MSPA 4LHJB 2ZXAA 2IDFA 4HGMA 5E2UL 4N5UA 3S36H 2KC0A 5HHOD 3VI4E 1GL4B 4MDIB 4P5KB 2HB0A 4JGJA 1HHGB 1QI5A 5E8OB 1NC2B 4PP2A 4XXDB 1N0XH 3H56A 4G7YL 2QT6A 4GLRI 2OJEB 2X0VA 1SLUA 4I18B 4YDJB 1F4WH 2QL1A 4LFHG 1A7OL 5TFSL 1FNHA 4RAVA 3F12A 3I9PA 4P5TA 4PS8A 2C1PA 5F0PB 3N9GL 2DQ6A 2GJ6A 1QSED 2AJXL 2Q86A 2VZ3A 4PB9L 4RRPM 1F2XK 1BG9A 4DKEL 4MMZC 3DLQR 4P2RD 1A7QH 4TUUA 4F7TA 1BM7A 2LVCA 3QE5A 3JZ7A 4YSDA 3QRGL 5SWZA 2I9TB 4YK4C 1THAA 4UV4H 1TDQA 3ZE1E 4PJBF 3B43A 3ZGHA 3UTTB 4HH8A 2ZXDA 2IV9A 4Z7UB 5HHPA 2ADJA 2P5WB 1YN7B 3WY1A 1U8HA 2LLLA 1FYTB 1SM3H 3N85H 5KTEH 4UOZA 5J6HB 2F53D 2FNBA 3OKDB 5C0EB 4KUCF 3SKJL 2ENYA 2XWJB 1HHKA 3TCXA 1PZAA 4QRAA 5HHOB 4NHUA 5C08E 1CE6B 5GS0C 1TETH 4AEHL 4GEIA 4G6FD 5IG7A 3QJFB 1J0KA 1IBGH 2N1TE 2ZSVA 2ZAIA 43C9B 3ZQ9A 1FVEA 3GSRA 2O61B 3WN5C 4UU9A 1X9QA 3VI4B 2FLRT 4WFFE 4F9PC 4J1UA 5AG8A 3VGGA 4Y1SA 3W1ZA 4Y88A 4OIFA 3Q6GL 1C5BL 4JHAH 2E7CA 3ARXA 4IHBA 4BWTA 3O3EA 5AB1A 2ARWA 3DSNA 5KVMC 3S97C 5T1MA 4KKLC 3BHBB 4HIPA 5KN5B 3QT2A 1IM3B 1TZGH 3QHZH 2EZ0D 2EO9A 2X28A 4I3SH 2GITB 3D18A 4O9HL 2HT2D 4H44C 2RB8A 5C7XH 1J1XL 4QGYA 3PWUA 3QNFA 3KYKH 5I74B 5KVDH 2OLDA 2W9DL 1JYWA 4LLQA 2Q8AH 2NY6B 3ZQXA 4JM2D 1VB9A 3HE7D 3JWNH 3IFPA 2NYKA 3FUKA 3RP1A 3MRHA 1OTTD 4MNGE 5IHBA 4L3EB 1KUMA 1S7XA 3UBXA 4N26A 5HGAA 5J1SC 3RQ3A 2WHVA 1NEZB 4Y5YB 4ERSH 4GW5A 1FV1A 3G5YB 1FF5A 2A77H 2BOBA 4H13C 5I16A 5GS0H 2QMKA 3NCFB 4QRPE 1JWMB 5I1EL 5JLZB 2D7PA 5IVOA 4PJXB 3DMMB 3JT2A 2X05A 4IHOA 3I6SA 5C08B 2IG2H 3NH7H 4K07A 3SBQA 5ADPH 2DLIA 5H94A 2DQHL 2JJVA 1TQSA 3VXSA 2F1AA 1DR9A 4AY0A 5DQJA 4LCIH 3RL2A 2AABL 3BIAX 4MAUL 5E2VL 5LCVL 3BIBX 4C56D 4HUNB 1HI6A 1OVZA 