2RCSH

Immunoglobulin 48g7 germline fab-affinity maturation of an esterolytic antibody
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
217
structure length
217
Chain Sequence
QVQLQQSGAELVKPGASVKLSCTASGFNIKDTYMHWVKQRPEQGLEWIGRIDPANGNTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCASYYGIYWGQGTTLTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN 48G7 GERMLINE FAB
publication title Structural insights into the evolution of an antibody combining site.
pubmed doi rcsb
source organism Mus musculus
molecule tags Germline antibody
total genus 45
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 1997-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2rcsH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2rcsH02
5GSRA 4K9EL 5KSBA 3E6FA 4O51A 2NXYB 4APQD 3MRLB 4LSQH 4HIIB 3WFDH 5DXWA 4G6JL 3BT2H 2X05A 5E99H 2PO6C 2XTJD 3E6HA 3L7FB 4QOKA 4XP9L 4KHXH 4WNQA 1IGIH 2WWKO 5JW4N 2C26A 4XPTH 4D9QE 4NFBA 4XPHH 3LN5A 1KG0A 2ZOKB 4L3AA 4LQ1A 1YECL 3PE9A 4Y2OA 1R3JA 4AG4H 3OKNA 4LEXL 3LDBB 4ETQB 3VDBA 3VG0H 1MH5B 1MJ7L 1FC2D 3EYFA 5HJ3B 5IEKA 4DN3L 4PJGF 4FFYL 4BYHA 5TE4H 1QLFB 1JWMB 3U0TA 4DGVH 3UJIH 5DRZB 4U3XA 1JRHI 5GJSL 2V17H 5CJQH 5E6YA 1NFIA 1PKQE 4M1GL 4PJHF 1FZMA 1NC2D 5SX5K 2HH0L 1SJEB 2VKXA 4RFOL 3IS0X 4RDQF 1EEZA 5DO2C 4Y19A 3O4LA 2NY0D 4Z7WF 2O93L 4HXBL 2Q86B 3W0WA 1BD2E 1I1AD 2MNUA 2R1YB 4GLRI 3QWQB 4E41A 4MNGE 2EYSA 3W9DA 1C16B 3RIFK 4YEFA 4FQHB 1S7VB 4P2RE 5C3TA 1FL3B 1Q0XL 3T0AA 5T1KA 4BSWA 2YD4A 3OB8A 4C59B 1T5WA 3ARYA 1AXIB 5DD3L 1I3RB 5J6GB 4OLYL 4PJ8C 1RVFL 3CNKA 2DQCL 1IZKA 1AXTL 3GBML 5GZNC 4UAOC 2Q8BL 3ALXA 3PXHA 1F42A 4GKZA 5D5ME 1RZ8A 4OLXH 3VWKD 4FQJL 5GS0H 1UWGL 2X4OA 3BDBA 2CJUL 4F3FB 2KQNA 4LIQH 3BFOA 3F62A 3QZWA 3NGBC 4TNVF 3MV9A 3E3QE 4JGJA 5E8NB 2JJUA 3RUGA 5DYOB 5HGHA 3MRIA 1U8IA 1XCTB 4MXWL 4LPTA 4AY0A 3TT3L 3FN0L 4NO0A 4G42B 1NAMA 5DRXB 3P30H 3BGMA 2DQUL 5E6ZA 4JQVA 4C54A 4FXGB 4LNRB 2R4RH 1I1FA 3B4NA 4HK0B 3OKEA 1TJGH 3S37L 4IRSA 5EU7E 2H3NA 2XWJA 2D3VA 3DX7A 2DTML 1SEBA 5K9JL 4LSDA 3PF2A 4OF3A 4Y16D 4LAQH 2VWEE 4PJGB 3WNMA 4HPYH 4OCWH 1IGFL 1SY6A 4GXVH 3QIWA 1U6AL 3ZKXB 1J05B 1UWXK 4PJHB 1A21A 3CH8A 2CIIA 2DI9A 1A3RL 4N68A 4PP2B 4IIQC 4U1LB 2GSIA 4UQ3A 1F11A 2FB4H 2G2RA 2Z31D 1JZ7A 1WICA 2R2HB 2DMCA 5HYFA 3D2UB 3IDNA 3JV6A 5DJ8B 4V1DE 4D9RE 3GMLA 1RZJC 3SE4C 5TF0A 1PBYA 5CJOL 4W4OA 4W68A 1ZXQA 1JMZA 1QEWA 1KYOJ 1JNLH 4XWOD 3FN9A 1U95A 3MRDB 1Q94A 4Y4FB 4OCYH 15C8L 4WI8A 5IF0B 1Q1JL 4KDWA 5C09B 3T3PE 2ARWA 5BS0B 1INQB 3VWJA 1KCRH 4E0RA 4YGVB 4ERSH 1U3HA 4U3HA 1AGDA 1RUKL 5EBMA 5C8JB 1P1ZB 2E3VA 5BJTA 1AO7D 5FOJA 2YWYA 1NGYB 4FQIH 1G9MH 5L7XL 3MTRA 3OJDA 4XNYH 2XZAH 1KACB 3MYJB 4LKCA 3VFWA 3MBEA 2F5AH 4O00A 2H2SC 1ZGLA 2EE3A 5LVEA 3QUXB 5HDQH 4OZHA 3TJEH 1GHFL 1W0VB 3LKNB 1P6AB 4KRPB 1M7XA 4OV5B 2BP3A 3EHBD 2UWEE 4WHCA 3B9KA 1FORL 1LNUA 4GMTL 4S2SB 3QIUA 4JR9H 1T20A 4MNHB 5HHMD 3RKPA 2BSRA 4OQTH 3WXVL 5KVGL 5I17A 5DMKA 3B8SA 4MNQA 4M61A 3MSPA 1OL0A 2P5WB 4NN7C 5T5FH 1W72B 3UC0H 4DJMA 4JPKH 4NRYA 3WS3A 5FYKD 4RGNB 5GGUA 5TPWL 4NZTH 5JZ7D 4YNYB 1F5WA 4UB0L 5GRVK 3FAWA 4FXLA 3ARFD 4NNPL 3VXME 4P4KD 2V7NB 4K3JL 2WBJC 3KPLB 3LV3A 4XZUA 5IG7B 3WUWA 2D7TL 3JWOC 2VDQL 4TUJB 3AU1A 4YEEA 3QPQC 4JB9H 3VCLB 4LRNH 4P3WA 4LCYB 1EEQA 1G6RL 5L2KA 1BPVA 4V2BA 3UDWC 1UGNA 3CD4A 1BZQK 3KXFA 4S1DC 1U2HA 1EZVY 1G7LA 1D9KC 4CU8A 2HJKA 3BT2L 4FZEL 4NQEE 4APQB 5E99L 4MJID 4RAVB 2NTSP 5F70A 4Y4KA 5B39B 4NOBA 1MFCH 4YUEH 1S9XA 2XTJB 1B0RB 4KHXL 4KV5F 1IGIL 4YBHA 5HGDB 4XPHL 4NQDD 1FFPA 3WMSA 1ZANH 5EC1A 1YJDL 3T3ME 4HJGB 4WHTA 2F74B 3VG0L 1NUNB 1G7HA 3V0VB 1EAJA 3IDUA 1AD0A 1CFTB 2BX5A 1N2RA 5TE4L 3UTTE 4YHML 3B2UC 1UENA 3WN5B 3ULUC 1EMTH 1NCWL 4DGVL 2D0HA 1FGVL 3OXSA 3EJJX 1U42A 2Z93B 5CJQL 1ZLVH 3ARBC 1X4XA 1A14L 3O6FC 3G6JA 1HSAB 5C9JB 2BVEA 3MOAH 2HKFH 4ODXA 4XB7A 4LEOA 1MCNA 1OD7A 1NC2B 4P2OA 4OZGF 4B41A 4HAFA 2J8HA 1QLEL 1MFDH 3QZWG 2JB6A 4X6EA 3R8BB 4HWZB 3RWGA 2NY0B 3TBSB 4W6YB 1E4WH 4M48H 2BXYA 5DJXA 3CH1B 5HD8D 4XBPB 1P4IH 5DD6A 3MLTA 3UMTA 3AS3A 3I3BA 3DXAA 3TJHC 5D7JA 3AGVA 5FECB 4KJYA 1G7PB 6FABL 1DZBA 2NY5H 4JHWH 5B4MD 3BUTA 1QBBA 1TNNA 4OLXL 1FBIH 1R6VA 4S1QH 4WDIB 3X3GL 5F7FA 5GS0L 1FZKB 3RGHA 5I1AB 3NIDF 3VWKB 4BH8B 4LIQL 2JIXD 2IJ0C 5KOVC 1QPPA 5CSZA 2Z35A 2NW2B 3VU2A 1IGCL 2CMRH 3A6CH 2HMIC 4QHNA 4U1KB 4JFYA 1ADQA 2ICES 4PRPA 2O61A 3Q6FB 4U1JA 2XN9E 1MCOH 3O2VH 2PYED 2ZOLA 1AI1H 2X4RA 4MB5A 3BGFC 2R4RL 1JGUH 4GKNA 4L29B 1M05A 3MRJB 5I2IA 1SM3H 3VI3F 1NGZB 1TJGL 3F5WA 3IJYA 2VXSH 5EOCJ 4PJIA 1RV6X 4Y4HD 5KOMC 4U7KA 2APBA 4LARH 5CEYA 1PQZB 3O8XC 5L0QB 4NBYB 5LWYH 3IJSB 5E4IA 4KXZI 1OWRM 4LAQL 5IMKB 4HPYL 1JPSH 4Y16B 4R7NA 4ZFOL 3K74B 4OF0A 2E9WA 4UOJA 4OCWL 3W39B 5E5MA 1I7ZB 2IBBA 4GXVL 1I7RA 5E00A 5DVNA 3K4ZA 1NANI 2IG2H 4O5LH 4OZGB 2GFBA 3LIZH 1FDLL 3FOLB 2CDGB 3I2CH 5IVNA 3MROB 3RRQA 3AAZB 4RAUB 4WFGD 3LKPA 1IEAA 5D1XA 3EJZC 3QWRD 2EC9T 1A7NL 1IC5H 4PV9A 5J13B 1KB5B 5J9PB 5FYJU 1QRKA 2CLVA 3B6SB 4D0CB 1JNLL 2FH6A 2LV4A 4ZS6C 1K6QH 1TVHA 3W9EB 4DZBB 25C8H 4I18B 4OCYL 5IVXF 4XRCA 1YUHB 4JY5H 1ZHLA 4S1SH 3QO1A 1VFBB 