5F2FA

Crystal structure of para-biphenyl-2-methyl-3', 5' di-methyl amide mannoside bound to fimh lectin domain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
158
structure length
157
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Protein FimH
publication title Antivirulence Isoquinolone Mannosides: Optimization of the Biaryl Aglycone for FimH Lectin Binding Affinity and Efficacy in the Treatment of Chronic UTI.
pubmed doi rcsb
source organism Escherichia coli j96
total genus 34
structure length 157
sequence length 158
ec nomenclature
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 5f2fA00
3SQBB 3ME0B 2WMPB 5AAPA 4XOCA 4AV4A 4XO9A 4CSSA 5F2FA 3RFZA 1TR7A 2J2ZB 4LOVA 2VCOA 5LNGA 5IQOA 2JMRA 2XG5B 4AUYA 2UY7B 1ZE3H 2JTYA 5FWRA 3BFQG 5FS5A 4AUUA 4J3OG 4AV0A 3BWUF 3ZL2A 5IQNA 2W07B 5FLUA 4XO8A 4X50A 3JWNE 4AVHA 5CGBA 3JWNG 4AVKA 1N0LB 5AALA 1KLFB 5FX3A 3MCYA 4CA4A 3ZPDA 5LNEA 4AUJA 5JQIB 5IQMA 4X5PA 3JWNH 1PDKB 4X5RA 5F3FA 4AV5A 5ABZA 4AVIA 2XG4B 4CSTA 4J3OF 4J3OH 4ATTA 4XODA 4X5QA 3ZL1A 1QUNB 1KIUB 5AB1A 3BFWA 4XOBA 4BUQA 2UY6B 4XOEA 1UWFA 1N12A 4XOAA 4AVJA
chains in the Genus database with same CATH superfamily
4LLMA 1JPTH 3QAZB 3RJDA 3V4VB 3BWAB 5FGBA 3SKOA 3B7SA 1DVXA 5L4JA 1PEZA 1E8ZA 2BY0A 3FTGB 1HEZA 3Q2LA 2LVCA 3OZKA 1I3RB 2WAHA 3U46B 3ZQXA 2VDRL 4AQ1A 1GL4B 5I76A 1KB9J 4JDZB 4ZOAA 2FZ3A 5DD0H 5ID0A 2HJKB 1E5ZA 4JFPB 2Q7YA 4LHUG 4FFVD 2H9GB 2B3RA 3W2DH 2VDRB 2B9BA 4G71B 4XX1G 1D5BA 2OCJA 3HZKA 5DO2C 3V0VA 3B37A 4Y2DD 4Z7WE 4U6XB 3MRIA 1KJ2L 1KTCA 5JOPD 5DR5L 2CO7B 5GRVL 1OAQL 4KK5C 4ODTL 3OL2A 2GJPA 2ZPKH 3VRLE 4LQFH 3W81A 4G6KL 1U8OB 4OQTA 4DP8X 4Y9FA 1Q90A 1BFOA 4I1NB 4YBLC 2C1OA 2QR0B 1RH8A 2YUZA 3O6FA 4MVBD 4KK6D 4TNGA 3NIDB 5JYLA 2P5EA 1KTJA 2VN5A 3NMEA 3DX9B 1A6VL 3SO3C 1CFSA 4XP6L 2AQRA 2H1PH 5EZOL 3EJPA 2I25N 4OZFG 3H85A 2APSA 2AZUA 3TPUB 3D08A 5CLYA 1SF3A 2VO5A 5D2LF 5F1IB 3HG2A 3FKUS 3GZQA 3OXSB 4N22A 1V05A 3H3KA 2ZT9C 4OCXH 4G1EB 1R3KB 1S7WA 1XCQB 3JV4A 2Z0UA 5BRQA 3CPLA 5FUOH 5GRZA 3ALXA 2VZ3A 5HJGA 1XGRA 4EUPB 1RZKL 1UA3A 4ZXBD 3HI1B 5TDPB 2R2BA 1ORQB 1OTUD 1EO7A 1TTFA 1XH0A 3INUL 2YUXA 3FSOA 3UTOA 5TQ2L 2P52A 4AC2A 4KJQD 4BSJA 1ZJAA 3RL1B 2FWLB 1HESA 3KPMA 4TUKL 4ZTPL 3X12B 1MCKA 2J6EA 4U1IB 1K8DA 3KE0A 5H4YA 3KM2A 2J1YA 4ODXB 1QWNA 3FCTB 1MUJA 3KH4A 3LKSB 5L0QB 5L2KA 4F57H 3HNVL 3S4SA 3QUYC 4N2NA 3ECWA 3WSQL 2FCBA 4QRTB 4ZMQA 5IMKB 4JQVA 1MI5B 3L3HA 4Z3HA 3LN9A 3T08A 1AGFB 1JI2A 2D8KA 4GRLC 3U79A 3SZ6A 5A7EA 3FUDA 2A4CA 4PRPD 4A67A 1UH3A 3PS6A 4MB5A 1EFXB 1GGBL 1NBCA 2YEQA 1BQKA 4P46A 3NFSH 4Y1AB 4HMCA 4J8RB 1XF3B 3H9HB 4Y1AE 5E4OA 4ANKA 5J11B 4XN8A 3GLZA 5C6WH 2VH5L 3QWNA 5BNXD 4UIMB 3GJFA 3II1A 4OLXL 3PWVB 4U49A 3BQUD 4G6AD 1ES0A 4OM0H 1OQOA 2DL9A 1RJYA 1ZEAL 3VB9A 3VXQA 5DK3A 2EIZA 2AQTA 3IJSB 2I26N 3QHTC 4R7NB 1PD0A 1NMAL 3MLWL 4G1MB 3BP7A 5CJ8A 4HWUA 2Q20A 3U6RA 4JAMA 2Y6TE 4D0BB 3F6JA 1KENL 3QFGA 3HC0B 4PJ6A 2H3NA 2NMSA 1S7VB 1F5WA 1L0XA 3FRPA 1GJWA 3MUJA 4D9RD 3D1MC 3AAZB 4PW9A 5ANMA 2JXMA 4OLYL 2PWEA 5HGDB 3U4BH 2IV9A 4ENEC 1J7VR 5E51A 2FGZA 3V9CA 1ZE3H 3Q6GL 5D7SL 2NSQA 1G6RL 4F9LA 2O6PA 4WV1C 3VVWA 5ESVB 3VXNB 2E8YA 1GYWA 1P4BL 3B6SA 2CNYA 4GBXD 2G3MA 4QHPA 1IZKA 2HVKA 1FORL 5EOQL 3W39B 4P5RA 1L6PA 1G6RB 5TE7L 2EKSB 1FL5A 2ESVA 5T1MB 5HP5A 3QIUD 1TJMA 1F90L 1AO7A 4X6DB 5FCUH 4X6DE 1NCDH 4PJ5A 2QQNH 2CCWA 5DHVB 1MRFL 1PAZA 1NDMA 2OMZB 15C8H 4PJGA 1S9VB 3ULVH 1NUDA 4FTVE 1KTDB 2FQGA 3MRLA 3RKDD 5HBBA 3DNKA 4M8VA 5JW5B 5KBPA 1HIMH 3BH8A 4WFED 1IAIM 2VJ8A 4Z0BL 3WJLA 1F4WH 5DJ0A 4UM9B 1E4XH 3WMSA 5EZJB 2EDMA 4PJHA 4UDUB 5JMRA 2WCSA 5CSZB 2WM0A 3DK0A 4CRPA 3WIIH 3AJ7A 2BSBA 3BVXA 2HJLA 3FB5A 1Z9OA 1R4XA 2OR9L 1ITCA 2EO1A 4F37F 1ZD6A 3NP4A 4LLDB 4KI5D 1LDPL 4MQTB 2ITEA 5D71L 3BKMH 4Y4KD 5I1IH 4PRHA 3DROB 3NFPB 3KPPA 5T1LA 3RHWF 2FYYA 5AD0A 2BY3A 3ROLB 1QR1A 4OD1H 1YMMD 1DJYA 4MNQA 2B5IB 3L5WB 3Q48A 3S6CA 4L1DA 1YEKH 5DYOB 1BF5A 4UNVA 3TT3L 1NWOA 2BS9A 1GA2A 3T0WA 3V4PA 1QUNB 43C9B 1WG3A 2GEEA 3EJQA 3I50L 3QWRD 3AREA 4ZW5A 1J1PL 3U0WL 2XTLA 1EWHA 4Y5YA 3HCVA 3SYPA 2F2HA 4ZAKA 4ZNCD 3GMLA 2DICA 2XIBA 2HPOA 4QHUA 1OSPL 4KUZL 4AG4H 5JPMB 3DKHA 3QUMH 3H55A 1PJ9A 4FA6A 3S35H 2JJSC 3L45A 4J6RH 4IHOB 5BMFH 4L18A 1EXUA 1QRNB 2NR6C 2X4RB 2J55A 2F7RA 3M1CA 3Q2CA 5AAWC 1LE5A 1SOQA 4NQUA 4F2MB 5IMLA 3D8MA 2N59A 4F2ME 5HYSB 3P73A 1X5KA 2VMCA 1W16A 5I6OA 4OM1L 5EC1B 3VO0A 3R0NA 2OSWA 4LCVA 4N0FA 4Z3JA 4CADA 2BNUA 2D3VA 3M7OA 1DP0A 3N1FC 1T0NB 4YHZH 4GH7B 4NNPL 1FRGH 4X2UA 1QWHA 3LZLA 1JAEA 5AVWB 4JM2D 4L0PB 3E2HB 4X5XA 1HHKA 4OFKA 3NFNB 3VXUD 5KWYC 4N90D 3B2VH 3SPHA 4MD0A 3QUKB 4ZFQA 2IPTH 3CV5A 1A7QH 1OCCB 5M94B 1LHZA 5FW7A 5IFHL 5I9QB 3RWGA 2R1YA 1TMCB 3SE4A 2NLJA 1UM4H 5IHLB 3HRZA 4BCZA 3FCGA 3OG4B 3TBSA 2EYTA 4PS4H 4YGVB 5D70H 5JIDA 1A66A 3MBEB 3W0WB 5D4HA 1LEIA 2G0LA 3W0WE 2JCCF 3MROA 3VXMA 4MRCA 5F6IC 3IYLW 2P8MA 4NP4H 2DZEA 1DQLH 3X1BA 3BOVA 3GLAA 4PRIE 3IDIA 1W0VB 5JPNA 5GGTH 4L9LA 2X87A 3D05A 1A4AA 4LNRA 3ZTNH 3VM5A 4MDJB 2EE9A 4XPHH 4ZW8A 4HUVA 1P7QD 5C0AD 4LT7A 5I0XA 5L6YH 3EUUA 3T2LA 4G80A 1WDAA 3MREA 