2RCSH

Immunoglobulin 48g7 germline fab-affinity maturation of an esterolytic antibody
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
217
structure length
217
Chain Sequence
b'QVQLQQSGAELVKPGASVKLSCTASGFNIKDTYMHWVKQRPEQGLEWIGRIDPANGNTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCASYYGIYWGQGTTLTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN 48G7 GERMLINE FAB
molecule tags Germline antibody
source organism Mus musculus
publication title Structural insights into the evolution of an antibody combining site.
pubmed doi rcsb
total genus 45
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 1997-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2rcsH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2rcsH02
4XVJH 1S7RB 4GG8A 4HX1B 1KJ2H 2XZAL 3VWKB 5J4MA 5BZDA 1LO4H 2NZIA 3WFBL 4QYOA 5JIKA 2VZUA 1CIDA 4U33A 4EDXB 5I71C 2GJ6A 3QEQA 4HMCA 5TFSH 5L8LB 3WEXA 4OFIA 4NUJB 4DZBA 3WHXA 5BVPH 1NBYA 2GTZA 2P5WB 3MOAL 2I27N 2PTTA 5C0GB 1P9MC 4JHAH 1D5BA 1IAKA 5IMLB 3C6SB 1ZVHA 4ONFL 2WWMC 3VXNA 3QULA 5DMKB 1IT9H 1KB9J 3TIEB 1YN6B 3CDYA 4ZS6D 3RWJA 3CIQA 1P2CB 3QULB 3WIHL 3LN5A 5F7WC 1VACB 1WZ1L 1YN6A 4PS4H 1ZLVH 1JRHH 2ICES 4YHML 2Q3ZA 1QSED 3MUGA 4OIAA 3OAUL 2LVCA 3Q1SL 1AXTL 3RVXD 1JZ4A 1RFDH 8CGTA 4NOBA 4DVBB 3GBLA 4XAWH 4JREB 4MA8H 3ARSA 5KBNC 4O4YH 5F70A 3DVIA 3TH3T 1TTFA 5D2NB 3WFZA 3C5ZA 4LKXA 2HLFC 2PKDA 3MSPA 3ILQD 5BZWA 1LP9F 3BWAB 4GW4B 1G7PA 4R7NA 3OXSA 2YSSB 1CQYA 5FECB 2NY6C 4Z7OF 4P2QE 4X7TB 1JHTA 3DVGB 4XCEB 4E5XA 1G0DA 3EDKA 1L6ZA 1AO7B 3SJVA 1TZGL 4L4TE 1IM3A 3L5WB 4DGYH 3PL6D 3QIBB 4WWKA 4ZQKB 3UDWA 3RQ3A 3GMRA 5DRZB 1EZVX 1MI5D 4CVUA 3A67L 1WBXA 4D94A 3AB0B 1YUHB 2A9ML 9CGTA 1ZEAL 5DO2D 1T1WB 1FNGA 4L8DA 1WV7T 4JFEE 3ELAT 4LVNC 5BW7A 3QDGE 5KN5A 5M94B 2VDML 3BHBB 1U8IA 2B1HH 4GMSH 5FYJL 2JE8A 3I2CH 4MJIE 5I73C 3U7YH 3BOVA 2BNRD 4DUXA 3LQMA 5F1NA 5TF0A 4MAUL 4RFNB 3FRPG 5EFIA 2FO1A 4RMWA 3HA0A 1MFEL 4U1NA 3FT2B 2Y5TB 1SMAA 1GGBH 4NO3A 2D7OA 5HYSG 2J6EA 4KRNA 4WEUD 3P9MB 1ORSB 3V0WH 4BJLA 1E6OH 4WUKL 2A73A 3QPXH 1U8MB 4EI5B 1S7SB 2F53A 1CDUA 1RJZA 2H1PH 1QPPA 1QFWM 3C8DA 3OKLB 3SBWC 3LDBC 1A2YB 2UYLA 1A6WL 1F4HA 1I3VA 3FFCB 5D7LB 1CL7H 3VFRA 3WLWC 5ELIA 3MLSH 2VN7A 3IFNL 2ZUYA 3MRRB 3GMNA 1ZVYA 4M3JA 3OBAA 2JB5L 1TJIL 5FYLE 4ONOA 4U4BA 1TQCC 4I2XE 4RMQA 4APQD 3DI3B 4LCIL 1L4IA 5I8EA 1E6JL 4PRNA 3TGXA 2HJFB 1EEYB 2I9LA 2EIBA 4P2OB 3LV3A 2VDNL 3MMEB 3GMPA 1EMTH 5ESAB 4ZTPL 3NCJL 3SGEI 1RIVL 5FCSH 1QZ1A 43C9A 2VLME 5FV1L 4NRZA 1MRFL 3PWLB 4X6EB 5GS2H 4Y5XC 2GITB 4YHMH 1LDPL 3K1DA 4UT9L 2GI7A 1JNLH 1U91A 4U0RB 1NDMB 5D7JC 5HY9A 1KIRB 2YRPA 4JANA 1Y18A 4TPRL 4IIQC 4XB8A 4TQEL 4HIEA 4IRSA 4QRQB 3O2WL 3F7VB 3OF6A 3DROB 1AE6H 1RULH 3GJFB 4G6FB 1N5YH 4I0CC 4LCWB 3SGDH 1IQDA 1BAFH 1MIEL 4QRQA 3QUMB 3GDBA 5I75B 2NLJA 1FGVL 3RY6C 4JQVC 1H0DA 4MDJB 3K81A 1EO5A 1IQDB 1KG0A 1AH1A 5E6ZA 2VITA 4MNGE 4YH6A 4DFIA 5I8KL 1DN0B 3CFKB 4WY7L 2AK4B 3OKOB 1TJGH 3BRFA 4Y1AE 2OI9C 4CU7A 1BF8A 1R0AL 4WU7B 5F7DA 3A67H 2Y25A 2AQ3A 5C0CD 1S9VB 4RAUB 2H6PA 5CKGA 3NZHH 5EBMA 5GSRB 1RIHL 5C0FB 1DLFL 2Q7YB 1VKXB 4F57L 3VI3F 2XZQL 1B0WA 1NLDH 2XG5A 4OM1H 4HKBB 4I77L 1FZMB 4ODHL 4XVTL 4Q9CA 3GNML 4TNWK 5FB8B 1J1XH 5D7JB 2V5MA 4N1EA 1D5IL 3W0WA 1T5WA 4XCCH 4KKNA 3T0AA 3T2OA 5KS9F 1FSKC 2LU4A 5GS1A 2YC1A 5INDB 5DSCB 1OP5K 1TZIA 5JW5A 4M93C 1RZJL 3U1SH 2IGFL 1FVCA 3PQYB 3AXLB 5J11B 3O3DA 3GKWH 2YC1B 3QQ4B 4JN1L 5DZLA 2ADFL 5JW5B 3U79A 5BRZE 5CP3H 3TBVA 4D3CL 2EIDA 5J1AB 5INCB 3S8WA 2VKXA 1AR1C 2CUMA 2VLJB 3CX2A 1TQCB 2H32H 1NSNL 1ZV5A 1T89C 1ACZA 5D7IE 3MA9H 5GJTL 3PHSA 4KZDH 1AP2A 5EZJA 5ERWB 3QFJB 2V2WA 5E8NA 1A4JB 4WTZA 2NY3D 3JTTB 4X6CA 3T3ME 1MIML 4X7FC 5JHDB 5ERWA 4Y8DC 4MVBD 2EH8H 1M6OB 5E8DH 3L5IA 2W60B 3IU4L 2IANB 4XAKE 4YDKL 5H94A 3CVHH 3X17A 3UTZA 4MQXC 3MLSL 4PTTB 5TGBA 3ULVC 3MUY1 4YXKL 4Y5YB 4DKAA 4ZOCA 3H9SB 1ORQB 4IM8A 4JDVB 4MCZA 2R9HC 3L5XH 5H8DA 3BPCA 4ZPVB 1VFMA 3FRPA 4NUGH 3QDJB 1ZA6A 3BE1L 4XMKL 1JMZA 5F72S 1SEBB 4KHXL 5IUSA 4JKPL 3O6KL 3WIIH 2W9EL 1QFUH 1FFPB 1NC2A 2E5EA 4HZLB 4WFGE 3DX7A 5AD0A 1DSFL 3W11D 4LL9A 4UUJA 4HFUH 5ISZB 1TJHH 1YYML 1Q0XH 3NN8B 5EU6E 3O2VH 5T1MB 4EUPA 4H1LH 5LWYL 4TTDC 5AYUL 1ZLUK 3ZZ1A 5GHWH 4NQED 5ITBH 3WS6C 3DBXB 4XI5C 2YRLA 3QDME 3GSNL 1H3GA 3LDBB 1WFUA 4N8VG 4DCQB 4AEHL 3HE6C 5I19H 5J6HA 4NHUB 2EYTB 4Y5VB 2QSTA 4M62L 2XKNA 5I6XB 2CKNA 3AS2A 5F89B 4NKDA 3E6FA 3QHFH 1X9QA 5SX4I 2CKBA 4NHCH 4PJ5B 4L8SB 2DLEA 1WTGT 3LS5L 1MUJB 2VQ1B 3JUYA 1HXMA 2DQFA 1NSNH 1EO8L 1JNJA 1I7ZA 4H26B 2AABH 5FYJE 2VLJD 3LKQB 4NZTL 1WWBX 3O4OC 3ULVH 2XXCB 4HT1L 5TE6L 4BK4A 4PRAA 3KGRA 4OZGB 5DMIH 2YA2A 5JOEA 1MCOH 4O2CB 3EOTH 1YMHA 3HR5B 1HH9A 4OM0L 3WL9B 5AAMA 4URTB 4JPKH 4J3VA 3V5DB 1DBJL 5DHYA 1BMGA 3Q48A 1NGQH 1NBZA 4J3OC 4YX2H 5TH2B 5JHDD 1EAPB 1QFHA 5FF6A 5DHXB 4L4VD 3DRTA 1BBDL 4BQ9A 4RSVA 2A6IB 2DQUL 2EDOA 3B9AA 1G7LA 4WWKC 3UDWC 3T0EA 2CSPA 2NY6B 3S3SA 2FDBP 4K71C 4FQQA 3EOBA 3HNVH 4P46B 1YYLL 4L3EB 4EUPG 3CFBB 4XNMA 3JV0A 4M7ZB 1A6AA 1T7VA 1VFUA 1W72A 1JV5B 5SV3A 3T77A 2F8XC 2EDWA 4GQPH 1I7TA 3ZHLA 1QSFB 3O4LE 5HHQB 1CIUA 