5F2FA

Crystal structure of para-biphenyl-2-methyl-3', 5' di-methyl amide mannoside bound to fimh lectin domain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
158
structure length
157
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein FimH
publication title Antivirulence Isoquinolone Mannosides: Optimization of the Biaryl Aglycone for FimH Lectin Binding Affinity and Efficacy in the Treatment of Chronic UTI.
pubmed doi rcsb
source organism Escherichia coli j96
molecule tags Sugar binding protein
total genus 34
structure length 157
sequence length 158
ec nomenclature
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 5f2fA00
4XOEA 4XO9A 4XOBA 4J3OF 1UWFA 4AV4A 2XG4B 4X5PA 3SQBB 2J2ZB 5FLUA 4AVHA 3ME0B 4J3OG 4AUUA 3RFZA 4X50A 4ATTA 4CA4A 2UY7B 2XG5B 4AUJA 4AV0A 3BWUF 4X5QA 4XODA 3MCYA 3ZL1A 5AB1A 1QUNB 5ABZA 1KIUB 4CSTA 3ZPDA 5IQMA 5F3FA 5LNEA 3ZL2A 4XOCA 1N0LB 4AVKA 3JWNE 5CGBA 4XO8A 2W07B 3BFQG 1PDKB 5IQOA 1N12A 5IQNA 5AAPA 5F2FA 3BFWA 4BUQA 5JQIB 3JWNH 5AALA 2WMPB 4LOVA 4XOAA 2JMRA 2UY6B 1KLFB 5LNGA 4AUYA 5FWRA 1TR7A 4AVJA 1ZE3H 4AV5A 4X5RA 4AVIA 4CSSA 4J3OH 5FS5A 3JWNG 5FX3A 2JTYA 2VCOA
chains in the Genus database with same CATH superfamily
2QADC 1BVKB 4A6YH 1DLHA 2YGPA 5CUSL 4J8RB 4P2QA 1U9KA 4NI3A 2DQFB 2YAMA 5ESAB 2HTLC 3U7WH 2EVGA 3WDIA 4RMUA 3FFCE 2WLYA 3T65A 4P8QA 4IOSD 5AVVB 2VLKB 3O2VL 1T5KA 3QDJD 4GKZA 4GFXA 4JN1L 4MZ3A 3MHZA 1KC5L 2QQLH 1BYOA 3IJ8A 1HEJC 2LE9A 2G4GA 3EGXA 4ILDA 5F7YC 5AVUB 2DM4A 4JR9H 4FQXB 5A2FA 4PJXF 4AGQA 4P23B 1OSZA 2C1PA 2QSCL 4PPTA 3U30C 5IMLB 1F4XH 3SKJH 3MR9B 2H0FA 4PWJA 4MDJB 1JPTH 2VZUA 3QZWA 4F27A 2X4RB 3DRTA 3DHMA 4LLQA 4F8NA 2ZYRA 3INOA 1Z5LB 5HI3C 4ZMLA 2AAAA 2YMOA 1LO0H 3K4DA 2PWDA 2BOLA 3WFHB 3ZQ9A 2ATPB 4V11A 4ZT1A 3U0WH 2BP3A 4NAQA 1XF3A 3J7HA 4NS0A 3GLAA 3QI9C 5G4NA 4LO9A 3H0TB 4YZWA 3BX7C 4H2CA 2BSTA 3WIFA 4F37F 5TDOB 1XIWD 1FL5B 1RZ8B 2ERJC 3JWNE 2XA8L 4R97B 4TS6A 2LABA 1OGAE 4ICXA 1T0OA 5C3IA 2PPEA 5AL8A 3CVBA 4YWGH 2NNRA 1BD2E 1X5HA 3D2UD 4LMQE 1PZCA 1R75A 3B9EA 4IOIA 1MAKA 3DPBB 1BG1A 1A4BA 1XDTT 5JXAH 2BZ7A 3VXNB 2C9QA 3V6OA 2JELH 5F2FA 4Y4KA 1SXSA 3B7YA 2NX5B 3DDFA 3O4LE 4Z78A 2ZCLL 4OUUB 3ETBF 3LKSB 1DJGA 2BDNH 3EYVA 5JPNB 2VMDA 4FXGA 1OEZW 2YLKA 1KXHA 3FQXB 3WKMH 4YPGA 1NCDL 4JVUA 2EUZA 5DO2C 3QO1B 1L3NA 5I8EB 4OZIE 3DX9B 1RUKH 4P57A 1QBBA 4F9PA 3ISYA 1HCZA 2IOOA 5FK9B 1HQRA 1CU4H 2D9CA 5E8DL 3KH4A 1ET8A 2WYZA 3HG4A 2F58H 4GUPB 3O9WC 1W9XA 1A3LL 1XO8A 3L4YA 4PJAE 2DLHA 1UT9A 3F6JA 1I7RA 2OTPA 2GT9A 5HYJA 1T66C 4X4ME 5E03A 2RFXB 1J05B 2E75C 3JBG7 1AR2A 4GXUN 3RZCA 1S9VA 4N8PA 2H0PA 3MCG1 4GT7A 1OCZB 3SDDB 4TOYH 5IKCB 2K70A 3B56A 4U0RB 1VFAA 2BRQA 3L1GA 3N40P 1ADQA 4IKLA 4WUUB 1QKZH 1NAMH 4UQ2A 2V7HB 3B3BA 3O0RL 1TJGL 2PABA 4PJDB 2LW3A 4KPHL 2B3RA 3GMMA 3ULVF 4XNYL 2DIAA 3UYOD 4LCWA 1S7SB 3MMEB 1NCBH 5FGSA 3WSQH 2XPZA 1QW8A 1PZ2A 1LDSA 4ZUWB 3FO0H 3OKDB 1R5VB 4ZXBB 2PR4L 3NBNA 2GJ6B 2CO3A 2OL3A 3KYAA 3A0OA 3VXOB 8PAZA 4XPBH 5C6PB 4L4TD 3T4YA 1QSFA 2XJKA 4KVPA 3L3OA 2P7TB 1CE6A 3E3QE 4JY5L 4NN7B 1B2WL 3OKNA 1KBPA 2R2HB 4L8SB 3FU7A 1Y1UA 3ASOB 4R83A 2G75B 3HZ3A 4AEIH 1YEIL 2FD6H 1YEHH 1BZ9A 4H0IA 1BZOA 4L37B 1LO3L 3T0EE 1KXTA 4WW1B 3MJ7A 1HSBA 1N2RB 1VFBB 3OZLA 3GT6A 5C0DB 1R0AL 1P6WA 1RIUL 4R5XA 1KIRB 3OGOE 3NJFA 5I5IA 5CZKA 4HFUL 2WZPA 3BKMH 2ARJA 4KQ3H 2Y1ZA 3LXCA 4JRXE 4A2MA 3BHBA 3WDHA 3ZMNA 5D2LA 3IXTA 4E5XA 1LLAA 4FFYA 1HI6A 2HG5A 1PZAA 1IBFA 5I9QC 4GAGL 5T33L 1PZ3A 2K78A 1JTTA 3HZVA 5CJBA 4UZGA 4G6AC 4P5TB 4X4XB 1MJJA 4QNPF 3VGBA 3BT2H 3IK2A 9CGTA 2EEAA 3DUSA 2X1XR 3T8XA 3TNMA 4ICWA 5B39A 2VRKA 3K6DA 3TFKD 3ULUE 1F02I 2HJFB 5IWLC 3EH5B 5F89A 4CN4A 4JO3L 1FG2B 3MBEA 2F19L 3SGJA 1E4JA 3ABGA 3C6LA 3D4YA 4IBZA 4KRPB 2CPUA 4P5MB 2EDWA 1I75A 5F9OL 2ADJA 4LNRA 1G7IB 1OAXL 3BD4A 4MMZB 4PRPD 4CW1A 4ZX6A 2EXSA 1CLZH 4LASH 1QPPA 5D7KD 3MBXH 2AJZB 1OGPA 3RY6A 4H26A 2HT3D 3GSXB 3HW7A 4Y16D 2Z8WC 4YDVB 3VXRE 5D4JA 2FNWA 2DQGL 3CUPA 1NTDA 1WH0A 1CD1A 2ESVB 4NRZA 5LAXA 3HHSA 2GI0A 1ORQB 4JLRA 2QADD 2JIXB 4PP2A 5B8CA 1XGUA 3CLWA 5L9DH 2OTWA 4X9YA 3TCXA 3MTXA 1E5UI 3JV4A 4ZX4A 2AMGA 2VXQH 3EAKA 2AEQL 1JZ8A 5F21B 3QEQE 4N0YH 1KYDA 5EBLB 3L7FA 2VSMB 3GZOA 4WFGD 4EOWH 1ZAGA 4ZZKA 5EZLB 1HHGA 3JZ7A 1YECL 2A9DA 2P24B 4GKSA 5LQBL 3FU0A 3PP3H 1HL4A 1NFDB 3KPRE 2L7QA 5ICXA 3WTVA 3UJJH 3FH8A 4DH2A 3LJ3A 4L3FA 3TZVC 4RBPK 3D30A 2O6DA 4QXWA 3M86A 5B1BB 1TFHA 2WWKO 2QR0A 4QRSB 1PFCA 3KJ4B 4RVBA 4YIQB 4BHUI 4F33A 2CJUH 5AL0A 2K0RA 5EU3A 3RWHA 1C16A 4LP4A 4U6HB 3V5KB 1DBBL 3QS3A 1NOLA 3S3DB 2XFGB 3QUZA 4FQ1H 3QHZH 4GKNB 4M8RA 4ODHL 4MCZA 1RLBA 2B9AA 3HUJA 1EAQA 1ZLDA 4A7GA 3DTUB 4M5SA 3ZE1E 1N6VA 2YD2A 3P0YH 4LGRB 3HHMA 2XIBA 4W6YB 3QI9D 4LP5A 5CWSB 1RSFA 3Q1EA 5EBGA 5F3FA 3ATAA 5F9JA 2VDNB 4QTIL 5K39A 3SBWC 5I75B 4NKIH 2EP6A 5LNEA 4JRYB 3H1ZA 5G4MA 1FNGB 3WXVH 1NBCA 2ZOTA 1T5XB 5GSVB 3VXSA 3HNVH 3UCRA 2NUPB 4LSSL 5D5MB 3R8BB 5HYIA 4JPWH 4N0UB 1UATA 3D0LB 5HGGS 1S6NA 4UNIA 3H9YA 3CE1A 2YRZA 2BFGA 3KWWB 4OZFB 4JDZB 1WV7T 3MRNB 4P3WA 1N0XL 4PTUA 4QY8A 3US1A 3OR7B 4XMPL 2JKLA 1MRDL 4PR5B 1XAKA 4LVNB 