4M62L 5B7FA 1NOFA 4CSTA 5IB4B 1RI8A 3AM8C 3WHE0 3K2UL 4U3HA 4L1HA 1BA9A 2R0ZH 4M61B 3V95A 1OCWL 3AT0A 2B1OA 3E80A 4F3FA 1FN4A 1PNCA 1O6VA 3P2BA 2BP8B 2Y7NA 3LVTA 3MLUL 5DRNB 4ZFFA 5ICYB 2J8UF 4U1LA 4KTEH 2BC4A 4NNYA 3DIFB 3MRCB 4PP2A 2GITB 1KCBA 4ZX6A 3QUZB 3H2PA 1SBSL 2X5PA 4PVLA 1MY7A 2ADYA 1PVHA 2A9MH 3KLQA 3N41F 4CVWA 3EH3B 1FNLA 1BOYA 2ZXGA 5F9JB 5MEOB 3E7JA 5ILTH 3GZKA 4IEFB 5IQ7L 5DQJA 2DB8A 1NFDA 4JFDD 1OPGH 3JWDH 1R0AL 4LARL 4Y4FB 3RIFK 1ZE3C 5JHLA 1BAFH 3SDAC 4JR9H 4AVJA 1Z6JT 4KQ0A 2ZOWA 4JPIB 3GXFA 3B2DC 5SV3A 4XXDA 3QGVA 5I1DA 4LFHG 4HEPA 1M2VA 3CFJB 3N1PC 4JB9H 4WDIB 4RQQA 5KBDA 1P2CA 1HNYA 1QLEL 4RMWA 3MO1A 2C9XA 1TCRA 2Y5EA 1VFAB 4W9KC 3PPSA 4OD2A 2QGEA 2LVEA 3M17B 4PGCA 1G9NH 4XMVA 3BD4A 2FGWL 3QJVB 4PJEF 4Q8BA 2I07A 3SO5A 2XZCL 3ULVC 1EJFA 4PJDA 4PCYA 4ZPTB 5CHNB 1JZGA 3JTSA 1FGNL 3VI3B 1E4XI 1IM3B 1DANU 1KGCD 1YEJH 2NW3B 1M2OA 2V9UA 4GAFB 4PTUA 4LSQH 4DEWA 2XNAA 3IFPB 1UD5A 2VRKA 5DUML 4KO6A 2CCVA 3K91A 3TZVA 4Q6KA 3GDCA 2YD1A 1DVFC 1KJ3L 1BCIA 2WVUA 3KVQA 4FL4B 4B7IA 1B4TA 4HIIA 3NCJL 1UXMA 4ZDHA 4ZMPA 1GS6X 3L95B 4M8QB 5K5YA 3BI9X 3MRHB 5F0PB 4OI8A 1AGEA 3FTSA 5CCKL 3HZYA 1GKOA 5AOKA 3GRGA 4GAGH 5DUBB 2X6AA 2XN1A 3LVEA 4K7PL 3I6GB 4HETA 4AYGA 3L9YA 1IBGH 2IH3B 3SE9L 5E1IA 2XKNB 2K6WA 2SODB 1NCHA 5C0EB 1TZHB 4H1LA 4O5LH 3VGHA 3ARGC 4PLKC 5FV1L 5MEPB 3I74A 4G6ML 4IRZL 3ZRCC 2B8OT 4Y2DA 3CFDB 1AZCA 4M7LH 1T1WA 1G7JA 5LXGH 4RFOL 3HPJA 3PV7A 4WTXA 3RWHA 3H4FA 4Z3FA 5EOCH 5EIIG 5A2BA 3MRDA 2V7HB 1IT9H 1MZYA 3FT3A 1SOSA 1N68A 3OB8A 4K5LA 4TNWF 2Q10A 1NIFA 4PREB 4HS6A 2N7BA 4U1KB 4PTTB 2VABA 4NJ9H 4WCYH 5D1XE 4JDTL 1AR2A 4Y5VC 4NKIL 5GS0D 2LU4A 3FCSA 3SDYH 5A7BA 1U41A 3WIHA 4I0PB 1BJ8A 4H4NA 1IAOA 2LTQB 2ZXEB 3KEHA 3OPUA 3NSCA 5A6MA 1L7TL 4MJ6A 2DQIL 2XICA 1NAML 2VL5A 3R0MA 3SPCA 1KXQA 1G7IA 3JT0A 5I17A 1CFMA 3L3JA 4XPTL 1QI5A 2WZAA 2BXZA 5KANG 5BZWA 4YVNA 5CEYA 4ZXBA 2ORBL 1NTDA 1C5CL 1ZS8A 5LGHH 1WAAE 3L2MA 3VFUB 1QFWM 1DSWA 1KBPA 2AANA 2W60A 3UMTA 3ZOAA 2MJWA 2GK2A 2Y7MA 3A23A 1RHHB 3CZJA 1HAUA 5I1JL 1GPOH 2XHNA 4YEEA 2CPUA 2FX9H 4LSRH 4PY7B 4OV5A 4RAVA 1BYNA 2CK2A 2QQKL 5C8JA 2IMNA 4AYID 5LGJA 4AWJC 3GS7A 3MYJA 3NCYS 2VXQH 1YPZA 4B9GA 1MFBL 5E7BA 2AKRA 1AOHA 3C6SA 1UADC 3IXTA 2W0FB 3S8FB 4FI6A 4YSQA 4L5FE 1KLUA 3IFOA 4PRPA 3UBXI 3UZVA 3L9BA 3WFDH 4N2MA 4UQ2B 6PCYA 1S9XA 3CLEH 1IGYA 4HPOH 1MZZA 4E9LA 3V5KB 1WV7T 4RFNC 5CUSL 4FQ2H 1RK7A 4BWWA 2JELL 4HUXA 2E27L 3F7YA 4NZTH 4I85A 3MV7D 1SZNA 4WUKL 2EH8H 3HC2A 1FZMB 3CMGA 1KDJA 2K7PA 1T1ZA 1XR8B 1BQSA 3BQUA 2M1KA 4UU9A 2A74C 3FXIC 4AGPA 3BGMA 3D0VB 3VI4F 2NQCA 4FZEL 5EBMA 5E2UH 3UPAA 2D9QB 1KYOK 5HGGS 4L1SA 1HVXA 5E2VH 4KO7A 4M9PA 2R56L 4OKVB 1FNAA 4HWZB 3QNZA 4KXCA 2GUOB 5KYUB 3FTWA 5KUMA 3LV3B 4QHNA 2OYMA 1JNNH 5FO2A 1OP4A 3D30A 4DK3A 2A6IA 1CGVA 4BQ8A 4DW2L 4NO0B 1NGWB 2D03H 4XR8C 5DSCB 3FULA 1JN6B 3QEQB 4MQXC 1FIGL 2OQJA 1MHEA 2PTUA 3GSUB 4OJCA 4WHTB 4Z7VB 4Z7VE 1NL0L 3BD5A 4YXLL 1OAJA 1RZQA 1QLRA 2O5YH 1KXTA 4FI7A 1AP2B 4TMPA 3MV9B 5EEXA 1NJ9A 2X6CA 3MV9E 3JWDC 1HDMB 2ID5A 2YAPA 3V9EA 3HUJA 4DF9A 6FABL 4LVOB 5KSAB 2YAFA 3CDFA 2Q3ZA 1SF5A 4UT6H 3QIUA 4K5NA 1QHQA 3ILDA 1MLBA 4LAJH 1Z5LA 2VDLL 4JN1H 2WIMA 3S5LA 5F7MC 1ZDQA 1E5BA 1K72A 3DV4B 4M48H 2GY5A 4XNMA 4PJ7B 1JCVA 3TTYA 1UEMA 2N56A 1Y6NR 1G9NC 2J3SA 4PJ7E 4I87A 5FK9B 5JOFA 5EUOF 3MFFA 4KMTH 1VPOH 2CU9A 5DI8A 2CRZA 4RGMB 1TMQA 4NSKA 1CDIA 5C0BD 4X4YA 1T22A 3HE7C 2QV2A 1FH2A 5JO5A 1GR7A 4L3CB 3SDCB 1MPAL 2EEBA 4ABWA 4XAKE 2VQUA 1P0SE 1BD2D 2YS4A 4XVSL 2X0VA 3JXAA 4FQ1H 5D72L 1JWUA 4PR5A 4U1SB 4Y4KA 2V5SA 1C5BL 3DARA 1KIQA 1IZJA 1PCXA 1P6AB 1IM9B 3S4SG 2NOYA 4HX1B 3O9WC 1YMMA 4FCHA 4NN7B 2IAMD 1TKWA 3B7YA 3L3DB 3ARBC 4JFVA 2W1NA 5EFIB 3ZMRA 4P2AA 1SPDA 5DJZB 2BIMA 1XDTT 1HCYA 5FDYA 3UERA 5FYJU 4UMGA 4F24A 1M71B 1A2YA 2QT6A 4A04A 2O5XL 2HUEA 4WI3A 3QWRA 3FN0L 1XGYL 1C12B 5I82A 1MQ8A 1LO0H 1E40A 4IW4C 4OLWL 3VQLA 1KZYA 2DBLH 4FEIA 3IFNH 5BW7C 3O8XD 4AZ8A 4O4YL 4UBDD 1QUPA 2EDBA 1G7LB 2ZZUT 4H25A 2JKIS 2WCGA 3E1F1 2AJVL 1MVYA 2LLLA 2W9DL 4HJSA 3B9VA 4HIEA 1QHOA 3IGAB 4P4RA 2VQ1A 1ZT4B 1HKFA 2ESVE 2LV4A 3QXVA 1U8JB 4BINA 3D9AL 3FRPG 4ZFZB 4EN3B 5KBKA 1BG9A 1GJUA 2GK0A 2Q7NA 1F4YL 3MJ9H 1XGPA 2E4FA 1VGKB 2VR3A 1EHLL 3EFFB 4M7LT 1N0XL 5CINH 5D7IB 4K71B 3T3PF 4EIBA 5D7IE 3MGOB 4K3JL 2W0LA 4JM2A 5BV7H 1FGVL 2JLPA 3CFBA 3VXUA 4KKCC 1N67A 3ZE2E 2UZYA 5JZ7D 5AVTB 4EEEA 4J8QA 1HQ4B 2VN4A 4A7VA 4GIAA 4ZPVA 3OJ2C 4H20L 4XH2A 2MQGA 3BT2L 3VH8A 1CMOA 3TM6A 1CU4H 3TBCA 4D2NA 1YN6B 2IDQA 4MXWL 4Y9EA 3HRPA 2R7EA 2RHEA 3CVBA 2VDQB 4DJMA 4NOFA 3LHAA 2WOYA 4M5SA 5HDLA 3LNEA 2VXSH 1KCLA 2NY6C 5CZVH 2AV7A 3KYKH 4YFDB 2D0FA 4WGWB 3O11A 2BS71 2Q76A 1WCQA 2EE6A 3ARDC 2ZCLL 3P0YH 4W4OA 1ONQB 3WENA 1BGXL 2XN2A 1GTFA 3Q13A 4JM0A 4NGHH 1ZMYA 1SLVA 1UWGL 2GHWB 4MAYB 1P7QA 5C0AA 3MUY1 3KR3H 3DLQR 5B1JC 3QP3A 5E6RB 4OCMC 3CC1A 4XP5L 5EO1B 1MQKL 3IAGC 2BJML 3Q5OA 1A6AA 3FTZA 1JVLA 1VERA 4PYGA 5JIMA 3ARWA 3DUSB 1TEGA 5CF3A 1KEMH 4OZGF 3HNTH 2NNAB 3B2XA 4YLBA 1DVQA 3HBZA 5F8QC 5GHWL 4AC4A 3MRMB 2EDKA 5FGSA 3ZE0F 3Q6FA 2F74B 4QOKB 4QOKE 1I9IH 2ED7A 4NPYA 3IFLH 