2RCSH

Immunoglobulin 48g7 germline fab-affinity maturation of an esterolytic antibody
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
217
structure length
217
Chain Sequence
QVQLQQSGAELVKPGASVKLSCTASGFNIKDTYMHWVKQRPEQGLEWIGRIDPANGNTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCASYYGIYWGQGTTLTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the evolution of an antibody combining site.
pubmed doi rcsb
source organism Mus musculus
molecule tags Germline antibody
molecule keywords IMMUNOGLOBULIN 48G7 GERMLINE FAB
total genus 45
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 1997-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2rcsH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2rcsH02
1XGTB 4D9RD 4RA0C 5KZCB 2OJEA 5HGBA 2ED9A 5GRUH 3HC3L 1M6OA 3P2TA 3FB7B 5EH1A 4RISH 4RGMB 1ZVSB 2FX9H 4PJCE 1J0HA 2HRPH 5JA8B 1FBIH 4EI6A 1MCLA 4IMLB 5F9AC 4UT7L 1ND0B 1WIOA 3ARGA 2HT3C 4WY7H 4TNVF 2FX7L 3QDGD 2XFXB 5DXWA 4MDIB 4E0RB 1JPTH 2VAAA 1YECL 5MI0C 5I8EA 4M43H 4NQED 1Q0XL 2OL3L 2W59A 3JTSB 1VFUA 2OX5A 5D72L 3ZKQD 4G6KL 3UBXB 2WAHA 4IOIA 1NCDH 2Y9RT 1BZ7A 5EORL 5IVXF 1MI5B 3V4PL 3U0PA 1BHGA 1MOEA 2HT2D 2KDGA 3T0WA 1IT9L 1K3ZA 2E7BA 5I1KH 4X7FC 4PR5A 1HCFX 3AXLB 2UWEB 1YEDA 3T0VA 4PJFE 3HAEG 2GJJA 3MOBL 4ZUTA 5F7NC 2VXVL 2NY0B 3CX5K 2AJVL 3DX7A 1FDLL 4GKZB 3NFPA 1DUZA 5MEQB 3EFDH 2FHBA 1KXTB 4NQEB 1BFVL 3O6LL 4X6EA 2FYYA 4PJIE 2H26B 1HYSC 3WKNA 3OAZH 1RVFH 4M03A 1A3RL 1T4KB 5DLML 5I1CH 3WFCL 1BD2D 2AJ3B 2DIAA 5IFHH 1HQRB 5JHLL 2QSCH 1IGIH 4L8CA 4P9HL 2GTWA 2X4SA 1SJHA 5F93C 4X98A 4HBQA 3O6KL 2NY3D 5I9QB 5AEAA 4R4ND 2AK4E 3LKPA 4PREA 5C2BH 4QOKA 1XMWA 3JUZA 2M2DA 4GRLC 1HKFA 3LZFH 3VFMB 4KK5C 1KLGB 3EO1B 4LLYB 4LAQL 2W38A 1ZGLA 1TJHL 3D3VA 4LKXA 1NJ9B 2YPLE 5C3TA 1FE8H 2HWZL 3A6OA 2WANA 1T5XB 1Y0LB 1S78C 1AP2A 4YXHH 3RPIB 1CFVL 4JVWA 1NGQH 1U0QA 1KIUA 2UZIL 3MUJA 4XPGL 5DJ2A 4D3CL 5BRZD 4IHOA 3B9KB 4IOSD 3WS3B 1I9IH 4WEUD 1KB9K 5D6DA 4NBYB 1I8KA 4JN2A 3QUYB 5DGQA 3BWAA 1FV1B 4X6CB 3SDDA 3VFRA 4ZO7A 1MHPL 3OMZA 3BDXA 3KLAB 2O61A 3VCLA 4YDVA 3O4LD 1AD0B 2IPUK 4GAGL 5K93A 1BOGA 2R56L 3RL1A 1NGXB 4KVCL 4HWEH 2W9LA 2Y5TB 1CDGA 1JZ2A 1XGUB 4F7MB 3DROB 4Z7UB 4XPFL 1RIHH 3C09B 5C0CD 3VGDA 4FXKB 4UU9B 3BISA 5D93B 2I24N 4R4FH 2LVEA 2CIKB 3BKML 3TJEH 1OTSC 2AEWA 4S0TD 2GITA 2BNRA 4HDIA 4O58H 2L0DA 1ZT1A 5JORA 4OCNC 4KQ3H 5EBLA 5E2WL 3F7YA 3GSUB 1GIGL 3HUJB 4HJJL 1CE1H 3EHBC 4XXCA 2BXYA 4PS4H 1F58H 4ZUUA 5KZCD 5FUOH 2IAND 4KH2A 4K23L 2E3VA 3VI3E 1FL6B 3ZE0E 1FO0B 8FABA 3GIVA 3GMNA 3L3JB 3WCYA 5LAXB 1CFTA 4WV1A 1B88A 3CVHB 3T4YB 5D7JC 1AP2B 1W0WB 2C1PB 3U9PL 4LBEA 4P23B 3DXAA 3VFMA 2MWCA 3KG5A 5EU5B 1V3LA 1F58L 5L2KB 4GMSH 2F74A 1NMAH 4ZG1A 3V6FB 4XHJC 1D9KA 2JLLA 1KPRA 1TJGL 2X9WA 1TZIA 3GK8L 4GUPB 4K7PL 4KAQL 2V9TA 5T5NG 4A2MA 4P46A 4X0KB 3O2VH 3TJEL 3IDNA 3LKNB 4IS6B 5CINL 1J1PH 5FYJE 1DLHA 3P3YA 1EHLL 3I75A 3REWB 2FO1A 4XWOD 2H45A 2AV1B 3HLAB 5BV7B 4AG4H 5MENE 1KN4L 1JHTB 1U3HD 4NGHH 4PBVC 4PV8B 3EO0A 1AY1L 2I27N 4WW2F 4N5UA 3NFPB 4J1UB 5EOCJ 1FIEA 1U8NB 3UEZA 3NCYS 4MHHI 1WCBB 5HGBB 4MCZA 2ADIB 5E24E 4HULB 4HWBL 2EIZA 3SDCD 5MEND 3HMXL 3AXLA 4NKDA 3EFFA 1NLBH 3LEYH 5BZWB 1YDPA 3CX2A 1YEIH 4Q9BA 4H25A 2HT4C 4NQDD 1ES0B 3QWOB 4M9OA 5I8KL 3WD5L 2PO6A 4F3FA 3T1WA 3WFDL 3QSKB 1IBGL 2YSSB 2AJ3A 1AC0A 3ROOB 3V5DA 5IMKA 1JHKH 2W60B 3RPKA 4YNYB 2V6HA 1FPTH 5C0AD 3VFWB 3I85A 4K9EL 1HHKA 1KEGL 2EYRB 4QF1A 1O7SA 1U8HA 1YNTA 4F57H 5KN5A 4WTZG 3CLFH 4HLJA 5MEOB 3P73B 1XR9B 3TA3A 1U91B 3P9LA 3V52L 4KRPD 1HOCA 1A9EA 2PR4H 5IJVA 4U2ZA 4JJ5A 3CC5A 3VXUD 3VJ6A 1QPXA 5EO9B 1EMTL 2DQJL 1IT9H 3MV7D 4ONGL 1LO4H 5DS8B 5I1KL 1LMKA 2SEBB 2C4FT 5LKNA 5EBMA 1J1OL 4J3SA 1NBZB 3V6OE 1I3RA 2UZYB 1VKXA 3T09A 1INEH 5E56A 2A6DA 3KPSD 2ZSWA 3RI5F 2EDFA 3GSNH 4ZFZB 5E6IC 1P1ZB 2PW2B 2EEAA 3QI9C 1NDGA 5L88L 4F9LA 4U1GB 4KJYA 4S1RH 2FX7H 1NDMB 4DKFL 4BFBD 2XZCL 3FFDA 3MMEB 4OZGE 5DEZA 4X4YB 1E4XI 3PIQA 5B8CB 2HRPL 2HVKB 3WNOA 5CZVH 1RK1B 5BXFB 2YD3A 3P11L 3W2DH 3JV0A 4HKXA 1HN1A 2NNAB 1TZGH 3RNQB 2J8OA 4JDVB 4P49A 1FH5H 4F9PC 1FNFA 4D9RE 1KGCE 1S5IH 4QRPE 2DYPD 4N9OB 3H9SD 5HDQH 3KPOA 4PG2A 1RHHA 5F6HI 3C87A 1IEBA 4PJ9A 5KVFL 1JNLL 3W81A 3TP4A 2VIRA 1A3QA 4LCWB 5C0CB 3VDAA 4DW2L 3ETBF 2IGFL 5KVEL 5L8LB 1MQKH 4ZUWA 3NAAL 1EEZA 2QTEA 5IFAH 1SEBA 4KHTH 4LGRB 5HHMD 4M62L 2C1OB 1V8HA 3WSQH 5TGBA 1EHXA 3VWKB 3CSPA 2APVA 3K8LA 1EEZB 4P2QB 2WLZA 2DBLL 4RNRA 2EEBA 1KIQA 3DPBA 4GMTH 4RFEA 4Y4FC 3HR5A 1FJ1A 2UYLB 3GI9L 3TBSA 1JF1B 4PGCA 4DKEL 5F7DB 3RVXD 4JLRA 4I9WD 2E8YA 2BVPB 4OKVB 4RGND 3O3BB 3OWEA 5IG7A 1YN7B 2BY0A 3TJHC 3RY6A 1D5IL 4G6AC 1T21A 1CYGA 5D1QA 3ARFA 3T0EA 1PBYA 4PGDB 3OR6B 2ITDB 2X4TB 4NN6C 3V6OC 1M7DB 2F8OA 4NNXB 2D7MA 5HHOE 3B83A 4XB7A 3RKPA 2ZCKL 4I9WE 1UCBL 3MLTA 1AHWB 2JCCA 5J1TC 1JGEB 3HB3C 4GXVH 4HPOH 1NAMB 5DZNA 1UWXH 5GSRA 4P9MH 1NMCC 3QXWA 2R1XA 3NA9H 4YHYC 3FHQA 4NKIH 4ZTPH 5ENWB 4JFDA 4X5WA 1AQKH 3QIBB 2P44B 4QHNA 1GOGA 1CBVL 4XMLH 5MENB 3EYOB 5TQ2H 1YJDC 3HI5L 5IMLA 4X99A 4UUJA 4KRPB 4PRHE 3T65B 5DO2C 3U4BL 3RFZC 3IFPA 1GGBH 4G9FB 4HUKB 1IM3A 4R8WL 5J9PA 