3SQBB

Structure of the major type 1 pilus subunit fima bound to the fimc chaperone
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
145
structure length
145
Chain Sequence
b'EVVNAACAVDAGSVDQTVQLGQVRTASLAQEGATSSAVGFNIQLNDCDTNVASKAAVAFLGTAIDAGHTNVLALQSSAAGSATNVGVQILDRTGAALTLDGATFSSETTLNNGTNTIPFQARYFATGAATPGAANADATFKVQYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chaperone protein fimC
molecule tags Structural protein/chaperone
source organism Escherichia coli
publication title Quality control of disulfide bond formation in pilus subunits by the chaperone FimC.
pubmed doi rcsb
total genus 19
structure length 145
sequence length 145
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2011-07-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 3sqbB00
1ZE3H 4AUUA 2XG4B 4J3OF 5FWRA 3MCYA 1UWFA 1TR7A 3ZL1A 4AVIA 1KLFB 3BWUF 4X50A 4X5QA 5AALA 2UY7B 3SQBB 4CA4A 4AUJA 2J2ZB 4AVJA 1N0LB 5IQOA 4XOEA 5IQMA 4AVHA 5LNGA 5AB1A 4J3OH 5FX3A 4XODA 4AV0A 4LOVA 1N12A 1QUNB 4X5PA 4XOAA 4XOCA 3BFWA 5FLUA 1PDKB 4AUYA 4XO9A 5AAPA 3ZPDA 4AV5A 5LNEA 5JQIB 3RFZA 2WMPB 2UY6B 5IQNA 3BFQG 2W07B 4XOBA 4AVKA 3JWNG 2JTYA 4BUQA 2XG5B 3JWNH 4AV4A 4CSTA 2JMRA 5CGBA 1KIUB 3ZL2A 4CSSA 5ABZA 4J3OG 3ME0B 5F2FA 5F3FA 5FS5A 4XO8A 3JWNE 4ATTA 2VCOA 4X5RA
chains in the Genus database with same CATH superfamily
4TNWK 1H19A 5JXEA 1F4WL 1J86A 4HLZH 3F64A 3CGTA 4FG4A 1BPLB 1U8QB 4J4PD 2W59A 1UH2A 3WL9B 4HGMA 4IHOA 1F6AB 3GSNL 3NJNA 4HPOH 4N0CC 4J5VA 3BP5B 3C9NA 3DGCR 1KB9J 1WBYA 4X99B 4X7SH 4IBSA 4Z7QE 3T6VA 2BC4A 3NCXA 4PJBE 5FO2A 1RURL 2EXYC 1AGDA 3EH2A 4KOCA 4ZFOB 3UBXG 3D39B 3BGMA 3L1FA 2D7TH 1NOLA 4Y1AE 3HFMH 1YC8A 4JRYB 5D71H 3LZFH 4U0QB 1N59B 1OAZH 2F7IA 3C8KA 1OTTC 4AL8L 3BXNA 3DO7B 3UAFA 4HWBA 2WYZA 5JYMA 3AU1B 2ZCHL 4LLAA 5A40E 1HYSC 3ESOA 1MEXL 4BRJA 4L4TD 4GAGL 2IOOA 4HULB 1YMHA 3AB0C 2APFA 3RWIB 4YSQA 1S7UA 4YDLB 3NPSC 4R7XA 1U58B 3ULVE 4NQUA 3UTZB 4ZXBB 1AR2A 5GZNC 2NY7H 3UAEA 4FZEL 1KUMA 2JB6B 2JNZA 3MUUA 4GSRA 2WM0A 4KKPA 1S7WB 1T1ZB 3DETC 4Q6IC 4ENZA 5FW6A 3P0VH 1JHLH 1H5BB 3H9YA 1BFOB 1I1AA 4M3HA 3WU1A 1IQWL 1EANA 3DX9A 3ECVA 3TBTA 4H0GA 1KC5H 1DEEA 4R2GB 4FFTA 5G55A 2DWEB 2RACA 3PYCA 1Q0YH 1M2VA 4KKAD 3BPOC 1L7TH 3SKNB 4R96A 1LEGA 3L95A 2X6VA 3VXSD 1A14H 2Z93A 5TFSL 2CALA 1CFMA 3QDJA 5FWRA 1RJLA 2IBGA 4BFIA 1F0LA 1LMKA 2GTWB 1CGXA 4LZKA 3A4AA 4NZUH 3O8XB 5IQMA 1T2XA 5I5RA 3VXPB 4DPBX 1I1AB 3HPLA 2G5UA 1IGTA 2X6AA 5D7IE 4DGIL 5INCA 3KLAB 4PRBB 5HJGA 3APNA 3Q1SL 2FYVA 3FF8A 2XWCA 1UWGH 3ZRCC 4BD4A 5KVDH 1PKQA 3QQ9D 1NFIB 