2NYZA 2EZ0C 2P28B 1WFTA 3IJYB 3QNXB 5JOEA 1D6EB 5DYFA 4OIIH 3ZKXC 1L7IH 2NYYD 5LCVL 12E8L 2K4WA 2HT2C 5FYKU 3O3EA 4N8UA 4NM8H 4JFDA 1EO5A 1OGPA 1UFUA 2L4OA 2YN5A 4YHPA 1Q9KA 3E6HB 2BRRL 2WLZA 1GYUA 3P3YA 5FC9A 3BVWA 1SVZA 3D6GA 4AIXA 2K8QA 4KHXL 4KDTC 5DK2B 3WEOA 1KLFB 4K07A 4F7TB 1S9YA 4XBGA 1N26A 3NCYP 4KVCH 4X8JA 3L3OB 3GBML 3REWB 4DAGH 5ADPH 5I1LA 3QJTB 4OLUL 5F7HA 1RUPL 3HS0B 1BREA 1J1OH 4GQPH 1AI1L 5DJ6A 1A6PA 4XC3L 2WINA 4K73A 2R8SH 1CZ8H 3MNWA 4KROB 4HOMA 4FHKA 1MAML 3BN3B 4QTHA 4YNYB 1IU1A 1KBGL 1OCZB 1U33A 1CDGA 2Y3NA 3QS3A 2DYPB 3T04D 3MLXL 3PREA 2A5UA 2KERA 1AS6A 3DVIA 5SX5K 4NRZA 4WU7A 4IJTA 3TL5A 4FNLH 1YN7B 3ATBA 3T0BA 1K6QL 1OT1A 1PG7W 2E6JA 1NEUA 1TJHL 4YE0A 1FZJA 3SPVA 2WW8A 3QDGD 1QBLH 4H26B 3EF4A 1DZBA 1IO4C 5T3XL 5I1EL 1K2DB 2CKBB 4HT1H 4H44C 1AKJB 1UKSA 1ML0A 4BZ1H 4Q58C 1EXHA 1IJNA 1AANA 5I74B 3LN5A 4PBDA 3K4ZA 1UOKA 5J3HD 4ELKB 4GW1B 5EORL 1BW8A 1M6UA 4FERA 1IAKA 4LCYA 2LE9A 5E6SB 1U3YA 4OJFH 1CF1A 1OARL 5DC9B 5F7NC 1NCAH 1SJHB 2IQ9L 5JHDB 1C7TA 3VD7A 2HVJA 5JHDE 4JO4H 1R3LA 4CC0A 4EAEA 4W70A 3MRPA 4CUCA 5GS1B 2EIKB 4XVTH 4JK0D 4JZNA 3H54A 2KPNA 5DRXB 1CL7H 1F3RB 2ED9A 5E4AA 4LPYA 3TBWA 1WIPA 5G5DA 2Y7QB 2B1AL 2OULB 2PPDA 3MMEB 3PLYA 4HJ0C 4CJ1A 4IU3B 3NZ8A 1BVNP 1IBZA 3PP3K 4XMTA 1OL0A 1V3KA 4HKZB 4FP8H 1OZUA 2ZOLB 5T3ZE 1ZT7A 1OE3A 4G8AC 4JDEA 4E9QA 5CZRA 3GSXB 4O2CA 2QQQA 2A73A 2MCPH 1Z9MA 2ZYIA 2P5WB 1DCEA 3QJSB 4X80H 1HH9B 5HGAA 3DETC 1ASPA 2ZPKL 2WIIB 3C87A 3I75A 5IG7B 3D4CA 4PJDE 4QY8B 1DSFH 5GIRA 4NAMA 3IDXL 4MLIA 1PIGA 2F7IA 1L9OA 4IDLA 2Z1KA 1RZJL 4JFXA 5CJBA 4Z77B 3FQWB 3UBGA 5BV7C 3ZT5A 2FX7L 5DHDA 1HXYB 1U8LB 3MZGB 4H0LC 4PJIF 4YBQD 5ETUA 1ZGLM 3C5JA 1WK0A 2H1PL 2AJ3B 5J0BA 1A7NH 5ERWA 3KCPB 1KIUA 4HH9B 1A4KA 2HA1A 5SV4A 1BV8A 4OCXL 2R1XA 2XZZA 2ZKWA 1G7HA 3NOIA 3Q9QA 1TQVA 2P80D 3CAFA 2C3HA 5FUOL 3L3IA 4M3JA 2VJ0A 1N64L 5C6TH 3ZR5A 4R0LB 3TCLB 3UTSB 5DC0A 5IFJB 3UTSE 3ABKB 4I4WA 4CU8A 1RZFH 4OCRH 4LBEB 3S88H 4Y5XB 5HGBB 2GG1A 2VE6B 3BHBA 3NP3A 3D18A 4HFWB 3MV7A 4RAUB 3RVVC 4F57L 3ES6B 4PGEA 3BPNC 1S9KC 5JXED 4PJBF 4FABL 1DJSA 2YXMA 2W95A 2CDFB 3LNFA 3STZA 4OQTH 2EVHA 1ZLSH 4NC2B 4G42B 3MV11 4JPWH 1SQ2N 3UTQB 5AW2B 3TH4T 1M05A 4JZJA 2E7MA 4BIKA 1I7ZB 1AR1C 3NFSL 3AXIA 2APVA 5E5MA 1MHHB 4N9GB 3G9AB 1U2YA 5EF1A 3MLVH 4QHLA 1IL1A 3AXLA 4CC4A 4H1LG 2NX5B 2G2RA 3DHUA 2NX5E 4GRMA 3TV8A 2OYKA 5CBEB 4OM0L 5C08D 1DR9A 3OKEA 1SHWA 1UVQB 2QSVA 4JFTA 2GTZB 2X1XR 2UYLA 1FL6A 5IVXA 1X44A 1JSYA 3CUPA 4OAWA 4S1QH 5IM7B 3Q1SH 4YSUA 1W8NA 4AMWA 3HG0A 3VXPA 2AQ1A 4W9LC 5LN8A 2WLIB 3MPCA 2DMHA 2XV2A 3ETSA 4AT6A 3V10A 2NXZC 3ESMA 1CVRA 1RZGA 3QG6A 4BD4A 2H8PB 1S46A 2J6EH 3PABA 4LCUA 3RTQD 4GUPB 4HAGA 4BFOA 4KUCF 5KVEE 1DLFL 3ETBF 2G5BA 3EJCA 4AW4A 1K5NB 4NKDA 3FO2B 4G5ZH 4DUVA 1MCEA 2WVVB 4PLJD 4Y0GA 3I84A 3X11B 5IQNA 1M6OB 4HGWA 3BPLC 5EO9A 3STLA 3RZCD 1BWWA 3OC5A 3FT9A 5JW4N 1ODAA 4XNBA 5D96B 4ERSH 5KZCB 5I16B 2OXGA 2WWMD 5FCUL 1NCDL 3CZUB 4KXDA 4J39A 1BD2A 2QQNL 4MZRA 3S36X 1RPQA 1YO4A 15C8L 3ULVL 3N40P 3GJFH 2CMRH 3SGJC 4YR6A 2ATPB 1HIML 4OCWH 3UBHA 4AYSA 4E36A 3RFZB 1M3IA 1F4WL 1SHMA 2IAMA 5CAYB 2E3VA 4JRXB 1E4XL 1L9SA 3EYOB 1C8QA 5IVZB 1FQ9C 1NA8A 4NKMA 1OP3K 3WIIL 2VSMB 1RSFA 1B2YA 2QFPA 5IBUB 3I02B 1LE9A 1N70A 3ZGIA 5FYJE 5HYIA 1FFOB 1ND0B 1U2HA 3FT2A 1OM3H 3HEIB 2QVIA 2EDFA 2CJUH 2EABA 5DD6A 1FIEA 1JIBA 3O41B 5HHNB 4F8OA 3EYQC 3O8XA 3GSNA 4OD1L 1WF5A 1XMEB 1U8QB 4LSTH 4AITA 5KANI 1YEKL 1OF2A 4I0CC 3BJ91 5MENB 4PVNA 5MENE 3VRIA 2B20A 3O4LB 1KBWA 3O4LE 3TFKC 1XR9B 3JZYA 2F68X 5DMGC 2NSMA 4X4MA 4MJIB 1DUYB 1HU8A 3F12A 4MJIE 1NBYA 2D2CC 2F54B 3UTTB 3HHSB 3UTTE 3TBVA 2J5LB 1UENA 3GMOB 5D1XC 1GGCL 1QFPA 1AHWC 1UM6H 3GTTA 4Z18A 4AG4L 1IIKA 4F37K 3QUML 4ELDA 1JV5B 1U8MA 1FNGB 1KLGA 1YYML 4J6RL 3FU3A 5DLLA 5BMFL 1P1ZA 2LHAA 3WDIA 3SKNA 2ITFA 1KCUH 2LLNA 1EEUA 4WJ5A 2DN7A 2QKIA 1H0DA 3RHWK 1IKOP 2V7NB 5BO1H 2WZ0A 5E8PB 4XO9A 2OMXA 5C09B 4B3VA 1BYPA 5C09E 1ZA3A 2YC1A 4DUWA 1R3HA 4QLWA 4UYPA 1RFDH 2GSGB 4XAWH 4TYUA 2FIKA 3T0XA 3DOIA 3P69A 3LIZA 1FRGL 4EE2A 2AV1B 1EAQA 4AH2B 3C2AH 3GDBA 4YSRA 4CN4A 5FGBC 3B2VL 2KHAA 1VZHA 1RP8A 1VAHA 2IPTL 5KSBF 1NUNB 3DSNA 1A7QL 2B2XH 4ZS6C 3MJ8B 5SWZB 5FF6B 3ULSB 4AQ1C 4YXKH 3V4PH 1P5UB 1UM4L 3EGSA 4GPVA 5B4MC 2W81C 1R3IL 2UXFA 1WD9A 4K7FB 4PS4L 4J2XA 5D70L 3PHQA 4HBQA 5C0IB 4L8BB 4P2QE 2GABA 4R3SB 1CO1A 3GRBA 3RVUD 4XB3A 1ROCA 4OTXH 3KYNB 1E4KA 2VRAA 5F1KC 4Y8DC 4NP4L 5BQDA 1DQLL 1L9RA 2EH7H 2YEVB 4JL1A 5F9OH 1VJSA 3ESVF 3F7QA 3S96B 3WE6B 1T66C 4U6HB 2E46A 2BH0A 4EPSA 1F00I 4JKNA 4X7CC 5E8DH 1OB1A 2V2TA 3ZTNL 4XPHL 2IALA 1QEXA 3BIBX 3O6FC 3ZR6A 4IOSD 4BDVA 5L6YL 4AKPA 5ICXB 5KSVA 3VJ6A 2DLGA 3ZE1E 5KS9A 3P2TA 1P4UA 1ZLEA 4P4KB 2FNBA 4AJ0A 4BFEA 4UV4H 2E8ZA 2R0ZL 4RLDA 1OOAA 5EU6B 1IQWH 5EU6E 2IBZY 3BIKA 1CQYA 5FYKE 4R83A 1A1MB 2YA1A 5EB9A 2XFGB 2J88H 3OKOB 1MCNA 3NYKA 1EUUA 4KTEL 2XQBL 3HG1A 3P4LA 4L37B 4PJFF 3QE5A 1FVDB 2A6JB 3U36A 3D0AA 4JJHA 4EOWL 4D94A 2H6PA 2A9ML 4XGZB 1NCJA 3DO7B 2Z64C 4LDCA 5ILTL 1E4HA 3WN6A 2QSQA 3H9SB 3M1BB 4XO5A 1OPGL 3JWDL 4TS6A 1T6BX 4WVRA 4Y2OB 1BF2A 4YZFE 3SYAA 