5F2FA

Crystal structure of para-biphenyl-2-methyl-3', 5' di-methyl amide mannoside bound to fimh lectin domain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
158
structure length
157
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antivirulence Isoquinolone Mannosides: Optimization of the Biaryl Aglycone for FimH Lectin Binding Affinity and Efficacy in the Treatment of Chronic UTI.
pubmed doi rcsb
source organism Escherichia coli j96
molecule tags Sugar binding protein
molecule keywords Protein FimH
total genus 34
structure length 157
sequence length 158
ec nomenclature
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 5f2fA00
3ME0B 4AV5A 4LOVA 4XOEA 5F2FA 4AVHA 2J2ZB 4J3OF 4XO8A 5FX3A 4CSTA 5IQNA 5FLUA 4J3OG 2XG5B 3BWUF 5LNEA 5JQIB 5AB1A 4X5PA 5F3FA 4J3OH 4X50A 2JMRA 4XO9A 4XOBA 1KLFB 5AALA 4AVJA 4XOAA 4X5QA 4X5RA 5CGBA 3ZPDA 2VCOA 5FWRA 1ZE3H 3JWNG 2UY7B 3JWNH 3RFZA 1UWFA 2UY6B 3JWNE 4XOCA 4AUYA 5AAPA 5IQOA 5LNGA 4AV4A 2JTYA 1N0LB 2W07B 1PDKB 4XODA 5FS5A 5IQMA 1TR7A 3ZL2A 2XG4B 4AVKA 4AUJA 1N12A 4CSSA 4ATTA 4CA4A 4BUQA 5ABZA 1QUNB 3BFQG 3SQBB 3MCYA 2WMPB 1KIUB 4AVIA 4AUUA 3ZL1A 3BFWA 4AV0A
chains in the Genus database with same CATH superfamily
3N42B 1PKQE 2D73A 4H1LH 3BP4B 3L5HA 4NX0A 2NY6C 3VD0A 2CO2A 2VAAA 4ZX6A 3IXAA 3DIFA 3MCLH 5F7AA 4UINH 1VCAA 5DEGB 4NO5A 3T0XA 4FI8A 1PZ5B 1IJ9A 1KELH 4LLUB 1T83A 4HGKC 4JQXC 1QRNE 2BMKB 4HIIA 5FW7A 1FH2A 3NFPB 2VE6B 2WQAA 2KPWA 4X4KA 3RI5K 3G08A 1OANA 4L0PB 1U3HD 1I9IH 3MV8B 2AJXL 3ZKXC 2ENPA 3DO7A 1OLZA 5KVGL 2DZEA 2EINB 3N1MC 5B7EA 2ZCKH 2UZXA 4JG0L 4LRNH 3VU1A 1HNGA 1J9SA 1OCCB 4JHWH 1UWGH 1KJ2A 1GCYA 1W8EA 1IM3B 2FYVA 2XYCA 3NJFA 5CM1A 2CKBL 3RZCA 1OKEA 1AOHA 1MQKL 1X5FA 2JK5B 5D1ZI 2OCJA 2HX9A 4NKOB 1UOVA 1CR9L 4P23C 2XA8L 4I9WD 3CK0L 1RK7A 3VXSA 1OW0A 4GP8B 4PSPA 1A9BB 1JHLH 4JN2A 4MJIA 2NY4D 4JO5A 3LPWA 1MFCL 3LQAH 3NJXA 4N9GA 2IV8A 5KBNC 1XSJA 3BUPA 1YY9C 4UT9H 4MNHB 3QWOA 1K6QL 4N0RA 1M7IA 5GS1B 4JHZA 1ZD6A 3QUMA 1SHXA 1WDAA 1YMMA 4NN6B 5DZVA 5E2UH 2ARJB 3ZKND 2UV3A 1L9NA 3PP3K 1IGML 4YC2B 3CQFA 2GAZA 3L4ZA 4XT1C 5JHDD 3REVB 2ZKHH 3VB8A 3HRZB 4PTUB 2VLMD 3DECA 4LL9A 4MZ2A 1MNNA 3S3CB 4ZZFA 2BVQB 4LPUA 3OV6A 4WUUE 1S7RA 3P30L 4ZOCA 4BKTC 4N26A 2Y06L 3SYPA 3VMPA 5B1KA 1U93B 2IFGA 4ELKA 2H9GA 1PIGA 2HLAA 1NINA 1RIHH 4KOBA 4NUGH 3OAZK 1S7VB 4R2GB 3SDAB 1FZOB 2Z6FA 4IGBC 4Y9BA 3DRQA 1GGTA 2WYTA 3AU1A 3WBDA 4X4ME 4KZ0A 3D25A 5E5UB 2XQYK 4NKIH 4HIQA 3UYPB 3NIGE 4PGCB 2DMHA 1BG9A 3I9PA 3CFUA 4G6ML 3D2UA 3VXSD 3PWPE 4R3SA 3X14B 2XWRA 1M7DA 4FQHA 2XWZA 2DIBA 3N44F 1RK0A 1HCFX 2IMMA 2ZOOA 3LD8B 3KLSA 3QJFB 2IBZY 3RWJA 4QKTA 5IB5B 5D1QA 5IESH 4Y4KC 2C1OA 1KPUB 3IDYC 2A2QT 1PY4A 2VLJD 2IDUA 1GAFL 4TTDC 1P9MA 3RTLA 2XN2A 1L9MA 4S0HA 4GMSH 4X6CA 4FQ2H 1H6TA 3N91A 3CFBB 2HSIA 4NKQB 4AV4A 1E2WA 4UIKH 4HJJH 2VZUA 3C8HA 4JFED 2HFEA 2I32A 2YD7A 3FHQA 2Y6TE 5DRXA 2OMWB 1T04B 3D85D 4Y1AB 1X7QA 4OIAA 5I75B 2LU5A 3BFWA 3KPPA 4FTVD 5DJCB 4JE0A 4PYHA 4R97B 4XMKH 1DFBL 2A9CA 3WOVA 4CVZB 1WAAE 4F7TB 3JV5A 4NAJA 4S1DC 2NR6D 4ODSL 3KYNB 4BSWB 1F3DJ 1V3MA 4LOEA 1TIUA 3QAQA 5HJ3B 2WKOF 3TN0A 2C4FU 4TV3A 3I3DA 3HBZA 3LS4L 1S7VA 5CJBA 5DMIH 4N8VB 5FKPA 3SDAA 5KVDH 5IQOA 2CUHA 4H25B 1P5VB 1C8PA 3Q6FA 2CG9X 3QW9A 1AMXA 2ZX7A 4MCYB 2HXAA 4ATTA 1TZGL 4R4FH 4GKSB 4PI0A 4PJHB 3GINA 4U49A 3II2A 4GLRI 3GXUB 3RE0A 5IUCA 1F4YL 2R0WH 3GSVA 1Q1JH 2UXVA 3GIZL 1NJ9A 5F7DA 1D9KB 2CU9A 4K55A 3C09C 4JANA 2V2TB 3U0TB 2V3EA 4QHUB 3DROA 3BGMA 2TAAA 3S98A 2D2CC 4U1KB 1Q0YH 1QLEL 1TENA 2WJ7A 3LNDA 4OGXH 4OU3A 2KLSA 3Q44A 3KBPA 2K8MA 5HYJA 3WY2A 4A6YH 3QORB 3L48A 4M5ZL 3FONA 4JRFA 5D2LA 5TDNA 2XN9D 5FHBL 3KWUA 3II3A 3MODH 3WFZA 5AG8A 4XMVA 4BWUA 1EJ6A 3OQ3B 4GW1A 4P3WA 4U05A 1KTJA 1L6PA 1RUAL 3LKQA 5GISL 1IAII 3BD5A 1GYUA 4MMXB 3A3YB 4J3OG 3KGUA 2FWOA 8CGTA 1QFHA 2F58L 3HAEB 1EO8L 1UM4L 3HG1A 3RJQB 3D9AL 4OV5A 2EDWA 3RTQC 4XC3L 3PJNA 3RZCB 1EHKB 4HXAL 4AL8H 3BVTA 2OYPA 4LDOB 1GMEA 3BGFB 2KZKA 2Z35A 5A2LH 3CLEL 3P0VH 2G4EA 2FZ3B 4OJFH 4H5SA 4N8VA 5TK4A 4NFBA 3ZRFC 5C6WH 4I1RA 3S8WA 2VSMB 3WI9A 1DBJL 3WNLA 4AQ1B 4F8LA 2DH3A 1JPFA 1KCVH 4TTDD 4L23A 1JERA 3LEYL 4XBEH 4BZ1H 3NJGA 2P8PA 3X13A 4AIEA 3WO4C 3TCTA 2ZX5A 5EUKA 2I07A 3FQNA 3CFQA 3OF6A 5CKAA 1FGNL 1TCMA 1N7MH 4OZGA 2F74A 2VO8A 1MWAH 5BZXA 4GBXC 1DVFC 4HULB 3I2CL 1RSFA 4IOIA 2C7FA 2NUPA 3W5MA 3MBWA 1WLHA 2MQGA 2GTWB 3WNNA 4GG6A 1AGCB 5T5FH 2QVMA 4JZJA 4RFNB 5CLWA 5EOCL 5SWZA 1DBML 1X3DA 2HT3D 4YHYB 3TEWA 3MJWA 3RVTC 5F7WC 2Y24A 1Y0LB 2Z4TA 4QJ3B 1Q90A 2AEPH 3VFMA 2DD8H 4PJ7A 5IW6A 4NQTA 4PJGA 2OW7A 2QHRL 3GI8H 4I1PA 1YYML 2CA3A 2WCPA 3ZPDA 1IGMH 3H2PA 4DPBX 4F93B 5JMRA 1QA9B 1JV5B 5I66A 4C4KT 4L4TA 3TEYA 1BZOA 3ECWA 1YMHB 3RHWF 1XGPB 2OMXB 1RSYA 4X9YA 5JW3L 2VLRA 1KXTB 3NQKA 4OJFL 4ZFGL 4K3EH 2CAKA 4A7TA 2HUEA 1JL8A 2DQGL 5D93C 3U30C 4R7NB 3GI9L 3JYCA 4ECNA 1OAXH 2Z35B 3ABMB 5AW7B 1NPNA 3GSRA 4PJ5B 3ZE2F 4PGDB 4J2XA 4DT2A 3HCVB 4L8SA 3I85A 3BT0A 4P9ML 3V0DA 4Y4FD 2CO6B 5GGSB 1NDMB 2RFXB 2XPZA 5GZOA 4X6EA 1XGRB 1HSBA 2ADJB 2MMXA 4JM2F 3EYOB 3QQ9D 1GGIL 3NP4A 3MTXA 3FTXA 3B2PA 3I6LD 