2E9WA 1OP9A 4R9HA 3OHXA 5BS0E 4WHTB 5KW9H 5HHQA 2EEDA 5KVDH 5FA3A 1A1OA 2YD2A 3RWHB 1TVHB 1FCCA 4IS6B 4NKMA 5FUZH 1BM3H 4PJXA 4WUUD 4P4KB 2ZCKL 2X4QB 1WEJL 3C8KB 3K80A 4NQCE 4UILL 3VD5A 5EIQA 1NBVL 3ZYOA 4Y19E 1NFDA 4Y4HD 5KVMC 1F3JB 4XRCB 2AJ3A 3TVMC 2VQUA 2HVJA 4LCCA 3VG9B 1VCAA 2J7LA 1IGIH 4UAOB 1M7IA 5I1DB 1S9WA 4DZBB 3HE7D 4LLMA 3UXFA 1OGAA 3S96B 3LKRB 2AXJA 1JI1A 3QCUH 1CLYH 4C59B 1BZ7B 3H8NA 2AERT 2BRRH 5DJ2A 3VXQB 2E6PA 4U3CA 3TT1L 1CFBA 1IGJB 4FFWC 1N8ZB 2FJFB 1XIWB 3HC0B 3ZTNL 1MCKA 2ZPKL 3VFPB 4KUZH 5FM4A 3NFSH 3CU1A 5E2WH 3CMGA 3MCLH 3V7AG 3L9RA 4POYA 4YO0A 3FT4B 1BBJB 4JQIL 1YC8A 1S9YA 3E2HC 1EDQA 4I5BB 1HINL 2NY5L 2XWBB 1Q72L 1CFQA 4O58L 4F9PC 1RFDL 2Z9TA 3IU4H 3K4AA 2VABA 3BISA 3IJYB 1A22B 4MD4A 4Z7VA 3VFUA 3D48R 4K7PX 4HUUA 4P2QA 2IAMB 4S1SH 3WFEL 2DYPA 5CILH 2RGSA 4FQXA 3SJVE 4OV5B 4XNYH 1TZHB 5L2KD 1RJCA 3MUJA 4KMTH 4X6FA 4K8RD 4GMTH 3CSGA 5KSAB 1RUQH 4N0YL 4PY8I 3FHAA 4LAJH 4OV5A 5J1SC 2X4TA 2ED8A 2VH5H 1AKJA 3T0EC 4NHCL 4WUUA 4X6FB 2CIKA 3DVNB 1FYTA 2KQNA 4UNTA 5CEXA 1G9NL 3QDGA 1KTRL 5IR1A 4LDEB 3CVIL 4XPHH 3MUGB 4R90L 3G6JF 4OLUL 5I1HH 4PJ7E 4I18B 1S7XA 1SYVA 3HC3L 1RK0B 4W6WB 5A43C 3ZE1E 1SYSA 4Y4KB 2ICEA 4XZUA 1KNOB 1H5BA 4ZO8A 1BD2E 4P49A 2ZUSA 2CXKA 3KG5A 4NO5A 1D5IH 5BZWB 3VE0B 2JIXA 2GK0B 4O9HL 2HN7A 4I48A 3VH8B 5CP3A 4QHKI 3GSNA 2VLKB 4KJQD 4ZDHA 1EBPA 1PSKL 2ZCKH 4PJ8B 2OP4L 4JFPA 5I1GL 1BP3B 4L3AA 2C3VB 2HN7B 1HCFX 4QXUL 4HPOL 5SX5K 1YEGL 4CMHC 2AXFA 3ZKMD 3BEWB 4MA3A 4HGWA 1VDGA 1F3RB 2ZSWA 4TVSa 1C08B 3WN5B 1NBQA 4G8IA 1K5NB 5HGHB 5D8JL 1X5LA 2BHZA 4LEXH 4HSQA 2AJSL 4OD2A 4TTDD 1FNAA 5FHAL 2EDRA 5F9OL 1CGSL 2FHBA 3SKMB 4L4TB 3PGDB 5DLMH 4HIHA 5CEZL 3PWJB 3FO1B 5JO5B 1KCVH 3IAPA 2R0LH 1ZSDA 1IC5L 3GMQB 1Y6NR 1DL7L 3LEVL 2G5RA 1ZAGA 4RWYH 3OPZL 4TYUA 2MKWA 4RNRB 1AGCB 3U0WH 4MJIA 4JJ5A 1U8MA 2J88L 3KPPA 4IDJL 4OZFG 3MRQA 3BP5A 4OB5H 5IMKB 2YS4A 2CMRH 3QUYB 4NZUH 5EU6D 4JFYA 4OD1H 2QSCL 2OL3B 3KPPB 4I0PD 4KV5E 4PLNC 1B4RA 2DIJA 5D1QA 4RIRB 5MI0C 1X5GA 2XTJC 5HYQA 3B2VH 1FFNB 4O02H 4TNWF 1KIRA 2P5EE 3QUML 7FABH 1QBAA 4Y7MA 3WFCH 2OXHA 5ITFB 2Z31D 5FK9B 2D7TL 3O9WD 4U31A 4N68A 3S36L 1GOFA 2IMNA 1A1NB 2E8ZA 5FO8B 5L2JA 1NJ9B 4J12A 3PUCA 1I8LA 3F5WB 1AQKL 3EYUH 5ESAA 3UJJH 5MHSE 1T89A 3MNWB 2EDJA 4GS7C 1A1NA 4NC2B 5KSVB 3V9FA 1LP9A 2NR6C 3M8OL 1J87A 3WBDA 2AQ2A 4OAWB 3EGSA 3VRLE 3DMMB 2V2TB 1MFBH 2DI9A 3B9VA 4ZFOA 2HG5A 2QR0A 1JNNL 3QT2A 1P7QD 1CLOH 3EZJB 1KN2H 5FGSA 1DQQA 4Y2OA 3BP4A 4U1HB 3DOSA 5HDBE 3MLTB 1KTDB 3GO1L 3P73A 2QR0B 3HRPA 2G5BB 1OAUH 1RJYB 3O2VL 4LARH 2GJ6D 4KGLA 4AENA 4PGDB 1B2WL 3JV4A 3MLTA 4LOUD 5DQDL 4ZPTA 1G6RL 3U9PH 5SX4H 3GHBL 5IV2A 3U2SA 2DRUA 2FH8A 5F6HI 5CBAA 4P23A 2DN7A 1KG0B 4EN3C 1WICA 3BKCL 4S2SA 5CJOL 4M6AA 5IV2B 1WC7A 4K8RH 4LCYB 4KC3B 4LKCA 1MJUL 1S9XA 2OK0L 4ETYA 4QCIB 1F3DH 5D7IA 3EJYD 3VGAC 4MNGA 3U83A 4K94H 3W39A 4PP2A 1CYGA 4JFDA 3ULVD 4Y1AA 2OX5A 1K4DB 3ZKQD 3OAZK 4P4RB 2VUOA 3MCLL 5CHNA 1MJ8L 2ZOKB 3REVB 4JQVA 4PREB 3DJ9A 3QAZC 4JKMA 2SEBB 3HG1A 3JWOL 4L3CA 3OAZH 2Z31A 5CHNB 2FJHA 1OP5H 5E8NB 4PREA 4KDVA 5GGSA 3IDJB 1TFHA 1FVCB 4OCYL 4ZXBB 4WW2A 5GRUL 3CFJB 2Z31B 5GIRA 3KR3H 2EDQA 1F58L 4V1DB 3UAJC 3NCYS 1CD0A 2C3XA 3EJYC 4OZHB 5I1EL 2GYSA 2BSSB 4CDHA 3CH8A 1ZANH 1I1FA 3CNKA 5D7IF 1ZOXA 3SDDD 1HEZA 2L4OA 2DM7A 4KVCL 1DBBL 4W68A 4Y5XA 2IFFL 5I8OH 2BNRE 3OGOE 1MVUA 2BY0A 4G9DA 1CT8A 3LHPL 1F4AA 2H9GB 2IQ9H 4HXAL 4F57H 1WWWX 5IROA 1J18A 3VXTB 4QWWD 1EUUA 1NL0L 1SBBA 3NCEB 3TVMD 5IW1B 2ESVE 3EJJX 5AD0B 5CJQL 5DK2B 4FQJL 4PGCA 2BNUA 2MQ0A 5TE7H 5CS7A 2YPLD 3VDAA 2JCCF 3VFMB 3WJJA 4FP8L 1CR9L 2Y4SA 2W60A 3EFFA 5FKPA 3MRNB 4HUNB 5HI5D 5EORL 3MBEB 5F96H 5F7LB 2OLDA 5I16B 2GY7B 1UADC 5KVGH 1A6VH 5TFSL 4A6YA 3T65A 1AXSB 1DE4B 2D3VA 3TBWB 1PDKA 4LGRB 1AO7D 25C8H 3U4AA 4OGAC 5DUMH 2AVGA 2HT2D 3PL6B 4QXUH 5F89A 1MCRA 5IFAL 1GGUA 3ARGB 3PV6B 3SGDI 1M05A 2Y5EA 1QA9B 5DK0B 4PGBB 5A3ID 3VGGA 5JHLL 2P47B 4PY8J 4UT9H 4EUPB 5KS9B 2JCCA 1T2JA 1KTLB 2DIAA 5H35A 1QACA 1EGJL 2R0KL 3HAEH 3AS1A 4HIJB 2AJZA 4FZ8H 3AMLA 4I0PA 1DQLH 2NY3B 1KELL 3BAEH 3OKNB 4B5EA 2GUOB 3ARYA 1R5IB 3M17A 3P30L 4YPGB 3T0EE 2PW2B 4MQ7A 4OGAD 2IBZX 3VXSB 1DBML 3W9EA 3TBYA 2XKNB 5D7JD 3TYFA 4GKOA 4ISVA 5EOQL 3QUXB 2OJZH 2FYYA 2C4XA 5DJZB 1HSAA 4FOMA 3DO3A 2DQCL 3O4LA 4QLRA 1NMBH 4M6NH 4ISVB 3FN0L 5FO7A 3TA3A 5CSBA 3QJFA 1H3XA 4O5LL 1K4CA 5BXFA 1A7RH 3BW9B 1ACYH 3BVNA 3RVUD 1FFRA 5DQ9A 1NCCL 3GSNH 3IKCA 3KPRA 2D0HA 1GGTA 2EDDA 4IOIB 3ULSA 3C5ZC 4WW2F 4U6VH 1E4WH 4PJ9D 3BW9A 3MRCB 4H0IA 3UTTA 5C0IA 2IADA 3EYOA 2WP3T 5DD3L 1FIEA 1GC1L 5LXGL 5C8JB 3MNVB 5E94A 3MRKB 1RZKL 2DICA 5DEGA 4J2XA 3RVVC 3GI9L 5C8JA 2O61B 1JZ7A 4OI8A 1E4XL 1BZ9A 4UTAH 2YPKB 2QQQA 1S7WB 4XC1H 2X7LA 2QADD 1MELA 1X5XA 3QHFL 4QRSB 4U1IA 5D1XB 1ZT7A 4JE4B 1OGAE 2DL2A 1T66C 4GG8B 4PJEE 4MAUH 2Z92B 2ZOLA 3VG9C 4CU6A 4XPAH 3W2DL 4U1IB 3FAWA 3UBXA 4HPYL 3FQTA 3D85A 4BFGA 1MNUH 3QXDB 4TNVF 1XF3A 3KYMB 3FFCD 5D7LD 1YN7A 1RJLB 2VLRD 5C2BH 4R96B 5IVNA 4FFZL 2Q6WA 4W4OC 1Y6MR 3ARFD 4PJDF 1BZ7A 4XB7A 1V3MA 2X9YA 5C0JA 1U8OA 3PF2A 2F74B 2AGJL 2ICWB 1CU4H 2EDXA 4DVRH 1C7SA 5GRXG 