4BKSC 1BAFL 4UINH 4JR9L 4ES9A 4E9WA 3B2MA 3K80A 3QXTA 4JQVC 3CJJA 2HG0A 4ORGB 1R5IB 5JIKA 1SXSA 4M43H 3C60D 4Y16B 5B1CA 3QDGA 3FZUD 4MS8D 1BXAA 5SWSB 5SWSE 5JIQA 2FEDC 4P46C 5E4EB 5F7LB 5JIIA 3VH8G 4NDMB 5C2UB 5FO9B 1WZKA 4FNRA 3HMXL 4UAOC 3QBTB 1G9NL 4HIQA 1YNLH 3WO4C 3MNVA 2AQ2A 4NUJA 3N44F 4YL9A 3EO0B 3GM8A 4Q9QH 2ED6A 3ARYA 4TLKA 4A6YB 4Y4HB 4I2XB 4I2XE 1KFAH 1YEJL 4GSQA 2W88A 4R90H 4X6EB 4PQXA 4TQEH 4Y7MA 1DFBH 2KLSA 3EIFA 4LSQL 4U6YB 3VNZA 4AQAA 2ZSVA 3IVKA 4RMBA 3KPSB 2CLRB 4B0MM 3DGGA 1S5HA 2H1LM 4E9RA 3CQQA 4NQCD 1WP6A 3JWNE 5CCJA 4UT9A 4F7CB 1B0IA 2R51A 2DOCA 2P44B 2YMXH 4LNVA 4M6NH 4YHMH 3WFHA 2L8AA 1WPCA 5HHMB 3IU4H 5HHME 1ZLVH 1CDUA 1NBZA 3V0AC 4IOIA 2ICWJ 4GAGL 5H35A 4S0HA 4BFNA 1QKZH 5JHLH 4HG4K 2XWEA 5E9DD 4F9LC 3QQ3B 2WTPA 2DWTA 4JJ5A 1AAJA 1YECH 4KV5E 5B3SB 1IC7H 1OT4A 4O5LL 3RWFA 4AQEB 5T3ZH 3QUGA 4WW2A 3H0TA 4EQ3A 2OV0A 4OFIA 1VHPA 4D9QE 4OZFB 1KBKA 1AHKA 5A40E 4M7LL 3L9RA 2G75B 2YD5A 4HZAA 5LXGL 4GSRA 5IB5A 4RGNB 3QWQB 5EOCL 4RGNE 2PABA 1IFHH 1QSZA 3RVTD 3TYFA 2WHVA 1IT9L 1GCYA 1UB6B 3CHQA 4PY8I 4PJAA 2VYRE 1KGCE 1LP9F 2NTFA 1N5AB 2ZXBA 3WJLC 5CJ5A 2ZX6A 4AENB 1HOCA 5C0GB 2X4SB 4WCYL 4G5AA 3L3GA 4QIRA 1O7VA 3KBFA 1FVEB 3GXMA 3SDYL 4ODSH 1PJWA 1N2RA 2AK4D 2ZSWA 3GHEH 1KYOJ 1FWXA 1MJUL 3LXBA 4DP9X 3VFVB 2YPLD 2DWXA 1ADWA 2P80A 5JYMA 1EBPA 3GBDA 4APQD 5JW4M 2DV6A 5CLTA 4WFFD 2R2HB 3VXOB 1MLCB 3ULUF 2OSXA 3TFBA 2DQCL 2KDGA 3BDYH 5EEUA 2BZCA 5D5MA 3UCQA 2H0PA 3QDJD 1NM4A 4Z7NB 1F6AB 3VXTA 2G9HA 3ILPA 4KDVA 5IESH 4HUNB 1G9HA 3GI8L 5K1NA 1GPOL 4H1LH 2O6EA 3U82B 4LSRL 4AGNA 3P4OA 4TNWK 1I4FA 3AREC 2YAOA 4BEIA 4N8PA 1FYTD 3E0GA 1AZRA 4Y5YC 4WEEA 2LGNA 3KWXA 2ADIB 2VXQL 4ZAKC 5JXEA 4AQ8A 3VFPB 4RX4D 4W9JC 1MELA 1Q94B 2AEPH 4HEMA 4HK0B 2N01B 3DURA 3WFDL 1JL8A 3CLEL 4HPOL 1BSIA 3SKJH 3LZPA 3I3BA 1U8CA 2PN5A 2WXRA 1QLFA 3AVEA 4AGQA 3L6FB 2YQBA 4NZTL 3PDOB 1B0GA 1HSAB 4XRCA 3GFUA 2EH8L 4U1NA 3A21A 4K94H 3TU6A 1ETZA 1G43A 1P6FA 4GYBA 3WIHH 3KPRB 4QRBA 1N0LB 2C7FA 5C08A 4YHNA 4IKKA 3AU1B 5BS0D 1D5RA 5C3IA 3APFA 2E9JA 4P8QA 2XDHA 1HHIA 4TUJB 4UYQA 5E2VL 1XIWD 4ZFOL 4GW4A 1CUOA 5JNYB 3EYVA 2ICWB 3AWEA 3HLAB 4N5UA 3PFUA 2WWOA 3OZ9H 1VENA 1WA0X 1JNNL 1NC4D 4L4TB 5DJCA 3QHFH 5F3FA 3G6JB 3ZKND 4HZLB 1BQHA 3IWUA 2D03L 2VN6A 3RTQA 3SE4C 1EEZB 3WE1A 3F7KA 3HRZC 1X4XA 1RJCA 2DQEH 4U1GC 5KVEH 1P4LB 1IRAY 2E47A 1LEKA 4HJTA 4J2QA 2GIYA 4LXFA 3WIFB 3TBYB 2XVKA 4XVUC 3H1ZA 2FBRA 3TVMB 3RZCA 3LMJH 2UX6A 2H32A 4FGMA 3RI5F 3FH8A 1TZIB 5TE4H 5JPNC 2DQHL 4JN1L 4YHLH 4JRFA 4L9LC 5G4NA 3FO9A 2OMYB 3IPBA 5BXFB 5ESQA 4WO4B 3QJFB 1A4CA 2ZUQC 2QV4A 5TFSH 3VACA 1QYGH 1Z3GL 3X17A 3P9LA 1E50A 3DVGA 3FHQA 4FYQA 4BUQA 4KMTL 1DJZA 3CDZB 1IGIH 1L0PA 4AEHH 2GBAA 3EH4B 2QELA 3ZO0A 3JV5A 4LCCB 4XO3A 3C8KA 1ZXQA 2FLBT 1E9QB 2O30A 3QRBA 3SPJA 3MV8D 5CILH 5AVVB 1U6AL 4LDOB 4AGLA 3G6AB 4FZ8H 3F05A 3M8OH 3UPRB 1TQSA 2RFXA 4FQ1L 1B4JH 2CK0H 2VXUH 2H0EA 3RGVD 4CN1A 1OGAD 3B9KB 4JZOA 3BSZA 1WQVT 4P49A 2XWBA 1SNRA 2OSLA 2BSSA 4TNVF 3X1EA 2VLJD 1V3LA 4FCAA 4L3EB 1D6VH 1FO0A 4L3EE 4WAFA 1OALA 1CFVH 3DIDA 1AMXA 4YHIB 5HGHA 5IP4A 1KJMA 1VZIA 5IQOA 5ISZD 4IRJD 5AB0A 1J5DA 3T0VA 4CVZA 5KVFE 1KJVA 1EDHA 1FI8C 2X4OA 4LRIA 4N8VA 1VLXA 2XRAH 5EC2A 2BCKB 1BJMA 3GIZH 1Y07A 3RUGF 4M1DH 2W07B 3FUFA 4DKTA 3T2OA 1LO0L 4XNAA 2VITB 1WIOA 4U1MB 3DHJA 1YAIA 2FHCA 3ZDYF 2DBLL 3PDGA 3IFNL 4GI6A 1GZQA 4MKMA 2XZQL 3DYMA 2MH4A 1A8JH 1EAPB 2XJKA 3NSDA 4ZUUA 3ZKMD 2WYHA 5D93C 5I8EA 2Y5TB 3VUAA 3PHSA 5FA3A 4IBWA 5C0CD 1G7QB 2I85A 3CZGA 4X5RA 1CG9A 1ZV9A 3RJQB 5TGBA 1HL5A 5CINL 2IOIA 3LSOB 4WI5A 3SKUD 5BV7L 1OHQA 3ZMEA 2GAZB 2DQMA 3KWWB 4IJ3C 1BFTA 4J3UA 3LB6D 3T77B 1UD3A 4OZIB 4Z3EA 5I8KH 1JBJA 5I26A 3LQZB 4YDKH 5BV7B 1KB5H 4I9WE 1A3QA 3ETTA 2X4QA 2Y06H 3QEUB 5FUZL 3KYOB 1OF0A 4FFVC 2QQLL 4DCQB 1PSKH 3SJVB 5GGRA 2WUCH 1QG3A 3FQXB 1J1XH 5DC2A 1IE4A 2VXSL 4Y2DC 5CZVL 3KYKL 2VW6A 3CFTA 4XOBA 2QHRH 3PWJB 1F1GA 3QJXA 3P0YL 3HAEA 1ZVSB 4MQSB 1IBHA 3NJJA 1D9KD 4OZ4B 2GJ6B 1HWWA 4KJYB 4MVBC 2GJ6E 1BVLA 4X4ME 4KK6C 3ISRA 4W9ZA 4GP5B 3KR3L 4IOSA 4PUBL 3H3PH 3NRPA 1TQBC 4YAQA 2OMTB 2YPVA 4LCIH 3CX2A 2NY1D 3NG5A 4GO6B 3A47A 4W9FC 2D4DA 5FYLD 2HFEA 1UH4A 4JG5A 5CEZE 3QIWB 1KEML 3HNTL 4K94C 1RP9A 3LH2H 5HHXH 1I1YB 1OWWA 4OZHA 3NPZB 5DVKA 4FXKA 3DX3A 3D5OF 2R2EB 5DD1H 2DEWX 1I9IL 4H5SB 3IFLL 4NNXB 4ZXBC 1ILSA 4OIIL 2JTYA 1L7IL 2EIEA 1OTUC 1JF1B 4HXAL 2NY5H 1SLXA 3H4HA 5GGVY 1P7KA 3ECQA 4KJQC 4TVPD 4U3XA 5F71A 4YLQT 2FLMA 5E56A 4NM8L 1OTTC 1UG9A 1UJ3A 2BOBA 4DTGL 2IJ0C 2A83A 5J1AB 4P3CH 3IRCA 1OOWA 1AIZA 2YA0A 3F6IA 3CMOH 4U6VH 1C1EL 2DM2A 5TDOB 1F6FB 2Z93B 4ZSOA 4O2FB 5I19H 1NDGA 3QZPA 3V0HA 4KVCL 3C60A 4PJ8B 5ADPL 4N2EA 1OAXH 4DAGL 4F93B 5DZ9A 4HK3J 3LQMA 1W80A 2BHUA 3FRUA 2ENQA 4IYKA 3WNJA 2R8SL 2ZUTA 1CZ8L 1FFPA 3L48A 2LQRA 1PZ5A 4CNIB 1YQVH 3KVPA 1T4WA 2RB8A 3RPKA 1UXSA 5F3BB 3IDNB 5CGYD 4DFHA 1CD0A 4JRYD 1UT1A 1AE6H 4AVIA 1AGDB 5DJXA 4G6AC 3EOTH 5DVMA 5E4IA 3ZTEA 4FNLL 4O2EB 4KU1A 5D2NA 5TK4A 3TNMB 5K39A 5AW1B 3QJZA 1QBLL 4MQ7A 5F7BA 2Y23A 4X6CF 1U8NA 1NINA 1DJWA 2I32A 3OKDA 3QH3A 1XGQA 5T33H 3C9NA 1JZFA 2VDKL 1NMCC 