1NEPA 3IN0A 3RGVB 4FQCL 4K3JL 3R7QA 4QRRE 3H56A 3KCPA 3A4FA 3TBYA 4U6YA 4DKFL 4JQXC 2V5TA 4KMTH 4R4FL 4OV5A 3GSNB 4J39A 2VDKL 3SDYH 2ZSWA 1YG9A 3QG6B 4XNZB 3P77B 5A2CA 2ZSVB 1OANA 2FYYB 3OC8A 1UWEH 5HI5D 4HEPA 3L3HB 2DM3A 3QISA 3QPXL 4DTGH 4LXFA 3O9WD 1ZA6A 2UUDK 4L4VA 3RWEB 4IQHA 3WHE0 5MP6L 1G4RA 2CUAA 4XRCA 1T66D 2K45A 4GNKB 2JKXA 2ADIB 4ZSOE 5LBSL 5IT2L 3VGGA 1D5IL 1UB6B 3DXAB 3QB7C 3OR6B 1FBIL 3W39B 2XWZA 1DVFB 3B7TA 3KWUA 1VACA 2KZWA 1UH3A 1JTOA 1OT2A 4JBSA 1GPOH 3WLWC 5EB9A 1X5KA 2J44A 3M1BA 3ULUL 1MZYA 1UZGA 2OR8A 2BW4A 1URLA 2VERA 4XOEA 1OF0A 2ID5A 2QTVA 5DJDA 3SCMB 5BNXD 2VDRL 4KJWD 3I9AA 5M7QA 4LHUB 1F3JA 4MRBA 4W68A 2DLGA 3PL6B 5JOFB 2OJZH 3FB7B 5E5MA 1T1XA 5J57B 1J18A 1ZD6A 2FQFA 4FNLH 4MXVE 5IHUH 2H45A 4YQXL 3LPWA 1QR1A 4D3CH 2XUWA 1UENA 4LSTH 1ZLWK 2ALWA 2YD0A 3NRPA 2ADFH 3VD7A 3T3PF 5CEXA 4K9JA 1L0QA 2IBZX 1MHHB 1HXMB 5D55A 4FTVB 4P05A 1LEGA 2FHFA 4ATTA 5CCJA 5I71B 3TEYA 4NUGL 4QXVA 4QT5A 3H54A 3VXUD 3VRJB 1QYGL 4J3BA 4WKXA 4UTBH 1TCRA 3H3BC 1UWXH 1ZHLA 3FQUB 3G08B 3O8XB 4YHOH 5IESL 4OD3H 5HGBB 3WO3B 2YGOA 1AO7B 4LNVA 5HHOD 3IGKA 1HYSC 1PVHA 5JW5B 3GK8L 1ETZB 3ZUCA 2QHRL 4KKAC 2ITCB 2H0JA 3HNSL 4TSBL 3S37L 4KJYB 1CE1L 5AVXB 3SPHA 2AKRA 1ZY9A 1PQZB 5JHBA 5EOCL 2J5WA 4ADJA 2VZ3A 2WLJA 3DV6A 3W9DA 2EEFA 2WKLA 4JZOA 1TYEB 2EAEA 4YK4C 5IOPA 4TLTA 2R29L 1CLYH 2V7NB 1EUTA 4N6RA 2F53E 2FYVA 3H9HA 1DQQB 2OTUA 5C0JA 4FQQA 2JVUA 3P3UA 4F7TB 4FG2A 2H32A 4G6AD 4YHNA 4ZFFB 1XFPA 4P4KA 3EZJB 3ARTA 2FDBP 3JWDL 1AMYA 1GCFA 1KXQA 1SVCP 2BXZA 1EA9C 1KB5L 3TA3C 1S7XA 3DJZA 4OLVH 1MCSA 4M00A 3HG0A 2PXYA 3ZZQA 4ZUUB 4JHWH 4WHTB 5AALA 3WFZA 2HSIA 1MFMA 1XXFC 3OMNB 3QNZB 4JJ5B 1NEZA 2VQUA 3BVNA 4Y4HB 4LLDB 4Z7UE 2MCPL 1RJYA 2G5RA 4NKMB 5FWRA 1ET5A 1IGCL 3TH2T 5C07E 4ZNEE 4F2EA 1EXHA 3H55A 1ZHKB 4CBZA 3FRPB 5B22A 4IMKC 4UUJA 1OAYH 4RH4A 3EYUH 3QNYA 8FABB 3LXUX 5DJAA 2P52A 1S7RB 3S96A 1GXEA 2P8LA 4FTDA 5IVXE 2GHWB 4GAYB 3TBVA 1UJ3B 2GSIA 2F5AL 4JO4H 1UXWA 1T3FB 1WGVA 1W8EA 1AXSA 3W57A 1MNUH 2WTOA 2XZCH 5ACZA 2H7WA 5L2KE 3ARVA 4AQ1B 4DP4X 4OCYL 3WFEL 3WD5H 4WI9A 3RRQA 4E5XG 1UGNA 5CSBA 5CJ5A 5KSBB 3P4MA 3RBSA 2VLMD 2VDOB 3GXTA 3O6LH 3RILA 3IVKB 1T7ZA 5T5FA 3WMQA 3GIZH 1KY7A 1I1FB 4HUVB 3L4ZA 1OAZH 2WLLA 3I9GH 2APFA 4LSPL 3BEVB 1TFPA 3RHWK 4ZAKC 3BQUA 4HUWB 4H0HB 4Z3HA 5JO5A 3BXNB 1H19A 1E5BA 1NQBA 5CZRA 1G9NH 5IFJA 4P9HH 1BP3B 4F2FA 1S7VB 1CQYA 3KGUA 5DD0L 2G3NA 4RFNB 3RDTC 3B5HA 4QRAA 2AQ1A 3ZXAC 2MIZA 1AQDB 3D39D 4UQ3A 3U2JA 1R34A 2C3XA 1SN2A 2E7MA 3QUXC 4Y1AB 3AY4C 1S7QB 4OD2B 1L5GA 5GGQH 4R96A 1L7TH 4R90L 1FSKC 2GQHA 2N3JA 4GMSL 4V2BA 5JQ6H 4U1KB 3MV8E 3WN5B 1TNMA 3BAWA 4TYUA 2HX7A 3IFOB 2Y7SA 2BP0B 2IFFL 3MROA 3IDGA 1FRGL 1GZPA 1DLHB 3KPSA 3OG6B 5HVGB 5E4EC 2NR6D 4P2QB 3BZFB 4X6BA 4EI5A 2PP8A 5KAQF 1G5AA 2G5BA 4OV6F 5AB0A 3T65B 4PCKA 3QDHA 2NY5H 2OA9A 3HA0A 5DWUH 2ED7A 4A2GA 2LFGA 4MJHA 1SEQH 1BVZA 2WCPA 3EGXB 3G5VA 1Y7VA 3FU5A 2X5PA 3OAZK 4DERA 4Q56A 5AOZA 2WB1A 5ES4B 1RL1A 1KENH 3FF7A 1OE1A 2C1PB 4FQXC 5HVHC 3DJSA 3MOAL 2X3AA 4K8RH 4HC1L 2K3TA 15C8L 5L88H 1Q0YL 4R0LC 5A2JH 2G5UA 3U2IA 4BKSC 2ZP9A 3QZWB 4NO3B 4F3FA 5BO0D 3UPRA 4HMEA 1HINL 1MWAL 3TVMD 4Z7VA 3X1BA 5AVYB 1L0XA 3M46A 3SKMA 2R56H 2NDGA 5LG1A 1DBAL 3T71A 4CMHB 1ONQA 4LSVH 4I89A 1R3KA 3RVWD 3KHQA 3FF8A 4M93C 4JPIB 4BK5C 3WN6A 4XPHL 3WJLC 2BINA 1BOGA 1XF3B 1F13A 2YWYA 2K3HA 3IE9A 5J5EA 2CUMA 4NT6A 5EH1A 4HLEA 1YEEL 1NMCB 4QTHA 4R4ND 4ISVB 5GZNC 3L1OH 1NM9A 1I3UA 2GAZA 4TXVB 4NJAH 2HJLB 3MJGX 5C9KA 3WLWD 2EE0A 2V9RA 5D5MF 2MPVA 4TQIA 1TG8A 3NG5A 2XFXB 3BVWA 3G6JF 3DWTA 4IOIB 4POUB 1R3LB 1AIFB 4E9RA 2IANE 4TLUA 3U36B 3VGAC 3ZT7A 1EAOA 4XAKD 3D7PA 2C9SA 5ETUA 3AY2A 2K7QA 3RYMA 2BSSA 2WHVA 1CDYA 4NZ8A 4C4KO 1N7MH 3EGSB 1AZUA 4HJ1A 1DZBA 5DFTA 3LH2H 1JD7A 3HI1A 4Q0XH 2VQTA 2O30A 5LAPA 4OLYL 4IBQA 5FLVA 1U36A 3PV7A 5EN2B 2J20A 1CZ8H 2CO6A 3QW9A 5F7EL 1YLBB 4P57B 4QHKJ 3NIFB 3BVTA 3V0EA 4QGTA 1HQRB 1A6ZB 3EADA 1AZCA 5H2BA 2X6BA 1U8PA 2WWMC 2XVKA 3WL9B 1KV3A 4HCFA 4OIBA 4JZJC 4B6ZA 3SPGA 5HYJB 3NIGF 1D5MA 3KCWA 3B5GA 1S9VB 3LXAA 2ED9A 4JFEE 2XQYA 1WEJH 1F4WH 4YXLL 2N4IA 4UQ2B 2JKRM 1MRFL 3PAVA 5L0QB 4BUGA 2I60L 4PY7A 2ODIA 3OM3B 2F74B 4K7PX 2LGNA 1EFXA 2PCPA 2RMNA 5IFAL 3II3A 5FB8B 5GS0H 4ODSH 3RGHA 1CFBA 3UMNA 4MCYB 3RVVC 4J8QA 1WO2A 4KKPA 4XHJC 3U7YH 2QQKH 2E0PA 1MY5A 1XCQA 5HPMB 3BJ91 4PEEA 4S1SH 2IVFC 3HJ0A 3DSNA 2YK1L 4QTFA 3V4PA 5I0DA 7TAAA 4GUOA 3TA3D 4G43B 5LGJA 4NHCL 4Y2NA 3T4YB 4UWQB 5FHBH 1QSFB 1O0VA 1ZV2A 5DK3A 3GHPA 4HIPA 3FU7B 1N64L 4LOVA 4EI0A 4NZRH 3CBRA 5HDBE 4ENED 2EJ1A 1TF4A 5EBMA 1BZ9B 2ENJA 3ZMRA 2EIDA 1BPVA 4X7FC 2EZ0C 4FNUA 4ZFOL 1RURL 4NENB 4QDGA 3LPFA 3DTXA 4N90D 1QLRB 2X40A 4POZC 3UDWA 1LO4L 3I85A 3UTPE 1PEWA 4P59H 3X1GA 2VAAB 1ZVSA 1AFVL 1BM3H 2X4SB 1E6JH 3MRLA 4JHUA 2XCMC 5IJKC 2ARJB 4P46C 4TQEL 2WJ5A 5GRVK 3L5WB 4O4YL 5D2LB 3WUZA 1IKOP 2XYCA 1HI6B 4L0ZA 5AEAA 3MUJA 2I9TB 2HG5B 3QCTL 1UA3A 2DZEA 4ZMXA 4PJBE 1HILA 3HZVB 2XV0A 5LBSH 1A9VA 4XNUL 3FCSA 4QRFA 3T8XB 3DUSB 3RBGA 3TNMB 3MV7E 5B39B 4Q9RH 4N2IA 3RVTC 1N8ZB 4OZIF 1TVHA 4N25A 1UWFA 4ZFGH 1Y18A 3PFQA 4G1MA 3VO0A 4TQPA 