4AQAA 1A7PL 5EU4A 4K71C 3UZVA 4PUBH 3U7YH 5E08H 5HI5D 1PBYA 3UERA 1JXKA 1ZT7A 1EJ8A 3WTSA 2P7TA 2WINA 1A6PA 4Z95L 2E7LA 4A66A 3MOAH 4BFNA 1CE1L 4OV6F 2VDOH 5BS0E 4AJYV 2DQEL 2MQ3A 3OSVA 1MLCA 5E9DA 3TN0B 5EEWA 1P1ZB 3S88H 1ZIAA 3WS6C 4JM2B 4F58H 5J89A 3W56A 5E7BA 3NH7L 2AI0H 1TU2A 3BH9B 3LKOA 2EICA 3P3UA 4EJ1C 3G08B 4N86A 4B9CA 5GPRA 1J0YA 4K3JL 4KK8C 2ZX6A 1GZQA 4TULL 5HYFA 5EU6D 4ZS7L 4MA8H 1CN4A 1MJ8H 5I15L 1UACH 2C9UA 3AMLA 3HNVL 2JF1A 2JKRM 2XC8A 1UD2A 4WUUA 4X4ZA 4NIKB 2XXMB 3V0EA 3NACH 2NX5A 1QHQA 2A1WH 4J3OD 3ZTJH 1JYNA 2E7DA 3CFEB 3TZVB 3OLDA 1PY9A 5EOCJ 3SDDD 4ZW7A 2FBJL 4NM8L 4JN1L 4Z76B 1A0QH 4U6YA 1FL6B 4JQIL 2E59A 4Z95H 5IK3A 4DOHB 2ILLA 5D2NE 2H4EA 4UQ9A 1TO4A 1T83C 4JQXA 2P5WA 2DQEH 1F45A 5EZLA 1U8KB 2KBGA 5T3ZL 1VAHA 3T3ME 3I6GA 3N40P 2VCOA 5EC2A 4KHXL 5BV7C 4B50A 3F62A 3VI3B 2NCEA 2YKLH 4U3CA 4GBXB 4UUJB 1CD1A 5AKVA 1LP9F 1N9PA 4Z7VA 1OL0A 4BA0A 1E50A 3BQUB 5TQ0L 1AQDB 3MRQA 3EOYG 2A99A 5F6IC 4LLYB 3CSPA 3V4LA 1JHKL 2B14A 4HS3A 4HXAH 5ENWA 3SE8H 3PY9A 3ZQWA 1LNUA 4HPHA 2F08A 5E0QA 5HYSG 1SVCP 2EXWD 1FYTD 3ATFA 4JDVA 2CKBB 3D09A 1MFEH 3QXTA 4R83A 3OAYH 3OGCB 4JZOB 2QTEA 1JRHL 4XR8C 3TO2B 5DD6B 5DHVB 2H8PB 2NDFA 2OJZL 1IEAA 4EEEA 4UANA 3C6LA 4HUKB 1BWMA 5INCA 3GXPA 1ZXKA 2NY0D 2ZKHL 3T0EE 3MYJB 3FFOA 3FU9A 1DL7H 4G82A 3VX1A 3VFOA 1F4HA 2WJ5A 3GSUA 1PS3A 4L5FH 3CVCA 4YDVA 4FN0A 4ANKA 2QVIA 1NSNL 3WY3A 3QPQC 4OGQC 4R4FL 5D1XC 4LRIA 5JLZB 5TFSH 4Y5VA 1K3ZA 3GM8A 3GSOB 2AQNA 3PLYA 4HBCH 1Q0EA 3V55A 4LEXH 5B39B 3I2CH 3VGAB 3FO0H 4Q2ZB 1QKZH 3IWUA 3KS0J 4BUHA 3PP4L 1DZ0A 2PXYD 3AM8C 4OLYL 3TEUA 1U8LA 2W9EL 3S5LG 4NZ8A 1U92A 2OI9C 3WLWC 2YJLA 1IKOP 3VXNA 2W9LA 4UZUA 2I60H 4BCYA 1KOAA 4YC2C 4MS8C 1KV7A 3OZ9L 3V6BR 4EZMA 3FN3A 3NJNA 1JZHA 2Q2EB 1IL1A 1JGVH 2QJDA 3QRGL 1XCTB 2EDEA 2JB6A 3K0YA 5E8NA 3KW7A 4NN5C 5IR1A 4ZAKA 1BYOA 1CIDA 3ALPA 3KPRD 2CK0L 4MLIA 1XIWC 4FKKA 3REWB 1JZ6A 2UZPA 5T3XH 2J71A 1CE6A 4QI3A 1PLBA 1T6WA 3DWTA 4H8UA 4LLWB 3L13A 5DJXA 5D4QA 3ULVF 1FFRA 2PW2A 1ZGLP 1YEKH 2MHAA 4MNGB 5J11C 5E00A 2J4WL 3ARGC 2ZP8A 1MCQA 2CLVA 4LEOB 3U2IA 4Z7WB 1ZE3C 2X0VA 4FF9A 2UY7A 3LIZA 2OMYA 5DD1H 4LBAA 3M6DA 4HIIB 2J1WA 4F80A 2FD6H 4E68A 1FVCA 3BDBA 2AJUH 4KKRA 1IKNA 2R2CA 4UDTA 5KTEL 4RNRB 1EH9A 2DWEA 3C87A 3K71B 1MCLA 1WEJL 3VDBA 4HSQA 2CO4A 2QVKA 3DI2B 4LHUG 4NGHL 2IH1A 2R0ZH 2XNAA 4PP1C 3EYSH 3OKLA 3KLHD 1E9QB 1EFXA 5FOBB 2GCYB 5BRZA 4Q97A 1GTFA 1F13A 2FIRT 4U1SB 4K94H 5LNGA 4JPIA 1TU2B 3LKOB 3OKDB 3KWWB 4DETA 4IIQC 4AYFA 4HKZA 1NCCL 5BO0D 4PJ7B 1FIGH 4CMMB 1FL5A 1Q1JL 1QTYT 3OM3B 2W80C 1X5GA 1NLDL 4XWGL 1U9KA 3AU0A 2ZOUA 3EHBB 4WGWB 2VW6A 4LVEA 2AS5M 1VFMA 4BGLA 3QEQD 1QYGL 4DQAA 4YDKH 3GSXB 3ISWA 3GZOA 5D72H 4DK3A 4MFHA 3BP5B 3HZKB 5J1SC 3TV8A 2I7SA 2DKUA 3MRKB 4WUKL 1V5JA 4KOCA 3TBTB 1NGXA 2GEQA 4LLYA 4LSTH 1U8QB 3V5KA 3LEVL 4WW1B 2UUDK 4GAAA 4JY5H 6CGTA 4KRMB 4NZUH 4TM9A 4JB9H 3ESPA 4GIAA 2QADD 4YHNA 4UQCA 2D9CA 4JG5A 5AWNL 1EO8H 1HKLH 3KYKH 1OTUC 4NCC1 4NGHH 5CZVH 3TO2A 1KN2H 5GIRB 1A9VA 2V5TA 1BXVA 2LGNA 3P0GB 4EI0A 3PV6A 2WGNB 4H8HA 3WTWA 3MR9B 5I19L 3GJFK 1U95B 3NN8B 4NRZA 3S5ZA 4E9WA 2UY6B 4XNYH 4JO3H 3D3VE 4OLUL 1DVZA 5B1JA 5E1AA 4XVOA 2GK0B 1GY1A 3I3EA 3U6XA 2D4DA 1CLVA 1IARB 5EEVA 2WXLA 5M7QA 2JJSA 1YC8A 2DTML 2P45B 4F7PA 1LILA 5TJWK 1OGTB 5DD5H 9CGTA 2OLDA 3BPNB 4EBQL 1Q9WB 3VXME 2QV2A 4NKIL 2HJFA 4NXSA 4PJBE 1X9RA 2E9WA 4XVTH 1DLFH 2ZG1A 4QRBA 2YSSB 1CK0L 2FHCA 3F05A 2VQTA 4BRJA 1T6BX 4BH8A 1HINH 3HAEH 4NNXA 2R1YB 3BSZL 3AWGA 3OHXC 4R5TA 3VXTB 3WXVH 4DEWA 1VPOL 4OVUA 4WW2B 5BW7A 3IS1X 4DW2L 5T5FL 1ED3B 3ESUF 4P23A 5FO9A 3T8MA 3TA3A 2OXGA 1N0XL 5DQ9A 2EVJA 1JZFA 5EUOF 1A9EB 4QPEA 1CLOL 4GXUM 4UNVA 1UXSA 1KGYE 4XP1L 4BQ9A 4FLQA 5C7ZA 5DO2D 3N85L 3N9GL 5IMLA 4HQQH 2VUOA 5LBSH 1JPSH 1T2QL 1CICD 3P40A 5CJOH 3GNMH 5JNYB 4ONGL 3N06B 4OJYA 4RGNE 1KB5H 4MNQD 4HKJB 4JJ5B 3C8KB 1IM9D 4RGMC 4S1RL 2VR4A 1XCQA 4JDZA 1NFDF 1O7DC 2RD0A 5FYKU 5EZIH 1EBPA 1Z5YD 4DP7X 1XB6A 5F1NA 3OJMB 4K7FA 3NCWA 3MXWL 1NUFA 2KDYA 4ZUWA 3QHFL 5AZEH 4BZYA 5IP4A 4YWGL 3BKCH 1RMFH 4LSQH 2P5EB 1I1RA 2D03L 4JPWH 1N8ZB 5ID0B 4OI7A 1BM3H 3CMOL 5F0JB 5LGJB 2VERN 2J88L 1YHPA 2FT8A 4LSSL 1FNSL 3L3GA 3AUVA 3WFCH 4IGBA 2N7BA 5TF1L 2HRGA 2UZIH 4NSKA 2VM4A 2ZXEB 1UADC 1EZSA 5IOKA 4YX2L 2E4TA 4AYGA 5DSCB 2XQBH 1WT5C 4G8GA 3AACA 2FE0A 1OM3L 3S96A 5DD6A 1YECH 2IF7A 1Q0YL 2VLKD 2FYYA 3B9VA 5FV1L 1KCWA 4XOEA 2HRPL 1R9FA 4Y4KB 3UABA 1I85A 4S1QL 5I28A 1KTRL 5FGRA 3IGKA 3FNKA 1KB5L 5MP6L 3GSXA 3CVHL 3PAVA 1P6WA 1NCOA 2HT2C 3HLKA 3OG4B 4QOKD 1KJVB 3HMXH 1IM9A 2BCMA 1OSZB 1YZZA 2WLNA 4PGDA 2Z92A 1JMXA 5F1SA 1WEJH 4HG4J 4IBUA 1NEUA 3MBED 1XSOA 3HHMA 3ZZLA 2JB5H 4KTDL 4NZJA 2XN9B 2DIAA 4Z6AT 3CE1A 4NUJB 2YAPA 3T0EB 4C56A 3L7FB 5TDOA 5EU6A 4XP6H 5DQDH 3QQDB 4UDUA 3P3RA 4LHQB 1URZA 4Z7NB 4U1MB 3ZIMA 1E3ZA 1CPUA 1NC4B 5CJXA 3GMPB 4U2ZA 3QCVH 3WAKA 1HXMA 2K6YA 5BO1H 1Z9LA 4LIQE 2BSSA 4B9KC 2QZQA 3DJTA 2XG4B 1S7UA 2AMUA 4LL1A 3FBKA 3U9UA 1VFAA 4FD0A 3DGGB 4L3EA 3ULVH 3MBWB 4J3VA 3N2JA 4NQEB 4RMRA 5D8JH 5CU5A 4QF1A 5F71A 4WJ5B 5EO0B 4LLWA 4PWGA 3F65A 5J1AB 3U30B 5AG9A 5EIQA 4OUUB 