5C07E 4O51A 3QO0B 3TNMA 3OX8B 1J8HE 4J7RA 3RIFF 1F6AB 1FVEB 3CC5B 5ESQA 1T4KA 4UT7L 4XWGH 4HWEH 1F4YL 1P1ZB 4E0RB 1R6VA 2GHWB 4MGXA 1A6UH 3MGOB 3CJJA 3VI3E 4JRYE 3CC5A 1FGNL 5T5NG 3ALPA 4LGPB 5EOCL 4JZNA 3JV5A 4M7ZC 3MFGB 4TULL 3MRDB 3WS3B 3PGFH 4D9QE 1MFNA 4WNQA 1G7HA 3TA3C 5FCUH 4HIXL 4Y4FD 1GGIH 4WUUE 3WIHH 3J7HA 4X4ME 1KCUL 1W72L 1RY7B 5T3ZH 4LSUL 3MXVH 3L5JA 1O7SA 3JWOH 4JY4B 2WINA 5E8PA 5I18H 3TESA 1RVFL 3STZA 2A2QT 1T2QH 4PLJC 3Q6FA 5MENE 1VEPA 1UWXH 1JWMB 4TPRH 4R7NB 5DMKA 3DYOA 4UU9B 3CH1A 3WNNA 4XPBH 2YBRA 1IC4L 4QTIL 5T3XH 3QNZA 1NUDA 5BV7L 3ZDZF 4QRTA 4XH2B 2B39A 4GG6A 2FD6L 1V3LA 3QUXC 4JPWL 1Z5LA 3MLZL 1VADB 1KN4L 1SYVB 4OM0H 3FONB 1N0XH 2BY3A 5D2LE 4B53A 2R2EB 4MB4A 2FEEI 2A6DA 4HWNA 5EUKA 3L3DA 2EE6A 2D4DA 5JMRA 5J6GA 2G60H 3ARXA 4X7TA 1CZ8H 2JIXB 4R8WH 5E2UH 2D4FA 2WW8A 1T5XA 5EWIH 4G80B 2FWOA 4R4BB 1INEL 4KDWA 4ODXB 5ILTH 1CU4L 5I1KL 4WV1C 5E5UB 4OLWH 4IRJD 3IXTA 1BFOB 1V5JA 3LN9A 4QF1B 4AEFA 1MHHB 3DI2B 3PL6C 1QYGH 2Q7NA 1ORSA 4PJ9B 5B22A 5K33A 4PJXF 1ETZB 3NCBB 1R5VA 2ZG2A 5DJAB 1FYTE 5ECJE 3OKLA 5MEOB 2XA8H 1NCAH 2COQA 5E2TL 5A16B 1GGBL 3VRIB 5IROC 5E9DB 3RA7H 3CFEA 4PRPB 3IDMA 3HMWL 4NO3B 1ADQL 4D0BA 3I84A 3ARQA 4OCYH 3GSQA 4ZTPH 3VG0H 1DDHB 4FQCH 4IBLT 1OQXA 2MPAL 4KHXH 1V7NH 1N5AB 4D9LL 1QFWI 2FR4A 4LF3B 2AEQL 4RNRA 3GSQB 1I1RA 1P84K 4PG2C 1A9EA 4S10A 3LV3B 1N5AA 3I50L 3MMEA 3FB6A 1LD9A 5FOBA 1BJ8A 2RJMA 4D0DB 4P9HH 1RURL 1YEFH 1IBGL 1UQSB 2EO1A 3MXWL 4PRID 1ED3A 4MVBC 3TJHD 3H9HB 2JK5A 1LHZA 5B39B 3ARTA 4HGKC 1NGXA 1UQSA 1SY6L 3PJSA 4JO3L 2EH8L 4YWGL 4XXCA 3GB7B 2F15A 4OQTL 1NGXB 4QNPF 3ZT5A 2FJGA 3QPXL 3F6LA 3QPQC 1MAJA 4F9LA 2EXWD 5JOPE 3FN0H 4TSAH 4Z7OE 1ZT1A 4UINL 4NRZB 3RVWD 3V5HA 1FV1B 2VZVA 2DLTA 4WEBL 4ZFFA 2N7BA 1WK0A 4X9BA 1U91B 4LNVA 3S9DB 4OAWA 4DFHA 4LSTL 1JZ3A 1KIQB 1TCRA 1I85A 4DN3L 4JANB 2UZIL 4NM8H 1FSKB 3TT1H 4LCWE 4RIRA 4PLKD 43C9B 2VC2H 4Z5RB 4KPHL 4LCUA 4P5MA 4AMKH 3TZVB 4QHNB 4F2MB 3GJFA 4K8RC 3V0VB 4U1HA 1QR1B 1A4KA 1JGEA 5KSBE 3P73B 1KTDA 1FLRL 4NWUL 1XR8B 1J1XL 3HAEA 4F37K 2C7UA 4YEFA 3IJHB 5FA4B 3LEVH 4WI4A 2UV3A 3C6LA 1J5OL 4PJCE 3SGKC 1B0GA 4IHOB 5GGSY 4MXVE 1YEJH 3G6JE 4AL8L 3QZWA 3U0TB 4A2LA 1LP9B 2IBBA 3GEWB 1YNLH 5JUEL 5DFTA 4X6DB 2R2BA 25C8L 4PRPD 4S2SB 5F7DB 4JFDE 1MREH 2XNAA 3FQRB 5GRJH 5FGRA 4ZUVA 4ELMA 4DOHB 5GSRA 2IG2H 4ZUUA 4P3CH 3ZLQC 2Q7YA 1RZ8B 5DQJA 4AIZB 2XN9E 4GLRI 4I13B 1I8LC 1U9KA 4PJDA 1XF2A 1MIEH 4AH2B 1JZ8A 4TRPL 4XBEH 1IGCL 1I1YB 3QCVL 4X6CF 3RJDA 3DUSB 4LPTA 4Y2DD 5IGXH 2KZWA 4YZFF 1N7ML 2K7QA 4GRLA 3EKCA 4M7JH 1F11A 3VU2A 1SJVA 4APQA 1R3KB 1AC0A 4ZODA 3AXLA 3K8MA 1FC1A 5TQ2H 1HKLL 3F58L 3CK0L 2WUBH 2D31B 2UVEA 4HWUA 5FB8A 1U92A 1J1PH 2XXMB 2V2WB 2VZSA 4MS8D 4FTVD 3MLZH 3TM6A 5DRNB 3MOAH 1N0XL 5E56A 4OFYD 2ENYA 2Q8AL 3KJ6H 5DJ8B 1OSZA 1OARH 3CUPA 4G3YH 2H3NA 4PP2B 3CSYA 5EH1A 3UTZB 4BSWA 1I1AD 5DJ8A 3STLA 4JPIB 3T09A 1NCDL 4U1MB 1NL0H 3D0LB 1MFCH 3NVQA 2MKLC 4X6CB 3HNTL 4G7VL 4LSSH 4NNYB 1CN4A 5GGSB 4F58L 3D0LA 4X83A 3LQZA 4HIXH 1ORQA 3RKDD 3S37L 3HUJF 5I19L 1IBGH 1HSBA 5KVFH 3SDAD 2CLZA 3O2DL 4GAGH 2D7NA 4MWFB 4KMQA 4NPYB 1T1ZB 3B4NA 4M02A 4YE4L 4HBCL 5FUCE 4JKKA 5T5FH 4ZFZB 1KLFA 4KXZI 3G04A 5E2VH 1OD9A 5D96C 1OAXH 3QDJA 1OL0A 4Z0BH 3QEGH 2YD9A 1A3LL 1G7IA 3BP7B 5IB1A 2BVPB 3DO7B 5FYJD 4U3HA 1CGUA 4XNUL 2BNRA 1PX4A 4OIIH 4CL7A 5HDLA 2PYEB 2VH5L 4NUGL 1FJ1A 5AAWA 5SWZE 5D7KE 3VFOB 5IHZB 2AGJH 3VDBA 4NQEB 3FO2B 4U1KA 3OXRB 2XG4A 5CGTA 2BNRB 3BESR 4N0CC 4XWOC 1ZEAH 4DCQA 1T7ZA 3B43A 5JXED 2ESVA 2AJZB 4F15C 1Q0YL 1T20A 4PJ5E 2DWDB 1OAZH 3FQUA 4NDMB 2UUDK 2PW2A 4MQ7B 1KJVB 2EKJA 1IKFH 5C9JA 2ILLA 2RB8A 1LO2H 5I1KH 2DWDA 3K1KC 2DQHH 1OTTC 4ZOBA 2PR4L 3KPRE 1W0WA 4WI8A 4U6YB 4IRZH 1ZLSH 3PV6A 1HCVA 3ARGD 4GKNA 1M05B 4JR9H 4UINH 1VFBA 4JLRA 5TH2A 3ILQC 3P77A 1PZ5B 5FF6B 3HS0A 1MPAH 3UTTE 4JREC 4YHYC 1DEEB 3LRSA 1ND0A 4N1CA 4F9PA 2OR9H 2AXGA 3RZWA 2DQFB 1XR9A 4LRNH 4MJ6A 5HDQH 1C1EL 3OKNA 4UT6H 3KYNB 4HEPG 5A2KH 3EYOB 2R1YB 1LO3H 5CIPH 4XPBL 5JLZA 4PJHE 3QIUB 3F8UB 1XH3A 1FG2B 4S1RL 3V6ZA 4PJEA 2VKWA 1U3HC 2FIKB 3LHPH 4HJGB 3RWHA 4GW5A 5I1IH 1EHXA 2A6KB 3WKMH 1NCNA 3QNYA 3MZGB 4XNQB 3VA2C 2Y36L 1A7PH 1FDLH 3O81A 4HJGA 2FIKA 1XF4A 4U2YA 1NAML 1DLHA 3QDJD 3EOTL 4JRYD 1QQDA 2ZOLB 4LCCC 2W07A 3IRPX 1UACH 3QEQB 1NFDB 1JPTH 2PXYA 3MGTA 1BM3L 2NXZB 3TPUA 3UBXB 1N6VA 3IDIA 1TTGA 1RK1A 3NIDF 4G6JL 5IB4B 4HC1L 4JHWH 2R0KH 5F71A 4KY1H 1A9BA 2D03H 3IGAB 5KG9B 2VDKH 4ZFGL 1D6EA 3NPSC 1HI6B 3S88H 3ARZA 4HF5H 5IKCB 3F6IA 3T0DA 5DUML 1BZ9B 3DX8A 5FUOH 4P2OD 2VR4A 5EZIH 3TCLA 5GXBB 1N8ZA 2R0WL 1U42A 3SDCA 1ZMYA 1X5YA 2X1PA 1KCVL 3GRWL 1MAML 2AJYL 1J0YA 4HS6B 2FIRT 1PGRB 4PBVC 5DK3A 3UPCA 3OR7A 4RFEB 2VDRL 1CD1B 4M03A 3KS0J 3ISWA 2EYRB 3PP3K 5AUMB 1EEZB 1P5UA 4R4FH 1FRGL 1KC5L 3NPSB 4OFYA 3TO2B 4ODTH 4JZJC 2HH0L 1PG7H 1C12A 4NQSB 5ICYB 1KB5A 3TC9A 5ACZA 2P42B 2G9HA 4HKJB 4LCWD 5GGUB 3ZDYF 3FO9A 3OX8A 1INDL 2YD6A 1G9NH 1C12B 4TUJA 4GG6E 3VWKC 3STZB 1I3GH 5GZNC 3C08L 4H8WC 1JP5A 3RWJB 3KLAB 3PV7A 3LSOB 4K9EH 4S1RH 4X4YB 1AO7A 1BGXL 5EO9B 4QYOB 2LAAA 1SY6H 2ZUVA 3H42L 3DHMA 3QNZB 2AP2A 1NGWB 5HTSA 