2RCSH

Immunoglobulin 48g7 germline fab-affinity maturation of an esterolytic antibody
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
217
structure length
217
Chain Sequence
QVQLQQSGAELVKPGASVKLSCTASGFNIKDTYMHWVKQRPEQGLEWIGRIDPANGNTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCASYYGIYWGQGTTLTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Germline antibody
molecule keywords IMMUNOGLOBULIN 48G7 GERMLINE FAB
publication title Structural insights into the evolution of an antibody combining site.
pubmed doi rcsb
source organism Mus musculus
total genus 45
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 1997-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2rcsH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2rcsH02
1BZ9A 1DBMH 5EUOB 1M7IB 1XH3B 1KYOJ 3GJFK 3OAZH 3DMMB 1F45A 2MQCA 4LPUA 3VGFA 1ZWIB 1L6ZA 2IEPA 2JJSC 4RGOL 2CGRH 2C3HA 2VABA 4L4TA 1UA6H 4M1DL 5C08D 3B6SB 2XA8H 2C3VA 5A2IH 5DWUH 3GJFA 4NNYA 2APXA 3HC0A 1FO0L 4FXLA 4MD5B 2GJ6B 4PJ9B 1AHWC 5IROA 2BSRA 1TQCB 4NZTH 3FO9A 4R8WL 2HFGH 4NHCL 4CVXA 2AXGA 1MFNA 4OTXL 3ZKXC 1PQZA 1J0IA 1OAYH 2D9QB 2DYPB 2FH6A 1RZJH 3ME0A 5HHME 4KROD 5IGXH 4MJ5A 1A3RL 3BGAA 5E24E 3QCVL 3FCTA 1C12B 2HN7B 1AGBA 3P4MB 3HS0A 5T3XL 3IJYA 4WI8A 2R2EA 1A22B 4WWKC 1HINH 2P8PB 3H7LA 4QNPE 4D9QE 1OAZH 4TSBH 2RJMA 2QQKH 1FVEB 2J8HA 3D39E 4DZ8A 3DRTB 2VXVH 2DQUL 1QA9B 1DQMH 3IETA 2EDDA 2W38A 5I75C 3P4NB 3ARTA 4M6MH 3BP7A 1FL3B 4FZEL 4HX1A 2ENSA 4N0RA 1GSMA 1PKQB 3PE9A 4N1EA 1E4WH 1BM3H 4GJTB 5C07D 4P59L 3T0EE 3GZKA 5D5MF 2Q6WB 2HFFA 3ARVA 3G08A 3VI4F 3MRIA 1BVZA 4Z7UF 1UXWB 4OV5A 4YK4B 1OTTC 4FXGB 5AWNL 2ZUXA 4QXWA 5SWSB 5I6XB 1C1EL 2DLTA 4DW2L 4U3CA 4XTRC 4OIIH 2B7DT 4X6CF 4NWTL 3HE7B 3FFCD 3ZKNC 3I6LE 3FOMA 3MRQA 3VE0B 3G6DL 3PL6B 1JPSL 1F13A 3VXNA 4X4MA 4NBXB 1XGPB 1YYML 2Y06L 1J05B 2LV4A 3BP4A 3D3VE 2NCMA 4WHDA 5DZLA 5DUML 1TENA 3MROB 4LLYB 2Z8SA 4OGYL 2VWEC 3I3EA 2PR4H 2PTUA 5MEQB 4TYUA 5HYJA 1R3KA 3KHOA 1X6NA 2ZUYA 3B9VA 3CXHK 1DLHA 3O6MH 5C0BA 2HJKB 3PWJA 1KCRL 4ZUUA 2PETA 1U8JB 5IBTH 4HCRL 3Q6GL 4FFYH 2F74A 3P0GB 5D6CB 1AXSB 2IPTH 2J8UE 1BREA 2QQLH 1S5IH 4WDIA 5DVLA 5FYKL 3CH1B 4KK8C 3HZVB 5JPNB 4QHNA 3C8KA 2BSED 1KPUA 3PP3K 5F9OL 2UWEF 4LIQL 3NCYS 3CMOL 5TQ2L 3ARZA 1MLBA 5TDPB 1T89C 1CD1B 1K2DB 3UYRH 1JZ6A 4HIJB 5F88B 5I1IL 4NO2B 2BY2A 3FT3B 2DDQL 5D72L 4CRPA 1U3HC 3HNVL 3ZO0A 3DXAA 2VUOA 4HK0A 3T2PA 3HNTH 3FJTA 2PXYA 2NY3C 3U30C 1YEFH 1CFBA 1MRCH 1CLOL 1ZHBA 3IT8D 5D7LD 3STZB 4EI5B 3UTTA 1MCBA 3THML 4TNVF 3VRIB 3ROOB 4PP1D 3CC5B 1HQRB 1ITBB 4HMEA 1NLDL 4MHHI 2EXWC 3SY0A 4P2QE 3STLB 4UNVA 4QHMB 4NYLB 1ED3B 3QUZB 5DSCA 5F7LB 4UILH 5ILTH 2FX9L 4JY5L 4PRBA 3L95B 1FORH 3DYOA 3GNMH 4Y1AE 5D1QC 3V0AC 1UWEL 3LSOB 3L3HB 5AUMA 1KN2H 3V4UH 3GUTB 3EYOB 2PTVA 2XKNB 1K4CA 4PJ8C 4BQ6A 3C8DA 1I1YA 2HG5B 3O6FC 1AFVL 2EEAA 4YHOH 2GUOB 3EDEA 5F93C 5ACZA 3OXRB 2QSCL 1INQA 1JNNL 4R97B 3GMMA 4OZGA 2OS7A 1A7OL 2JCCE 3UZVB 1YDPB 4UDTA 1WV7T 2QHLA 1B9ZA 3GDBA 5ITBL 1PW3A 2I60H 5FUZL 3T0DA 4P23C 1X44A 1YEDB 4PJHF 4UAOC 1S9XA 2FH8A 3ZKSD 4YNYB 1UCTA 4OZ4B 5HHNB 5CBEB 5L2KA 4BFGA 3SKNA 1F8TL 3NTCH 2RB8A 4PRNA 3ARBD 2HLAA 5B8CC 3R8QA 1G7PA 1ZEAL 3RTQA 2VL5A 4U4BA 2EDQA 4AZ8A 4LASH 3S7GA 5K9JH 4HULB 3MNWB 4DTGL 1YYLH 3AM8C 2NY6D 3BO8A 5E5MA 3WLBA 1AP2A 5F9WB 4R0LB 4WI7A 1BFOA 1P4BH 4TQEL 5DQDL 4MX7A 1XCTB 4HLZG 5EFIA 3GSNA 3D87B 2FECL 4RAHA 2AVGA 2HFEA 1RI8A 4M1CD 1I3GH 1YNLL 2B1AH 3Q5OA 3QNZB 4OLUL 1D9KB 2CKBH 4WFHE 1TVHA 5E2VL 1EAJA 3DUUA 5ETUA 4U1IB 3TO4D 2XN9E 2KKQA 1G7HB 35C8L 1ROWA 2X4QB 3VXMD 3OKNA 2AXJA 3MA9L 3TYGL 4JGMA 2V6HA 3U6RA 3KPPA 3P30H 5I1EL 5FYJE 4JGJA 5HHMB 3QDMD 3GMOB 3MRBB 1ZT4B 1T1WB 3RUGA 1DQQA 1T1YA 3BP6A 4ODHL 1E27A 1MAML 4HK3J 3MYJB 3ABZA 4XMKL 1MHPL 3WS6C 3BXNA 3D0VA 5CEYA 3TPUA 4Q6IC 5I66A 3D39B 4RMTA 1RIHL 4YHKH 3WIHH 4UUJA 3NPZB 5F89A 1A6VH 2HTLD 3DSNA 4PS4L 4PRHB 4KVNH 1RJZB 2Y36L 5HGDA 2MOVA 2VLRB 3K2UL 4XNXL 1T03L 2V7NB 4PJFB 2WNGA 4GW4B 1MFEH 1FO0B 4KROC 5KSUA 3U7WL 1PDKA 4XMLH 5C9JA 2BSTA 3GSNH 4FNLL 3VXSE 4ZPVB 4V1DA 3S4SA 5GGSA 3T0EB 1H5BC 2X41A 4NBZB 4JFFE 4X5WB 3MJ8B 1NAMH 4NUGH 1VFOA 4ZFFB 4O4YH 1KTKE 1JTOA 3Q3GB 5BV7H 1MCIA 4JLRA 4ZNEE 3CPLA 5CEZE 3MLXH 2FJFB 5A16B 4O00A 1ZHKB 4UIKL 1DANU 3EYSL 3T1FA 3D18A 4ODXB 1IEBA 3WMSA 5BRZA 3DX9A 1A7QH 4X6BA 1ODAA 4XCCH 1P9MA 4RFEA 3O41A 3D3VB 1B2WL 4JRYE 3KR3L 1GJIA 1CG9B 1MIML 43CAB 4D9RE 5HI3D 4MAUH 2H9GA 3L5XH 3FB7B 1RMFH 4LKXA 3ES6A 1U8IA 1CYGA 4XNMB 1D5XB 3IAPA 3BHBA 3ARFD 3QDAA 4AIZA 2AV7B 5GJSH 2AEIT 3MR9B 1M7DB 4KV5F 1RZ8A 1X6LA 4ONGL 3O2DA 1I1AD 1RJCA 5DHVA 4OZFA 1KCUH 2F53B 2JK5B 1JZ2A 5T1KA 4C83B 4L5FH 3NPSC 5KSAA 5IMMA 4Q2ZB 4RFOH 4LSTH 4UOJA 4XAKD 5D7SL 3VFUB 5HJ3B 1ZA3A 4U1HB 4YEEA 1N8ZA 3HE6B 3GI9L 4WFFD 5HHPA 4H20L 5EU3B 1FNGA 4LRIC 5JXED 1DQJA 1KJMB 4KC3B 5C9KA 2BVOA 4Y4KB 4X8XA 3EYUL 1AGDB 1NBYB 5BJTA 5DURB 2FB4H 3DROB 1Q38A 2BNUA 3OKLB 2CLVA 4GKNA 3WUWB 4LVNB 4ZFZA 5E2JA 4H88H 5GSRA 3MLRH 3VXTB 2X4RB 2VLME 2AXFB 3DMMD 4NQVB 1CIUA 5I15H 5JDSA 3U4EB 5GS1B 1E6JL 3IFPB 1FH5H 2DQHH 2EC8A 4HT1L 5C09D 3VG0L 4KHTH 2E7LC 