1VGKA 2A38A 4CU7A 4OCRL 3VWJD 2IADB 3KPQA 2LAGB 2HRHA 4PRDB 5F1SA 1UXSA 2D7MA 3P4OB 5HHXH 5EWIH 2BIOA 3PWVB 2K1MA 5HDQH 4ODUB 4PRDA 1XF4A 2IMNA 5TE4L 4FXLA 1I9JH 1OSZA 2DH2A 4MNHA 1LNUA 3KWWA 4Z0XA 4YHNB 3MI6A 1G4MA 5E00A 1CE1H 5E08L 5IM7A 3PGDB 4NWTL 3RUGB 4FYRA 1AXTL 5INCB 3DSNB 1BX2B 3BQUC 4RAUB 2WLKA 3JYCA 4DKDC 1HHJB 3ZMRA 5C2UB 1IC4H 4S1SL 4FQQA 1ZIAA 4QEGA 1UQSA 3L1GA 2ZWYA 2WTPA 3EYVA 4LASH 4S0HA 4GXFA 3HC3L 4MXWL 1FF5A 5F9JA 5ICYA 1I75A 2K9FB 5JHDE 1CI5A 2WUBL 5JHLL 5HGBA 1AYOA 4KHTL 1JN6B 5ILTL 3B3IA 3CDFA 3BPLC 3P0YH 3QFDB 4FFWC 4PJ7B 4UOW0 3WNJA 3FUFA 4OZFH 1RHFA 5TPWL 3ZHNA 5DVNA 3CFCL 4LLMB 3T2OA 3U6XA 4JKLA 1NMBH 3TBSA 2B4CL 2WQWA 5I74C 2V7NB 2VMCA 2X89A 32C2A 3TCLA 3B7UX 1B6DA 3CMGA 3LQZA 4E9WA 4MMZC 4FQQB 4J6RH 5BRZB 1SBBA 5E2WH 1S7WA 1OQOA 4C83A 4PRHD 2YWZA 1C5DB 4IIQB 2I5YL 4NKIL 1QRND 5HD8D 4JPSA 4KGLA 4UTBH 5DLML 3RGHA 3SDAC 3IGAB 1NEZG 3QH3A 4HWUA 4G7YH 5GGVL 1JNLL 4HDIA 2NW3B 3RX5A 4W68A 4F15C 4IRSD 1J8HE 1PNCA 5CU9A 2E27L 4NHCL 5AWNL 2IALB 2DS4A 4U4BA 3A3YB 3F6LA 2CMRL 3UO8B 2XKNA 4YGAB 2AXHA 1A8JH 1B0GA 3EH4B 4L29A 1WIOA 4DIXA 1UZGA 4Y4KB 2EXSA 2OW6A 3CBRA 2D3JA 5M95B 1OOAA 4PSRA 32C2B 5JHLH 4Z7NF 4X6BB 4UT6L 4PBWD 3ELQA 5KVGH 3V5HB 4HEPA 1A6AB 1T5WA 4PRBA 3UJTH 5D93B 1P69B 2YRLA 4RFNB 4EN3A 3L4TA 1ORQA 5GRJH 5CLTA 2DJSA 4D9LL 4UQEA 5ICZB 5D1ZA 3IMTA 4XMKH 2WVSA 3QRGH 4B9YA 2PW2B 2F19H 3ARRA 1DFBL 3QI9C 3K6FA 3O11B 4EZLA 5KYXA 1OP4A 3HS0C 1O9ZA 1RJLB 5CJQL 5KVGL 1A1MB 3ZTEA 3ILPB 1EFXD 3B2VH 3MXWH 3DURB 3LV3B 4DT2A 4GEIA 3MRPB 2EEBA 1TJHL 1G6VK 4QJ4B 2FR4B 1UOKA 4N8PA 5C0EA 4FL4B 2P43B 1A4BA 3ARTA 4NO3B 3U9WA 4JPVH 1E27B 3PDDA 1KT2B 4G1EA 3X3FL 4WWID 2IV8A 1EZUA 2BSEA 2X4QA 3OHMB 4ABVA 1SJEA 5EBGA 3QDMA 1J05B 4QHMA 5I1DA 3LV3A 3TO2A 1SGKA 3BWAB 3BVXA 3QW9A 1GYAA 2ITEA 4HMCA 3D8MA 3I74A 4ZUUA 3SDCC 2EICA 2CUIA 2J25A 5E8PB 3VXOB 4IBZA 2O6FA 4TUJA 4H44C 2X3BA 2YD1A 1P84J 4ZRGA 1LWHA 1S3KL 2OJ1A 1H8OA 2KLTA 1FCGA 4KROD 4PGCA 1IM9A 3TBCA 1WWAX 2OSYA 4DP8X 5HHNB 4ZUTB 1NCAL 5F0JB 5E6IA 4LOFA 4AQEA 2DKSA 3WIHH 5D4HA 5I15H 1ITBB 3DRQB 4K3GA 1BYNA 4Z7UE 2QZ5A 2H2PD 1UA7A 2HFGH 1Q1PA 1ZLDA 1T22B 3S7GA 3V0VB 3HBZA 1T66D 4KROB 3WEXB 2VTFA 5AVXB 3GO1L 2ZAIA 3B9KC 1HK6A 1HHGA 2OYLA 1JPGB 3BEVA 3FH7A 3SO3C 3NP3A 3OMZA 2P80A 3HZYA 1RHHA 4ORZC 1AG0A 3CC5B 4U3HA 4NXSA 2Q8BH 3MV7D 1ACXA 3I9PA 2VR3A 1MHEB 4F57H 3IVKB 1OAJA 3IB4A 5EBMB 4R3SB 4Q0XH 4RRPM 3VFVA 3KPRA 1EMTL 4OD3H 5F6IC 1YDPB 4GUOA 4D9LH 1AHWB 2QL1A 1GGIH 4HU8A 2C4XA 1TEYA 3X1EA 1R5IA 4KRNA 4GMSL 4HFUL 4TSBH 1UT9A 5IKCB 3CUPA 3NCEB 2EEFA 2VW7A 