4QHKJ 4E42B 1M1SA 3LN4B 3T2PA 1C1EH 4PR5A 4M03A 5CKAA 2NLJB 4J12A 4L5FL 2IPUG 4TULL 3RI5F 5MI0B 2MSPA 3SKNA 4FQIL 1F3DH 1G9ML 5CJXC 1XZ0B 2ZNWA 1HDMB 2XZAL 4JFQA 2C3WA 3S37X 1AD9B 4NJ9L 5AAMA 1TFHA 5KG9A 1A4JB 3TJEL 1BFSA 2XNAA 2D9QB 1BBJB 1GZQA 2YN3A 3GSRA 1CDJA 3DUUB 4HUXA 1RPQA 2YMXH 3HLAA 1KXVC 1OGAE 1RIHH 1UVQA 3VXOA 2QQLH 3S96B 3WUWG 4O2FB 1AXSA 2P7TB 4ZUVA 3EYSH 2AABL 1TNMA 4OQTL 1EPFA 1P2CA 5HHMB 4EN3D 5E6IC 3V4PL 3L7EA 3ZDXF 5JXED 1I8IB 3QT2A 4G8GE 4H26A 4LLUA 3ULVF 4OGYH 2VITA 3G5ZB 3QEGL 1KGCD 4WTZA 5T5FL 3UC0L 3D69B 4JPKL 5JNYA 5GS2H 3I9GH 2DI7A 4NN6C 1SEQH 1FAKT 5IHZA 4W70A 2X1PA 4PJCE 3ARFB 1DQLH 4P2CG 4P4KB 4ACPA 3GIVA 2UZXB 3CIQA 4NHUB 4XPBL 3GB7B 3DX8B 4YBQC 3U1SH 5KSBE 5KSAA 2XACC 3QXWA 5J3HC 2V7HA 1KTDB 1HILA 4JRYA 4QOKE 1SQ2N 4L4TB 2Q1EA 4P57A 1BREA 4LLDB 2C1PA 3ET9F 5IVXB 1YEFH 1FRGH 5IWLC 1XF3A 1MNUH 2UUDK 1DLHA 5GS1C 1DN0B 3T0ED 4FZ8L 1WCQA 4N0CC 1MFCL 2H8PB 1VHPA 4MJIB 1P4LB 3GNML 4RWYH 1EXUB 2Z92A 4F7MB 4IOSD 1IVLA 5T3XD 2VLKD 4OD2A 4A6YB 2I26N 2CDEB 1DQJA 1IE5A 3IU4H 2FD6L 4FG6D 3NZ8A 1ZANL 4NQDB 4MJ6B 3V6OA 4Y8DC 1DSFH 3UTSD 3MA7A 3BN9C 4PJEF 1BOGA 2BVTA 3AXLA 4PD4K 4WY7H 1C5DA 4Y19E 3O4LE 3PABA 4GXUM 3W0WE 5EU6D 1ED3B 1FO0L 2YD9A 1EMTL 3STBA 4UDUB 3REWB 5EZLB 4E41E 5I1DA 5D6CA 3VXTA 1S7TA 2HFEB 3FAXA 2HKFL 4LU5H 2ZUQB 4NP4H 1X5HA 4XAKD 3GMMA 3MNWB 3V2AR 1NJ9B 1MFDL 4OUUB 1LE5A 3RA7H 3QIBD 5KVEH 2HLFD 5D1ZA 1WZMA 3DNKA 3R1GL 1YYML 2AQ3A 4M48L 5CD3B 5E08L 4PGEA 1B88A 2KL6A 4H25B 2MTPA 5DQ9B 3TZVA 3C5ZA 1P4IL 2E8YA 4N9GB 4N0FA 4YE4L 3CK0H 4OZIA 2Q76B 3F12A 4QRTA 3V7MA 5I8CA 4P9ML 3SCMC 3MV9E 4H5SB 2ERJB 3RUGE 1TQCB 1R0AH 3GSOA 1QQDA 1ZAGA 3OG4B 3VG9B 1MRCH 3HTLX 3KYNA 4DKEH 3LRSA 5D70L 1MCKA 1IGJB 3QG7H 4S1QL 1KJMA 2EC8A 3TVMD 4Z7NF 1K8DA 4HIXL 1OPGL 3PL6B 3OJVC 2FGZA 3EYUH 1PLGH 2CMRL 1PJ9A 5IB1B 5FYJH 4K71B 4HUVB 4X9BA 2AEIT 4AK1A 1Q9WA 3KPPA 3CLFH 3GGWB 1H15A 4R90H 1IAMA 4P23A 2HRLA 3VGBA 4HIJA 3UP1A 1AI1L 5FKAB 1JGUL 4RBPH 4PJ9D 2PYEB 1ZLSL 1SM3L 1YMHB 4WV1C 4PREA 5I6XB 1CDIA 3QH3A 2YUZA 1T0MB 5BV7C 5IBUB 4NYLB 4ZFFA 4Z0BH 2DMKA 3MBXH 4PJEB 4Y4HB 1S5HB 2EDTA 4YDLC 4TSAL 3F7YB 3LN9A 1JPSL 3WXWL 3RVWD 1LO5B 3DETC 4JANA 1QR4A 3PIQB 4KJQC 4OSUH 2W38A 4PRAB 5DHYB 4MA3B 4NCDA 2RHEA 5FO8A 4MB3A 2IG2L 1VKXA 4XAWH 4O5LL 1B4RA 5EWIH 3CCHB 3LIZL 3UBXG 3IDMA 5D1QA 3I2CL 1S9YA 1N59B 1H3GA 2F53D 2VQUA 5E5RB 5F7YC 3JTSB 3ELAT 1P69B 1IKNA 4HH9A 5AZ2H 2GT9A 5CIPA 4UNTA 4XMPH 4G5ZH 2IAMD 2VOTA 1EFXD 5LJYH 4M1DL 2WQRA 3GMOA 4KI1A 1UEYA 4OI8A 3ARDA 4KRMB 5JQHC 5TE7H 4XBEH 4AENA 4M8QA 1PEZA 3S8WA 5GRZA 1K6QL 1J0HA 4TNWF 2ARJA 1QHPA 2HLAA 3BQUA 1RIVL 1OM3H 1YNTB 4MAYD 5K9QG 3Q6GH 3MJ9H 3LKQB 2M1KA 3LSOA 4NO3A 5HTSA 4TNVK 4JY5L 2DQFA 4S1SL 3BIKA 2AJZA 3L95B 1C1EL 2XPGA 2X7LB 4XP5H 3G08B 4OZHE 3T4AB 4F33A 1XFPA 4MA8H 3L3KA 3ZT5A 2COQA 2KH2B 4OCXH 2WP3O 3MRBA 3V5KA 2D7PA 3VJ6B 1YEHH 5LGHH 2D7OA 1TJIH 3DBXB 1N0XH 4F8TA 1RULH 3UZEA 4I48A 1JHTA 5D2NC 3ARGC 4PPTA 2AI0H 1JGDB 4MNQE 3SDAC 4LVNB 5C0BD 1RIHL 4ZO9A 3VRJB 3WJLA 2QQLL 2FX9H 1J11A 3AS2A 4ZDHA 4L8SA 3SGKC 3W81A 3Q5YA 5SV4A 1KEML 1M7DB 1GOFA 4B0MM 3CPLB 5J6HB 4N8CL 1J1OH 2IALB 3ULVH 5LCVH 1T66C 5CMAA 1JUFA 1YN7B 4JZJA 2VN4A 4OGYL 2I25N 2BNQB 4TSCH 1VPOH 4PGBB 3DSNA 5C0RL 5IMLB 2BC4B 3I9GL 4Z7UA 1XGYH 3CDCA 1SEQL 3KLAB 4WI3A 2JKXA 3OKLB 4OLZH 3LS5L 1ZKAA 3EOYG 5FUCE 1FAIL 4O4YH 5CGMA 1OAXH 3RY4A 2Q7YA 2ZSVB 1DQLL 3P3YA 5L2KE 5I1EL 5DI8B 4RAHA 1JN6A 1FYTD 3KXFE 1N8ZB 4DKFH 4YFLI 3T4YA 1OARH 3V6FA 4BA8A 2I27N 1F4XH 4QRSA 1IGML 3I3EA 4BELD 2E7CA 4X5WB 1YEFL 1FRGL 3KDMA 4LCWD 4FQ1H 4Y5XA 1MRDH 1MNUL 3CDGA 4GW5A 3CMOL 3T0EB 3FO9B 3BDYL 2VZTA 3D18A 5FCUH 1CDGA 4LCCB 5F7LB 1T1YB 1V7ML 4G6AC 3EZ8A 3P73B 3IU4L 4KZEH 4ZYKA 2VLKB 3Q2CA 4IOIA 4MCYB 3QDJA 3G6JE 3JVGA 5BVJB 5K9OB 1DSFL 4AL8H 4YK4B 1QZ1A 3HS0B 5EO0B 4WY7L 2EZ0D 3I50L 3R06A 4LHQB 1YEGL 4Y1AA 4AEFA 4F7TB 1HZHH 2OL3H 5EU6B 1U8HA 4ISVB 3SN6N 4AIZB 1DJSA 1MF2L 2X9XA 4ONHA 3D9AL 4H1LH 5EUKB 3CSYA 3X12B 4R0LA 4R4ND 1WBZA 2CH8A 3C8DA 4NP4L 5I75B 3RA7L 1JTPA 3ZE1F 1Y18B 3DXAE 4Q0XL 1CZ8L 3QIBB 5CP3H 3RVUC 4RMVA 1I85C 4YXLH 4DVRH 3SKOB 4LCUA 1TVDA 2BZDA 2E9BA 2ZOKA 3CK0L 3ARSA 4XH2B 4WU5B 4ETQA 4QCIB 3WJJA 2GCYA 4M6OH 2LVCA 9CGTA 2WUCH 1R0AL 1JWMA 1RUPH 5TDNA 5K59E 1N5AB 1MRCL 3VD5A 1ZTXL 3IAQA 1KJ2B 2B1AH 4L4VD 3O3EA 1LP9A 4PRPE 3F65A 3TVMB 1KULA 2E7HA 5ITBH 2YD6A 1MRFH 2KZ1B 5JPMB 5L88H 4MS8C 3DARA 1EFQA 1C16A 3SKUD 5D8JH 1HEZA 1WZ1L 4F37F 4TVPD 4FQHA 5BVPL 1WITA 1N5YH 1FL3A 4PJIE 1GPOH 3CLFL 2YC1B 4MDIB 1QD0A 2DAVA 4R90L 5ICXB 2BOBA 5J6GA 5ID0B 5E8OA 1TQBC 2IQ9H 2C3XA 2GJ6D 3QFDB 2GK2A 5F88A 2ZJSH 5CFHA 1LDPH 5IEHA 3L3HA 4OZFH 5T1MA 2W60B 3MBXL 5A16B 3WFBH 4I9WD 3VFPA 1LD9B 3LHPH 2YUXA 4PRIB 2MPAH 4LLWA 2YPVL 3V4VH 4G43B 5DYOA 4M8VA 4OSUL 3O3AB 1HHIB 4P5TD 5JDSA 4G42A 4BKLB 2AP2A 2HG5A 4F9LA 2YSSB 4X5LA 5EWIL 4EVNB 5GHWH 1MWAL 1DBJH 2AEWA 2NXZD 4PJXB 4JREC 4HD9A 2F53B 4YPGB 5LBSH 1BIIB 2FECI 5AZ2L 5IW6A 2VR9A 2E8ZA 4G5ZL 4RGMB 3TA3D 1J1PH 4X7FC 1GOHA 2IAMB 1EFXB 4Z95H 2OZ4A 4KJPC 2D9CA 5TE7L 5CGYC 5DS8B 3GJFB 3S4SA 1A4KA 3C6LD 5KAQG 4WWKA 3O2DH 