1TMQA 4K9EC 3QQNA 3Q2NA 4QHUA 3GHEL 3GBDA 4RMSA 3U4EA 4XRCB 3WNIA 2CKNA 3IFLH 4J4PD 4PGBA 2G5BA 4Z3TA 2R2HA 5DFTA 4AYDC 2QR0B 4AMKL 3ARED 2B1AL 4ANWA 2PTVA 4GBXD 1R0AH 2BMKA 2C9PA 3MA7B 4X5WB 2Y7LA 4JQIA 3T2QA 4C83B 4Y2DD 4PGEA 2B5IB 2EDRA 4UM8B 2Z8SA 1KJ2A 5L2KD 2AXGA 4ZUSA 4MNGB 3ALPA 5B7MA 4QXUH 2I24N 5IQ9A 2BRRH 2EJ1A 3B2VH 4PI2A 4ZXBC 3IDNB 1DZ0A 1IC7L 4LPXA 4Y2LA 5JTWA 1VEOA 2CO6A 4LLMA 3UBHA 2XKUA 1I7TB 2Z91B 4QRPB 1I3RB 4QYOA 2BIHA 2YRZA 4PJHA 1CGVA 4X7TA 2BY0A 4D3CH 1YNLL 3G04A 4Y4FA 2PXYC 3FHAA 6PAZA 4Z23A 5J89A 2D03H 3HNTH 1BECA 3SGJC 1AFVL 1QPPA 2HTLD 4UV7H 2LOEA 2XA8H 4XZ4A 5C0DA 3K2IA 5ICYA 2EH8H 3QP3A 4P0DA 1K5WA 1KXHA 2VLRE 4ADJA 1PZ5B 2HN7A 5CZVH 2IBZY 4HBCL 3H9ZA 2FYYA 2RQEA 4WAFA 4LOVA 2NX5A 3ARFA 1ZJBA 3CVHB 4NZUL 3UBXG 3VYNA 2VDRB 1R3KA 2EDWA 4KQ3L 2R56H 3SE8L 3RFZB 4GKSB 3UZQA 4IRJA 4RESB 1QI4A 2DL2A 3WHXA 1R5IA 2EC8A 2W1NA 1S7RA 4FJYA 4H0IA 5L2KB 4KNSA 4HUMB 4MD5A 2CIIB 4XN4A 2HZHA 4U0QB 3FN3A 3RKDD 4OW6A 3QXTA 1TCMA 1S7VB 3MRPB 1YEWA 4WW1B 4HHWA 1UQSA 1JZ3A 1T1WA 2CGRL 5IHHA 3D7PA 3LPOA 4IBLT 4U6YB 2Y3AA 2XY2A 1YYLL 2Y7SA 2KZKA 3I9GH 1JHLH 2XPGB 5IFAL 5DVLA 3ZZSA 2JKLA 4QGTA 3CX2A 3IETA 4GS7B 4ZO8A 2HFFB 1GIGH 1EHLL 3FCSB 3GLZA 4KTGA 4HC1L 4NNPL 3WBDA 1F8TL 1WFIA 1P9MC 3Q2VA 3BVNB 4W6WB 5IR1B 4X4ZA 3TBCA 5L88L 5IW6B 2HG0A 1E50A 1FSKC 3GB7A 4HQQL 4DVBB 2WO3B 3UJIH 4X8CA 2IAMC 1XF4B 3C75A 3SDAC 3QZWA 3VQ1C 2WB7A 4UM9D 1RZIA 1IQDB 4XVUC 4F58H 2AQRA 4PEEA 4YNYB 3U82B 3PFUA 3BGFB 3OC5A 3GINA 43CAA 3C8HA 4JB9L 4WWKB 4M5YH 4XMWA 1JERA 2MNWA 3BJ91 2A4EA 2MH4A 4FFYH 2V5MA 4Y4HA 1NIDA 1T1ZB 3LH2L 4B9CA 2W60A 3WEMA 3AUWB 3CFEA 4PSRA 3ZKNC 1L0QA 2A5UA 