1JK9B 4OFVA 2X44D 3T3MB 5IT2L 4WNJA 5DS8B 1NBVL 1TNNA 3TESA 4OLXH 3P4NB 1F90H 4TUKH 2GIMA 2HPOA 5D6CB 3ARDD 2D7QA 4OIFA 4EDWH 4DH2A 5ADOL 2PCYA 4LPVA 3IKKA 2CBMA 3E6HB 4PY7A 1Q9OB 1WV7T 1KGCE 2NYZA 3G6JE 4FLOA 1CCZA 4NIYE 2DKMA 4NZFA 3TZVC 1YEHH 5JIMA 2FBRA 1OAZL 2XJKA 4AEIL 2CBTA 4OZFA 2XFXB 3SGJA 3G5ZB 1WC7A 1WF5A 2OMTA 2YAOA 4LCYB 1HNFA 3UCRA 2YA2A 2F8OA 4AENA 1XGYL 3U1PA 1FYTA 3DBXB 4AIZB 1ZEAH 1I8IA 4X6DA 2NY0C 3QR2A 2JI2A 4J1UB 4RBPH 2V7NA 4BK4A 2F8IA 1QVOB 3GRWH 1IAKA 3WNJA 4MAYD 4I0PB 4Y4FB 4XO5A 1QI4A 1MLBB 3VNZA 2A6IB 1D9KA 4L9DA 1SZNA 2X41A 5T1DH 1BLNB 3NZ8B 1GZHA 3CZGA 3MV8A 4HEPG 2WBKA 3C2SA 5I8CA 6TAAA 3U9UB 4X6CF 32C2A 2ZXCA 4HJ1A 2Z91B 2WNWA 1N3NB 1U3ZA 3JBG7 1KJ2B 1YMMD 1UXWB 3S35H 3U0PB 3D07A 3LQAL 3TVMB 4BH7B 4E41D 5EB9A 1IT9H 5E08L 5JXAH 5AKTA 2JFCA 4NPJA 2XCMC 4YXLH 1JF1B 2YQBA 1XF3A 2O5NA 3LJ3A 3PDDA 1JHTB 5JUEL 4KAQH 3BJ91 4XNQB 5IM7A 4S1RH 2IMNA 1PNDA 4DUXA 5B3SB 1NIEA 3HVDA 2ERJB 4K0OA 3L81A 3QUGA 2J8UF 3O0RL 2WVVA 4PRIA 4HWBA 4GO8A 2H32H 1ZPLA 3TC9A 4E41A 4UT6L 1B90A 4AEHL 5D96C 3HN8A 4FLHA 3FT2A 3SBPA 5I8OH 2YD9A 5CN1A 5AAWC 1IGTA 3IXTB 1FFTB 3Q5YA 3QZBA 4GUPB 4BSJA 5IEKB 2WXRA 2YXWA 1I9IL 2C1OB 2YGVA 4E9QA 2GUYA 1GJWA 3HUJE 3DI3B 4MA3A 1BQRA 2JH2A 1X4YA 1HIMH 3HW7A 3GF8A 1UZGA 3V7MA 3DIFB 3CFBA 2ARWA 4LQ1A 3FO9B 5D9SB 1CGUA 1P69B 2EC8A 3S35L 2L7EA 1M3IA 3S2CA 3MJ8A 4FAAB 2QFRA 4UTAH 1BVLB 2GBUA 4U7MA 4ZNEA 4RDQF 1DQMH 1DSFL 3GJFH 2WOYA 2VDKL 2EEBA 3IK2A 2LE9A 3KPQA 3EH5B 4X9BA 3I6GB 3KEHA 3C5ZC 1FLRL 1WPCA 1VGEL 5CINL 4KTGA 3EF4A 3KPNB 4JO2H 4MTMA 4GEJA 1CXFA 1PLGL 3BAKA 1BA9A 1AO7D 3NSFA 5A2KH 2D9QB 2JI1A 1IILE 4DPRA 5CEZD 5EU3B 2JQZA 3HN3A 5I16B 3BDYL 4RX4A 3QZPA 3VRIA 2GJ6E 3B9KC 1WBZB 5JA9A 5IV2A 1YPZA 1I9JH 1UJ3A 5D1ZB 1OAJA 2Q1EA 3SDCB 4AQEB 4MNQB 2AABH 4XN7A 3MRPB 4Q6IC 3VWJD 4YFLI 2ICEA 3ZDYE 3VI3A 2XACC 4QRPA 2ITEA 4OH2A 1VKXB 2R0LH 1WAPA 4G1EA 2KI6A 3BSGA 4O02H 3G6JB 2ZUQC 2J57A 4R2GD 4YLCA 1D5ZA 5IFJB 2EUXA 3D0LB 3L1OL 1MH5B 1QPXA 1UB6B 5T33L 3E2HB 1G7PB 5BO1L 4BQCA 1KIRA 4EI6B 3BP6A 1Z3GL 3P2BA 4GQPH 4TVPL 4HSAC 4FTVE 1FVDB 2FIKB 1BX2B 1Q9LA 2HMIC 1F97A 5DQ9B 4P5TA 5LNDA 5I1JH 5IESL 1KCUH 5LLIC 3ARZA 3ABGA 5LN8A 2GSGA 3HKZA 2X38A 2WY3B 5E8OB 4LCWB 3IRZA 4MYPA 2IQAA 3NFNB 5DZPA 1YYMH 1CT8B 1FNHA 3GXNA 1VIWA 4NQCE 3LH2L 3MODL 4FJYA 5E1AB 4N25A 1LWJA 1R3IH 3FFCB 1X5AA 3GGWB 4UQ2B 2AJZA 3IS0X 5FYLE 4IRSA 3UADA 3BQUD 2J1XA 4FKHA 1IC4L 4XP4H 4YLQT 1ORQA 3FS9A 2JKWA 3WFEL 1LDPH 3UAJA 3G04B 3IFOB 5J12B 4ELMF 3FL7A 4IU3B 5DYOA 4MMZB 2R8SH 3LIUA 2AHIA 1CB4A 1N0XH 2MKWA 3T71A 2XKNA 3CJJA 4OJDH 4BWWA 4QHMB 3B56A 4XCFH 1DQQB 3MLZL 4M48H 2NDGA 3GK8H 5GZNC 4IOIB 3VYPA 4C58B 1NFIA 2XXFA 5BPPA 4DWHA 5IIEB 3C5ZD 5AVXB 1F86A 4J4PC 1OARL 4XHJC 3TV3H 3NGBB 1J8RA 2XPYA 3QUYA 1M7DB 4FQHB 1HQRA 4QTHB 5FFOA 4G5AA 4CN6A 3DGGA 1E9PA 3LTVA 2YZ8A 4J3WA 1GOHA 4WIQA 2K8QA 5J6SA 2YRPA 3PXJA 2FWLB 5BV7L 1VFBB 3NA9L 3BO8B 5JOPD 1S7TA 4AM0Q 3QP3A 2CHWA 1RPQA 2VKWA 4R0LC 3QEUB 1KCKA 3FC8A 1SEBA 4IBYA 4AKOA 4I5BA 4PV1C 2X4TB 3MRFB 3VCLB 4H88H 4AQZA 4CVXA 1IT9L 8FABB 3Q7JA 2YFNA 2YAQA 1H3PH 2CNZA 3ULVL 4W1TA 4TYUA 5E8DL 3O3AA 3FTUA 3HS0C 1J9CT 1Q94B 1MWAA 4FFYA 4R7DA 2DB8A 2XWTB 3B7SA 4OQTL 4UUJA 3PL6C 1ZDSA 1XAUA 1RKRA 3ARDA 3MUY1 5B4MD 1KGUA 3EHBD 4OCRL 4TVPD 1TTCA 1TTUA 2P5EA 1Q9KB 3VTTA 1P7QA 2WN3A 3HZKA 4NHUB 5D5ME 1ZS8B 2B16A 4GKLA 3TPUB 3HNVH 5L7XH 4P4RA 4PG2A 4KWUA 1UA6L 5HHMD 3QSKB 3VH8B 5K59E 1PZCA 2XKNB 5B21A 1R24A 3ZR5A 3CPUA 5ACZA 4FULA 1INDH 2CHDA 1SFDA 2XIDA 1QFWL 1YEJL 4HETA 1DQKA 1NPJA 4JK0D 2A5UA 3IJHA 3S96B 4U7KA 3ZO0A 1TCRA 1T7XA 4F5CA 5J1TC 3MVSA 4F7EA 2ED9A 3AWEA 3OXSB 4G9FD 4OAWA 4P4KC 4P8QA 2ITFA 1F6LL 5E2WL 5EDSA 1QR4A 4O2EB 1H0DA 3EH4B 4GRWF 3HAEA 5D1ZC 4XVSL 3WUWA 3VRJB 3HS0B 1E2VA 3IAPA 1NDTA 3M7OA 1QZNA 5J4MA 1ML0A 3BZEA 3TBWB 1GIGL 3IE9A 1DQML 1WG3A 3QDJA 1SYVA 4HF5L 3PQYB 1RUPH 4P2RD 3Q13A 4Y1TA 2ADFH 4D9QE 3B2UD 1Z1WA 4BSWA 2BSTB 2X9YA 3U46A 5K9JL 3SPGA 3W9DB 3V0WL 2Y7QA 3KCPA 4NAMA 2F5BL 2ZAHA 1GC1L 3BH4A 1CFVL 2GTZB 1BFVL 5EOQH 5ICUA 4ANXA 3ESNA 4DKAA 4AIOA 3MLVH 3QDMB 2QVTA 3LS5H 4Z0XB 3SY0A 5CEYA 2QSVA 4U1LA 5DEFA 2V17L 3DYOA 4M3HA 1URLA 4P2OD 4GLRH 5MEQB 4Y1SA 1YRKA 2E46A 2P7TB 3ARRA 1PCXA 5BV7B 4OZHB 4UMGA 3VSQA 3JTTB 2Z31A 3SBQA 3LXBA 1M1XB 1NGPH 1UQSA 3KPNA 4GI8A 3V4PH 4G71B 1OCZB 3GD1C 3M17B 1CFQA 2YBRB 4G3YH 2WN2A 2MH4A 2WXOA 3D3VB 1RZJL 1D5IH 1M9WA 5BUGA 4JHUA 5CMAB 3K2MC 4DUVA 3WIFA 3GS7A 3GNML 1JDCA 4P9MH 3SKMB 1NMBH 3TYFA 1TZIA 1QRNB 3QZOA 4PY8I 5DQJB 1DSWA 1S7QA 4LEXL 3R1GL 2Z34A 2QPFA 1ES0A 4IKKA 4ELDA 2JMRA 1M4KA 1KTLA 4M8UA 1K72A 2ICCA 1CQKA 1PU0A 2YPKA 5G4OA 1PG7L 1NAMA 1PKQB 5IEHB 3ZHKA 1WCBB 1T1ZB 5HGDA 3ABZA 1J0ZA 3PL6D 1P1VA 3DJRA 5DK3A 1GY2A 4QT5A 2D2OA 2APBA 1OAKH 1PQZB 3MOQA 5E1QA 3D0AA 4JKNA 2GC4C 3COOA 3MUJA 1XSIA 4O5LH 5ITFA 5IB4B 5ITBL 4JFEE 4U1JA 2CBOA 1DVSA 35C8L 3KPLA 1E2ZA 1UATA 3QWRA 4EUPG 1E6OL 4M93C 4FNQA 1KWGA 2J8HA 4NHCL 4KXZH 1OE3A 3NH7H 3WKMH 1DBAL 3EYQC 3LZNA 2VJ0A 4MXWL 1Y6MR 5IFAL 2BNRE 1RURH 2W0FB 4B9YA 1T1XA 2CDFA 1QD0A 4OCSL 4GUOA 5GGRY 4N5UA 1LXMA 4OGAD 3ZZSA 2V4LA 