4WU7B 3D33A 1KCVH 3F85A 1UD5A 4RQQA 4F9LA 3WFDL 3WO4B 4JZNB 2DTMH 5AOMA 1S7VA 4G5AA 4D9QD 2FO1A 4G8EA 1EBAA 4WFGE 2E9IA 4B7IA 1BJ8A 3ZHFA 1EFQA 4Z1PA 3J7HA 5C0CD 4FNPA 2BVYA 1I1YB 3QIBC 4PJIF 3Q6GH 5E94B 4XMLL 1P53A 2ZXEB 5AVRB 1OARH 4E9TA 1N0LB 4QKTA 1UJ3B 1WBXB 2OMBA 1AACA 2VXUH 3B6SA 4G9DA 2CRMA 2UY6A 1WBYB 1PZSA 3OR6B 1AIFB 4XMVA 2XWJB 5TE6H 1F8TL 5B22A 2QHRH 4GXVH 5DJCB 3US9A 4KQ4L 2AQQA 5DVOA 2BVQA 2D3NA 5EU4A 3UH8A 1BG1A 4ZO6A 4Q4EA 1LL1A 1E5AA 4Y5VB 3U46A 3IAPA 3EBIA 1AS8A 3BVVA 4JFUA 3MLZH 3I84A 5TF1L 2ZUQC 2FQFA 3NP4A 3U7WH 5C0GA 4LCUB 4AKOA 3MLYL 5FCUL 1RLBA 3M1CA 5B1AB 1YO4A 4EDXA 3QORD 1JFHA 1NBCA 5KVFH 5DQ9B 4EI6B 4YSDA 2IBBA 5DJ2A 5F9WB 2COQA 4BRVA 2AMUA 2NY1D 2V9QA 4KY1H 2MIZA 2ZICA 4RGNE 3CQQA 3GSOB 1BXUA 2K7QA 3WHE0 1AE6H 1S7UB 3IXTB 3PQYA 4CSPA 2R0KL 2Y07L 2GBAA 1XB8A 1NFDB 4GW5A 5DHDA 3LZRA 3OKLA 4ZMLA 2VQ1A 1Z7JA 2DY2A 4CSZA 5LGHH 3D3VB 2GK0B 5DK2B 3BXNB 4LCUA 2MOQA 2G3XA 3P9WB 3AABA 3SE4C 5M94B 1E4WL 2X88A 2CBQA 3AS1A 1KGCD 2V2WB 3QNYB 2NZ1A 5L7XH 1E6JH 3RL1A 5E6IC 1CK0L 1AI1L 1PGRB 1U8KA 1KBKA 4HG4J 3GBNH 4MXVE 4DSYA 4WHYH 4AIEA 1LWJA 1HHHA 4PJCE 2VISA 5ALBL 1U8KB 1Z2KA 3C5SB 5JHDD 3BKCL 4HH8A 4IYKA 2YQGA 1KB5B 3PWNA 4L2YA 1XB6A 3ARSA 3N0AA 5MENB 4TUOA 1B2YA 3RY6C 4AYFB 5TGBA 1ZV2A 2Y2YA 1AD0A 2OLDA 3A24A 4NS0A 2GC4C 3WS6A 1S7VB 3GTNA 1D5XA 3JVGA 4JDZB 4KH2A 5H94A 1IGIH 3V9FA 5EWIL 1S7RA 3KLLA 3LXBA 1I9IL 1ASPA 1WIPA 3NSJA 1HKLH 4FYQA 3FW6A 3HUJE 1IBGH 2YEZB 2HFFB 3SCMC 2P5ED 1I85C 1OSPH 1JGDA 4R26L 4RSVA 3T6XA 2V8LA 5HPOA 4IS6B 4NP4H 1D9KD 1V8HA 1E5BA 1NIDA 2WWMD 1LHZA 2DQJH 4L1HA 5E2UL 3HHSB 4YX2L 2EZ0D 1A2YB 1NAMA 1ZGLM 1I9RL 1I9EA 1LQBC 4EN3C 4BK5C 5HY9B 1SJVA 3OJ2C 4JBSA 5JQ6L 2H4EA 5ECGA 1OAQH 5ANME 2JKRM 3BWZA 4CGTA 3U7AA 3TM6A 1DSFL 1RD6A 1OEZW 4RMSA 4RRPA 1Q90A 4DQAA 3NTCL 3TIEB 2RFXA 3T65A 1PLGL 1EEZA 1FNSL 4Y9GA 5GS0D 5IJBC 3GSVB 1XXDC 4QXWA 5D71L 4AYMC 2UZXB 3GTVA 5E6RB 2LOEA 3KWVA 4M7KH 3L54A 1MVUA 5T1DH 1EGJH 3NABH 2EDKA 3F12B 2PYEB 4FNLH 4X8JA 1UA6H 2IH9A 5IZ7A 3O9WD 3VXQA 2BXYA 3CXHJ 1YECH 3PE9A 4EE2A 2JKXA 5C70A 4DEPB 2JSFA 4G1MA 1NFAA 5E2JA 3LVTA 1RUKL 3CSPA 2DQJL 1R75A 3FN0L 1U8MA 2VT0A 2EILB 1FYTA 4C4BA 5AD0B 1XF2B 4F8QA 2DLEA 4ODSH 2ZCHH 1AG6A 3W5NA 4JFFD 1ETJA 3HVDA 5ERWB 4JN1H 2EXWD 1PZ3A 1IGMH 1JNJA 2J5LB 4MCYB 3O0RH 4HJUA 2F0CA 3DC0A 1ORSB 2NY0C 1R5VB 3PNWA 3MRLA 1RZIA 4H88L 3ULUC 1KGIA 2R69A 3AMLA 2XU9A 2JKWA 4I2XA 2A4EA 1HSBA 5GJTH 2CG9X 3QXAB 2DM4A 5IGXH 2WXFA 1RHHB 1JERA 2CJSA 4P3DA 1U3HD 3Q5OA 1GIGL 4K5OA 2X12A 4DZBB 2BSCA 2H6UA 5GGRY 4KROC 1UKTA 3KPSA 3P0GB 