3ARBA 4XWGH 5F89B 3MBEB 1PKQB 3BVXA 2DPKA 4YAQA 4PJAF 3PAUA 2EIZA 3C6LB 3RIKA 3VYPA 3RDTD 2ADJB 4CW1B 2WC7A 3OZ9H 5F93C 3ZR6A 2HKFH 4MMZC 2XXFA 1KCVL 2KLSA 4H26B 3JWOH 4ABUA 1MRCL 2XYBA 4WCYH 4GQPH 1JIBA 1EJ6A 2DB8A 3S4SA 4OFQA 1ZXQA 4PGJA 3C5ZA 4NRZB 5JZ7C 1TVDA 3GXIA 3ISRA 4I9WD 4JLRB 4AIXA 4PP2B 2MHAA 4OTXL 5B8CB 1JGUL 1XGUB 4PWEA 4JPKL 4X8JB 4U49A 2EUXA 3QJQB 3IJYA 3ETSA 3JV4B 3WIHL 1CF8H 3IS0X 3OKMA 4TNVF 1QVOA 1YJDL 1E27B 1ZGLP 3QDMA 2OSLA 1B4JL 1WA1X 3L7FB 5D6CA 4KNUA 5KSBF 4XCCH 2HVKB 4MJID 1SOSA 1JGVL 1HHGB 1IAMA 3WEBA 3U7AA 3KS0H 4GKSB 2VL4A 3QQ4A 4MS6A 3LPPA 4XMLH 5FYJE 4WTZG 3K3QA 2OJEA 2Y06H 4AYFA 5C0CA 4M9PA 4TSBH 5A7EA 2GCYB 1CBVL 2XNAA 2Y7QB 3EYOB 4M61B 1IEBB 2QR0B 5IHHA 1XF2B 2Z0BA 3QEUA 1YVLA 5BV7L 3T9WA 4GRMB 1JRHH 3RWHB 1F6LL 1C16B 5I1DA 4E9YA 3ZRCC 1GZQA 2E7LC 1D5ZA 3QUZB 1E9QA 4NFCA 1HKFA 3BPLC 1EZSA 3QFDA 3QA3A 1F6AA 1DDTA 1L9RA 1RIHL 3HR6A 5D7EA 3RVXC 4XWOC 2O6EA 5EU5B 1WFTA 4ZFZA 2A1WL 4S1DC 2B59B 4D2NA 2KKQA 1G84A 2AW2A 5IBTL 2OMUB 3K81A 4XCNB 3VXSB 2MCPH 4KMQA 1GYWA 3A6CL 3DSFL 4QR7A 1IC0A 2Y36L 3CX5K 4IOFC 4Y19B 3T0VA 4BXSV 1WSST 3IDJB 4OZ4B 1DQDL 4RQQB 1QI5A 4QY8B 3L95A 2X6AA 5FM5M 5E5UB 3ULUF 3NIDE 3VFOB 3CFEA 3GSOA 3IDXH 5DS8A 4PJIE 2Z7WA 3VFPA 2X12A 2OPCA 3D87B 4WW2C 2GEQA 3KCPB 1ANUA 2EH8H 4PFEA 2X9WA 4FNQA 1WWAX 4OCWL 4APXB 4NZFA 1PY0A 3NTCH 3EFFA 1EGJL 3BUYA 3FO9A 4OI8A 1PZSA 3S36X 1TZGL 5FECA 4AVHA 3F7RA 2NNAA 2NLJA 2BZCA 4RMSA 4XPTH 4AG4L 3FNKA 1FF5A 4IBTA 3WDJA 1AXIB 1UB5A 3K0WA 5TJWK 4XGZA 4L4VB 2EILB 3CFKB 5BZWB 4LGPB 2NY4B 4RISL 3H2PA 1FNLA 4WUKH 4EZJA 1ZGLM 1NCNA 1PKOA 3GLZA 4WWOA 1I8KA 1S5HA 1U8LA 5LNDA 4X5QA 1NCOA 2ROYA 4B41A 1VACB 3MJ6A 4WEBL 5AQ0A 5TPWH 5B1JC 1DR9A 2VWEC 1KTRL 3OHXC 3F83A 1CT8A 2CHXA 4HW6A 5K9QG 3DX2A 3M1BB 2C3VA 3OGCB 1SBSL 4ES8A 2XPGB 1VB9A 1F3JB 3FT4B 3LNHA 2V9UA 3RVVD 1IGIL 1RU9H 1JPFA 1FYHB 4XHJD 1VSCA 2H1PH 3KVPA 3S5LG 5E5MB 1L9MA 1T1XB 4GW4B 4WTXA 1CI5A 3ZO0A 4NEHB 1QR1B 1NIDA 2B16A 4G7YH 2P5EA 3OXSA 4Y2DB 1AJ7H 1QHPA 3ZZSA 2ARWA 2QKSA 3LH9A 4XO8A 1VJSA 2CHZA 1BEYH 3LNIA 5EIIG 5AUMA 3GJFK 4JFFA 4BSWA 2FBJL 3ZE1F 3RWFA 2C7FA 3EBHA 5BW7A 2X3CA 1CD0A 4EF3A 5IFHH 4KUCF 4YSDA 1UZ8A 2CGRL 5AVQB 4GQ9L 1J10A 3BOVA 1JXDA 4MX7A 4AGOA 1QO3A 4I0PD 2EZ0D 4R2GB 2X70A 4G8FB 3UC0H 4MGXA 4POZD 1Q0YH 5FYJL 5DFWH 2B5IB 5FA4A 4JHAH 3ZDZB 1QFWL 1TR7A 2RAMA 3Q01A 5D2NA 3VB8A 1HWHB 1IBHA 1R5WA 2AKRB 2W60A 2WWNA 4QCIA 4YDIL 4P46D 1E3XA 2DQDL 1A4JA 3DV6B 2JF1A 3W9DB 5IOPB 2OXGA 5DD5H 4Z0BL 4N6RB 3CFQA 5LDUA 4G83A 4PVLA 1F2QA 1FJ1A 2KBGA 5C0JB 4FQQB 2E59A 4FN0A 3K2MC 4TUJB 5E94A 1P5UB 1IGFL 2H32B 1PIGA 3GXFA 1YNTA 4KTDL 5C7XL 3VXMA 1W16A 3T3ME 4P4KB 2YPLA 1CXFA 3KR3L 2EEBA 2YPVH 1S7XB 4XNXH 3A6BL 4L8DA 1KCRL 4XPGH 1MIML 2VZTA 1KEMH 4BWTA 3RWIA 5HHME 4YHZH 3RWJB 2XVGA 1KN4L 4AV4A 1KB9K 1AR1D 3OMIB 5EO0A 4BK4A 1ETJA 3D52A 1IC4H 1NEZB 3BVNB 1M4KA 4DGVL 4OLXL 3VRIA 5FO8A 1MHCB 4KO5A 3C5JB 4XCYB 4ZQKA 1AANA 2FHCA 3PWPA 5C09A 2E4FA 2XICA 4FQHA 5ISZA 4YL4A 5JZ7D 2P8LB 2VKXA 4EN2A 3DOSB 3D3VD 3TBVB 2AGJL 1U3NA 4OLYH 3SGEI 4L4TE 4MKMA 1UJ3C 1AXSB 2APWA 4HCIA 3L3JB 4C4BA 4KHXH 4RZKA 3Q6GL 1DQIA 2UZIL 4BV1A 4LLMB 5J6HA 35C8H 4JO1L 4Z3TA 3UO1H 5HHNB 5LGYA 1H3PH 4AQ1C 2W88A 3P4MB 3K8KA 4MXVF 1P7HL 1IUZA 2OXHA 2X87A 3PNRB 1O6VA 1DQLH 4PUBL 4XC1L 1GJWA 2XWCA 3IBOA 4NKOA 4A2FA 2WNGA 4NPYA 1I8IB 3CXFA 1INEL 3HCVB 3O6FB 3BWSA 1E4WH 3BZ5A 1OWWA 2QELA 5KSAA 4JG0L 4X9BA 4ANVA 1G6RL 2EIJB 1KJ2B 5IIEA 4NZUL 4UQ3B 2DMBA 4UOQA 3FB5B 3SDAB 1UQSB 2MCMA 2P28B 4OFYA 2MNWA 3CSTA 2V2WA 3HBGA 3IJEB 4XWOD 4KJQC 3RVXD 3S4SG 1FE8H 1ZLUK 1VCAA 1KGWA 5E8EB 3EG9A 4S1DD 4IRZL 5DCCA 3NH7L 3DGDA 3KPSB 5LJYH 3F7VB 4X6BB 4EI5B 3JUYA 2VC2L 1RUQL 1W0WB 2WVTA 2G3XA 4G9FB 1UOKA 2G5BB 1NCAH 1OOWA 4PRPE 2FL5B 4IOFD 3UJTL 3OLDA 5D7KE 2H2SD 5MENA 1BLNB 3LRMA 4HUNB 1U8KA 5DK2A 1GS7A 2NYKA 4OFIA 4PMFA 1KUMA 3FDWA 2I9LB 3MOQA 4CDHA 4DVBA 3KAAA 4X4ZA 4DFIA 1WISA 2FWUA 5C08D 4A6YB 4C8XA 1GMEA 1ICTA 5ERWA 2CMRH 4M8QB 1IU1A 2BSEA 3UAEA 3RTQD 3V5DA 3C5SA 3QK0A 4PS4L 4APQB 1PNCA 3B2PA 4K0OA 4O4YH 4F8TA 1HSAA 3UPRB 3FFCA 4OM0L 4Z7VB 1KEGL 3SKMB 3SY6A 1PX3A 2BMKB 3HS0B 3QEHB 1NZRA 1KPVB 1R3KB 4LB8A 4OLEA 2WNXA 4WO4C 5IVXF 3UL4A 4XN9A 1UACH 2SEBB 1QBLL 2WXIA 2W8CA 5FM4A 1BOGB 3FCBA 3BI9X 2Y07L 2YSSA 2FO8A 5LXGH 3NA9H 1G9ML 2RD0A 4NT6B 4JG1L 3H9SE 1TQBB 1W80A 1GOGA 3EOAA 4DPBX 4JK0D 3MNWA 2GAZB 4IBUA 1JYXA 1AHWA 4FKHA 3SHSA 4PLKC 2N7SA 4FG0A 4HAGA 4E9SA 1P4BL 3ZDYE 1TQTA 2HJKA 2ENPA 2K9FB 5IQMA 5L6YH 4X4YA 4PI0A 1LYQA 4X7SH 4LAJH 5DRWA 4XMKL 1KGUA 3CXHK 2BSSB 4Y4KC 5AZUA 2JKIS 1HCYA 1UCBL 3D4GA 4J6IA 1YRKA 2GPZA 2Z1PA 3VFRB 3ZHNA 5GZOC 1I53A 2CBOA 3ZDXE 3PABA 3TBTA 4Q4EA 4FXGC 1ORSA 4H8PA 4BFKA 1OGAA 2A9ML 2F54D 3VD5A 1IX2A 2CO6B 3EOTH 5HJBA 4OU3A 1I9EA 2Z8SA 4Q8BA 3SDCA 1UUSA 4I4WA 3IU4H 4F9PC 1KULA 2BWIA 3D85B 5ILTL 2R2EA 2FBOJ 3TLRA 3T0BA 1INDH 2WQVA 3PIQA 3MGOA 3VFTA 1D5MB 5EIQA 3SGDI 3APNA 3O4LA 2AEPH 2CZNA 1NOFA 2CKNA 3OB0K 4F92B 3NN8A 3RZCC 1X5GA 3PFUA 1NCGA 2YBRB 3H3PL 5AVWB 4RETB 2A9NH 1U8HA 2APTA 1I9RH 2FJFA 1S7WB 2AQTA 3B1UA 4PY7B 5EZOH 1QSEB 1XGYH 