3KJ4B 2K3TA 1YNTB 2GY7B 1QFUL 3WNKA 4JFZL 2JJSC 3L9RB 1AQKL 3Q6FA 1WT5C 2P43B 2EO1A 4NRXB 3DARA 4RAVB 2PNDA 3FAXA 3DSNA 4TSAL 3FKUS 2FGWL 3NA9L 5DC0A 4XNYL 3C6LD 4R7DA 4J23A 1MCFA 1BJMA 4OZFG 4ZSOA 1NCAL 2FB4L 3E3QC 2YOCA 1MVUA 5LGJA 1TFHA 5C0AA 1I9JH 2A83A 1IGCH 2IBZY 2FBJL 3MJ9H 1DQLH 5JHDD 3PL6A 3O4OB 1OW0C 4TYUA 1H0DA 4ZNCD 4TVPE 3NIDF 4L8DB 1HH6A 1R5VA 3SGKA 5EBWB 5FM5M 2NW2A 4GAJL 4HJ0D 1FHGA 3N1MC 3QFDA 3LY6A 4KI5E 5KSAC 4F8TA 3F58H 4NM8H 5DRWB 1JZ5A 2GSGA 5CEYB 2Y7QB 4BSWA 3VA6A 2R1XB 4S1RL 4MD5A 1CK0L 5I8EB 4TNWF 4QRRE 3HE6C 3V5KA 3NABL 3LRSB 4MNQE 1T22B 3RWGB 4U2YA 3MRLA 1CD8A 1HYRC 4PGEB 2K7PA 5CHNA 4HHAB 1DBKL 1DQDH 4WUUB 4DAGL 5E4EB 4UIKL 5CD3B 4ZSOE 5GRXG 4CVWA 3O0RL 3I75B 3REWA 4V2CB 1YQVL 4X80L 1B90A 2YPLB 4JCMA 4EN3D 4PLNC 5DJAB 4Z7VF 1AGDA 5KVEH 2GQHA 4JPVH 4NO3B 4JO4L 1S9YB 4GKOA 5HHQA 5GRWA 2LU7A 1FG2A 1P4LA 1EFXD 4EVNA 1S9XA 1S5IL 4MNGB 5IR1A 3P77A 1G7QA 1TZGL 2NY0C 3O2WH 2AJYL 1CFTB 4YLQT 3SQOL 2A83B 2WBWB 2EICA 5D7LA 3DI2B 2DS4A 2ENSA 1P53A 4JDTL 3QDJD 4H0HB 3SE4A 2V2XB 5DK2A 5E1HB 5FCSH 1K8IA 3I6LE 4EI6B 4QNPF 1TNMA 2OR8A 4E41A 2YXMA 5DJZA 3X12A 3DURA 2EXWC 3NTCL 5LJYH 2ZPKH 4ODHH 2O5XH 4WW2C 2I26N 2FWOB 3U46A 1KG0A 1TLKA 1RHHB 2WZPD 5A2LH 3UDWA 3D39D 3BP5B 1AIFA 1H5BC 5D7IA 1J1OH 2NY7L 1FNEA 3CSGA 1II4E 1DBBH 2CR3A 1IZJA 1G7PB 4KKAD 1MCPL 3OKOB 3VXUB 1U8JA 4U1MB 2YD7A 3TPUB 2UY6A 4AMKH 2BOBB 5EZJB 3ARUA 3VDCA 4L3CA 3ARSA 4M5ZL 1U92B 3SGDH 4PP2A 1NDMA 4NHCL 1RHFA 4Z7OF 4Q0XL 4YC2C 4WFGD 3KYOA 2ICWB 2XG4A 3TT1H 5C2UB 4RAUA 3SCMB 1KN4H 1V3MA 2LTQC 3JZ7A 2R1WA 1Z9SA 5F7HA 3PHQA 5C09E 1GHFH 1E27A 2IANB 3QNXB 3P0VH 3VXUE 4OD3L 3ARGC 4Y4KA 3LEXB 3PWVA 4MXWH 4X9BA 1NMAL 2FECL 5J6GB 3ARWA 4ELME 2Z35A 1OAQH 3LS4L 4YAQB 1M71B 5INDB 3MBXL 1QLEL 4R96B 3SPVA 2OCFD 3RDTD 5DHVA 1YYMH 2I9LA 3BP5A 2QADC 4RFOH 1EUUA 3VXRA 4AH2B 2E8ZA 4MCYB 3JVGC 4PRPA 1I7ZB 4YHPB 2FWOA 1JGDA 5ANMA 4HWBH 2XI9A 5D7JB 3WN5A 1HHJA 2EYTA 4EJ1C 1G0YR 2RHEA 1ETZA 2GJZB 3BI9X 2RJMA 3BKMH 1YEHL 3FQTA 3QHFH 3QEHA 1B4JH 1T3FA 2K1MA 1G7HA 3GIZL 4PJIB 3EOAA 2GI7A 4W4OA 1J8HD 3AREB 1OCWL 4Y19D 1UVQB 2HMID 5JXEC 3M17B 3QDJA 5IVXA 1HKLH 5DK0A 4L29A 4GRMA 1J8KA 2XACC 4CVZB 1A9BB 3N06B 3BKYL 3CH1A 5GS0C 2VSDA 5HHQB 5F6IB 5FYKD 2G2RB 4MQ7B 3T1FA 3PWPD 1SY6A 1Y6KR 5KSBF 4X5LA 3BGMA 4KKCC 1BF2A 4M00A 5B8CA 1V7ML 4L4TB 2Y4SA 5ADOH 1T6VN 1N59B 3DX6B 3L7EB 4I13B 1F4AA 3HI1B 2W65A 4DOHB 1VESA 4R0LA 4FG6D 1KCUL 3DIFA 5KVGH 3TYFA 2R2EA 5CIPA 3TO4D 3MBXH 3ZT5A 5I8OH 4O2CB 3LRSA 3T2NL 1P84K 1F00I 1KELH 3EDEA 5E00A 4Z6AT 3BZEA 4KQ3L 1RZIA 3CFBA 2NTFB 4X4ME 4OF8A 1CZ8H 3G6JE 4UOW0 3RZCC 3CFEB 1X5YA 3FOMB 3OGOE 43C9B 4DGYL 1D9KB 1GHFL 4CU8A 3E3QE 3MRBB 2MQCA 4K71C 2MPAL 2OJZL 3WUWG 5K9QG 3HZKB 3FQRB 5CJ5A 1JPSH 4LHUD 3FOMA 4X5WB 3EFDL 3K2UL 3Q0HA 4PG2C 3EJYC 1XR8A 2FJHB 1SVCP 3WEXB 4AENA 1WCBA 3V4UL 5IM7A 4I3GA 3CCHA 1DSFH 3DTXA 1AO7E 4I18A 1DE4B 5T1MA 3HUJF 3P9MB 2AK1L 4YQXH 1INDL 4XWOC 5CD3A 4L3ED 4YHYB 3MXVH 4GRLD 3E6HA 5HY9A 4R4BB 2VR5A 5H37H 2BSSA 5CD5C 3ZHKA 3VH8B 1VDGA 1L7TL 5FKPB 3HRZA 1YUHB 4LSPL 4Y4FD 1CQYA 2W65B 4YXHL 4H5SA 5HDLA 3VXMD 1NUNB 5DI8B 5ISZD 5ADPH 4L4TA 5D96C 1U8KB 4H1LG 4G7VH 4LAQH 5CEYA 2ZPKL 4ODHL 3ZHDA 4DJMA 3RX5A 4BH7A 4CDGC 5TE4L 3ZE2F 2F74B 1XF5B 4E9LA 5I1JH 5HGHA 3ULUF 4GXUM 3RNKB 1DFBH 3VI4F 1G9MH 4KJQD 4U0RB 1UJ3A 3MA9H 1MCCA 2FX9L 3ULVF 3W82A 4R97C 4D0DA 2XA8L 3QUYA 3PGDB 3HG1E 1A7NH 5F9WB 3UTZB 1KPVA 5IFHL 3I2CL 3A67L 3DVNB 2UUDH 3WLBB 4Z7QE 1BD2B 2DDQH 4I0PA 1T66D 2BSRA 2ICES 3K74B 4NZRL 4F80A 1KPVB 2ZCLH 4OT1L 4J3TA 5TDPB 2JCCB 1MLCB 3QNZB 1TVHA 4F15C 5KW9H 4ODXB 4I77L 5IVZA 4ISVB 4JPVL 2ZUQC 1CDCA 3MOBH 3BD5A 4LF3B 3QQ3A 4FXKA 4KI5D 2N7BA 1IGFL 5C0BE 5C0ND 5F1KC 1IKFH 1R3HA 2CKBL 5H35B 1ZTXH 4YHMH 3KLDA 3VFPB 4WEBH 2VQUA 3L6FB 1FO0L 3T65A 4MHHG 3FB6A 1TJIL 3WLWD 5IVNA 1FV1A 1MJ8H 2DWEB 4F7TB 1KEMH 3IU3A 5EO0A 3PGCB 4GBXD 3RAJL 3RUGE 3DLQR 3ZDXF 1NBYB 2EE9A 2BCKA 2AGJH 4ZOBA 4OQTL 1NKRA 5TE7H 1YEGH 8FABB 1S9KC 4N0CD 3PF2A 2R0KL 3RVVC 1HDMB 2CKBB 3AS3A 1ZGLB 1R3LA 2QQKL 2BNRB 3OKNB 4HDIB 2FD6H 4DVRH 2PCPA 2YK1H 2XKSA 5DMGC 3MRRA 1UADC 3C5ZB 5IF0A 2A9ML 2YA2A 3CX5J 1I9JL 3F6LA 3UTQA 4P3CL 1A7QH 3EIFA 1LO2H 3GMRB 3SDXF 2BMKA 4LPUA 1OWRM 4BZ1L 3TC9A 2CDEA 4D8PA 4E0RA 1ZT4B 4AIOA 3GMMB 1UXWA 4ETYA 3QH3A 4E41D 2EDDA 4KUZH 3GMPB 1EHAA 3D18A 3ARYA 1ZEAL 4YHIB 3R06A 2VTFA 4ODUB 1NAML 2AXFA 1RZJH 5BW7A 4D0BA 4OLVL 1U8IA 5L2KD 1BIIA 3HE6A 1EEYB 3CVHL 1A0QH 4HQQH 1FVEB 1UM6H 1GGBL 3T3MF 3BYYA 2UWEA 4G80A 3LDBB 1EFXA 1FZJA 3IDIA 2BOCA 1KENL 2O5YH 2E7CA 2JB5L 3GO1L 5DHYA 1NAMH 5SX4I 2EDEA 4LCWD 3QZWA 3TO2A 1H5BB 5E9DE 1E6JH 5AZEL 3V0VB 5IGXL 2Y36H 2Y06L 5DK0B 4FZ8L 2FLRT 1QA9A 3MV7E 3D25A 4AK1A 4MJIB 1KIRB 4H8WH 1B0RA 3H9HB 2WIMA 1UCBH 1KBGL 4IIQB 1A7RH 4LLDA 3DMMC 2NY1B 2ZCKH 4PB0H 3MACL 5J56B 4QYOB 3WFEH 3NZ8A 1ED3A 5DD3H 2GKIA 4OUUA 1NC4B 2YK1L 4MMXC 1KYOK 1RIUH 3ZKXC 2VABA 5J57B 1G7JB 2IQAA 4JFOB 3TIDA 3RU8H 2PXYB 1R3KB 3S35X 3G08B 5I1GH 2BVEA 4HUNB 5MI0B 1YEKL 4NQXB 2I9LB 1WBZA 1F90L 4JAMB 4X5XA 2A73B 4YWGL 4TSBL 2P1YA 4P5KB 5C9KA 4OV6F 1OY3B 1Z0MA 4R2GC 