1W0YT 2XQ0A 3ULUF 2E75C 1PCSA 2G9KA 4F2MB 3CSYA 3S4SG 2ZPKL 3BJLA 5IFJB 4XVJH 4F7EA 2X7LB 4LVOC 1U3HB 3FHAA 4XVUD 3K4DA 1HDMB 3MSPA 1UZ6F 1M56B 4WJG3 2O4EA 3EJZD 4DFHA 4PJ8D 4C4KT 4ZMZA 5BQ7B 1JRHH 1ZT7B 2AJUL 1CT8B 3F58H 2G2RB 2HLFC 4KMLB 4ZNCD 5A2JH 5KBPA 3MV7E 3GRGA 4UINL 5JQHC 1CXIA 4LVHC 3QISA 4CVXB 3OR7B 2PNDA 3NFNB 5D5ME 3UCQA 2WVTA 2CIKA 4P23A 5IFJA 1N3NB 1KBVA 1ADQH 1YHPA 5SWQA 4D7BA 1HL4A 3TPUB 3MJ7B 5J89A 3P3UA 4P05A 4F7TB 3WNLA 4PG2C 4PWGA 2AJYL 3V0HA 3JTBA 3CZSA 3EJYC 2FGWH 1X9UA 2NYYC 2W65B 4JJ5B 1IM3A 5HYJD 1F6FB 2CBMA 3ARDC 4NLHA 5T1DL 3K6SB 4ZOBA 1KCKA 4DKFH 1J9SA 3DTDA 3ARGB 4GRLA 5H2BA 3ECBA 3UG4A 3U0TA 4IIQA 2X2IA 3BDBA 4P5KA 2BMKA 4K3DL 3ETBJ 3LJ3A 4KI5E 2GC7C 4QNPF 2X2UA 1BZQK 4OGXH 2WXIA 4HVBA 2CLRB 4ZX3A 3NA4A 1YUKB 4MBRA 2YGQA 4ENED 1W80A 3CLFL 3MLXH 5I15L 2LU4A 4X7SL 1W0VB 5E9AA 5B4MC 3TGXA 2HAZA 1F11B 2ZOLA 2NYYD 3ARYA 3M17B 1HKFA 3FO9B 4MWFA 3IDGA 3BQUD 1XBDA 2QJDA 3SHSA 3ZKSD 5MEOA 3V8OA 4WWKC 4UTBA 2OMXB 2YO3A 4WFEE 5CCKL 2EDMA 3HB3D 3MROA 5C7XL 4TF4A 4RMUA 3O6FA 4L1SA 5DMIL 1TYEB 2D9CA 2QKSA 4EI5C 5IHLB 4XCYB 3B7RL 2V3EA 4RAUA 1U8OA 2RHEA 4YDNA 1P9MA 1UH3A 1NLBL 2OP4L 3FTYA 3C12A 4LLWB 4EQ2A 3VD2A 1W8NA 4X2UA 3L9YA 4CC4C 1AZUA 1UZ8A 2E6JA 1L9NA 1LJMA 1ZEAH 2VR8A 3NOIA 1LK2B 4XE0A 3W9EB 3GM8A 3LSOB 3PV6B 4XXCC 1XHHA 3ZDYF 4J2XA 1JG9A 3V5KA 5IIEB 5FUCE 5LGKA 1J1PH 1ZA6B 4J3XA 3O2VH 4PW4A 4FXKC 1T0NB 3F7KA 3LQZB 4OJFL 1UKSA 5I6OA 3ATBA 1T6BX 3KXFA 3NCYP 2X41A 5J1AA 4BE6A 1MCFA 2WHVA 2H26B 4U1MA 1HZHH 5D7LA 5DHYB 1PJWA 3VB8A 2A9BA 3JVGC 3MV8B 1E5ZA 3U6RB 5EC1A 1OCZB 3IFPA 1SXAA 4AMWA 4PJHE 3QUMH 2WLNA 1N7ML 1FQ9C 5AG8A 2MCMA 3GMPA 1YA5A 3FOLA 3K3QA 1GJIA 3GB7A 4MS8D 3MV8A 2Q87A 1OWRM 3GIZL 3NJMA 3FT2A 3WEOA 4AJYV 3IDYB 4AL8H 3KR3L 5J1AB 2AJVH 3VXSB 2XVBA 1A9BA 1OTUC 3ULSB 4XP9L 4YLCA 1U3NA 4LQFL 2AMGA 2BXZA 5DD0H 3ALPA 5T33L 4HFWB 3WKPA 4OV6F 4KDVA 3C5ZB 3BN9D 2Y7MA 3CFEB 3HZVB 3SBPA 5FFLA 3AM8A 1NC4A 4Q58C 3OR7A 2C3VB 1J9QA 2D7QA 2HFEA 2YPVL 1RY7B 2ED9A 4GW5B 4N5UA 1CE6B 5HJBA 4ZPTB 3IJYA 4MA8H 3TFKC 4J3BA 1DVFA 3K4AA 3HE6A 3LQAL 1BXVA 1UD8A 4KNSA 4I0CC 1FA4A 3ABKB 4XCYA 3KBHE 2Y9RT 1C08A 2PTTB 4IKIA 1E3FA 1EAQA 5FM5O 1HE7A 2KMWA 3WMQA 4CDHA 1FZJB 1IMHC 4EDXB 2QDWA 1L9PA 5FUOL 2Q20A 2WBJB 3D4YA 3QZWA 4YZWA 3WYRA 3AQDA 1Z0MA 2X28A 3BCFA 4OIIL 3DX0A 4PGEB 5DURD 3FKUS 3NIDE 4QRUA 4X6CF 4OQTL 3ZKNC 5KYWB 1VFMA 3HG0A 1IAOA 4NN5C 3O81A 4ZPTA 1KYFA 4QPEA 5DWUH 4G8GE 3GS0A 3GBDA 2XN1A 1TJGH 1ZTXL 4PJ5E 1M42A 1TYRA 2XXMB 4HV8B 4ZFQA 4POZD 4QTIH 3KDMA 1WIUA 3KGTA 4JFYB 2WYTA 1QA9B 3B5TA 