3CLFH 4HK0A 4JUTA 4X4MA 4ODBD 3OZKA 2IPKA 4I0KA 3Q1EA 1V05A 4OFYD 4WQOA 5D7JD 1DJXA 2VL5B 4JE4B 3FH7A 4L4VB 2A73B 2CJSA 3MRIB 2UXTA 1A7OL 1E4XL 3QQ3A 5SWSD 5CD5C 3JSSA 3O45B 1XF3B 4CKVX 3FRUA 4YIQA 3VFUB 2X3AA 1KEML 2Y72A 3VG9C 2ZF8A 2DWEB 4MNGE 4P3DB 1LQSR 4JM0A 2R27A 1A1OB 1FIGL 4EUPH 3KHOA 1QPPA 2WXIA 3B3IA 5IB1A 5L9DL 5IROD 1KNOB 2EH8H 2NY6D 3L7EB 5ECGA 3HZVA 5HVGB 5C6PB 2I69A 4NN6C 3CSBA 2X9XA 1OB0A 4G7VH 2OZNA 4U0RB 3UAEA 4C55A 4A04A 4X5LA 4MJIB 3BAXA 1YC7A 5AB0A 5FF6B 2IQ9H 3BZFA 4PV9B 1DJGA 2Q2LA 5FGCE 3LH2H 2X40A 1A4CA 2YQGA 4BXSV 1U58B 3EJJX 1WBZA 3KBEA 1L7IL 3ZKMD 3RWEB 4WSKA 1G84A 3WSQL 4K5MA 1D6VH 3MGAA 1NGWB 3K4DA 3ZE1E 4TQHA 2ICEB 1I1FB 2IBGA 5LBVA 3E6HA 3ARDB 5F0LB 4DP6X 2NNXA 3FU6A 2NW3B 3ZZ1A 4HPYH 4OSUH 5IR1B 5DD1L 4F33A 3TO4D 3Q6GH 5IF0A 5ADOH 5JW3H 3MACH 1XGRA 4NZTH 5HI3D 4P5SA 1TUPA 3T8VA 2K0RA 4LVHB 4X7SH 1A3LH 3OHXA 4M8QA 3HAEG 3PWUA 4DPCX 1IFGA 5T1JA 2VXTL 1G0DA 4ZUUA 4WWKD 4DP9X 3QZWB 3L08A 2AABL 2VR6A 4XE0A 3TVMC 5C0IB 2NTFA 3AROA 3MJ8B 4GS7C 5K39A 2YC1A 5KYUB 2H1PH 3NUKA 1LO3H 1OLLA 1RUML 1B3JA 43CAB 4QRUB 2ZXWB 3C60D 1CD1B 4X99B 2R7EB 3CFJA 5DRZA 1U8MB 5DMYA 5DJDB 5FGBC 4FI6A 3MLVL 3N04A 3WJMB 5B38A 5DEGA 4PJFA 5FOJA 4X5RA 5HDWA 1LNUB 3B9AA 1CFMA 3RFZA 1T7YA 4X6CB 3SPIA 2JQAA 1MHHA 3BWUC 3UTSB 2DW5A 3ZMNA 2QADC 3S34L 1ROWA 2A0LC 1K4DA 5GRWA 4LIQL 4JFQA 5I73C 4OCWH 1AZCA 4DJMA 3A4DA 4OZIF 3VE0A 3W9EB 4I77H 3HE7C 3GMQB 3IDJA 4MD0B 3MCG1 4G9DA 2WUCL 2P8LB 3UJIL 5IOPB 3TZVD 1QPKA 1AOZA 4XH2A 3GRGA 1B4JL 5I8KH 4DGIL 3QRLA 4UQDA 2NOYA 3V0HA 1BREA 3Q01A 1BAFH 5GJSH 4UTAA 5HGDB 4E41B 3SOBH 3HBGA 3M8OL 3PWLB 1R33A 3V0VB 2DJUA 4OKVA 5E03A 4BHUA 1A3RL 1OWWA 3IDMA 5EIIG 1F3JA 1ZIBA 2EVFA 1UD5A 3C09B 3WMQA 3O0RH 1SF3A 4QGYA 4W9CC 4XE5B 2F53D 3V7AG 5FB8A 1RUMH 2WOBA 1X5KA 2FGWL 1BJ1J 2XQ0A 2J7LA 3VWKB 4CSZA 2BS8A 1INQA 3MFFB 1CDJA 5CZRA 3BP6B 2N1TE 4V1DB 1ETA1 2OQJA 1G1CA 4YUEH 4N2LA 2OTWB 1P7KB 2JLPA 3GJFA 3UTOA 4IRZL 1F3RB 5LAXA 3G9AB 4XX1G 3LAFA 5E4OA 4YX2H 5C0EA 3CVIL 5FPIA 3EKCA 2DDQH 4IOSA 4PRNB 2BC4B 5EZOL 2I27N 1OF2B 3SE6A 4EF3A 2IPUG 3OC8A 2HWZH 2VH5L 4ONFL 4P3CH 1ZLSL 2DQIL 4WNQA 5I1AB 1YSOA 1LE9B 1E4XI 1IAOA 4TQEH 4QDGA 1X5YA 2Q20A 1HQ4A 4Z8FL 4LOFA 2MJWA 2PR4L 1OXYA 2WB7A 5C0GB 1BQKA 3VI4A 3EDKA 3HLAA 1FLRH 1RJCA 5CINH 3PFQA 2NR6C 3G6DL 5JPNA 4H8WC 2YIHA 3BCDA 3M8OH 3TONA 2EIZA 3VXRB 4OAWB 1AQKH 2CPCA 2WBJA 1HL9A 1NUGA 3FU3A 2YR3A 3FJTA 3WXWL 5JQ6H 5I71B 4ZJ9A 2ZKWA 5F9WC 3V4UH 5KZCB 1J8HB 3VD1A 2ZXQA 3P4OA 3ZDYB 3QDJD 4P06A 4L8CB 3VU2A 2BHFA 3QXAB 1J0KA 3QDJB 3BH8B 2AJXH 4AI7A 6PAZA 3AREC 4PJ5E 4QY8B 4P2AA 3K6SA 1NL0L 4QXTA 3KYMA 4BE5A 4IMLA 1MPAL 2FLBT 1YNLH 4IS6B 3B2VL 1OGAA 2OTWA 3FQUA 2QGEA 2ZCZA 1IAIH 2AZAA 4W70A 1L0PA 1XH1A 4PRHE 5I6XB 2J8UB 2HWZL 3T4AB 1KJ3L 3U9WA 1BF5A 4IOSD 1IIIA 4YSUA 1OW0C 5EO9B 5I1CL 2FCBA 2OMZA 2EZ0C 1HNYA 4PRNA 3X11B 2K7QA 3CFCH 4EBQH 3TN0C 1GIGH 4P4KD 1B6UA 4R7DB 1SJHB 2GBVA 4A2EA 4OLXL 2BOBB 3UYPA 1YQ2A 3OAUL 2CR0A 2X4RA 1AD9A 4ANUA 4LL4A 4HALA 1YQVL 4ZI8A 3D39D 5BXFA 3MJ7B 5FR3A 4KNUA 4LU5L 1MQ8A 1NBQA 1NMAH 1D6VL 3OKDA 2EXWC 2BOLA 2F58H 5HHOD 3TU6A 4ELKB 4K7PH 4AKQA 5MEPB 3VAEA 5I30L 3IPFA 4ZODA 1QHPA 4Y16C 3WD5H 4OZHF 1IC4H 1AP2B 5E9NA 3UBXG 4WCYH 5BOZG 4XH2B 3K71A 4MJ6B 4KY2A 3IDIB 4GKZA 4NOBA 4YHKL 5LGKA 5I5JA 2RA1A 3KS0H 1I7TA 4R3SB 3T2PA 2D8KA 4LDEB 2F0CA 4XGZA 4G6JL 3X14A 5ISZE 4ES9A 1GPOH 1D7CA 1IFRA 2FECL 2GCYA 1P0SE 2MNJB 5BRZB 1IKNC 1TJGH 3DETC 4WI5A 2R56H 3VXRE 4AQ1A 3X12A 2VQ1A 3TT3L 2HG5B 2H26B 1U91A 3S36L 4IKNA 1KYFA 1FL5B 2ZONA 1AKJD 1NWPA 4XN9A 4WK0B 3U83A 4N9OB 2JKTM 4XPHL 5IWLC 2L0DA 4P99A 3O6FC 1U93A 2XA8H 1QW9A 5HJGA 4YE0A 2NT0A 5AW2B 2FJGB 2EC9U 3M7FB 1OF2A 4W4OA 5F21B 5TE7L 1OOWA 2VXQL 3MNMA 5ILTL 2V8MA 1OM3H 2YWYA 3MRCB 3T5WA 4OCXL 1NBVH 5E8EA 3V95A 2BIIA 1CXEA 3QJHA 2QQKH 4HKJA 3JV4B 4H26B 4M4PA 4QHKI 5EV7A 4LQFL 2DQCL 4HHAB 3NIDB 3P1VA 1IVTA 2O6FA 1LO2L 4ZAKB 3AGWA 3O2VL 1QEWB 5C0JB 4XAKD 5I73B 5LQBH 3CIAA 1S9VB 2ARJQ 2BMKA 2QGDA 1MFVA 3Q6FB 4V1DE 4X98A 5E4EC 4YHMH 5FW6A 1J5CA 2ZUQB 4N22A 3SDAD 1Z9PA 4M8VA 3E2HC 4QYOA 1NJ9B 5F7DB 3UH8A 3WJLC 2M1KA 4MX7B 3VM7A 1BPLB 5GRYA 1H5BC 1FL3A 2NRDA 5F9DC 2YMXL 3J2PA 1VHPA 2E47A 5DLML 4XP6L 3Q8AA 5HGBB 2YS4A 1WFNA 1JVOA 2FO4A 5EBMA 2ZJSH 2DDQL 2WXHA 3P54A 4L1HA 2Y7LA 2DM4A 2VO5A 2I5YL 5HYIA 3IDMB 4LGPB 4IRZH 4DTGH 4UMSA 5F3FA 4APQA 4PJ8D 1DUYB 3SGDH 1KLUB 5L4MA 3LSOB 3PGFL 1BQ5A 1BZ9A 2F61A 3BVNA 3DJZA 3S37X 5FA3B 2CRZA 4HWNA 2EDFA 1FVEA 3BXNA 3IGFA 5F9OH 4AYBA 1I8MA 3P73B 1DN0A 1DQDL 4XNXH 1FZOA 3TA4D 3AWFA 3LHPL 3X1GA 4PLJD 2FQDA 3J27A 4NQEE 4OCYH 4D3CL 3QC6X 4TN9A 1X5XA 2Q3AA 4PD4J 2XTJC 1NCIA 2QDVA 1MFDH 1OALA 5DHYB 1KB5B 1PJ9A 2OCCB 4Y16D 4Y2DA 3AJ7A 3PWPB 1XD1A 1F6AB 1CDUA 3BEVA 1EK3A 4O2CB 3MV7E 4EDWL 3T0EA 2ZP0T 2E7BA 1C5DB 4BH7A 3FH8A 3AAZA 2UZYB 1R19A 5IB5A 3ULSA 1D2PA 2E0PA 2A9NH 2GW5A 3HI6H 3EZ8A 2H9GB 3KEDA 4XNMB 4HU2A 4NOFA 3LXAA 2F54E 3FT9A 3Q5OA 5CHNA 5F3BB 3ETSA 4IW4C 4LARH 4Y8AA 4S1SL 2XN9E 3WS6A 4GUQA 1XR9B 5CU9A 3TBYA 5MEOA 1X5MA 2R59A 4WUUB 3MREB 5D7LA 4WEMB 1SXNA 2WVVB 3OD3A 4ERSL 4NZTL 3KPOA 