2XY1A 4K23H 3DHJA 4OQTH 4P57B 3RNKA 3SE4C 5DS8A 5DT1H 3QDHA 1VADA 5C7XH 5HVFB 4D8PB 1KUMA 5I15L 1WITA 3MV9D 4MCYA 1DQTA 4P9HC 3RI5F 4P3WA 3UAJD 4NQVB 3V0WL 3C6SA 4ETQB 4RMTA 1KLGA 1ZS8B 3X3FL 1AKJB 1NANI 4GBXA 1C5BL 1XZ0A 3GSRA 3IF1A 4FQLL 4PJ7B 3O4OB 1K8IA 3SDXF 3D5OF 1RU9L 1GOHA 3WSQH 1VERA 2NY3C 4E41D 1ES0A 2YA0A 4C54A 3WS6A 2A73B 2XWJB 1Q9LB 5FHBL 4OCSL 3WKNA 4WUUB 3NCYP 1F90L 3BAEL 4QRUA 3JWNC 4MAYB 4MZ2A 3BH8B 4PJ9A 3M1BA 5FGBC 4DVBA 3OB0K 5IBTH 4F7PA 2DI7A 2BRRL 4KK6D 4Y5VC 2OBGA 1BF2A 4Z7QF 5DUBB 3BH8A 3L3DB 2AEPH 2NTFB 2BC4A 2OXGA 2EYSA 2VL4A 2DS4A 1MI5E 4EI5D 4G9FD 1S7UA 2HJLA 2GY5A 3DXAD 5E5MB 5D2LA 1G1CA 5L2KB 5ANME 1JHTB 3DVGA 3D69B 5AZ2L 3ULUH 3QFJD 4YAQB 5HJ3A 5EUOB 3FT2A 4RA3A 4UIKL 4Z76B 1RPQA 2VDMH 3SY0A 1QRNE 1U2HA 4MB3A 3MLVH 1GZPB 3QIBA 5D8JH 5GGTH 4ZDHB 5DGQA 4PJ8A 4KKCD 2C3VA 5JW4N 4ZOEA 3QISA 2J2ZA 3SDAB 3WUWA 2R69L 2G60L 4GT7A 3QH3A 5GS0H 1CR9H 4N8VB 4HIHB 3VCLA 4I3GA 4J23A 3MRBA 5ILTL 2YKLL 1AQDA 3IDMB 1N3NA 4PBWD 1MCPL 3LQAL 5EWIL 5IEHA 5GISH 1FFNA 2XZZA 1FNHA 4IOFC 5DVOA 3UJJL 4JM2B 5A40E 3UBXG 3BQUA 1T0NA 1K8DB 1I1AB 1ULVA 3P9MA 3ZHKA 2APXA 2NW3B 5HI4C 2BMKA 5F9OH 2JB5H 1EEQA 1OY3B 2X70A 2OJEB 4LEXL 5D1ZB 1IC7L 4JJ5B 1FNSL 5C9KA 4JO2H 5GS1C 3B5HA 4YDIL 1X6LA 2OZ4L 3BGFC 4C4KT 3X13A 1KENL 2VAAA 1MRFH 5EO1A 3VFWB 2QHLA 1KV3A 2H6PB 3G6JA 3NTCH 1RIVH 1LO4L 2GJZB 3C6LD 2JTDA 4UT7H 4XWGL 2VZOA 5DFVC 3ARPA 1A8JH 1NGPL 3RDTA 1QHPA 5E08L 1Q94A 4PJ5D 3MRLB 1NCUA 3VD9A 1NEZA 5B4MD 1CGWA 4P2OA 4WJ5B 3H6JA 3SE3A 3S3JA 4N8CL 3P11L 2ZCHL 4PJFA 3SJVD 4Y88A 5I1AB 4JPVH 4WGVB 5C0EB 4M6MH 3L3GA 3WIFB 1NGYA 3KPQB 1YECL 3MREA 2BHYA 4ZFOL 1BLNB 5E6IA 1LE9B 3IT8D 1IKFL 1KBGH 5D4QA 1GGIL 3O3DB 2Y6SC 3QQ4A 4NZJA 4NN7B 3V4PL 5SX5H 4HAGA 4M8VA 4KFZC 3TZVA 3UTTD 2O5XH 3PWUB 4F2MA 1T22B 3T4AB 3TH4T 3PQYE 4XVJL 2AK1H 4KJWD 3T0XA 4L4VB 1F6LL 1INDH 5BVJB 4MXWH 3PGCA 1RUML 2ZJSL 4X80H 3C6LB 4JCMA 2AK4E 3DGCR 3GGWA 3G6AA 4Y1AB 4QRPB 5GJSH 3TBTA 2DJUA 3GK8L 1UZ6E 1CF8H 4PGDA 5D7JA 1EV2E 1CXLA 1REIA 2BDNH 1EFXB 1BX2A 1WISA 3JTTA 1S9XB 3DMMC 3PABB 4LHJB 5KSBB 1D9KB 2W9LA 4Y8AA 1I9RL 2NX5E 4AMKL 2VXVH 2KQMA 4RGND 2W0FA 5ID1A 4NM8L 2DJ4A 4NO0D 1ZTXH 2QTEA 3OG6B 3TZVC 2YZ8A 1E4WL 5ID1B 5C09E 4DW2L 1VKXA 3KLSA 1MY5A 1DQML 4Y5XB 15C8H 3C08H 5E6IC 3T4YB 3WFHB 2Q86A 1RU9H 3TEUA 3WSQL 2XN9A 4GXVH 4CUCA 1Y0LB 2VDOH 5CZVL 4PRDA 3IFLH 2X4UB 2I07B 2Z35A 4FQHA 1YNTA 2QADB 3O0RH 3PNWA 4JFFE 5GIRB 4P3DA 3BDYL 2IAMD 5C0RL 4J3SA 2QJDA 3H9SD 3NIGE 1JGUL 1DJSA 3L5HA 3L3IB 5CAYB 2DQDH 3NFNA 4R97B 4CADB 2YPLA 2HRPL 3LD8B 4LDLB 1RAMA 5TDOB 3VMPA 4K3DL 4ACPA 4WHDA 3VXUB 3D0VB 2H9GA 3HZVB 1W0YT 4WV1B 4JPIA 5JHDE 1RIUL 2YD4A 5L6YL 1T80A 5DJDA 5J9PB 1JPGB 1IILE 2ORBH 1C16A 3VDCA 4MZ3A 4ORZC 1FRGH 2G75A 5D71H 1SY6A 4FZ8L 35C8H 4CRPA 3MV9A 1QA9A 1A3RL 1XGQB 4LNRB 4ORGA 4OQTA 1V7MH 4OZIF 3MV9B 2I5YH 3FB7A 4JDVA 5FM5O 4S1DC 4LPYA 4YDVB 1VB9A 1T04B 4PV8A 5CD5D 1LNUB 3ARGA 1CFSA 4FP8H 5C0CE 4YDVA 4ONHA 4X98A 2F54D 1D5ZA 4IOFD 5IB2A 3GNMH 2R1XA 1QVOA 3I3DA 1G7LB 3I6GA 4L8SA 1RUMH 2ZJSH 2JCCB 1NDGB 5KVGL 1HXYB 3RVUC 3JWDL 2P7TA 5FO9B 3A6BH 5KW9L 1JL8A 3QDMB 2AJXH 5BOPA 1QFPA 1ZXQA 3D39A 4MAYC 2WK2A 4KK8C 3RWGA 5HHOE 1C1EH 3DYPA 5DK0A 3BVNB 5TDPA 1SVCP 1FIGH 2FGWH 1LEKA 1OVZA 4UQ2B 1B9ZA 4DUWA 4HV8A 5C0IB 2DQDL 2MTPA 2VZ3A 3N1PC 4DZ8A 1I8KB 2W65B 5T1LD 2UWEB 5CUSL 5FGBA 5I66B 4BH8B 5I1IL 2HKHL 4PJ8D 3QRGH 4UQ2A 4WI5A 4TSCL 1EMTL 1OCWL 4PRHB 3V8CA 4OSUL 3TO4B 1A7PL 1BWWA 1PZ5A 3TT3L 2DQEH 2X1XR 3VXSE 2CH8A 3F7YA 2DM4A 4J6RH 4OUOA 4OCXL 5CILL 4XVSL 4AM0B 5B38G 1AIFA 1N64L 1QNZL 1T83C 4XCFH 4KK6C 5BJTB 4NQCB 4PRAB 3PIQA 1RUPH 3GMLB 1RIHH 3E2HB 1M7IB 5C92A 4HMEA 4Y4KC 1QLEL 1P7QA 2GW5A 2R1YA 5K59E 5E4IA 5E2JA 1KJMA 3GSOA 4F7MB 5D72H 1QLRB 2H1PL 5HDOA 1U3YA 1U6AL 3LZFH 4JFOA 5C0AA 3D25A 1NCDH 5EO0B 4M1GH 4XGZA 2FJFA 3FQNA 1QLRA 5F3HB 4P5TB 1R3IL 1VEOA 2DQHL 3ZTJG 3DTXA 1JPST 2I9TB 5I71B 3U7YL 5C0AB 1NUFA 4HUWA 1AD9A 2HLAB 3LH2H 4G9FB 1E4JA 4PJHA 1ZLUH 5HDBF 3S3PA 3HHRB 3MRIB 1EIBA 2CDFB 3WLBB 2VLRB 2PXYB 1EGJA 3VJ6A 4NFCA 3ETBF 5C07B 1OQOA 3U4EA 1U8OB 1JTOA 4RQQA 5IFJB 2ICWA 3LPWA 4NQCD 1QHOA 5JW4R 4JRXA 3S96A 3B2UC 2WBJC 2VZTA 4CMMB 1ZA3A 1OAQH 3D85B 3DRQB 3QXDA 3CGTA 2WWKO 3BRDA 2GT9B 3SKOA 1HOCA 4R90H 3VWKD 1IAKB 3HC0A 5E03A 3DRQA 1CF8L 3QEQE 4TVPH 2IPKA 4I3RL 2VDPL 1IGTB 4WI2A 4P5TD 3QHZH 2P8PB 5T5NF 5F6HJ 3S5LG 3R8BB 3E6HB 2Y1VA 3EYFB 3BZFB 1T21A 2A0LD 3O6FA 3V4PH 2D03L 2ADJB 1FE8H 3QXAA 3NPZB 5ESVA 5MHSD 1NFIB 2R0ZH 5D9SA 2ADJA 5I15H 5FV2A 4YNYB 3HMXA 4L3ED 4JRYB 4KQ3L 1WVZA 3PHOB 1HHJB 5DURD 1CL7I 3N0PB 1IGJA 3Q6FB 2VXQH 4FQXB 2HFTA 3VGFA 5EBWB 4W70A 5I74C 4G42B 2YBRB 4JM4L 1CQKA 4HXBH 2VJXA 3OJ2C 1EO7A 3VXRE 3G6DL 5KJRH 1DLFH 1KGCE 2AJSH 3EOAA 4YGAB 3P30H 4YK4B 5SWSD 4XBPB 3D2UB 3QDAA 1VGKB 5FYKE 3UJIH 3T1WA 3BIKB 4YHYB 3HMXH 4FFYH 2YK1H 4MD4B 1AO7E 1CVRA 1HQRA 4XH2A 3WCYA 4G8IB 4GG6B 3H0TA 3TBSA 3RKDC 1Z9OA 2YSSA 4JM2F 3RHWK 2IGFH 1IARB 1Z9SA 4HDIB 5J8OA 1RZFH 2VXTL 3VW3H 3SKMA 4PLOB 1TVDA 4GXVL 3MBXH 3TA3D 3IF1B 2D7MA 1S3KL 2HFFB 1S7QB 1XCQB 1F4YH 1AC6A 1DBKH 3HE6B 3B8YA 4CW1B 5E9DA 