2VB5A 1MCNA 5EORH 4AOFA 3VQ1C 4APXB 4OT1L 4LGPB 4QRPA 2XWEA 4LPCA 2JB6A 3CN3A 3HI1B 1W91A 4JFYA 2ZX9A 5D2LF 4JO4H 3X17A 1LD9A 4M1CC 5AVSB 2V2TA 4KO9A 4XNDA 4HSAC 2V17H 1NINA 1Q72H 3PGFH 1HZHL 1CS6A 2GJ6A 4GS7B 5JIPA 3GMQA 1MKFA 3RNQA 5DUBA 1CICC 1MPAH 1GHFH 4BE5A 3IWUA 4R5TA 4ZO7A 1ZLEA 1QRNB 2VXVH 2X09A 1ZHBB 3DX8A 1YPZF 2XYBA 5CZVH 4IRJD 2P1YA 2YMXH 4OJEH 5TH2B 3STLA 4HIEB 2VLME 3WUWA 4BINA 5IHZA 1K5NB 3QRFM 3NT0A 1N64L 3ULUD 1U3HC 5ID0B 1G0XA 4XO3A 4S11A 5TH2A 3STLB 5F7AA 3KXFE 1ED3B 3FOMA 4JCLA 4UV7L 3E6HA 2OMXA 1IFHL 3VXRB 2QHRL 1GH7A 2HUEA 4GXVL 4KXZI 4ZFGH 5EV7A 1J48A 4Z3FA 5DUBB 8FABA 1E8ZA 4GT7A 4MWFB 2V2XB 5FA4B 3WSQL 4UWQB 1KNOA 3LKPB 3BDXA 4I18B 4PM1A 3C5ZA 2MTPA 2CBPA 4QR7A 4BFBD 4KKCD 5IB1A 3MR9B 4MMXB 4J3OF 4UANA 2EVGA 4IS6A 3VAEA 5LQBH 1QFWI 2GEEA 3N91A 3CVBA 1A4KB 1J9CT 5CD5C 5KS9E 1I8AA 4L3EB 4TSCH 4I9WD 5DS8B 1I4FA 3M86A 3CFIC 1YNKL 5FK9B 5E4EB 2DJ4A 4L8SC 2C3WA 4WWOA 4PRAA 3CFMA 2ZOKB 2VLRA 4ZS7H 2ICWA 4KY2A 4MMYB 4FA8A 3GLZA 4KMTH 2E7LA 1HL9A 3WBDA 3P4NA 3UYOD 1CLCA 5FHAH 5I0VA 3BD4A 1M6OA 4FMKA 4OV5B 3RVVD 3X2QB 5C9JB 1SLXA 4ODVL 5FGSA 3GS7A 1AO7D 1MW3A 2FH8A 4MMXC 2EVFA 3LN4B 3GK8H 1DCLA 3MLVH 4CMMB 5GS1A 4UMSA 3MBWA 4I3GA 2Q0ZX 4EMZA 1HIMH 3N5AA 4PJXF 4OBRA 1NGZB 4GO9A 2CE6A 4N4YB 4P57B 1LO2L 1GKEA 1WK0A 3AZUA 2OXGA 2F54D 3T4YB 2BNRB 5CEZE 1HWHB 5DHMC 3O9WB 4PWKA 4CBPA 5E8DH 4FHBD 2ADFH 4PJEE 3F2LA 2B8OT 1C5CL 1DBMH 4B9IA 4KTYA 3RAJL 4P3CH 4PR5B 5KAQF 2BVOB 2WAQA 2X4SA 4M7ZB 4NO5A 3NSYA 4ERSL 4XVUC 5HYQA 3PPEA 3DSFH 5FHBH 2BIPA 3TJHD 3BUQA 4M8QA 2X7LA 2CDEB 3LRKA 4UILL 1MHPH 1WGVA 3ZKMD 4YDVB 3ULAB 3IYLW 1P7KA 5BUGA 1TQBB 5HVWA 2YEVB 5IHHA 1N64H 2IJ0C 2E46A 4PR5A 2Z8SA 2WC7A 2A1WL 1G7LB 2F5AL 1BHGA 2PW2A 2HLEB 4W93A 1IJ9A 3VXUE 2MQ3A 4X9IA 3PWPE 2W07B 4H0LC 4U3XA 3OXRA 1G9NL 1FLRH 2IWFA 3CBKB 1ZPUA 1KF9B 2VL5B 3VFNA 1F3DH 1KLFA 3GNMH 2P5WB 3TPUA 5I6KA 3P73A 4A6YA 4XXCA 3GMOB 1KLFB 4NDMA 3VI4B 4XBEL 1MCEA 4MKTA 3WXWL 3LYRA 2V33A 1KCVL 5JW5B 2LTQC 4F37F 2W07A 3M07A 1M9WA 2YC1A 5D5MB 3D0VB 4ACTA 3RDTB 1GRWA 4NZ8A 4G6JL 2AQRA 4YC2B 1D6EB 5L9DL 2G2RA 5E6ID 2N1TE 4Z0BH 1DR9A 1TZIA 3RQ3A 1ETB1 4M93C 4EUPG 2X4UB 2Z8RA 4LCWD 2CGYA 4JB9L 1G5GA 1MY5A 4NNXA 4EI5A 3D12B 4G7VH 3VGBA 4Q89A 5TDPA 4GFTB 1IB5A 3MODH 5DJXA 3HTLX 4U3SA 2ENSA 4M43L 2YSTA 2J1KA 3CXHK 1NWOA 3C5SA 3PQYD 4GG8A 4Y4KD 1FPTL 4UT9H 4NQXB 5HDOA 2B39A 4MA7L 3V95A 3K71A 3VQLA 2I85A 1OP5H 4F92B 2ZJSL 3AQYA 4FNLL 4HJSA 4XPTH 3L7EA 3O2DH 1ED3A 1VZGA 4G43B 3ARGD 1CFBA 1D6EA 1MCWM 4NPKA 3VTMA 2QVFB 1XF5B 4O9HH 1A21A 3QI9B 4LBEA 2VRKA 5L0QC 