1IGML 3M45A 4OD2A 4KROB 3RWDB 1CICD 3UTSB 2Z92A 3MREA 3HE6A 1ANUA 3PHQB 4M5TA 4DP1X 1T22B 2AKRB 5L7XL 1IKFH 5T3ZH 2BHFA 4Y1TA 3UTOA 2HJLB 4K5PA 3F58H 3VGAC 4M8UA 1WRFA 3VA6A 3WIFA 2DLFH 5EUKA 3H53A 5E94A 4YIQA 1JL8A 5GGQL 2VDPH 4HUUA 1KTJA 1B9KA 2MOGA 5DD5H 3S3CB 5CUSH 1GZQB 1Z7JA 3OLGA 2CMRL 3FKUS 2I60L 4AVKA 4HKXB 1LE9A 3EJYD 5DVKA 4HJJH 1NKOA 1F6AA 2DWDB 2X4NA 3OMIB 4JHBA 5EEYA 2D7NA 5AYUL 4JPVL 3WYRA 3VACA 4P07A 4PPTA 4R97C 5F1NA 4DEPB 2KLRA 2EXWD 1QI3A 3FTZA 4EBQH 2CU9A 1FZMA 3H2QA 3VFPB 3FT3A 2FEEI 2ZAHA 3B37A 4MJ6A 3V0DA 5FK9B 3O4LA 2HLFC 3IB4A 4FTVA 4L1BA 1LO5A 2FGWL 2G75B 2HT4D 5DJ8A 4DUVA 1PX4A 1VEMA 3AW5A 3IDGA 1L7TH 2DYPD 3O6MH 4W6YB 3N42F 4K2UL 3QZMA 1AOHA 3H7BB 3VG9C 3NQKA 3CE1A 4JFFA 1DQDL 4ZS7H 3X2QB 3CN2A 5H35B 1K8IA 5D7KD 3I84A 1ZIAA 2MHAA 4KKRA 3LNDA 3EF7A 5EOCH 3FJTA 4P46B 2EDDA 3PPSA 1F3JB 2K3TA 5FF6A 5JNYA 1AS7A 3O4OB 3BLKA 4GIPD 4CVWA 3CIAA 1CDYA 4HEMA 4BHUI 1Z32X 3HKFA 3KBPA 1NCDH 1KIPB 2W9EL 3WMSA 1G87A 2DQTL 1YEHH 4PS7A 3D39A 1S3KH 4GI8A 5K9JL 5J13C 1MHCA 4LLVA 4RMBA 5JDSB 1RK1A 2IBBA 2X6BA 2X4TB 4CL7A 2XV3A 3FOLA 5EZPA 5FA3A 2DQDL 4LPUA 4M7JL 1JZJA 4XVTL 5FYJU 3DGCR 1ES0B 2F8XC 4JDVB 5DMKA 3U9WA 4YPGA 1E9QA 5T1LD 4AMXA 2QGCA 4A6YH 4B9JA 3U7AA 3L3KA 1JPFA 2CIKA 5FDWA 4Z0BH 2QPSA 4IQHA 2XRAH 3O6FD 3WSQL 3TV3L 2BVUA 4OGQC 5MI0C 1I9JL 4GMTH 5LAXB 4U6VL 4ZFFB 4H20H 4ZO6A 4XMXA 2EAEA 3RY6C 5DVMA 2A9ML 2HRPH 3NAAL 3HC4L 3S3BB 5MEQB 3BEWA 3E2HC 5E00B 4P9MH 3NCCB 5FA4A 3MRNB 5FYKH 2FL5B 4KKPA 5GRVL 4XNXL 2JIXB 3AWGA 3ZYOA 5JW4Q 1YMHA 4NN5C 5ANME 4AENB 4JMNA 4ZT1A 2J71A 1EJ6A 1ZV2A 1PZBA 4J2XA 2XZQH 3N6YA 5B8CC 4YX2L 5HHNA 2FR4A 1LO2L 4JZOB 1UOVA 