5L2KA 4WWKB 4K2UH 1L0QA 1DN2A 2HKFH 5E00A 4DWHA 2IF7A 1M1SA 4KDTC 4UTBH 5EFIB 3UTOA 2VR9A 2V9RA 3BEWA 3JVGC 5DJAA 3VFVA 5HDQL 2KH2B 3T3PE 5E00B 4ZNCD 5KN5B 1X3DA 4F7PB 4NUJA 4IRJC 2DTML 4NN6C 4MJ5A 4FTVB 1M7DB 3QH3B 1HDMB 5LBSL 1Q8MA 1OSPH 4R2GC 2R2HA 4PRIA 4FTVA 5BV7B 1KCKA 3KJ4C 4LLYB 3RU8H 1AI1H 4A6YH 2QADC 4EOWL 5ITFA 2E7CA 2C1PA 2F53E 4KU1A 4HS3A 3RWFB 1MHCA 3DSNA 1UXSA 3BH9A 1JBJA 1NJ9A 1RJZB 4ZSOE 3QBTB 3RHWF 2EDTA 1P2CA 1UYWH 4XNZB 1QO3B 1GJIA 2RQ8A 1VACA 4Y2DC 4PRNB 1Q0YH 3DUUB 3P4NB 4JFXA 3RY4A 5KSVA 1NMAH 5HHNB 2VC2L 2DQGL 5JW3H 1OAYH 2R4RL 3OKEB 2V5SA 3Q5TA 2XV6B 2OMNA 1F90H 3KPLB 4JGJA 2NY4B 1YEIL 3E8UH 3ULVE 3ARDD 2HG5B 3LRGA 1D9KC 5IEKB 4QOKB 3OKEA 3B9KB 2NW2B 5FDWB 4WFGD 1P4LB 5EUOE 3BDYH 5C0RH 5KANG 4R26H 5FKAA 1NCTA 4HQQH 2AKRA 2HJFA 1JGUH 3TNNB 1JHKL 3VWJA 4N0YH 4RMVA 5IHUH 1CBVH 5B4MC 2N4IA 1JGVH 3V0VA 3JTSA 5KZCD 1X4XA 1JFQL 3BUYB 4XP9H 4WHCA 5L2JB 4EZMA 4PJIF 2VN4A 5E1HB 3A6CL 1IM3B 3BD3A 4O02L 2M2DA 1ZT4A 3AUVA 3QAZB 4IHOA 1CLYL 1AGFB 3LIZL 3ARUA 4JN2A 5CSGA 1FL3A 2JIXD 1C7TA 2F9BT 2OM5A 3FCTA 3HKFA 4DK6A 4XCYB 1JPFA 4WTXA 1A47A 3GSWA 4M43L 1HZHL 3H3BC 3CFKA 1N2RA 2R0ZL 1TNNA 1XR8A 3HAEB 4QXGH 5IG7A 4DKFL 4YHZH 1RZ7L 3ORJA 3D3VB 4OZ4B 4RZCB 1GZQB 2FNBA 5I17A 5DYOA 4Z5RA 2IH3B 4P5MB 2NLJB 4L4VA 4PRHD 1Q94B 4TTGA 1AHWA 2WV3A 5BO1H 2ZG1A 3GSXA 1MFDH 5EBMB 3HI5L 4HWBH 2MCG1 5C0FA 1JGEB 3PHQB 2VDPH 3MYZA 4A6YL 1Q9KA 4L4TD 3U2SB 1S9KC 1GIGH 5EOTB 5H37G 2XZQH 3RZCD 2FGWL 3LKOA 2PO6A 2CD0A 4GRWF 3D9AH 3U9UA 4PJFE 4F3FB 1S9VA 2XIDA 1TZIB 3LZFL 1DUZB 3F7PC 2QKIA 4LKCB 5L8JB 3DV4B 4MNQA 3MFFB 2DD8H 4X5LA 2EIZA 5D1ZC 3DUSA 2VTFA 3A6BL 4G6JH 2Q3AA 1KTKE 2GEEA 4M7JL 5DHVB 2HFEA 4QT5A 4NN7C 4EKXA 4FQ2L 1BPVA 5BVJA 4KGJA 4LSSL 3MLWH 1XF2B 4Q58C 4BQ6A 5CD5C 5BRZB 5JORA 1U36A 1WTLA 5IJVB 4QHUB 3VWJC 5KVDL 4X7SH 5HGDA 4L8BA 3T2NH 4ODWA 4N8CH 1IFHL 4O4YL 2DQUH 4P3DB 2IG2L 5HGAA 3MLRH 1G9MH 3W9DA 3OV6A 5JXEC 1CICC 3MCKA 2YK1L 3CFJA 3UROR 4IJ3B 1A21A 5IWLC 1KJ3H 3CSYB 4FFWD 2OI9B 3LIZH 3OWEA 5IBLD 4DGIL 4S1QL 1GGCL 4XVUD 4XCFL 1OT2A 4Z78A 4JM4H 3NCJH 3V6FA 5I1CH 1QD0A 1LO5A 4Q6YA 4Z7UA 3LVEA 5I75C 3BQUC 2DLGA 3NCFB 3Q3GA 4YQXH 2X4UA 3STLB 1JPGA 4HLZH 1RHFA 5HHOD 1JF5A 2EC8A 4QKXB 2VITB 3QI9B 5HHVL 2XPGB 4R7DA 5FOJA 1BIIA 4ZUSB 4MWFA 4NKOA 4OZIA 1CVSC 1RHHA 3O41B 2YKLH 3FRUA 3ECBB 2AABL 4I18C 5B8CB 3MBEA 3QI9A 3WO4C 3BO8B 2XPGA 5DR5L 4J3UA 3S4SB 1X5ZA 1MY7A 2ESVB 4RFOH 4LRIA 4PV8B 5I0DA 4PGJA 5CZVH 1GC1C 5EZOH 2P48B 1AXSA 1DE4A 1OD7A 3TBWA 5I1GH 4NDMA 3VFNB 4OLVH 3D39E 5IHUL 5KZCB 1F00I 1YEGH 4AK1A 4UDUA 1BQHG 2XFXA 5J9PA 3RX8A 4XX1G 3KNBA 2A74A 2WBKA 2YD8A 3MLWL 4HWBL 4DTGH 4PUBH 4W4NA 1K4CB 3VXUE 5BXFB 3QWQB 4M6OL 5F7EH 3TJHC 1H8OA 1QBMH 3JBG7 3FTGA 2VISA 4KRLB 5DD1H 5T5FL 5FKPB 5LJYH 3QI9D 5GS0C 1DP0A 1IGMH 4JFZH 1UB6A 1LDSA 3N1MC 4GAJL 2CRZA 5GQBA 2X4PB 3T3MF 2RFXB 4NKDB 2BJML 3GHEH 2VLJA 4S1DD 3BKJL 4HS8H 5E8EA 2RAMA 3HUJA 2HKFL 1VFBB 4JLRB 4XPAL 1WBZA 1LK2B 2F54B 3Q6GH 3KXFD 2DQJL 3MYJA 5D2NC 1JJUA 1KYOJ 1DVFA 3J8F7 5L6YH 1S78C 1GC1H 1ZT7B 1QEWA 4HCRH 1FBIL 1XAUA 2AEWA 5CZKA 3T0EB 5C0CA 2Z92A 5IQ9A 1I8MB 3OKYA 3Q2CA 3HCVB 3L5XL 4V2BA 4ODSH 2DF3A 4UAOC 1DBAL 1LK3H 4L9LB 4NJAH 1ZTXL 5HI3D 3FT3A 3MV11 3MJGX 4LLUB 1NBZB 4Y5YA 4PJEB 3WFDL 3C5SB 1CL7L 1JF6A 4FRWA 1MAKA 4KK5D 4U6VL 2EZ0C 4NC1C 3TBYB 5IFHL 2UWEA 4OF7A 4LHUG 1QSFE 2HYMA 5HGGS 3GMOB 2X41A 4J1UB 5BRZD 3MRKA 1T66D 1HI6A 1HSAB 4GSDL 3IFLL 5IHLB 5IMMA 3HPLB 2I9TA 3KXFB 4RGNE 3TA3B 1FNEB 2P24B 3NZHL 4P4KC 5J12B 2CLRB 4RCAA 1S8DA 3RWEA 3X11B 4R4FL 1AI1L 4YFEA 4OLEA 4JZJA 3UP1A 1PBYA 5EIVA 1KT2B 2YMXL 1QQDB 4QRRD 4CVZA 3K7UA 1T6VN 3AVEA 2BSED 3MCG1 1B4JH 4RFEA 4JRXB 1UH2A 4JO4H 4JZJB 1I9IH 3WE6B 1OGAB 1AFVL 5CMAA 3RWDB 4IRZL 1ZLSL 1DQJB 2G2RA 3VXNB 1D6EB 3C8HA 3G5VB 3AAZB 1T3FB 5HBBA 1KB5B 1UM6L 2J8OA 3UPRB 5CIPA 2NXYD 4ERSH 4GUPA 1AD9B 2HLAA 4AL8H 1P1ZA 4E0RA 1IEBA 2X5PA 1PSKH 1JYVA 4LAQH 2HFGL 1T7YA 2WNGA 3RVWC 1T21B 4LLWB 1KGCD 2JJWA 2Y6SD 4M48L 5HYJA 5F8QC 5C71A 1MHPH 4I5BA 4RQQB 4QRRA 1NGWA 3FONA 4EQ2A 5F97E 4P3CL 4XTRC 3VI4F 1YMHB 3K3QA 4WFFE 1G7HB 4MSWB 5CGMA 2X89D 2RIKA 1MJ7H 3VFPA 3VXRA 1JNHA 4QRPD 1A1MB 1BJMA 2CDGB 4POZD 1YEHH 1L0XA 1A6PA 3L6FA 4X5WA 1AE6L 4KROD 3BKYH 1FDLL 2A6IA 5E8PB 5IBUB 3CLEH 2YD7A 5FECA 4U2ZA 4JDZB 1BAFL 3MXVL 1OPGH 4RMUA 3SJVB 4CNIA 1GAFL 4KZEL 3REWB 1WZKA 1F6FB 5F44A 5HHME 4IEFB 3FQXA 4PV9A 3QXAB 3QIUD 2R15A 5ALBL 3LKNB 2CO7B 3D1MC 1UCBH 3WS3A 1G7MB 4YC2B 4EQ3A 4X5XB 3QIUC 3ZDXE 2X89A 1HHIB 5EC1A 4OI7A 2FD6H 4JPWH 1KLUB 3BKCH 5CLTA 1U8IB 5FA3B 2DDQL 1RZKC 3FO0H 1DBAH 4NJAL 4Y16D 2VYRE 1NQBA 1MPAL 3SCMD 3RPIA 4HX1A 3SKJL 1HN1A 4MCYB 4NO5B 1FL5B 5T3ZD 4LRIC 2V7NA 3PXHA 4U1NB 2JJSA 4LARL 2OR7A 4TVPL 5D2LB 3JUZA 4I18A 3W82A 1NBYB 1CTNA 1S7SA 3D2UA 1A9EB 3F7RA 2MHAB 3WNKA 4PRIE 3P4LA 4Z76A 4KQ3H 3LS4H 3WO4B 5IVOA 1IGML 4JFZL 1MNUL 2UYLB 4TUKL 1CLZH 4MS8C 5IVXF 4FFZH 3H0TB 4D0CB 3SE8H 2ZSWB 1I9RH 1OTTD 5F9WC 2X6MA 4YLQT 5T1KA 1FZKB 4V2CB 1AKJD 2OTUA 1SVZA 4XMLL 1UT9A 1A3LH 2QBWA 4JFED 5DTFB 5KSUA 4BSVA 5EN2A 1B2WH 3GO1H 3LKPA 1DVFD 3WIIL 5DQDH 3OSKA 5IWLA 2WSKA 