3UTTD 5E4IA 4JRXE 1T83A 5CMAA 3GKWH 4L4TE 4NOBA 5KSVA 3RZCD 1H5BA 3IU4L 3RY6C 3QIWD 4KZEL 3W0WE 4U1NA 3BQUC 4CL7A 2YUWA 2JK5A 4NQVA 1EFXB 2BP3A 1U91A 4NKDB 4O4YL 4W81A 3NCBB 4YFDB 5D5ME 3U30C 4ELKB 3TN0A 2D7QA 5JXAH 2NZ9C 4XRCA 4MVBD 3BH8B 2HJLB 3P9WB 4YHNB 3IVKA 5C0AB 1JNHA 4LASL 3WO4C 1YEFL 3L3GA 3QO1B 3WFZA 3LKOB 3RBSA 3ARDA 4KZDL 1R3IH 5KG9A 3ARBB 1BQHB 3ARTA 4P2YA 2HVJA 4NZRH 4M5YH 3O8XD 4HMEA 3BP4A 3LN5B 1UKTA 4U0QB 1ED3B 5HHME 1PY9A 4NYLB 3GB7A 5DEFB 1E28B 2IPKA 3IDYC 1FNEB 4JGMA 4XNQB 1KTRL 2VDKL 3RGVC 3QQNA 4XC3H 5C0JB 5J6GA 2KQMA 4OZFA 2QJDA 5T1LD 3MX0A 3V7AE 2IBZX 3BW9A 1IARB 1QUNA 4CJ1A 1CICA 1O0VA 3CD4A 1T7YA 3HA0A 1JI2A 4FFVC 4P2RD 3QJHA 1QRNB 3O6FC 2HAZA 3VRIA 5AAMA 1D5BB 5TDPA 1I1FB 1WT5A 4PLKC 4ELMA 4LSPH 1KCSL 1WF5A 1EO8H 3QXAB 4JFXA 4JREB 3U0WH 1CGXA 2X89D 2P5ED 2BOBA 4NNPH 1IQDB 1T0NB 1UM4H 5EZJA 3PGCA 1C08B 4FQ2L 4LIQL 1U8JB 5D1QD 1A1OB 2DKUA 1N6VA 2APTA 3L3DA 2XXMB 2HTLD 5HHOD 5BS0B 1A7PH 1LP9F 1BLNB 4EVNB 1D5XA 4NN7C 2H2SC 3FB6B 1S9VA 2QSTA 4IIQC 5HSFA 1GGIH 5DYOB 3RBGA 2XRAL 3PL6C 1BVZA 1MFBH 4PGDA 1X44A 3LB6C 1JBJA 4K9EH 1KEGH 4Y19A 4XP9H 4ACPA 3QDME 3C5SB 1EVUA 3OKDA 2YRPA 1ZHBA 3PABA 2R15A 2X1PA 5KS9F 5J8OA 4JFEE 3EDFA 1K2DA 5FO8B 4OGYH 4XBPB 4HMCA 2VDPH 3CVIH 2V2XA 1ONQA 3HNSH 1Q9LB 4Q7DA 2GFBA 4G6JH 2X9XA 1KCRL 1PKOA 4ZXBC 3S6CA 1SJEA 5I75B 5TDOB 4OFYA 5CGYC 4ELMB 2GSGB 4MVBC 3UTZA 4Y8DC 3MV8A 1IAOA 2ZOKB 1RIVH 2X4NB 3UJIL 3OXSB 4QRSA 2I07A 1X5HA 3SJVD 2R1YB 3OKEA 1N0XH 5F9OL 1AQDA 2DQCL 1BM3L 2NR6C 3O11A 1IEBB 3SDDD 3H2WA 1F42A 4C83A 2WIIB 2CDGA 2D7NA 2HP4A 1WBYB 2ADFH 1NLDL 1YYLH 2BY2A 4QTIH 1LO0H 4EUPB 1C5DB 3QA3B 2F53A 3NIGF 5KANI 3EJJX 3SQBA 5FKPA 4TVPD 3IDMA 4PYHA 5TE6L 2W1NA 5E99L 2VQTA 3F12B 3BHBB 1DL7L 1D6VH 3IXAA 5LVEA 2B1HH 4JR9H 3ULUD 2VOTA 3P9MA 3ARBA 3CXHJ 2J8HA 1X9QA 3O2DL 1F3RB 1RURH 5GRZA 5FYJD 1XGTA 1ZA6B 1HHGA 3RL2B 5EA0H 5D1XB 2A6KA 5CAYB 1ADQH 3GJFH 1FQ9C 4JRXB 4OF7A 5EUOA 3QG6B 2A1WH 2YBRA 3U9PH 4ETQB 5KTEH 3QAZB 3X17A 4DEPC 1QYGH 3FFCA 3BDBA 4BH7B 3WNPA 2O5ZL 2NY3B 1PD6A 1S3KL 1NQBA 2H1PL 4WO4B 4HFUH 5ILTH 5L2JA 3BP6A 2VAAB 3BZ4A 3CAFA 3MRCA 4O58L 1IVLA 1BVKA 5GZND 3T0AA 2VLJD 5IB5A 3LRGA 3PDOB 1IAIH 3IDGA 3MRNA 5LQBH 4XXDB 1IAMA 3S3PA 4DFHA 3BRFA 2ARJQ 3RUGA 4KPHL 3L9RA 4XBGA 5IHUH 1YN6A 1DE4A 1CD0A 3ME0A 4WVRA 1XIWC 5CLTA 1FAIH 2G5BA 3B5GA 3W5MA 1I85C 4M5ZH 5JIIA 4AM0B 4UUJB 2W0PA 3KHQA 4RMRA 4JQVA 3CH1B 1CDJA 4FQ2H 1DBBL 4UQ2A 1A64A 3FB5A 4JG1L 4OLWH 2OP4H 4IJ3C 2J6EA 3SKMA 4EN3A 5HJ3A 4XPGH 5C70A 1LO5A 2NQCA 2ZG2A 3QNXA 4KKLC 5HDBE 1XF3A 3QEQE 4G8FB 3C60D 1J8HB 1QOKA 1T5WA 5JPMA 4TSCH 2F54B 5E8OA 1EAPA 4BM7A 4NRZA 3QO0A 3NTCH 5ANMB 3WN5B 2IAMA 4Y4FB 4M1GL 4PJDF 4ZUWB 3THMH 5HYQB 3U7WL 4H88L 2R8SH 2CQVA 1Z3GH 3O6KH 1JWMB 1G7MB 5GS0L 3EW3B 4JQXC 4OJFL 2Q6WA 3KPQA 4FQLH 4GG8B 1X5AA 3TBYB 3D18B 1T80A 5CJOL 4X6FB 4N0FB 1N4XL 3S88H 2X2YA 4R97B 2Z0BA 3DXAD 3DRTA 4RGOH 1MNUH 1RSFA 4KDTC 1RUQH 2BK8A 1MHCB 4R26H 3MCG1 1AH1A 5DQJB 3EGSA 2CK0L 3DVGB 4M7JH 2IANA 3GUTB 1N7MH 2EXWD 5DGRA 4P2QA 3MOQA 1QR1B 4HIJA 5HYJD 1FN4A 1E27B 4RAUB 5ACZB 2CKBA 1Z2KA 2DQDL 4ZFZA 3V4PH 5C0FB 3L3JA 1FL6A 4TVPH 2BCKB 1KACB 1NL0L 3NABH 3VMOA 4YEFA 3BO8A 4NKMA 1BZ9A 2YD9A 5HI5C 2YD1A 1JPTL 4PIRF 1A21A 5A16A 3S37H 5IBLD 3QIWB 1J12A 4BSVB 2R9HD 4OCSL 5DHVB 4M48H 3Q3GB 4YJZL 1ZLUK 4N8VG 1YEKH 4DN3H 3NCMA 2XTJD 3D5OF 3MLZH 3K46A 5I1GL 5E94B 5CGMA 1DN2A 4Y2DB 1AGBB 4FN0A 2XT1B 5GRJH 4H0GA 4L9LC 5BRZA 3S5LA 1QBML 4FMKA 2JCCE 1NFDA 1EX0A 4P2OB 5HYSB 3QG7H 5DVNA 4PLJC 4Q6IB 4I18C 3PDOA 1MLCA 3QQ4A 5HGAB 3V5KB 1S5HB 1PLGH 5F3BA 4RDQF 4HZAA 2VDOL 5CJXC 4OZIE 4L3CB 2NY4B 3EZJB 4OZGB 3VFGH 2VSCA 1MI5D 3P4OB 2JB5H 3GO1H 5FYLE 1IMHC 1LEKB 5DMJB 2V7NB 4AEFA 1JGLH 4N1HB 2KZWA 3Q6GL 2OZ4A 2YPLA 3U4BH 4L5FL 2DQEL 4Y5VA 4QXTA 3SDAA 5IW3A 3GM0A 4P2RA 2B2XH 4JFOA 1ZHLA 2XZAL 4F7PB 4PJ5B 2WUBH 1BEYH 3P30L 3RRQA 3V5HA 3QFJB 3U36B 4U33A 4QHUB 1ORSA 2J4WH 5SWZD 4WI6A 4UQ3A 4WFEE 5AYUH 3G6DH 3QPXH 1T2QL 3O4LE 4UT9L 2ICEA 3L3HA 4PB9H 3KXFE 2P24A 4LEOB 3CUPB 3ILQD 4N8CH 5F96H 4FABH 1J87A 3FFCB 1I9EA 2Y07L 1T2JA 2GK2A 3O8XA 5HYJA 1XR8B 2J88H 2ADGA 5F3HA 2P8LA 4YIQA 3FQRA 1B6UA 4X6DE 3G6JB 1G0XA 3BX7C 5F7UA 1AD9A 4JE4B 5DUMH 1U8QB 1MJUH 3GJFA 2CDFA 3MBEA 1FORH 4OZGA 4PRDB 1J0KA 3NCJL 5SWZB 5EOQH 2EO9A 5FA4A 2F58H 4PP1D 1MJ8L 1AE6H 3QQ9C 5DD0H 3RUGB 1T0MA 1V3JA 3BIKB 4U1GC 4TUJA 4R4BA 4IMKA 2I9TA 1JGVL 3MJ9A 3STZB 4V1DA 1JTOA 2CH8A 3MRDB 2MNUA 4JZNA 5KVDH 2HFFA 3ECBB 1WBYA 1CGWA 4IRZL 4M4RA 1ZHLB 2X89A 4F7PA 4R90H 3T0EB 4LCYA 1VGEL 3DROA 3K7UA 3WKML 3MOAL 5IW6A 3NOIA 3EJYD 4WI9A 1XEDA 1HSBB 3VXQA 1KPRB 3ZDYF 3MNVA 5FYJU 4M7LT 3Q3GA 3BIAX 3LKRA 3CFCL 2O93L 4Y5XC 2HKFL 1VPOL 4UILL 3BYTA 3MV9A 4ALAL 5SWQA 2PXYC 3ZKNC 1HHGB 3RL2A 5BVPH 3LPGA 1H3VA 3WIHL 3SDCB 1JK8B 2AEIT 4GOSA 5HI3D 5T3XH 1FO0A 5SX5K 5C8JA 2VUYA 1A7NL 3ARZA 1SY6H 4GG6E 3L1OH 3P4NB 5GSRB 5D71H 2ERJC 3TO4A 5HHVL 4PY7B 4TNWK 5FCUH 1SYVA 4FFYL 5J06A 2PUQT 1QR1A 2YZ1A 1G6RB 3TBTA 1TMCB 4ONHB 1HHJB 2Z4QA 2GYSA 1U8PA 3ARXA 3BQUB 2JF1A 1XGPA 1HE7A 3MGTB 2NW3B 1NFDF 1FGNL 5IG7B 3KJ6H 3D85B 4M6OL 2XXCB 