4YR6A 3ISWA 2BOCB 2B8OT 5D1ZI 4D8OA 5AYQA 4AV5A 2KERA 3NRFA 5IM7A 5FAAA 1A14L 1LEKA 4G5AA 4PJAA 2CR0A 2O5YH 4NQDB 3K2UH 1T6WA 4NC2B 4JL1A 1XCQB 3VSTA 1AXTL 2WZ5A 4NQEB 5EOQL 3S88H 1LK2A 2MWCA 1IV8A 3DSFH 4TVPE 2QGEA 3UZVA 3SYAA 3BC9A 3L3OC 4UNVA 4P2CG 4DO5A 1ACZA 2IOIA 3VD0A 3UBXB 5EBMB 1FFNB 4P5SA 2DAVA 4JY4A 4XNBA 4E36A 1UM6L 4IDJH 1CICA 2F1EA 5ICZB 2A7BA 4K3HA 3VG0H 5ECGA 3VWJB 2D73A 4I18A 4PJCE 3CNKA 5C8JB 1QSVA 3R7RA 8CGTA 3QUHA 5F1NB 5FIEA 1ZVSB 3P3SA 4X5LA 3MRLB 4HIIB 2F9BT 2PYFA 2AVFA 1WAAE 1YN6B 1TEYA 1DEEB 4ZD3H 5DZ9A 4EZMA 1QLEL 1EDYA 3EOBA 3VXUE 2P45B 5ESQA 2OZ4L 1A65A 3QQDB 3ZUNC 1DVQA 2IPUG 1CQKA 4LKCA 4QYAA 3T0EA 3J2PA 3BIKA 1G7HA 3FONA 1OP5K 4MB3A 1JGDB 4BM7A 5HHOE 1I3RB 1MF2H 1UM4L 2ENSA 1U91A 3GSQA 5F88B 3TO2B 5IEHA 5FOBB 3WXWH 3AABA 1Y18B 2PCXA 1V05A 3DA0A 1P2CB 5F7DA 3EO0A 2TRYA 4YAQB 2EIZB 4IHBA 4UNTA 4X9IA 4A66A 4HX1A 2R83A 3B5TA 5JA9A 4ACPA 4BZYA 2GHZA 1R9FA 4HGWA 3WJJA 5KAQG 5AOIA 2DOCA 2UZXA 2F08A 5LBSA 1JNNL 1C8QA 4G6JH 3OKKA 4JGJA 4BH7B 3FTUA 5JIHA 5JOEA 3RY6C 4GEJA 2A6IA 4GSQA 3GBNL 1CN4A 5CBEB 3KD4A 1I82A 4PRIB 5DJ0A 5JMRA 2O5XH 1NCJA 2H41A 1T83C 2UZYB 3IJYB 1RVFL 4O5LH 1NANH 4F15C 1ET7A 1UWGH 4N3UA 1HH9B 1QVOB 4PJ7E 3UTSD 1U58A 1WT5A 2EVHA 3VI3E 5D6CB 3CK0H 3UACA 4XP9L 3ESOA 2GJRA 3VXRA 3BH9A 1MWOA 3AREA 1W0VA 3ARXA 4NB7A 4NO0D 4RRPA 3QUKA 4TRPH 1N4XL 4X0KA 3LPOA 5E6IA 3TIEA 4GO9A 4AYFB 1DVXA 1FORH 4Z77A 5CGMA 2XNAB 2QKIA 1HT6A 3OPZH 3QWRA 4KKCC 4PIRF 1SM3H 5BZXA 5HDBF 1H9VA 2WLZA 4PCTA 3NZUA 1J9QA 1CDJA 5EOTA 3TH4T 4AYGA 4U6VH 5FM5O 4NO5B 3TPKA 1GZQB 4AY0A 1V10A 5C86A 5JNYB 2HA1A 1MCRA 3QA3B 1IFHL 3N9GL 1E4XI 2Z93A 4WO4D 3KPRA 1ULVA 1YN7A 2EE6A 4NHUA 3BKYH 4XXCA 2B9BA 3BPCA 3EF4A 1UKQA 4LU5H 4G9DA 4PLJC 5BUPA 3AVEA 3WTUA 3MXWH 3DNKA 4WO0A 1XGQA 4WNQB 3PPSA 3SJVE 2ORBL 3I6LE 3F8UB 4ODXA 2R29A 4PJBF 3VVVA 5A3IC 4IGBB 4TVPL 3Q2NA 5E70A 4FYRA 1N5YL 1XF1A 2Z4QB 2OMTA 1W15A 4OQ1A 2E7DA 3ZL1A 2HKAA 1KB5A 3CFEB 1EEYA 3MRFB 4EDWL 1NC4B 1MHPH 5A6LA 1UT1A 1WFIA 3IJSA 4XXDB 4Y4KD 2ZG1A 3CSYA 2E6QA 2WGNB 3NJLA 3ZE2E 1ZE3C 5GZOD 3DROB 3QXDA 4YN3A 5JHAA 1OPGL 1MDAA 1JGLH 4PJ6A 1JZJA 2DMCA 2XN9D 3I9PA 1GRWA 1F58L 1A22B 1A1NA 5C6WH 3MU3A 4XAWH 5FECB 2CIKB 2NNAB 1H8OA 4G5ZL 3A4DA 5DVLA 3Q5TA 2DQ6A 5I6OA 4L3ED 3V0DA 3ZO9A 1M42A 3LS5L 4QJ3B 3BUPA 3VACA 3F12B 1U8LB 3B3IA 1J88A 2VIRB 4QRTA 3C8DA 4N6QA 1E6OL 2JNZA 1YSOA 4KK9C 4WI8A 1JZ2A 1OAQL 4WQOA 1F90L 2X2YA 5C0AD 2ZTBA 3VVWA 1BFVL 5KZCB 2XWBA 1CT8B 2WUBL 1D5BA 2UV3A 1CGSH 2YD1A 4HCRL 3LQAH 5CXPA 1D6EA 2C3VB 3FYEB 4XMZA 1WIPA 3BVDB 4LCWD 4NQVA 5EO9A 4MD0A 5MI0B 2OX5A 1IJNA 4MVBC 5CGYC 5DHVH 4DAGL 3AU0A 2WXFA 3FO1A 2ZCKL 1B0GB 3GI9L 1AGFB 3CX5J 4JHVA 3S34H 4I2XE 5E2VL 3OXSB 1BX2B 5C2BH 1NJ9A 3FTWA 3U1SL 1P4UA 1ZVNA 4KNSA 4RNRA 2Y5TA 1N9PA 3UERA 2FVNA 1OT4A 2PYEE 3JWNG 5DJZA 1PY4A 5AUMB 4FADA 1XEUA 2Q6WA 4JFFB 2C9PA 4YE4H 2XWEA 1IAKB 1KIUA 1TEGA 4N2NA 2PP9A 3E8VA 5DR5L 4F37K 3PHQB 4HS6B 3KW7A 1ZHNB 3GRWH 3HZYA 4LARH 5E1GA 5JYMA 1IKFH 2WXPA 3EJUA 1I1AB 2CWRA 4MX7B 1T7XA 1U8QB 4XAKE 2J12B 2DYPA 3T8VA 4Z7QE 4P3CL 4KNQA 4YEEA 2X70B 4MD4A 4AE1A 3EHBC 4HG4K 4WNJA 1O7DC 2B5IC 2IWKA 3MRMB 5E00B 2NSXA 2Q86A 3DUUB 2BHFA 3DVIA 1R5WB 3FTVA 3HZMA 4Z7NE 4QCIB 1C12A 2WSPA 5H35B 2J4WH 4LFHG 2ATKA 1D7DA 2QL1A 3RX9A 4HQQL 4KFZC 4PJIF 5HY9A 4KZDH 3IRZA 2OXGB 1ECYA 4Z3IA 4HYTB 1FZOA 3G5ZB 3HB3C 3KGRA 2CAKA 2VN6A 1J1OH 1FJ1B 4LRNH 2XN2A 3PQYE 2NCMA 2FJUB 4HC1A 5E94B 3Q2CA 4AYBA 2E3VA 4DEPC 5B3SB 5FEBA 1YNTB 3LKNA 1DUZA 3ML8A 3VXMB 3F5WB 2YPLB 4GOSA 1MWAA 5T1LD 2EXYC 1FN4A 4K9EL 4MAYB 3ZBMA 1UWYA 2PXYC 4NJ9H 4X4KA 2K8MA 4NQCD 4XNAA 5HHXL 1KCUH 4S11A 1PDKA 1MFAH 2FIRT 4LEXH 3DV4A 1X7QA 3VM7A 4XO3A 1OSEA 2F53A 1MCBA 4ZQKB 1EQWA 3CSGA 4OCRH 3RIAF 1DSFH 3CU7A 4P2OD 1J8HD 3PWPB 1GOHA 1I8LA 4LDLB 5AW4B 3AXLB 2XVBA 1TJXA 1QFPA 4FQHB 5ISZB 1BA9A 2P5WB 4J3SA 1U8CA 4AWJC 1ZPLA 4HWZA 3MNDA 1H3WM 4AT6B 3L48A 3OJMB 3T1FA 1BGXH 2P1YA 5A16A 3LRSA 3PXHA 2CRZA 5CILH 3O3AB 4Q7DA 3NEOA 4Z7UA 4P48A 5DC4B 5C2UB 4ZNEA 4ZMVA 5C07A 2VMJA 2BRRH 4PQXA 5F9AC 1CG9A 1MFDH 2YFOA 4OGXH 5A6IA 2CPCA 3O6KL 1W72H 3Q6FA 1AC6A 4XVOA 1E9OA 2BHZA 3BQVA 3KXFE 4BRJA 4HPOH 2J8HA 3UTTE 3BWAA 4EMZA 3Q05A 3LN5A 4NKOB 1KBKA 2MQ3A 1SXZA 4YO0A 3BQUC 3IWUA 3GD1C 4DN4L 4NPYB 1ZV9A 4KKCD 4QYOB 2YKKA 4ZRGA 2MQCA 4PAZA 5L2KA 4QAWA 1B4LA 5DUPL 4AENB 2AITA 5F96L 3ZE0B 2CKBL 2MOVA 3D4CA 1IZKA 3ILPB 5ALCH 4RGNE 2G60L 1ZLSL 2EE9A 2OZNA 1HNFA 1HZHH 4O02L 1X5LA 2WLHA 3LZFH 3RKDC 1YDPA 1JVOA 3K8MA 2VERN 5SX5K 5CN2A 4J6RL 1NMBL 4LRIC 1S5IL 4PLJD 5TTRA 4XZ4A 1RFDH 5K9JH 5I6PA 3CDCA 5EA0H 1MG2C 2ZUYA 4M7LH 2R0KH 2EACA 1NBZA 4YSOA 5FHAH 2HUEA 2XWJB 4EI6A 2A5UA 1HH6A 3WELA 3T4AA 4AK2A 5KTEH 1IM9D 2XTJC 3QUML 2KL6A 2L4OA 4CC0A 5A3ID 3T3MF 3CFJA 5MENB 1U8KB 2FATH 3B2UC 5MHSD 4YC2B 2C9XA 3MV8A 1T4KA 1SY6L 4RRPG 3FQNB 1T1WB 5J11B 3BP7A 2PTVA 1I1YB 5ERWB 3K2IA 4DW2H 1DTUA 3TIDB 3C5SB 3DK2A 4W9GC 5PCYA 1N67A 1P84K 4ZUTA 1DQVA 4UILL 4KWUA 1MUJA 1HSAB 3ILQD 3NJJA 2HVJA 1GAFH 3W82A 4B9GA 4IK6A 3GKWL 2H2PD 3M8OH 2W07A 4ZFOA 3G5XB 5DHXB 1HCVA 2N0MA 2DQUH 2ENYA 2JQZA 2XI9A 4S2SB 1A66A 