2NY7H 4NCDA 4NIKB 1TLKA 4TOYL 1YMMA 4N90D 4M7LH 5E9DE 5L2KE 2NPLX 4Z7VF 3NACL 1NUNB 4JGUA 2B20A 1HDMA 4OGXH 2OJEA 5EU3B 2ZP0T 4DKDC 3QWRA 3RTQB 3PWJA 2BOCB 3BWAA 4PJBB 1ZSDB 3C9NA 5HPMB 2WQ8A 1P4LA 5DFVD 1Y18B 2AJUH 1MCWW 2GK2A 2AJYH 2NY2C 2GKIA 3FB5A 2WLZA 3LH2L 1WCBB 1D6VL 2IBGA 5HHVH 1DDHA 3C9NB 5HPMA 1U8JA 1HYSC 2D7TH 3NBNA 2ED7A 3L5WA 3VFGL 1ROWA 5HYFA 2AQ1A 5FGCE 5IEHB 3BUYA 7FABL 4FTVE 3BP6A 2EECA 1OAKL 4JFEB 1WBXB 6FABL 4NGHH 1ZT4B 4MD5A 5DMJB 2MNUA 3N06B 3MNWA 3STBA 3UJIL 2PO6C 1RZJC 3X13B 4GFTB 1S7XB 5K9OB 4PJCB 3LEXA 4N8PA 1KIQA 1TCRB 4Q7DA 3IJSB 2W9DL 5IVXE 2ADFH 4WU7A 2NW2A 3QSKB 4JAMB 5FDWA 5K9OA 3AU1B 2OYPA 2ADIA 1NANH 4R2GD 4Z7WF 5K9JH 1TQBC 4JRWA 3SKNB 1KEML 2X44D 3WJLC 2FJGB 4YUEH 3ZSSA 3L3GB 1NUGA 3BEVB 2H8PA 4EI5A 3VGAB 4GRLC 3HAEG 1T5WB 1K2DB 3WDJA 1FP5A 1M7XA 1YDPB 3R1GH 4M7KL 2D9CA 3EDDA 4M4RA 4JCLA 4G8FA 5D1QD 5GGVL 1NCWH 1PKQB 5FHAH 4PY7B 1N2RB 4ZUVB 3DETD 1DUZA 4ELMB 1TTUA 5LBSH 5E5RB 4DEPB 4AIZA 2Y06H 3CUPB 4ODUB 3MR9A 3GGWB 4XI5D 3RUGE 4NSKA 4HAFA 5D1XD 2QHRL 1L6XA 3FO1A 1A7OH 4P2OC 3FB8A 1CI5A 2O5YH 5MERA 4UMGA 1R24B 4UNUA 4UBDC 1GPOL 3BGAA 4C56B 2W9EH 3AY4C 3WXVL 2HT4C 3IFPA 4H5SB 4M8QA 1KYOK 1HYSD 1D9KA 2E9IA 4JVUA 5EU7E 4L4VE 2XICA 3HG1B 1YY8B 4KKLD 5E70A 4WHYH 3IFPB 3U9UB 5C09B 1MHEA 1OW0A 2CLVA 1SQ2N 1XCTB 4YHLL 4YPJA 2J6EL 1BX2B 4LP5A 2NNAB 2L0DA 4TUKH 4KH2A 5D1QB 2EIZB 3MX0A 4YHZL 1MHEB 4XMPH 5I1EH 3OZ9H 2NNAA 1ZA6B 4LSPL 5DJXB 3O0RL 4XTRD 1J8KA 1AQKH 3D0VA 3CD4A 8FABB 3TIDA 1CDGA 4OZHE 1S7TB 5JXAH 4KRPB 1H0DB 3DVFA 2OMBA 2XZCH 3IDJA 4Z7UB 3ZE2F 3O8XC 4TVPE 1CXHA 4H1LG 4G8GA 3U0PA 2DQCH 1AJ7H 5DJYA 2E7MA 5IW1A 5MEPB 2BY2A 4R7DB 4WDIA 3VXUD 1W8NA 5L0QC 1AXTH 4QY8B 2PXYD 1NCCH 4OJFL 2BNUB 5TQ0H 4OZIB 4KDTA 1XGQA 5B8CA 3O6ML 1I1CA 1UB5B 2H2SD 3FOMA 3MRFA 5F1KC 3B6SB 4NQEE 3FQUB 3QIBC 3P3YA 1YNKL 1MCDA 1R3JA 4KMLB 2FO4A 1AR2A 3KYOB 3HZKA 5CINH 43CAB 2A83A 4JZOA 2LFGA 1DANU 2HAZA 1BVKA 2PYFA 4C55A 3WD5H 1N4XH 1RUKH 3WDHA 1A7OL 3B2VL 2FRGP 4ORGB 5KOVC 4E41E 4LASH 4M7LT 3DXAA 1NKRA 1QLFA 1LO2L 3EW3B 3BPNC 4OGYH 1F13A 2FECL 3A0OA 4PYHA 1IGIL 2DL9A 2AXGB 4OLXH 1EJOH 3ROLB 2A9MH 4F8QA 3SDDA 5K93A 4A6YB 1KCSL 2HTLD 1OWWA 5D7IB 5K9QI 3MV7A 3KYNA 3NZ8B 5DMYA 2W91A 4NPYA 4YEEA 1J0KA 4LGSB 1JGDB 1M71B 4MLIA 5IVZB 3TN0D 2DB8A 5IB2B 3TWCL 5DJCB 1RD6A 3V5DA 1D6VH 3K8KA 4IRJB 2A1WL 1WBYA 3HFMH 1WJ3A 4R3SA 5I74B 3VFTA 2QHRH 1S3KH 4O9HH 1MRDH 2AW2A 2DQIH 4MJ2A 2VDKL 1QRND 3H7LA 5GGTA 2IANA 4XP4H 5IQ9B 4DK3A 2UWEE 1CTOA 3RX5A 3CDCA 3O6FC 5JQHC 3PWPA 5T1DH 4OKDA 1SJEB 3MV8B 4MJ6B 4Q0XH 1OB1B 1QFOA 4KKBD 2AXHA 4K7FA 4PRHE 4DZ8B 4F33A 5C6WH 3BZEA 1U8HB 4M1CC 5DVKA 1NAMA 3HNSH 1H5BC 2B5IB 3P2TA 2HWZL 4JVPA 3QUXA 2DQTL 5SWSA 2B4CH 3KPRD 4IS6A 1UACL 1XH3B 5DJ6B 4Q9RH 2Z8WC 4J1UA 1QNZH 3OL2A 4D9QD 2FZ3B 1AIFB 5E94B 3HTLX 4KKAD 1LEGB 2EDKA 3ULSB 1LWRA 1W72H 5TF1H 4X9GA 1LO3L 2E3VA 2AV7A 3SE8L 5C0ND 3QG6B 2CLRA 2APWA 1ND0B 4QOKD 4NZRL 2EE3A 2W9DH 5DJ0B 3MROB 2J8UB 3CMOL 3QG6A 2ITDB 4FQXC 3G5YA 3RBGA 4BYHA 1RK1B 2V5RA 1PG7W 5DJ0A 1JHLH 4OD1L 3SN6N 3V0AC 2MWCA 4HW6A 5JLZB 1UEYA 1G9MC 4NRYB 4K7PL 1HKLH 1BREA 3F58H 1WIPA 2HJKA 2VDNH 1E6OL 1V3KA 1D5MB 1O5DT 3LN4A 4P2RE 3OJDB 4H26A 2XZCL 1J10A 1FGVH 3L3OA 3B5GA 2NR6D 3NFPB 2B0SL 3RGVC 3MRGA 3FQTB 1DQLL 2XWBA 1L0YA 1QKZH 3U7WL 1KTLA 1E4XI 1G7JB 1T83A 2NYYD 3OJMB 4IOSD 4QRRB 3HC3H 1VSCA 5I1JH 2CXGA 2ICCA 5KG9A 5A2LH 1HOCB 5HHMD 3WHXB 5LWYH 5ESVB 1HZHH 2BFVH 1EFXD 1F6AA 3W9EB 3HI1B 1FO0L 1DANT 5ICYA 4NFBA 5IF0B 4GBXB 5B21A 1UKTA 1L7IL 4XBGA 2GJ6E 2HRLA 3EOBB 4WI3A 3E6HA 3TCLB 1MWAA 5ACMA 1U3HA 3TVMA 4PP1C 4OBSA 1AD0A 5IF0A 1IEBB 3VG0L 3IXAA 4L5FH 2BZDA 1CZ8L 4ODVL 1MFDL 1W72B 4R8WL 4S0TD 3T77B 1A6VL 3RVVD 1ADQH 4CNIB 3T3PF 2C4FU 4U6HA 3VWJD 1C5BH 4ZNEA 4PLKC 4NWTH 3CH1B 4MAYA 2Z93A 1H8NA 2LU3A 1H3PH 4XZUB 2BVOB 3BIKA 3WFDH 5EC1B 1OF2B 5MENA 5IT2L 3C8KA 1LILA 2EYSB 4JFHD 1ZE3C 4M5YL 4NQVA 5D9SB 1PVHA 2ID5A 1WUNT 2G9HB 4KJYB 5I2IB 1A7RL 3ARGC 4M00A 4YFDB 1BQHA 1W2KT 3N1QC 1TCMA 3BSZH 2DLIA 4HCRL 4GW4A 1MCLA 4RRPG 5A2JH 2JLLA 3D18A 3O11A 4Z8FL 4D9RE 2Q76B 2O5ZL 4DGIH 3KWWA 1TVBB 3G9VA 4AQOA 5M7QA 3QZWG 4D3CH 2DOCA 4M1CD 4NZRH 2BJMH 2HVKA 5L9DH 4R96A 1NC4D 5CKAA 5DVLA 1PG7X 1ETZA 4FFVD 3BPNB 3VCLB 1RURH 3KPNB 1MQKL 5EC2B 5E7FA 1ITBB 5MEOA 4L4TA 4OF8A 5I6XC 5JMOC 4XVTH 3JXAA 4GSDH 1S5IL 1PQZB 2R2HB 3MUHL 4L29B 4AT6A 1YEDB 1KCRH 3O4LD 3DX6B 1DBJH 3WHE0 4ZUWA 5L7XH 3ULUC 4LU5H 4MQTB 4FZEH 4G8EB 3QFDA 4FQCL 4Q9QH 2P49B 2P8LB 4C83A 2B4CC 5IGXL 2NW3A 4ZUWB 4M1DL 1MCPH 5IMKA 3VD7A 1KCSH 3DUUA 2XYCA 4WU5A 5A3IC 4P2QB 2BERA 2F53B 4R97C 5MP6H 3EO9L 2QQNH 4X6BA 4U7MA 3CZJA 4D0BB 2NTFA 5EU5B 1ZHNB 2HT2C 2EDLA 5DD0H 3HPJA 3ULUD 2BNQA 1Z9MA 4CVWA 1BFVH 4KK5C 1WCBA 4PB9H 2CRIA 5T3XL 5DTFA 4JFXB 5KSUB 5CEXB 3QDGB 2CK0H 3ZYIA 4UI2A 5I1AA 4RDQG 3SCMB 2BVYA 3NIFF 4L8CA 3KPLA 4U1JB 3C87A 2RBLA 2JK5B 2HTLC 5GRVL 4X4XB 3DMMA 2V2TA 3UTQA 2F5BH 2HT3D 4U1JA 1RZGA 3EYSH 2Z91B 5HYEA 1U41A 1BQLL 3PWLA 1KULA 2NY1D 4HH9B 4X8JB 3S4SG 1KXVC 3FCTB 3BPLC 2XKSA 1YMME 4EVNA 2DJSA 3W2DH 2A38A 5DUPL 4OLUH 2AK4D 5IEKA 4GRLD 4U1SB 5EOCH 1G7PB 