3LZOA 4UT9A 2HYMA 1RZFH 5D7HA 2IV9A 3GRWL 2C9SA 4OD3H 4O58L 2NXZB 2FLMA 2WIMA 5JZ7C 4DN4H 5E51A 3IRPX 1G4MA 1HJCA 2JCCA 3UO8B 1HN1A 1ACYH 1XF5A 2AQSA 2BSRA 2EDJA 4QXWA 4YOKA 3AQDA 4FNRA 1T1ZA 2NY5H 1ADWA 5KBMA 4PV9A 4N2KA 4EDXB 1R47A 1MFDL 1C16B 3KJ4C 4CW1A 4KXCA 5JPNB 1IBBA 4HS6A 5ACMA 5GGVY 3V4PA 1S5IH 4V33A 4N28A 5JHLA 1QFWI 2CO1A 1QLFA 2B0SH 3QUZC 1NBYB 1JS4A 2RTTA 3Q5TA 5GGTA 3MLTA 3TNNA 5AENA 2J72A 2PABA 4JFFE 3MLSL 1JWMB 4OZFB 5F7LB 1KB3A 2Y5EA 4HCRL 2BWQA 3ZQ9A 3GK8L 3QJHB 3P69A 1KTDA 4XMLL 5IQMA 3FCTB 2F53A 2VXQA 1U91B 1BOGA 4HBQA 4D0DB 4OZ4B 3WS3B 2L7QA 2ADJA 4TUJA 2LW3A 2OMYB 3TS8A 2F19H 4G6JH 3VXRD 3EJPA 4DGYL 4PRPD 1P7KA 4DKDC 1B4JH 3KBFA 3BEWA 1OGPA 1BLNA 1LJMA 2PPAA 4OD2A 4W9KC 1S7XA 1T66D 3P4LA 4W9IC 2F8VA 3VACA 4OFDA 3QZMA 1J05B 5JIIA 3QO1A 5E70A 4PJ9B 1BCIA 3FN9A 1BYPA 4N1CA 3MA9L 3MTRA 3A67L 4B7IA 1S7WA 3L1OH 1KXTA 1UKSA 3ZL2A 4TNVF 4X7EC 1CDBA 1A6TB 4LNRB 3WDIA 3B3IB 1E4KA 4M9OA 5JO5B 3JWOC 3F7RA 1E0OB 1C5CL 2OW6A 3ESOA 3WJJA 5CAYB 3DXAD 4OB5H 1NFDB 1WGVA 5J06A 4GRMB 4JHAH 3FAXA 1TFPA 3RIKA 3WEOA 2AXFB 1XH3B 2VXQH 4EE2A 1NMCB 1DBMH 5ILTH 2WXJA 4PS3A 1XZ0B 3P9LA 3LZQA 3QIBC 3LN9A 1BQLL 3QA3A 4MA7L 2RALA 4Y4KA 1WUNT 5D7LE 4GKZB 5J13C 4U0RC 4HV8B 1SMOA 4RGMB 5IW1A 4D2NA 4YEEA 1UH4A 3DSFH 4NBYB 4JQVA 1ACCA 5JDSA 3S5LB 5EUOE 5C08A 1GRWA 4JM4L 4PJFE 4XCFL 5BQDA 1ODUA 3G9VA 4P2QB 2O5XL 3CFIC 1YEGL 3AS0A 4JZJB 4G8EA 2X05A 2ZOLB 5D4IA 3HI5H 4N6RA 2H6PA 4HWZA 1FE8H 2YSTA 4PJDA 4XHQA 1J10A 3QYMA 3ISYA 3RIAK 1A6VH 2CKBA 5JQ6L 3PHOB 3WFDL 2UWEB 3V4UL 5ACLA 2H41A 2CM6A 4R0LA 5IBTL 4MYWB 2PCXA 4NC0B 2M83A 1QSEE 4DP4X 2HJKB 1EERB 1TJGL 4FFVC 4DSYA 3DDFA 5FYLD 2OMXA 2BLFA 4X7SL 1NCBH 3GUTA 2IQAB 2CRIA 3NFNA 1S9YB 4MJHA 3HKFA 2WBJC 1MCPL 2WTRA 1DQDH 1QUPA 4B60A 1GS6X 2PWFA 5AEAA 4AZ8B 4TNWK 1AZUA 1ZLVK 5CCKL 5F1OB 4HKZB 2EEDA 4XMTA 1I85C 1AI1H 1P7QD 5HHNA 2Y7QB 3KCPB 1L9OA 3QFJE 3TFKD 5JXED 5EULV 1QUNB 2HFFA 3DXAE 2CSPA 1U8OA 1V7NL 3FN0H 4FABH 2O61B 1E3FA 4L8BA 3BRGC 2W0LA 1NTDA 4Q9RL 1U30A 5F96L 4WLCA 5KBKA 4A55A 1FL3B 1JWMA 2BPBA 4ZAKD 1D3CA 3H9HA 3I6KA 2H3KA 4F8QA 1GA2A 2A9MH 1F1DA 4NQED 2Z4QB 4U3SB 5D7IF 4LCWA 1MW1A 2C9AA 1YY9D 4ISVA 3ZE2E 1ICTA 3F7VB 4HCRA 4KRLB 4FQLH 4LSUL 1QQDB 3CDGA 1CE6B 1F3JB 4ZYKB 5DS1A 3OPZL 5EZJA 3UBFA 1E6JL 4OD2B 1MRCH 2XWXA 5D6DA 1SHWA 1FZJA 2ADIA 2Q7NA 2X4NA 5C0ND 1KCBA 4PJAA 2OL3H 1J7VR 3LXCA 1JGUL 2VR8A 3HMXA 1QO3B 4PGEA 4Z77B 3FCTA 1X4ZA 5AYUL 2KS0A 2GHZA 1A7QH 1RY7B 3WUWB 1I3VA 3W0WA 2XZZA 1H3PL 1EANA 1MRFL 3OJDA 4PJ8B 5IVXE 5I1LA 3WEXA 1CO1A 1S5IL 1ADQA 4QMEA 3VH8A 5L2KD 4PV8A 1K8IA 4TQPA 1TDQA 1KULA 1G7IB 4OQTH 4HZAA 3G6JA 1PG7X 3L9RB 1RP8A 3AB0C 3THML 3FB6A 1QATA 1Q38A 4RISH 3FTGB 2Z8WC 4YO0A 1FNEB 4TUUA 3QEHA 1XZ0A 3LD8C 2Y07H 1IEBA 2V5MA 5DFAA 2XI9A 5T3XL 4WI8A 1QA9A 4WV1C 3IDYB 4M61A 1D5MB 1Y6KR 1U3NA 1YPZB 1EZVY 2MQCA 4MXVE 4OR1A 1E90A 1AGEB 1FFOB 5JDSB 4JPVH 4PRIB 4JQVC 4RSYA 1V8HA 4M6ML 1KTBA 3LPGA 2HTKC 2APTA 3L3JA 1LO0L 1F4AA 4YAQA 4ZO8A 3IJ7A 5EPMB 1VFOA 3GJEB 3MA9H 1CLCA 2MPVA 4Q56A 3T9WA 4UQBA 4IU3A 2F8XC 4LAQL 3P3SA 4O9HH 3T4AC 2PWHA 3ELAT 4IIQA 1BV8A 3GHBH 4I3GA 3VXOB 4N0FA 1GVIA 1RZGB 2GT9B 1RUPL 2Y7SA 3BP7A 3D2UD 3FSZA 4M7KL 1CFTB 1U8JA 2ZJSL 1UASA 3GBMH 4YK4B 5SWSE 5KZCD 4E42B 3F6JA 2NQ3A 2B39A 1L7TH 1GGUA 2ZWSA 1X5JA 1OSPH 2F5BH 3JWDH 1RD6A 3FSOA 1RUKH 1F41A 4MX7A 1S7WB 2XVGA 3TO4A 3JTTA 4L1DA 3MZGB 3BYYA 4WY7L 3VSTA 5I1CH 4LCWE 2X09A 3TYGH 2B77A 3Q05A 3SYCA 4FLSA 2V2WB 3DSFL 1O6SA 3V4VB 1UD3A 2K4WA 3AM8A 2J43A 4LKCB 4RX4D 5D72L 3ARYA 3L3IA 2XY2A 4U1GB 3RA7H 2E74C 2VB5A 4L37B 4BDVA 2QSCL 2E6QA 4YSPA 3SGKC 3B7YA 1J1XL 3LSOA 4P46B 3FHEA 1N5YH 4XPBL 4YXKH 2IALA 2QFPA 4KJQC 3LEVH 3HUJA 3V0AC 3SPHA 3C60A 4KO9A 4QYOB 4PJ9A 1DE4A 2DLFL 4Y19E 1DUZA 3V6OC 2GKIA 2QQNL 1DEEB 4LCCA 4Y2DD 1DVQA 3O3BA 2EYTA 4ZXBC 2ARJA 3WIAA 1UJ3B 5D1ZA 3T0WA 2PYEA 4XOAA 2CBQA 3WTVA 4W9EC 3MLZH 1FFNA 4XOCA 5IF0B 2VRAA 3D34A 5D2LF 5FM5O 4M62H 5DD3L 5JOEA 2YEVB 4JN2B 4FEIA 2VLLB 3ULAB 1D5BA 4K3HA 1F11A 5D7LD 3V6FB 2EP6A 3IPEA 1QFUL 4I89A 3TURA 1QG3A 2VR9A 1D5XB 1MY7A 5IREA 2XXCB 1M7IB 3F00A 5FYKL 3ZT6A 3EFOB 3RG1C 3TBBA 5J12C 1SM3L 1QNIA 2EIMB 3C6LD 1JAEA 4I8DA 5BQ7A 3GKWL 3QIUB 2XN0A 2QHRH 3GI8L 5BS0B 3U25A 2YUXA 4HOMA 2HTKD 4HGWB 5IGXH 4FQQB 5KG9A 1P84K 3GHEL 5E99H 4ZFGH 2YD4A 4OZIB 2XVLA 2IDQA 4UOJA 3APCA 2A9AA 4PHXA 4DZ8A 4YHPA 1TZHA 1CLOH 4L4VA 5FCUL 3DJSA 2WWOA 3OF6D 1NDGA 1RJYA 3JWOL 3V6ZB 3WY4A 3NJMA 4I9WE 1RHHA 4PJIF 3S8GB 1AC0A 2V37A 4XP9H 3U4BH 4CW1B 5I1DB 4HHGA 3Q9PA 1OAZH 4AEIH 5H2BA 1JDAA 4ZX3A 3OPZH 2D7MA 4JRXD 3RPIA 5ISZB 3WE6A 1MW3A 3B1UA 2EIKB 3VFGH 2TSBA 1JTOA 3WIIL 4GW5B 1A7OH 3QQ4B 3H54A 5EH1A 4MJJA 1NAMB 1PKQA 3RZCC 3VFRA 3WKYA 5AB2A 5E6YA 3APMA 2YAEA 3HB3C 4BZ1L 1FP5A 1N2RA 4Q89A 1IIKA 1U4EA 2EO9A 4QCIB 1U36A 3DX0A 3HC0B 4RMBA 4RMQA 4UQAA 5HVHB 2DMCA 2W0FA 4LLMB 2DJMA 2BX5A 5JPNC 4LCUB 3C08L 2IPUK 4NENB 1P6FA 4B41A 2Z93A 3P02A 3H9YA 3OBAA 4JFFD 5HHXH 5G4MA 3B4NA 3E8UH 2ZUXA 2OM5A 5JIQA 1CGSH 1RIVL 3EUUA 2ENQA 3DV4A 1C12B 3GXTA 2PR4H 4UM8B 4XI5D 3W2DH 4IRSC 1RJLA 2WAHA 1DN0B 2OZ4L 5E6UB 4UZSA 4CMHB 