3VTTA 3TEWA 3LKRA 1FVCA 3L4TA 3SPVA 4ZOEA 3UYRH 3IN2A 3MA7B 5IMMB 1HHHA 3ULVC 3MLYL 5HDWA 3Q8EA 2CBPA 4XP4L 5BZDA 2A74A 4JKPH 1QP1A 4KK9D 2BVUA 4BBWA 5EUOB 1QASA 1PLGH 4G1EA 3EOAB 1J5OH 1P6AB 2DBLL 5DHYB 1TQBC 1AHWB 2IGLA 5DLMH 4CKVX 2HJKB 2CJ3A 2WNKA 1YYCA 4BK8A 1DDHA 3MUUA 2J57A 5C0BD 3WTWA 3ZX1A 3WNKA 4KGJA 2DI8A 4MVBD 4OZGE 3R1GL 5CGYD 4AL8C 4CADB 3MOBH 5DRWB 3KPMA 4FLRA 5CAYB 1MI5A 2G4EA 3O4OC 2YQ3A 5D1XB 5F6IB 1SGKA 1U95B 5E6YA 2EDDA 1ODUA 1UH2A 3MGTA 4O2CB 1JZEA 5FS5A 4WF7A 1HJBC 3SDCB 2VZVA 1JPSL 3TN0A 3ARZA 4B53A 2YRLA 5FYKD 3MRKA 1MJ7L 2ZXBA 1JFQL 3PIQB 2IANA 1YMME 1ODAA 3VFTB 1J0YA 2VR7A 3WIHA 4NP4H 1NL0L 5DZNA 3U1QA 1P69B 3ZKNC 1VAHA 1YEKL 2A73A 4GG8A 4OIIL 3MLVL 2Y22A 2AMUA 5LWYH 2WYTA 4LQFL 2FJFB 1BMGA 5T1MB 3BT0A 3V7MA 4YBHA 3ULAB 1F86A 3FRUA 2L7JA 5BUAA 1LE5A 5I74B 5IM7B 1LEKB 5DS1A 1OTUC 1SLVA 4PJ5B 3VG9C 2V17H 2FEEL 3BDBA 3IF1B 1AOZA 1OXYA 2MPAH 4JFEA 4XODA 3FT2A 3FUKA 4NUMA 2EDYA 1ZLEA 4NDMA 1G7JA 4R3SB 5J89A 3WYRA 1LK2B 1YO4A 3FMGL 2PXYD 1FH5H 3OVUB 4E42A 1NWOA 1VFMA 5I2IA 1WS8A 3CXHJ 3V7AE 3MGAA 4S1QL 1SPDA 2AJUL 1JV2A 3VD3A 4Z7OB 1J0IA 3P9LA 1CICB 3D9AH 1TPXB 3HBZA 3MCKB 5CLXA 1CFSA 1NCUA 3OKLA 4PH8A 3IAPA 4AX3A 2NY3C 3UDWC 1QAWA 5GGTL 1TZOA 2HX8A 4BE6A 4QEGA 3H3KA 2PYFB 5CCGE 1ID2A 3GTTA 4DK5A 3X3GH 4ZTOH 2FSDA 4ENZA 1B9KA 3CVCA 1NC2D 4LLVA 5T1KB 3HS9A 4KVCH 4HZAA 3KPQB 4LKCB 1TNNA 3T0EB 3V4VL 2D31A 3ARDD 2PW2A 3ZDXF 3ABZA 3LRKA 3TWYA 4JKKA 2Z7ZA 2X2IA 3GSQB 1F2XK 2BY1A 2W0FA 3FT9A 4AVJA 2DQEH 3V0WL 5C3LD 3GHEL 3QXVA 3A5VA 4MDIB 5IMOA 4KHTH 1IQWL 4JFTA 4OLUH 1NFIB 2GYSA 2WUBH 2ZPKL 4RGOH 3VDAA 4M6NH 4ZG1A 3EO0B 4HCRH 1HX0A 3QORA 3ARBC 4FXTA 4W9ZA 5JDJA 3K74B 4H1LH 5D72H 1OM3L 4P07A 1JHLH 3EDDA 2UZXB 5C0GA 5FUCE 4PJBA 3D07A 4C56E 3L4XA 5E8NB 2IAMC 4HALA 4Z5RA 4DP6X 1A3QA 2Z31B 4GG6E 3L8QA 3MV7A 1SXCA 5DJ0B 5CCHE 3QNXA 1YPZB 3AGVA 1RI8A 3ECWA 3C5ZC 1MREL 3DHUA 1ZJAA 2X2JA 2XKNA 3C8KA 5EU6D 5I23A 1R17A 4HXAH 2ILLA 5SWSB 1PTZA 3V0AC 1AY1H 1U58B 3Q1SL 1IT9L 3HN8A 1QTYT 4N5EC 1I31A 3GSWB 4PRHE 5B1KA 2G2PA 3JQOB 4OCNC 3NYKA 2GK2A 5D9SA 2IBZY 3ZN6A 3T0DA 4LSQH 1UZ6E 2DLFH 3B2UD 3JVFC 1W0VB 2QEJA 4K71C 1CLCA 4X0KB 3WKYA 3QUKB 1KWGA 5E6IB 2RIKA 3D3VE 4I0CC 4WENB 4AMKL 2C4FU 4Z77B 4ZDHA 1QNZH 4ONFH 2FZ3A 3FU9A 4J5VA 3LMJH 3SDXB 4M56A 2ED8A 3M88A 2XZQH 4Y9CA 1G7LB 1N3NA 1GW0A 3QSKB 2Y3NA 2AFNA 3WNNA 4WLCA 3KPOB 2HG0A 3FULA 4WHYG 2HTKC 4PJCF 3IT8D 5I73C 4MNQD 3PCYA 5JOPD 4PHZA 1AC0A 3NA4A 4M7JH 1A7NH 3ULVD 3L5XL 3US9A 1WAAF 4JB9L 3MACL 5DT1L 4G9DB 2AHIA 5E9NA 4PBXA 4KI5E 4LSDA 2ZX9A 5L7XL 1MCPH 3NMEA 2ZAIA 4ODXB 1MCDA 4ZQTA 3GMPA 3REVA 2HB0A 43C9A 3AMKA 3P30H 3P9MA 4LCIH 2JV6A 5IVZB 4CN1A 4MBOA 3P40A 4NWUL 1RUMH 2IPUK 1IGJA 1VEOA 2F7RA 2R1WB 5HGHA 2OMTB 4QOKB 4M4RB 3SD2A 2VDML 3SBRA 1BZ8A 2J6EL 4HWNA 1S7UB 3TT1H 1FGVH 1ROCA 4L3CB 4DGIL 3IM1A 3C60C 2JI1A 1BF5A 3QXDB 5C0EA 3A3YB 3O2WH 1U8NB 3UTQB 4UB0L 1PCXA 1U6AH 2WO4A 5E2WH 4UM9A 4IJTA 2Y23A 4NN5C 1I9IH 2VB5A 1AE6H 4K3EH 5AOJA 4WSKA 1PZ5A 2PWHA 5KG9A 1BBJB 1Z3RA 2VJ8A 2GC7C 2UXVA 3P2TA 1BQRA 1P1ZA 5C08E 2DWXA 4PJIA 2B2XH 1ES0B 3EO9H 3D06A 4XVSH 3LS4L 2FWOA 3A24A 3B3IB 1RULH 3ZKND 3NDZE 3MCLH 4QRTB 2HLAA 3DPDA 4WWKA 4LPUA 3VI3F 1LM8V 4R26H 1QBMH 2AABL 1LO2H 2I69A 1UXSA 3KPNA 4YDLC 1I7UA 2XX0A 3CLEH 4HS3B 4MMXA 2QV4A 3J27A 4IOSA 5TE4L 2XWBB 3BRGC 1J0JA 4KK6D 3BDYH 5D6DA 3ARWA 4D9LL 5ENWB 4MXQD 4FZEL 2B1AH 1NICA 4XB8A 4NQVB 4MD0B 4PJ8C 3L9RB 2C4FT 2EEXA 2XXGA 1OTUD 4XVTL 1CLOH 4DOHB 5MI0C 4I1PA 2VLRB 1NMBH 2A6JB 2O26U 4Z0XA 5GJSL 1OCWL 3HE7A 4YSAA 1G6RA 2FEJA 1CMOA 2WUCL 3HG1D 4KKLC 4FG6D 4L4JA 1MQKH 2Y5TB 2VWEE 5H8DA 5J13C 2WXMA 2Q6WB 2BC4B 4RESB 1KIUB 4XVUC 4G7VL 3NCBB 1CR9H 4M5TA 4OQTH 3HZYB 4IRZA 5BW7C 1WF5A 1IC1A 3CHPA 1BM7A 4UINH 2YAFA 4NM8L 4MZIA 1E8XA 4KO9A 4MD4B 2D3NA 3H4HA 1QPKA 3HAEH 4BCZA 1K8IA 1XIWA 2NY3D 1NGQH 3LAFA 3OAUL 1U93B 3KYKL 1CXKA 2HRPL 3N3EA 4UIKH 3HZMB 4RBPH 3MJ9L 2F54E 5DRZA 5D2NC 3EO1B 1IBGH 3GS7A 4LDEB 4NLHA 2ZF9A 3APDA 1F45A 4PJFB 3D2UA 2X6VA 4LSUL 5HY9B 4GXVL 1XF4A 2RQ8A 4CDGC 2ITDA 4P9MH 1JDDA 2DJSA 1FZOB 3G6DL 1AP2A 4M6OH 3CPLA 1NDMB 5AOKA 1C7SA 1JGEA 3LKNB 1DUZB 3NJKA 5H37H 5I16A 3HPJA 3RUGB 3ZHLA 4CRPA 1OWRM 2VXUH 2JK5B 4AUYA 5LGKA 3Q48A 1PYWA 1EAPB 2NY6C 4D9RE 2EDKA 3RIFF 1UYWH 1YYML 4EUPH 2DRUA 4UAOC 2QPUA 3BPNB 3ARBD 1DJWA 3UG4A 3CVHH 4F58H 4UTAL 2Y5EA 4OAWA 2RCSH 1N5AB 3DV4B 1X7QB 3UABA 4YBLB 12E8L 5TH2A 1MW0A 3N5AA 2IAMD 1T03L 3X1FA 1MAJA 1YQVH 2ITEA 2ZUQB 3FB8A 3IMVA 4GAJL 1QHQA 1MFBH 5FUZH 2EYRA 4HWZB 4RFEB 1CFVH 1HHIA 3C5ZD 2FLMA 1FC1A 5CD5C 1XD0A 3GS0A 1EHLL 3GTVA 4MA3A 2JSFA 3NPSC 4YGAB 4IHOA 3BAYA 4M43L 4P23D 5DJ8A 3V0HA 4N5ED 25C8L 4Z7UB 5I19H 3SE9H 2R9HC 5AD0A 4Z7WE 3EYFA 1NFKA 1KPRA 1X9QA 3BWZA 2XQBH 1CG9B 1NUFA 2IWFA 3PHOA 4HG4J 1T0NB 1A7PL 3Q6FB 2WIIA 4HKXA 4NFBA 1TUPA 1NL0H 1QRND 1R5IA 1UCTA 4I5BA 2UUDH 3ETBJ 3LN5B 4L3AA 2NXYB 4JVWA 4YDNA 5JHLH 3ECBB 5C0CD 2FH8A 4CVXA 4L4TA 4CGUB 5BRZE 3MX0A 4OFDA 1ERNA 3GXDA 2R0LL 5L2KB 4D0DB 3TH3T 5KSAC 5T3ZE 3PUUA 1JERA 2X42A 2FTAA 4K23H 1ZANH 4K7PY 5KYYA 3QFJB 3PGDB 4BZ1H 1DJHA 3KPTA 4WY7H 1VADA 