5FOBA 5GSVB 2FECI 2YC1B 1I1CA 1WWCA 5KSBE 3ZHKA 5FM5O 1V3LA 5IMKA 3VXPA 3IFNH 1NMAL 5JLZB 3NMEA 2HH0L 2J4WL 2P8MB 2VXTL 3K3QA 5D9SA 5D1XB 4P2QB 4PJ9D 5GGRB 2GJ6D 4Y16B 2D4DA 5D7KD 1J87A 1ZHLB 1F2QA 3ZKQD 1MJUH 4HV8B 2R0KL 4JFQA 5F1IB 1MFBH 1B6UA 1JNHA 3TO2A 4D0CB 5EUOF 4EDWL 1DBBL 2DYPD 3ZTNL 2EYTA 3IJSB 1QLEH 3TA3A 5DD6A 3BZDA 5AYUL 4CDHA 3X14A 4Z76A 3ARDB 3PHQB 4PP1C 4LHUG 5IHZA 3SKUD 3BKYH 5C2BL 4PJAA 3MUGA 3EJJX 4S2SA 3ULUE 4CL7A 1I8IB 4DAGH 5I73C 1CN4A 3IU3A 4YXHL 3HZMA 4ZFGH 4P57B 2GSGB 1A3LH 2EDKA 4JB9L 2BJML 2AK1L 1RUMH 1EIBA 4XBEL 5IMLA 2A77L 1T83A 1CFTB 4DK3A 1EHLH 3ESVF 5JQHC 4M5YL 4NOFA 4S1DD 3QPQD 1EZVX 3R0NA 4XXCA 1IKNA 3SKOB 3MXWH 4WHCA 3TZVA 4HJGB 4YHYB 1I8MA 5SWSD 2CDFB 3GI8H 3ZE1E 2ATKA 2KDGA 1T4KA 1XGYL 3HE7D 4JPIA 5E1HB 1JUFB 2BXYA 4ZUWA 3RNQA 1DBAH 4GS7C 3PL6D 4U7SA 1F6AA 4QEGA 3QG6A 2IJ0C 5F3BB 3U0WL 4G9FE 5I1DB 2XI9A 3UJIL 4WGWB 4KJPD 3NH7L 4PGEB 3ARBC 3KHQA 1OGAB 3GIVB 2JJUA 1QG3A 4Q97A 5E00B 4NO0B 3ZE2E 1DCLA 3DO3A 3U1SH 1GXEA 5I1GH 2Q87A 2NY6C 4ODTH 5TF1H 3U0PB 2AABL 3L3IA 1NCDH 3K8KA 2AJ3A 1BOGA 5E7BA 4U1SA 3CSGA 1UXSB 1M7XA 4FFZH 5DD0H 2IG2L 4QHLB 5DTFA 5JR1L 2DI9A 4KZDH 5I1JH 1FZMB 4M1CC 5D4QA 1BD2E 1R3IH 2XWBA 3TO4C 4HPOH 1Z9MA 3RBGA 3KPQA 5BOPA 1HIMH 1BQLL 4EVNB 1U8QA 2BVQA 1KIRB 1T7ZA 4RA0C 5ESAA 4RBPK 4G7YL 4YHPB 3VXSB 4PGJA 2RBLA 2IPKB 1BMGA 4KKCD 3C09B 4HC1L 2MCG1 4JCLA 5IWLA 4MJIE 1Q9KB 5KVEH 1QTYT 3M45A 4NO5A 4YBLB 1PY9A 3GM0A 1MPAL 4JRXE 4KHXL 3AFLA 4YFLI 4YWGL 2ZJSL 1A14H 5CIPH 2HTLC 4RNRA 1OVZA 1BVKA 1V3MA 4UBDD 3U0TA 3HUJA 1CK0L 3GRWL 3WN5B 4YLQT 4F3FB 3GSRB 4IM8A 2CDGB 4K7PH 3CSPA 3PGFH 5DMKA 4AENB 2F54E 1HH9A 1YEHH 4L8BA 4M6ML 3VW3H 4JFXA 1ZVSB 1ZV5A 3EOBA 3QUZD 3P9LA 2DLFL 1OSPH 4YDKL 5C92A 4BQ9A 3BEVB 2QADB 3UMTA 1IC7L 5C0CD 4NKIL 2Y25A 5CSGA 3DI2B 3LKNA 3TBSA 4ZPTB 4XNUH 5GRJH 1H3TA 4XCNB 1FZOB 2NW2B 3NZHH 2I25N 1JK8A 4G9DA 4GAJH 3KYMA 5BMFH 5HI3C 3DUSA 3G9VA 2QHRH 2ILLA 1DBJL 1QOKA 3FFDA 3FKUS 3UTSD 1KC5L 4MQTB 3HRZA 5KVFH 4G6KL 3ARFC 4JDZA 4NKDA 1DUYB 3RWGB 1T3FA 3QFDB 3BD4A 4Z95H 4ZQKB 4KDTA 3OKKB 2BSSA 4YO0A 4J3TA 2D0GA 2MHAB 4JFPA 3NN8B 1N4XL 3RJDA 1I1AC 3W39A 4G3YH 1HXMB 2GQHA 2QKIB 4FQPA 1IGTB 3CXHJ 3BIKA 2O26U 3VWKA 2HWZL 5HY9B 2ZOKA 1CE6B 1WT5C 2VITB 3KAAA 3RU8L 5EDXA 2DQEH 3RGHA 4ETQB 1PG7W 1I85A 5DVNA 3RWDA 3WS3A 5KSBB 4I0CC 4LHQB 5JXEC 4LSPL 2WWKO 1S7TA 3CFCH 1FNLA 2K3TA 4XZUA 1BJ8A 3HC3H 1A7NL 5A2KH 1EEYA 1YNTB 5GHWL 4FABL 1JGUH 2DL9A 5AZ2L 1D9KD 2I9TB 1FJ1A 4OJFL 4CW1B 4TUJB 3GO1H 2YZ8A 2DQFA 3MCLL 1FCGA 3V52H 3QHZL 3KPSA 3L7EB 3DMMC 2AJSH 4C56A 5IIEA 2ID5A 4I3SH 4OZFG 3EFDL 2CLZB 4HWBA 4P9HC 3SE8H 4MMXC 5D70L 1CXLA 1TITA 1A1MB 3QULA 3QQ3A 2NLJA 3B2UC 1NC4B 5L6YH 1IFHL 2L7UA 4D9QD 3V8OA 3L5JA 2B5IB 1QVOA 2FEEL 1X5YA 4PJ9C 1KGCE 1MRCL 1TQCC 3CLEL 4JPVL 4JQXC 1D3CA 3P11L 5CILH 1Z9OA 5A2FA 3EO0A 4PRHD 4X5XB 2LU7A 5MEPA 4Y19A 1PX4A 1AXTL 2VLRD 5D2NA 1AH1A 2BX5A 3D1MC 1QZ1A 4HF5L 5KVGL 3ZE0E 3CX5J 2YRZA 1HILB 5IFJA 3WFDL 3T08A 5EN2A 1FG2B 3T0ED 1BGXH 4UDUB 4X4ME 1L7TL 5FM8A 1RHFA 2OXHA 1SJHA 3OF6A 4QNPF 5C7XH 1TNMA 3RI5K 1QRNB 3TT3H 4TSAH 4YHOL 5C3TA 1F4WH 3BH8A 3WJLA 4QGTA 4WUUE 3SDAA 2MQ0A 2VDRH 4GMSH 2E7CA 1CT8A 4PJFF 5CJOH 2XTLA 4HIIB 4R4BA 5C0BE 3LMJL 3D3VD 1CFNB 1UZ8A 3QEGL 5CFHA 2HT2D 4S1DC 3QPQC 1FFOB 5IM7B 4JZNA 2H2SD 2YD8A 1RAMA 4YK4C 1XGRB 1WGOA 2CRZA 3Q6FB 2G9HB 4Q9QH 3LN9A 5KN5B 4I9WD 5I6XC 1H9VA 4FZ8L 4NFDA 1F4YH 2X1XR 5GISH 1JV5B 1UH3A 1QSFA 2Q76B 3HE7C 3C6SB 3S5LG 2A6JB 1DQDL 5HHXH 3BQUB 3FO1B 1NMBH 3PL6C 3TYFB 1UZ6F 3KNBA 5B38B 3VDAA 1I7UB 3H7BB 4G6MH 2NX5A 3FT2A 2DF3A 1BD2B 2F53D 4P4KA 1U8HB 3SDXB 3O45B 3RDTB 4KJPC 2GJZA 3CDFA 4OLYH 4E41A 1WBXB 1R5WA 4JY6B 15C8L 3LPFA 1NCCL 1EHXA 5BS0E 4J4PD 2DM3A 4DN3H 3HE6D 4ZYKA 5T3ZL 1NAKL 2R23A 3DXAE 3VFSB 3VD4A 4LVHB 4GOSA 4UQ2B 3FTGA 1T0NA 3PWLB 1J0ZA 1RFDH 3MLVH 2VR9A 3Q0HA 1A6AA 4KKBD 3MLTB 3VFNB 4Y4KD 1IM9A 5CJ5A 5DURD 5IV2B 4JRXB 4QRTA 3UTTE 3W9DA 3QUMB 3VMPA 5FF6A 2VLJB 3FT4A 1P7QB 4WHYG 5HVHB 2PYED 3EYFA 4LSUH 2ICES 4UT9L 3UBXI 3VH8A 4MMZC 2FGWH 4QY8A 1E28A 4P5KB 3VG9B 1S7QB 1X5GA 4OFYD 5EO1A 3VGHA 3QHTC 4I8DA 2ARJB 4D0DB 3RVUD 3FB5B 5FFLA 4JKPH 4M7LT 3PWNA 4KKCC 2ERJC 4I48A 3EOAA 2CO6B 2XXMB 3W0WA 5D1XD 5FYKD 4Y16D 2ZPKL 5ISZA 4NKMB 2OL3H 4ZSOA 2BOBA 3VFRB 2FGZA 1LEIA 1T6VN 1Z2KA 4TSCL 5EC1B 4UBDC 1R3HB 2VR5A 5C86A 3O3AA 5M95B 2IBZX 1BZQK 1GOGA 3Q5TA 2E7BA 3I50H 3OAYH 1MHEA 4L4VA 4ONHA 3UEZA 2OZ4L 1WCBA 1JTTA 4DJMA 1QKZH 4PRPB 5EO9B 3ARDD 1OHQA 4Z78B 4LSVH 1R5VA 5IB1B 3CFIC 1Q9WB 4JM4L 1ND0A 5FUCE 3BJLA 4QRRB 4S1QH 4LEOA 3DPBA 1UB5B 1JWSA 4G8EB 5TDOB 1LK2A 3QUZC 4OT1H 5KS9E 2EDRA 1TZIA 5I1HL 3CU1A 1T1ZB 4MGXA 3TCLA 1JNLL 1IVLA 4MAUL 2W9EH 4GLRH 3RGVA 3QIBB 5J8OA 1JF1B 2NR6D 4GW5A 4K3HA 3LKQA 1T7YA 4AT6A 5HDQL 3ULVL 4XWOD 4TVPD 2A6IB 5HGHB 3V4PH 2C7UA 3S3JA 1IBGH 4R97C 4DVRL 4X80L 3QXUA 3U7YL 3H9SA 3UAJD 3PJSA 5IK3B 1S7VB 5I1KL 4X5LA 2C1OB 1MFCH 3PWUA 1CE1L 1K3ZA 1YEJH 4QXGL 1H3PH 4OI8A 1QR1A 3T2OA 5I2IA 3HPJA 1C5DA 3MBED 1EV2E 4E0RA 5KG9A 1QD0A 3C60B 1MCQA 5DHXB 4ZS7H 4YHML 3QO0B 3BWUC 1OGAD 2XZCH 1MRFH 3VFWB 2BVEA 1FYTA 4LDOB 3SJVE 