3FFCE 4RGMC 5D7LE 2EXYD 2Y36H 3IVKB 3LMJL 2X4SA 5KOMC 1QR1A 1L9NA 4OSUH 2AKRB 4HBCH 2IH3A 2R23B 5E8OB 4AEEA 2C4FT 4GAFB 1G9NC 1FL3B 2F5AL 5CGYD 5D93B 4JDTL 4MD5B 4LCIH 1ZHLA 1IZKA 3C5ZD 4I4WB 1JHKH 2NY0D 2BXZA 3RUGA 2AJUL 4R26L 1R5VB 3ABZA 4DAGL 1HINH 2NY5H 4KQ4L 3WYRA 1QLEH 2PO6D 1J0JA 4CAGA 2GSIA 3EYVB 5D6CB 5FUCC 5JO5A 1A14L 5FGCB 1AHWB 1HK6A 2D7QA 4HEME 2MCPL 1PLGL 4EDWL 1V7NL 3CFEB 4PRPA 4LHUD 5C6TL 3GFUA 3SGKA 1FGNH 4K9EC 4PJDB 2D0FA 1GPOH 3GIZH 5IVXA 1GAFH 4KZEH 4LIQH 2X4NA 4PJFB 4WFEE 2XN9B 1EX0A 1AY1H 2X4OB 1UG9A 2NY2D 3I3EA 4TRPH 4Z0BL 3WIFA 2DM3A 1JWUA 5DD6B 4K94C 5E2VL 2VXSL 4U7SA 2J6EH 4UDTA 2DM2A 4DGVL 5GS1B 1JWUB 3MLYL 5DD6A 2ARJB 1OGAD 1ED3B 4FFVC 3L3HA 4FXKB 2BSSA 1Z0MA 3H9ZA 4PJAF 3UJTH 5MP6L 3MR9B 3KPSD 2NY1C 3DV4A 4MNQB 3TBVB 4PJGF 4WI6A 4PTUA 3ARBC 4XVUC 5I76B 3ZDXF 4N9OB 1T0MA 3GUTA 3O3UN 4F9LC 5GGRY 3OR6B 1R24A 2B1AH 1NBVH 5DHVH 5D5ME 4LU5L 4GS7B 4PRBB 3P40A 4KUCF 1LO5B 3RY6A 3BIAX 5BRZA 3QUMH 5E99H 2PCPB 2YA1A 5E7BA 4ZFOB 3RTQD 3UC0H 2HKHH 4DUVA 4FQXD 3IS1X 1JPSL 3HZYA 3EDJA 3S34H 2Z4QA 3L3IA 2X42A 2H2SC 1EERB 4G6KH 4G43A 5D1QC 3EDEA 1WAAA 4HJ0C 1M6OA 5GGQL 1KELH 3V6FB 1RZJH 3U1SL 4PG2A 1S5HA 35C8L 3B2UD 4HIEB 4IRSB 4E41A 3R06B 3PXJA 3T2NL 3DXAE 4Y89A 3TIDB 3SQOL 3HZVA 3VFGH 4YUEL 5JW3L 3CXHK 3QUZD 4YBHA 1RUQL 5J13B 3GZKA 3O3AA 3OF6D 3RL1A 1G7QA 5IIEA 1NPUA 4LLQB 3CLEL 1BZQK 5C2UB 5CFHA 3P9LA 4KPHH 3OPZH 3CXDL 4IMKC 3O3AB 4N0CD 2EE2A 4PIRF 4X6DA 3W11C 1EUTA 3T0BA 4LLVA 3I9GH 4TUOB 3K0WA 3RWGB 1YJDH 3P9LB 4HIJA 1TJGL 1XGYH 1JN6B 1QBBA 1R0AH 3LKSA 2D9QB 3CFDA 4JQXA 1CD8A 1HH6A 3VMOA 1JN6A 4WV1A 2BY1A 3IU3B 1A3RH 1MFEH 3SBWA 2IANE 5TQ2L 4FMKA 1YNLL 4BZ1H 2ICWJ 2CGRH 4HKBA 3VH8G 1MCEA 5SWQA 1DFBL 5CZXC 3EFDL 4MA1C 4JO3H 4ZXBA 2ZUWA 1AGBB 1OAQL 4K94L 4ZMAT 2XRAH 3I2CL 2G75B 2IBZY 3BIBX 2OTWB 2K7PA 4GKNB 1PX3A 3QDMA 1JYXA 1RZ7H 1F3DJ 3SE4A 2D31A 2VUYA 3P77B 3NA9H 4QXWA 3PWNA 1AGBA 4PG9A 4NN5B 5AYUH 2F5BL 3EIFA 4X9FA 5I0ZA 2AI0H 3ROLA 5T1LB 3UYRH 1EHAA 1I7ZB 1I9JL 5IQ7L 5C0CB 4PJAB 1A7NL 3MNZA 3X12A 3MRCA 2HLFD 4HFUL 4NJ9H 5JOPD 3NZ8A 4OZHF 5EU6B 1FE8L 5DI8A 1CFSB 5TE7L 4MLSA 1J0IA 1DVFB 1XF1A 2YHGA 4LASL 2ZSVB 2C1OB 1L7TH 5DDHA 3MV7E 5IHBA 2EKSA 2CO6B 4HIIB 4YJZL 4R6UA 3BE1H 2YPKA 4XMKH 1T7XA 3HUJB 1XIWC 1HXYA 1FG9C 1AY1L 2GFBA 4YDLB 3QFJA 2Z8VC 4GW5B 5ENWB 3HCVA 2EKSB 4HIIA 4P4KD 4LQFL 1CE6A 5ID0B 3QNYB 2VLMD 3BYYA 2O5XL 1XMWA 1MCJA 3FMGL 1CDJA 1MRCL 3VJ6B 4ELMF 3F12B 4WFHD 5H94B 1HSBB 1QUNA 4G9FE 4K7FB 1XF3B 3O3EA 3SDCC 4JG1H 3NAAL 4MCZB 3QUKA 1T1ZA 3ZKNC 1ZA3B 2VLRE 2LVEA 4CVZB 1ZWIA 2GTWA 3LEYH 4Q6IC 4O2FA 1SEBA 3PWPE 4OZGE 1WIOA 4Q2ZA 2CDEB 3KDMA 3TNMB 3TO4D 2ZKHH 4LSQH 1MQ8A 3DX7B 1Q38A 2CR3A 3SQOH 1H3UA 4RAHA 1TMCB 2VLLA 5F1SA 4Q2ZB 4KUZL 3DX8B 1MJ8H 2PYEA 2DLHA 4M61A 3ARFB 1J05A 1UA6L 3FN3A 4GUPB 4WWID 1BQLH 4GQ9H 3D85D 5T1MA 1KFAL 1N0LA 1WZMA 3OAUH 3Q1SH 1HIML 4YBLC 2ITDA 4XRCA 4WCYH 1IAIM 3ARFA 3IB4A 4KWUA 1T20B 1A02N 4LCCB 3L7FA 4LSVH 2WUBL 1P9MA 2B2XL 1J1PL 3N9GL 2ED9A 4GOSA 1UWGH 4XAKD 4XC3L 1NAKH 4Z7WA 4OM1L 5J12C 5E1AA 1JWSA 1U8PB 2UZXB 4NQDE 2HJKB 3SGJC 3U0WL 3MRPA 5J7CC 4K3HA 2FX9L 4KROC 5C0AD 2J8UE 5D5MF 1U3HB 4F7TB 4BZ1L 1U8PA 4ZTOL 1IGTA 2P8PA 3G5VA 5CSZB 3RDTD 3RGHA 4PJGE 1JGLL 1IEAB 2EEAA 1HHKA 4MD0A 4JEGB 4HKZB 4BUGA 3DETC 3L9RB 3LKQA 3QHTC 3ARDC 4G7YH 1CXEA 4FG6D 3S34L 2X9XA 3REWA 3O2WH 4QXTB 5IFJA 3VXRB 2ZNXA 4CJ0A 2R69H 4YNYA 3BXNB 3P0YH 5GRJL 2VABB 5FM5M 3IJYA 4TNVK 1VFAB 4OCLC 2IAMA 4JFQA 4QRSA 4KTYA 1P7KA 5D71L 2FBJH 4N5ED 4OKVA 4RRPA 4E9LA 1Q1JL 2A6KA 2P8MB 4GW1B 1PY9A 1VFAA 4FQ1L 5K9JL 4H20L 4Z7VE 5F7KC 1JI2A 3EYFA 4X7CC 2X4TB 4OUUB 5I1JL 3ARED 1A14H 2BNQD 4LBEA 4W6XB 4JDZA 2Q76A 3M45A 2OSLA 4I0PC 3KYMA 4LSTH 4D8PA 1J0HA 1Q9LA 1SHMA 2YD1A 4Z0XB 3PDGA 4LBEB 5IB4A 4OFDA 3DV6A 5SWZD 5JW4M 2EDNA 3V4VH 2FHFA 3IFNH 1RZIB 4WI7A 2CUHA 3G6DH 5KJRL 1A1OB 3QO0A 1SYSB 1IC7H 3MACH 5F7HA 1EHLH 4EEEA 2EC9T 3RIAF 4X5XA 4BQCA 1FL6A 1KNOA 5C08A 2OR9L 2NY6D 4N0RA 5K9KA 3V2AR 2ORBL 1LE5A 3MLUL 3NABH 4N9GA 4KROB 2WUCH 3O11B 1DL7H 4LF3A 1G6VK 2OTUB 3P4OA 2J5LC 4C83B 1TVBA 1OAZL 3FQWA 2PETA 15C8L 2LAGB 4GRWB 3CMOH 5IT2H 1LD9B 3FB6B 1QR4A 1MLBA 4WW1A 1W0VB 1A7BA 2R29H 4BZYA 2XWTA 2X1WL 1M7DA 4HK0B 5KVEH 4NT6A 2GQHA 4QOKA 2WIMA 5ANMA 3DNKA 1BOGB 3QIWD 2FX7H 1HQ4B 5EBLA 4YHLH 1OAYL 2R4RH 4CKVX 1QRNA 4ZS6C 3OMZA 3LKPB 1UJ3A 1CDIA 3MRBB 3HE6D 1XGRA 5IOPB 1HQ4A 5EBLB 4NQXB 2ATKA 3CPLA 4DKEH 2WIIA 2YXFA 4GH7B 3VRLF 4EOWH 1IJ9A 1X6NA 1IGYA 1RI8A 3WHE1 3WUWB 5FYKH 5BQ7A 4MXWL 3QUXD 1PG7L 4C4KO 4W81A 2BMKB 4IJ3C 4N0UE 1EHNA 3FZUC 1UXWB 1JPFB 5BQ7B 4Q6IA 3CSBA 4XXDB 5J11C 5HYSB 4L9LC 4KI5C 4WENB 2A0LC 5CCKL 5EU5A 4MA1B 4JO1L 3O2DH 3LEXB 2DQIL 1U8JB 3GSVA 3C5JA 4UV7H 2QV2A 1L9MA 4KI5D 4EI6B 5DD5L 3KVQA 3OTTA 3TT3H 3GI8H 1MHCB 3H42H 4B50A 2B0SH 2OJZL 1CFTA 1BFOA 3NTCL 1VFOA 2CIKB 3DVNA 4M5ZL 4QF1A 4TVPD 4HF5L 3JWOC 5JOFA 1ONQA 4S1QH 1WCQA 3U0TA 3VXMB 1JGVL 2BNQE 2VAJA 5E08H 3QG7L 2DYPD 3IDGB 1JNLL 1NKOA 2A9NL 1IEHA 3QA3A 5JOFB 3VXRD 3CZFA 4PRPE 3OKOA 3Q5OA 2ADIB 3MOQA 4XCYA 1BLNA 1IC4H 4QTIH 3RKPA 4PD4K 1EA9C 1YYLH 4OTXH 5TF1L 4EIZC 