4X0KA 5DUPH 3S8GB 1OT2A 2FJFB 3VJ6A 3U4KA 2NNXA 5EG6C 3VFMB 1Y1DA 3JV6A 3LEVL 2BFVL 5C6TL 4UTBL 4K94C 1EFXA 5K1NA 4APQA 1QFWM 3U4AA 3D69B 5IESL 1S6NA 1AHWA 5LXGL 3U4EA 1KEMH 3RNQB 1E0OB 2W9EH 3NRQA 1F45A 5I0ZA 2EVIA 4FZ8L 3DX7A 2GJ6B 4PJAA 2X4TA 3HS8A 1MCHA 3KPOA 4JDEB 2EH7H 4ORGA 3FPXA 5IFAH 4CDGC 1MAKA 1JSYA 4KTGA 4M6ML 2F61A 3KWTA 1ND0A 2XV2A 2OA9A 3PWVA 3BVDB 2O1AA 2AEOA 4HETA 3SDXF 3WEXA 2GJ6D 2WBJC 1H0DB 2R39A 4O2FB 1UXSB 1B0RA 2VDOB 1N68A 5FF6B 4JKWA 3NIGE 3HE6C 1LDSA 2A1WH 3HNVL 1R33A 5ANMA 1ZRUA 3RUGE 2XWJA 3L5XL 3IJSB 4N85A 2DN7A 4AMKH 3SZKC 3EYSH 2ZOTA 1MG3C 2IDUA 2RD0A 1AR1C 3FQRA 4ZW6A 4BUQA 3L5HA 4O02B 3EHBD 4IJ3C 1EDQA 3C75A 3JXAA 4JO1H 4WGKA 3ZKND 1QRNA 4YHPB 2IANB 4WJ5A 1G9EA 1XV8A 3RX9A 1J0HA 5JMRA 4HG4K 3H2PA 3QNZA 1EMTH 4HEME 2W60B 5BOZG 3KL3A 2R69H 1NPJA 5C9JA 3OTTA 3IGFA 1E4XL 3OKLB 1A3ZA 5D7SH 2CCWA 4TOYH 2BO0A 1KG0B 4GKNA 1S7TB 2F8IA 1KPVB 3RZCC 1P6WA 4JB9H 3GXFA 1NANH 1IBDA 25C8L 3MTRA 1NCBL 4PTTB 1IGJB 3QG6B 4WIQA 4Y19B 1BLNA 1ZLUK 1SBSH 3PXHA 4OLVH 3QNXB 4JAMA 4MAUH 4N6RB 1JPFB 2FJGA 4XRCA 5F6IB 5DQ9A 4JM4H 3QR0A 4L18A 5KTEH 2P52A 4MA7H 4Z7AA 4TQHA 3ULSA 1DO6A 2EVHA 5IEKA 4KAQH 3H4HA 3MYZA 1YMHB 1C1EL 5D7KD 3RWIA 3PF2A 1AO7A 5IEKB 1TTUA 4K2UH 3AB0B 2MPAH 2XZQH 4HBCH 3FO1B 1QFUH 1JWUA 4JK0D 3RL1B 3FB8B 4Z5RA 3SJVA 3I3EA 1JUFA 4N3TA 4ES9A 3RI5F 4HX1B 2EEDA 5DMIH 1ES0B 4NYLB 1VEOA 3VWJC 4YFEA 1JPFA 5CBAB 2FIRT 1Q0YL 4RAVB 1NC2A 5FYJU 1LO3L 1FSKC 3F7VA 4A2FA 3A6BH 1BF2A 1II4E 2R1XA 2H1LM 1MCPL 3D3VE 4PHXA 4E5XG 4MJ5B 3ZKQD 5MENE 2AERT 2H45A 2YUWA 1D5XB 1JHLL 3IDUA 5DHVA 2FT7A 3T2LA 2ADIA 2UXTA 4BFFA 2ZX5A 3VI3E 1Q38A 2Y1ZA 4GLRH 2Q5BA 3JWDC 3WL9A 2C3HA 4XP6H 3QUYD 5B21A 1FZMA 3MCKA 4PJ5B 5EOCJ 4HD9A 2F74B 1TKWB 4IGBB 5AVTB 4KKBD 5D1ZD 1XGPA 2HP4A 2XJKA 2ZP9A 1QUPA 2MQCA 3RVWC 3L3OA 3VXSA 4IBUA 3AGVA 1KT2A 1V3MA 2ZP0T 2DQIH 3KDMB 4XBGB 1S5IL 1JZ6A 1AZZC 3JV4A 3OKNB 3PGCB 4NM8H 4WFFE 1BQHA 4BCZA 2KQMA 3QEUA 2UYLB 4HEPG 4U1JA 4PJ9A 4U1LA 3BH8B 4JRYD 2EP6A 4DHLA 4G7SB 1AXTH 1WDAA 1M05B 3O11A 4TS6A 5KYXB 5A43C 1MWAL 4BH8A 1KV7A 3CZFA 1K2DB 1NJ9A 5ESQA 4LKCB 3ENEA 3WIAA 4U2YA 2YD8A 4NUJA 3L9RB 1OSEA 4AQEB 1JV5B 2F7RA 5CMAB 3KXFB 4ZXBD 2YR3A 2ZKYA 1DSWA 5SWSB 3VXUD 1R3LB 2BOCA 4NUMA 5EF3A 3FU7A 1U8NB 4PJXE 4D0BB 5GGVY 1MCRA 1BYOA 1IILE 1S7XA 4LSUL 2XWBA 5D2NA 3TV8A 3BJ91 4PJ8B 1SM3H 1E2WA 5I19L 4FG2A 1EJ6A 3DUHA 3IETA 1M9SA 1TZOA 2WW8A 1SVBA 1UZ8B 2BSTB 2H6PA 3QAZC 4PLKC 5AW1B 4BFRA 1J5IA 3W11C 3IGKA 2FSDA 4JRXE 4CVZA 1YY8B 4M93B 5E8NA 2OR7A 5IF0B 2YJLA 2UY6B 4AKPA 4KHTH 4XAKE 1UCBH 5ACZA 