4NO0D 5JO5B 4NZUH 1AJ7H 1T20B 3GMNA 1CF8L 4X9FA 3WLWD 3O3UN 1ORQB 3WEXB 3EYQD 5F3HB 5HHOE 4QKXB 4UU9B 4IOFD 2FX8L 2RAMA 2H26B 4NQCA 4OCSL 5F9WC 4NRYA 4HGWA 4R0LC 5BVPL 3D85B 5BQ7A 4NQXB 1LWRA 5BXFB 1UJTA 5CD3A 4HIEA 1NLBH 4YFDB 5JOPE 4UT6L 3K1KC 3QUYA 3BSZH 3FQXB 4OAWA 3FAWA 4LGPB 1D9KC 3LEVL 3BI9X 5I8OL 4H0GA 3LDBB 1WICA 2CIKB 1T5XB 2GK0B 3O3BA 3BUYA 5SWQA 5T1DH 2DQCL 3D6GA 4OLXH 1XGUA 4DOHB 5H35B 1JF6A 1B0WA 4GKOA 1MCPH 4ORZC 1FSKC 5FAAA 1S8DB 4WU5B 3VXRA 3VXSD 2Z92A 5LQBL 1HH6B 1TQBB 3W5MA 1GCFA 4UINH 5K9KB 4K9EC 4A6YL 2HAZA 2FYYA 4U6YB 4C4KT 4LDLB 3UTZB 2CK2A 4G6FD 5ITFB 4OBRA 4IIQC 2IANB 3DGGB 5CEZD 4JFEB 3HZYA 4TRPH 2XNAB 4WJ5B 1K4DB 3N1PC 3MOAH 2B1HL 4WUUB 1W2KT 2NZ9D 1YEIH 2CQVA 3EJZD 3NCJL 2JJSA 2EIZA 1CDGA 4L9LB 4LU5L 3QISA 4HLZH 4NUJB 1BVLB 2XQBL 3T0EC 3MV7E 4D9RD 3F12A 4HH9A 1ETZA 4WFEE 3V6OE 1AHWA 1MHHB 1YQVH 2A9MH 3HMWH 3TBTA 1YUHB 4RWYL 2WINA 1WWWX 1DEDA 4MA3B 5L9DH 1UCBH 4JFHE 4EQ3A 3RNKA 3BT2L 1OGTA 3O3EB 5L2JA 1I3RB 1M71A 1LK3H 3MRMB 1CDCA 4RSVA 5C0JB 5FM5M 2DQTL 2NW3A 1X5IA 2VXQH 3PIQA 2DJSA 3X11B 3PP4H 2HT2C 3QA3B 4WW2A 3QDHA 4F2MA 1KCSH 1GC1L 5BS0B 2H2SC 3KS0J 4XP9H 1A6TA 3UJJL 3QDGA 1FCCA 5LJYH 3HMXH 3SDDB 4AEHH 2XYCA 1K6QL 3N1QC 4FQQA 2KL6A 4OB5H 1J1XH 1V7NH 3T04D 1GAFL 4OFKA 1G7LA 5F7FA 1S3KH 2I07B 2WK2A 4ZDHB 2P24A 4HBCL 2P43B 1QFOA 1BWWA 3REVA 1OLZA 1RPQA 5I1LB 4X99A 3OAUL 1A6UL 3GMRA 5EU4A 4NP4H 1ZGLB 3B9AA 3ETBF 4J4PC 3QCTL 3FO2A 3HE6C 2R1XB 1QLFB 1EX0A 1KN4L 1QR4A 1PKOA 4M1GH 3QH3B 3O2WH 3RPIA 1RY7B 3JWDH 4KXZI 4KPHH 4PRIE 4W81A 5DMIL 3MV8A 4KKBC 4YR6A 4Y4KC 4HKJA 2ZUWA 2VLKB 3E6FB 4RQQB 4YDVA 3BGFB 5CEXB 1CU4L 4ODVL 2WSKA 4D94A 4LL9A 5FO7A 2CKBB 2AJZA 3MRPA 4P99A 1IC5L 2ZUSA 4AG4H 2X89D 3QFJE 3MGOB 1VFUA 3DX8A 2YPVH 3AREA 4HFWA 5T5FH 2BRQA 5IB4B 5GS1C 3KLHD 2VQTA 3WIIH 3RVUC 2UUDH 1HN1A 3GSVB 4BSWB 4U49A 5F97E 4N90D 4S11A 1LO5B 3OQ3B 5H2BA 1JPST 2FL5B 1K8DA 2PW2A 4H1LA 5D1XC 1U2HA 4Y16C 2BC4B 4NDMB 5DA0B 4P5TB 5KS9B 3IVKA 3I02A 2R4RL 1LMKA 1P69B 2EIBA 3VCLB 1F90L 5B3JE 4PJBA 1PEWA 2G60L 2RQ8A 2Z31B 4XVJH 2OMBA 3QQ9D 2NTFB 2W60B 2R2BA 4F57L 1G6RA 1UM4H 5TE4L 4MCZB 3BPLB 4OCXH 1CL7H 1T21A 4HUWB 1D5ZB 3L6FA 4N0UB 4EI6A 1K9TA 3QG7L 5FDYA 4OM0L 4PGBA 3ZDXF 2AQ3A 4TULH 3ARDC 1JHLL 4JM2B 3P9MA 4XT1C 1HKFA 4HSQA 4EDXA 4RMWA 4F9PC 5C1MB 3MACL 5BV7B 3AS2A 4NQTA 1QRND 2JJVA 4BZ1L 3H42L 1DTUA 4PJDB 4AY0A 5E08L 1D5IH 2ARWA 3BKCL 5MEND 1PY4A 4LCWB 3DBXB 5TE7H 4KTYA 1JCKA 2NR6C 4NC2B 1S7SB 4BSJA 5KJRL 4OZIB 3RX7A 2W0FB 4CN6A 2V2TA 3FB8A 2XOTA 4XWOC 4EOWH 3WFBL 1ZT7B 3RA7H 2R1YA 4LNRB 4RAUB 1JHTA 3GBMH 4XB8A 1KPRB 4Y4HD 4YHYC 5HHOB 5EZLA 2GIYA 3UAJC 4F80A 2ITCB 1JL8A 3UROR 5IFAH 3BQUD 1TJIL 5DJDB 1JZ5A 4QTHB 3IDGA 3QRGH 5HPOA 5D1QA 1JGDA 1JMZA 3IXTB 2B4CC 1MCJA 1MJ7H 1LD9A 2GSIA 3MBEC 5E2TL 1FVDB 3RWIA 2JELH 2O61B 2JKXA 4TPRH 4PJ8A 1CDYA 3RDTD 2DWEA 2V2XB 3JVGC 3TVMB 4DGIH 2DL2A 3WIFB 2CDEA 3X13A 3T77A 3F7RA 5SWZB 2APTA 4JZJB 3LKOA 1Z9LA 1CFSA 5JW4N 4O58L 3WLWC 1RUPH 2ZOLB 2R29H 3EYQC 2ICWA 4HMCA 4N8VA 4XPAL 4IOFC 4Q9RL 2YUXA 2NTSP 1U8LA 5F96H 4ZG1A 5DEZA 4WCYL 1XCQB 1WAAE 4P46B 3MBXL 3PP3H 1S7XB 3O6KH 4KKLD 3QIWB 2VLJD 1NCAL 3KJ6L 2AKRA 3HB3D 5B8CA 2Y5TA 4HLJA 4JJ5B 5EIIB 4KVCH 3SDXF 2VIRA 4KQ3H 4P2RA 3DECA 5L7XL 3NZ8A 4YBQD 1O7SA 2MCPH 4EUPH 4F7MA 2V5MA 3B5HA 1JGLH 2I9LB 4M62L 3RWJB 4D9LH 4BQBA 4OLWH 4P9ML 1A1OB 1P4LA 3BJ91 5F1SA 1XIWD 2X7LB 1CDIA 3DVFA 1YPZE 2CRIA 2X1OA 4YBLC 5HI5D 5HYSA 3GGWA 2GT9B 1A6WH 1EGJA 3UC0H 3LRGA 2XG4A 5DJXA 4BUGA 1SJEB 1A0QH 5CMAA 2JB5L 3BZFA 1HKLH 5DYOA 2OTUA 3B2VL 4MXVE 3SDCA 1T04B 3WN5C 4ELMB 3LIZL 4LMQI 3M17A 2NZ9C 1EDQA 1UM5H 3EJZC 4PJ7B 4M6NH 1P2CA 4J3UA 1ZVYA 4U3HA 3GMQB 4PRPD 5ICXB 4HG4K 2XZQH 4DCQA 3JWOC 5E94B 1KB5L 1NANH 4K7PY 5FIEA 1OSZA 5IVZB 4QRRD 3QWOB 1MCLA 4GH7B 5FA3B 5CZVL 3ZHDA 5IQ7H 3TH3T 5T1MB 4HJJH 4NRXA 3PNWB 1LP9E 1IGCL 5FGBC 4K07A 5C0GB 3QIBD 1N3NB 2BDNL 3IDIB 1JPGA 1U8OB 5D5MA 2Z93A 4MHHG 4Z7UA 4F9LA 4G8IA 4OCRH 1G7QB 4JO4H 1VGEH 4ZD3H 1I1FB 4QCIA 3LRHA 2HTKD 2VZ1A 4X6CA 3TC9A 1HSAB 2YKLH 4F33B 5IOPB 4XPHH 4PJ5A 1VGKA 3Q5YA 4RFNB 1EFQA 2DWDB 3U4BH 4PRIB 3QXTA 5E99L 1B90A 2VISB 3B83A 3C60D 3UPCA 3V5HA 3QIUA 1RURL 1MI5E 3MRRA 1KELL 3QFJB 4M7JL 3RHWK 1H3XA 2FSEA 4GQ9L 2GK2A 4Y19E 3F7PC 4RDQG 4E9LA 4F7CA 5HYEA 1C16B 2CIIA 5IR1A 3FFCA 3D85D 4PUBL 5EA0H 4U1NA 3DYMA 4AK1A 1OF2B 3ILPA 3MRJA 1V7MH 1D5BA 1PEZA 2ED9A 2OMNA 4X8JA 1NGXB 4BFEA 4YAQB 1B0RB 3MC0A 3CLFH 2WUBH 2GITB 4FFWD 2L0DA 1JZ7A 4UV4L 3I75A 2IAMB 1ZE3C 2EEBA 1FL6B 1CFQA 2OJEA 3RBSA 3EKCA 3CVHL 3QPXH 2BY3A 2AEPH 2XZAH 3A6CL 5I1AA 3C5JB 3KLHC 2UWEA 2VDKH 2E6PA 4QOKA 5I18L 3MV11 4LRIA 2DI8A 3BGMB 4F7PB 1TDQA 5KW9L 1Q9OB 3VFOB 2V9TA 1NEZG 4J12A 4P2CG 5TGBA 2B5IC 4L3CB 4FA8A 1Q9LA 1IEAB 1K8IB 2IAND 2JIXD 2ZSVA 4XP4L 4JFED 5CIPB 2AI0L 1U8NB 1UC6A 1QRKA 3G5ZA 4J23A 2V5YA 2K7QA 2FIKB 5FK9B 2FR4B 3PQYB 1FGNL 5C0AE 3QQ9C 4WUUD 5EBMA 1WEJL 3GIZL 3O11B 3O3DB 4ODUA 1RZ7H 4RGMB 4YUEL 4LAJH 2VERN 1N6UA 1I9RH 5IBUG 1NGPH 2EH7L 1EFXA 4GBXA 3DTXA 2NX5E 2OR7A 2XWJB 1XZ0A 1CZ8H 2UZIH 3HN3A 3ULUL 2EEDA 1CD0A 1JGVL 2C3XA 4KY1H 3NACH 4WI3A 5I16B 