3DHPA 2ADYA 4P2OB 3FCGA 1FVCB 4YSCA 5KSAA 3STZB 2GIMA 2MPAH 1C5CH 1BAGA 2FLBT 3D0VB 2IADB 1NSNH 3VFTA 1CYWA 35C8L 4OD3H 3DVIA 4YHLH 1A2YB 2VM4A 4M7LL 4HIHA 4UTBH 2J88H 4FX5A 3UDWA 4E5XB 5E4EB 4B9PA 1CD9B 4ZMQA 5EU7E 3VE0B 4LCWA 2OMYA 2VE6A 3CHSA 3QWNA 1LO4L 5IREA 2VOTA 3TESA 5DR5H 2IQ9H 3D9AH 2QQKL 4ADGA 3GF8A 1FLRH 1WQVT 5T33L 1TQWA 4FQIH 3D6GA 3SGKA 3IJEB 4NX0A 3V7AE 4UQ2B 1TIUA 2UZPA 2EIMB 3NG5A 4MD0B 3EFFA 3IJ9A 4NKMB 1KZQA 5GZOD 3APDA 3ZU8A 2R0KL 1EJFA 5FGCE 2DM3A 3ARDD 1Z9LA 5ANMB 2BP0A 4K94C 4I9XA 4QXTB 4LSUL 3JV0A 3VRJA 2P8MB 2X4QB 2RCSL 1AYRA 1QKZH 2X4UB 1I9RL 2ZOKA 3GKWL 1D3CA 3MA9H 1JP5A 1TQUA 3QXDB 3IS0X 2NCMA 5CXPA 1O6TA 2OJZH 1F1DA 5G55A 1AGDB 2EIBA 4HGWB 2OS7A 3EGXA 2WBWB 4TUJB 2V5RA 1Q9WB 1F41A 4TSAL 4MWFB 1DBMH 3OZ9H 3IRCA 3NZSA 4CVXA 1CFNB 3N5AA 1D9KA 2Q3ZA 4P2QE 5DMJB 1HN1A 2XZZA 2GQHA 4PIBA 2H3NA 2VH5L 2WC7A 2DV6A 1MFEH 3QEUA 2HRGA 5DHVB 5F9OL 1LEGA 4WV1A 2OX5B 5BQDA 5C0NC 3KDPB 5FGSA 2WGNB 3TGXA 4WU7B 5HDOA 4B41A 4RFNB 1E8YA 2UY7A 1T0NB 3VD3A 3EJTA 2FO4B 4IMKC 5MHSE 5JHLA 1DLHB 3ROOB 4WUKH 3TLRA 2PW2B 4K94H 3LZQA 3MBXH 3MLWH 5BZWB 5FGCB 4UZUA 4XVOA 3QO0B 1A9BB 4PWKA 5E6RB 5JMRA 3H54A 3EGDA 3WJLC 4WCYL 2WM0A 3L9BA 5DJ0A 4W81A 2PUQT 1YG9A 1EEYA 3FT2A 2V3FA 1N0LA 3A67L 4DNLA 3TEWA 1KTDA 1C1EH 3PDGA 5ILTL 4PJ7B 4FHBD 4NQTA 2ZXGA 4D0CB 1KYUA 4H25B 1MCSA 3BUPA 1KG0A 2XPZA 1IT9L 5AVVB 3OMZA 4Z5RA 5H37A 3OJVC 4Q9QL 4JRXD 1RHHB 4YHOL 4K3DH 4JFZH 1V27A 4PGZA 4EI0A 2Z6FA 3LXCA 4KOCA 4ELME 2FB4L 1T80A 5J3HC 1G5AA 4HSCX 4RIRB 3ALXA 4IRZA 4M03A 5KW9L 2EDYA 5TE6L 5AOJA 1LQSR 2ICEB 5HDLA 1P4LA 3H9SA 5CJBA 4FXKC 4JPKH 5I6XB 4IDLA 4U2ZA 5DK2B 1PLAA 2FHCA 3BP6A 3P4NA 