4MNHB 1ACYH 2HT3D 4R4NC 3HFMH 3RTQA 1SJXA 5AAWA 2DL2A 2ARWA 1CF8L 4LU5H 4L29B 4H26B 3O9WC 1BQLL 4OKVA 3QIWA 1BVLB 5IBUG 4XPAL 1HILA 5I1DA 3IAGC 1BQHA 5IEHB 2VLJA 4Z7UE 4C57C 3C5JB 4AEHH 1K4DA 3ZYZA 5D2LB 3L3IA 3C09C 2J8UE 5SV3A 2P8MA 3W11C 1P1ZA 2PW2A 4D0DB 3RGVB 3GI8H 4WEMB 4PJGF 4PJXF 3UTTB 1FPTL 5E0QA 1F2XK 3MFGB 2X9YA 4QRQB 1UJ3B 1Y18B 2VDQL 4N0UA 4XBPA 1F4WH 3JWOC 3BN3B 2EDNA 5FYKH 4FFZL 2W9DH 4Z7VB 5EUKA 1PG7X 3PXHA 1P4BH 1RK0B 3PQYE 1NCCL 5EUOE 5DD5H 4OZFB 1W2KT 2DLFH 2HFGL 4XPTH 5DA0B 4OD2A 5E94A 5SX5H 4QEGA 4CMMA 2GTZB 4G6ML 1A9EB 1XGQB 3MRMB 5H94B 2OZ4H 3TA3B 4JHAL 3U9UA 1OPGH 3CU7A 1IKNC 1JPFA 4LSQH 1OGAA 3RIAK 5IOPB 3T3PF 1K5NA 3LV3B 3S3SA 1AXSB 1TCMA 4EDWL 2A9NL 1UM5H 1G7LB 1XZ0A 4K07A 2XNAB 4WI8A 4JRYB 3SDYL 3D48R 1XH3A 5DMIL 1DEDA 3RY4A 5TFSH 5FYKL 4PRAA 2F53E 3BGAA 4M7LH 5FYJH 3WEXA 1BQSA 4P23D 4YDLB 2O26U 4X7DC 4RA3A 1KJMB 4PRNB 4U3CA 1OCWH 1TZHA 3SN6N 1XIWA 2ID5A 3JUYA 5EO9A 5CJQL 1P2CA 1DBMH 1DEEB 4OZ4B 1I85A 5D1ZB 3RWEA 2BERA 1JYXA 5JIHA 1CFNA 4U6YA 2EH7L 2CIIA 3RNQA 3JWNC 2A6KB 1EBPA 3HMWH 3NACH 5D7IB 3WE6B 3VGHA 4HWBA 4LU5L 4CU6A 2D03H 4KRNA 4NKOB 4ZYKB 2P4AB 3NN8A 1A6ZA 3WIHA 1R24B 1ACYL 1P7QD 4P2QD 5AUMA 1R3KA 3SY0A 5GIRB 4WUUE 4BA8A 1HH9B 3H3PL 4CDHA 4J1UA 4XP5L 3TNNA 4WV1C 2P5WE 3AU1A 5GXBB 3TVMB 4ODUA 4HHAA 5ESVB 4KTYA 2UZXB 2DKSA 2M26A 4LLAA 4LSVL 1B4RA 3GKZA 3H9SB 1D9KC 2VKWA 4M02A 5FB8A 2HG5A 3MRIB 4C83B 2IG2H 4RSVA 4P46C 2DQIH 3M17A 5HXMA 5JZ7C 4A6YL 1FFRA 2ARJA 3VXSB 3WIHH 1QBLH 4X7CC 4OCMC 5I1LB 4C56B 1WCQA 1RZKL 5A40E 2VUOA 1I75A 2CGRL 4KJPC 4LLVA 1AR1D 1U41A 2HKFH 4GAGH 2NY1C 4HKJA 3PWUB 3O6MH 1OT1A 3R0NA 1F2QA 2W0FA 4OLZL 3CVHA 3T4YA 4AT6B 2BSTB 5GZOC 1Q94A 4TUKH 4NJ9L 5D2LA 1QLFB 3ZDXE 3HZMB 4KFZC 4ZSOB 1H8OA 4XVTL 1MI5E 4YNYA 1QQDB 2Q87A 5GJSL 3LMJH 2UZIH 2NY7H 1X5LA 3D0LB 1NGQL 1B3JA 4U1LA 3NBNA 3QXDB 3WJLA 3WUZA 4M6AA 1VCAA 1LE5B 1GGUA 4JG0H 1KC5H 2HWZH 4MJ6A 4G8EB 1AE6L 2BXZA 5DUBA 5IEKA 1U3HB 5JIKA 5GGUB 2PETA 2PN5A 2XWTA 4JO3H 2XY1A 5CUSH 5KJRH 3CJJA 3AS2A 4LVNC 3C5ZA 5HHNB 5CWSB 4G9FA 4ETQA 3V2AR 1FSKC 2PCPB 2LAAA 3RHWK 1AI1H 5D7IF 3NZHH 2RIKA 2CXKA 3BD4A 1P6FA 4QGYA 3EYOA 4PUBH 5BOPA 2V5MA 2DM7A 4JFEA 1FZJB 3IDIB 1BP3B 3N1GC 1OM3L 4ESKA 4G8GA 1FL5A 1PEWA 4OZHE 1F6AA 4JFXB 6FABH 2V5RA 4NSKA 1TDQA 4W6YB 1AGCB 3O4LB 2VZOA 1E4WH 5EO0B 5HGAA 3ARBC 2MSPA 3SGJA 5CBAB 1JZ3A 3G5VB 4PJBE 1OAXH 3RTQB 4K9EC 3QA3A 1KXQE 3DBXA 1I8MA 1KB5B 1YPZB 1BIHA 3VFPA 3HZYA 3FMGH 1F8TL 3ZSSA 4MDJB 1IE5A 2CLZA 4HS3B 4Y19B 1MELA 3WUWA 1NGPH 4J6RH 3FOLB 5EORH 5J1AA 2IPKB 4DAGH 4G6KH 5MEPB 5T3XE 5IFJA 3WDIA 3HE7D 5CP7B 4ZOAA 1QFWI 4P4KD 3L5HA 5DFTA 4JFFE 4V1DD 1JZ8A 2BDNH 4ORZC 4UB0L 5A3IC 4KKBD 4F9LC 3T77B 2X40A 2ORBL 3VXOB 4YGVB 4M6NH 1R3JA 3HNTL 2MJWA 1BOYA 1FZKA 4XNXL 4WJ5B 4IRSA 5D70H 4NM8L 3B9KA 1FBIL 2VITA 4LCIH 3GHBL 3QIUC 4GAJH 4JHZA 2DICA 4NP4H 3MNZB 2KL6A 3QI9D 4BFIB 1JYNA 1RY7B 2OL3A 3UX9B 4LCWA 3JV5A 4OFYD 4XB8A 3UC0L 2FEEL 3GM8A 3KR3H 1NGXA 4JAMA 4X5XB 3QIBC 2NLJB 4XNYH 3CLEH 1T4KA 5FOJA 3VE0B 2DJSA 4KQ4H 4EI5D 2FYYB 2D4FA 4KRPC 5D70L 4DN3L 1LEGA 3HNTH 3BP4B 3MODH 1WIPA 1QG3A 4XVUD 5D5MF 1EERB 4X6EB 2OTWA 2YPVL 3DVIA 3SE8L 3B43A 3KS0J 1P7KA 1U3HC 2BDNL 3LN4A 4M7KL 4OUUB 4NRZB 1Q72L 2WK2A 5C0IA 1KCKA 2IBBA 2IEPA 3KGRA 3U6RA 4J6RL 4XMLL 5SWZE 4JFHE 2CIIB 1JNJA 4K7FA 1Q0YL 2AEQH 4LCWE 4FFWC 3HG1D 5DVOA 3C8KA 3S36H 5IV2B 3ARFC 5J6HB 4IDJL 1MFNA 2VZ3A 1RZIB 3MFFB 3H9SA 4Q6YA 1KFAL 2F53D 3LKQB 2EH8H 1MCDA 2I5YL 5EFIB 1MIEH 3TCLA 3VG9B 5FHAL 4NHUA 2Q86B 3GSVB 1UZ8A 4UOJA 5TQ0L 3CNKA 3SJVA 1I7RB 4XNMB 4OJFH 1JGDB 3G6AB 3QUZB 4S0SD 4Q9RH 2YA0A 2FO4B 1X6NA 5FYLH 2BNRE 2B39A 1Z3GL 1T89C 5JO5A 2Q20A 3DTXB 1AGEB 4JO1L 2ILLA 4MA3B 4M1GH 4OFVA 3V0WL 3MROB 2PTTB 5I1IH 1BVKB 2AJZA 4TTDC 2DLEA 2ICWI 3VRLE 1UH3A 1LE9A 4RDQG 3DUUB 3UYRH 1MFDL 4I0KA 3ARQA 1AXIB 5F89B 4Z7OE 1F13A 5JW4R 2WQ8A 1KC5L 3MUZ1 4HWNA 4KV5F 5JZ7D 3PWVB 4J4PA 2YD4A 1FYTB 5ETUB 3F7PC 2UVFA 4HX1A 1RUKH 2HTLC 1U58A 4HG4J 5JQ6H 5AZ2L 4F9PA 2XZZA 3BN9D 4I4WB 5HYJE 4OZIB 1KJMA 4U3HA 4OM0H 3ZL4L 4XI5D 1I7TB 4V2BA 4HV8B 3T0DA 2AJXL 5FHBH 5CCKL 5DD1H 1CDIA 1FAIL 4DCQB 1YMMD 2CGRH 4D0BB 4PD4K 3H0TA 2X09A 4JHWH 5DFVC 5GHWL 1AGBA 2X4QA 4CMHB 4KPHH 1XGYL 4O00A 4NKOA 3WFBL 1OGAB 1WJ3A 1ULVA 3HPLB 1C5DA 4N0FA 4L1DA 4MNQA 2BC4A 2BHUA 3GMMA 3VMNA 4LQFH 3UROR 3QFJD 4KDVA 4OD2B 1U8LB 1MJ7L 2ZCHL 3C9NB 5A2IH 3AREA 4Y89A 4DTGL 5L88H 2L7UA 4TUOA 4QY8B 2D3VA 5HHPB 4LHJB 5ANME 3EYUL 2OS7A 5KTEL 1MPAL 1HWHB 5JDSB 2YMXH 4PLOB 4XMKH 4QRQA 3S8WA 4G3YH 5T1KD 3T0EC 2VXQL 3ZHLA 1TETL 1UQSA 1KN2H 4OCLC 4KY1H 4TN9A 4XCEB 3E8UH 4ONGH 2BJMH 5FM5O 1S7XA 3GGWA 3FRUB 4BKLA 3CDFA 4LKCB 4YGVA 4MAYA 3VA2C 3ULSB 5DMKB 1S9XB 1T1ZA 3GSXA 4PJ7B 2BNQB 2A74A 3DX9A 1YMHA 1KCVH 5K9OA 1FFQA 3MRFB 4NDMA 2IFFH 3SE9L 4O51B 2HJKA 1BFSA 4EOWH 3BH9A 1EGJL 2CRYA 3PQYA 3OKYA 5IF0B 2VWEE 2XN9B 5C0DB 3GBMH 1QO3A 1OAZH 4WUUA 3OPZL 1EDQA 3TO4B 1WFOA 3QDGE 4ZUVB 1X7QA 3IXTB 1SYVB 1RIVL 4Y4HC 1KGCD 3FO0H 2XY2A 4QRPD 3SCMA 4MB4A 4AEEA 3H9SE 1PY4A 4HF5H 1G9EA 2P48B 3B9VA 2ENYA 4JHAH 1DBJL 1U6AL 3IJYB 1CN4A 1T20A 5DRNB 1D5BA 3IU3B 