2AERT 1OM3L 3ZKSD 3OAYH 3NCFB 4JY6A 1OSZB 4MAYB 1MLBA 1Q9KA 3SDXF 1BFVL 5DA0B 3FQXB 1CVSC 1OTTD 4PP2A 2XKNB 1JFQH 3REVA 3DSFH 4XP5L 4GUPB 1BQHB 1MPAH 3WDJA 2R2EB 2R2HA 3QNZA 1S7WB 4OCXL 3D2UA 1BD2D 2Y07H 5DJ8A 4HC1A 4MVBD 1ZWIB 2OTWA 4X80H 3OKOA 1YEHL 5LGHL 5CKGA 4F58L 2BSTB 3DVNA 4EUPA 1ND0A 3RNKA 4QXTA 1B0GB 1RULL 1ZHBA 2A1WH 4JRXA 1R24B 3B3IB 4PRNB 3BKYH 5IROC 5EZJB 4DQOH 4NPYA 2AI0L 2EDYA 4Z7QF 1AIFA 3DV4B 4Y4FA 3QUZA 4OBRA 4I0PA 4IJ3B 4LPVA 3RZCD 4OFYD 2VR4A 4WEMB 5BS0A 3LKSB 5JXAH 1I1YA 4JGMA 4XVUC 2DF3A 5CZXD 2H32A 3FQUB 5GGTH 1J1OL 1IFHL 5LCVL 5IV2B 1E6JH 2B4CC 2Z4QB 5I9QC 1YEJH 1LK2B 1NGYA 4UU9B 1XR8B 4PD4J 3RHWK 4F15B 1G7MA 1OAUH 4JRYE 3BIBX 2Y6SC 2YZ1A 5E8PA 4O4YL 1OAXL 3LKNA 5JIHA 2F8OA 3BPLC 3GMQB 4GAJH 5EOTB 4UV7H 4IMKA 2ICWA 1FYTB 1XGQB 1OARL 2B5IC 2A6DB 2DBLH 4GRWE 2VZOA 3D87B 3CFJB 1F4XL 1LO3H 4HS3B 3QUYD 3P4NB 3B9EA 1AQKH 4U6YA 3TV3H 2X4TB 5F71A 5FHAH 2J8UF 2WLYA 3QDGA 4FTVA 2P5WA 1MRDL 4X0KB 3V6OE 3MRNA 4LCWB 5L2JB 3SDXB 3P9LA 1CFVH 4X4YA 2WWKT 4DCQA 5IFHL 5FGBC 5FCUL 4OLWH 5GGVH 1MCEA 3LQAC 3RI5K 4IS6B 3HMXL 5L9DH 3L5HA 2G75B 4YNYA 4U6HB 1INDH 5MEOB 3KPLA 4P59H 2J6EA 1BBDH 4JPWL 1WISA 2CRIA 4LLYA 3T0DA 5DEZA 4R7DB 4MA1C 1M7IA 3HI5H 4V1DD 3O6KH 5DEGA 5FM4A 4XGZB 1HZHL 3P77B 4HEME 5FIEA 3VCLA 1BQLH 3MNVB 1FL5B 3MJ8B 1J8HB 1FN4A 3NMEA 5I18H 3CVHL 2NY1D 1ES0B 4APQA 4OZIE 2D4FA 5GSVB 3MOQA 3IAGC 4YXLL 5FM5O 1TTGA 4HAGA 3C8KA 5DHVH 4FMKA 1BF2A 3CSBA 4HWEH 2ZUVA 4XP4H 3RWCB 4HJGA 3MQIA 4LFHG 1KIQA 3KR3H 4M6OL 1S78C 4UINL 1JV5B 4ZTPH 2ZCLH 3TO4B 1RUPL 3DUSA 3QCVH 1FO0B 2Z93A 4HLZG 4M7JH 2IF7A 2B1AL 2D0GA 3DMMA 4CAGA 4H88H 4CVXA 1MUJA 4L4VB 5ITBL 4KK9C 3U7AA 1MRFL 1ZEAH 1XGUA 1JTOA 4XMKL 5L88L 1MCJA 4HWZA 3UTPE 3TBSA 1FZOA 1AR1C 1RZ7H 4ZAKC 1I1AA 5D8JL 3QDMA 4U7SA 1N5YL 2J8UB 3AUVA 2GAZB 3KLDA 4XBPA 1AE6L 4NZRH 3IDJB 1UZ8B 1JNJA 3ZKMC 3EO9L 4LGPB 4GS7C 2CDFA 1T6VN 5FDYA 2JK5A 1YEDB 5FECA 2GJ6B 3MRHB 1DQDH 1OB1A 4ZODA 4HX1A 3QI9A 1BEYH 1ITCA 4WDIA 3VXMD 2ID5A 1WVZA 3WFBL 4CW1A 3HE7D 2DQDH 3N1PC 1IAIL 1MVUB 3S4SG 5FO9A 3P4MB 4LGSB 1T0NB 1ZT1B 2OI9C 5D5MF 4ALAL 1RZJH 4HUWA 3CFBB 1K8IA 3UYPA 4XVSH 2R2CA 2V6HA 4P5TB 5DMIH 3VFOB 4JCLA 4WW2A 5GHWL 1DL7L 3ULSA 5BOPA 5AYUH 5C2BH 1ZHNB 2DQEL 1D6VH 4PGCB 4XC1H 3MRJA 1R3HA 1YYLH 1NGZA 2GI7A 1BJMA 4WO4C 1J1PL 3FQNB 3H7BA 4Z95L 3TA3B 4EUPG 3T2QA 3H3PH 5IMKA 3SPVB 1Q0YH 3DX6A 4Y16A 5ICZB 3DYMA 3C6LB 1CYGA 3O2DL 3MLVH 3W39A 3TN0A 4KKAC 3IU3A 4NM8H 3UTTD 3FL7A 5BZWA 4HKZA 1WGOA 5JHLH 2P46B 2VJXA 3C2SA 1T6WA 5FXCH 4YBLC 2J5LB 2CDGA 3MUGA 4HKXA 3FFDB 1PKQB 3DSFL 1HH9B 3FB7B 3WFEL 5H35A 2EH7H 3AS0A 5E4EB 4XT1C 1FG9C 3AAZA 4RAUA 1OGTB 1MPAL 4HBCH 2P4AB 4HUMB 4RISH 2Z31A 3TBWB 3MV8A 2Y07L 3SDCA 4JZNB 3PQYD 1X5LA 2ORBL 1BD2B 2YD2A 4QXGL 5DFWH 4MNGB 5J9PA 4NIKB 2A1WL 3JWNC 3UROR 3HUJA 2E6PA 3FQRB 3BKYL 4D0CA 2V5SA 1TCRA 2AW2A 4DQOL 4YHYC 4RFEB 4J3XA 2WM0A 3U6RA 2FWOB 3S97C 1P9MC 4UQ2B 2H1PH 5EUOA 1XF1A 5AZEH 4AT6B 4F9PC 3FRUB 1EHAA 3RZCB 4Z7UE 4GT7A 1VFBA 4I77L 5D5MB 3DRQA 3LB6D 3T3PF 3DX9B 1IGTB 3H0TB 4HT1H 4XXCC 3JWOH 3U36A 1YEJL 5E2UH 3QQ3B 1AO7A 3DLQR 4YXHH 1HDMA 1QO3B 3AY4C 1JYNA 4NQSB 1S7UA 1L0YA 1ZA6B 1YDPB 2XN9D 1U8LB 1BBJA 3QHZH 3QB7C 5C6PB 5D7KE 4H0IA 4MLSA 3WKNA 3IDYB 3ZDZE 1VEPA 2NQCA 2DBLL 1UA6H 4OD1H 3ARXA 1EX0A 4O2FA 4TNWK 2VC2H 4OFKA 1KIRA 3HZYA 1BQSA 1V3JA 3V4UH 1LO3L 1KFAL 2P7TA 1X9QA 4K7FA 2UWEF 3VGDA 3DGCR 3NACH 4G8FB 4WW1A 1AQKL 1OAKH 3QUYB 3TV3L 4JFPB 2R0ZH 1KT2B 2GK0B 3QDJE 4MX7B 5F1NB 5GRYA 5SWZA 2DOCA 1CFVL 3O9WA 3ULUH 2C4XA 4OLWL 5B39G 2HN7A 4P2YA 5L9DL 1PKOA 5MEND 4Y1AE 3NPSC 5ECJE 3AFLA 2F9BT 4M6NH 1C5BH 1F00I 4P59L 4PRDB 4P4KA 1BBDL 3J8F7 4NQTA 4XCFH 3B5GA 3IDGB 1UJ3A 3GB7A 2CIKB 4LSRL 1EJ6A 2O5ZL 1LGVA 2PXYD 4OUOA 5IHUH 4ODTH 3HI5L 1KTDA 2OYPA 4V1DB 5C71A 4Z5RB 3BN3B 1CGUA 1H3TA 1M6OA 1U8QA 5IKCB 5MP6H 1CVRA 4AEHH 2HTLD 3KNBB 3ILPB 4K94C 3ROOB 5ETUA 5I18L 2OMBA 4M93B 2J2ZA 1QSFA 5IQ7L 1TPXC 3OKKB 1NDGB 2NY1B 3ARED 2P8PB 2HTKD 2PYFB 3HR5B 1KLUB 4F7MA 4MXVE 4A6YA 1NFDB 2CDEA 3F8UB 4RQQB 3QNYB 2CK0L 3WS6C 1D5ZA 3OGCB 4ZXBA 1C08B 4HWEL 4RMSA 2HJLB 2R0WH 4XP4L 4MJ6A 3LQZA 4YDJB 1LP9E 3DO7B 4PGZA 3KR3L 3RBGA 4CMHC 3WNOA 4I0CC 2UZIH 4ZTPL 1YQVH 2HT2C 3QCVL 1T89A 2ENSA 3T3MF 3PWLB 1RZIA 3VD9A 2YS4A 4U4BA 1L0XA 4NUGH 2HFEA 3HE6D 3GDBA 2X6MA 5ADOH 2FZ3B 4CN1A 1XH3A 4L8DB 4PLJC 4YHIA 3MNWA 3MPCA 1A7OL 5GPRA 1ZEAL 1CL7I 3DGGA 3IFOB 3KS0J 4W6WB 2EXWD 2UWEB 3C2AH 3OF6D 3IDIB 4HS8H 1BX2B 3BEVA 4HIHB 3GMPB 5DFVC 2FO4B 1PY9A 1HE7A 5F9JB 5EO9B 1G9EA 5TQ0H 5DQ9A 4NZRL 1OW0C 1W2KT 5L6YH 2AJXH 1S9WA 5F72S 4G8GD 4K8RC 2QL1A 1L7TL 3OPZH 4HMEA 3LH2L 3ROLA 4M4RA 4D2NA 3TBYB 1QLRB 1BLNA 3RWEB 1JNHB 3TZVC 3GHBL 1I7UB 4JG0H 4QHKI 4NKIL 1X44A 3C60D 5DJ0B 4L9DA 2HWZL 3DPBA 3LS4L 2BMKB 3M1BB 2DQDL 3VXMB 3LEVH 1F90L 3HE7B 5DSCB 3PHOB 2YN5A 2JIXA 2APFA 2H9GB 3IJHA 5IHLB 1RZJL 3LKRA 4XVSL 2KBGA 5ACZA 1EHLH 4YFDB 2P45B 3UO1H 3D0VB 4Z7OE 2P24B 2R0LH 4PJFF 5DMIL 3PV6A 1E27A 5E2WH 1A6AB 5EIQA 3TNNB 4XNUH 5C2BL 5E2TH 3STZB 1GGCL 2R9HC 1NGXA 3FB8A 5DJ6B 4PRBA 3VGGA 2PYEA 1D6VL 1OTUC 4D0DB 1YYLL 3QUKB 1S5IH 3O3UN 1YMMA 