1DEEA 3SE9L 3BKJL 4OCWL 3DRQB 3T0VA 2Y4SA 3DX6B 1C08B 3SKJH 5JXAH 3QNYA 2YPLB 4GG8B 1HDMB 1CGSH 4JFOA 2WUCH 5D7LA 3IF1B 4PYGA 4JE4B 1X3DA 5JMRA 4MA7H 1EMTH 2JJTA 1AQKH 3MOQA 2YD1A 1IARB 3NCFB 2PN5A 3LN5A 1OAKH 4NJAH 4RGNB 4LLVA 4Y4HC 2D31B 3IFOB 4HWEL 2FO1A 1FFRA 3RY6A 4PJHA 4XP5H 3SDDD 3I6GA 1FFNA 4P5MA 4YXKL 1RQ5A 4G80B 5CUSL 1FE8H 3BQUC 4IHOA 2B20A 1YJDL 5FCUH 2VDQL 3B3IA 2FATH 1NBQA 2R4SL 3U79A 3GB7B 3ZDYF 4E5XA 4O2CB 3WFCH 1MVUA 3RDTC 1KBGL 4X7TB 1FL5A 4Z0BL 3W0WE 4U1MB 4U33A 4U6XA 5T33L 1HHIB 4PJCA 2YHGA 3GHBL 1K5NB 1QFHA 4U1JB 2YPKB 5EBWA 4ZSOE 5CSBA 1AXIB 4KQ4L 3FL7A 2IWGA 43C9B 5CBAA 4LVHC 1KTDA 3MRGB 1NCWL 5IB5B 4YGVA 2DTML 3CDYA 3VFTB 3CFEA 3PV6B 4WI4A 1YPZB 5CCKH 4L8SC 4L4VE 1A21A 4LP4A 4MNHB 5JA8B 2VLKD 8FABB 4FQ2H 4YHNA 1G84A 4CDGC 5T3ZD 1GOFA 4KKLC 3IKKA 3HB3C 1YMMA 5HVHC 4KTDH 1BF2A 1WTLA 1XF2B 5FHAH 1RIVH 2Q7NA 1FLTX 3E3QE 4YBQC 4XNQB 2WP3O 5MP6H 2VB5A 1YECL 4PTTB 3VG9C 4TUKL 2OSLA 4O5LH 1VB9A 2H3NA 5FCSH 4KZEL 4GAGL 3F6IA 2ZCKL 1XIWC 5CWSA 2O93L 3NFNB 4MB4A 3MLUH 1AD9A 5GS2H 4EEEA 5HI5C 2ITDA 4K23L 2EC9T 2XTJE 1VACB 4ZODA 4HUUA 4NFBA 3INUL 4NWUL 3TO4A 3U9UA 3OR6B 3VXMA 5E5RB 4DFHA 1HOCA 2Z31D 1LP9B 3U2SA 1AE6L 3T4YB 4L1DA 1IGFH 3H9SE 3JZ7A 1Q1JL 4NNXB 2HJLA 1FC1A 3P77A 3L3GB 1AKJB 4R2GD 3AAZB 4JM2D 4HH8A 4HS3A 2GYSA 1N6QH 3REWA 3C6LA 1I7RB 4GG6B 3LD8B 4U6HA 1UKQA 3KWWA 3CDGB 5ID1B 4XCFL 1IJ9A 1UADC 1MRDH 5KS9F 4HMDA 3CZJA 2ZCHL 1BP3B 4UQ3B 4NQCE 5FDWA 1W72H 1VFAB 2OP4H 2VH5H 4HWZA 3V95A 1KACB 2VC2L 3QIBC 4LCWD 4R90L 2BERA 5CP3A 3F7VB 4Y8AA 5BO1H 1MI5B 3K1DA 2YEZA 5CHNA 2AJUH 1U95B 3KPRE 3L9RB 3BVNA 3QNXB 4LRNH 2R9HD 1E0OB 3HHRB 3BH9A 3DX7B 4JM2F 1A64A 5HHOD 4F7TA 1MY5A 2HTKC 3UTQA 4ZUTA 4JO1H 4MAYB 1QNZL 1G9EA 4FQ1H 4LSSH 2QJDA 3HPLB 5EOTB 1U6AH 1REIA 2VDPL 4QRSA 4Y2DB 4Z7NF 4OF6A 5IKCA 3VXRE 2FJGB 4UV7L 5HHQA 4FG6D 1A3QA 4PJDF 1T1XA 3T3PF 1RJYB 2D7PA 5C0IA 3C60C 3CCHB 1A7RH 4LLQA 3MREA 3CVIH 3GSOA 4OFPA 1Q0YL 5SWZD 4OZIF 1VFBA 3E8UH 2YA1A 3M1BB 4DGYL 4QRPD 2BXZA 1NH6A 5E4IA 4JFDA 3WKML 5L88H 3D25B 4U3XA 4F37F 4UTAL 4KRLB 5B39A 1VEPA 1A4JA 1Q72H 3O9WB 3ARFA 2YD9A 3UBXA 3C08L 4U6TA 2OR8A 1TLKA 5EOQL 4ZFOA 1CLYH 1QSZA 3OGCB 25C8H 3MTRA 4R26L 4RBPH 1M6OB 2KBGA 4P46D 1J1OH 1I1AA 4RMQA 3N1GC 3SO3B 1KOAA 3QIWD 5D6DC 5D71L 3PABB 1J5OH 4FFWC 4W6WB 4R7DA 4YC2B 1KJ3H 3LDBC 4HXBH 3MZGB 4NGHH 5SX4H 3DV6A 4Y4FB 3PGDB 1MVFA 4JANB 4PRDB 5D7IB 3V5DA 3P0YH 1AY1H 5JXEA 4QXUH 1WLHA 4R96A 1GGYA 4HZLA 1PAMA 1RJLB 1TQBC 1G9NL 4MNGB 1D6EA 1JJUA 3WO4B 2BFVL 4LKCA 5FV2A 3QEQA 1IILE 3CVHB 4PGZA 1CL7L 3FONB 4NM8H 2OL3B 1UACL 4Y8DC 5EUOA 1M7IA 1XH3A 2G2RB 4JFZL 4PV8B 4I77H 3EDDA 4XNYH 5M94B 4S10A 3WE6B 5LG1A 3DMMA 3QDGE 1DSFH 1S9YB 3MMEB 1ZLWH 2FLRT 4GXVL 5DJAB 1ZWIA 2AV1B 2IQAB 1LGVA 4L9LC 4LLWB 5JQ6H 2A1WL 1B3JA 4NKOB 1SYSB 4TUOB 1L9NA 3B6SA 3FAXA 3CXDL 5D1ZB 2DQIL 2J5LC 2H1PL 4MD5A 4PJ9A 2GJ6A 2XPGB 3NVQA 3A0OA 4JQXA 5DRWB 3LV3B 4YX2H 4S0TD 3N85H 1HHJB 2J6EA 4XWGL 2DYPA 4JO3H 4KK6D 1GGBL 5T5NG 4GT7A 4ELMF 1TVBB 4KRPB 4KK9D 4M7KL 5GGTA 4M4PA 1C12A 4J1UB 1UB6B 2HN7A 4PJ7F 4M6OL 2N1KA 3AUVA 2DBLH 3JUZA 4GAYB 4QT5B 4CKVX 2VAAB 3KPLB 4Q7DA 4X9IA 4X6FB 1SY6A 1BAFL 2ICWJ 1FVEA 2RIKA 2XA3A 4I1NB 5EORH 2MNUA 3TF7C 3DRTA 1FN4A 3SDDC 4LVEA 3QEHB 1QA9A 1FV1B 2VWEE 5DQ9B 5H37H 3UJTL 3P4NA 1FL3A 4P9HH 4GMTL 4NSKB 4M5ZL 2ZG2A 5E0QA 1PKQA 1U3JA 2WANA 4B41A 4X83A 3MA7B 1N59B 2AGJL 3K8LA 4QGYA 4CNIB 3QFJD 1HQ4B 1KEMH 5ALBH 4QF1B 2Q6WA 2DJ4A 5KVDH 5FB8B 5CZXD 1UXWA 5BZWB 2EDLA 3BEWB 4OQTA 4FXGA 4NJ9L 1J88A 2DD8L 5SWSA 4PJBE 1HCVA 2EDYA 3HE7A 5FM4A 2XWTB 4XPTL 3L3KA 3VE0A 3PL6A 1E4XH 1OP9A 4B5EA 3BGFC 1XGPA 2OR9L 3IDNA 3TNNB 1LILA 4XP1L 3U36B 4Z77B 1PYWB 1WFUA 4BELD 2IAMD 3U46B 4KKNA 4Z7OE 3MROA 3QWQB 3BE1L 4OSUL 2W92A 1VPOH 3RL2B 3R1GH 1VESA 1KNOB 9CGTA 3W11D 4WTZG 3QI9D 5MEQA 1JGEB 1SM3H 4K3DL 5JMOC 1TJHL 3FOLB 5IW1B 4IRJB 2WW8A 4Y5VC 4YHIB 1E6OH 1Y6NR 2VXUL 3AC0A 2VJXA 3SGJC 1OL0A 1MFAL 4G42B 1EHNA 1T22B 3HC4H 4HG4J 1JI2A 5GRYA 2Z31C 3PQYD 1AXSA 2VL4A 4BFIB 3I84A 3TWCH 3CH1A 4JKWA 3HZVA 4GSDH 3X12B 3BPLC 4JQIH 5TE6L 2VSCA 4LCCB 2YN5A 1NMCB 1NCTA 2R0ZH 4U2YA 3QDJA 4MWFB 3C9NB 1Q94B 1YY9D 1X7QB 4R2GC 2D4FA 5TDPA 3WJJC 4JM2C 1CD1A 3QBTB 1K2DA 4HIJA 1UKTA 5F88A 4O9HH 3FZUD 1UGNA 5FKPB 4HAGA 4NO2A 1FNSL 1TETL 1JFQH 3OKMB 4Y7MA 4XHJD 1KJ2H 1MWAL 3FT3A 4M7LH 5LGHH 3BD5A 4MS8D 3MQIA 4M6AA 1YY8B 5I76B 2V5SA 2QR0B 4CMMA 4XBGB 2HP4A 3RIFF 3C5SA 1UYWH 2YPLD 3Q2CA 4F8QA 3LKRB 5D93C 3STZA 4EI5A 2W9DL 3VRIA 3ROOA 4GRMB 3RWEA 2NZIA 2NXYD 3CC5A 1HQRA 1LO4H 2R9HC 4OGZA 4DKFH 2YRLA 4RGND 1DQLH 3STLA 1MJJB 4QHMA 4NYLA 5K9OB 1ED3A 1EXUB 3QUZA 2G75B 3EOTL 2X44D 3HI5L 1FNAA 3EO1B 1PSKH 4NQDE 5EBLB 3L95A 1FFPB 5E6YA 2Z4QB 4QRQA 3LSOA 3L3HA 3GUTA 4FG6C 3EYOA 1OP5K 2R0LH 2XKNA 1MF2H 2IFFL 1YEEH 4K3JL 5EH1A 2HG5A 2VUYA 1MH5B 1SBSH 5L8KB 3GMLB 2GUOA 1JRHL 2NY5H 3OXRA 4KMQA 3VU2A 3CSYB 5E95B 1YDPA 1NL0H 5KSVB 2JE8A 3I9GH 4FQJL 4J3OC 2ADGB 1IAKB 5C6TH 2LU4A 2YN3A 1YEDA 1CR9H 3HC0B 3PXJA 3Q48A 3MODH 4P2YA 2BSRB 2BK8A 3QUXD 1VCAA 1G9ML 4YNYA 3E2HB 5HHNA 4OZ4A 5CBEA 4NN6B 2WBJD 4CVXB 4P46C 4LAQL 1OCWH 