1NLBL 3CDYA 3MRBA 1S9YA 4HH8A 4FQHA 4MNHA 3RZWA 4AM0A 5A2KH 1AGDB 1XF5A 4EIGB 2H9GA 3WFHA 2G5BB 3MNVB 5HYSG 3MRPB 2VDLL 4ZS7L 1ZHNB 2VR4A 4JZNB 5I6XB 3GI8L 1U36A 1VEMA 4RMVA 1HQRA 1PG7H 2HH0L 4X6CE 3ARVA 4XGZA 4EXKA 4J3VA 1KCVL 5INCA 4QHUA 3PWJB 2DYPA 5IUSA 1H3XA 3PWPE 2VH5L 3EYSL 3OL2A 3STBA 3U7YH 4POYA 4J3WA 5C0BA 4Y16A 3JWDL 3UYPA 1P4IL 2BSRB 4B5EA 2IADB 4OLUL 4Y4KC 3PP4H 4K7PH 1CF8H 4LGSB 2H2PD 2XKNA 3GK8H 3QEGL 2Z93B 5GGSY 3IDXL 5J6HA 2CDFB 2CLRB 4JY5L 5FUZL 4PYGA 4PRDA 1LD9A 3AM8A 4G3YL 1A6WL 3DJ9A 3UZEA 3UBXG 3FJTA 5IMLB 4Y16D 5AG9A 4LHUG 3D0VA 4WHTA 4OM1L 4NO0A 3MO1A 5JA9A 4KTDH 1MFCL 4NPYA 4YDIL 1WK0A 5I30H 3BRGC 2E9WA 3N1QC 2EEDA 5HPOA 3I02A 1T3FB 1FFNB 3QP3A 2J12B 3RVUD 3MV7A 4GO6B 4PV8A 1UC6A 4GRWF 4F33B 2B4CC 5BO1L 1RU9H 4NQCA 3IJHB 3DGGB 1QD0A 1CFSA 5C0AE 2CJUL 1FGVL 2NY5L 3VWJB 4ORGB 2D31A 2AEPL 3HN3A 1IGTA 5CCKH 2FZ3A 4OB5L 4FNLH 5EU3A 3BEWA 5E8EA 2VLKE 3TIEA 3QWRA 3ZL4H 4NBZB 5F9DC 5HI4C 4U05A 3J7HA 4WFHE 4WW2A 4NO5B 3D9AL 4MD0B 3LEVH 3KNBB 2DI8A 5L6YL 1S9WA 1X5XA 4K3GA 4JY6A 1CL7H 2VITB 4PJ9D 1NAMA 3O41A 1RZ7H 1FE8L 5LGJB 3AMLA 3FN3A 1X7QB 3IXTA 1TJHH 4S1SH 4WHDA 4O5LH 5ESVA 4YWGH 1KJ3H 5EIIB 2HA1A 1OD7A 4ZXBD 1QRNE 2FLBT 3KJ4C 4OGXL 3N1PC 4O9HH 2ESVD 1U8IB 2D7TH 2VZVA 5K9JL 1L6XA 4CW1A 1MJUL 3PQYB 3BWUC 1JZ7A 2YUXA 1RZFL 3VFTB 4QRUA 2CLZB 2R23A 5FKAA 1AXSA 2BRRH 3L5XH 4QXTB 2R39A 3GSOA 4ZS6D 1RVFL 4J2XA 1CTNA 4LDEB 4OD1L 1BFVH 3FQNB 3O6LH 4JKWA 5DMKA 3NH7H 2H8PB 2DIBA 1NBVL 1FDLH 4PB9L 4WDIB 1MCRA 4K8RC 4HWUA 1KFAH 4HIHA 3AB0C 4JKPH 5FIEA 1SQ2N 1OWWA 4Y4KB 4J3OC 3MJ7B 4M1DL 4ODBD 5DJXB 4ZAKB 2D0GA 5ITBH 1Y18A 1T03L 1D5ZB 3PJSB 3FT2B 4XCFL 4RGNE 4G8FA 5B38B 4K8RH 4YGAB 3WN5C 4OTXL 1UM6L 1S9WB 2ITDA 1ZMYA 2LE9A 2X4TA 1JGLL 5HHNA 3SEPA 1TVDA 1YECH 5ITFB 3KPRD 1ZK9A 4Y2DA 1CS6A 3IS0X 3QCUH 3MLSH 3TBYA 1UENA 3MGOB 3CGTA 2RR3A 3G5XB 3VD3A 5JMRA 3FB8A 2X4QB 4ODVH 5MEOA 3DV4B 4YHZL 1JWMA 3QUYC 3MRJA 3C6LA 5JXEA 3KR3L 5FDYA 5EU6D 5FKAB 1JCKA 4QXGH 4ZPTB 3E1F1 3TIDB 4NIKB 4XP6H 2Q8AH 5GPRA 4J3XA 2DIJA 2HLAA 3IFLL 4DZBB 3KPRE 3X13A 3O4OC 1I1AA 2DM2A 3RWFA 3TN0B 4AL8L 1BBDL 1XF3B 5DJ0A 3Q5OA 3ISWA 2H2PC 3QWQB 1S7WB 4OI7A 1V3KA 4FQCH 3B3IB 4ODWA 3RA7H 5DJDA 5DQDH 2NR6D 3CMOH 3BEVA 3DRQA 4P5TC 3FB5B 3OKOA 2XICA 3TNMA 1JL8A 3OX8A 3LH2H 3SKMB 4EN3B 3OAZK 3RAJH 2KQNA 4NO5A 4UTAL 3HC0A 1QNZH 4B0MM 1CD1A 1ZV5A 3RVTC 1JWUA 3TA3C 2ESVA 3PWLB 5J89A 5L9DL 1F11A 1A1NA 4EDXA 3TVMA 1MCWW 4LLUB 4P23C 2G5RA 3TNNB 4Y16B 1OHQA 5I16A 3FMGL 4QHMA 1ZTXL 4RX4A 4P3DA 2AXFB 3DURB 4G8IB 3UTSD 1KT2A 5T5FL 4GG6F 1FFOB 4LRNL 1IFHL 3UJJL 3MRNB 4Z5RA 1OL0A 4W68A 1OVZA 1BBDH 4R26L 1KF9B 3P4LA 2PXYD 3FFCE 4RBPH 3BZ4B 4P2CG 4ZUSA 4FXGA 4KKNA 3MTRA 5DVLA 4MD5B 2KUTA 4YX2H 4G9DB 3KXFB 5LXGH 3O3EA 2DDQL 4I3SL 1DVFA 4GRWH 2UWEF 3MRGB 1C12A 1C8PA 4M8VA 1G9MC 1BX2A 5D6CB 4ODVL 4XH2B 1H8SA 2X41A 4HUUA 1FIGL 1RZFH 2PW1B 3MA7A 1OAUL 3U7WH 5IW6B 4HG4K 4O9HL 3MROA 4PJFF 5I1JL 4PRIE 3TYGL 2LU3A 4HFWA 4JRYA 3WIIL 3WXVH 2Z31D 4O5LL 5J11C 2AV7B 5AYQA 3TVMD 1MEXL 4JRWA 1DQML 1O5DT 3K4ZA 5CZXC 1OSZA 1K2DB 1MIML 2DD8H 5FO7A 3MR9B 4P3DB 8CGTA 4KVNH 2E6QA 2AERT 3LEVL 5E2VH 3BP6B 5ITBL 2VC2L 2V17L 1XAUA 1UWGL 1INDH 4YQXL 2YD6A 3ARGD 4Y5XB 4NPYB 3HE7A 1ZS8A 2V9QA 3X11B 5B39G 1YEJL 3FO9A 1IGMH 5IT2H 2YBRB 3K2UH 1HH6B 5LCVH 2NY5H 4Z7WF 5ICZB 1EV2E 5EC2A 1J5OL 2I07B 2JELL 3QUZC 3R0MA 4EKXA 3QIBA 4KK9C 1M7IB 1KJ2L 2XKNB 4MAUH 5T1DH 3WMSA 3LS5H 4MCZB 1BJ1J 2J6EH 3NGBC 1CZ8L 4L3AA 5I74B 4K7PY 1CXLA 1ZWIB 4PRBB 3TM6A 4CMHC 1EEQA 3RX8A 5BZDA 4RGMC 1QHPA 4YPGA 2FH8A 1Z9LA 5I1DB 1CLCA 3BHBA 3V6OA 3TZVC 3O2DA 3IETB 1I8LA 3NFNB 4TUOB 2AP2A 4YDIH 4AQOA 3QR2A 1KCUH 1RFDH 3CDGB 4UT6L 1B2WL 3KPMB 2F54E 2VXTH 4GQ9L 5GGTA 3MLYH 1U2CA 1BOGB 1GGTA 5BCAA 5C0JA 1RZJC 3HPJB 3ULVC 1B0GB 4LVOB 2P8PA 4X98B 4P59L 3IDXH 1FSKB 1IL1A 1LHZA 2MCPH 5C71A 4NQDA 5FO7B 5DJCA 1T7WA 4FQJL 5I1HL 2HKHH 3UO1H 5GGTH 3RWHB 3CU1A 4PJBB 4P2OC 1XGRA 1UB5B 5TE6H 5GGSA 3SDCA 3PXJA 1EO7A 1QSEE 4WNQB 3C5ZD 4LL9A 4ZPVA 5SWQB 2DQGL 1RJCA 1WZ1L 4KROC 1NPUA 1VFOA 3REVB 4JFHD 1CFQB 1RUPH 1FYTD 2AQ2A 1FZMA 32C2B 1SHMA 3GUTA 3PWNA 4NM4H 4FQIH 1VSCA 2SEBA 4XP1H 1YZZA 1ROWA 3P0YL 1MCOL 4U1MA 4WU7B 4WDIA 3HS0B 2I60H 1Q9OA 2Y23A 4U7SA 1LE9B 5J11B 2XG5A 5DQ9A 2WMPA 1I8MB 3VWJD 4H1LB 3O3BA 3O6FA 5GGRB 4LPVA 2YZ8A 2Y5EA 3STZA 1BAFH 4R9HA 4TTGA 1A6WH 3ZYOA 3BO8B 1A6PA 3RWJA 5FAAA 1PKQE 4DOHE 2H32H 5JNYA 1FC1A 5DT1L 3LSOA 5DSCA 3MXWH 2PYFA 4ZD3H 3BKCH 3FB7A 1NCUA 3DMMA 2IAMB 3A6BH 1SEQH 4JJHA 5F1IA 3U1SL 2HJLA 1PZUB 5L0QB 2YSSA 1DN0B 4TULH 3ZYIA 4MQ7A 1KNOB 1DQQB 4IIQA 3MLRL 1EGJH 4OAWA 4I2XE 1KJVA 4ZNEE 1LGVA 3W39A 4R3SA 4GS7C 1S7TB 5F3HB 2FJGA 1UB6A 3OKKB 5E8PB 4C56E 1GGIL 5J3HC 1F97A 3PP3K 4PJAA 4ONFH 4LEOA 4ZUSB 2FCBA 3UAJC 4JDVA 4ZS6C 1TTFA 3I6GB 4LSTL 5C0GA 4LIQH 2VB5A 4DUWA 4LP5A 1G7HB 3S98A 1HNGA 5IW1A 1FFOA 1PVHA 3HI6L 3K80A 3AU1B 1HQ4B 4KY1L 1FC2D 3KPLA 4MA3A 4ODSL 2GT9B 1HINL 3HTLX 4XMKL 5HYQA 2AXJA 1DUZB 3DGGA 2GJ6E 5MEQA 1F4XH 1UH2A 4DQOL 4FQQB 2R2HB 4YBHA 3GBNL 4XPHL 4PG9A 4HEPG 2X4PA 1EFQA 1LEGB 4RIRA 4HF5L 4AT6A 1NGZA 1T04B 4KMLB 3ES6A 2OR9H 