3OWEA 4NRXB 4KKBD 3RQ3A 4L9LB 4KKNA 1RURL 5C0IA 3ZKNC 4ZO8A 4KUCF 3HA0A 5IJKC 3ZTJH 3FB6B 3H3PL 5HVWA 1NCTA 3Q1SH 3F7YA 5FDWB 3BVNA 4MXQC 4X6FB 3QA3B 5FUZH 1VADB 1UG9A 3BZ4B 3MLVL 3M8OH 4NKOB 4LMQE 5HGAA 3PIQA 5I76A 4NSKB 1B9ZA 4WFHE 5DHYA 3QQ4B 3W0WD 4FP8L 4HIEA 2W65B 3UTTB 3GSWA 4E41D 3P0VH 4MCZB 1JPFB 3CCHA 2ZG3A 3RTQC 2FSEB 3U30B 4JRXE 5T1KD 1MWAB 4B7IA 3GMRB 4Z78B 3LPWA 2EH7L 3JTSA 1P5UA 4HBCL 1MFNA 1AY1H 4RISL 3BSZL 2X10A 3CMGA 3P4OB 4XHJC 5TGBB 4XNZC 1EO7A 5CBEB 4OFDA 5A2JH 4HUUB 3KLHD 5J06A 5JPNB 3QWRA 2W9DH 4C55A 4XP1H 2HVJA 5BS0E 3HN3A 1NL0L 3UYRL 5C0EA 5F1KC 3B5TA 3S35X 3TYGH 1IKNC 2IPKB 5IR1B 4MQ7B 4FQPA 4QHMA 1YNTA 4AQ1B 3MV9D 5AZEL 1IBGL 4NKMB 3RL2B 2AJUL 3J7HA 5CJBA 2QKIB 3O41B 4IOFD 1GL4B 3TIDA 2DLFH 4K23H 4G6MH 4RGOH 1FG2A 2CK2A 2LFGA 1RD6A 4NO0D 4EDXA 1G7JA 3BQUC 4H8WL 2X7LA 3T4AA 1CICA 4I3RH 4HT1L 3JWOL 3MRGB 5ITFA 4YXHL 4PJFB 4UILH 3VJ6A 4BZ1L 3HNVL 4OF7A 4JPVH 3W11D 1T7VA 3RWJB 1Z0NA 2B2XL 5H94A 3S7GA 1EUUA 1F97A 3QHZL 2AJ3B 2XN9B 3ABZA 3O3BA 3BP4B 1JGDA 1NMCC 4JDVB 1S3KH 1GGIL 4ZUUB 3QDGE 4FTVE 2P5WE 3KYOA 2R8SL 1UA6L 5IB5A 4OD1L 2DWDA 1UH2A 3ISWA 3KG5A 4FOMA 3H9YA 4TTDC 3V4UL 5HHQA 3B9DA 2WUBL 5EULV 2QSTA 1HNGA 1A7RH 1OAKL 1DBMH 2XKUA 4EN3A 1J10A 4NCC1 1V8HA 2R0ZL 2N1KA 2BFVH 4YDKL 2ZCHL 4KTDH 1HSBA 5BMFH 4PJ5D 4ENED 3ULUL 1UKQA 2Q3AA 4O9HL 1DUYB 3V5DB 3KLAA 3UBXI 5B8CC 1II4E 3L3IB 3FO0H 3JTTB 4JZJC 2VLLA 4M6NL 1C5BL 4LAJH 5M94B 3PHSA 4WWID 5HDOA 3STLB 2VDOL 3TPKA 2ATPA 2BHZA 4XCFL 4GKSB 4DEPC 2PO6D 3THMH 1BZ9A 4KDVA 1R5WB 4ODTL 4D8PB 5EBWB 2NY3C 3C5JB 2PXYB 1ZOXA 3C8HA 3ESVF 5ID1B 3VXQB 4LHUD 1FVCA 2FEDD 5KSBF 3FT3B 3VWJD 1IM3B 4FXKA 5F3HB 4AEHL 1D5MB 1U3HD 1V7NH 1J1XH 1QFWM 4C83B 4I8DA 3CGTA 2MFNA 1YY9C 4NDMB 4U1MA 2DN7A 3FO9A 4Y2DA 2YA1A 3AREB 5MEQB 3RWHB 5FM5M 3FTGB 3OXRB 3P73A 3MBED 3QQ9C 4OFPA 2VLKA 3HC3H 2OQJA 2R0WL 5DO2D 1CGTA 3JSSA 1RK0B 3HS0A 5GISH 3UTSA 4OCSH 3BWAB 5EO0A 2LU3A 2UZIL 1PYWB 3CX2A 5M95B 4PJDA 5C86A 3SE3C 4X7TA 3QIUD 4NUGL 4P5KB 2X42A 3JVGC 1UCTA 2R1XA 3EGSA 3QDME 3IVKA 3WO4B 5IW1B 1G6RA 2L7JA 5ADOL 3FO1A 4Q6IA 2W0FA 3HE6B 5EUKA 3X12A 3MRQB 2NY7H 5FA4A 1AP2B 4XCNB 3RGVC 3CVHB 4MNQD 5F1SA 3GBNL 1J5OH 4HS8L 3VI4E 5BV7H 5DMGC 2WBWB 1P7HL 2NXYC 4QGTA 4EIGB 5C0FB 3RX5A 4XH2A 4G8GB 1N4XH 1DBAH 1VACA 2JJSA 4IDJL 4FQQB 4GMSH 5DQJB 5TDOA 5KSVA 4QEGA 5EC2B 4QRRA 4ZD3H 3OJ2C 1EAPA 3OB0H 2P8MA 4J23A 2NY6D 1N5AA 4JG0L 4A2MA 3VXUD 2Z8SA 1U58B 2A9MH 5JW5A 3LDBC 3C60B 4OZ4A 5IVZA 3U46B 3Q5TA 5HI3D 4U0QB 3RUGF 3TC9A 3TVMA 2QSVA 2C7UA 2XFXB 2VDPH 3IGAB 3G9AB 3VXSD 5CBAB 5E1HB 3FMGH 1UWEH 4G6KH 5KSBB 3E6FB 4O51B 4G9FD 4YX2L 5DGRA 4OM0H 4Y4KD 1NSNL 1EHLL 4UT9H 3H42L 1AFVL 2OR9H 4QOKB 3UPCA 1OLLA 1YEIH 4PS4H 4WTXA 2OP4H 5ICXA 2GITA 5E2TL 1V5JA 4DW2H 2ARJQ 3QFDA 2D7NA 4PJ9A 5TE6H 5F9WB 3VXRA 1MCPH 3TF7C 3EYFB 2MCPH 1W8NA 2W60A 4MQSB 4DK3A 5B38A 1GCFA 2WAHA 4Z76B 1LEKA 1NPUA 5EIIA 2JJVA 1LD9A 4G7YL 3IFLL 3OHXB 1K3ZA 1FZMB 4P2OD 1IRAY 5SWSD 3OAUH 1XCQA 4G43A 5B3JE 4M02A 3OG6B 3MFFA 3EFFB 4QY8B 1EEZB 3MV8E 4Y19B 3O4LB 2V5MA 3RY6A 3W0WB 3P0VL 5FYLH 4N5UA 1IEBA 4KDTC 4E41B 2EYSB 3W9DB 3BD3A 5CUSL 4CMMA 5C7XH 3HUJE 5D72H 3C9NA 2HT3D 5KTEH 3JV4A 3FZUC 4PJXA 3SGEH 5C0NC 5T1KB 1I1RA 2VSCA 2F53A 3CFDB 1AY1L 4KVCH 4ODVH 4X4MA 1BIIA 4DWHA 2LTQB 2MKLC 1JGVL 1T5WB 4F9LC 1ZLUK 5EUOE 1LO2H 1D6EB 2W9DL 4JVUA 4XP1L 2QADB 2EEBA 3L3DA 1TZHA 2GSGA 2VXVL 1KCKA 1BP3B 3TYGL 1CDHA 2UY6A 3RKDC 2X4OB 2W9EH 4ZFOA 4Y5VA 1FNLA 1RIUH 1AO7E 1X5JA 3MV9B 4C4KO 4GQ9H 3RUGB 1KPUB 4OF8A 5HGHB 2DLFL 3MRIB 4K23L 4ZTOH 1CFNA 1VENA 3FQXA 4G6ML 1KEGH 4RGOL 2PTUA 1JWUB 4LSVH 4PUBH 2F15A 4BQBA 2AJYH 4N8VA 4NO0B 1HYSD 1NAMB 1F8TH 4MJ5B 5IHBA 1NBVH 3MLSL 4YO0A 3ZKXC 3QDAA 2R2EA 5D7LA 4TTGA 5J12B 5J11B 4FNLH 1A6UL 1WAAF 4WHDA 1ZWIA 4UILL 2YPKA 5E9DA 4OZHF 1I1FB 3QAZB 4G8IA 2BSTA 4JPVL 3PWVA 3B3IA 1R3KA 2QR0A 4IRSB 5DK2A 4U7MA 5ISZA 4FQCH 2H3NB 3DX7B 2IH3A 3AB0B 1SEBB 3ALWA 3DV4A 5JO5B 1S3KL 1P84J 4XNQA 5HYJA 1A6PA 1Q9OA 3DI3B 4HKBB 3LKSA 5C0BA 5SWZE 5CEZH 5C08A 5FYKE 3QIWB 4FFWC 4FQXD 3BO8B 1A7RL 1DBML 4XXDA 3DTXA 2LABA 1I9IH 3QISA 2P8LA 5BMFL 1LK2A 3QPQD 4UQ3B 1F11B 2G2RB 3EFDL 4PJ5B 4ZFZA 5D1XD 3QHFH 5ENWA 3DUHA 3IDNB 3FO0L 1DCLA 1JF5A 4J3WA 2WNGA 3GMLB 2X4PA 4X6DA 1ITBB 2PCPA 2R15A 4B53A 1B90A 5EOTA 2VLJA 3THML 4MWFB 1QEWB 4XNXH 1FYTA 1GGBL 1GC1L 3T0BA 1QSFE 2AK1L 1U95B 1I8MB 1Q94B 5I0DA 1UM6H 3QUXC 2BDNH 3LAFA 1JJUA 3S88H 4LHUB 4OGXH 2C4FT 4KRPC 3P4NA 1IQDA 1CE6A 4OQTA 1A7PL 3VWJB 4IMKC 4YZFF 1U3HB 4KK5D 4WRLA 4P0DA 1J1XL 2A74A 4GOSA 1AGDB 4I2XA 5EBMB 4LCWA 4KQ4H 1A6TB 5L2JA 3B2UD 1KCUL 4NQXB 1CD1A 5BJTB 1TZIA 2BVQA 5F7HA 1IAKA 1JWSA 3ARBD 4IS6A 3SQBA 4K07A 3S34H 1MREH 1GAFH 3OJDB 3BRDA 2MHAA 4LKCB 2I5YH 2ADJA 3FB5A 3HC3L 4JFDA 4LOUC 3MBEB 3VFWB 2O26U 1LO0H 3EIFA 1ZGLB 4RGNC 2UVEA 1OQXA 1UC6A 5I1HH 4AEIH 5GISL 4OZHB 3NOIA 1QYGH 3G6JF 3I6GA 3FHQA 1Z0MA 1LNUB 5E7FA 5FUOH 4POUB 3QIUB 3MJ8A 3UJTH 1JI1A 3DVIA 1EJOH 1FZJB 2NY7L 4XI5D 3C09C 4O58H 4JO1H 1ZA3A 5GSVA 1F4WL 3NFPB 4UAOB 2NW3A 5I17B 5DMKB 1J5OL 4NO5B 4MNQB 4M61B 4RNRA 3ZHDA 5HVHB 3ORJA 4NRYB 4POZD 1BJ1H 5GS3A 