1HK6A 3MLPA 2D3JA 4XZUA 4W9JC 3TO4C 3WHXA 2DM2A 4NKMB 2Z31B 2JCCE 4H8VA 5JQIB 2OX5B 2YJQA 4FMFA 2BP8A 2FDBP 3QPKA 1U8NA 1UACL 5KN5A 3INUH 2DWDA 1FN4B 1UUNA 1QVOA 2J8UE 2XIBA 4MD5A 3M46A 3CZEA 4OCYL 4M6MH 5EN3A 3PGCA 4YHLH 4B9GA 3QDGE 2X1OA 2BERA 3L9RA 1UWXK 3EGSB 4PMFA 3QUKB 4ONGH 3ZKMC 3PWNB 4Z7UF 5HYQA 3GEWB 4PLKD 4MMZC 5FK9B 2I7OA 3VXRA 4RCAA 3AXLB 1T0OA 3HR5A 2QLYA 4FXGB 4F8NA 1IQDB 4JQIH 3VGFA 3SEPA 3FUMA 1HHJB 1EGJL 1TTBA 2DWTA 2NYYD 4DFHA 3X12B 1HWGB 1WAAA 1MCWW 3GDBA 4CKQA 3HNSL 4L4JA 4PWJA 2PTTA 1NIAA 1X9QA 2AQTA 1W9XA 2WKLA 5JXEA 5MEND 1T80A 1PYWB 2D03H 4GAFB 4JPWL 2Z7YA 4RMVA 4Q74A 1FIEA 4KK6C 4P5TD 4GAGL 2QBWA 2RACA 4Y4HB 4HGMA 3C60B 1AHKA 1ZLSH 2G30A 4XTRC 1V3KA 3QNZB 3R4DA 4HYTB 4NJ9H 5EN2A 4PHZA 3T1FA 4KKCC 2IADB 4PR5A 4DF9A 3MHZA 3OKOA 5F88A 1S6NA 4NKMA 4WO4D 3MRNA 3QG6B 4QLRA 1R4XA 4W9FC 1PNCA 4O5LL 1HXMB 4Z7OF 2IPTH 3GPEA 3OHMB 5SWSB 1TSRA 4KK5D 4KK8D 5I1IH 3PGCB 3ARBA 2Q8BL 4UV7H 4N90D 4ZS7H 3KW8A 3MPCA 2LFEA 4KNTA 3QNYA 4XPGL 3OMAB 5F7YC 2BNUB 4UNUA 2J1ZA 3QUZB 1OM9A 4FXKA 4LHUA 2VQUA 5DJ8A 4HHWA 4TSBH 2OQJB 4N2IA 5IFHL 5PCYA 3ECVA 3OXRB 2W65A 4R0LB 4PRID 3GSQB 3H7LA 3HS9A 2F74B 1NGYB 2QQLL 5CGTA 5CJ5A 1B9ZA 2VIRB 4YS4A 4ZTOL 4L8BB 4KXAA 5IVZB 1H3TA 4E41E 2YUZA 1D9KD 1U8MA 4HBCL 3EFDH 3OKMB 1BIIB 2I85A 5BNXD 1A0QL 2CR6A 1I3GH 1AFVL 1IBFA 2WO2B 2DJSA 1E4XH 2Z9TA 3CSYB 4UOW0 3K2KA 25C8L 4M1GL 5DURB 5I0DA 4FADA 4IU2B 1CI5A 4M5TA 1Z9MA 2AW2A 4OD1L 4JZNB 5H37G 2D7OA 2EVHA 2WZAA 1IO4C 4G8GB 4FYQA 4BWTA 4FLRA 1FG9C 1OPOA 3O2WL 4F91B 2X10A 3W9EA 1R3JB 3ECBB 4XNQA 5I76A 2DL9A 3PREA 2M8XA 2JKSA 1QBLH 3T1FB 4FL4B 2EIZB 4IKLA 4ZMTA 2EDXA 2C3WA 2WBWB 2PP8A 2R4RH 2C7UA 5HGHB 4YXLL 3OWRA 4JKLA 5B3JE 3MUGB 3MGTB 1PJWA 4L3ED 1CTOA 4OI8A 1CF8H 3RWCA 5DFVC 3QIUA 4UQ2A 5ESAB 4GO9A 4BFFA 5DRZB 1JDDA 2VDLB 32C2B 1YJDL 4RAVB 2CR3A 1BQLH 3QUZA 4PJ8A 4KI5C 4LEOA 2V5RA 4Z7WA 3ZKXB 4I2XA 4BZ2A 4MHHG 4NRXA 4YDJA 3UBXI 4HUMB 3IRCA 2M26A 1PZBA 1MKFA 4F7MA 1WD8A 1D5BB 1HT6A 3NJVA 3LKRB 1T4KB 4UF7C 1NGYA 5FW8A 4RNRA 1NAKL 2VM3A 4WW2F 5LAXB 4UZGA 3S36X 1MFMA 1RZKC 4PPTA 2X4NB 1GW6A 3FK3A 4PMEA 4NQDA 3VTMA 1AKJA 4N8VG 1UM5H 4Y5XB 3LEYH 5I8EB 4FG4A 3B2VH 2OULB 1SYSB 4A7QA 1XBRA 4UAOC 3NPZB 5KSUB 2IAND 3UIYA 4QHUA 3VFSA 3ZHLA 5CEZL 4K8RC 4EXPX 3H7BA 1N8ZA 4LVNC 5F1KC 2V9QA 5ALCH 1QBLL 4B97A 5ID0A 3D48R 4CMMA 2IBBA 1FH5L 2GABA 4YQXL 3GZKA 3NVQA 3PWLA 1OPGL 3IM1A 3QORA 3DXAB 5A2FA 1WBXB 4YSEA 3CHQA 1FFPA 4CGTA 3C9NA 2P5WE 3P4NA 4MXQC 1FRGH 5KSBE 3VXNB 1KPRB 2O61A 3WJJC 1H3XA 1W16A 3OQRA 4Z0BL 4PRHD 2J21A 1C5BL 2XHNA 5TGBA 4GSXA 4NQCA 1F58H 4MSWB 3ARDC 2JJSC 2P24A 1UKQA 3VWKD 4MQXC 4XXCA 2BWIA 5IVXA 1JYVA 3DVNA 1QWHA 1WIOA 1KG0B 3NZUA 2ZNWA 2WTOA 3RAJL 5GIRA 3GM0A 3RJDA 3QRBA 4X5XB 3ABKB 3WGVB 4NS0A 4P2CG 5EU5A 2LFGA 1CFNA 3JV6B 2J6WA 4FFWD 4WK4B 5H4ZA 3L2MA 3BWAA 1Y18B 3PWNA 3JT0A 4MCYA 1CR9H 2VISB 4JREC 4AEFA 3EJRA 1KTLB 5BRZD 5L0QB 4MAYB 2J44A 2EDOA 4M5YH 5IJDC 1NIBA 1ADQH 4PWKA 5FS5A 5SWQA 2Y2WA 3VG9B 3VGGA 4JHBA 3AITA 4U2YA 4UT9L 3WXVL 4FNPA 1IGJA 3U7WH 4JFWA 2QQQA 3IFLL 4LASH 1V27A 3CVDA 2R69H 2G75A 3ILPB 3SYAA 2O6PA 4Z0BH 4JFEB 2OSXA 4NO0A 2CO7A 4MRCA 2NZ1A 4HIPA 3QEUA 5J11B 1A7QL 4Z76A 1T89A 3ETBJ 4XCEB 4FXLA 1IBGL 1CU4H 5D2NA 4E2OA 3GKWH 5FYJL 1R0AH 2OK0L 5HDRA 4DO6A 4LEEA 4PRAA 1MUJA 2H0FA 1Z9NA 3O2VH 4MDIB 2JNZA 4MSWA 1CTNA 1NGPL 3D4YA 4NQXB 5LJYH 4NN5B 1PPIA 3B34A 4GQ9L 5ICZB 2Q8AH 4Z9KB 1KFAH 2B1HL 4UWQB 1EAPA 3HI6L 3PJLA 5ICXA 3WELA 5B8CB 4B27A 3G6AA 1EV2E 3QNXA 2FWSA 4FE9A 4WTZA 2Y22A 2NNAB 1E67A 2VUYA 1GOGA 4Q9QH 5AVUB 2FBOJ 1JD9A 4BFOA 2NSXA 4A37A 4ZTOH 4ZUWB 1OSEA 3IJ8A 4X6DF 4EN3C 1JPGA 2E7HA 1KY7A 4B9PA 2ZPKL 2EIDA 1TJMA 1OT2A 1OQOA 2AK4E 2P80D 3TNMA 4MAYA 1ACYL 4NKDB 3UJJH 1KYOJ 3FKUS 2UUDH 4N2OA 1CYGA 1BJ1H 1SYSA 1UUSA 2WINB 4IBZA 3QULA 4NPYA 5D1QD 5I8CB 3GMLB 2XT1B 2JI3A 2A9BA 2W9EH 4WFFD 3WS3A 3HJ0A 3BWZA 2H6OA 3ZHFA 3QDME 4KKLD 3POHA 3S4SG 1SYVB 5E9AA 2DYSB 4L0ZA 1PX3A 4JKWA 1ORSB 1YCSA 2Q9OA 4WV1B 5CWSB 5HYJD 2Z7ZA 3GC3A 1YEWA 2WIIB 3X17A 4HAGA 1WHOA 2GTZA 4O00A 4PM1A 1FHGA 1KIUA 2RQEA 3DJ9A 3SBWC 3PQYE 3MCLL 2UWEF 2AMGA 3RIAF 3QEQA 4G80A 1E5CA 3F58L 2VDQH 1J12A 4MNQA 5KVMC 5EBWA 3VGDA 1I1CA 4F7PB 3D69B 1R3KB 4FQ1L 2FJGA 4DGYH 5J13B 2XWTA 5MENA 2V2XA 3B43A 4PYGA 5DI8A 1IL1B 1Z5HA 1L5GA 1IAIM 5D7KE 4G8FB 1KXHA 5GHWH 5G5DA 4MWFB 4C8XA 1J87A 2IO5A 5KJRH 2IPKB 4YFDB 3BDXA 2MRYA 1C1EH 4CDHA 1ZHNB 1TNMA 2VN5A 4D7BA 5B7FA 5GZNA 2H2SD 3VW3H 5KS9E 2AITA 1QBAA 4YQXH 5BRQA 4F7MB 1CFBA 1NGQH 3SDYH 1ERNA 5CEZH 3BHBB 5J6HB 3LKSA 1ZLWK 1QZ1A 3W37A 3VWKC 1S7UB 2GFBB 3WY1A 3DX3A 1AKJB 1QFOA 3SSGA 2EECA 2J6EH 3X11A 2YUWA 4BYHA 3I3BA 3C5XA 3MRKA 2BHZA 1BXUA 4X7CC 5E8DH 4EQ3A 1SDDA 2VAAB 3QJVB 3VQ1C 2VXVH 2DI8A 2GTQA 3CN1A 1KFGA 1BEYH 4MMYA 4P9HH 1BF8A 3QXDB 4MXQD 1T03H 2EO1A 1MCRA 4XC3H 1R3HA 3QG7L 4G8IB 4XNMA 3NTCL 1FNEA 2QADB 1NBZA 3R7RA 3WKQA 5D2NB 2VITA 4HPYL 4GINA 4OSUL 4LKXA 1LD9B 2MFNA 1OTSD 1A7RL 1B0RB 4LLVA 3ATEA 4GIOA 5E1HB 5DJAB 2VXUL 5GGVH 5GQBA 1NFIB 2WYHA 4ACPA 5I17B 4PY8J 4E9VA 2EXSA 3S4SA 4YVNA 3RAJH 4HOXA 2BO0A 2WGXA 2E8ZA 4ORZC 4CADB 4GXUN 