2IBGA 4R90H 4UMGA 4X8JB 3FU6A 1NJ9B 1BF2A 4H26A 1SHSA 1Q9KB 3ENEA 1FFNA 1WBXB 2AV7B 2QTVA 5F7DA 4AH2B 4MYWB 4B5EA 1KPVA 4EDWH 4JS7A 4HDIA 4DN3L 1HIMH 4DP5X 4NC2B 4OLXL 3MAWA 2MRYA 3VMPA 3ZDXF 3SD2A 4AKPA 1ZA6A 1XCQA 3B1TA 2VLME 4KXCA 1MIEL 4G1MA 4WEEA 3VFOB 5DLLA 5EZLB 4X6BB 3QIBB 3MLXL 3MRRA 4Y1AA 4GAYB 4XXCA 2RMNA 2XQBL 4YSEA 3CDYA 5HGGS 5HBBA 4F7KA 1CTOA 2VMJA 4OZHF 5A40E 5FO8A 1SZNA 1U3HD 4OFYA 4ELMB 2XWTB 4FJZA 4XPAH 5F3FA 4N0CD 4Z18A 2YD8A 4DTGL 3DJSA 1U58B 3JYCA 3RVUC 1M9SA 1FORL 3V4VA 1BJ1J 1Y6KR 3BKCL 1IEAA 4ZW3A 1RUMH 1AZCA 2PPAA 3PLYA 4L4TD 1T2QH 4G8IA 4HCIA 1AXSB 1I1RA 5FUZL 4OY9A 3ABLB 5HGHA 4PJEF 3VB8A 2EYSB 2CJTA 2V2TA 2H1PH 3QUYB 4FZ8H 2QLVB 2CK0L 4EI5C 1A6ZB 2X9WA 2FZ3B 2J4WL 5EF3A 3LJ3A 4JQIL 3ZRSA 4ETQA 3ES6A 5TK4A 4XMKL 4AJVA 4XO9A 3HI1B 2VDQH 3GXPA 4R7LA 2FQGA 3TBTA 1KJ2L 2DMCA 1JAEA 2FQFA 1XMWA 5H37G 1OAXH 3DNKA 3UEZA 4GKNB 1AGEB 1KLGB 3QAQA 3RHWK 1G4RA 2F54D 3KPLB 1CLOL 5EHFA 5AEAA 4GG6B 4KFMA 4Y7MA 1V5JA 5FX3A 3MXWL 4R7NA 1ZLEA 5HI5C 5IFJA 1YPZF 3FQWB 3UC0H 4YXKH 1KB9K 1WAAE 4IJ3B 2ZWZA 1ZT4A 2E8ZA 3HB3B 3NT0A 3U6XA 4LPYA 1T5XB 1C16A 3II3A 5L9DH 3QG6B 2HG5B 2QDWA 3LEYL 2P45B 1D6VL 2RD0A 2PTTB 1KIUA 5CP7B 5C8JA 1BFTA 2Z31A 3RIAK 3AJ7A 3PE9A 3ULSA 3T8XB 3C9NB 1RULL 5KJ4A 1K8DA 1OQOA 3P9LA 3CZFB 4DESA 1QUNA 5FFLA 1FA4A 3GJFH 1I1FA 5EO9B 1S9XB 2ZD0A 3QK0A 3LRHA 3HC0B 5A2AA 3LPGA 4OIIL 1U42A 2R4RL 4RMTA 2J55A 2XWDA 2AP2A 1UM5H 4AZ8A 3AZUA 4F7EA 2CGZA 1WS8A 4CC4C 2ZXEB 4WTWA 2RFXB 2XQYK 4JFDD 3MHZA 5EF0A 1G4MA 5AD0B 4XWGH 1J1OH 4UQDA 4UANA 1BSIA 5BVPH 3GUTB 3QJZA 4MXVE 1MHPL 3MLVH 2RR3A 4X98A 5FV2A 2O5XL 4U1JB 5PCYA 2DIJA 2VL4A 2XSKA 2FLMA 2IQAA 