2DIBA 4UI2A 5DD0H 4IHOA 3RWCA 5SWQA 5DEFA 5E03A 4GMSL 1NCDH 2XTJC 3D25B 3VMNA 5KSAD 4HV8B 1WEJL 3LV3B 4XZUB 5DMJB 1UH3A 2NY6B 3WUWB 2ICEA 3MGAA 1X5YA 2A9ML 5F6IB 3VXUB 3AU1B 5DHXB 4ZUSB 5B38G 4ODWB 5J0BA 4L4VA 5K59F 1BFTA 4KRLB 3WN5C 3BX7C 3G6DH 4TVSa 2AKRA 1SYSA 3MNZA 2PYEE 1G7LB 4OM0L 3K1KC 3K3QA 1AGFA 1QKZL 4UT9L 5KN5A 3O8XD 2HJFA 1YMME 3IT8D 4Y4KB 2OR9L 3P9MB 4NJAH 2IBGA 4UNUA 1A2YA 4OJFH 3SGJA 1PDKA 5AG8A 2EEAA 2OP4L 4CUCA 2CKBH 2NY0C 1FFPB 4OQ1A 4RBPK 3P40A 5EC1B 1YEDA 3WO3B 4XPGH 3FO2A 4WHTB 1U8MB 1R5VB 4WUKH 3MRHA 4N90D 1G7HB 2MCPL 1AD0B 4OB5L 4RZCA 4WENB 1SY6H 1KB9K 1S7RA 2XT1B 4NQCA 5F96H 3JUYA 1JZ6A 1IILE 3G6JB 2R29L 1T0NA 1SJXA 3EJZD 3KPMB 4LQFH 4ODXB 3U7WH 4LEOB 5SWSB 4P2OB 3I6KB 5IESL 1L6XA 1X4ZA 2XIDA 4WFGE 4X6EB 3VWKC 4M7KL 3RWGB 3KPOB 2X1QA 1FPTH 1NGPH 1QFPA 3N1FC 3MRPB 2DJ4A 4QKXB 5C7XL 3C5ZD 3BP5B 5DJXB 5D72L 2A0LC 5D9SB 5KTEL 5IMOA 1XGPA 1E4KC 1ZHNA 5DD6B 3MLTB 3B83A 2R23A 5GIRA 4PY7A 2XKSA 1I3UA 1LO2L 3RDTA 1B4JL 5INCA 2J8OA 5D7JB 5F7UA 3TA3A 5EBLA 4N9OB 4KJYB 5I1CH 2B4CH 4KMTH 3INUH 5I71B 4NBZB 2OTPA 3F7VA 3F7QA 1RIUL 1JZ4A 5CSZB 3T0WA 4MD0A 5L0QC 4O2CA 2PTVA 4GQ9L 3AVEA 4JHBA 1N64H 4ZTOL 1KEGL 4BZ2H 2Q7NA 4Y16C 1S8DA 4LSVL 4TPRH 3UX9B 4J3SA 2AJYL 3CFEA 3FB7A 4JFYB 1FYHB 4YQXH 4P23D 4U1JB 4JVWA 2DICA 5B22A 4TUOA 1F2XK 1E4XI 4GKNB 1GIGH 1M05B 5E95B 5I2IB 3E2HB 5E8EA 1GZPA 1JPST 2AAVA 3MOBL 2A73A 4FQCL 4RFEA 2BY2A 2PUQT 5CEYB 5DZNA 2F8VA 5EOCH 1X6LA 5J13C 1LQSR 4Z9KB 3GI8L 3LQAH 4AT6A 1UM5H 4R7NB 4GJTB 5CEZL 5HHOD 4ESKA 3RZCA 5E5MB 2NX5D 5C0AA 1XAUA 4FQLH 1I7RB 3DECA 1JPGB 5E00B 5A2KH 4I18C 3MC0A 4FQXB 3DX9A 4C57C 5D1QD 3BJ91 1I9IL 4CRPA 3QQ3A 1RUMH 4FQ2H 2A83A 4UV4L 4YHZH 3QHFL 3TYFB 1IEAB 2FX7L 5I8OH 5D1XB 4K3EL 1RU9L 3DOSA 4LMQI 3ARDD 4RX4D 1CL7H 2ADIA 2CLVB 2OXGA 3NTCH 5ICYA 3OKMA 4XNXL 4PG2C 1TVHB 1E4JA 4ZOCA 4JO4H 3UCRA 2EDFA 4Y88A 1UM6L 3MLWL 3QEQA 4G3YH 2BDNL 4O02L 3QJHA 3S88L 1XIWA 3C5SA 4MD4A 4XRCB 1EEYA 4OGXL 3ZT7A 4J1UB 4G8FA 5J1TC 1RY7B 3QUYA 5T5NG 4H20H 3BN9D 4GRWF 1ZHLB 2VLKE 3QO1B 3EHBC 2P44B 3GO1H 3MUJA 2Y36H 1JZ2A 4MX7A 4KQ4L 3VFNA 4PR5B 2DLIA 5C0GB 3UTSE 2VRAA 5HYQA 2RQ8A 2D2OA 3SKNB 5HI5D 1MREL 4PJDE 1GAFL 4HWBL 4HW6A 4X6CA 4JFQB 3KPSD 1U3JA 5LAXA 5DTFB 3RVTD 1LO0L 2XICA 4OIIH 2IQAA 3IDGA 3KYAA 2CIKA 4AEIL 3JZ7A 5I1HL 5KG9B 4RMQA 1BJ8A 2VAAB 1GZQB 3BIAX 5JZ7C 1QYGL 4JN1L 4XHQA 2VZ1A 3WUZA 3HLAB 4XVJL 3ARFC 3IYLW 5IK3A 1UVQB 4P4KC 1X5GA 3UZVB 1YY8A 5FUOL 4K7PL 1AXSB 1CDCA 5JDJA 4ZUVB 3UJTL 4JAMA 1P2CB 4XMLH 2EDWA 2PTTA 3L7EB 1JF1A 4JO1L 1CLCA 1KUMA 4H26B 4LLUB 4U0RB 5DVOA 3TWCH 4HULB 1NDGA 3PV7A 1A9EB 4QRRE 3G5XA 1CGVA 2VITB 2PYFA 3HR5A 4JZOA 5JNYB 4P48A 1NFDA 3ARUA 4OZIF 1FNFA 1C08A 5DD0L 4C56A 3F6IA 2OR8A 3QQNA 2VDLH 5IHZB 3DURB 3UTQA 1NCDL 3EBAA 2K7PA 3GIVB 3VD4A 5JW3L 3SEPA 4M3KB 5KSAB 1GJIA 1KF9B 2V7HB 2F5BH 5DJYB 3BD4A 5SX5H 5IBLD 4JRYB 3V5HA 2FZ3A 4P57B 4UT7L 1I1CA 4KWUA 1T7YA 3TO2A 1EUTA 3TGXA 2NYYD 2OJZH 2W59A 3RVVD 3IFOA 3G6DL 4BQ9A 3DIFA 1YPZA 1U2CA 5A3ID 1DLHB 1RJZB 4GRWB 1Z9LA 1U9KA 3LRHA 1W0WB 3VXRE 4IM8A 2ZUQC 4ODHH 3O8XB 3T04D 4OJFL 2XA3A 4DN4H 2Z92B 1WIUA 1OOAA 3DETD 5FA3B 3FKUS 3QDJD 3NZ8B 5F7MC 1NLBL 3CVIH 2OR7A 2X4NA 4LIQE 4OD3H 1UYWH 2ED9A 3H2WA 1XT5A 1Z2KA 4OTXL 4WUKL 1I7UA 3L5XH 1BOGB 3AXLB 2VLRA 5DJ0A 1C5DB 4Y1AD 2EKJA 1EDQA 3PABB 2L0DA 3L3OA 2FR4A 3HE7A 4M7ZB 1CXIA 3EO1B 5D6CB 5I1DB 5F96L 5DSCA 3VXTB 3MRKB 4Q97A 2ERJC 1D5IH 1TQCC 2H9GA 3U7WL 4PJXE 3VG9C 1CS6A 3A0OA 1TZGH 2AQ1A 1ORSA 2F53E 3GMMB 3NIFE 4X4ME 2VQTA 1SMOA 1U8KA 3EOAB 3VXNA 2CO6B 4U6TA 5B4MC 2CXKA 5JOEA 2IANA 1FPTL 1ZSDB 3PL6C 4PGEB 2FEEI 4K55A 1T22A 2C9AA 1HWGB 3C5ZB 3V0AC 4N0FB 5I1GH 1ACYH 2YD1A 1H3WM 3F12B 2DDQH 4K71C 4QRTB 1JYWA 3T08A 2VDMH 2GTZA 3OSKA 3BMVA 2OTUB 5FOBA 3GSOB 1I7TB 2B4CL 4KMTL 2CO7B 3KYNB 3LRSB 3WKMH 1A5FL 3K46A 1F6LL 5DJDB 4J2XA 5I6XC 3VH8B 2QQNL 1K8DB 1TJHH 5D7LE 1XF2B 4Y4HC 4ELKA 1DBKH 5E9DE 1JPFA 4YGAB 2ESVD 1BOYA 3SDDA 1ZVSB 1MWAA 3PP4H 1YEKL 1DVFA 1Q9WB 4F8QA 4YQXL 4U1SB 4CDGC 5ISZE 2FL5A 3WHXA 4PB0H 5TGBA 3P4OA 3QEUB 4P23B 5CBEA 3O81A 3UJJH 4HIJB 4J7RA 1QSZA 3UZQA 3V52L 5HYJE 3VFSA 4HUUA 3PQYA 4KKCC 5JPNA 1GIGL 5KAQF 2HRPH 1T66D 5C0BE 2ADGA 3QUMH 3MZTA 5C08E 1J0ZA 4KFZC 3QH3B 4XCYA 4ZFFB 4MQ7A 2VIRA 4GBXA 2C1OB 2XTLA 3LQAL 1KNOB 1U91A 1NLDH 4JANB 2B1HL 5HHOB 4FQLL 4UBDC 4OCMC 3LCYA 1FL6A 2NX5B 5FO8B 3P0YH 5FFLA 3FQWA 3CX5K 4GH7B 4K3HA 1VKXB 3VGEA 4X6DE 4Z7UF 3IDMB 5D1QB 4BUHA 2JJWA 2DQJH 1S9YB 2VLJE 1VSCA 4PJFA 1DQMH 1WBXA 3T8XB 1FYTE 4LP4A 4HH9B 1MFBH 3RWJA 2GT9B 5I8OL 1H8OA 4K94H 4JQIL 4ZSOA 3SKMB 2X4QB 3GMOB 4PP1D 3CSPA 4DUVA 4TYUA 3ARDB 2AJ3A 4POYA 3HG1D 2GIYA 4J4PC 4AENB 3MGOA 4M8QB 1F4HA 2Y4SA 1MJ8L 5I73B 4I2XE 4LCWE 4JO4L 5CEZD 2ARJB 3RX8A 3N9GL 2HLAB 1KC5H 3CZJA 5D71L 4UNVA 2OSLB 3ZDZF 4NO3B 3LSOB 2E9IA 4H20L 2DQFB 3KPRA 2VN7A 3BIKB 2AJZB 4JFDE 5FO7A 3GO1L 4LCIH 3RNQA 4UZGA 2ED7A 1T1WA 4F33B 3A67H 3V5DA 1UB5A 3L3KB 1A1MA 3BAEH 2Y7QB 1CFSB 3JTTA 2YRZA 5HGBA 5JXEC 2FJHA 1H3UA 5MENA 1T7ZA 3STLA 5C70A 1MLCB 3OKDA 1JHTB 3CUPA 4XNMA 5I66A 3V0WH 2R0KL 4WI7A 4X83A 4D8PA 4EJ1C 1MCDA 1IC4H 3PGDB 