1VADA 2R2CA 5D7KD 2AABL 3NCFB 4NM4L 1MWAA 3QIUD 1IGYA 3DO3A 4POZD 4PJ8A 1DEEA 1QA9B 3VXSA 3DV6B 3VGAB 3BJ91 3V8OA 4KKBC 1CT8B 2DQGH 4D9QE 1T1YB 2GEEA 3B5HA 1JIBA 1DQQA 4NRYB 4Z8FH 2EIEA 4QXUL 2JB6B 1BQHG 4HIIA 4G80B 5GS3A 4J7RA 2VRAA 3GNML 2IALB 4LASH 4PJHB 3BPNC 1A02N 4FHBD 1U8HB 5JLZA 5FGRA 1JWSB 4RMTA 5DJXA 4ZAKA 5JUEL 1HSAB 2RQ8A 2AI0L 1YQVH 4X7SH 5AZ2H 3VDBA 3CSYB 4BH8B 4HWZB 1WBXB 1GVIA 5KSAB 3DYPA 3KWWA 3GSVA 4O02L 3CFDB 4NHUB 4EUPG 4QCIA 4YHIA 1ZT4A 2XTJB 2OXGA 4CMMB 2LU4A 1J88A 5E8NA 1XGUA 4F7MA 2CDEB 3HR6A 4ZFGL 3MGTA 3D39A 2CDGB 3LAFA 2K9UA 3BFOA 4QRUB 4P46B 4X0KA 4KK8D 2AKRB 5D1XD 1NMBH 3QRGH 1EEUA 3SO3C 4J12A 1Z9OA 3T2QA 5DUML 1FG9C 4XVSH 5FOBB 1HHIA 1V05A 1IGJA 3O3DB 3TWCH 1XF4B 2CLVA 2BOCB 1T20B 5C0IB 2XN9E 2NXZD 3ZKMC 5IQ9B 4FQXC 3UTSA 3CZFB 2FECI 1F4HA 3L5JA 3L3IB 3UTTE 4XWGL 4OIBA 1LK2A 4X83A 3DVGA 1RI8A 1CDUA 3PNWA 5I66A 1PYWA 2AK4D 2WBKA 3S4SB 5GGQL 1BVLA 4NCDA 3DNKA 3T77A 3VXOA 4ENED 1TQBB 1JZ6A 3VFNA 4PJ7E 1GGCH 1T1XA 4UDUB 3FO9B 1P9MC 2J1KA 3TIEB 4KUCD 4GLRH 3O9WD 2XN9D 1UWXK 1RUKL 5EU3B 2P8PB 3BT2L 1A22B 2EKJA 4WI4A 5GS0D 4MA7L 4PRHB 1RK0A 3WHE1 3ULVD 2EZ0D 4Z7NF 3L5WA 4XAWH 1GL4B 3B9KD 4QRSB 3TBWA 1CIDA 1ZLWH 4KKCD 3QNZA 4CNIA 2N1KA 4G6FB 1RZJL 4PGEA 3MODL 1KIQB 2AJUH 3VFOA 4KK5D 2E9BA 1K6QL 2QHRH 4HUWA 3DVNA 3VXPB 2WP3O 4I0PB 1ZLUH 3D69B 2IAMD 4P9ML 4ODTL 4UINL 2OK0H 3BMWA 3H9YA 1MUJA 3BE1L 3OG6B 2F5BL 2VLJE 1N26A 3N9GH 1HZHH 5F7YC 4Y5YC 2VAJA 3BUYB 3VXQB 3KPSB 1JHLL 4KDTA 1PKQB 1DVFC 5FUCE 1EJOL 2OM5A 4GBXB 4NWUL 5EO1A 5IROC 5E2UL 5F70A 4NP4L 3BZEB 5GRJL 3VWKC 4NQCB 1RUML 3V6BR 1MFEH 4FP8L 1SJHB 1OSZB 5CFHA 4NCC2 5ALBH 1VGKA 3ARGB 1Q0YH 2AEQL 5K33A 3LN5A 1EA9C 2QBWA 1ZVSA 2OMNA 5E9DB 4BH8A 4XTRD 2ATKB 1A14H 3S96B 5GIRA 2AV7A 3T4AA 1HSAA 4S10A 4APQB 3H7BA 4JFQB 4GKSB 4KK6C 1VFAB 1Y6MR 3CCHB 3TESA 4NO0B 1OAKL 2GK0A 4M6ML 1NGPL 1QRNA 3VRIB 4LPYA 5J4MA 4M62H 5E70A 2XWJA 3CFEA 1INQA 4FP8H 5D2NE 5A2FA 1BPVA 1AR2A 1EIBA 1ZS8B 3CMGA 5DRNA 3HE7C 2NYYD 1CLZH 5IB3B 4KJPD 4L9LA 1UZ6F 5CS7A 4NN7B 4AL8H 3SE3C 2GSIA 5I6XC 1S7RA 1RUAH 4H0IA 3L95A 1RJLA 5LBSL 3N9GL 3V5HB 1AGEA 5HY9B 4K7PX 5KG9B 3IDMB 3HZMA 1XZ0B 4GKZA 2HRLA 4IJ3B 2VISA 5HVHB 4YE4L 3FRPG 4GBXA 3H42H 3HMXA 3JV4A 5KSAD 3QBTB 2AAVA 5HHXL 3BGMB 3U7AA 4QYOA 1HYSD 3V7MA 3JTTA 1W0VB 5DRZB 4NRYA 1JWUB 4R96A 1XCQB 3I6GA 1WWAX 2A74B 5A16B 4PJFA 2NY4D 3JSSA 3QUXD 3OR7A 1G6RL 1OTSD 1QRKA 2DMCA 5D1QC 4XCFH 1F8TH 1KJVB 4UV7L 1TTGA 5E00B 4XCCH 4HKBB 1UXSA 2YC1A 4UV4L 2VLRD 4NJ9H 1GGCL 1FVDA 3KVQA 3SGEH 4TPRL 2DLHA 4CNIB 5DVMA 1V7NH 4P2OA 5HYSA 3VRJA 4G8IA 5C0DA 5HHPA 4C59B 2Z8RA 3SDCC 2OTWB 4PJ5D 3KAAA 4TQEL 4UAOC 4YK4C 4URTB 4HK3J 4KU1A 3X14A 5I8CA 1I8IB 3QXTA 4GS7B 3FT3B 1G0DA 1OM3H 4N0YL 3S36X 3L5XL 3BPNB 4IDLA 1IEAB 4P2RE 1CXIA 3WIFA 3QI9A 2YD2A 3EAKA 4XMPH 2X1QA 1QBBA 5CP3A 4YBQC 4XHJD 1W72A 3QPQC 4L3EB 5IVXB 3OBAA 3BRDA 5HGDB 1UA6H 3HAEH 4OGZA 5I73C 5DJZB 1CXKA 4OF0A 3KPSE 1CR9H 4NNYA 1VENA 2QSVA 1D5ZA 3BXNB 5C09D 2YA1A 4X6CF 3L7FB 2D03L 3VFUB 5GJTL 3R1GH 2DRUA 3BPOB 1VACB 4K3EH 1RZ8B 3RVWC 2VDNL 1SM3H 2QADD 3E0GA 2V2TA 1ADQA 3F8UB 5LWYH 4MA8L 4D8PB 3QJFB 1WWWX 3DETD 4H1LH 5CJXA 1L6ZA 1ZLVH 2CJUH 4KRLB 3FT3A 5ISZE 5I74C 5DJAA 4XCYA 1MY7A 4NJAL 3MC0A 4EI5C 3QHFL 1G9NL 4JRXD 5EPMB 3ILPB 4MQSB 4XI5C 5FYJL 2X70B 2GW5A 2YR3A 12E8L 1QLRB 4GRLB 1TJGH 4JFED 4TUJB 5ICYB 1QKZL 2X4UB 3RWGA 5D4QA 2LQRA 1CDHA 4LSQL 5B3JF 4ZO8A 1J8HE 3ET9F 2HTKD 4DQOH 2GUOA 4NQSA 5L8KB 4K23H 3HNSL 3LS4H 2DLFL 1FLRL 3GSQB 1C1EH 1H0DB 2EDKA 1NGYA 2W9DL 3SJVE 3CXHK 1DJSA 5KSBE 4NQXA 3ZTJG 2EH7H 3MRKA 5D7SL 1OLLA 3MV9D 4RRPG 2VISB 1U8MA 3UTOA 4XP9L 1S7VB 2RGSA 3QDAA 4FQQA 2R56H 5FK9B 1CI5A 4Q0XH 3TZVD 2LTQB 3B8SA 4TQEH 4WIQA 2XTJE 5DK2B 1E4XH 5D7SH 2NXZC 4XVUC 4LVHB 5I1AB 1MCPH 4WO4A 5IBUB 4ZD3L 1AO7D 2AQ1A 3QCVH 2Q3AA 3D0VB 4WHTB 4QWWD 5GGVH 4XCCL 2VDRH 5BJTA 4PR5B 4N0CC 4N90D 2A9NH 2VE6B 4X99B 1LEKA 1FNHA 1H15A 3OXSA 1U3JA 5FFLA 4WI5A 4KGJA 1MH5A 4KWUA 1GXEA 4G6FD 5FM4A 1A1MA 3C2AL 5J7CC 5CSBA 1U8KA 1KLFA 1FVEA 3EDKA 3ULUL 3VXSE 2C3HA 4Y88A 1OD9A 5HHVH 2BVQA 1P4BL 3MV8D 4AZ8A 5INCB 4BSJA 1ORSB 5ACLA 2VWEC 1YEEL 5J0BA 1MCBA 1SBBA 4M5YL 4JKMA 4G43A 2IANE 1IILE 2APXA 1VPOH 4UILH 1SVZA 1R3IL 2DQUL 5F7MC 3GMRA 3IDNB 3LKNA 4IS6A 1F4YL 4HS3A 3MV8E 3HZKA 5ICXB 4HT1H 2FRGP 5EU7E 1E4JA 3VI4E 2APWA 1CD1B 4HS6B 1BQLH 4U1HA 5JOPD 2X10A 2P8LB 3HFML 5BS0A 4PJHE 3QDJB 4Z0XB 1IM9B 1JYVA 2CLRA 2EDXA 4P4KC 4KTEL 1Z5LA 4WJ5A 1DBKH 3MLUH 1DQDL 1LK2B 5IBTL 1CR9L 5GRVK 1B2WH 4M6MH 4I5BB 4LDOB 1WFUA 2D2OA 1LNUA 2OR7A 2VYRE 4M43L 1IEHA 2F58L 2C1OA 5EBLB 2C5DC 1KPUB 3QUXA 4LSDA 1G7IB 5DJ8B 3UPRB 1ORQA 5FCUL 1N59A 3DX6A 2X05A 3F58L 4EUPA 5F71A 5HPMA 1HIMH 5EPMA 2J6EL 3KLSA 2ZZUT 3ALPA 4JRYE 1FNGB 3CXDH 5IIEA 1MFEL 1RIUL 4LSSL 5E2UH 4JFYA 6CGTA 4JHWL 2JJWA 5T3ZL 4L8CB 1H3PL 3MRFA 1T1ZB 3GSXB 4PJ7A 5LCVL 3KDMA 3TCXA 3IETA 3K8KA 4RWYH 4UNVA 1A7RL 3FHAA 1I9RL 5CEZH 3TNMB 1NEZG 1ZT7A 4JN2B 2MKLC 1QQDA 5HYFA 4HWZA 2DWDB 3LEXA 2QV2A 5K9KB 5E03A 1LDPH 1VGEH 4R7NB 1AFVH 3HKFA 4DGVH 5DA4A 4KI5C 5FV1L 5E2VL 4N0UB 1H3UA 3GMOB 4ODTH 4UINH 4UV7H 