1BECA 1JZ4A 4Q74A 4NT6B 3U9UA 5I18L 5I1CL 4X8XA 1TITA 5C1MB 4OLZL 4MNQD 3BUDA 2JKLA 4LF3A 4BWTA 3D2UB 5EO1A 1KIQA 2Y7NA 1WICA 2MH4A 1R19A 4FZEH 2NTFB 3MV7A 4N9OB 4U6VH 4XNAA 2FEEI 1MRDH 1N4XH 3UBXA 1GPOL 5EHFA 1ZXQA 5E1AB 3SDXA 3WIFA 5BVJA 1D5BA 1T21A 5GGQL 3GHEL 1CBVL 2CLZB 1NGPH 4G42B 1CT8A 2DW5A 2Q86B 5H4YA 3P9MA 3V4UL 4F15B 2RH0A 3TBYA 3LKRB 2NNRA 4Q4IA 3IXTA 5TE4H 4F33B 4CSSA 2H26A 2JJTC 4XNUL 4N2IA 1KN4L 2ED8A 3NCCB 2H7WA 4ALAC 2N3JA 3B7SA 1UA6L 1YDPA 3EO1B 2HT3C 2AK1L 3CX2A 4LCWE 5DFWH 4M5ZL 4LFHD 5CGYD 1YEHH 2P8LA 3LH9A 5BOPA 4XCEB 1S9XA 2C1OA 1LDPL 3C6LA 4LESA 3BPLB 4PUBL 3OKKB 3QUXB 1BLIA 4GRLD 1JZGA 1LE5B 2XA3A 2ERJB 4YQXH 5B4MD 1B4LA 4HP5A 3VXMB 4PRID 5DJCA 2Q6WB 5SWQB 3EAKA 5CEYA 2YGOA 3NGBC 4YJZL 2W0FA 3DMMB 2E3VA 1QACA 3T0BA 1N59A 3ZL4L 4IIQC 4ELDA 1NAML 3N9GL 4L8DB 1FYTE 4IMLB 4W6WB 1BMWA 3MOAL 4RGNB 4JM0A 1B3IA 1OCRB 5DJDB 3VXMD 2MOGA 1GZQB 2BWIA 3GZKA 3AITA 1M6UA 1KGCE 5BQ7A 1B4JL 4FXTA 5LWYL 4L8CB 3VSQA 4ZMAT 3OAWA 1QSZA 2ITCA 4X6CE 1QWHA 2X6CA 3RIFK 2AK4B 1CD8A 1YJDH 2D73A 3FJTA 3FCTA 2WV3A 4OZHB 4PJFA 3A5VA 3QULA 2GIMA 3LKQA 4HJ1A 1QR4A 3ABMB 5FLVA 2EDDA 3S5LA 4JM2C 1CF8H 4QY8A 3FSZA 3FN9A 5IHBA 2PXYD 3IKCB 1RP8A 2DIAA 3E8VA 1UFGA 2R4SH 3GSQA 2PTUA 5FO7A 3AQXA 3RDTD 3SYCA 4U7MA 5JHAA 4FNUA 1OHQA 3P30L 4H8UA 1XGQA 2OCCB 2YGPA 3MA9H 1R47A 4YDIL 3K6SA 3U1QA 4HIXH 1GGBL 2F7QA 3PWLA 3AAZA 4KDTA 1R24A 5LBSL 2P24B 2WWOA 3BD5A 3SDCA 3OLGA 1Y0LA 3KVDD 3ZW3A 3V55A 3UFIA 1XF4B 4PG9A 4F1SA 2N56A 3X11A 1NMAL 5D2NB 3MRKB 3MV9A 5IMOA 4XNBA 3KYMB 4GUPB 3QJZA 3ZE1F 2Y2WA 2V7HA 5HVGB 5A2IH 3N43F 2WTRB 2DQTH 1RXLA 3WAKA 4HA1A 3EJPA 3WIIL 1CDIA 4TNFA 4QIRA 5KSBF 5L8JB 1EERB 2BHUA 5D1QD 9CGTA 3UC2A 1PS3A 5GRUL 4J4PC 4DUVA 4S1QH 4WUUA 5BS0B 3HPLB 3KPTA 3VFRA 4NRZA 1SYVA 2CJUH 3Q2LA 1G9MH 2FB4L 1RU9L 2VJ8A 3RTQC 3UAJA 3ZTNH 1YZZA 1AE6L 2NY2C 1KEGL 5EUOB 4YEFA 2R59A 5G4OA 5IB5B 3BRDA 3QORC 2PWEA 3ULVL 3ZOAA 2BM3A 1JHTA 3GMNB 4AG4H 1LVEA 1U0QA 2J4WL 4Z8FL 4PJ7E 3FQXB 5B8CB 5I1DB 2IMMA 2XTSA 3TESA 1MRCH 3GZPA 3OKEB 3LIZL 1W6LA 3SY0A 1U6AL 4WU5B 3PNWB 2O6CA 4MNHB 5BW7A 2R8SH 5IOKA 2J2ZA 1DLHA 5AW9B 4AT6A 1BVOA 4FC3E 1K8DA 4TVSa 4DAGH 5ABDE 3FUIA 3K72B 3RVXD 1ZJBA 4C59B 3BWUF 2EDOA 4KO5A 2DI9A 3Q06A 3I75B 1P4BL 4AQ1B 1X6LA 1MSPA 2DIEA 4PWHA 1JN6A 5LGJA 2JCCB 5TQ0L 1WFJA 2IANE 1KIPA 1FO0L 2XXCB 1YYMH 1DVFD 1JPSL 3KYKL 5C0RH 5LCVH 2LGNA 1MI5E 3FQ2A 3IBEA 3SE9L 4F91B 5DO2D 4Y88A 5HHOA 2BP8B 1J18A 4Y0GA 1XGUB 1ORQB 2E7LC 2WVUA 2CO3A 3F12A 4Q56A 2BIIA 1KELL 3L4XA 2B20A 5CCHE 3CPLA 3WXVL 4LL4A 2Z65C 3LS4L 2QELA 1OE3A 2EIZA 