4J6RH 3MXVL 3QUZD 3GSNL 4I0PD 4AQOA 3VXQA 3MGTA 1S7XA 3U0PB 4K8RH 4HMCA 4ZDHB 4AJ0A 4L8SB 3CFIC 2AXFA 5FCSH 3MCKA 1EVTC 4C83A 2XRAL 1NCCH 3SBWC 1JUFB 1CCZA 4NDMA 3TWCL 2QV2A 4OM1H 3MLYH 1CGWA 1WT5C 3RVXD 1Y0LB 2NPLX 2QLVB 1X6NA 1N6QH 5F7DA 5T1LA 3OXRA 4ZFGH 2I9TB 4Z7UB 1PG7X 4IRJA 3B5HA 5F21B 1P7QA 4AMKH 2VDLL 5T3ZL 4MS8D 3T0EC 1KIPB 5ESQB 1KB9J 4CADA 4TOYH 4L4VE 4MXVF 4LCCC 1IEHA 3AMKA 1PYWA 1JN6B 1IAOA 4JVPA 1WTLA 4N5ED 2R1WA 3UPRA 3T2NH 1LP9F 2F5BL 3HZVA 4FG6C 4P5KA 3V6FB 4A2LA 3V95A 4MB4A 3SQOH 1XF4A 4YK4C 5IW1A 2V9QA 3VGHA 2ED8A 5TH2B 4Q9QL 2XY1A 2NY2D 2OJZL 1TXKA 3CVHA 4FTVD 3KDMB 4Y5XB 3HCVB 5CP3A 4ONGH 1KV3A 3L3GB 3QRGH 3FCTA 3U4BL 1UADC 5AD0A 5I75C 4ODHL 3K4DA 3D18B 3CFCH 4DN4L 1BAFH 4HJ0D 2ITCA 4F2MB 5KZCD 4Z77A 5KVFH 1HQRB 3QIBC 4I9WE 2HLFC 3CVIL 4NQCE 3DROA 3QDJB 1UYWL 4K2UH 1E0OB 1D3CA 1UB6A 4M4PA 1T7XA 3B2VH 4GG8A 1YNKH 1OTSD 3MXWL 3QNXB 3R06B 1KELH 1YNLH 3C60A 4JE4B 4Y1AB 2XOTA 4K7PX 1JI2A 1FIEA 1VFUA 1U8HB 4JN2B 2V5RA 2XFXA 3OZ9H 3O2WH 4DGIL 5CBAA 2AJSH 5DF0A 3O6LH 4ONHB 4K3DL 3RAJH 3CSYB 4R0LB 3G9VA 1WBZB 1I8LC 1UJTA 3LOWA 1KPRB 3TH3T 3VE0A 4NWUH 3QWOA 5CGYD 4HJJL 3S36H 1JCKA 5CIPH 1MFEH 3BKJL 4LCUB 2VZSA 5I0ZA 4DZ8B 2CXGA 1ACYL 3FT4A 4Z7OF 3BH9A 3P9WB 4X98A 2GCYB 2VDML 4OKVA 2JE8A 3QXTA 2AGJH 3GSVA 5F3BA 4Z76A 5DJ2A 4NFCA 5TDNB 3T65A 1HXMA 1FNHA 3DMMD 3GMNB 3OHXA 3WBDA 4WJ5B 5KVDH 2EKSA 3O3EB 5DLMH 1LP9B 3W5MA 1TJHL 1LO4H 3EFFA 4GRLA 1N26A 4X7CC 1Z3GH 4QY8A 4LPCA 2DKUA 2A38A 1DBKL 5D6DC 1T83C 3QDMD 5BRZA 3TBTA 2P48B 3EDJA 3H9SD 2QJDA 1HEZB 2BRQA 5DZOA 4Q9RH 3RVWC 2ESVB 3PP4L 2CRMA 1A64A 2BY3A 2KQMA 4NN5B 3CFDA 3LPFA 5CINH 5KANG 4D9LH 4PB0L 2BOBB 1VGKA 3DO3A 3ZTNL 1B6DA 5E8OB 1D6EA 1ONQA 2HRPL 4KI5E 3OTTA 5F88B 3QUML 3QI9D 5IEHB 3SY0B 5C0AE 3L3HB 4KUZL 3RWFA 1VDGA 3MA9L 5T1MB 4PJBA 2BVOA 4JKWA 1QHOA 3Q0HA 1J0IA 2CR6A 3VFPB 4RGMC 3O2DA 4XVTL 2IAMC 2WIMA 4EBQL 5ERWB 4LLWB 3P11H 1QNZH 2YKLH 3WIHL 1KPUA 1J8KA 1Z5LA 2IADA 5ANMA 4OLEA 5JOPD 1JWUA 3P0YL 5L8KB 2FX8L 4RIRB 5JDSB 5I8KL 4YHKL 2HG5B 4LDLB 4MJ5A 4I13B 4MAYC 1Q9LB 4KK6D 2D4DA 5E94A 1VFMA 1DQML 4ZUWA 2XQYK 3VFTB 3QPXH 4QYOA 4FN0A 1MFBL 5IW6B 3QEQE 4K94L 1EBAA 1VEOA 3T09A 1B6UA 5CSBA 1UFUA 3NH7H 1WUNT 3P2TA 5JO5A 4EI5A 3S4SB 2DLEA 3HG1B 2JF1A 1A4KB 4PTTA 5IGXH 4WWKB 3TN0D 4HKBA 3WNNA 1KC5L 1BGXH 4JY6B 2YPLD 1A6WH 3BO8A 1MLBB 1GYAA 1Q9KB 3MX0A 4X6CE 3WSQH 5C92A 4IMLA 2AXJA 4IJ3C 4PBWD 3BPNB 4LCIL 4YH6A 3REVB 3TM6A 3ZSTA 4PJ5A 3SOBH 3MV8D 3KLSA 2FGWH 3A6BH 3BAEL 3SDCD 3QNZB 3MJ6A 4UUJA 4JDTL 2OTWB 4X99A 4OGAD 1R5IB 3OKOB 1K4CB 1MEXL 5TF1H 1F58H 4QT5A 3DVNB 4EUPB 1ND0B 4LVHB 4QXTB 3RNKB 1UM4L 4JRXB 1ZHBB 3LVEA 4LRIC 2W9LA 4MWFA 2PO6A 4F15C 4NPYB 1QOKA 1IC4L 4J6RL 1CXLA 1MHHA 1I8MA 3IKCA 1AIFB 3QUZB 4I0PB 3TEUA 1OP3H 4LHUA 4K8RL 3KJ4B 5ALCH 1I1YB 5TDPB 1NFDE 5JQ6H 5KW9H 4HGWA 3VFUA 2CGRH 2R4SL 4X9IA 5JORA 2JELH 2H32B 4C56E 4NNYB 2EO9A 1WTGT 1I4FA 1NCCL 3MODH 1A6TA 3KPQB 2B0SL 4NQXA 4ODSL 4U6XA 5E0QA 4YLQT 3HAEB 4CNIA 3QFJD 1DEEA 2YUVA 1CD0A 3NVQA 1K3IA 4ZFGL 2IPTL 3LD8B 1DBBH 3BH8B 2YHGA 1WAAA 2X70B 4PLKD 1G7MB 4R8WL 5J1SC 3CXDH 1CTOA 2ZKHL 5E8PB 1IT9H 1REIA 2GYSA 4ZAKD 5MEPA 1BZ7B 1J12A 3IF1A 3QG6A 2ICWB 1CT8A 1YPZE 3N85H 3T2NL 4LPXA 3NN8B 4X8JA 2G9HB 4NUJA 4KU1A 3JWDC 2LE9A 1FZJA 2C3VA 1TQBB 4PJ8A 1YEEH 2EZ0C 2EIZA 2NY2B 4U6YB 3NFPA 5DJCA 4NO5A 3QDGB 4FTVB 2QSCH 5SWZD 1KBGL 1YC8A 3MRNB 3O9WD 5FGSA 4ONGL 3QRGL 2W0LA 2BNRA 3P9LB 4X4YB 3QXAA 2EDXA 5DHVA 2DRUA 1I9JH 4DCQB 2VLRE 3CFCL 1CBVH 4YAQB 1P5VA 4R4NC 4U33A 4WI2A 1DQTA 3VI4F 4NM4H 5T3ZD 4LSUH 1MFAH 3LZFH 5KZCB 3TP4A 3BGAA 3D25A 4K2UL 1QBMH 4HV8A 5GGRY 1CLYL 4LLYB 3B2VL 3O6ML 2DB8A 1YNKL 1M7IB 4F7PA 2OK0L 3KVQA 1KELL 1YNLL 4OFIA 5DEGB 1T5XA 1ZLWH 3VXUA 4ZUSA 4Z6AT 2IANE 4ODWA 1FLTX 3AC0A 2A6KA 1WF5A 4Q2ZB 3O2WL 4JREB 1JYXA 5DUPH 3TO4C 1L4IA 3VXSA 2DM3A 3RAJL 1FN4B 1QSFD 4LSQL 2DJUA 3WFDL 4K7PY 4WW2F 4G9FA 1UEMA 4Z7VA 2E9JA 1FE8H 1OQOA 1I9EA 2BHUA 3P9MA 3P4LA 5B3NA 5A2IH 3QO0A 3ES6A 1MFEL 4XPTL 3C8KB 4QRQA 4ZXBD 3VGAB 1KENH 3ALPA 5IIEA 4OT1H 4AG4L 2OZ4H 2F19H 4Z0XA 2XWBA 1U8MA 1R5VA 3ARPA 4XCEB 5DVMA 1KIQB 3SGJC 1INEH 2JCCA 2X4SA 2YR3A 2AGJL 1RUAH 4IIQA 3DUSB 2EDOA 4HCRH 3UJIL 2V17L 1J7VR 4WI6A 1DUZA 5KVDL 3DMMB 3KPMA 5DLML 2WWMC 4CVXB 1MUJB 2WK2A 3PHQA 4C4KT 5SWSA 3I6KA 1D5BA 4S1RH 3SE4A 4OLUH 1K9TA 1XGUB 5HGGS 5LKNA 3KPOA 5HDBE 1FZOB 2EXYD 3DRTA 3PQYE 5B3JF 1QBAA 1CK0H 1I1AB 4Q9RL 1HQ4A 2VXTH 3MRPA 3QDMB 3BP5A 3PNWA 5D9SA 2EICA 5CAYB 2YRLA 5DDHA 4D9LL 5CINL 3NBNA 2CDFB 4EEEA 4P5TC 5D2LA 3HUJF 2JK5B 1HOCA 5GJTH 4KRNA 3QCUH 1GH7A 1OB1B 4HX1B 2ZSWB 4JM4H 3QI9B 3D48R 5EUOF 3C87A 5BXFA 3VRIA 3X13A 4CW1B 1UXWA 4EI6A 1ZS8A 1P7KA 3TA3C 5FO9B 1NBQA 3P11L 4PJFE 2YKLL 4ELMA 4HUWB 1K8IB 1ORQA 3BDXA 2P47B 4P3CH 3C6LC 2C3GA 3BPLB 4ZSOE 4R4BA 3P30L 2XZQH 3HKFA 1MHCA 1QFUH 4LHJB 4WW2B 3RWIB 5DK0A 3ULSB 4IRZH 2B5IB 2Z8VC 1MCIA 5DRWA 1C12A 5F7EH 1D5XA 1WCBB 2OCFD 2HVKA 3EOTH 5DC9B 1YMMD 1NGQH 2J5LC 4GAGH 1R3HB 2XXCB 5CS7A 2V2WB 5C2UB 5E4EC 1Q8MA 1YZZA 5TFSH 1H0DB 3NH7L 3O0RH 3H7BB 4YWGH 3U4EB 5F8RC 35C8H 3KPRE 1UKSA 3TFKD 4NFDA 3GRWH 4MVBC 3DX6B 