1WD8A 2OCFD 2F53B 1YEDA 2F53E 3G08A 3DGCR 2Z31D 3L4XA 3Q2WA 4MZIA 2JB5H 3EXLA 2X3CA 1E4JA 2FO4A 3AU0A 2W9LA 2VDKB 2EYRB 5LAXA 1T0MA 1WUZA 2ZNXA 3EO1B 1T6VN 2YBRA 3ESUF 1MEXH 3HG1E 2YAEA 4HKBB 4OH2A 5EIIB 5FDWA 1FDLH 2K3TA 3RWJB 3R4RA 1VA9A 2X4TB 3EJUA 4OJFL 4R84A 1PNDA 3NIGB 3NIGE 1NCAL 1Q9LA 3CVHA 3QWOA 4TQPA 2VM9A 2VISB 3SE8H 4BFIB 2BSRA 3KL3A 1G87A 3OJDA 1J5CA 4JO4L 4X6BA 2Z7WA 5DEJA 3BWUC 4XVTL 5FLVA 2BVEA 4P59H 1F58H 2X09A 4TUOB 4LKXB 4N2HA 5KJ4A 3HZMB 3HG3A 4PJCA 1JUFB 3RKDC 3NABH 4AJWA 4G9FB 5L4IA 3KMDA 4JY4B 4HS3B 1AQMA 4ES8A 3QDHA 4MD5A 1PLCA 5LDUA 3BFQG 1PCSA 4GMTH 2BY2A 4PIBA 3MA9H 2F7QA 3PNWA 4JFFB 2AK4A 4JFFE 1X5XA 4ODWA 1UZ6F 3FUIA 2YPLA 4KI5C 3LEYH 3S37H 1E5AA 4Y4KC 1DSFL 5DEFB 4PRDA 4APQA 3W57A 4MMYA 3V7AG 3FDWA 1I3GH 1HE8A 1T2QL 1XF4B 3MRBB 3OD3A 2J57A 2PP9A 4LKCB 2AS5M 2F1AA 2JCWA 2R0LH 4LB8A 3P3RA 4N3UA 1GYVA 4TL5A 3QDJA 1CLZH 1A7NL 1PBYA 3AG3B 3BLPX 5FO7A 3AXHA 2XXGA 5MERA 3MODL 4LDEB 1A1OA 1CIDA 4E5XA 2YSSB 4ZUVB 2IPUG 5CSBA 5TH2B 1FYTA 1SXAA 3QA3B 4NKQB 3QPXH 1PG7L 3VDAA 1RJLB 2WO3B 1DQQA 4GO8A 3U1SH 2YKKA 1S7RB 2OMUA 4OGQC 4RX4A 5F96H 4TRPL 1E5UI 2AJYH 4DPCX 5EF3A 3IAPA 2EIMB 4Z7OB 4Z7OE 1AXIB 1SYVA 2NY0C 4WKZA 2VKWA 4HF5H 3S88L 2ROYA 4FI8A 4HKXA 2WXFA 1HZHH 1Y18B 3CK0H 1E90A 5I24A 3NSJA 3IEAA 5LBVA 4QRUB 3IMRA 2GSMB 5HVHB 5LGKA 1JFQH 1D5BB 4GIPD 3FHAA 3ZO9A 2XU9A 1DL7H 1XCTA 3HZKB 4Z5RA 3VVVA 5BS0A 1VKXA 4JG1H 4CU7A 3V0VB 4OQTL 1ZLSL 3CH1A 2MHAA 3MRIB 4JPWL 5A2KH 1XIWA 4AM0Q 3KYMA 4S1DD 2W65A 3NVQA 1AGCB 1GIGH 2DBJA 2WLJA 3FN9A 4HU8A 3EGXA 1NC4A 3MLVL 5HHOD 4UM8B 2NY5C 3OB0K 2VDNB 3CZFA 2ZUWA 3S2CA 1UA6L 4BV1A 2ICES 1KTBA 3HE6B 2WXGA 3FH7A 3MCG1 3HC3L 4NYLB 1L9TA 2PR9A 4UDTA 1JTOA 1EZUA 5CLXA 1A47A 3VI3F 3TIEA 1LO4H 2BMKB 4PY8J 4S1QL 5D5ME 1XF2B 3D2UD 3HB3B 5AVRB 4GRWH 4A2DA 3JTBA 4NQDB 2IANB 3JV4B 4WEBH 4NQDE 5K9OB 2IANE 1A6ZB 3CPLB 1L5GA 3JVFC 4PB0H 3ILQD 2DD8H 4X4XA 2YWYA 4W4OC 3RKPA 2H0FA 2ENJA 4R4ND 1YAZA 3GRWA 4PCKA 1OP9A 5FWRA 4H8HA 3WNIA 5IJDC 2XG4A 4XXWA 3T4AB 3VGEA 1JS4A 4RMRA 2CLZA 3ISYA 4NWUH 4X98A 4ZX5A 5IJVA 3L13A 5D2LB 5I8CB 3BCFA 5D2LE 3C6LD 4FMKA 5CIPB 3PJSB 3B3BA 4BE5A 5BUAA 1E27A 1FSKC 3NH7H 5CR1A 3AY2A 5IK3B 5C07B 1JZ8A 2HYMA 5C07E 2FSEB 2CO6A 3MV8A 4C56B 4C56E 3EYFA 4ERSL 5J13C 3C6EA 1BQUA 3V0IA 2J1ZA 2A4ZA 2X10A 8FABB 3ZPDA 1R6VA 3RGVA 1AACA 4IRSD 3QI9D 4PSPA 3Q8EA 2CMRL 3P4MA 2VLJA 4OCWL 4EDWH 3I85A 4OLVH 1FV1B 1EMTH 4J4PD 3AITA 2OL3H 4H8QA 5HPMB 5CKGA 4BFFA 5ISZA 4IRJA 4I88A 4LVHB 5ID1A 3Q8CA 1JZ5A 3FQNB 3VSUA 5KVFH 3T2NL 4UV7L 1W72H 2X38A 3CBJB 4FC3E 3P4NA 4OUOA 1HXKA 1T04A 1OM3L 1BZ7B 2CJUL 1RK1B 2BVTA 4HWBA 3D4YA 3HZVA 1N59A 4I3RH 4J3OD 4K3HA 3FRPB 3SBWA 1XGTA 5IW1B 2C3GA 2PW1B 4LSTL 4K3DH 5EU4A 5ANMB 3MLTA 1J0KA 1P9MA 2AEOA 4XVJL 2L7QA 1KNOA 1U3HD 5C2BH 1GCFA 4HUMB 4PWKA 1U8PA 1ZV5A 3FF7A 5IWLA 3GHPA 2BNRD 1BZ9B 5D55A 4LLWA 1PQZB 1HX0A 4GKZB 3B6SB 3OBAA 4CL7A 2LU3A 3KHOA 5C0CA 5EZLA 4X5LA 1BQHG 3WUWG 5FB8A 1FL5B 2CBQA 5MEQA 2PPCA 3OKLB 3BJLA 1DBBH 4N85A 1OGTB 3AFLA 4F92B 1BZDA 2WQUA 3SOBH 5IEHA 4L1TA 2DM7A 4Q2ZA 3BPOB 4EF3A 2VM4A 3LDBC 2AEQL 1CDHA 2QVMA 3ZTJH 1UGKA 1IKFH 4LSVH 3WFEL 2IVFC 2Z6FA 4CGTA 4LMQE 1X5YA 5DJ0B 4FLRA 1RFDL 3NTCH 4RZCB 4XAWL 2XG5B 3ISWA 4XNQA 5ITBH 1SEBA 1JZIA 3QO0A 1XVSA 3CBKB 3KJ4C 4WI2A 2BOCB 1EEQA 2UZPA 1TJIH 4AE0A 1XEDA 3S3PA 3GSNH 1JZ7A 1FZOA 1SMOA 3P40A 3IE9A 1DUZB 4FFZA 4Q14A 4KXZH 1T21A 4PH8A 1U2CA 2B2XL 3KNBB 5DVOA 1Z32X 1D9KA 4YXKL 1BEYH 4TPRH 3V4PL 4D9LH 1RZPA 2WCPA 4RRPM 4BZYA 1F2XK 2CRMA 1XF5A 2XVBA 3DX7B 4BQ9A 3O4OC 3BVVA 4WWNA 3V4PB 4EI6B 4IMLA 4U4BA 4NN6B 3W82A 3T3ME 4PWJA 4NQQA 3BQVA 2GHZA 5CEZH 3DOSA 2LW3A 2EH7L 3HCVB 3FOMA 3LNIA 4U3SA 5F9OL 1AQ8A 1OM9A 3MN8A 2EXYD 3GMLB 3CFQA 4AV5A 3RGBA 5E8DL 4K9JA 1S7UA 4GI9A 2GCYA 1NCNA 5CMAB 1CN4A 4UQ9A 4TULH 3BW9B 2AJZA 1QFWL 4CMMB 4N8VG 2IBBA 2V9QA 1RKRA 4WENB 4YSDA 1K8IA 1YNTA 1WWBX 3VFMB 1LILA 1Z3RA 4WU5A 3S7GA 4YQXL 3LRSA 1NEZA 3TCTA 2FYVA 1CICA 2BVOB 3B34A 3LN4B 4QAMB 3C5ZB 3MTRA 3LIZH 3CHXA 1IQWL 3BGFC 1GS8A 4P5TD 4NC1E 3RTLA 4W9DC 2J88L 4PJXF 5EU5B 3KLDA 5C0FB 3OAYK 1RK0B 1BYOA 2BNUB 1H3VA 2FE0A 2EXWD 4OBSA 2DY2A 5KAQG 1WCBA 4NQEE 1ZVNA 1DEDA 1ZHLB 4B53A 1UB5A 1PLBA 5A3ID 3OX8A 5FECB 3SIKA 1MFVA 4KNUA 5HXMA 1Y0LB 3U25A 5FEBA 4HG4J 1A3LH 3OMZA 4XOAA 3WHXA 5J6HA 2JI3A 1YUHA 3RWGB 3WTYA 2GUYA 2NLJB 3FONA 4IIQA 4JW3A 4P5SA 2NXYB 3K71A 1KFGA 4JRYA 4LK4A 4S10A 4UINL 5GS3A 1EUTA 2RIKA 1MHPH 1WITA 1LEIB 2IIJA 2AQ3A 3EO9H 5J12B 3EFOA 1IBDA 5IBLD 1FG2A 4M43L 4DUXA 2YRPA 1CS6A 5FM4A 4Q7DA 4TTDC 3DBXA 1D5ZA 1ASQA 1G7PB 4JZJC 4XBMA 3IDIB 3VFSA 4LEOB 3LKNB 1C08B 5CN3A 2QGBA 2P47B 4IBQA 2QZ5A 2VERN 1YNLL 4ONOA 4V1DB 4V1DE 1IGFH 2Z31A 2X41A 5LG1A 4BFJA 4HUVB 4CC4C 1I8MB 4JFOA 3V8OA 2IEPA 3ARTA 5E6ID 4GUOA 4G80B 3MREB 3WTVA 2JCCB 2NT0A 2HTKD 1SOXA 1KFAL 3QFJD 4R90L 3QORB 4TQEL 1DFBL 3ARUA 2VIRA 3K72A 3UZQA 1ZLUK 1AGBB 1UZ8A 2QPSA 4XE5B 3DRTA 3GPSA 4X99A 5CM1A 3HKZA 2OTWA 1Z2KA 3OQRA 1GY1A 2YMXL 4M6NL 3SBQA 1IGJA 5F93C 3IU4L 3WKYA 1IEHA 3GGWA 4FQQB 3AY4A 3ARFD 4DKFH 2VDOB 3BP5A 1QKZL 5GRJH 4BSVA 5JHLL 5TF1H 3FQRA 