4KTEL 2XIDA 5C08E 3QIWC 4WWKB 5AG8A 1A5FL 1LE5B 2ZG3A 1RIUL 5HVFB 4Q9BA 5FYLL 4YE4H 1NEUA 1HEZB 3MJ9A 1T66D 2D7MA 4G7VH 4NRZB 5FKAB 4ERSL 1F11B 1HYRC 1EAPB 4R0LA 2WBKA 1XCTA 4HEME 1IRAY 5D8JL 2UYLB 2BVPA 2F5BH 2CK0L 3L3OB 5D5ME 3VI4E 3UBXG 3SOBH 3QNZA 4DKEL 5E2UL 1F6LL 4N9GB 3GFUA 3BP7B 3FB6B 4U1IA 8CGTA 4WY7L 1NGPL 3V0WL 1G7HA 2X4QA 3LS5H 4HX1B 2XACC 2ORBL 1QEWB 2DQGL 4X6CE 3P2TA 2IPUK 2YRPA 3GMOA 3BZ4B 3MRBA 1ZT4A 4W4OA 3RWCB 2OJZH 2OTPA 1DUZA 5GGUB 3O2DL 3RZWA 2CO7B 1ADQH 3MYJA 5F6IB 5JXAL 2VDOH 3CZFB 4UOW0 5C07E 2J88L 5IMOB 1QFWL 1Y6KR 3D39A 3MRQB 1RVFL 4PRHA 1NBZB 1RJZA 2GI7A 4U6VH 5ICZA 2V7NA 4PJFA 1SHMA 1DJSA 4GW4A 4KK6C 1EPFA 5HHVH 5J1AB 2QSVA 3FFCE 2MKLC 3MLSL 3WXWL 5F7HA 4KK9C 5C2UB 4YQXL 4ZPVA 3T0EA 1AR1D 5EO0B 1AGEB 4X5WA 3MJ8A 3MPCA 1ZKAA 4ZFFA 1CD8A 1B4RA 1RZKH 3Q3GA 4GG6F 4WI5A 4FQCL 1RU9H 4MAYD 2AXHA 2FJFA 3SBWA 4RFNC 3RQ3A 4X7CC 5A16A 1ZHKA 5F1NB 1RZGB 5E8DH 1S7UB 2UWEE 4Y2DD 4ALAL 4OI7A 5IVNA 1IKFH 1WZMA 4OGAD 4MVBD 2F74B 4Y89A 3D3VA 2FZ3B 4MA1B 5DK2B 1AO7B 1UKSA 1CG9A 4LHUB 43CAA 1T80A 3NGBC 2VNCA 5FGCE 5CZXC 4RGOH 3FB7A 3G9AB 1D5XA 2HVKA 4M1DH 4N0YL 3O9WD 4EZMA 4PR5B 5LBSL 5JW4R 3ZYIA 2AV7A 1FO0H 3MR9A 1B4JL 1M7DA 1UJ3A 4DUVA 2NY2B 2GCYA 2IMMA 5K93A 4R8WH 4UOW1 4NHCH 5CGYD 2JK5A 4OTXH 1JRHI 3QUKB 2Q8AL 4C83A 3NIFF 4Q2ZA 5TH2B 3VWJB 2IAMC 3H3PL 2J8UA 3VFUA 4ESKA 4Y4FD 1A3RH 4U1HA 3HE6A 3QCVH 5F1OB 5EU3A 3W11C 4U1LA 1OB1B 3QI9C 5T3XH 1RZIB 3V6FB 1OM3L 3CUPB 1RHHA 3SY0B 1KJMA 1HE7A 5LAXB 4HUMB 4Y4KA 5DSCB 1KPVB 1AGDA 2ZUTA 5J06A 2UV3A 3DROA 2CLRB 4WEUD 3RY5A 2DQUH 3O6FB 2V7HA 3OKLA 5DO2D 5JIPA 4XPBL 3WUWA 1RULL 4TTDD 2B39A 5EOCJ 4FZEH 1WWBX 3HR5B 1INEL 3VXTA 1L0YA 2X4RA 4FQHB 2AXFA 4FRWA 5GJTL 4NQVA 2Z8WC 5GS1A 3U4EA 4PJHE 1J18A 3QO1B 3IFPA 2X9XA 4OFYA 4CADB 4CVZB 4P59H 5GSVA 2YC1A 5ADPL 3IB4A 5D7IF 5DLML 3RX8A 1INQB 4OZGB 1BECA 2EDXA 1R5IB 2P8MA 1YY9C 5ESQB 5AWNH 5I17B 1NFDF 5D1ZD 1C1EH 3TIEB 4DW2H 5D1XA 4P2QA 4Y16A 4NWTH 1BOYA 4Y88A 1OTSD 3FZUC 1DL7H 4OBSA 4XHJC 2OTWB 3G6DH 4HV8A 5F1IA 3TPKA 4MS8C 4NQDB 1HZHL 1JPSH 5JZ7D 3OPZL 4D0CA 3ZLQC 3SKNB 1YYMH 3KGRA 2Y06H 1G7PB 2L7JA 3QR2A 2IGFL 5DUMH 4MD0A 1MWAB 2HMID 1QFWI 1NDGB 4OGYH 3ARDA 3VGAC 3PHQA 3CJJA 2NXYC 2NYYD 4NC1C 4O2EB 3MRDB 4RGNC 4LARL 3RJQB 3AY4A 4Z7WF 1T5WB 1I8IA 3VMNA 4ZTPL 4JR9L 2HKHL 1KCRH 3TH2T 4P57A 2GSGA 1QBLL 4CGTA 3L7FB 2X4OB 5ETUB 4HCRH 1I9IL 3M8OL 2PNDA 3Q6GH 4ZXBB 3EUUA 3O6LL 3IJHB 5DEFB 1CFTA 2AP2A 4H25B 2EE3A 3GBLA 2QSTA 3DGCR 5FYKH 1WFOA 1IAIM 3NIDE 4Q6IB 1A7PL 3SKOA 3GSUB 1URLA 4HJGA 1P53A 5F9OH 4PB0L 4LIQH 3VXME 2CDFA 3CMOH 5GRZA 1CDUA 5TQ2H 5EU6B 2ADJA 2NMSA 1JUFA 3QDME 5I1IH 4APQD 5I66B 3QUXC 3B5GA 2DDQH 2WBJC 3MRKB 5D72H 3WFEL 5F3BA 5I1DA 4G5ZL 3HNVH 3JVGA 2X4SB 5DFTA 4PGEA 4FQXB 4YH6A 1OGAA 4HKZA 3BN3B 5E00A 4NO0A 4Q0XL 1CLOH 1N2RB 2Q7YB 4I3RL 4V1DB 5GGSB 4P4RB 3TBYB 3F7QA 1T66C 1XAUA 3U0PA 3THMH 1CI5A 1MCCA 2IADB 3T09A 1IT9L 3LQMA 1NLDH 1TFHA 4G6AD 1SQ2N 4YHLL 1UXSA 4QHLA 5C07B 5DC9B 1FZMA 5MEOB 3FRPA 2FJHB 2FX9H 4JY5H 3R06B 3LHPL 4Z8FL 2HKFL 5BRZB 1UWEH 4JN2B 3PXHA 1GHFL 4EVNA 1KIRA 4XNZC 3F7YB 4KV5E 4EN3B 4YHPA 1AFVH 5J4MA 3VXSA 3VJ6B 2YZ1A 3F65A 3QWRA 2IPKA 3QSKB 1CBVL 1GGTA 4OD3L 1IGYB 2QSCH 1JNNH 1Q9KA 1NC2B 1A7OH 4UTBL 3DHMA 3BHBB 4AIXA 5ITBH 3KVQA 5FUZH 1G0YR 4JVUA 4DQOL 2LU3A 1MCSA 3PGCB 4PJIB 3AXLB 4DUXA 3LZFL 4OF8A 4AJ0A 3QXAA 4OZFB 3WN5A 1BJ1H 3UYOD 1F8TH 1ZK9A 1NUFA 3ZL4L 1LO3L 2CDGA 1ZEAH 5AG9A 3HCVA 4DTGH 1AR1C 4PGDB 1AGFB 4HK3N 1PLGL 1BEYL 5HHPB 5FGCB 1ZVSA 1RUQL 2AERT 5J13B 2VYRE 1DQJB 4FMFA 1Y0LA 4TQEH 1S9KC 5DQDH 2VZSA 2HVJB 4MAYC 3BEVA 2LFGA 2QBWA 2P49B 4HWBL 3WXVL 4GKSA 4WFFE 1QLRA 1YNLH 5J3HD 4Y2DC 4OLUH 4PJGB 4ZPTA 5E2VH 1H8SA 2IPUG 4WHTB 5FGBA 4OGAC 35C8H 4MVBC 3S35L 4XCNA 1FZOA 2NW2A 3OXSB 1ZLVK 3MA9H 3TYGH 4LPVA 1F3JA 2EDFA 2WMPA 5I1EH 5I1CL 2OK0L 1KSRA 4L4TD 2ZWLT 4Q58C 4FMKA 5EUOE 1X4ZA 1T7XA 4ODHH 3LB6D 4PGCA 1MAMH 3O9WC 1UWGL 3SE3C 1DUYA 2E8YA 1NSNL 3RWGA 3QFDA 4XMKH 1MHPH 4ZQKA 3OKKA 3MLWL 4KUZL 5C09E 2D7NA 2MHAA 3NN8A 1RIHH 2C5DC 4JFQB 5GZND 4PS4H 1NGWB 4JZOB 5CGYC 3SO3C 4F58L 3CGTA 3CU7A 2QKIA 2Y36H 3K2UH 4XNXH 1T03H 4YC2C 4XGZB 1FAIL 3I6KB 3GHEL 5GRUL 5HY9A 2GJ6E 1CE6A 3PDDA 3TA3B 3HG1B 1R0AL 3MGTB 3U7WH 4Y4FC 4FNLH 4XPFL 4ETQA 3QHFL 4MD4B 3S5LB 4ACPA 2Q86A 4JKMA 2EO9A 5KSBA 4TOYL 3HC4L 4WIQA 5IHZB 5ELIA 1YMHB 3MUGB 4LSQL 1U8PB 1FGVL 1MCNA 5HYQA 3CH8A 1YNTA 1IAOB 4C57C 5F7EL 4N1HB 1CDJA 1YQ2A 2I9TA 4UIKH 4TUJA 5DO2C 3DVNA 4QYOB 3EYSH 4TTDC 2DKUA 4IJ3B 1BZ7B 3L7EA 1DP0A 3PWVA 4LDEB 5AAMA 5IT2L 3FQNB 4YIQB 2CLZA 5DDHA 2WIIB 3ZZ1A 1B2WH 1WQVT 3KR3H 32C2B 4GS7B 1MIMH 3V7AE 4UIMA 2IMNA 2WWMD 1A1MA 1O7VA 1XR9B 1I8MB 1NC4A 3KXFB 5D1ZC 4M03A 1GYAA 1WIUA 3ARBB 4AEIL 4JPIB 3IS0X 2H32A 3RNQB 3BESR 3VFVA 3VFPB 1WIPA 5GGVL 2Y7QB 4X5XA 3TH4T 1Z6JT 4DKDC 4MYWB 5K9QI 4ONGH 5JZ7C 5SWSE 3PHOB 5F9JB 1W72B 3S97C 4LOUD 1JHKL 1HILA 3WSQL 4WUKL 1F4XL 1V3KA 5D7SH 5JORA 1FG2A 2DOCA 2HMIC 3WD5L 3GI9H 4M9PA 2NYYC 4H20H 1IQWL 3L3IB 1CICA 2PW1B 4M61A 1QRNA 4MQXD 1DANT 3SE4C 4JHBA 3EYUH 3M07A 3QDMB 3H9ZA 2IH3B 3GKWL 3AS0A 1UWXK 3SKMB 3D5OF 3V6ZB 2W0KA 