2YPKB 3JVGC 1JJUA 3MBXH 3D39B 3ORJA 4ESKA 4W9GC 4NZRL 5TD4A 4F8OA 2OL3L 1S5HA 4MD4A 4OI9A 1I1YA 1KG0A 4J3UA 5C70A 1INEL 4YNYA 3IJSA 2XQYG 2YWZA 1OARH 1UQSB 2E86A 2COVD 5E4IA 5CBAA 3ARSA 5IVNA 4M7JL 4ZO6A 1WIPA 5IQLA 5CJQL 4G9FA 5H37A 1PG7H 3LPFA 4PWHA 5IK3B 5EOCH 1AFVH 1I8AA 1L6ZA 1KDIA 1UG9A 2HCZX 3BKML 1I7RB 1S9XA 1ZJAA 2G3NA 1AHWA 4HUXB 4JFTA 5KUKA 1KEGL 1M71B 1BX2A 1Q9LB 3MV7D 2V2TA 1FNGA 5KVGE 4AYEC 1U8PA 3DTDA 5AAWA 3T8XA 2F6AA 4Y8DC 3IBEA 3BN9C 4KTEH 4EXKA 5DUJA 4C59B 2E7LC 3DMMC 5KSBA 4K3DL 4NHUA 4JFXB 1AGDA 2ATPB 1UD4A 1KBBA 1LMIA 2VXUH 5GGVL 1ZVSA 1UZ6F 1AR1C 3BAWA 4L4TD 3WKML 4KH2A 3L95B 2P42B 4H4NA 1AYRA 3QPXL 3HG0A 3TA3D 2DWDB 4HPOH 3LYRA 2AEWA 2G5BB 2W38A 4PCKA 3CH1B 1W80A 1A3RH 5DVNA 5AYTA 2ZKMX 2BIQA 2HUHA 3L17A 2B20A 3H6AA 4Y5XA 3RFZC 4JW3A 2BM3A 4DKEL 3MCKA 1PTZA 4P59H 1WTGT 4KROD 1KN2L 4U1KA 1K5NB 4XB3A 2OZ4A 2OXGB 1A6VL 2WTRB 1IU1A 3H3KA 5E56A 3EFFA 5AWNH 5IQ9B 4HCIA 1EAPB 3SIKA 5B8CA 5E5MA 3HC4H 1G6RA 3QUXA 3KL5A 3BESR 3QS3A 1QSEA 4GSQA 3D87B 4PUBL 3U7YL 5J6GB 1WFOA 1P7BA 3F12A 5J3HC 1SJXA 4FQPA 3TA3C 4APXA 1F8TL 5C0FB 5KWYC 3CG8A 3PWJB 3D33A 4LRNL 4MQ7B 4MKTA 2XRAH 1ZA6B 2DLTA 2X4OA 3IJEB 2OAAA 2P8LA 5MHSE 3ZT5A 4K73A 1BQHG 2YK1H 1O9WA 1G7LB 2YN3A 4R5VA 4Z8FH 4X50A 1TVHA 3O3AB 5E0FA 2ZG3A 1A4KA 4JLRB 1AO7B 2VDLH 2KYIA 3BSZH 3MYZA 2BP3A 1T2JA 1H15B 2BIOA 2ZIDA 3OAZH 4NYLB 1SDDB 5DZLA 1CK0H 4QKXB 4FS0A 2X12A 3FCGA 1NLBL 1CICB 3ZDYF 3WE1A 3WJMA 5IHUH 5B38B 1T0MA 1M6OA 3P0YL 3SQOL 4PJDB 1VPOH 1IC0A 4XN4A 2NW2A 5GRZA 3CXDH 4X9HA 4YHNB 2V17H 3L7FA 4FNTA 4Y4HD 2IEPA 1EEZB 2X4UB 2NY0B 4MMXC 3BGAA 3LKSB 1C5BH 4G43A 2E7MA 3ESVF 4DVRH 4OF6A 3CX5J 1ILSA 2NTFB 3FFDA 4XMLH 1VLXA 4I18C 4PG2C 3VRLE 4PJBF 1JZ5A 2ORBH 4LSPL 1JZ3A 3OXRA 1P4LB 5DU7A 5T33H 3SO3B 2R7EA 3CFJB 2AQPA 5DQDL 3M1BB 5HHQB 2HFGL 2F7QA 1HDMB 3OKLB 5K1NA 4LCUA 3FBQA 5T1KD 3ULVD 2FZ3A 1YEIH 4AW7A 1S3RA 1RUQL 4HS8H 4XMZA 2DJ4A 2X4OB 2YPLA 3IJEA 4NN7B 1NC2D 1JZ4A 1XXFC 1AD0B 1NEPA 3L5WA 4U1HA 3VD9A 1T7VA 5CSZA 3SDDC 4M5YL 1II4E 4LPYA 1D6EB 4NP9A 3U2SB 5AW9B 5FUCC 4F2MA 4MNHA 3DHJA 3HZMA 5IHUL 2JJVA 5JIHA 2X9ZA 3MLUL 4P0DA 3ZE0F 3WENA 2R39A 2ZWZA 2R8SL 4P3DA 3QDGA 2W8CA 1XIWA 4ONHA 2H0EA 1UGNA 1QSZA 2IFFH 3AABA 3SJVA 2EDRA 2IOMA 3TTSA 3ZDXE 4HT1L 1N6QH 2EDTA 3F84A 3KVQA 3BE1L 1V3JA 4XP9L 1N3NA 4QR7A 3U4BL 4M48L 4DZBA 2IXQA 3CVHH 2BY3A 1ONQA 1SJMA 2R0KL 1T6VN 2XZCH 5SX5K 2XU9A 3HZVB 4EZLA 4ZFFA 5KUMA 3SZKC 1LE9A 2P49B 3B37A 3LN4B 2RQ8A 5E8PA 1F2XK 2I25N 4NQSA 2RGSA 4PJ5D 3V6FA 4LKCA 1JCKA 1PZ5A 1BVKA 1T1YB 4GQ9H 2VZOA 4ZBJA 5A7BA 3MLWH 4NFCA 5DJ2A 3RGVB 4F92B 3GJFB 4K9EL 3P9WB 3HB3D 1ILUA 2BIPA 4JNXA 4PBVC 5A2AA 5F7BA 2VJ8A 1G9EA 5HHQA 1J0JA 4M62L 2JB5L 2K78A 1WUZA 4KTDH 5HI5C 2YD3A 1I7TB 5JLZA 3DX6A 3PXLA 4Y19B 4QRPB 3RI5F 2FHFA 2PPEA 5FKAA 1PCSA 1DP0A 2H1PL 3PHQA 3S3JA 3TCLB 1DCLA 1MWAL 1A7PH 4HEPA 4WI4A 3VFTB 2OZ4H 4OF3A 4QF1B 1RZ8B 3S3PA 4XWOC 1JNHB 4KQ0A 5I6XC 4DIXA 4NENA 4XXDA 4BK5A 2A4EA 5CZXD 3T0BA 2AXGB 2HJFB 5JMOC 1WGOA 4FFWC 5ANMA 2DI7A 1DVUA 4IBTA 2EEFA 1AS6A 4YDZA 1TG8A 2BVYA 3IU4L 4Y5YB 3FUKA 2HFEB 3QNFA 5EC2B 2ED7A 3GB7A 4K3DH 5EA0H 4YJZL 3M88A 5IT2H 2AEPL 1FFOA 4YBLC 2X4PA 3FMGL 3OX8A 4JDTH 4OIBA 1MHEB 2OR9H 1LDPL 3O6LH 3ROOA 3U1SL 3BQUA 5DRWA 3JWNE 3NIGB 1V7NH 1J1XH 1N5YL 3F7LA 2LOEA 6FABH 4D9RE 4B96A 4K3EL 4JREB 3ILQC 4EIBA 5KS9B 1DN2A 3L6FA 5IMMB 2PWGA 3MJ7A 4JDVB 2FLRT 4TMPA 5KYWB 2Q86B 1VEOA 2W65B 1G7IA 2G5RA 4YPGB 3EYSL 2P8MA 2VDQL 1YYLL 4LLQA 3ULUL 3C5JB 3FU7B 5ETUA 1GL4B 1TVHB 2I5YH 1GMIA 2A6IA 4KY1L 3PNWA 4YO0B 4LF3A 1QWNA 2F1BA 3OJ2C 3IKCA 3RNKB 1ZEAL 4ZMQA 2F5AH 2JJUA 3VXUD 4KQ4L 5A3IC 1QFUH 3AY4C 4HS3B 4PGCA 5ENWB 2GJZA 3FT2B 4ABWA 4JMXA 2BY2A 2MWCA 4PP1D 2LU7A 2KPNA 3IDXL 5C08D 2J5WA 1PEWA 4QXTB 1SJVA 5FGCB 3NCYS 4D8OA 3LNGA 4Y5YA 3FSAA 2XBZA 3I9AA 4TUOB 5IB3A 3SY0B 1ZA6A 4H13C 5C2UB 1KC5H 3ZUCA 1G1KA 3D0VA 1XGTA 3TXAA 3IETA 4EVNB 1LO5B 2HVKA 3PAUA 3STZA 5JUEH 1JFQL 3HG2A 2BFVL 2G2NA 3QK0A 3D3VD 2P5EE 1HWHB 3D12B 1MI5E 3EFFB 4HFUL 4OQTA 5I82A 5IQ9A 4Y9GA 3VWJB 3L3DB 4HLEA 3FQXA 3WD5L 2ZX9A 1PZ2A 2YD6A 1D5RA 5I1GL 2CA4A 5F97E 1FYTB 1R34A 4KV5F 4NO3B 4X6EB 4ERSH 4P59L 5C0JA 4R9HA 3VTAA 4KH9A 3NACL 3JWNH 2A1WL 4L5FL 1OAXL 1XF2B 4KQ4H 3ZE2B 2N4IA 1SHSA 4YHZH 2JIXA 4JVWA 1U0QA 4BIKA 3K5SA 5K5YA 2SEBB 5HHOA 1IBYA 5KSUA 1ETJA 2O26U 3IMSA 4G70B 3O2DA 3ZU8A 2W9DH 1I9RL 4NUQA 4AV5A 4O2EA 1XCWA 1ZT7B 2C3GA 5CCJA 3PL6B 1XR8A 3GZQA 4N0YL 1IQWH 3CN4A 1JCVA 1KZQA 1KB9K 5GS1C 3WHXB 2EYTB 4O9HL 2EH7L 1KLGA 5AQ0A 5LCVA 3A6OA 3HJEA 2IFFL 3KPRE 1SLXA 2DQFA 2CCLA 3QFJB 1SDAB 2ITCB 2Y6SC 4K23L 1LK3L 1T3FA 1A2YB 1J11A 4NQDD 2DYPA 3LZFH 5CBAB 4NLAA 3BE1H 4F7EB 3PV7A 2OV0A 2PN5A 5AOLA 5LKNA 3CLFL 2D0HA 1FAKT 1KCSL 4FNLH 5EO9A 2QMJA 3MGTA 4X5WA 3VI3F 4R7NA 1DDHB 3O4LA 4PIRF 4Q0XL 3VVVA 5F44A 3SY6A 3R0NA 1RIUL 3P77B 1SRDA 2NY2C 3WHE1 3BQUC 1YNTA 2WTPA 4CADA 1AQHA 2ZOLA 3V0GA 1QSEB 1F1AA 3WLBB 2CO6A 2LT9A 4PJ9C 3V6OA 4AM0A 3SPJA 5A2IH 1RMFL 4H5SB 1MELA 3NZHH 2WLKA 5JHDA 1RZ7H 1DQLL 4MASA 5HI3C 5F6HI 1R17A 1ZHNA 2O6EA 2WW8A 4LSSH 1UB5B 4P2QE 1HYSC 4N2MA 1S9YA 1L9PA 1NL0H 