2V17H 4UILH 2Z4QA 2HKFL 4CW1B 1AC6A 1YECL 1TU2A 4TVUA 1NCIA 5DD3H 4KZEH 5DWPA 1J10A 1YSOA 2J8UE 1I9RL 2X4NB 1DLHB 1VFBB 3I9GH 4EZLA 1TUPA 1W8EA 3ABLB 2FIRT 5I1DB 4A7QA 1BVKB 3GKZA 2PTVA 3N41B 3EDFA 1IFHL 3MO1B 1TCRB 4UANA 2VKXA 1PFCA 2CIKB 4OD2B 4RA0C 4H8WH 4JHUA 3TO2A 5IVNA 2I07B 5D1ZB 2IAMC 2L0DA 3GS0A 4G8IA 1RUAH 4NRXA 4WK2B 3C09B 1X5MA 2UY7A 2ADJA 2VERA 2Y24A 4G6FD 1LK3L 1XCWA 3UAFA 1QASA 1T83C 1WT5A 2JJUA 4UT9H 2E9BA 4XMPH 1NC2B 4EIUA 2SEBB 4WK0B 3S8GB 4BZ2A 3TZVB 2LT9A 5C0JA 2B1HH 2NPLX 5GSRA 1EGJA 3HS9A 3PP3H 3U0TB 3O8XC 4M1GH 4PJEB 3LS5L 4UBDC 5AKSA 4KXZI 4IK7A 4MZ2A 1AGEB 2DI7A 4OT1H 5CJOH 1MAJA 5IESL 2OZ4L 2TSBA 4XP9L 2N1KA 4X9HA 3T0ED 4HW6A 5K59F 2XQYA 2XY2A 5ACMA 1CD1A 3IPEA 3Q2NA 3CTTA 3MJ7A 3G6DH 4G72B 4LF3A 3FSZA 4B7LA 3TJHD 2YEZA 4G83A 4EVNA 3T6WA 2VLKB 3IMSA 2VLKE 1XX9C 1TO4A 1QACA 2AEPL 4HLZH 4JFED 4KJWC 1FL3A 3WNNA 5I66B 1H3PH 1GH7A 3ATAA 4JGNA 3PWPD 4MXVF 3RDTD 2JIXD 1JK9B 5F1NB 2IH1A 1JVOA 3HHRB 3QRFM 2CJ3A 1LVEA 1ZTMA 4HU2A 2QKIC 2ARWA 4ADIA 2CXGA 2DH3A 2OX5A 4HS6B 3KAAA 3PGCA 3WIHL 4L4VB 1V7ML 4L4VE 2DQFA 1T80A 2V5MA 2Z7ZA 1XEUA 4HIJA 4M29A 4BA0A 1QABA 2MOQA 3FCSB 5IB3B 1REIA 5DZLA 1CE1L 3SN6N 1CBJA 3D2UA 4MJ6B 1JPFB 2YA2A 3CXDH 1XZ0B 5IB2B 1WBZB 4GY4A 5I17B 2X9YA 3QHFL 4DIXA 3FFCD 2XWXA 3N9GH 3ZHNA 1FHNA 4NQXB 5PAZA 3QULB 1KPVB 3P77B 4I5BA 4NAJA 2DQEL 5L8LB 4GXUN 4J28A 1KOAA 1KGJA 1J5HA 3V6FA 4GUQA 2GKIA 1AXTL 2VWEC 3C6LA 5A6IA 4PIRF 1E4KC 4ELMF 1VEPA 3LMJL 1QQDA 4HUUA 1T6WA 3IGKA 4Z7UF 5C8JB 2F7PA 5AZEH 1NUFA 4C83A 1YPZB 3KZ8A 4KOCA 3AWGA 3BVNA 4YHLL 4ZMAT 4W6WB 3UABA 5I1AB 2PO6C 2OI9B 3VSVA 3LRLA 2NDGA 2EDXA 4MKTA 5E2TH 4AIZB 4RRPG 2AXFA 5CD3A 4AW7A 3DPBA 5TFSL 4IRSA 3QI9A 4APXA 3GHBH 2B39A 4E5XG 3FO1B 4BELD 3FNKA 1OB0A 4GMSL 3FUEA 4HSAC 1BZEA 2ZKXA 3WMQA 5BS0E 1IGIL 4J4PA 1JXDA 3WOVA 4AEHL 1AD0A 4XTRD 1T1ZB 3AADB 3BQUB 3BP4B 4HUCA 4FZ8L 1FNSH 4PW3A 5FV2A 3ZDZF 1V8HA 3I6KB 4X83A 3IDMB 5E8OA 3UTZB 1B4JL 5DURD 2VXUL 5F70A 3L7FB 1UXWA 3ZTCC 4OJYA 1RPKA 3AWFA 3RI5K 1M7IB 3NZSA 1NMCB 5I6KA 1A4JA 4I18B 3WAJA 1D6VL 2OPCA 4QXTA 4L05A 1CFVL 4MA1B 4N28A 4XWOD 3LKRA 2QL1A 4ORZC 3ZGHA 5EIQA 1U3HA 2JVUA 2XRAL 1UUNA 2H32H 2UY6A 4PRBA 1KCSH 3GIZL 3VI4B 2BNRA 3VI4E 2COQA 4M1DL 3RWEA 3VX1A 3CN1A 2IFFH 3MX0A 4GBXB 4Z78B 4YSCA 1A5FH 2O4EA 4AK2A 3QIUB 1MLBB 1SEQH 5DJAB 2V9TA 3RL2B 2R23A 3KLSA 4WI6A 4O51A 3MNDA 1CPUA 2BO0A 3NPSC 1ZT1A 2ISDA 5DA0B 4X7TA 1BXUA 2ADGA 3BO8B 2K9FB 4FQXB 1CLYH 4KTYA 2VXTH 4ABQA 1RJZA 1I7RA 5AAWA 1KYFA 3WNOA 5BRPA 5I2IB 4H8WC 4AYFA 2CRYA 3STBA 3SDXA 2ZAHA 3RDJA 4TNVK 3MRQB 5J3HC 1H3XA 2Q6WA 4QPEA 1KWKA 4Z76A 1HS6A 1U8HB 2ALAA 2XT1B 5DK0B 3MAWA 4NSKB 3SEPA 5DMKA 3LKPB 3EYUH 2VR8A 4XHQA 2EO7A 5GRVK 5E94B 4JHBA 4PU2A 1OAZH 2V2XB 3JUYA 3BSZH 1CI5A 1AZUA 2VLJE 3N0PB 1JGDA 3F84A 2YPKA 1J5OH 2KZWA 2JK5B 2WN2A 5IT2H 3SBRA 1AS7A 1FO0H 2ZWNA 4PR5B 3VWKD 3CFCH 5I8KL 4LHJB 4HFUH 4WZ9A 3T8VA 1NOAA 1ZANH 4YDKL 4PGDA 1K85A 3IMWA 4KK9D 4PMEA 5EUOB 4EXKA 1YMMB 5EUOE 5BZZA 5IJBC 4R7DA 4N87A 4P57A 1XGUB 2Y06L 5FO8B 3K3QA 4J5VA 4GG6A 2Q86A 2WUCL 4DVBB 3FS9A 3OKYA 3KCWA 3CBRA 3JV6B 2GIMA 5JQHC 3QQDA 3ZYJA 5I73B 1J1XL 1A4BA 4H8VA 2E7DA 2MCAA 1FLRH 5TE6H 3L17A 5ESAA 3T0AA 3NZUA 1ECYA 3BD3A 2QHRL 1MWOA 1GXEA 3O3AB 1JXJA 3QJHB 5E08L 3ARDD 3ZT7A 2WTRA 3QT2A 4P07A 1E28A 1XXFC 4AZ8B 2ETWA 4H25B 2DF3A 4U31A 3VWJB 3QEGH 4WI4A 1MFUA 3BE1H 4HV8A 3SYQA 3EXJA 3RPBA 4YBQC 2XWCA 1LD9B 4ZQKA 5B8CA 4PI0A 5INDA 3U30C 5E99H 3PYCA 1T5KA 4Y1AD 1ZGLB 1ED3B 1ZLDA 3LQAH 4HLEA 1F97A 3L8QA 2ZD0A 2ZYRA 3LH2L 5KJRH 3H53A 4P5TA 1RPUA 2I7OA 5H2BA 2J1KA 5K9JH 4GXVH 3PHOB 1S7SA 5CR8A 5DD1L 3LKOA 1IX2A 1MRDL 4LIQE 4ONHA 4JM2B 4QHMA 3TO4B 2NY5L 4HD5A 1WH0A 2P9RA 5EA0H 1M1XA 4GIOA 3D25B 4OUUA 2UZYB 3CSFA 1HHHB 5GZOD 3FSWA 4MYPA 5EU7E 3MCLH 3L2NA 2YSTA 3HNSH 4OB5L 4ZPVB 1TEFA 4XH2B 1NUGA 5GS2D 1H8NA 2V6HA 3MR9B 3ULVF 4B50A 3IETB 2PCPB 3DRQB 3CMOL 4KO5A 4OF5A 1KYUA 1UACH 4U6VL 5FAAA 4QTFA 5DJDB 4B41A 5JXEC 3MBXL 4AQ8C 3T3PB 2Q2LA 3MGTA 5I19L 5IB1A 3T3PE 4LGSB 3HAEH 3D52A 3B43A 1OAXL 4KH2A 2XOTA 1WWCA 3MJWA 3O11B 3WLBB 3T6XA 1Y1UA 1RSYA 3TNNB 2R59A 4XO4A 3K2IA 4EO5A 2WN3A 3APCA 2WAQA 4MMXA 1T89A 2YPVH 3E3QE 1MJ7H 1YQVL 4P5MB 1VESA 2DWEA 3GSOB 5C0AB 4C4BA 2E6QA 1AE6L 5E6IA 3QJUB 1IUZA 3EOTL 1KC5H 2V9RA 5CJXC 4A2MA 1I7UB 4ONFH 3K6SB 2EDWA 3LXCA 4G8FB 1II4E 1AQDA 2GI0A 3X3FL 2VSCA 5HY9B 4UM9D 3G04A 1JGLH 4WK4B 1JGEA 2BIIA 1YDPA 5DEGA 3TT1H 5T33L 4I1PA 4TVPE 4LVEA 3MJGX 5HDOA 3RPIA 3R19A 4UTAL 2GSIB 1BZQK 1MCOH 4MNHB 2DYRB 1TSHA 3G5VB 3RTQC 5JR1H 3ARFA 2CE6A 3P3SA 3OR6A 4OFQA 1SN0A 4MBRA 4ZZKA 2P24B 3O3EB 3MRJB 4JN2A 1TJGH 1FDLL 4OZGB 4PLJC 4PBXA 4OZGE 3E8UH 3CCHB 2E9GA 3VNYA 3RZCC 5I6XC 2GFBA 1S7XA 3BZ4A 5EZIL 2P8PA 5ICUA 2YJQA 1ZHKB 3D87B 3O3DA 3ZE0E 3SE8L 3VRJA 4G11A 3ZKQD 1KB3A 3NRQA 2FX8L 2WWMC 2Z91B 3ESPA 4TVSa 5HD8D 5HDBB 1GSMA 3CZKA 4P59L 3DO4A 1NEZG 1F58L 3LY6A 3POCA 4RDQG 5ICZA 4JRYE 1ZLWH 3WY1A 2CLVA 1PKQA 4AM0A 3NABL 3ELAT 6CGTA 4I7ZC 2XACC 4HJ0D 3H7BB 3RVXD 2J8HA 1HXMA 3BSHA 5L9DH 3C12A 2JJTA 2IV8A 3NRFA 4OFVA 3M6DA 5FR3A 4I48B 5DTFA 1QRND 4ZUTA 4GMTL 1JMZA 