4G9FA 4NCC1 4HIIA 5JHDB 2K7PA 3HAEG 4MNQE 1AO7D 1XF3B 4LHUD 1FFOA 1E6JH 4Y5YB 5ESAB 5IM7A 4HT1H 3VG0H 4MSWB 1XGRA 2A83A 1YJDC 4JG0L 2G9HA 5KN5A 4BH7B 3WHE0 1NMAH 4BKLB 2HH0H 2J4WH 4NO5B 1JV5A 2Q76A 3C6SA 2A6JA 3P0VL 3BQUA 2XZZA 4APQC 1ZTXL 3TYFA 5B38A 2NY2D 1A2YB 4ONOA 1I7UA 3H7BA 3N1MC 2R0KH 3LEYL 4Y0GA 1SVCP 1BD2A 1U8HA 1S7RB 5F21B 3SDXA 3O45A 3RDTA 3HFML 4EDWH 4CN4A 4XVSL 1DBBH 3VWJD 2V5TA 3ZTNH 1WBXA 1U91B 2WLYA 3AVEA 4HEPG 4JY6A 3RFZC 5CLTA 5IHLB 3RWHB 1BQUA 3FQUB 1PG7L 3WDJA 5E56A 5AYUH 5T1LB 5DJYB 1FLRL 5H94B 3VFSA 1JZ3A 2CR6A 4UQ2A 2F19L 2VQUA 5EG6C 3PWLA 2XY2A 3LS5L 1PZ5B 4AQOA 1ONQB 2MPAL 1IGIL 3EOBB 4G6AC 3ZMRA 3MLTA 3VFNA 1N7ML 5CJXC 5IV2A 5C0FB 4JRXA 3QUMA 1X5AA 2VLJA 4YXHH 1P7QA 2B2XL 3LKSA 4JB9H 4ZUSB 2BJMH 2AK1H 4XBEH 1MCFA 2A77H 1XGQB 1DE4B 3FQWB 2C4XA 1JK8B 1S7QA 3KYMB 3GBNL 3UX9B 4P2OB 5INDB 4M5YH 5C0CE 4CVWA 4D0DA 3FB5A 4LCCC 3QXDB 1NMCC 4H8WL 1ACZA 4OM1L 3FFDB 2CUIA 4GKZB 4HQQL 5EWIL 2D3VA 1XGYH 4NKMA 1MLCB 4K3EL 2BSSB 3WHE1 4LVOB 4B7LA 3VFRA 1AQDB 4P3CL 1MY7A 5EC1A 2RCSL 5L2KD 4D8PB 1R3HA 4OUUA 3W39B 3U0WH 3UTSE 3UJIH 2E9IA 4PG2A 3WNLA 4LCIL 1U3ZA 3RTQD 3S35X 3T8XB 3VWKB 1Y18A 4EIZC 2LTQB 1T6WA 4KGJA 5FOJA 2HT4D 4HIXL 3T0WA 1NJ9B 4PRPA 5EO9A 1FNEA 4Z78A 4HKXB 3RWDB 3WS3B 3TT1L 1UENA 5IB1A 4I4WB 4OZGF 1Q9WA 2AABH 3ARRA 4WW1B 4QRRA 1UB5A 4G8EA 5TDOA 4BK5A 1GPOL 3OKDB 1EEYB 1MCHA 1T1ZA 1WFNA 2IG2H 5JR1H 4OKDA 5C09B 3S88L 4YHZL 5J3HC 2DQFB 4ZXBD 1JF1A 1T2QL 2IALB 1CXHA 4DZBB 1BQLH 4UMGA 3OKEB 3FRUB 3X3GL 2A6IA 3HI6L 5HGHA 1E4KC 3RX5A 1JNJA 4G7YH 2GKIA 3MLYL 4N8CL 1KLUB 4HC1H 3LB6C 5EU6D 4NN5C 5IK3A 1S7VA 1U58A 1NCBL 1JPFA 3JWDC 2Q3ZA 2C1OA 3IDXL 2ARJQ 1MPAH 4KHXH 4YWGH 2ZJSH 3E2HC 1S9WB 2O5ZL 4V2BA 4NN6C 5GZNC 5MEPB 1U92B 5C0EB 3C60A 3TNMB 3ZT5A 2LAGB 4FQXD 1RUKL 1CK0H 3GRWH 3VFWA 4M43L 5JO5A 1NBVL 3BPNC 1T20A 5DHYB 4R4FL 1VA9A 1ORQA 3DNKA 3KDMB 4V1DD 3WEXA 4PRHE 5F3HA 4TTGA 4H26B 4UU9A 5DEGB 3RUGF 2H26A 2VLRE 1AI1L 4PJFE 3D85A 4BH8B 4NQXA 3WV0A 4O02L 4AEFA 5BXFA 1FNHA 2EDNA 4LGRB 4OUOA 2DMKA 5EULV 5FYLD 2AK4B 2DLFH 4J8RB 4YDKH 1CGUA 2I5YL 3FQXA 5D6DA 3G5YB 1IC7H 4NKIH 3K4AA 2VRAA 3BH8B 2CIKA 5BRZD 3SDAB 5FYKU 1T5XA 2GK0A 4X9GA 1FZKB 5H35A 3OGOE 1DL7L 4N8PA 4X7DC 4OD1L 1S8DA 4EN3D 1UZ6E 3A6BL 4PJXE 5T3XE 5GPRA 2WWMC 1HH6A 1NC2D 4YDIL 5F6IC 1DBJH 5GS0H 1MIEL 5K9KA 1QSVA 1KC5H 4G6KH 4U6YA 1QSFB 5ITFA 2QTEA 3DOSA 4URTB 3DGGA 1KJ2B 4JFEA 1X9QA 2XKSA 2XNAA 4M48L 4WJ5A 1N4XH 2P5WB 1RSFA 3IDMB 3WHXA 4I9WE 4WUUA 4PTUB 4XVUD 2E27L 1XGTB 5KSAD 1KCVL 3JTSB 4LOUC 5F1KC 1UM6L 1KXVC 2AJXL 1OD7A 4MNQB 2NY4B 2HWZH 3DHJA 4NUJA 1BVLA 3L5WA 5ADOL 1IZJA 2MKWA 4ZYKB 3RU8H 3UPRB 5DJ8B 3VI3F 2F53E 3ARXA 3FTGB 1EEQA 1MHHA 2IFGA 4IRSB 4LSPH 3UYPA 1A6AB 2FIRT 4MQXC 1A7NH 4MA3A 2H2PD 4QRTB 4PJIF 4RMRA 5GHWH 4FABH 1LDPL 4NNPL 5AZ2H 1G7IB 4UI2A 3O3EA 4OJFH 1I3RA 3BN9D 3WFZA 3MRMA 1EVUA 2ERJB 3MCLH 5C0JA 2EIDA 2Y23A 4QY8B 3QHZH 1OAUL 4MA1C 1BBDL 3OB8A 2BNRB 3DSFL 4IDLA 3X11A 3HR6A 3QA3A 5IFHL 3EFDH 5BS0A 4A2LA 4AEEA 2JTDA 1PG7X 2YR3A 2Y07L 5DGRA 5D70H 2PYEE 2A0LD 1G6RL 1IFHH 2ZKHL 5FYJU 1F97A 3FO0L 2YUVA 3KLSA 5ISZB 1EEUA 2I07A 2QLVB 2NY2C 3CLEH 5ICYB 4JPVH 3P11H 1MFDL 4PJGF 4WV1B 2X4PB 5I1LA 1AXTH 1LO2L 3D69B 2H41A 4HF5H 1OPGL 3RAJL 3D2UB 5FYKE 4MJ4A 3VWJC 5KVGH 3FQRB 3TA3D 3HG1D 3CX5K 3V9FA 3P4LA 4X4YB 1TZGL 1OLLA 1WCBB 3WFDH 2R1XA 1QLFA 5A43C 5C0CB 4LIQE 3BAEL 4F15B 4ODSL 3QH3A 1L7TH 4GRWB 4Z0XB 1OARL 1LEKB 3CK0L 2OQJB 5GS2D 3E6FA 2Q8BL 4RQQA 1S9VB 5CEXA 3RWFA 2FCBA 5EPMB 1P6FA 2CKBA 4LFHG 1CD9B 1XF4B 3MGOA 3WCYA 1BHGA 2ZCLL 3UTSB 2GTWB 3IRPX 1YA5A 5HDBF 3OBAA 1NGYB 3LMJH 1PD6A 3BP5A 3QEGH 4LGSB 3OKOB 4GQPH 3GSVA 4BSWA 4QTIL 3TZVD 1TJGL 1LO5A 3KXFD 3MRNB 4XBPB 4PJAF 1Z3GL 3NFSL 4FZ8H 2BC4A 1KEGH 4NDMA 3SO5A 1DQDH 3KPNB 4P5TA 4TVPE 5KS9A 5C0ND 2VAJA 4JREB 3WIHA 1N0XL 1QR1B 5IF0B 3VCLA 2ICCA 2MTPA 3QZWA 2K9UA 4FFVD 2Z31A 1O0VA 2P5EB 2W60A 4BYHA 1SJVA 1PBYA 2EDWA 4MCZA 4ENED 3RTQC 1FYTB 15C8H 4N0UA 1NCCH 2HT4C 5T3ZH 1NAKH 3TV3L 1EERB 1NAMA 4HPYL 1IEHA 3VD3A 4PBVC 3U4AA 3D9AL 1OGAE 1R24B 2CJUL 5CD3B 3UZQA 1F5WA 1FBIL 1FSKB 3MNVB 1HI6B 2DLIA 4PJDA 2DQJL 1U93B 1SEBB 2XQYK 4HXAL 5CD5D 4OZHE 1BQHG 4LCWA 5DUBB 3DBXA 5JHDD 4UT9H 4MXWL 4ZXBC 5JIIA 2D03L 1S7SA 1ZSDB 1EGJL 3ARGA 5DFWH 2EKSB 3SJVA 4IIQB 5JIHA 4RAUA 1JWUA 3NIDF 1AIFB 1KPRA 5HHOA 2Z92B 5GGRY 4IDJL 2ITCA 1WBYB 1CLZL 2FD6L 5DJDA 3DJ9A 1KTLB 4QTHA 1WF5A 4PPTA 2ZPKH 2PYFB 3IXTA 3JV0A 2X05A 5LKNA 1HHGA 2O61A 3C5ZB 4TSCH 2V2XA 3BMWA 5SX5K 3TVMA 3WIFA 4FQXC 3G5VB 3MNZB 4R7NB 2P8LB 5SWZA 4JZJA 4HGMA 2EIZB 3VMOA 5DT1L 2OZ4H 5T1LD 5IVXB 4PJXB 1OAQL 3PV7A 3QXWA 4JM4H 1HHKB 2OBGA 1XCQA 4IMKA 4P46A 3EFFB 1S7XA 5I1HH 3QIWA 2CH8A 1JNLH 4JJ5A 2V2WB 3HUJF 3MUJA 3L5IA 3DVGB 4KJYA 4X6DB 5MERB 3TJEL 2NW3B 5K59F 1NGZB 2N7BA 4K7FB 1TTGA 2P44B 4P2OD 3N0PB 2I9LA 4EN3C 4KDWA 5HDQH 1W0VB 4WW2B 3ULVH 3RWJA 5EZOL 3NA9L 2MMXA 5LCVL 5FHBL 4POYA 1A1OA 5LXGL 3MV7A 1QQDB 1DN2A 1A6TB 4FHBD 4DVRH 3OJVC 2UVFA 4X80H 1UEMA 2CRMA 3F62A 3GSXB 3U7YH 2GT9A 3V6OA 3LH2L 1QFWM 3ELAT 3LPGA 3MRLB 5I1KH 1SJEA 2CRYA 2YK1L 1CE1H 2P45B 4QXGH 2X4TB 1JYVA 