3AT8A 4Z7NF 1WZMA 4ZTPH 3RPKA 3U46A 3OWRA 1YPZF 3OSVA 3BP5A 4YBQC 4N8UA 3BAJA 4FA7B 3NP3A 1NBZB 2Y7NA 4EI6B 4WNSA 4XTRD 3X3FH 5DD1H 3T4AB 4KXAA 1LDPH 1MLBA 4QRPD 4AJ0A 1JPGA 2HPOA 3CFJB 3ZKXC 3AM8C 3W38A 4PW9A 4Y0GA 1E4XL 2DY2A 2VMEA 5HYFA 5D70H 2AV1B 1EJOH 4DF9A 4WGVB 3PWVB 1NGWB 1T4KB 3V0FA 2B0SH 2ZKMX 3S37X 3N43F 1MNNA 1VLXA 4Y5XA 4JN2A 3LQZA 2X4PA 5AKVA 5SWZD 2YD6A 3C60D 5DZAA 4G8EB 1BZQK 2CHNA 3QIWB 1MUJB 1TITA 1UOLA 4HV8A 4JFQB 3UTSE 2D9QB 3BLKA 5IROC 1IO4C 3ARQA 1W2KT 4PRPA 1X4XA 3SDDD 5KVGE 4X42A 4Y16A 4WUUD 4IEFA 3KDPB 2P8MB 4TNVK 4AITA 3WU1A 3LKRB 2NY7L 5D1ZB 3RVUC 3KYMA 3SPVB 1MJ8L 1N59A 3VSUA 1HHHB 3LCYA 1UM5H 3BPOC 5FX3A 3S8WA 5E4IA 2EUVA 1J1XL 3HE6B 5BZDB 1GGCH 5CD3A 3TBWB 3H6JA 2XG4A 1CTMA 3AQZA 3SPIA 5KWYC 4FL4B 1G7QA 1I1CA 4HK0B 2OZ4A 2XLLA 2ISDA 3TURA 4P5KA 2AP2A 5DWPA 4YXKL 3LRHA 4MMYA 1FIGL 5ITBH 2H6OA 4R9HA 4PJ8D 3B6SB 5DRNA 4NKDA 3VMNA 4FQLH 4YL9A 1JZDC 4WU5A 4GW1B 1A1MB 2NTFA 3BYTA 2X0UA 2KQNA 3KPMB 3VD4A 3I50H 1MI5B 3T0WA 2ADGB 1J8KA 2NY0C 2W1NA 1ASPA 4L29B 3MV11 1F00I 3V10A 1HXKA 3LYRA 2P5ED 2VXVL 1RPQA 1C5BL 4IBSA 3CN3A 4AZ8A 3JWNC 2V2TA 3BAEL 4QXGL 4WJ5A 5T5NF 3ZHFA 3DMMB 1JBJA 2HN7A 1JZHA 2XQ0A 3QEGH 2W9LA 1CXIA 4FKKA 3WFCL 4I77L 4CSTA 1P84J 2ZD0A 1BYNA 3FBKA 3EBIA 3CQFA 4X6DE 5TQ0H 4OB5H 5KOVC 1N6QH 1J9TA 4GG8B 1OARL 3EZ8A 3DIFA 3B1TA 5C0IA 1S4IA 2BNRE 2XN9E 4CU6A 5FFLA 1JWMA 3CFTA 3O2DH 3EXLA 3IDYC 1HKLH 1WIOA 1DHKA 3FRUB 1U3HB 3K6SA 1LE5B 1RZ7L 4UZSA 1KDJA 3WE6A 4L3EE 3W0WD 2BZDA 3U6RA 3K80A 5I74C 5T3ZL 1AZNA 1JE6A 3DETC 1YEDA 1KELH 2DWYA 4KTEH 5ADOL 5D1QB 3CFMA 3PY9A 1RD6A 5BV7B 4K5PA 3ARGB 4Y1TA 5J4MA 1KACB 1ZTMA 4NDMB 2NY6D 1G0YR 1G7JB 5D93B 2NZ1A 5DVMA 4G6KL 1SUJA 4P99A 2DW5A 1QFUL 1Z9NA 4YHIA 1R24B 1NBVL 4E42B 2E6PA 4QHLB 5I2IB 1LILA 3FK3A 4L8BB 1MLCB 5I5RA 1PSKH 3GB7B 1IFGA 1MJUH 3L13A 1R3HB 4ONGL 1JV2B 3ATFA 3P9LB 1NAKH 4E41E 2CDGA 3HG5A 1QPXA 4DGIH 2I7SA 4K3DH 5CJ8A 5A40E 3OAZH 5C09D 1HWGB 4PVBA 3B2MA 4NGHL 1CFSB 3OKLB 4IJ3B 1LGVA 3DRQA 3WS3A 3ESMA 1K9TA 4I18C 3UBHA 3SY0A 1FYTB 2CDFB 4FAAB 1FFRA 3HMXH 3NCEB 1KZYA 1MEXH 1BJ1J 1ZSDA 4OZGF 3E3QC 2XRAH 3ZGHA 1KIQB 1YNLH 2R9HD 3DGCR 4PWIA 3TPUB 3HNTL 2VDQH 1BQLH 3P4NA 5J6GA 5KVGL 2NY1B 3T0EC 2PW2B 4KVNL 4XMVA 1Q0XH 1OGTA 1U8IA 3AACA 4PJCA 2W0FB 1JWUB 3V6FA 2ZKHL 2BM3A 2ODHA 4NUQA 4WI4A 4OZHE 2JJUA 2Y1YA 1BYPA 4X6CE 2F1BA 4FLQA 4K94L 4JANA 4PJHE 4UQBA 3JSSA 2MEJB 4QGYA 4U1GB 3BWUF 3VXUA 4PGEA 1PAZA 4JQIL 2RB8A 1I3VA 3FCTA 4JRYD 3MRPB 1BFOA 1D7FA 1DQML 1JCKA 4GAAA 5DMYA 4PVMA 7FABL 3IETA 5HHOA 3MV7B 4MYWB 3VFWA 4W4NA 1I7ZA 3OJ2C 2J1ZA 3L17A 3I3EA 3NEEA 5AWNH 2CNYA 3I75A 3C8KB 4HCRA 2XKNB 5F7WC 4LK4A 3ZKSD 4YSCA 4YBQD 3ULUC 1HDMA 4LLWB 1BXUA 4NQCE 5D7LD 3BCDA 5FKPB 4N2MA 4OJAA 5DMKA 1WT5C 1B88A 4K5OA 3WNMA 2LTQC 1BBDL 2HKHL 3S35L 4HH8A 4HOWA 2M2DA 3IJHA 4DP9X 4KI1A 2DWSA 4TNEA 2W95A 1IMHC 1N12A 2YN3A 4G11A 5I1JH 2X6MA 1TVBB 4I3SH 1OK8A 3AREC 3U4BL 3MPCA 3BFWA 1JI2A 2IH1B 4JRFA 3QWNA 2BSED 4NUJA 2IBBA 3QJOA 1GGBH 2QKIC 1Z3GL 1PJWA 4YSPA 2VDPH 1OSPH 4PJ7A 2VLJB 1ZT1B 5IROD 3CHRA 5DHEA 4HZ1A 3FFCD 2EO7A 2Z4TA 4PI2A 3OSKA 1DQJA 4LLUA 1DVFD 2LV4A 3OF6D 4M1GL 4NN6B 5HYSG 2VL5B 4MASA 2CGYA 1LP9E 1CI3M 2VR8A 4N0FA 4N26A 5AZEH 4G8GE 2PPDA 4JFDB 2QVTA 1GIGL 2V2XA 4JFVA 4FLSA 1NKRA 3CJJA 5AW6B 1OL0A 3CDYA 4AGMA 3SE8L 1RPKA 4UTAH 5F1KC 3MRQA 4GKLA 1DO6A 3REWB 5A1AA 2ZWKA 3P9MB 2FGZA 5KVFH 5ABAA 2GC4C 4L5FE 5KN5A 4JUTA 2E5EA 2PO6D 5HGHB 1YEJL 1U92B 1SOKA 2DQCL 2KPNA 1IC7L 3JWDC 3UPAA 4W70A 4A7TA 3K46A 2W92A 4YFEA 4BZ2L 3FS9A 3F7KA 5JDSA 2HZHA 1NH6A 5CLYA 2NY0D 1OB1A 3HLAA 3SJVA 3LZOA 3FPYA 2EADA 1WP6A 4UV7L 3MUY1 3O8XD 2ZKWA 25C8H 1O9WA 2AK1L 3GJEB 2BCMA 2NXZB 3JYBA 3FUDA 3D39A 1T20A 5DMIL 1S9KC 1M71A 2ZCHL 3SOBH 4UM9B 4GG6F 1OGAD 2Q5BA 1YUHA 3N44F 3OL2A 4U3SB 3LD8B 5BS0E 1CL7H 1AG0A 1OT1A 3N85L 5MHSE 3PV6A 4OF7A 4UI2A 2P49B 4TVUA 3VI4B 5KG9B 1BD2D 5JPMA 4H25A 1LWJA 2COVD 3NIDB 3GSUA 1P1ZB 1UA6H 3LNDA 4HS8H 5ABZA 3BD3A 3SBWA 2HCZX 4HXBH 2BIPA 1RIVL 2GFBA 5F6HJ 1LO5B 3PHSA 3O4LD 2NR6A 2HLAB 5ESVA 4B9KC 2PP7A 1AYOA 2Y6TE 3CXDL 3FOMA 1I7UB 4MMXB 4N2BA 4PJGB 3QBTB 4JDVA 1XV8A 4HZLA 2JCCF 3C87A 4AW7A 3QDJB 2VH5H 2P8PA 2BLFA 4JFOA 1SZNA 2YUXA 4BFEA 3GUTA 1U3JA 4IBYA 1FUNA 3LN9A 1B0WA 4LFHD 5IK3A 2UWEF 5HYEA 5I6XB 4TF4A 5IGXL 3VE0B 4GRLC 2WBKA 3PG2A 3GBML 1LEIA 5GHWH 4KQ0A 4HKZA 2F5BH 4JQXA 2A9CA 3DO7A 3U83A 3BSZH 3TVMA 2DDQH 4Y8DC 1OZTG 1JNHA 1VEPA 3GZKA 1FO0L 2BJMH 4XNQB 4A7QA 1GHFH 2UYLA 4FFZL 5DMGC 2EKSB 4HIXL 4QKTA 5DHVB 5C0BE 2OK0L 1KCSL 2WTRB 4KI5F 5EORL 5FGBA 1WZ1L 3MC0A 4F2MB 4H88H 2OMVA 5IR1A 2QVFB 1XHHA 2FSEA 3T8MA 2QQNH 4I2XA 4KNTA 4EE2A 4R8WL 3GIVA 3GO1L 3QUMA 4KROD 2J72A 3O3EB 4KX8A 4DP8X 5DRZB 3CQQA 5I1CH 1TT6A 1XGTB 4RZCA 1ZJBA 1UADC 3TCLA 1FZKA 2MNUA 3CDGA 1SY6A 2YWZA 4M3HA 5FYKE 2H6UA 2ITDB 2K4WA 4KK8D 3OXRA 2OCCB 3CPLB 2HFFB 3N1GC 2J5LC 2YD7A 4WEMB 3UTZA 1JGEB 3FO2A 1S3KH 3KEHA 4PD4K 4X5PA 4J7RA 4HWEH 5I16B 3A6OA 2O5ZL 5D7IE 2FGWL 4IRJC 3KYNB 3VSQA 3E1F1 3OQRA 4UDTA 2B4CL 4MTMA 3B4NA 3IFNL 3INUH 5I0VA 2BSRA 1A9EA 1QQDA 3P3RA 2IPTH 4U31A 4JRXD 5ACMA 2IPKB 5H94B 4DZBB 