3IU3B 3UGEA 4GXUM 3ZIYA 2DIAA 5DZJA 1KN4H 2W80C 3LNDA 2ODHA 1FZJB 3F2LA 3SPVB 3RFRA 3VFRA 3LEYL 1PY0A 4LL1A 1SY6A 4ZUWA 2YD7A 4TNEA 3WJJA 1F18A 1G0XA 1I3GL 4WRLA 4D0DB 3KLLA 4ZMVA 5GGQH 8PAZA 2WO4A 3RWCA 4IBUA 3OKNB 1CLZL 4D0CB 1XH3A 4LVNC 3R1GH 5EPMA 4JFQB 2OYLA 2VC2B 4PYHA 1NFKA 4MA8H 4LRIC 3CVHH 4X5PA 4YUEH 2LAGB 1DQVA 3T0EA 3O2DA 4AK1A 3CFUA 3DUUA 3QPXL 1AC0A 5DMJB 3U1SL 2HFTA 3IMVA 2E0PA 4E0RB 3PGDA 2AJYL 3MBED 4JFEA 1R3LB 3W0WD 1ZWIB 2OK0H 4ZO9A 2X4UB 4YFEA 2BSTB 4JMNA 1SJEB 4KWUA 3GJEB 3PWPA 4HF5L 2JIXA 3RDTA 2VZTA 3APNA 2EDNA 3MLRH 3ECBA 4WEUD 3CK0L 2GJZA 4QXWA 3OGCB 1YY8B 2J12B 1RUQH 1RULL 1DDHA 3CC5B 1URZA 4W9CC 5GS0L 5BJTA 1TDQA 4HC1A 2UWEA 1JFQL 1VIWA 1BQLH 1J88A 1OAKH 2Q3AA 3MXVH 3O4OB 2BHYA 4OD3H 1DL7L 3LQAC 4O2CB 4A37A 4JG1L 1DQJA 4JPQA 1WGOA 5KN5B 3HTLX 2RBLA 5HGAB 2JB6A 2WKOF 1SDAB 4HUWA 3I75B 3EJYD 1CYGA 4BRVA 1CTOA 4P48A 2C9SA 3IF1A 3FFCA 2BP0A 2B15A 3WBDA 3WNPA 3IJ7A 4ZUSB 1NFAA 2BSDA 4DKEH 1BLNB 1Z7JA 3C5JB 3ME0B 4HWNA 2DWDA 3ETBJ 5IREA 3QUZD 4NHUB 3EZ8A 3GMMA 2RD0A 1RLWA 3RVUC 1R24A 1MFEH 3ARQA 4ZZFA 2K7QA 4P2YA 5DVPA 1LO4L 3QUXB 3V0WH 4DGUA 2P48B 3Q3GA 4WEBL 1E4WH 1P5VB 3LEVL 4N2DA 4Y4FD 2J2ZB 3BZFB 2A7BA 5LNGA 2AGJH 1NPJA 1Q38A 4DVRH 3VFOA 2NUPA 4PJIB 4PJIE 1JD9A 1IV8A 2DIJA 4GXFA 2JKTM 5B1BB 5AW9B 1HSBB 3SGEH 4ANUA 2XTJB 1E8XA 4NWUL 1O7DE 1A9EB 2Q9OA 5I0YA 3FTYA 3MV7B 4UUJB 3H2WA 3M7FB 3WU1A 2IFGA 1TF4A 2FJGB 4PGEB 4N6RB 2Z4TA 2C3VB 3DI2B 4OCSH 1QTYT 4BXSV 4DHLA 3DTUB 1T4KA 3WN5A 4N86A 3A6CL 1IM3D 3D69A 2IH9A 5FKPB 1JNHB 5AW8B 2EVFA 2A99A 2BINA 3BPCB 5B22A 5E5MB 2IGFH 3O2VH 2XQYG 5L88H 3JV0A 2H6UA 4EDWL 5LQBH 3IS1X 2K3HA 1PLGH 1U58B 4KXBA 5ALBH 3HBGA 2ED8A 1EMTL 4P2CG 4UWQB 1UJ3C 3QHZL 3QO1A 2VDPH 1SUHA 2FR4A 3V4VA 3AB0C 2RACA 4P2OB 3NAAH 2R4RH 3CH8A 4PJBB 5KVFL 3FTGA 1WVZA 1I3RA 3U46A 4G59C 2UYLB 4KRPB 5AL8A 3EH5B 3WS3B 4NCC2 4JDZA 2CWRA 3C60C 2KI6A 2HX7A 3GRWH 3NUKA 1KV3A 3FZUC 4MS8C 3VXPB 4I3RL 2H9GA 2ZF8A 3WI9A 3ZQ9A 2CO4A 4AT6B 5I30H 1IGCL 2KZBA 1AY1H 2QVKA 1RZGB 5KYWA 4FG6D 4K3DL 1PX4A 4Z7WA 1VACB 3F58H 3PABB 4ZTEA 4U6XA 3TGXA 2NRDA 4BK4A 4KY1H 2OM5A 2DIEA 4TOYH 4Z7NF 2H41A 1U8OA 3TFKD 4ZFGH 4GEIA 4OF0A 1B3IA 5D2NC 2QR0A 4LLUB 5EO9B 5ABAA 3STLB 3MXWH 2OTUA 4HIHB 5C0BB 2WSPA 1YEWA 2Q3XA 3DX9A 5I28A 2ZOOA 2O72A 2JKLA 3HOGA 1B90A 2OXGB 3AS3A 1MCPH 4B0MB 4M7JH 1BD2B 1BJ1J 3BIAX 4LPCA 4XPAH 3MU3A 1XH1A 1QI3A 1DBBL 2BVPB 2K8MA 1I9JL 4I0PD 2I5YH 2ZXCA 4ZOCA 3VWKA 3OXSA 1NLDH 2X9ZA 4JFYB 4G1EA 5EN2A 1R3KA 5BOJA 3TEYA 1I8UA 4PRNB 1XCQA 1UOLA 4JPVH 4YJZL 4E41B 1IKFL 4E41E 1UCBH 1JK8B 2JJVA 4JVWA 2IAMB 4EUPA 3HI1A 4YPGB 2E74C 2XYBA 2D7OA 1EDQA 4KX9A 5PCYA 2RCSH 3DMMB 3DXAB 5GSVB 2AQQA 5AZ2H 2HRGA 3DXAE 4R2GB 5ITBL 1RZ8A 3RL1A 4WFGE 4HWBH 3X12A 2C9QA 4ANVA 1TJIL 3LYRA 4MD4B 2CXKA 3GSNL 4W68A 3M1OA 2LFGA 3S36H 3FCTA 3BP6A 3LKSA 1OY3B 3FU7B 5DD6B 4QRTA 2FSDA 3RVTC 1KWGA 5IMKA 4DN3H 3SY6A 1BEYL 4TPRL 3WXWH 4D9LL 2BNRE 2M83A 1AGFA 2GBTA 5KW9L 2HLEB 3M46A 1E6OH 3VFTB 3JBG7 3G6JF 1TPXC 4QAWA 1PZSA 5EG6C 4HJ1A 3ZTDC 4W9IC 1VRSA 3ZK0A 4Y1AA 4J8RA 2Z65C 4FQLL 1XF3A 3H9HA 3F01A 3UAAA 1Y7VA 3WMPA 4JGJA 4HIXH 3UTPE 2HCZX 2MOGA 3SY0B 4R7VA 4WTWA 3BT0A 2XIDA 5FM5M 4UIMA 1DO6A 1VEMA 3PWVA 4UOQA 4APQC 5BPPA 1UKQA 2CGRH 5A2LH 4GT0A 2GBVA 1HNFA 4NLHA 2DTMH 4ZMWA 4LIQH 4G1MA 1IEAB 5GZOA 4D0BA 1SXZA 3V0FA 4GW5B 3HC0A 3K6OA 1OSYA 3BUPA 3WTSA 4U33A 4YX2H 3BLBA 5JIHA 3AAZA 3QCTH 4NO0D 3WS6A 4HUKB 5HGDA 3QEQD 1T1XB 2ZUVA 4P3DB 3F83A 5F89B 1E2VA 1YMHA 4FFZH 2Y0SA 4AYEC 4G8GB 1MJJB 3HI6H 2FVNA 1VADB 3MV9D 5ESVA 1VF5C 2D0HA 1E42A 1GTNA 2HB0A 5KSAD 3ENEA 5A6LA 3W39A 7CGTA 4WJG3 2HRLA 5D7JB 5D1QB 1A3LL 3QB7C 5D1QE 3SGEI 1ZIBA 1VSCA 1VFOA 4XNUH 5T1MA 2AEIT 4X6DA 5IMMA 2FRGP 1Y1DA 4LLYB 4ZW3A 3PQYB 4NO5B 4L1BA 3PQYE 4J3SA 1GHFL 3IB4A 1S9VA 1MHPL 4DFIA 2F6AA 3EO9L 5C86A 2JI1A 4Y7OC 1ASOA 5JW5A 2GC4C 1OSEA 1UD8A 1XIWC 3IBEA 3ILEA 5KSBB 4UM9A 4EXPX 5EZJA 3U1PA 4UDUA 4MNGB 5CSZA 1A1NA 1G7MB 1QSEB 1U3NA 1NGQH 1QSEE 3OKKB 4KVNH 4TVPH 4Q6IB 1UWXH 3SDCD 4XAKD 3ZKNC 4QYOB 5F3HB 3MUGA 1ETB1 3QXUA 4XCNA 1Q1PA 5I75B 4TSBL 2QDWA 2DMGA 3MRFB 4XMKH 3KHQA 5H4ZA 3DROA 1J48A 3NFPA 5DUPH 4L0YA 1IM9D 4Y19B 1F41A 4N2FA 2D3LA 4Y19E 4QD2E 1HILB 5IQLA 3ZKSD 3L5WA 3PP4H 4QLRA 1CFNB 1XFPA 2KZ1B 2RQ8A 3NJFA 1LJMA 5FKAB 1MDTA 1QUNA 43C9A 1A7RH 1MFDL 3N6YA 3OR7B 3U36B 1U95B 2CGYA 1J8HB 5JA9A 4UOW0 4DKFL 1KUMA 2UXVA 5IEKB 1A3ZA 4XXWC 5GRJL 4MSWB 5TF1L 4AMKH 1PZAA 2V17L 4OZIF 4FQHA 2J6WA 4QJ4B 5I8OH 5KJ7E 4G3YH 1F56A 5JPMA 1OP5H 3BISA 4PG9A 4KZEL 2YBGA 2A38A 3V7AE 3KPNB 4IHOA 2Y69B 4B27A 2H45A 1QRNA 2X4RA 3I9GL 5FA4B 4F2MA 3IDYC 4PJFB 5HYSA 3TV3H 3K1DA 1ITBB 4NM4H 4PJFE 4U2ZA 1JHTB 1XCXA 4XCCH 5EC1A 1ETJA 4YVUA 3RGVC 3MJ9A 4EN3D 2I9LB 2HJFB 3PWUB 2Y25A 1YEFH 3OAUL 4H8WL 1UH2A 2J72A 5HHQB 1DE4B 4RNRB 1T0NA 4OJEH 2EACA 3MNVB 5C71A 2DAVA 3RU8H 5FM5O 1RUAL 4YDVB 3ZVVA 4GAJH 1CLCA 5IFAH 4IRJC 4ZYKB 3NFNA 1QVOB 4LPUA 3QZLA 3QUKA 4F7PB 2BWDA 3QS2A 5MI0B 1GGYA 3DX8A 4LL4A 4GKSB 4XMPL 1YYCA 1E5YA 1ET8A 2A1WH 2X6MA 3L2LA 3CFKA 2VLME 3KPQB 4HXBH 4PD4K 2WXKA 3QDMB 1B0RB 3QDME 2CUIA 3SSGA 3S9DB 