1XEDA 1T04A 4ELMA 4X9HA 2M8XA 4XVUC 4YHMH 3GKZA 5KSAC 2DQDL 4PJ7A 3VWKD 3GMRB 2VXSL 5BW7C 5DK0B 3AROA 5E8PA 4QXTB 4H5SB 4NZJA 1NEZB 5F9AC 3GMQA 3FO2B 5ICXA 1CF8H 3RKPA 3EGSA 5E94A 1OP5H 3FN0L 5J13C 2FX8H 1HHHB 1W8OA 2HJFB 5IVZA 1EZVY 2PYEB 4OCSH 3QWOA 2ICWI 5BVPH 1INDL 5A1AA 5FA3A 1N5AB 4ZTOL 3MV8B 2X42A 5T1MA 2R39A 2H2PC 4UT6H 5FO7B 3MRPB 1KJVB 3LEVH 5DGQA 2A74B 5GQBA 1QP1A 3BN9C 3OR7B 5I8OH 5C0GA 3DURB 1N3NA 3IDIA 5IBUB 2Z8VC 5HSFA 4NBYB 1KCKA 4MDJA 3KPSD 3AREB 4LLDB 2DQCH 4C56D 4EQ2A 1X4YA 4S0SD 2QL1A 1OAXL 1CFVL 1G7QA 5IQ9B 1I1FA 2NQCA 3L3DB 4K71B 2WV3A 4K2UL 4F33A 5IOPA 2A0LC 3OHXB 5LQBH 5C0RL 1KV3A 2XY1A 3LN4A 1G0XA 4A6YH 2DWDA 4PRIA 2C4FU 1IE5A 1EBAA 2EC9U 3SQOL 3ZDXE 2VISA 4N90E 1FZJB 4N0FB 1F58L 4XRCB 2R2BB 3K4ZA 2B1HH 4J3VA 3BDYL 3QFJA 1D6VL 1T21B 1DDHA 3TA3C 3NCJH 4B50A 1TTUA 2GJJA 3VXOA 3JSSA 1J8KA 4LU5H 2XQBH 4JPWL 4BJLA 5FO9B 1C16A 1ORSA 2O5YL 4L4JA 2D0HA 1OF2A 1Z0NA 3WDIA 4L8CB 4RWYH 5ID0A 2AK4D 1NGXA 3IFLL 4DKAA 1QFUL 4YAQA 1B0RA 4J3XA 2GITA 1IL1B 4Z7VB 4NQSB 3W9EB 2H6PA 3BWAB 3EYVB 3BT2H 3FN9A 5ECJE 4AL8L 3SDAD 2IAMA 3CFKB 4IJ3C 1FL6A 2X70B 1X4XA 5I8EB 2GFBB 2AQ1A 2DQTH 1QRNE 3C5JA 4JVWA 1IKNC 3BGMA 1GC1H 3BKML 4I2XE 4F7PA 1L0XA 4Z5RB 3TZVC 3MBEB 1Q9OA 3H2WA 1Y6MR 2EYSB 5MENE 4HIHB 3UJJH 1JMXA 4L3CA 1JWMB 3VXUE 1C5CL 1QSFD 4OI9A 1K6QH 1IEAA 1K8IA 2W0LA 3C87A 1GAFH 5C0NC 5CIPA 3QB7C 1EJOL 2ZNXA 2H8PB 2P5WD 5FK9A 2FIKA 4FFVC 1CGYA 3PQYA 4HBCH 1C5BL 2PO6A 3O11A 3O81A 3O3DA 1CS6A 4OZHB 4E41D 4ENEC 3OAUH 5EUKA 1A6UH 4MNQD 5ESVB 3RI5F 2NY4D 5AAWA 1UQSA 3W2DL 4FOMA 4WTXA 2YXMA 1CFSB 1J1PL 3QCTH 4WWID 5GRXG 1KN4H 4LSRL 2DMCA 3SDXE 5JA9A 3F58L 1RZFL 4IRSD 5C3LD 2BCKA 5HGAB 5EU5A 5I16A 5DMIH 4L29A 5HVGB 4M8QB 2UY7A 3DRQA 5E70A 1CU4H 4ODVH 3DX6A 3SCMB 1C08A 4CMHB 1IC5H 2VMFA 4UNUA 4MQ7A 5CD5C 2YPLA 4JHWL 1HDMA 1SYVB 4PJEB 3QZWG 4JPKL 2BNRD 4RMUA 4LF3A 2IQ9L 5DQJB 4Y5YC 1T7VA 2J7LA 4G6FB 4Q74A 3TEUA 2VLJE 4MDIB 3W81A 3IDUA 4GUPB 2D31A 3IFOA 2EKJA 4DGVL 5IWLC 4IS6B 4RA3A 3FMGL 2BHYA 4LEXL 4G80A 3BZEB 5ISZD 5GXBB 4YDJB 1WAAA 5CMAB 2R4RH 4PB9L 3GB7A 2YD2A 1F90H 2V17L 2G60H 4HS8L 1V8HA 4XAWL 3T0BA 4U1MA 4F57H 1HHIA 3D2UD 5TE4H 1K5NA 3QRFM 1KB9J 2YPKA 2HLFD 2NY1D 4M3KB 2Z91B 3QG7H 5EOCL 43C9A 4OM0H 3MRGA 4JG1L 4DCQB 1JHLH 3FN3A 5IB5A 1OSZB 3VFTA 3PV6A 1YEKL 1YPZA 3DUHA 3MACH 4MNHA 4QWWD 1QUNA 2R0WL 5CJQL 3HAEH 1OQOA 2XQYG 2FO4B 4BZ1H 1IAMA 1JN6B 3N50A 4PRPE 3H42H 2BNQB 1WBZB 5J57B 2X40A 4CU6A 5E08H 1XF2A 4O2FB 4QRRE 5GS0L 3BKCH 5F7DB 1A1NA 4XNQA 3S4SG 3QJFB 3H8NA 1L9MA 4PTTA 5KJRH 3ARSA 3QJHB 3ULSA 4P2OC 4XP6L 4NT6B 3WFBH 1QYGL 4JN1L 4GRWF 3BISA 4HGKC 1J0JA 3TGXA 3P4OB 3H3KA 5LVEA 2V9RA 1VACA 1TJIH 4LVOC 3OR6A 4RRPA 1ZA6B 4BSVA 1J8HB 1KG0B 3H3BC 5I30L 5IW6B 1LP9A 2P5ED 5E2TH 3T4YA 3QIUB 2J3SA 4NNXA 4HW6A 5J7CC 1FYTD 1U8MA 5DVMA 3VWKC 3MRCB 1VSCA 2LTQC 4RWHA 1Q0XL 3RZCB 3L3GA 5IEHB 1AKJA 2R15A 2N7AA 1NPUA 3AAZA 4O58H 1I85C 3X3FL 1I7RA 2PTTA 4XPAH 2CIIB 3V4VL 4ELKB 4Q9RH 4U1NB 2O5XL 1ZMYA 3ILPB 3CDGA 1GGCL 5ID1A 2K1MA 4WCYH 4M4RA 4OF5A 3MBXH 4PD4K 4S1RL 4UQ3A 1NCAH 3KJ6H 1IGML 1BFSA 1T0PB 1DLFL 2X9YA 3F7VA 3WBDA 5L7XH 4OD2A 1F4AA 1MI5A 4KH2A 1JI1A 1MEXL 1BFVL 1U95A 3L9RA 1F6FB 4XPGL 5JHLL 4QOKB 4M62H 5D2LB 3DX7A 2WBWB 3OJ2C 4JAMB 4P9MH 1FPTL 4N0CD 2X9WA 3F8UB 3TBVB 3HPLA 5EOTA 5F44A 4DOHE 2DLHA 1L7IL 1MCEA 1KUMA 3V0VB 2A9NL 3BW9A 3P3YA 3QP3A 3SGKA 1I8LC 4OFVA 4Y2DA 4EBQH 2FJGA 2JB5H 5IVOA 3C5ZD 1RJYA 3G5ZB 1CLCA 3CCHA 3B2VH 1MQKL 5HBBA 5D2NC 3LIZH 5EBMB 5CINL 1I7ZB 2IANE 3S34L 3JBG7 4JFEE 1DVFB 4AH2B 3O9WA 5T3XD 2J6EL 5IJKA 3KYAA 4I2XB 1KB5H 3ZSTA 2EXYD 3MJ7A 1CCZA 4LCYB 4LK4A 5MENB 5GGTL 3OGCA 5CZVH 2VDML 1I4FB 2N56A 1M6OA 3VXUB 5JW3L 3PABA 2FWOB 2F8OA 1IGCH 1SY6L 4X6EB 3SDAC 4Y4HB 5C0AA 4LPCA 4WEBL 4Y4FA 2BDNH 12E8L 3PGDA 4LBEB 4JANA 2HRPL 3B8YA 4PRDA 5D7IA 1U36A 2IBZY 4JO2L 5IVXF 3ZT7A 4YZFE 4PJXF 3G6AB 3ZDYE 2F15A 1OW0C 1RJLA 4RISL 4LPTA 2ADFL 4G8GB 4U0RC 3FONA 2OL3A 3EW3B 1DFBL 4ZOCA 5EBGA 1MCDA 4OQTL 5E99H 2G2RA 4PV8A 3RPKA 3WE6A 4E5XB 4HUXB 1S9YA 4BUHA 3MMEA 4X6DF 3PDOA 3DWTA 4FQIL 2FNBA 5CP7B 5DJAA 2AV1A 1RURH 2IQAA 3QCUL 4RCAA 4PJCB 1KELH 4RDQF 4L8SB 2NY4C 4LLWA 4NKOA 4M7JH 1SYSA 4WW2F 4TUOA 1MUJA 3G6JB 2L4OA 4GQ9H 3VGGA 4YFEA 1AD0B 4YGVB 3X17A 4IRSC 4PUBH 5DRWA 1KT2B 3LV3A 2R1WA 3MV8D 1T2JA 3QQ4B 3RVVD 1T0MB 4BZYA 3V5KB 1HHJA 1X5XA 5K33A 2DLGA 1XF5A 1Q8MA 1TVBA 4NPYB 4UV4H 3MJGX 5E6IB 1XIWB 5IEKA 5DRZA 3ARED 4J1UA 1UB6A 1QSEB 3CVHH 2VLKE 3A6CH 3BPCB 4GAYA 4QT5A 5T3ZE 2VAAA 2LQRA 2OSLB 3KPLA 2EE9A 5I18H 2NY5C 4X6FA 1ACYL 5DR5L 5A2JH 5KW9H 5CWSB 1BLNB 2AEQL 3MRHB 4G8FB 4JDVA 3AGVA 1FV1A 5DQ9A 3OMZA 3LAFA 4AM0B 2RGSA 3ROLB 2CXGA 4NSKA 1N5YL 5DJ0B 1MHCB 4NHUA 4XP4H 2AI0H 3KPMA 3MA7A 2B8OT 1N59A 4WV1C 2KQMA 4KAQL 1FGNH 1ZANL 3JV6B 4I3GA 4CNIA 1OWRM 3DVIA 1HQ4A 4QF1A 1WEJH 3GIZH 4R3SA 5FB8A 5BZWA 3BEWA 2HLFC 4YUEH 2NY1C 3P77B 3HZKB 1EEZB 2EH7H 3RVWD 4JJHA 1SEQL 4F15C 1FIGL 2MWCA 1FRGL 4ZOAA 4BZ2L 4MA8H 3V6BR 3IDJB 3ULUH 1LEGB 4QWWC 1A8JH 1JGVH 4N0UE 1FVCB 4UB0L 3TNNA 5MI0B 3SE9H 3BKJH 4OCWH 3U36A 4Z77A 1PYWA 3DLQR 4D3CL 3D0LB 3VRLF 4Y5XA 3U46A 