5I1EL 1LQSR 2XZAH 3MLTB 3NA4A 4LKXB 2EXYD 1CGUA 4KDWA 2JTDA 4GW5A 4R0LC 1KLGA 4LLYA 1DQMH 2RCSL 3RJQB 4CGTA 1QSEA 4QY8A 1N64L 3OZ9L 3FCTA 3RJDA 1J86A 5E5UB 5KSVB 5BQ7A 1EVTC 3WIIH 3WXVL 4U6XA 5E6IB 1FP5A 1QSFA 1E6OH 1U8OA 4JM2C 3VJ6B 3FB8B 3QUKB 2A73A 5DI8A 4PY8J 1KSRA 4PJAE 3RZCA 4HGWB 1FNSH 4LFHD 3VXNA 4PJEA 4BFGA 1ITBB 3QYCA 1OLZA 3KPRA 1U42A 3W9EA 2Z4QB 3FFDB 2A9MH 1WITA 1XCTB 4XCEA 5GGQH 2R1WB 3QUMH 2FD6L 4DVRL 3VXTA 1LVEA 1H3PH 4ERSL 2JIXA 1OQXA 3G6DL 3F7RA 5IVXE 2ZSWB 4JO2L 3IAQA 5D7LB 3W9DA 4GBXC 1BEYL 3JWOL 1HIML 2CK2A 4LRIA 3D3VE 5SX4H 3KPNB 1RZGB 3C60A 1MCWM 1BFTA 2NTFA 1HOCB 3VD4A 2DQEH 5M94B 1EZVY 4HS6A 4JJ5B 4PJEE 4M1CC 3MRQB 4KC3B 2R2EB 3V9FA 3VXME 2DBLH 4OUOA 2Q6WB 1URLA 1G7MA 4POZC 4P99A 3RGHA 3H6JA 3WV0A 4K94H 3NIDE 3MYJA 2CKBH 5KSBB 4FQXA 1XF2B 3NAAH 3AVEA 3MBED 1OF2B 3D2UB 2AI0H 3T0XA 2ZOLB 2X1OA 1NANH 2OTUB 3ZTNH 4NN6B 3TT3L 4BQCA 3MRMA 2ZCLL 5EO1B 1CGYA 3N85H 1T1WA 1I3RB 4G9FD 1FZOA 2Q8AL 4LARH 5CBEB 4OLXL 1NFIA 1NUFA 5BV7H 4LHUB 1T7XA 1RULL 3IDJB 2Z8VC 3A67H 1NC2B 4OCXL 2XA8H 4KKAC 1YEEH 4P2OD 3HE6D 3QNYA 2NW2B 1KNOA 4JRXA 5F88B 4JB9H 3ES6B 2IC2A 3F5WB 1B6DA 1IGTB 2IF7A 3MREB 3U6RB 1ZA6A 3DSFH 3VGGA 4N5ED 3W0WA 3S37L 4NUGL 5CJBA 1OT2A 4GKSA 3VMPA 2X42A 2B1AH 4LVEA 5E8DH 5ESAB 1NBYA 3T4AB 1WZMA 1JI1A 3VD5A 1I3GH 1TENA 4AH2A 5IOPA 3PWJA 4BQ8A 1U93B 2NY3C 3MCLL 4GG6A 4MQTB 3E6FA 4RFNB 4ZDHA 4XNZC 2BNUB 4HZLB 1XGQA 4R2GB 5H94A 2DQJH 1T03H 4PJCF 1HNFA 3BAEH 1NFKA 3B5TA 4P2QE 5DRXA 3HI6H 2B4CH 2IQ9H 4MS8C 3WNMA 2AK1H 3U2SB 1WWBX 4JKPL 5E6IA 4PJ5E 4OBRA 2OTPA 1DSFL 4XCNA 1FZMB 5DTFB 5GS1C 4HH9A 1E4XL 1U95A 2R1YA 4PJDB 4JZJC 4ONFL 4PJGB 4PJXB 5FYLD 1BLNA 2IPTH 3VI3F 4CKVX 4GW5B 4ODXA 5IROA 4XBEH 4QHNB 4JDZA 1N3NB 1Q9WB 4JVPA 1AJ7L 3RIAF 4BELD 2MQ3A 3FN9A 3B2UC 3SOBL 3LSOB 4PRIB 5JPNA 4LFHG 3U1SH 3TLRA 5ILTL 5DC4B 2BFVL 1TITA 1S3KH 5MEPA 5IFJB 1NEZB 4NRXA 4PJ8D 1LP9E 3QEQA 3WUWB 1IC7H 2A1WL 3QAZC 4PJXE 4PJGE 5GGUA 4JKKA 4ZOCA 4OCWH 5D2NB 5J13C 3U46B 3SKOB 5L6YH 1XIWD 4EQ3A 1OSPL 1TZIB 1CLYH 2ZUSA 4A6YB 4G43B 4JG1H 3PWNB 4JZOB 3ZT6A 5IVOA 2H3NB 3CFDA 1A6AA 4Z7WA 3FQXA 3G5ZA 5DD6B 4WRLA 1KPUA 3WJJA 5D1ZD 5ENWA 12E8H 4N1CA 5ISZA 4ZPVB 5E2TL 3NFSH 3GNMH 3UBXI 1EUTA 1I7UB 2NY6B 4E42A 4HD9A 4HUWB 1JK8A 4HFWB 4Y5VC 3SDAC 1D7FA 4JDZB 1KIPB 2QR0B 5JW4N 2A0LC 3LD8C 3QUMA 1Q9WA 3EHBD 1NLDH 4L4VD 2F19H 3MUGB 2GCYB 4WI3A 2Q76A 3O3DA 3PV6B 4A6YH 3NFSL 1IAIL 3AMKA 5GGTL 2CIKA 2IG2L 1DBAL 4BYHA 1N0XL 5F9OH 4KAQH 5HGDA 3EGSB 4DWHA 5BJTB 3PQYD 2Q7YA 3BD3A 4LHUA 2FZ3B 3MQIA 1NMCB 3L6FA 2H1PH 1MFCH 5KAQG 4MX7A 1VADB 4RFOL 2EDOA 4OCWL 2KH2B 1T7VA 3QEQB 4WTZA 4XP5H 5T33L 4PGCB 2NY2C 3KHOA 4IMLA 4ZO6A 5IKCA 3F62A 3F7VB 1PSKH 4LKCA 5I75C 4A2LA 2VQ1B 5FUZH 3I84A 1UA6L 3WLWC 3L7EA 3MBEC 3ARDB 4OCYH 4DCQA 4IHOB 3GJEA 5F21B 3BP7B 4IM8A 4XX1G 1MQ8A 1C16A 4RQQB 1F11B 1R5IB 1TXKA 5DRWA 3IS1X 3PGDA 4FZEH 4YH6A 3MRHA 2B1HL 1RIHL 2CUIA 4JR9L 5TH2A 1PG7W 1DBML 4N0YH 2HH0H 3VXMB 1YY8A 1U8LA 1MREH 4I2XA 4QTIL 2DMKA 4ZS7H 2H32B 4JPIB 2VDLH 1TPXC 4FXGB 1E4KA 1H3GA 3S35H 2WINA 4FFWD 3WS6A 1IAIM 3FTGB 1OB1B 1CICC 5DMIH 3BSZH 5I71C 3X3FL 2YHGA 3RP1A 1LO3L 3AROA 4ZXBB 1EO8L 4P4RB 3BAEL 4F2MA 2ZKHL 3VU2A 4EDWH 3HE6B 3LKOA 5C07B 4XNUH 5JNYB 1JNHB 2G9HA 4HSQA 4PPTA 4G6JL 2F15A 2WSKA 3KPRB 1M6OB 2ZSVA 1MRFL 5T3ZD 2EKSA 1WFTA 4HPYH 2GY5A 3NN8B 1EBAA 4NQVB 1U58B 3DETC 5DD5L 1A6VL 2VL5B 4HGKC 4PRPD 3CFIC 3HUJE 1UWEH 4LSUL 4WUKL 3H42L 1N5AB 4GW4B 3STLB 4Q97A 2BRQA 2QSCL 4PJAB 4QRRA 4MJIA 3RVUC 5MP6L 3MRRB 4YXLH 3RWCB 4ZAKD 2ADJB 5HDBF 3MCKA 4FTVE 4PLJD 4I3SH 1RJYB 4KZDH 1F6LL 5BV7L 1XR9A 4OLXH 1CL7I 2VXSH 7FABL 4WNQA 4Q6IA 4JO4H 1ETZB 2GJZA 3SKJL 3DHMA 3X13B 1EGJA 5GQBA 3AGVA 1QLRA 4LNRB 3VGFA 4APQA 4OI9A 4XNMA 4RMQA 4O4YH 1T83C 2MHAB 5F1SA 2PYFB 4F2MB 2FEDD 3H8NA 3U9UB 1G7PA 3QCTL 4ZXBA 4UIKH 2Y25A 1NCDL 1L4IA 2Z31A 3FTGA 2ZUTA 3QI9B 1Q0XH 2OL3H 1UT9A 2ESVE 1A9BA 1U8OB 2NW3A 1BGXL 4OSUL 4Q58C 3C6SA 4DTGH 4LP4A 4MAYB 5HPMB 1S7TA 3RIFK 4MD4B 3CPLB 4DFIA 5C86A 3WNNA 1S7XB 3GGWB 4NZUL 1P69B 3BUYA 5EUKB 4Z7VA 3UTSE 3QZWB 3TO2B 1GZQB 1JPGB 2V5TA 4EZMA 1I3VA 4TVSa 5L2KA 1UQSB 4NC1E 1DN0A 4LNVA 2VDMH 4LPCA 3V8CA 1QFOA 3WHXB 2FATL 2DBJA 4JO2H 4NZDA 3RGVA 4MLIA 3WLBA 1QEWB 2EYTB 1ZLVK 1J18A 1Q9LA 1WSST 4R7NA 5GS2H 1IGML 5IT2L 4QWWC 4MJ2A 3KPOB 2AJXH 4KKLD 5BVJB 4PTTB 1FRGH 3EOTL 5JXAL 5DEGA 3OJMB 3V4VH 4QXGL 2FGWH 2H3NA 3HPLA 4JZOA 4QRTB 4XZUB 2ERJB 1Q9OB 4OBSA 5I8CB 4AY0A 5EG6C 2DD8L 4Y7MA 2GJ6D 2R4SH 2RAMA 3SDXA 1P6AB 32C2A 4X9HA 4KRMB 1DUYA 4TSBH 1G1CA 3CVHH 5DJYA 3ROLA 2BSSB 4ONHA 3G5VA 1G7IA 3QUMB 2DJ4A 3JXAA 1CBVH 1A1OA 5C9JA 5EOQL 2DTML 4I5BA 1RJLB 2QADB 1DANT 1NEUA 5I17B 4D0CA 2YN5A 1NBZA 1WIUA 1F6AB 4NKIL 1YY9D 1HHHA 3HUJA 3NIFF 2P49B 4DUXA 3F7YB 3GSUA 1MSPA 1N3NA 1X5FA 3T8XA 5HVGB 1NJ9A 5F89A 35C8L 1X5IA 1BX2B 3KDMB 3MV9B 4FABL 3MACH 4OLYL 3LKRB 2A77H 3SKOA 5D9SA 3IGAA 4NN5B 4OLYH 4UT9H 2Z93A 3D39B 5T3ZH 4BUHA 1IFHH 3UJJH 1WUNT 3BKJH 3VGEA 3QDMD 1EAJA 35C8H 4EN3C 5D5MB 5AD0A 2Y36L 1M05A 2EE3A 5AZEH 3ORJA 5IGXH 1LE5A 2BNUA 2Z91A 5HDOA 3VG0L 1J1XL 1GZPB 4MA1C 3QFJA 1M05B 1OB1A 4Z7VE 