3CHRA 3UAJD 2OW7A 3UPCA 4AT6B 4KRMB 1XGTB 3G5ZA 1AJ7L 1N7ML 1RZJC 1OB1A 3WMPA 3LKRB 5GGRB 4XB3A 5AKTA 4XBMA 5K59F 3KYNB 4BFNA 4DW2H 2NY2C 1H3TA 1OARL 1FH5H 1YEFH 4GMSL 2OTUA 4PD4J 1MCIA 1TTUA 4Z7UF 1JGDB 1KGJA 1YNTA 4JFOA 2HJFA 4AQ1B 2UY6B 3B3IA 3NACH 4MXWH 5CINL 4LFHD 1BVLA 1UZ6E 1IGFL 5FV1L 4X4YA 5IHZB 1CK0L 1WD8A 1RPQA 3E9UA 5F1IB 2DQFB 3TO4C 1NQBA 1LP9E 2ZF8A 2Q6WB 3IPFA 3ORJA 5DYOB 4LLWA 1OXYA 5E2JA 3EJJX 1PLBA 4QRQB 2GI0A 5FLVA 2WWKO 5GSRB 1DVFC 1H6TA 3ZMRA 2V7NB 2VQ1A 4C54A 5D1ZI 3LNHA 3MLTA 2CRYA 2WIIA 4ZTOH 1KJ3L 1RPKA 2W0KA 5IOKA 3VI4F 4PRIA 3R18A 4OZIA 3BVDB 2XZAL 3P4OB 3HFMH 3OHMB 2EKJA 5KSBA 1RKRA 2C3VB 4OF6A 2VXUH 2ARJQ 1CGSL 2P3YA 1SLXA 5MEPB 3DXAD 4PWIA 2QVIA 3N1QC 1V3KA 1UVQA 4UF7C 4UDUA 4XP1H 3C60A 3Q3GA 4WI3A 1SVBA 4N8VA 1RZJH 3HLKA 3ET9F 5KYNA 5FHAH 4E9VA 3OX8B 3L3JA 4GY4A 4TNFA 2ATKB 4LCYA 1EA9C 4PG2C 3ZE1F 2ZOWA 1DQIA 1QHOA 2WTRA 3MCKA 4UIKH 2AK1L 3DRTA 4MB1A 3FSWA 2FH6A 3UBFA 1R3IL 4DQAA 2V0AA 4WJ5B 4HMEA 2I07B 4GFXA 5E8EA 2VO8A 3T4YA 4Y4KD 3UTPE 4NN7B 1LP9B 1JXKA 4WGKA 1TJGH 1AHMA 4PJXF 1J9SA 3PQYA 5F6IC 4Z6AT 3TVMB 1RURL 5E8DL 3A21A 3H6AA 5J11C 5CM1A 2WXFA 5I1GL 1Y18A 3UZVA 5B21A 1JF6A 2C9UA 4GW1A 2GJRA 2TRHA 3VX1A 1IL1A 4YVNA 3B5HA 3P2BA 5AW9B 4YDLC 1SJHB 1NGPL 1EZVX 3C08L 4MHHI 3UIYA 3HG4A 1YY9D 3LKQA 1RZKC 3OC8A 2GJ6E 1I1AB 3T0BA 5I1JH 1A4AA 1PJ9A 2ADFH 3TN0B 5KBDA 2ZKXA 5EO0A 2NNXA 1AI1L 4LHUA 3APCA 1WZLA 3BPNB 3CXHK 2ARJB 2V2WA 1MH5B 2OSLA 3U6XS 4FNTA 3AY4C 4YDKL 4OZFG 3SKNA 1UYWL 2WGXA 4BRVA 5E2WH 4I9WE 1UD4A 2EDLA 2IV8A 2HA1A 2QKIA 3MUGA 4LSSH 4ELKB 3T2OA 1JHTB 4QCIA 5SWZD 3RDTC 4KKBC 5FM5O 5DUBA 3IMBA 5D96B 2NLJA 4FI6A 1JCKA 2FEDD 3D8MA