5J13C 1EO8H 3BEVA 4PJHF 1UM5L 3KYKH 2YEZA 5E24E 1T22A 3KPSE 4GXUM 2VLKA 4BFBD 2FBJL 5DF0A 2KZ1B 4NKIH 2ADGA 4QHUA 3SKNA 3SDXE 5ADPH 2GSGA 5T1KD 4LQ1A 5FOBB 3DYMA 3H3PH 4XT1C 3FFCA 5D7LA 3VFRB 5GPRA 1GGCH 3KAAA 2FBOJ 4YXLH 1CXFA 5E95B 1YDPA 1YY8A 3LY6A 2VDLH 2EDEA 4CN6A 1CICD 3UJTL 2QQNL 4C56E 3P0YL 4NQDD 5DMIL 1XCTA 1CFNA 1G0XA 2F58H 4Z7NE 4YHPB 4RZCA 4EIGB 3BFOA 1GIGL 1QPXA 2HT3C 5F7UA 5DYOB 2W0FB 5DHVA 4JB9H 4Z78B 2B1AL 5ACLA 5D6DA 4HUXB 3QYCA 4XXCC 2FSEA 1UM6H 3RNQB 1OAXL 4ERSL 4IMKA 4JY5H 2RR3A 5KSAD 3QR2A 4ZFFB 2NX5A 1P4BH 4RISH 1OAUL 5HGDB 4NNYA 4D9RD 4U1GC 1KPUB 5HHXL 1Y0LA 1FPTL 2V6HA 4FABH 4PRDB 3B9KC 5GZOD 3THMH 2CIIB 4KAQL 4FNLH 4RAVB 3RL2A 4NO0B 4Y16C 3T8XA 2NY4C 2Z4QB 5EG6C 5ITBL 2R29L 4G43B 2EDFA 2C3GA 4L1HA 3L7EA 1YEJL 4KK9C 4OZFA 1S7TA 4L5FL 4ODVH 3HG1E 3T8XB 2YPLB 1KEGH 1G6RA 4UTAL 3G5XB 4PTUB 1J0ZA 1EFQA 5E6YA 3ILPA 3R06A 3B6SA 5FHBH 1BIHA 4X6DE 3PNWB 4K3JH 4X8XA 3MLUH 3NABL 5FO8A 1BVZA 1E4KC 3A6CH 4H0HB 3EO0A 3VGEA 2ERJC 2FLBT 4HG4J 2DMCA 3RAJL 1NGYB 3KPQA 2CKBL 3LEYL 4R2GB 2NY1B 3MCKB 4LVNB 2YUWA 4G8GB 1BHGA 5D5MA 4Z95H 3ARBA 5T33L 3RWIB 3HC4H 1R5WA 3AB0C 1RUPL 3FRUB 1I3UA 3BO8A 4K8RL 1BVLB 5AZEH 2X4PA 43CAA 2I25N 5IJKA 3S6CA 1FBIH 3S4SA 3CK0H 4XP6L 4I9WD 4RGMB 4Z8FH 1HHHB 4FQ1H 1F11B 5F7NC 3LAFA 1R3KA 3GBML 4D2NA 4AG4H 1WAAE 3MV9E 1N6UA 3F7QA 3OKMB 3KPMB 3V5KA 2CKBB 5DSCA 1GSMA 5C0BA 5EPMA 3LPFA 2AJVH 4WFED 3LB6C 4LLVB 1MEXH 1DEEA 3HE7B 3BN3B 3PWNB 1A7NH 3S5LA 3SKUD 1GHFL 5BW7C 2J12B 2ZNWA 4PJAA 2QQLL 3SDYH 5IW3A 3KPOB 1QBML 3WV0A 2NXZD 1MF2H 1SJEA 4DTGL 1YECH 4H20H 1DQDL 3CVHB 2PTVA 4QHMB 5AYQA 2X05A 3L1OL 4HKXB 1KJ2L 2XZAH 2BDNL 1NAMB 3GMOA 4I77H 2XTJE 4ODHH 3T0ED 1ZGLM 1JUFA 3WFHA 2XFXB 2FX8L 3MYJB 1JE6A 4QHMA 5FUOL 1I7UA 3GIVB 3QJHB 4GLRH 4B0MM 2WQRA 3MV8E 5F21B 1WGOA 4FQQB 2ZUQC 4U49A 2FZ3A 1CDCA 4S0SD 3HB3D 5CJXC 3QUZB 3MV8D 1A6AB 4YE4H 5I1LA 2E8YA 5DD0L 3QIWA 1I8MA 5FO7B 2X1OA 2C9AA 1CGVA 4YXLL 3NFNB 5CEYA 3ZKXC 1DEDA 4L9LA 3PIQB 3O3EB 2OR8A 3AGVA 1CLCA 5EU6A 1IAIH 2J4WL 2R39A 4HUMB 3L3KB 1H15A 1OB1A 3BZEB 2PYEE 3INUH 4LVOB 1F2QA 2YUZA 4Y2DB 3AAZA 4AZ8A 3OJVC 1H15B 1UVQA 1WZ1H 4YQXL 2H45A 4M6NL 1X7QB 3ZYZA 4W4OA 4HJJH 5DJ6A 3DURA 3FOLA 1DBKL 3I3BA 4GXUN 1S8DB 2X7LB 3MJ8B 4M61B 3EYQD 5F88A 5BV7C 3IDYC 1CDBA 3FOLB 4LNRA 1YEHL 1HILB 4Y4KD 5C0AE 5IW6B 1F58H 5GGQH 3MJ8A 2R1WA 2R56L 3GJEB 2PUQT 2R4SH 3MROA 4FXGB 4NN6B 2J8UA 1NMCB 4RGNB 1UH3A 5DEFA 5F3HA 5I30H 1VGEL 1W0WB 3T65B 1YN7B 1YQVL 4F80A 1O0VA 4KTEH 5HD8C 1JTPA 4FXGA 4ZUTA 3NFSL 1NC2D 3RZCA 5F7FA 1MJJB 2JJTA 5T3ZL 4K3JL 4P5TC 5I9QC 3ZE2E 3UPRA 2XQYK 1BEYL 1CXIA 3N50A 3FN9A 4JRXE 4G5ZL 1DQMH 2NY0C 1MJUH 4MA7L 5GHWL 5C3LD 3HR5A 4GAJH 4LVEA 2MQCA 1EBAA 4JFFD 3HI1A 1FH5L 1EJ6A 2B8OT 1J8HA 4MAYD 5HSFA 3MRDA 1NEUA 3IAQA 4LPCA 1I75A 5IM7A 5CMAB 4XP1L 4JHBA 3O9WC 3TV3L 2PTUA 4JRYA 3IXAB 4MDIA 1GGYA 3EFDH 1HHJA 4JFQB 4H25B 5CP7B 4FA8A 3ULVF 1DCLA 5JDSA 1SMOA 3UMTA 1TPXB 4X80L 4PJXE 4Z7WE 1IEAA 4ZYKA 1CFVH 2XWJA 1CG9B 4MXQC 3LN5B 5JDSB 1FORL 2B1HL 3PDDA 4WHTA 2BFVL 2NY0B 2ARWA 5TE4H 5IB5A 5C08E 4MNQD 3KWWB 3MTRA 1A6ZA 3PDOA 4Y19A 5FXCH 2HP4A 1BOYA 4PJGA 5ALBH 5IB5B 1PY4A 4PS4L 3MNVA 5JQ6L 4JFOB 4G42A 5HVHB 1K85A 3VE0A 1FL6B 4QGTA 2GCYB 1PD6A 4OGZA 5DEGB 4K7PY 4P5TA 5I8CB 1K3IA 2VNCA 1J1OL 5CBEA 2ZCHH 1LE5B 4HS6A 1UWEH 3VW3L 3SE9H 1UWXK 5E2WL 3ARWA 1NLBH 1NCBH 2DWEA 2WLYA 3MRIA 4UIMA 5IESH 1N26A 1UZ6F 3SKJH 2MHAA 3D18B 1GCFA 1KXTB 3WJJC 3V7AE 1KN4H 2P43B 4P5KB 1U95A 3BKJH 1JCKA 2VR5A 2E9BA 1MHHA 1WT5C 2XKUA 4UOW0 2N7AA 3QUYD 3B9EA 1FFOB 5BV7H 3MXWH 2BOBA 3TZVD 5BMFL 4HKJA 1YEDA 1G9ML 1QFWH 2EH7L 3IFOA 5IFAH 2XI9A 1FNFA 2E7HA 3F62A 5FEBA 4UV4L 1FVEA 3K4DA 3K46A 5ESQB 2IPKB 2IH1A 3PWVA 1ZGLP 3AM8C 1CFQB 2HH0H 4MJIB 3ARRA 2R8SL 2X9WA 3BH9B 3BZFA 4WHYG 4QHKJ 4CU8A 3H9YA 4WW2C 3P0VH 3QCUL 4HHAA 4XNXH 4KVNH 3SPVB 1WIUA 2XA8L 4LLYA 4D0CA 2ZUQB 4WNQB 1JYNA 2Z31C 4ESKA 3SO3C 3DMMD 3RTQA 2ATPA 5CJXA 5F7MC 3RUGF 2C26A 3PHOA 3E3QE 1QYGL 3K2UH 4PJ7A 2ENSA 3R1GL 3OB0H 4KHTL 2W0LA 2GJZA 4HH9A 4N5UA 4GRMA 1X5AA 2FX9H 5CWSB 3PJSB 5TPWH 3RDTB 5FYLD 1J86A 1QFUL 5FYKD 4QOKE 3GM8A 4M1DH 1BD2A 1MRDL 5DRWA 4HC1A 1A5FH 3D3VD 5J3HD 2X4SB 1JRHI 1KPVA 2UVFA 1EEYA 2I9LB 1RK0A 2P5WD 1G9EA 3H2WA 3T04D 1KEMH 3DX9B 2CPCA 4OI9A 3BZ4A 5GGVY 3MODL 1VA9A 3V95A 5GSVA 1AGFA 2VIRA 3EO1B 3RWCA 1ZGLA 4JHAL 1YY9C 3MJ9H 4P23C 4PUBL 3ZTJH 5FCUL 4P2YA 3D9AL 1VPOH 1Z6JT 4JAMA 1RZGB 1S7VA 4LKXB 3FL7A 3QEGL 3D69A 4KZDL 4W6YB 4G80A 4R0LB 4ZXBC 3TYGH 5BCAA 1K3ZA 1MCHA 4LCWA 2VDOL 5AZEL 1SBSH 4FQLH 4JG1L 2X4NB 1RZKH 4LVHC 2NTSP 4JJHA 3OKDA 4M5YH 3CZFB 4JQXC 4N8VA 5KSBA 4UV7L 3SOBL 3PP4H 3QXVA 2N1KA 4JO1H 5F9JA 4OLZL 3O8XB 4BZ2H 2BP3A 2ARJA 5A16A 4YXHH 4HUVB 4JM2A 5DJXA 3VXME 5A2IH 2GSIB 5D7SL 2NX5D 2UY6A 4EJ1C 5K59F 3T4YA 2J1KA 2RCSL 3EJZC 1NFKA 4J4PC 4F37F 4PPTA 3GMMB 4OLVL 4ZO9A 4ELME 3OR6A 1J9CT 3Q6GL 2MPAH 1NFDF 4IIQA 5EZOL 3U0PB 2KPNA 2WZPD 2NCMA 1L7TL 2QKIB 3KPSA 2X4OA 3ESUF 4OT1H 1F45A 4PJDE 5C0NC 2UZYB 4R4NC 4HFWB 5KVEL 5INDA 5HYQB 3SDXA 1PLGH 4EDWH 4QY8A 1EXUA 3L3JB 3MV01 1II4E 2IQAA 4B7IA 2LV4A 1LP9E 4EXPX 3SHSA 3CSPA