4GLRI 3P4NA 3QUXC 2H2SD 3A6CL 4LVNB 5J9PB 2P5EB 1K4CA 3SCMD 3PL6D 2G2RA 1IM9A 4Y2DC 2FJHA 1A1MB 1WEJH 2Z9TA 1REIA 3IFPB 3MLUL 3TV3H 2R4SL 3T2PA 1ZLSL 4YHML 3Q48A 5E4EC 3GRWA 3VFGL 3IJSB 5D2LE 4YDKH 2QSQA 5C92A 3OF6A 4W6WB 5DQDL 3CLEL 4QTHB 5SWSD 2EIZB 3P4OA 1MQKL 3K81A 3RA7L 2IGFH 2GUOB 3IRZA 1PLGL 3LN4B 3O3EB 1MVUB 1MWAB 3O6FD 4G8EA 3EOTH 3QXUA 5E5RB 3VWJA 3ECBA 1U8NA 3LVEA 4FNLL 4H5SB 5H8DA 3QG7L 2C4FU 3C5ZC 1MCHA 4XP6L 3IXAB 1BFOA 4JFDD 5T3XD 1QBMH 2WM0A 2X4UA 5C0EB 4XGZB 2H26A 2IH1A 2A6JB 3V6ZA 5D1ZC 4YXLL 2X5PA 1NCBL 5GZNC 2FATH 1U8MB 3OR6A 3MLZL 2VABB 4MCYA 5TE7L 5B39A 1I4FA 4XCYB 4R6UA 1DQJB 3IF1B 2NMSA 1QSVA 4OCRH 4KMQA 5ELIA 1U8QA 3GSQA 3V6FA 3SPVB 5EU4B 1WTLA 4WW1B 1NL0H 3T0ED 1CE6A 1C12B 4K8RL 2EDHA 3MNZA 4L4VB 2R0LH 3TVMC 5IP4A 1F4XL 2A2QT 5JQHC 1KXVC 4JRYD 2PYEB 4RNRB 1HINH 1MRCH 3VFOB 4W4NA 5EOTB 5C9JB 3QCVL 1LILA 1S5HA 4PJ9C 1FN4B 1XF4A 2CLVB 4R7DB 2G60H 2FGZA 3KYOB 3V4UH 3T0EE 4WTXA 5KW9L 4GAYB 4HIXL 4ELMF 1U92A 4XAKE 4DZ8A 3SKJH 3AFLA 5E6YA 1L0QA 1MREL 3OJVC 4Q74A 4Z0BL 4DKAA 3RDTC 5FXCH 4N8VA 5B3JE 4YC2B 2Y5TA 5CJOH 3MRPA 1W72B 5DFWH 1Q1JH 1KB5A 1TPXB 1YPZA 2I25N 2IMMA 5DYOA 1JE6A 2XV6B 1CXEA 4XNQA 2BY1A 1B0WA 2R8SL 1NEZA 2CRIA 1JYWA 3BMVA 4NYLA 1AI1L 4PTTA 1MRDL 1JF1A 3UP1A 4CRPA 3C60B 4YAQA 4HS8L 4OZ4A 3WFDH 3QIBD 2EECA 2NX5D 1A6VH 4OCYL 2GIYA 5ITFA 2QQNH 1OGAE 3SGEI 1FLRH 1KJ3L 5HYIA 2E6PA 1IRAY 4GH7B 2Z8SA 4JQXA 2ZG1A 4D9QD 1YEIL 3ARBD 3OKNA 4PJIF 1MWAH 1EAPB 5ADOL 3B9AA 3WDHA 3OB0K 4WHYG 1CL7L 5B3NA 4P3WA 1LP9B 3OG4B 5DJYB 1RD6A 4HUXA 2I60L 1UB5A 15C8H 3PV7A 1LO3H 1OAYH 3X3FH 1I1AC 5KS9E 2X1XR 3C6SB 3KNBA 5CMAB 4QT5A 5E8NB 1VA9A 3OKMA 1YA5A 2NX5B 1IGYB 4PJEB 2XA3A 3WIFB 3BPOC 2Q7NA 4JPKH 2DM4A 2DQHH 3ELAT 3WO4B 3DWTA 4R2GD 3HAEA 4NGHL 5A3ID 3U4EB 3B2VH 1B0GA 4BFEA 3LQMA 1NANI 2NX5A 1ZE3C 2QHLA 3LCYA 3OKMB 2E7LC 4LCCA 2NY6C 1B4JL 1E4KC 5LWYL 1HK6A 4K94C 1FCGA 5E2TH 4UOW1 4FZEL 3FZUD 4IOFD 1GC1L 2FSEB 3FONB 3QUYD 4EI5B 1S7UB 4LSVH 5IB4A 5I0ZA 4OIIH 4HBCH 2YC1B 5GJTH 4HJ0C 3TZVA 3VW3L 5JDSA 3FQWA 5JW5B 2OYPA 2WWKO 2C4XA 3QNYB 3RVXC 2WBJB 5T33H 1KIRA 1OGTA 1QTYT 3LRHA 4WUUD 4UT6H 2ZG3A 3EYUH 2F8XC 3C8KB 2ICWJ 1J05A 1MCSA 4U1IA 5F72S 1PGRB 4RZCB 3BGFC 4K55A 4HBCL 2ZCHH 5IMMA 2NNAA 1EXUA 4OF3A 5H37G 3JWDH 3PL6B 3SOBH 3GMQA 4QRPA 4FTVA 4Y5XA 2R23B 1NSNL 3VFTA 2FJFA 1I4FB 3A0OA 5E99H 2A6IB 3VGAC 4HK0A 4YEEA 1Y6NR 5ID0A 2LABA 4V1DB 2CSPA 4Q6IC 5CSGA 1LO0L 2IPTL 1YYLL 4RBPK 1T0MB 3MRQA 4JPKL 5DD1L 3AB0B 5D7KE 3G04B 4H1LA 5TFSL 2DQCH 1V7NL 5CGTA 3GFUA 1DLFL 1OAYL 4FA8A 15C8L 5D9SB 4D3CH 3BDYH 1ZSDA 2V17H 3ULVE 3TPKA 3LN9A 3AS1A 4HUMB 1DBJH 1U6AH 1ZVHA 4Z77A 4RRPA 1XCQA 1R5VB 4HIEA 3JTTB 4KJWC 3RKDD 2C1PA 3FO0L 3BZDA 4WV1B 3OJ2C 2D31B 5C2BL 3O45A 3GJEB 5EIQA 3OF6D 5F9JB 1NCCH 5TJWK 1PX4A 1X6LA 3DSFL 3OB8A 4MXWL 2BFVH 3U30B 2PKDA 3CSBA 3VFWA 5M95B 4HS8H 3F7VA 3ESVF 3S96A 4FTVD 1IM9D 1CDYA 5JHDA 5D7LE 2VL4A 3IDGB 4K3HA 1FIGH 3MRLB 2Q86A 4Y1AB 4HUVB 4BQ9A 3Q2CA 1AJ7H 4MMZC 1AXTL 1MFBL 1RULH 4LVHC 1T7ZA 4LARL 4KROB 4Z0BH 3G9VA 3HS0A 2BHYA 1A1NB 4EDXB 4GKNB 3Q5TA 2YEZB 4XPAH 1PKQA 2GHWB 1AD0A 3UYOD 4RGNB 3VFSB 3ESUF 1YMMA 1PX3A 3SDDC 1UM4L 4YDJB 3ULSA 5D7IE 3E8UL 4M61B 3U0WL 4L8BB 3TFKC 1TETH 4LPWA 4TOYL 4X6BB 5JW3H 2G75A 3KYAA 3TH2T 1HWGB 3ZDZE 1RQ5A 1P7KB 4IRJA 1E0OB 1S7WA 2ED8A 5E9DA 1I3GL 4Z76A 1ZT7B 5HGGS 2XTLA 1IL1B 2YPVH 2OLDA 4NUGH 4LQFL 1J9CT 4JDTH 1WVZA 3LKPB 4PREB 4Y4HA 4GJTB 1ZKAA 3ARFB 1NCBH 4M8QB 4B53A 3O2WL 1BF8A 2NXYB 4FQCL 1J0IA 5DWUL 1TVBA 1L0YA 1ZAGA 3VFNB 5GS1B 1I3UA 5C07D 3MYZA 5E6ID 5EC1A 3HG1A 1RZ8A 1WBXA 4PY7A 4HXBL 1W8NA 3L3DB 3WS3A 3MOAH 3ZTNL 3QDGB 1KIPA 4C56D 4HUXB 3CZFA 4IRZH 5F3BB 4U1SB 1L7IL 3HCVB 4JFEB 4X4XB 2W0FB 4C4KT 3ARFD 5F8RC 1ACZA 1D6EA 3TV3L 3OGCA 2ORBH 5DD0L 3MRGA 4WWKB 1BECA 5TQ2L 3N50A 1ZSDB 4Y16C 3PGFL 5FEBA 4OTXH 4NO2A 3I3EA 1P7QA 5J1SC 2RCSH 4B50A 4MXVF 2VL5A 3OHXB 2XKUA 4QXWA 4GXUN 4ZTOH 3QDJE 2BVOB 3TBVA 4MS8D 2EDYA 4O2CA 2BVPA 3RU8L 1JZ4A 3KLHC 1D5XB 4LCUB 4NQUA 4NQEA 4DGVL 4MWFB 3RGVD 1NH6A 4YHLL 3S4SA 2DAVA 1QLFA 4Y0GA 3VWJC 1DQLL 5IMKB 1IGCL 1QEWA 2HTKC 3QUML 5DJ2B 5C08E 3RY5A 3VRJB 2ZJSL 1PEZA 5JLZB 1NCAH 1NGWA 4IDJH 4E41E 1Q9KB 2ITCB 2J4WL 4IRSD 4LSSH 1UYWL 3MNWB 5DO2D 3B2UD 1D5IH 4MZ2A 3MZGB 3TWCL 4U1IB 4JY6B 1RZGA 2ZP0T 2E9JA 1M4KA 4L1HA 3NZHL 4DKEH 1WV7T 4R8WH 5KOMC 3U2SA 4L5FH 4P5KA 3S34H 1T04A 1AGFA 3R4DA 2XWBA 3MRHB 3RQ3A 4MSWA 5KJRL 1ZXQA 5CUSL 4OLVH 3KPQB 4GG8A 5FGCB 5C09B 3BUTA 3OZ9H 1NGZB 4YUEL 2E6JA 5E9DD 3WSQL 4JG0L 1XH3B 1QSZA 3D1MC 4KTEH 1BREA 1YN6B 2XNAA 1KUMA 2CPCA 3SJVB 3OAUL 2AQ3A 5IKCB 1A2YA 3QIUB 3OKLA 3W0WB 1A6TA 1VFBB 1ZGLP 4MNQD 1LO2L 1ODAA 4OZIA 4WFFD 3ROOA 2BVOA 2ZUVA 4HXBH 4LLVB 3SGJC 5HDQL 4HX1B 3SKNA 3MCKB 4LLDB 1LO5B 4OLZH 5L2JB 4Y2DD 2A0LD 3QXVA 2DQUH 3UTQB 2HJFA 4QRRB 2AJSH 3BEVB 4G7YL 1RZKH 4L8SA 5BO1H 1PDKA 3ZTJH 4LCIL 1NFDE 5D93C 1Q9KA 1CFQA 2ITCA 4HCRL 3VXMA 1TQCC 5EUOB 1MVFA 5FO9B 1NGWB 2DQIL 1WBZB 4M6NL 3ULUC 2AVGA 2QKIA 2AABH 2L7JA 1QFWM 1D5MA 4IRSB 4QF1B 1MHHA 3GI9H 2EYRA 2X70A 4YHPA 1HH9A 5ISZB 2NY2D 1Q38A 1K8DA 3KYNB 2VN7A 1FO0H 1A3LH 2J8UB 4XPHH