3IXAB 1JGEA 3DWTA 3BW9B 4HG4K 1G0YR 4PRHD 1T1XA 3TN0B 3T77A 1MHEA 1BGXL 1JPGA 1W72H 3IU3B 4ORGB 1T04B 4LHUG 4FQXA 5C3LD 2YPLB 5BZWB 5MENE 3WSQL 4HKZB 2Y23A 1K4DA 2JJTA 3GZKA 5GRUH 1QACA 3MUGB 4HKXB 4ZO6A 4N1CA 5H35B 2FB4L 4MGXA 2R69H 3RHWF 2EE6A 3ZDYE 2FGWL 2D31A 5CZXC 2Z31B 3TYFA 3MV8B 4B50A 3BI9X 1JMXA 1H8SA 2GW5A 4XCCH 3SDCB 5CEXB 3UDWA 3U4AA 1F58L 2GJZB 1CGSH 3E3QC 1D9KA 3ETBF 5F44A 3HUJB 1EEUA 1SBSH 3MJ7B 5D93B 5J1AA 1TCRB 4F7EA 1FJ1A 4M3JA 3MV01 4OIBA 3TIEB 3U6RB 5EUOB 4YHPA 1V3KA 4J1UA 5JQ6L 1KCRL 3IDYC 4ERSL 2JELL 3G04A 4JO2H 5IB2A 3ILQD 2DL9A 1KXQE 1QFWH 4YHLH 3MODL 1CICD 3DRQB 4NT6A 3QXDB 5C0GA 1Y6MR 2VZUA 5DZLA 5EU7C 3U36B 4GG6A 3RPKA 4URTB 1AO7B 3QUYC 1T2QH 1JVKA 1NUGA 3ARBA 4G9DA 3QFJB 3O6FA 4XNYL 4R26H 2VWEC 4PLJD 5DTFA 2F5AL 4ONFH 3V8OA 1S7UB 4FRWA 2E7BA 1TENA 1RZKC 5HDQL 1IT9L 3CZFB 5FYKU 2VAAA 4U1IB 1A7BA 1MQ8A 4ZAKB 2QBWA 4GW1A 1WC7A 3GSNB 4KY1H 4RWHA 4JR9L 4BK5A 4LLMB 4PGDA 1KIRB 1QUNA 2RFXA 3HZYB 2DI8A 4JFOB 2IMNA 4K7FB 1NUFA 4WW1B 3U2SA 1CG9A 5HHXH 3V6ZA 3IETB 5BO1H 1A9EA 2QSCL 4XTRD 3O3DA 5SWZB 4Q7DA 2GJJA 3O9WB 4JHAH 4NZTL 5DWUH 1I9JL 5KSUA 4M93C 1CBVL 2HN7B 4NM4L 2FJFB 4L1HA 2NY1C 2VMFA 3DURA 3O11A 4NC0B 4BFGA 4LSUL 5T33H 3OB0K 2PW1B 2DKMA 1QBML 1UJ3B 3BPOB 1MCQA 3QSKB 5DJYA 2Q8AH 3NCYS 4KKLD 2P5EA 4JB9L 1I8KB 2R9HD 3SHSA 1M6OB 4LRNL 4JM2D 1U8QB 1ZT4A 5ETUB 5HBBA 2AS5M 3LKOB 5J4MA 1QSFB 1RJZA 4Y2DD 1FE8L 1W0WA 4L8CB 4TQEH 3O8XA 5CHNB 4YUEL 1A22B 2Y25A 5FA3A 4UTBH 4WI4A 1D5ZB 3QHTC 2F58H 4ZXBB 1AQDA 3LQZB 4NQVA 2F19L 1NH6A 3K1DA 4MSWA 1INEL 2FBOJ 5DUBA 1MCHA 4HCRL 5BRZE 1RZIB 3EO1A 4XHJD 3MRKA 2Z0BA 3MOAL 2FBJH 1JHKH 1XH3B 1G1CA 1HKLH 2AEQH 2WBKA 4YHIB 4S1RL 4BFIA 3VD7A 3EOAA 3DGGB 1IL1A 1U92B 3HE7C 1E4WL 2HYMA 1TCMA 1ZSDA 1CK0L 4U2ZA 3BEVB 5GGSB 3BE1H 3KS0H 2VXTL 4LL9A 1GXEA 3NCJH 2VE6A 1N6VA 1KB5H 1S9WB 4I5BA 4PJBE 3VDAA 4HFUH 3D85A 1EBPA 3FONB 4I3SH 4QRRD 2RCSH 1SYVA 4ZS7H 1BVKA 3ROLB 4XPAH 5GJTL 2OTUA 3MRRA 1OP5H 2BJMH 3QCUL 1BLNB 1I7TA 5ANME 2O5YH 2NY5L 4JHWL 4P46D 2DM4A 5DJDA 1FBIL 1KCSH 3AM8A 2VNCA 4L9LC 4YHOH 3VH8A 1LILA 5HYSA 1XF2A 2JIXB 3IJHB 1XF5A 1SVCP 2V2XA 4MQXD 1T2XA 2E7LC 1PG7W 1GVIA 3LKRB 4CVZA 4P3CL 2WLZA 5ACZB 3A6CL 3RIAK 4U49A 1BVLA 1CU4H 1MCWW 1ZVSA 4F7CA 2XZQL 1B0WA 4U1SA 3PV6B 1E27B 1QFUL 3CSGA 1MCOL 4HBQA 3O2VL 3QEUA 4KVNH 4L1DA 5HPMB 5GGSY 1CF8H 1NGXB 5I1LA 3FB8B 3EOTL 4PRBB 3U30C 1NGQL 4GAGL 3VXRD 2YBRA 3OR7A 5JUEH 5JW4M 2XQYG 1YMMB 5E6IA 2VXSL 5C0IB 1QTYT 3RY5A 3O0RL 4YWGL 4ZNEA 2PW2A 35C8L 4LARL 5GS0D 2CUMA 5LWYL 3D0LA 1EHNA 2IBZY 2XI9A 3GRWL 3UYOD 2C1OA 3VFGH 3BVNB 4I4WA 4ETYA 1CN4A 1CTNA 1KNOA 1J0YA 4HPOH 2IH1B 4PJ5E 5HGAB 5HHOA 5I76B 4DOHE 1W72L 4PRHB 1DTUA 2NX5A 3HC0A 4HIEB 3BYYA 4PYGA 3GSWB 5FYKH 1OSPH 1NBZB 5GRUL 5F1IA 3FOMA 3S5LA 5E8DH 2WZPD 5HHPB 3T8XA 1OCWH 5INDA 2VL5B 1P4BH 4JO3H 4NO2A 2VL4A 1UT9A 4XCCL 1WK0A 2MQCA 2ENYA 3LB6C 3SKMA 2X4QA 3QXVA 1IC5L 4L3EA 2HVJB 5IWLA 4RX4A 5C0EB 4YHNA 4M1CD 1VEMA 3WV0A 5FGCE 1OP9A 2WANA 1LVEA 25C8L 4QHMB 5IB4A 5JLZA 7FABH 2OSLA 3JV5A 2XYCA 5KJRH 4HMDA 4L4JA 4ZNCD 3TIDB 3FQTA 4JO2L 2NR6D 1FG2B 1WAAE 1QFWL 4EDXB 1G7JB 4AIOA 3K8LA 4A6YH 3JXAA 2BNUB 4GRMB 5D7LD 4AH2A 1CICB 4RMUA 1ZGLM 1B2WH 2Y7QA 4WTZG 1CFSA 5ITFB 2EIEA 5E9DD 5H37H 2NMSA 1HHHA 4R26L 4FABH 4U3CA 4BQCA 5HVGB 1DN2A 3KPSA 3RGVD 4CU7A 3H9HA 1KJ3H 4PBVC 5H94B 4JCMA 2Q6WA 1MLCA 5ISZD 4QHLA 4PJDF 3PGDA 3O3BB 4DTGH 5HYJD 2EDRA 2YMXL 3ZO0A 1UXSA 2XG5A 3KYOB 3U0PA 4KY1L 5IB5B 1TTUA 2FEEL 5C08D 2BNRE 2DWDB 5ACMA 4G6JH 3WIFA 4PG9A 3HI1A 5HHQB 2JTDA 1T4KA 3EYSL 1DP0A 2H26A 2PXYC 1HHGA 1A3LH 4R9HA 2B7DT 2DIJA 2CUIA 3CU1A 3SCMA 5HHXL 4EN3B 2H45A 5BO1L 1MIEH 1OHQA 3LEXA 1HSBB 5FEBA 4GQPH 1Y0LA 1YECH 4KPHH 2HTLC 4JHAL 5DWUL 2I9TA 5BQ7A 5H2BA 1JRHH 5EU5B 2J7LA 1MJ7H 3VXUE 1WJ3A 1LDSA 2VLLB 1KIPA 3NA9H 4G8EA 5ESQA 1N7MH 3AREC 2QHRH 4NZDA 2HTKC 2VLJD 2ATPB 3VXSE 1OD9A 4X8XA 1U8NB 3QR2A 3U1SL 4M1GH 1BZ9B 4GLRH 3RBSA 3VGFA 2VDRH 3PJSA 3BISA 2AK4D 5HYEA 4RFOH 4G9FE 1Z9SA 4Z7VE 4YZFE 1MOEA 3PWUB 2EYRA 5TH2A 1FVCB 4FXKB 4WU7B 4JM2B 2WW8A 4ORZC 5ESAB 3G5VA 4WV1A 1WQVT 3HCVA 4WI9A 3TPUB 1F2QA 5ILTH 3L3GA 3WO4C 1ZMYA 2NNAA 4U1MB 3HE6C 4R96A 5DD3H 4Y2DB 4OLYH 3VXPB 2JCCE 4U2YA 4RWYL 1RVFH 4BH7A 1AXTH 4F2MA 4CJ1A 4JFDD 4UTBL 1HQRA 2EXWC 2F58L 1V3LA 2OQJB 3O45A 1AR2A 5BOZG 4FQJH 1KTRL 3UTSB 5SWSE 2CJUH 4CVUA 3QNXA 4YJZL 1NBYB 5J89A 4PJDB 4X7TB 1OAQH 2L7UA 1SJHA 4JN2A 3EGSB 2R1XB 3ZTJG 1FQ9C 3IVKB 2FBJL 1G6RB 1JHKL 3FO1B 4Q6IB 5DVLA 2W0FB 4LU5L 3TT3H 3FN0H 2AQ2A 2RGSA 3VH8G 1WFUA 5HYSG 1KPRA 1N0LA 3C60C 5FA4B 1IC1A 3MLUH 5KVEL 2DQUH 5D2LE 5BCAA 5HY9A 4PJXF 5E7BA 3BE1L 1H9VA 1NCAH 1IGYA 3NCJL 3NIFF 2OLDA 3WCYA 8FABA 4RCAA 7CGTA 4DZ8A 4HFUL 3S37H 1AHWB 2ZG1A 4I3SL 5TDOB 2RCSL 1VACB 1L6ZA 4O2EA 2EIBA 5KSVB 4QRRB 1EAPB 4HG4J 2P8MB 4ELME 4DKEL 2O5YL 3GMNA 5JW5B 4WJ5A 3QG7L 4OZ4B 4P46B 2K3TA 5IVZB 5F9WC 1A3RH 4KKBC 3TCXA 2C7UB 1T80A 3IXTA 3MCLH 4MQTB 1CD8A 2G5BA 4MJ2A 3EYUL 4ZPTA 1PLGL 4M5YH 3HRZA 5FYJL 4X7EC 5D2NA 1XGRA 2ESVA 4PGJA 3S3JA 3M17A 5DGQA 4QNPE 4LASH 3SDAA 4PJAA 5CJOH 4FFVD 4KVNL 2GITB 2BOCB 3SGKA 1CF8L 3S5LG 4R3SB 