1ZGLB 2EXWC 1XR9A 4WI0A 5C6TH 3N42F 2NT0A 3NK4A 5I8KH 1B2YA 5I24A 1QFOA 1T1YA 4GSXA 1RZFH 4E0RA 1FNAA 1QNIA 3KLHC 1M53A 4L5FL 3C08L 2AXFA 1JN6A 1RK7A 1NLBL 3L16A 1I8LC 4G42B 1A7OH 4PVNA 3V0JA 1VZIA 2EYRB 4EUPA 5IJDC 2NQ3A 3LRLA 3QZLA 2WQSA 3BP6A 3T0XA 1U8MA 2ITFA 4AKOA 2XWRA 1PU0A 4OSUH 2X7LA 4MA1C 5I18L 1BQHA 4NNXA 3MO1A 5DJ8B 3HG3A 1DUYA 5AD0B 4JCLA 5IF0A 1AKJB 1KCKA 4XCFL 1KPRB 4P4RA 5IOKA 1VZHA 5LXVA 4LCCB 3LPGA 4J28A 1F41A 4Y2LA 3LN4B 2A4ZA 2P5PA 3E2HC 5IW1A 2CIIB 1WHPA 3ARED 4URKA 1ZMYA 1M6OA 5IHBA 4UT6H 2NZ9D 4A67A 3GDBA 4L4TB 1BFTA 4PV8A 3MX0B 1GOFA 1S2EA 3QWRD 1NIBA 3U2SA 2ZOUA 4FXKA 1CYWA 4N1CA 5K1NA 3G04A 3LZQA 3QEQD 4U0QB 1W72B 1AZZC 5CO1A 5KYYB 3BP4A 5DQ9A 2VDOH 4IMKA 4KXCA 3T2NL 4QAMB 5CBAA 3LEYL 2RBLA 3KXFA 3SPCA 4NIKB 3U46B 1HEZA 1WRFA 1RJCA 4OCXL 4TNWF 4IU3A 3BP5B 1PD6A 2XG5A 1EEZA 3QUGA 2F7PA 4FC3E 4PY8I 3SO3C 2XZAL 1TJIH 1TQCB 2OMWB 3L4VA 3MZGB 1CK0H 5CU9A 3GJFH 4BZ1A 3AGWA 1MFEH 5IW6A 1JDAA 1X5JA 3GMNB 2R69H 4RFOL 4XOBA 1TMQA 2AI0L 2IGFH 4HBCH 4FQIH 5F1IA 1Q9WA 3L3KB 4JDEB 4NQTA 3LQZB 1YEFH 2W65A 5LCVL 3RURA 4GRWH 1WGOA 2X4PB 1JHTB 1RMFL 1UKTA 2Q7YA 3B9VA 3DX8B 2VDLH 3WUWA 3RDTA 1EDHA 4MZRA 4N1EA 3RGBA 4EPSA 2X4UB 3CPUA 4TSCH 3ZSSA 3HNTH 5EV7A 3VH8A 3AY4A 4WWID 2C9VA 2EDJA 1J86A 1R33A 5I8OL 4QD2E 4X98B 1U8JA 1BVNP 5CN3A 1A6WL 4DP0X 5FYKL 2D7PA 5GGTA 2FUQA 1NCCL 3P69A 3SE4C 2QADB 2R23A 2XWDA 5CD3B 5IB5A 3QZNA 3QQNA 3OKEA 2X88A 5DF0A 3SIKA 1P5VA 4JM0A 1G7QB 2A74C 3GHBH 4QRRD 3MRBA 4ELME 4Z7WF 1VFUA 1OTTC 4DN3H 3OKOA 4K7FA 4P5KB 4QF1B 3DDGA 3V4VA 3MZTA 5KBPA 1BAGA 1QHOA 4MJIA 4MMYB 4RAVA 2IWEA 5E99H 1YC7A 2JKTM 3DVNA 4MNQE 4X5XA 5I6MA 3ETTA 2BFVH 3EBGA 1N19A 1F4YL 2EO9A 2F18A 2E6JA 1JCVA 2UVFA 4GRLD 2O6FA 5GS1A 5DQJA 4WU5B 2H3XC 2GW5A 2ICWA 1WPCA 3AWEA 3U30B 5DUMH 2HFGH 2FJSA 2HWZH 3NUKA 5T1DL 3K91A 1CGWA 4W93A 3WEAA 1J8RA 3I2CL 3Q5YA 1O6SB 2OQJB 3KGTA 4F8QA 2AQSA 4AZ8B 2V2TB 4WJ5B 2HN7B 4J1UA 4G8IA 3ZDYB 4HSQA 5DMGD 5JHMA 3QZBA 2Z6FA 3O6MH 1J9SA 1E8ZA 1NPNA 1DVZA 3TN0C 4OZGA 4P2RD 4PREB 4KDWA 3QI9B 4YHKL 2F8OA 1TTGA 2G9HB 2A9AA 3U9WA 4GLRH 3GPSA 1EPFA 4HT1H 2NMSA 3DIFB 1YJDC 2ERJB 1IEAA 1R46A 3FAXA 1JWMB 1XD1A 4OLWL 1X5IA 3KLQA 1RUPH 3MYJB 1OAUL 2GSGA 3SQOH 2GK0A 2C34A 3QHFH 4KAQH 1CD9B 2H9GA 5DTFA 5JIMA 2A2QT 1KXVA 2J88L 4R4BA 1YEDB 4XH2A 2KC0A 3PP4L 4TQ8A 3N41B 1E5AA 2FR4A 5IBUG 1ZLUH 2VSDA 4OLZL 3CMGA 4K5MA 4IRJD 4BJLA 2OMYA 5BV7C 2ZUTA 4KKRA 3D69A 1A3RH 3MV9B 1ADQH 1CDIA 2WXOA 5MEPA 4G6ML 3GNMH 4YHIB 1WZAA 1GKOA 1T2QH 1IAIM 4XMUA 2Y5QA 5EPMB 2C8NA 1JYNA 3L6FA 4R7VA 3O9WB 2DLEA 1GC1L 4GXFA 1PG7L 5CGTA 4JZJA 3SQRA 4Q9QL 1E7VA 2BVOA 1E5CA 2CDGB 3KLHD 1EAJA 1EHNA 1UURA 3WJMA 2I27N 2WXLA 5D7JD 5HGAA 2G9KA 4WJKB 3HG1E 1ETB1 1SEBB 1KLFA 1ZEAL 4XN5A 1ACYH 4IJ3C 3I02A 3FUFA 2OL3H 1EK3A 4JDTL 4HLZG 4JM4H 2D03L 3BIBX 4GMTH 1JS4A 1LTXA 2OW7A 3L45A 3S2AA 3ASWA 3LKOA 3MRRA 1H0DB 4JFZL 3CTTA 4U1IB 3VW3L 1PLAA 2AEIT 2DQHH 2J6EA 3P4NB 5J6GB 5C07D 3A22A 3CN0A 3QG7L 1RP9A 4EIUA 1PGRB 5KVEE 4U7SA 4M62L 4OGZA 1U0QA 4XMXA 4H5SB 3IFLH 3V6FB 4UOJA 1MIEH 2DQMA 2YN5A 5DGQA 4OCMC 1JZ5A 5FFGA 2H3KA 3NSJA 4QXUL 4NRYA 4ALAL 3BKCL 3TYGL 5CCKL 3EJZC 5JW4Q 5LBGA 4HHAB 2FX7L 1BOYA 4LP8A 3D25A 4M1DL 3RL2A 3SZ6A 3QORC 2CJTA 2X9XA 2ARJQ 5HHVH 3FCTB 1A6VH 4FFYH 2HYMA 2R51A 4ZX3A 4N20A 1BFOB 3HI5H 4I0PA 1HN1A 2AXWA 3NCWA 3NACL 2HFTA 2TAAA 1E7UA 3C2SA 3IETB 5HHOB 3HN3A 4Y19D 5KW9H 3UC2A 3K6IA 3VFWB 5CKGA 5GJTL 2H6PA 5CM1A 2GEEA 4YNYB 1KBGL 3I75B 5SV3A 5H4YA 3WBDA 4Z9KB 1HDMB 3V4UL 3VQ2C 1P4IH 1FL3A 1P7QB 4H1LB 4U1NB 5E9DB 4WGKA 4LCYB 4RGMC 4L9LA 5I9QB 5SX4H 5HHQB 2YD5A 3QWQB 4ANKA 1KCSH 1MVUA 2X0VA 1LXMA 1K3ZA 4C56A 2ZWSA 1D5XA 1H15B 2VLKE 1F3RB 2IQ9H 3L3IA 5I1GL 2OMNA 2WZAA 4LEBA 4R6UA 3RIAK 5I1IH 3LZPA 2GUOB 2FECL 2BNUB 3OB0H 1CFTA 4HUCA 4NUJB 4CC1A 1TTCA 2XWTA 3WIAA 2AZAA 3M17A 3LVTA 4D9QE 1X9UA 1I1RA 3ECQA 2OYKA 1J1PL 1NGXA 4DPCX 2HXAA 3K6FA 3TESA 4PRNB 1DQJB 1HL9A 3VNZA 1L7IH 5F1SA 4ADIA 2X53A 4QLRA 1ZV5A 4HDIA 1IQDA 3W56A 4N0FB 2QGCA 2OSYA 3MJ9A 4K4KA 2BIHA 3D3VA 3QRLA 4Z95H 3VGFA 2A0LC 2V2XB 3ZTCC 4DJMA 1L6ZA 2BS71 4M6ML 4TPRL 3D51A 4FA8A 2NUTA 3IE4A 4RX4D 3ZTNH 3DVFA 1OTTD 1Q9KA 1RZIB 3HC4L 3KE0A 3PJSA 4MB4A 5EZIL 5KN5B 1OP4A 4KZEH 1BIIA 1A7RH 3C08H 5T5NG 4OZHF 1F3DH 3KNBA 5DVPA 4S0SD 1M1XA 4X6CF 1RJLB 3MLRL 3BGFC 1N0LB 5DJ6A 5DVNA 2UVEA 4PJHF 3HKZA 1GJUA 3QIBC 4YLQT 5CEZE 3L3DA 5F9WC 4Q58C 1OB1B 3HLAB 4UTAA 4XPAH 2ZG3A 3A67L 4OKDA 4D8PB 2NX5E 5IHLB 2NQDA 1NPUA 3D39B 1T20B 4UT7H 5GGVL 3UPCA 3VFVA 3FQWB 4QRPE 2E7LA 2NXZC 3BO8A 4EBQL 1HL5A 3APFA 1LWRA 1J7VR 1M05B 2BNQB 4L9DA 4X80H 5J1TC 2Z34A 3PV6B 5EF2A 1UH4A 1F8TH 1SBBA 5DEFB 4H25B 2WYIA 2KLRA 5E8OB 4LHQB 4TUKH 4LOEA 1JXJA 2IAND 3VRLE 3MREB 4IKJA 1OP5H 5SX4I 5SWZE 2BPBA 3GI8H 3HPLB 3QUYC 5ESVB 4E9LA 5K9OA 5EF1A 1EH9A 5KVEL 2YR3A 1QD0A 1ZE3H 4WWKC 4YFDB 4RMWA 1GMIA 4FULA 1HOCB 4JDVB 4KXZI 4MMXC 3ZIYA 3WLBA 1PZUB 1TO4A 1U2YA 3RPIA 3LKPA 3U9PL 4WUUE 2TRHA 4M7KL 5E8PA 3QNFA 1FV1B 3IFPA 3NFNA 3W5NA 3JV6B 4PJDE 5CU5A 5BO1L 5C08A 4ELDA 4HJJL 4Z3GA 4LBEA 3BW9B 3WEMA 3Q43A 3RTQA 2VABA 5DA0B 1OAKL 4HKJB 4OF3A 