3NJIA 3MBEA 1U91A 3DVNB 3SBWC 3W0WA 3BAXA 4M1GL 2QLVB 1F3DJ 3UAJD 1OQXA 4ISVB 1FCCA 3BKCH 1P9MC 3AT9A 4OT1L 5CJOL 3LHPH 4IOIB 4IS6B 2WYZA 1MW0A 4I13B 5C97A 1JYWA 1C5DA 1W0VA 3WJMB 1BVNT 5LGYA 5IWLC 4POYA 5F9WB 3ZKMC 4ETYA 4JHVA 4B9JA 4DKAA 2X53A 1CGUA 4LASL 5EUKB 4S1RL 2QMKA 4MAYD 1MCSA 3G6DL 3IDGB 4MDJA 3ZU8A 1CK0H 1WRFA 3FW6A 2YFOA 1G5AA 4NZ8A 4WW2B 3GB7B 4NZFA 1ZSHA 2X3AA 2KC0A 4DETA 4IGBB 5BRZB 5IB4A 3VE0B 4KHTL 3ZSSA 1H3PL 5BRZE 4M61A 3T65B 2IDCA 3LB6C 4AL8H 4NRYB 2BP8A 5DRNA 1NIAA 3F7PC 2Y3AA 5CWSA 4QOKD 2WMPA 2NTFB 3DIFA 4FS0A 2GITA 4UQDA 3QUZA 5DU7A 4LOUD 2NCMA 4BFGA 3D3VE 3CXHK 4FNUA 1PX3A 4RBPH 5EU7C 1QA9B 5F9JA 5MEOA 1NKOA 1RURH 5KYYB 2VXVH 4BZ2H 1NEPA 4IEFA 5F6HJ 1DN0B 3NCBB 5B21A 1NCOA 5D7KE 1EGJH 3OMAB 2B59B 1RY7B 4OJAA 1EEYB 4XNXH 1EV2E 4Y4FA 5IIEB 1GVIA 2PPFA 2WBKA 2X2IA 4DZBB 4PHXA 3N9GL 1LP9B 1D9KC 2AABH 1LP9E 4IKIA 1SXNA 4JPIA 5GJTH 4EI5D 1AFVH 4JHAH 1HC1A 1TQTA 3CFJA 25C8H 4WDIA 4YDLC 4CJ0A 1X7QB 5TQ0H 2NY1C 1VFAA 2AI0H 3E3QC 2DQTL 1MW2A 1R3JB 3M17A 4KROD 1THAA 2F9BT 2ATKB 2P4AB 3IRZA 5AZEL 1SHSA 1H8SA 4FKKA 2DMCA 4H13C 4U0RB 4ZPTA 4BH7B 5LG6A 5CHNA 3X13B 3ULUE 1D7BA 1IM3A 4AUYA 5DDHB 5E2TL 3SOTA 2FTAA 5F72S 2NW3A 4GAYB 2Y2WA 4OF8A 3IFPA 3JSSA 4PBVC 2W9EH 1QLFB 4JQXA 5KUKA 5KYXB 1CICC 3QNYB 2DJUA 5C0DB 2FK9A 4U1NB 4RIRB 5EBLB 3ZZSA 2YQGA 3L95A 4M8QA 3MRHA 2C8NA 3KW7A 1AIFB 1FNSL 2E7HA 2ICCA 4ONGH 2XBTA 3CDGB 3EHBB 1JOIA 2JF1A 5I6PA 1S6NA 3I6GA 2WBJD 2HRPH 2IH3A 1KBVA 2CJTA 4TXVB 2XKNA 4QJ3B 4OGAD 4R96A 3SE6A 5CSGA 1ZOXA 4P2RB 1INQB 3BYYA 4JE0A 3DV6B 1TZHA 1X9RA 4LOVA 4BRJA 5MEPA 5JHDD 3WUWB 1JJUA 3TIDB 1F8TH 3KWUA 1W9XA 4X9BA 1N4XH 3CFDA 3PUCA 4IIQC 5CGYC 3T5WA 3UG4A 5F88B 3VGAC 3ZRFC 2C7UB 3O6KH 5AOMA 4IQHA 1LEKB 1RMFH 1KCSL 5ALCL 5ECJE 2IDSA 4GINA 3MLZH 2RAMA 4I8DA 4FXGB 2KUTA 3RZCB 1FAIH 4BSWB 5I6XB 4ALAH 4X5WB 5E8EB 2FBJH 4PREA 1A5FL 3BUIA 4U1KA 1WAAF 3GBEA 1I53A 5AALA 4DPRA 3H2QA 3MA7B 1NMBH 1SEQL 4UB0H 3T8XB 2CAKA 4LCWE 5AKVA 4UT7H 1A14H 3FO9B 4CA4A 4NEHB 1TQCC 3Q06A 3LKQA 4WNQB 2Z31C 4I0PA 3QQNA 1CLYL 3QUHA 4QCIA 3SDDB 2VXTL 3U0PB 1CXKA 4PV8A 4KKRA 4GS7B 3B2PA 1CXLA 3BZDA 2NZ9D 3D39B 1E3XA 3D39E 1URLA 3CZSA 1RERA 3C8KB 3VD1A 3EYUL 2XV3A 2YGNA 3VFUA 1OAZL 1JWMB 4MX7B 1EANA 2EICA 2UXTA 4PPTA 3AQZA 3BWZA 4WJKB 3HJ0A 4WO0A 1D7DA 1S5IH 4J3OH 4DESA 1J5OL 1RHHA 1FO0L 3CFCL 4Q52A 4XWGL 2PTTA 1Y6KR 3AY4C 4HFUL 1G94A 5IV2B 2OSLB 1A7BA 2W0FA 4DNLA 1PZUB 1ZK5A 4UQ2A 5JIPA 3UTSD 1YG9A 4CVZB 1I8KB 5D7LB 5AUMA 3U9WA 4N8VB 5D7LE 7TAAA 2VSKB 1KG0A 1FLRL 5TE6L 4TV3A 4E9XA 1IC5H 3EDKA 3S3SA 2UZXB 4TF4A 4BQ6A 1FZMA 1XH2A 1RIUH 4LSPH 5FIEA 2BCMA 1BAGA 1XR8A 2WD0A 3ARVA 2I60L 4XCEA 4EKXA 4GQZA 4BK8A 3QEGL 3D0VA 5L7XH 1KJ2B 1VFUA 2NY4B 4E9SA 3ZL4H 2PYEB 2DKMA 5G55A 3NIDE 2PYEE 4MYWB 4AL8C 2CJSA 5D4QA 2VT0A 5E99L 4V11A 3POHA 3RUGB 4B95C 1T7YA 4OKVA 3RUGE 2IDTA 2X0WA 4F58L 4HWZA 1ACXA 2HN7B 2M8XA 3GXNA 5KYUA 5KJRL 3LV3A 5LDSA 3ASNB 1WT5C 3TA3B 2DKUA 1L9NA 4BYHA 2O5NA 4NO0A 1NGWA 1S3KH 2NX5D 2Y4SA 3ZRSA 1A0QH 1AJ7H 1ET7A 1P7BA 1JN6A 3QEQA 5DSCA 3GSUA 4WHTA 3ZDYB 4Z7VA 5TGBB 3ZDYE 1GRWA 2YAQA 3G7TA 4YGAB 1IJ9A 1AP2A 5DD5H 3MV9A 1KXVA 4NUGH 1PYWB 3LNGA 4G7QB 1HDMA 5EA0L 5FLUA 2FL5A 3VGDA 1SFHA 2ZWSA 2APWA 3O3BB 5KSAA 4RWHA 2UZIH 4NKOB 5C7ZA 5IF0A 2P8LB 5BVJB 1OTTD 3SQBA 4HJUA 1EFQA 1EHKB 4NN5C 4QNPE 3PV6B 4H88H 1TTCA 1UACL 1F3JB 4OCYL 1ZTXH 3V6OE 4AXWA 3QJOA 4IU2B 4PJ7A 4LSUH 2VUYA 1O7SA 1MI5E 2WPGA 3K8KA 1H8OA 5FK9A 1KPRB 32C2B 3N3EA 2DLFH 3T6ZA 2D0GA 1EO8L 3NA9H 5AB2A 4S1DC 1NCUA 3W56A 2GTQA 3A5VA 2VDMH 2YPVL 5KZCD 1MJ7L 3SDCA 2FQEA 1FNEB 1X7TA 4WWKB 4L48A 4XHJD 4Y2NA 1SJXA 3VD4A 4U1SA 2D73A 4HULB 5H94B 5CEXB 1KC5L 4ZNEE 3MTXA 2HFEB 1IM9A 1I7TB 4MA7L 2AK1L 3NGBB 4HX1A 2IO5A 3DDGA 3GLDA 1N5YL 3IRPX 4ZODA 4URTB 3GMQA 5EFIA 3SB3A 3DI3B 5DJZA 1JGLL 4HHAB 4FXKB 1SYSB 2WNGA 3ILQC 2WXIA 5FUCC 1M71A 1Q4NX 2PW2B 1MCOL 4R4NC 2F5BH 4GFXA 1C12A 1WBXB 5FYJD 3T2PA 2OBGA 1O6SB 4YK4C 1KCRL 5TJWK 2XN0A 5M95B 2FD6H 1GGIH 4PJGF 4YDJA 1TJGL 4DK6A 3VD3A 2VW4A 3C6LC 3CFIC 3E8UL 1IC4L 3RGHA 3TBBA 4A1RA 2YLKA 2HMID 1B4RA 3GMPA 1IBYA 1LO3H 4RMSA 2Y5QA 3LD8B 1XF1A 4N0CD 5MEND 3IK2A 3UYOD 1NSNH 1X5LA 3A24A 4P04A 4Y9CA 1G1KA 3ZE2F 2ZTBA 1JHKH 3IGAA 3O4LD 4PJHF 3H9ZA 2J7LA 4ALAC 1U8JA 1W0WA 4TL4A 5KBNC 2QZQA 5KTEH 4MJID 1U93A 2MQ0A 1WZAA 4BFRA 3UTTD 4W4NA 4IRSC 3QI9C 4EN3A 1JDDA 3FFDB 5J6GB 3PF2A 4YHOH 1VGKA 1JYVA 3EYSH 1UXSB 3L16A 4J4PC 5D7IA 5L9DL 1I1FB 4N2CA 3MGOA 4GI8A 5JXAH 5KOMC 1ZSDB 3MI6A 4UIKH 1WS8A 2XKSA 2IAAC 2WSDA 4BE6A 5F7EH 1KN4L 1HQ4A 2XBDA 2XWDA 3L7EB 4JKWA 4YE4H 2J4WH 5C09D 2K0RA 2ZX8A 1MCQA 3TBTB 1WAPA 2JKXA 5IBTH 4ECNA 2AC0A 2FO1A 1GW0A 5DHEA 4NQCB 1YN6A 4KRNA 4J3OC 4L8SB 1S8DB 4LLVB 5E70A 5TPWH 1J9SA 3D51A 5CCGE 4YC2B 3UAJA 5GGQL 1MHCB 2D31B 4HMEA 3G3LA 3UJIH 4YEFA 3R1GL 4K5PA 2W0KA 5GZND 1U3HC 1OLZA 1Z9PA 2EUVA 2EEDA 3T6VA 2YBRB 4MA8L 3QFDB 3KLAB 4YUEL 5E9DB 2VJXA 1E6JH 2IG2H 1ONQA 4XN5A 5SWZD 1HINL 3FUHA 3FB7B 2P26A 4HAKA 1T1YB 4NBYB 1GW6A 4LP8A 4MAYA 4X6CB 4X6CE 3IDUA 2BERA 3WKPA 4XNDA 3QWOB 3L5HA 3X1GA 3WGUB 4P2QD 5BQ7B 4E9TA 2GBUA 5EO1A 3F64A<