2MQ3A 2X9YA 1X7QB 4PJ9B 3VXRB 3SY0A 4NC1E 5C09D 15C8H 3MLPA 4JY4A 5B38B 2LTQC 3LRGA 4Z0BL 1AH1A 3MRMA 1LEKB 4G7VH 5EIIB 1X5ZA 5CD5D 4NQCD 5IMMA 3OBAA 2FDBP 2QADC 3KLHC 5C07D 1AGCA 1RUKH 5ERWA 4EXKA 3PUCA 1XCQB 2NZ9D 3A6OA 3MFFB 5E5UB 2OBGA 4XWGH 4KC3B 4RIRA 3HZKB 4XAWL 3EDEA 1IEBB 1Q9LA 3BMWA 4QTHA 1A8JH 4GXUN 4CMMB 2EDKA 2JB5H 4X9HA 3C9NB 4JRWA 1KTLA 5D96B 3JV4B 3VFTA 1OCWL 1BMGA 1MIMH 2Z91B 1GHFH 4KRPD 5KBNC 3FN3A 4X6DF 3RDTD 4XMPL 2X4UB 5J11C 1FCCA 4PY8J 5J12C 3VFRA 1FORH 2I07A 1VCAA 3L3DB 1PW3A 1TZHB 2GSGB 4JQVC 1I9RH 4XBEL 5F6HJ 3EUUA 3HG1A 4KJWD 4KZDH 4CDHA 3QAZC 4ZFOB 4Y5VB 3W11C 4BSVB 1FVDA 4IRSC 1WSST 3Q6GL 5C6TH 7FABL 5KVGH 3ULUE 3MJ9L 4GG6E 1Y6KR 3AB0C 3PWJA 1RQ5A 1CFNB 3RWDA 2FJGA 2E5EA 1PGRB 4N8VB 1NUDA 2I60H 4UB0H 5C0DA 3QIWC 5T3XH 4NNPH 4YO0B 4MA8L 5D7LB 3PDOA 3K80A 1R5IA 4WUUD 1K4CA 5KANI 2YPKB 3S9DB 1ODAA 5E9DB 1AGEA 4G8IB 4Y89A 1TJIL 1N0XL 3WYRA 1KJ3L 3PWVB 3RGVB 1R3KB 2QR0B 5DK2B 1A3QA 5ISZB 3MRFB 4WTWA 1CD9B 2IH3B 1I85A 5T5NF 4WI5A 4XNQB 4KI5D 5HYJB 1A9BB 3T1FB 4BUGA 4W4OC 2ZUSA 4AM0A 1Q9OB 2FX9L 3HZMB 5C0BB 1U41A 4FZEH 5C0AD 5TDPA 3U7YH 1S7SA 5C08B 3OR6A 4NNYA 3ULVL 3NFNA 1A3LL 3KPQA 2A9NH 4XXDB 5IVOA 3DTXB 3WLBA 1MIEL 4TSCL 1VPOL 2P8LB 3HAEA 2FEDC 1YJDH 1JTTA 3VWJC 4KPHL 1S9VA 1ULVA 3RFZC 1U3HC 5E70A 2GQHA 1JRHL 1XGYL 5GGRA 4ZFZB 2E7MA 2AV1A 4HWBA 4OLZL 3BH8A 5ENWB 2X70A 3BHBB 2P5EE 5F9DC 3NA9L 4YHMH 2X4PB 5C6WH 1N7ML 1NCWH 1T3FA 4MAUH 4X6DB 3U9UA 2QHRL 1FGVH 2PCPB 1J0KA 1KJ2H 5FK9B 3ECBB 1BZ7A 4N8PA 4R2GD 1A14H 2VLJB 3ESUF 1W0YT 2VDRL 1EGJH 4I1NB 4DKFL 1KSRA 5I15H 4UTAH 3MBEC 1ZGLP 3BPCA 3QEQD 3I3DA 3NN8A 4QF1A 2G9HA 4Z8FH 2AK4B 1DE4B 1XIWD 1QLEH 2UY7A 3Q5OA 4JLRA 4LVOB 2AXGA 4M9PA 1IQDB 1CE6B 4QRUA 1RFDH 3B9KC 2A74B 4FQ1L 2YK1H 4I2XB 5ILTL 3QIUC 5GS2D 3EO0A 1CD1B 2CRYA 4NHCH 43C9A 1TZIB 2BVQB 1IAKB 4N90E 1JWSB 4YAQA 4LBEA 3WL9B 3OQ3B 6FABH 3GSQA 4KZEL 2DQTH 2MHAB 2ADJB 3FB5B 4JFDB 5HVHC 4WGVB 2XWTA 3BKMH 4AL8L 1IM9D 3X3GH 4PLNC 1CXEA 5IM7A 1SVZA 1OY3B 2A0LD 4HWUA 3I6GB 3PGFH 2OL3L 1OAQL 4Q2ZA 1IGCH 3PGCA 4QHUB 2NY6C 4HS6B 5F6IC 1MCFA 4ZMAT 3CC5A 3MLUL 1ZA3B 2NW3B 5FUCC 4RNRB 3HNTH 4DKAA 5HI3C 2EDBA 1NCAL 4ZPVB 4M00A 4DVRL 4KXZH 4XPFH 3X14B 4C56D 4G80B 4J3OC 2CKBA 4IHOB 2OM5A 2IC2A 5SWQB 4NKDB 5DEFB 4Y4KC 1NEUA 5JHDA 3GJFH 2GY7B 4XCEA 3L3JA 2WUCL 1NANH 2CUHA 4L3CA 2E27H 2ICEB 4M43H 4KGJA 4X9FA 2FHCA 3MCLL 1VERA 4Z7WB 1A7QH 4P3DA 1G1YA 1RHHA 1FDLH 4OLVH 2AKRB 5IJVA 1SYSB 1RAMA 4M5YL 3MNZB 2ZP0T 3KWWB 1U3YA 1NFKA 1AGFB 5IROA 3QRFM 5KN5B 4M9OA 2HJFB 1EK3A 1ETZA 3H9SA 1A1OA 1A2YB 1GPOL 4P2OC 4LASL 5EB9A 3UTOA 4ZNEE 1A7NH 3UXFA 4CBPA 5DA4A 2IQ9L 4JFEA 3FO2B 5DD1H 3BP7A 2ZJSL 1LDPL 2N4IA 2VLRD 2WIIB 2NZIA 5HHOE 4P5MA 3HMWH 2HT3C 2ZSWA 2NX5E 5CGTA 4G7VL 4KI5F 4RZCB 3LHPL 2ZZUT 4W81A 5FGRA 5JIIA 3EYQC 1UZ6E 5D7JC 1S7RB 1WFOA 4NQCB 5KS9A 2MPAL 3V4VL 5C07B 5I71C 5C0CD 4L5FH 5I8EA 4TULH 3RU8H 5FYJD 4XWGL 1IAII 1HHKA 2IAND 3M45A 2M26A 5FB8A 3WEXA 3OAZK 4L3EE 3H7LA 2APWA 3RWIA 3I84A 1DBJL 2JB5L 4NJ9H 1X5KA 4LNVA 1G6VK 1XGPB 2NXZB 4X6BA 5IMOB 5JR1H 1WCBA 1MIML 2ICWJ 1A6ZA 5LBSL 1M71A 2R23B 1LWRA 5GIRB 2V2WA 4PY7B 3AMLA 1HYSC 3RDTB 5CCKH 1QRND 5INCB 2H6PA 1H0DA 3GUTB 1XGTA 3U4EA 4R6UA 5EBLB 1EVUA 1TDQA 4DUXA 3AROA 1I9RL 3G5YB 3CJJA 4KZDL 2YD5A 3EOBB 2AABH 3IXAA 3BW9A 5FGBA 3E2HC 4JPIA 3V4PH 4KROD 4XB8A 1NAKH 3F7VB 5C6TL 5CZKA 1F6AB 1HCFX 4ORGA 3QEGH 1BJ1J 4MD0B 1T04A 4J3VA 4O2CB 2YPLA 2CPCA 4N0UA 3SDDD 3KPSE 1S8DB 2EE9A 1DVFD 1JFQL 1OAZH 2BRRH 3CFEB 3GFUA 5BZDB 2I60L 5T3XL 2A6JA 4NC1C 4X6CF 1F6FB 1X5FA 5A43C 4FQXC 5CEXA 2VQ1A 1MCBA 3HAEG 2J4WH 4XPBH 1U8OA 3GSUA 4TUOB 3JWDH 4X80L 4H8WC 2FHFA 2JJTC 2GJZA 4WUUB 1CXHA 5E8EB 1KJVA 3BEWA 4L4TD 3C09B 1GZPB 4U1GC 3MJ7A 1TTFA 2X1OA 1H3XA 3QULA 2A73B 4GBXD 32C2A 2ZPKH 5D1XC 3TIEA 2HT4C 1DANT 2HAZA 4LSTH 3L9RA 3WDIA 2OMNA 4YIQB 5JA9A 5JXAL 4FZ8H 3U7YL 5C0AB 5GGTL 2J88H 3GNMH 4ZQKB 3MO1B 1E6JL 2A9NL 3QXDA 1ERNA 1NFDF 2FD6H 2WINA 3SO5A 2VR5A 1T21B 2A83B 3QFJA 3ARTA 2EDLA 4MDJA 3IFPA 2UYLA 4KK5C 5M7QA 2EDNA 3EJYD 1OAUL 1FO0H 3CZFA 3N1GC 4MAUL 1X4YA 2K1MA 4FFZH 4U1IA 2ADIB 1KJ2L 4ZAKA 3PP3H 4GAJL 3JUZA 4UV7L 3BXNA 5ICYB 3OKMB 1EGJL 3GSNA 4R2GB 4CN4A 5I15L 1EERB 4UTAL 5IOPB 1LEIA 3MLRH 4UOW1 4Z8FL 4WFFD 3QEQB 4LLMA 1RSFA 3QJHB 4JFOA 1HN1A 1QSVA 1XIWB 3C5SB 4MD4B 1EEYB 3ULVD 5AUMB 3R1GH 1YYMH 3KPRD 1YPZF 1AJ7H 1BFOA 5E08H 5A1AA 3K8MA 5FHAL 1UCBH 1RFDL 3IETA 4TVPH 1KOAA 5IT2H 2X89A 2YK1L 1J87A 4AZ8A 3VFNB 4YE4H 5I16A 5FV1L 3MV7D 4NHCL 4LLQB 4P9MH 5HYQB 5GGVL 4U0RC 2FJFA 4XI5C 4X6CB 5LGJB 2DQTL 1INDL 5LAXB 2PW1A 4BM7A 43CAA 4F57H 1DDHB 4KGLA 3BKML 2IQAB 4PBXA 5D70H 4POZC 2YXMA 5CZVH 1IM9B 2NY4D 4MMZC 3PL6D 2X1XR 4HIXH 1OPGH 2W07A 3O6KL 4LPWA 4N0YH 4NRZB 3PGFL 3VA2C 1I8KA 1C7SA 5IK3B 2CR3A 1YY8B 2Y1VA 1BQLL 1Q72H 5KSAC 5EN2A 2I9LA 4JAMB 3TH4T 4ZUTB 4WO4A 3LKOA 2PTTB 1JF1B 2FLRT 3BZEB 4L8CA 2W0KA 3G5XB 3HNTL 1PX4A 5CHNA 2X40A 4YDIH 2VDNH 5T1LD 4JZOB 4KTEH 4IRJD 5FKPA 1ZLSH 4XPFL 5DJAA 2DYPA 5SV3A 1P7QD 1TVBA 5ESVB 2CLRB 4HUKB 4C56B 4CL7A 3UTQB 4B5EA 3W5NA 2IFFH 4TSAH 3RL1B 3DVGB 1WLHA 1RJLA 2ZCLL 3MYZA 5DQDH