1QI5A 5EN2B 4U0QB 2APVA 2DLGA 4N6QA 2ATAA 2XV2A 4GAGH 1ZTXL 3LRHA 1KLGB 3O2WH 3UO1L 1CBJA 3L3HA 4XPAL 1EA9C 4CSSA 1H8OA 2H7WA 4N0CC 4L3CA 4TVPH 5KSBB 3FFCA 1BG1A 3DUSA 2B4CH 2F1EA 4Y16A 1SGKA 2J1KA 3UOAB 3HMWH 3L9EA 3UGUA 1HOCA 2FO1A 2E9BA 4Y5YC 1W0WA 2C26A 4M6OH 5DRNA 3LQZA 3OKNA 5T1LB 5E7FA 3NJLA 3VI4B 1ED3A 4NWTL 5I2IB 2Y0SA 1OP9A 3BI9X 3CC5A 1ZLEA 4K5OA 3H42H 4BQ8A 4WK2B 1M56B 4H2AA 1B2WH 2DQJH 1O6TA 1HEHC 3SKOA 3CX5K 3JTBA 1RZJC 3QQXA 4HKBB 4WVRA 5DZ9A 1EFXB 4MHHI 4W9HC 4P2OA 2VZTA 4RMTA 4FFVD 2MCMA 2WSKA 4LHJB 2O6CA 1YAIA 1VKXA 3SBWA 5H94A 1Z6JT 3MRGA 4K7PX 1MHPH 3KZ8A 3EXJA 1KEMH 1U8NB 4JG0H 2P3YA 1NC4D 2R1YA 1CC3A 4X0NA 3VXQA 4GG8A 1FZJB 5GRVL 5TQ2H 3PUUA 2WXFA 2CDEB 4K7FB 1K8DB 1L3WA 1NCTA 1XGTB 4JKPH 3QORC 3QNZA 4BEIA 4IHOB 2HLEB 5D5MB 2O5ZL 3ML8A 3H4HA 4LVHC 3QO1B 3SD5A 5EZPA 1DJYA 2XWEA 4LF3B 4ABUA 1GZPA 1IMHC 3ULUC 1AG6A 1BVLA 3CLWA 3IYLW 1GC1H 4FQ2L 3VFNA 4Y7MA 1PSKL 2X4SA 2KC0A 2IOIA 4L29A 1QOKA 4NM4L 1UYWL 1NGXB 2HH0H 3WN5A 5D1XE 1JGEA 2Y6SD 4ZZKA 1AKPA 1KPUA 4M4RA 4RRPA 4G8GE 4FHJA 5T1LA 5C0AB 4RQQA 2ZUTA 4I13B 1U8OB 2DRUA 5ITFB 5ACZB 5DUBA 2FQGA 3NT0A 1T0PB 4AGPA 3AG3B 5AZUA 1T2QH 3OLIA 3AGVA 3G5XA 3TASA 5E94A 3NIFE 1OZUA 3EJUA 3VRIB 1A1NB 5JW5B 1O75A 5IZ7A 3BPCA 2E5EA 3ULVE 3RNKA 1YEJH 3BQVA 3QJRB 3G6AB 2C7UB 1G1YA 4H44C 5HGHA 1ZXQA 5AFAA 1P5UA 5DWPA 3KPMB 4GRLA 4RMSA 4L0YA 3FT4A 2G75B 4KV5E 5SV3A 3QYCA 3BFOA 4L8DA 5AKSA 3UC0L 1N5AB 2MPAH 3BZ5A 1JYXA 1X44A 2X28A 3TBTA 4KKBC 2A74B 1I8LA 3GLDA 4Z78A 1YNKH 2JKXA 3FUHA 4KUZH 3D06A 4QD2E 5EOTB 1T04A 1NWOA 4H40A 3IEAA 3P9LB 2CUMA 1EBAA 1YMMB 2AJ3B 2HKHL 3H1ZA 3LXUX 3IDXH 2FX9L 4NQCB 2FL5B 2CNYA 2N1KA 5IVZA 3VI3E 2MTAA 3D7PA 5C08B 3W0WB 4K4KA 4QEGA 3KD4A 1YN6A 3IMTA 5SWQB 2R1WB 4BCXA 1N10A 5IROA 3REWA 1G7JB 5I71C 3L6FB 3EAKA 5IMMA 1P53A 1CXHA 4X8GA 1HL5A 4FTVB 2Y07L 3S37H 5ID1B 2EUWA 1CFQB 4MGXA 1T1WA 4FMVA 4WFFE 3NCEB 1T5XA 3HZ3A 4P5KA 1A7BA 2ADIB 2CLVB 3FB5A 1EMTH 1UZ6E 1KBWA 4KBPA 3BZ4B 5HPMB 3NEXA 5DJ2B 3RGVA 3KR3L 4Y1AD 3LRSB 3QJUB 2BCKB 1Q9OA 2F19L 2GC7C 3QZNA 2IWEA 4IOFD 1UH2A 4NFDA 1GGYA 2NY3D 1A02N 4X7FC 1Z3RA 4KK9C 1XR8B 4M6AA 4RGOH 2MOVA 1KXVA 1H0DB 1RIHL 1UJ3C 3L7EA 5LXVA 2B1OA 1JN6B 2V2XB 4LCYA 4WWNA 3Q8FA 3WN6A 5D71L 3BAJA 5DTFA 4CC0A 4UTAL 2PP9A 3ALXA 3TCLA 4FXTA 1A6WH 4Z1PA 3K91A 1RU9L 1RUKL 3M1OA 3UO1H 3QJXA 4NRXB 1VCBC 4UT6A 1ZTXH 1SBBA 1FNSH 4QJ5B 3DIVA 2A73A 3MRIA 1BJMA 1QLEH 4NDMB 2X1QA 3IPBA 2YUVA 2O5YL 4IEFB 4AGLA 5ABDE 4PJCA 4LESA 1HWWA 3N55A 4GMSL 3D85A 1KXQA 2QSTA 2VUKA 2NUTA 3C6SB 3CSTA 5KAQG 4OQ1A 3ME0A 4MB5A 5FYJH 2M2DA 1PDKA 1A7NH 1BF2A 2BDNL 4EUPA 5K9KA 1N59A 3RB5A 1AS8A 4NUJA 4ADIA 5BMFL 2HT2D 2OSYA 3PWVA 4HP5A 1IGIH 2B9AA 3HE7D 1KYOK 2BP0A 4N5EC 2MTPA 1Y6NR 2K6ZA 4FA8A 3OR6B 3FH5A 4XP5H 2R2BB 5BRZE 3HUJB 4BQ6A 5ETUB 3SKJL 3EH3B 4NQUA 4YVUA 1B2YA 2JKJA 2NY3C 1SY6H 4PS4L 1AGCA 1A3LL 4AVHA 4P49A 5C9JA 1H3UA 3OLEA 1S3KH 1HESA 3BAEL 3DX7A 1RXLA 2I9TA 3L45A 4KDVA 3OMNB 3DO3A 3HB3B 4XPHH 3NYKA 4A2LA 3ILPA 3C60C 5HJBA 2JCCF 3MSPA 3T65B 1BMWA 4X8XA 4JPKL 4QT5B 4HWBL 2WYIA 1WTLA 2YXVA 3B5GA 1LHZA 5D9SA 1N6VA 1P9MC 4Z23A 3TVMD 2ZYIA 3CZNA 1A22B 1YJDC 1I7ZA 3WFHA 2EXYD 3W81A 4PRPA 2FH8A 2FK9A 3L5IA 2J88H 5JQHC 4KJPD 4C4UA 2GB2A 5ELIA 5F0PB 4HH9A 5FFGA 4YBHA 4X5WB 5G55A 5C0CE 3RUGB 5HXMA 1TZOA 4LAJH 4M5ZH 1CBVH 1AGEA 3GGWA 4KQ3L 4FA7B 4F27A 3ZXAC 3DX9A 4QXUH 1GH7A 4QHNA 4MBRA 5D7SH 5F9WB 3UG3A 1I8KB 2VLJE 3MNZA 1G7MB 4GG6B 2V9TA 2XTLA 5MEQA 1LM8V 3TJHD 1DVTA 3ES6A 1QSFE 4PW9A 5F96H 1J0HA 3MRGB 3TVMA 5I30H 1E43A 4PRHB 2CGZA 2KHAA 1T5WB 4JJHA 3AW5A 1ASOA 1QRKA 3EBHA 4XBPA 2A9ML 4MB3A 3TJEH 1HQ4B 4A2GA 2VABA 4GKNB 1VRSA 2AERT 3MRDB 4WEBH 2R15A 3S0PA 1T20B 5KW9L 2EE3A 4HMDA 4KVNH 5BOJA 3CLEH 4PREB 2W1NA 2WV3A 3F3HA 4L2LA 5CZXC 3RFRA 5F6IB 3QWNA 2HJLA 3NA9H 3QDJE 3GUFA 1M3JA 1EXUB 4KDWA 4WI9A 2FEDD 1FZKB 1PF3A 2BVUA 2XX0A 4Z7AA 3CHSA 4JHVA 2P26A 1RK1A 4P4KA 2HRHA 4RSVA 1ZA3B 1DYZA 4IK6A 4KKNA 3MRLA 4QHLA 1BVZA 3IF1A 3DKHA 3TEXA 3BW9B 3BVWA 5A6MA 2PCFB 2ZXGA 5I16A 4M02A 5T8IA 3Q2NA 2PCPB 5CKGA 4YDIH 5DT1L 2O4EA 4O51B 5AVSB 3QGVA 4QTIH 4H2CA 3HC3L 4QHNB 1RV6X 1YDPA 2DQCH 1ZS2A 2YGPA 3L4VA 4HDIB 4FQXD 2FNWA 3Q8BA 5FYLH 3E80A 1VACA 2O72A 4GSDL 4JRXE 5DK2B 1A9EA 5TE4H 2OJZH 2ZWKA 2GJPA 4MZRA 3PYCA 5B3JF 1IBGH 4XPBH 4YXKL 3QYNA 4J23A 4OCWL 3PCYA 1LTXA 4ISVB 4ZTPH 3OSKA 4WO4C 2ODIA 2BINA 5DO8A 3SDCD 2I9LA 5FM4A 4Z7NE 5FLVA 5DWUH 4RGOL 5GGUB 1BFSA 4RFOH 1TJHL 4LE8A 3H42L 3QXDA 1QNZL 5I8OL 4X7DC 5EHFA 5J57B 5HYQB 2FJSA 3V4VA 3EJQA 3G6JF 2G0KA 2VIRA 3DX8B 1G5GA 1SNRA 3LEXB 2BSEA 1KPVB 3P2DA 1WFIA 4HF5H 3QR0A 2VERA 4AVIA 4U6HA 3JVFC 4Q9CA 4PRIE 1AR2A 5C0DB 3ULVC 1XGPA 1U3HA 3LS4H 4QRUA 3SE3C 1IBZA 4MAUH 2XG4A 1ZHBB 2NXZC 1BGXL 1G6VK 3EH2A 4MMYB 4N2CA 3VRLF 4YHZL 2DBJA 3G04A 3IFOA 4OLZH 1ETZB 3L3HB 4JL1A 1XTMA 4PJ5A 1DEDA 4JKPL 1DDTA 1NANI 5BXFB 2VKXA 4PD4K 1BZ7A 4AOFA 2KQMA 2XPGB 3QJFA 1QACA 3JQOB 2FX9H 4ADJA 1U3JA 4RGNC 1YEFH 3UTSE 3V6ZA 3O6FB 1NCDL 4X6CE 1SVZA 4JFQB 3X2QB 2BDNH 4N0CD 2AJSL 3HG3A 2PPFA 2LV4A 2Z93B 1M53A 3S3DB 1U2CA 1CGVA 3QDGD 1ZANL 4U4BA 5JDJA 2FTAA 4XXCC 4MLSA