5HHPB 3W2DL 5I1KL 1LEIB 3HE7C 1S9YB 3VUAA 1SJVA 3WG7B 4JFED 1L9NA 4KQ4L 4Y7MA 1R4XA 4DQOL 3DO7B 5HYQB 4N8VB 1PL3A 4UT9L 2YUWA 4F7MA 4G6FB 4LHJB 2JJTA 3AW5A 4JRLA 1LP9F 1MKFA 3FJTA 2F0CA 2GJ6E 2I24N 2UYLB 4TNGA 4PRBA 3NEXA 1H8LA 1KFAL 3MLUL 2EDRA 2OLDA 3WY3A 3E7JA 2BP8B 4Y4FA 3D18B 1XGRA 4NQSA 3DHJA 2Q2LA 2VSCA 1YA5A 4GBXA 4MZ2A 5AVTB 3EJRA 3TCTA 1JXFA 3MODH 4JVPA 4ORGA 2OMVB 3VJ6A 4KTYA 2WQWA 1G7PA 4MA7L 5E1QA 3GIVB 1I3GH 1Z7JA 3FQRB 4HJSA 5C9JA 3RFZC 1J0ZA 4L18A 1OTSC 4UQ9A 1R3JB 1XIWC 2RR3A 1A6AA 5B1JA 4BFIA 3HFFA 4OVVA 4RZCB 5TFSL 3UYPA 1TETH 5FDWB 4Y5VA 2FT7A 4XVJH 4KZCA 3CDGB 4AEEA 2DJUA 5E2TL 4TQHA 5A2KH 2DLTA 5IVOA 4FQJH 4ZS7H 2LU5A 2VUYA 3GLEA 4WWPA 2NNFA 1CXHA 2H3NA 3ZRSA 4JUSA 3ATBA 3UTZB 4Z7QB 3FO2B 3WHXA 4PM1A 5J0BA 3HAEB 2Q7AA 4PJ9C 1A1OA 2P42B 5IHWA 1FAIH 3K5SA 3QCVL 1PNDA 1P7BA 4I88A 5J1AB 1IM3B 4UDTB 1U8OB 2C9UA 5L4IA 4HIJB 3HVDA 1EO8H 2F54A 3HFMH 1KBBA 4JRWA 3EJZD 2BSRB 1A9EB 1QQDB 1TJHL 1MW3A 4GSDH 4MQ7B 3QORD 3NGBC 3VGEA 4Z23A 2WW8A 2J8UF 2MKLC 1XR9B 5KJRL 1KLGA 4WI0B 2IALA 4KC3B 1M7XA 4M48H 1O5DT 3W0WE 4B3EA 1DBMH 4C47A 4HWBL 3E1ZA 3APMA 2BOBA 5EUKB 1T1YB 1Q8MA 4RAUA 5F7UA 2H1LM 3DGGA 4BSJA 5EEYA 3WMPA 1G9MC 2ZXAA 3CZSA 1ILSA 1JN6B 2CXGA 5IEKA 2DQIL 1EXUB 3I2CH 4EUPB 1DL7L 4JO5A 1MAML 4NZTL 3NJHA 4O2EB 4QPEA 4HVBA 2FX9L 4DUXA 5CEZL 5I30L 3ESNA 2B1OA 1BQHB 4NNXB 1KTDB 3QRGL 3NCJL 4YK4B 4DQAA 5HDOA 3GEFA 1JUFB 2KT6A 5CLTA 3RP1A 3V7AG 4GH7B 1K85A 2XJLA 3QJVB 3P0VL 1Z2KA 4F1SA 5IW1B 5KOMC 1EFQA 2K1MA 3TA3B 4G7RB 3P4OA 1NFDE 5DJCA 1RP8A 5DA4A 5DD3H 5ALBH 4PV8B 5DZPA 4WDIA 1Z9MA 4F7CA 2D7NA 1M1SA 1MCOL 1WAEA 4FMVA 5L8KB 2IC2A 4N0CC 4PD4J 4Z7WA 5DSCA 3L4CA 3RX7A 2K8QA 1A0QH 1IGMH 1V7NL 1HCFX 1RK1B 1T80A 4YHPA 4BSVA 5I1EH 2JXMA 5DQ9B 5CBAB 1UHVA 2D7TL 5FYJD 3MLTA 5KYWB 4MJ4A 2ZOLA 1H3TA 2NPLX 3IGAA 3GF8A 1QA9A 3KLAB 2C26A 2XG5B 5BRZA 4G6MH 2XTLA 1PBYA 1V54B 1QMUA 1EEZB 5E9AA 3IMTA 4M02A 1ZT4A 3O3BA 2XKUA 1UTDA 1BCIA 3KBFA 5BUGA 4JRYE 1NMAL 2DYRB 4DUWA 4JFHE 3SB3A 5D7IF 2HRLA 4ZMTA 1FGNH 4KY1L 1YYLL 5D5ME 3CLFL 4ZAKB 5JHDD 2NCEA 4YSSA 1V5JA 4AOFA 5F1IB 1Q9WB 4YDKL 5F7AA 2W65B 3LQMA 1LK3H 2W9EH 2YGNA 1M7DB 3G6JE 3QIBD 4FZ8L 4Y5XC 5DVKA 3VQ1C 2Q7YB 3M7OA 5DXWA 3CZNA 4KBPA 1U2HA 3WUWB 5DI8A 3RDTB 4B97A 1O7VA 5ANMB 3FH7A 1MOEA 2WQRA 5ICUA 3FU8A 2PWFA 4L8CB 2BIMA 4PB0H 2B1HH 1NLDH 3QUXB 5KJ7E 1SJXA 1OQOA 2R69A 3F04A 3KPLB 1SXBA 1FSKB 3H2WA 2YC1A 2HT3C 4Y16C 5L8LB 2WN2A 1JPST 2FB4H 1DVTA 3X14A 4YUEL 2R59A 5CJOH 3NZHH 3ZL4H 4JL2A 4F7KA 2EDMA 3T0AA 1JF1A 3O0LA 3OKEB 5E4EB 2Y1VA 3QUYD 2FWSA 4K2UL 4EDXB 3DJRA 2W80C 1TLKA 4WWKD 3NIGE 4M1DH 3UTSA 1XTLA 3MRIA 1REIA 4NYLA 5IB2B 4TULL 5F0MB 3DXAE 4YHLH 3V8CA 3Q7JA 1NKOA 4MJIB 4RAVB 5E7FA 2E74C 4OCSH 5I5MA 2AJ3A 4ABQA 5DQDH 3PWLB 4KH9A 2R4SL 4X5XB 4LPVA 2FHBA 4NO0A 5KVDH 2CO1A 5DQJB 5HVHB 3ULVH 1WFUA 3I6GB 3HE7D 4R0LB 5DUBA 1JK9A 2VUKA 5D96C 4JQIA 1TQSA 3H42H 2X6UA 4ZUVB 1FLRL 2R0ZL 5KS9B 4NAMA 3VWJD 3EUUA 3RPBA 4HFWB 4J1UB 4WO4A 4M93B 2D2OA 4GJTB 4FTVE 3THML 3VFSA 3Q3GB 3EXJA 3E6HA 4ZMWA 2CM5A 4H20L 3F58L 4AL8H 4XBGA 4M5YL 3TO4A 1TQVA 4YSRA 5GRUH 4PBVC 1P6FA 2CUHA 5DMJB 5GRWA 2WXGA 3TWCL 4L1HA 5LVEA 3LHPH 5E6RB 1GGIH 4CNIB 1OTSD 3NCMA 1IEAB 5J12C 3GQFA 5C0RH 3B7RL 3RNKA 1AO7E 1KJ3L 3TEZA 2AC0A 2APXA 5FCUH 2R8SH 1FA4A 4GI9A 3NJNA 5DEJA 2XY1A 2VYRE 3MCYA 5JUEL 3ZKMC 2GSGB 2EH7H 3TT3L 2GK0B 5J7CC 2H9GB 4Y9BA 5DTFB 4FERA 2YUZA 3ENEA 3VGAB 2DTMH 4R4BB 2WLNA 1F56A 1CO1A 4XH2B 4X6DA 2MFNA 3V5HA 2NYYD 2VRAA 4TPRH 4AEHL 4PJ9D 4HF5L 4JHBA 3NP4A 5GZOA 5SX5H 3BKJL 4YHMH 1CUOA 2OMYB 4TSAL 3P73A 2XN9A 4O58H 2XVLA 3FN0H 3ZMEA 1JZIA 1A25A 4XE0A 4YGVA 3HI6H 3MRHA 2G0KA 5EZIH 2VTFA 1RZPA 4PRID 3TXAA 4HJIA 5HI5C 2XACC 1U41A 1DFBH 2DTSA 5A2LH 5TE6L 1EMTH 5FW6A 4F7PA 5EBWA 3LEVL 4L3EA 1ZT7A 4JZJB 2VDNL 1NCIA 2GI7A 2GTZA 1LE9A 2BVOB 4ELMF 2BCKB 3U0TA 3WJMB 2KZ1B 5T3XH 4XO4A 5C0AA 2PETA 3NVQA 1KLFB 4QHNA 3QCUH 1KGCD 2FT6A 5GGUA 3QT2A 4KX7A 3V4PH 3FCGA 3RU8H 5CFHA 5HHMD 2YPKA 5HDQL 3RY5A 3K72A 4MA8H 1Q1JL 3MRRB 2EYTA 2AJXL 3LKOB 4J2QA 4ZUSA 4BZ2A 4HPYH 4MSWA 5HJ3B 3SBPA 4KJWC 3SN6N 3U4EB 3QQ3B 4GS7C 2FLBT 3TJEL 3UGEA 2DI9A 3MKGA 2X9ZA 5F3BA 5KSBE 3GSNL 5FYLE 3IJ7A 5I17A 1DBJL 2RHEA 1OSYA 2J1WA 1ZA3B 2XBZA 4OF5A 4JPVH 4GIAA 4EXPX 1B9ZA 3PNWA 2WXKA 4NRYB 4RRPM 2F8VA 3GSRA 4N0CD 2VDQB 2IDQA 3MJWA 4L1SA 3RAJL 1SXNA 1T0MA 2NSMA 1FNEA 3TF7C 3TU6A 4TVSa 2DMKA 2VR5A 4B50A 2JB6A 1Z32X 1KGYE 1IL1B 4U1JB 5F8RC 3EJJX 5GSRA 3C12A 3TEXA 3RA7H 2NQCA 3UJIH 4Y1AE 5FXCH 4IGBD 3SYOA 3E8UL 3H9ZA 4UT9H 3NQIA 5FA3A 2WK2A 4NX0A 4OZHA 4D0CA 4K55A 5K9KA 1IAIH 4P46B 1OHQA 1M7IB 3P1VA 4GKOA 2JI3A 4PJHA 3EFOB 3ZT5A 1NC4D 2GY5A 4FJYA 3G5YA 1KFAH 4G72B 2XU9A 3RIFK 4P04A 4R7DA 1AGDB 7CGTA 1HL8A 3BZDA 1OP3H 3FU6A 4A55A 4C56B 1P7KA 2V3DA 1D5XB 4TTGA 1KDIA 4PTTA 3V0IA 1IC5H 1X44A 3QE5A 4JM2F 3BAXA 1FL6A 3FT1A 3ILDA 4FP8L 1AQKH 4HUXA 4QHUA 5T1LA 1WLHA 1BJ1H 1HQ4A 1A6UH 1T22B 1F42A 3JV0A 1BW8A 1C08A 2RA1A 1FO0A 4K7PL 4FFZA 4M5ZH 4AM0B 4XPFH 1XH0A 2V6HA 2WINA 1ED3B 4NQCA 1XH3A 3T5WA 1HHJA 3WFBL 4XBEH 3SYCA 3L5JA 3BN9C 2BY3A 4F7EA 1E28A 1YEGH 5BVPL 1NGXB 4OJFL