3R4DA 4WFGD 2OXGA 4X98B 3FQTB 5BVJB 5IP4A 1CTNA 2E3VA 3RL2A 1WC7B 3TBWB 3TN0B 2CUHA 1KNOA 5CHNB 4D2NA 4Z7NE 5DJ6B 1JGEA 3FOLA 2X4NB 5IW1A 4LPXA 2AEWA 4PJDE 3T3PE 1ZOXA 5EIQA 4IRJA 3BX7C 4LCWE 4HS6B 4YHIA 5E8NB 3JTTA 4HWEH 5CJXA 5J89A 2ESVB 3LOWA 4KK5D 2NXZB 1ZHNB 3NABL 5A3ID 4OZIE 1ZVHA 3ORJA 4YXKH 5ABDE 5FUOL 4FQLL 4QRUB 1MREL 5CUSH 4YPJA 4JREC 1BBJB 4G42A 1YJDH 4Z7VF 3RIAK 2VDQH 4H8WC 5HHQB 1KTRL 3QEUB 2R4SH 4BFIA 3B9KB 4KGLA 5AZEL 1KBGH 3MV01 4Z0BH 3X12A 2D7TL 5T33H 3GHBH 5IJVA 5IHUL 4FTVE 5JIKA 4MWFA 3C9NA 1Q94A 3KPRA 4KQ4H 1X7QA 3ALXA 4D0BB 3IXAA 5KANI 1QPPA 2E9BA 1NCWH 2A73B 3P73B 5FKPA 3G04B 5K9QG 1RZKC 2DTMH 4HBQA 5SWZE 1A7BA 1G6VK 4QRPE 3GK8L 5ANMB 3OG4B 1YY8A 5DD1L 3MJ9L 4OGXL 3SCMD 4HFUL 1QBML 2BMKB 2KZ1B 4P2RD 4KDVA 1I3UA 3PWPE 4OZHF 1F02I 3L1OL 2OLDA 4GRMA 1YECH 5DZOA 4OCYL 4TUKH 2JIXB 3V5DB 4XC3L 1MJJA 4KZEH 3EOYG 5K9OA 1EXUA 4GAGH 3UO1L 3HMXA 2ZCKH 4N0CC 5LWYL 1EO5A 3QEQB 3EAKA 3EO1A 4QLRA 5EBLA 4PG9B 1FFPA 3I2CL 1B88A 4K23H 4KWUA 2Z4QA 4NZRL 2KPNA 3INUH 4NWUH 3VFGL 4AMKL 2Y6SD 1O5DT 3C5ZC 1MCOL 3SDCD 4K9EL 4WI6A 4MLIA 5HGGS 2CKNA 2J5LB 1AE6H 4NM4L 5AEAA 3O0RL 1MH5A 4PJEF 5EC2B 1Q1JH 3GMLA 1E4KA 2ZUQB 1XR8B 5CSZB 3CSYA 1ZT1B 2X09A 5KSVA 1F3DJ 1FFQA 2HYMA 2ADGA 1IAKA 4ELME 1GZQA 5I19L 4UNTA 2AJVL 3IKCB 2EXYC 5DS8B 4PJ7E 4XCFH 3H9HB 3LQZB 3WFHB 1W0WB 3TIDB 2UUDK 2BNQD 3ECBB 4WWKA 4QHKJ 2ZCHH 5J0BA 4HKBB 1LE5A 4HUVA 3A67L 1TCRA 1DZBA 1FYHB 3VDBA 3LS4L 2VC2H 4R90H 4MB3A 3C2AL 1HEZA 1WZ1L 3KLAB 4NRZA 5FKAA 4JKKA 3VXQB 4K8RL 4WW2C 1F11A 2XRAL 1EAPA 5JW5B 1UG9A 3NFPB 1B0GB 1KFAL 2UYLA 4PJ5D 1FN4B 4WO4B 5JUEH 1IC4L 3L3OA 2XT1B 1AC0A 1QNZH 1ZLUK 3VDCA 5DUPL 4N9GA 2GAZB 3FB6A 4N5ED 2AW2A 2VDPH 1J8HD 1QPXA 3AU1B 2QQQA 1P4IL 4OLVL 1QEWA 4UV7H 5IG7B 3S8WA 1QO3B 1T2XA 3QIUD 5F9DC 5GRWA 1J86A 3GJFH 3BZ4A 3RWCA 1ES0A 2ATPB 1Q0YH 4LLMA 5GGUA 4DGYH 1YN6B 3RZCD 4NCC2 3WKMH 4QHUB 4UTAH 3CZFA 3C08H 5IMOA 3CSBA 3L3KB 5EOQH 4OV6F 3RVVC 3MSPA 4WU7B 1NBZA 4R26H 5DRNB 3IDNB 4XC1L 3IYLW 5D71H 5DC0A 4RIRB 5J1AA 4OLZL 3IAGC 1VADB 4X4XA 4Y5VB 1LO0L 3AREC 1NKRA 5TFSL 3LQAL 2R8SL 3HLAA 2KZWA 5EO0A 1R3LB 1AGEA 3ARYA 3JWNC 4GW1A 5EZIL 4QOKD 5EZJB 4LHJB 3H0TA 4K71C 3U82B 5D7JB 4R4ND 2XFXB 1G9NH 2BFVH 4LQ1A 3SDYL 5F1NA 3RY4A 1RZGA 2P48B 1DBKL 1S7UA 2FBJL 3JV4B 1BIIB 3RHWF 3VRJB 1UACH 3VH8G 4JHAL 4JFZH 4R2GB 5DXWA 2AAVA 3S3PA 1T89A 2FZ3A 5ALCL 5DK2A 1AO7A 2APFA 4LHUA 5FV1L 2DRUA 4YFLF 4GXVH 5CGTA 4YGAB 2P7TB 1YNKL 1DVFD 5TPWL 1U3HA 2A1WH 4OLEA 1EFXD 4NCDA 5LGJB 3QDJB 2YSSB 3RVWC 5D2LF 1R3JA 2E7HA 2EH8L 4GBXD 4LMQE 4DFIA 2R2HB 3MO1A 3PQYE 1JYXA 2W07A 3CXDH 4PR5A 2DQIH 2COQA 2H1PH 2RHEA 2R56L 4P3DB 1HSBA 1GGIL 4WGVB 5D93B 3EO9L 3VXUD 1EH9A 5T5NF 4CUCA 5DMJB 3QUKA 3AMLA 4CMMB 2EO1A 4DVBA 2UY6A 4XWGH 5TH2A 3VWJA 3C5SB 1GGBH 4M7KH 4EUPA 2PF6A 2RR3A 1I9JL 4M6OH 1OB1A 3RWEB 1RZIA 5JOFB 3V6FA 4M7ZB 4FTVB 3CUPA 2QQNL 1BAFH 2YPLE 4G8GD 5LAXA 1KPVA 1RK0B 2YOCA 4IRZL 2BOCA 2RFXB 4XB7A 1H15B 2CLRA 4KK5C 2VZUA 1D5MB 5A3IC 3O6FA 2LVCA 4TVPL 5AD0B 1IAIL 3UJTH 2YBRB 2MQ3A 4NC1E 4QRQB 4QRPB 4GMTH 4M5ZH 2DKSA 3HR5A 4RGNE 4Z7QF 5F7WC 4FQHA 1R6VA 3KYKL 2X10A 5I8KL 4OKVB 2D9CA 3S37X 2AGJH 1AGCA 3QO1A 4P23A 4CADA 5F71A 5KOMC 4CVZA 3MLZL 5IESL 3PWPB 2B4CL 2F5AL 4NJ9H 1R5IA 5ESQA 4IMLA 2DD8H 4PD4J 5I17A 4C55A 3UTPD 1BX2B 3TIEA 3S96B 3CFJB 3O4LE 1YEGL 4KJQD 3EZJB 4Q6YA 1ERNA 4XPTH 1C7SA 3O2VL 2BRRL 2OTWA 4YJZL 5FYJL 3U9PL 4NQDA 3AM8A 3LKPB 4ZUVA 2OR9H 1JE6A 4XP1H 1PX3A 3SCMC 4CMHC 4NFCA 4UT7L 1YMMD 4ZMAT 5E6ID 3NAAL 1U9KA 4KMTL 1WUNT 4JRWA 1MWAA 1QSED 1NDGA 2YD3A 3BE1H 4OSUH 4PJCF 5HPMB 5KVMC 4EBQL 4O2EA 3MRDA 3G6JF 4K3DH 1TJHH 1VKXA 4ORGB 2YWZA 1N0LA 1T5WA 1WFTA 5IB3B 4I13B 2BVPB 4G43B 4N5UA 4A6YB 4GRLB 3IU4L 2VXUH 3O4OB 3QT2A 3L7FA 2EDTA 2X4OA 1MFAH 2Y6SC 5C08A 3KPOB 4ZXBA 7FABL 5B22A 3SDCC 1WZLA 1U8KB 3IJHA 5DEFA 4H25A 1RV6X 3WS6A 1JPTL 4XX1G 4Q6IA 5CEZL 5L8JB 3GSUA 5TE6H 1FQ9C 3N1FC 5I8CB 1DUZB 3WO3B 3T2NL 4FXKB 2M1KA 4U05A 5EU6A 4O51B 2Z8RA 3C6LD 1ZLSL 1S5HA 3R8BB 4TN9A 4PY7B 5TQ0L 5HTSA 2D0FA 1FNSH 1TETH 1M05A 3NCEB 1MWAH 3MXVL 3MRKA 1CVRA 4HDIB 1H5BA 3E6HB 3JWOL 2Q3AA 3OZ9L 1N26A 2P4AB 2X4SA 5ICZB 4FQXA 1CGXA 4GG6E 1UVQB 3S36L 1P6AB 2Q1EA 2E9JA 1N2RA 2Q7YA 3TN0D 4C4KO 4KI5D 3RP1A 4P4RA 3TBYA 5DF0A 4YPGB 4F9LC 2W9DH 4NN7B 2NY7H 2IADA 4S1SL 3PUCA 3MCKA 3RL1B 2WZPD 1KLGB 2VTFA 5FGSA 2WWKT 2DMBA 1I7TA 5DRXB 5GS0D 2ESVD 1I8KB 3EOTH 3HI5H 2NXZD 5C07A 3T65A 4EJ1C 5MEOA 2FJHA 4JHZA 4LQFL 6CGTA 3NGBB 4XMPL 3DV4B 4XVTL 3R06A 2FX7L 4N5EC 4PREB 5GS3A 5GGQL 4JN2A 5SV3A 4L1HA 1UFUA 1FDLL 1BIHA 3B9KD 3QIUC 2OM5A 2IFFH 4XCYB 3F7YA 3HI1B 3KYOB 4K3JH 4NQEE 4EN3A 1IM3A 3VJ6A 4YXLL 4KI5F 4K94L 1I9EA 1JRHH 1IGYA 4JFDD 5DD3L 1IAII 3RZCC 3NIFE 3MJ6A 1NC2A 3LEXB 2HVKB 4JY4B 4U1KB 4FQJH 4X7SL 2F58L 1ZS8B 1A4KB 1G1YA 3PGCA 1UJ3B 3ET9F 4PJIA 3AXLA 2GCYB 1G9MH 2YWYA 4XCEB 1LE9A 3QQNA 4LAQH 3BPOB 1VHPA 3QI9B 4KTEH 3S6CA 1A5FH 2B0SL 2W65B 1NDMB 5IB2B 1WZKA 1RIUH 5F70A 5BW7A 3TP4A 2J8UB 3DIFB 5FYLH 2PUQT 1A6ZB 2OX5A 3N9GL 4PGDA 5FECB 1AGFA 1CVSC 3MRFB 4TNVK 4U1LB 4ERSH 2X2YA 2AS5M 5SX5H 4R4NC 1RHHB 1KENL 3QEQD 2HVJA 1SVZA