2DKUA 3OV6A 4YXLL 5IR1A 5GPRA 2OTUA 4QXVA 3J27A 5DJAA 4OGAC 3OZLA 2XQYA 1NGYB 3SCMD 1QUNB 3VE0B 1H6UA 4OCLC 1SFHA 4E41D 3STZB 3FO1A 5AZEH 1SHMA 2XKNB 1CD9B 1OAYL 4HIXL 3IKKA 4AC4A 2GT9A 1H8NA 4X42A 3PXJA 4UMGA 4ECNA 1QSFB 5D7HA 2APWA 4UV4H 3WGVB 3RZCD 4JNXA 1P5VB 1UD2A 2EE2A 3PABB 3EGSB 2ESVA 1BXXA 4L9LA 4QT5B 5C08E 2A6KA 4HLEA 3FB7B 5EF0A 3GO1H 5I2IA 1NCAH 1J0ZA 3NN8B 4GG6F 2XV0A 2CCLA 2NQ3A 5IT2H 2NT0A 3X12A 3ZDZE 3T6WA 5IB4B 3SGEI 3ZDYB 3P9MB 3LH2L 1EHLL 3C2AL 4Z77A 5EC2A 4DVBA 5I1JL 2F8VA 3V4VA 5B3JE 5SV3A 1RQ5A 1X5JA 3PJLA 1BQ5A 1BD2E 3US1A 5I9QC 3FH8A 4EBQL 1SQ2N 2A6KB 2IQ9H 4ZNEA 1WZAA 2R8SL 4UT6A 2BFGA 2XZAL 4BZ1L 3D4CA 4YS4A 1XH2A 4N24A 3GT6A 3VXNB 1GGCL 1GTNA 3HI5L 1UWYA 5I5IA 3O41A 4N1HB 3G5XB 4HD5A 3K6IA 3VH8A 5CJXC 2Z9TA 3CFJA 3H42L 2VDNH 1FI8C 4CMHC 4FCAA 2AFNA 2O5ZH 2OMZA 3DPBA 2PR4L 3NDZE 4DK3A 4XNMB 2R2BB 2Z4TA 3KEDA 2W80C 3VXRE 1X4YA 3ZE1E 4E5XB 3DYPA 4B9CA 2Y36L 1L0XA 1OGAB 4LHQB 5E23A 4X98B 4KO7A 2NY1B 4JFXA 3V5KB 2FL5B 5IIEA 5IMKB 4PJFF 2YBGA 4FMVA 3QPQD 1OE1A 3WFBH 1ZTXH 4GG6B 4XVTL 3HMXH 4H2CA 1P4IH 3MRBB 5H8DA 5HTSA 5EZLA 1XGUA 3QUGA 4UDUB 1OGAD 4HS8L 1XSOA 1E4WH 3MLRH 3OMNB 2YPLD 3WFHB 4JMNA 1EXHA 5J13C 2BS8A 1XZ0B 4KU1A 3U6XS 5IMOB 5J5EA 4H40A 1IBYA 4ONFL 5FOBB 4R5VA 3UZQA 1UCBL 3QB7C 1U3ZA 4PG9B 4PY8I 1LEKB 2YA2A 4C8XA 3FH5A 2FJFA 1BBDH 3N85L 3JQOB 3WUZA 4QF1B 4W1TA 1QPXA 3UAJC 1QBMH 3PDGA 1F4HA 2NR6D 1YQVH 3ABLB 4G2AA 3KPMA 2PPEA 3ARDD 1BZ7A 1MRDL 2UWEB 4OM1L 1JZ5A 1RERA 4IHOB 3NFPB 3MLWL 5EEWA 2YD2A 1URLA 4KKZA 3TS8A 1DZBA 2JMRA 3D85A 4UZUA 5TF1H 5ACLA 4G6KH 1WAEA 3OMIB 4PWJA 3FFOA 5IGXL 5KSBB 2AEQL 3VYPA 3MCYA 3O6KH 4A2MA 3F7YA 4PJGF 4AGPA 1WPCA 2EZ0C 2Z4QB 2XQBH 2Y5TB 3THMH 4JY4B 4EUPB 4LL1A 2D0HA 3QCVL 4P2RA 3HI6L 2J8HA 2NY3C 2PPDA 2VDLH 3LTVA 4G8EB 2VKWA 3N04A 4JRWA 4OLEA 2E74C 2H2SC 2VIRA 3P4LA 3QJHB 1YEKH 2IAMA 2BDNH 2OJEA 5KN5B 2HRPL 4NPYA 1W2KT 2NPLX 3BAYA 4K15A 1ZLSH 2WN2A 2GBUA 4CADB 2ICCA 1ADQA 5BJTB 2VDRH 2EYRA 4TLTA 1DUYA 3WNOA 1MWAB 2A6IA 4JREC 1T1YB 2W91A 4FZ8H 4UNVA 3VXMA 5FUCC 1NBZA 2F2HA 4XPGH 5A7EA 2R1YA 1BFVL 1HEHC 1E9QA 5GGSA 4P2OA 2FUTA 1OM3H 2WB7A 5I1LA 4LHUD 1N5YL 2GSMB 3NTCH 5C0EB 5E4EC 2OFQA 4FE9A 2I27N 4DEPC 1W6WA 3FQXA 1LP9E 5B8CA 2VH5H 2AJYH 1RL1A 4ZUVA 2ZWNA 4PJDB 5D8JL 1N6VA 4XC3H 4H7VA 2VN7A 2X4PA 5D7JD 3MNDA 1DQDH 4F2MA 5T3XE 4DGYH 5CILH 1HZLA 5CLZA 3GSQB 4IKJA 2QV2A 1AC0A 1DVYA 1WUZA 3L3KB 5KSVA 3RGBA 3VD0A 1QBBA 2IEPA 4NM8L 3SN6N 1C5BH 4AV0A 4DVRL 1JTOA 1ZEAL 2JJSC 5DRNA 3VG0H 3AU0A 4YSTA 4HJJL 1JOIA 1GMIA 3EYSL 3QWRA 4W70A 1G94A 4BGLA 4N0FB 1A6AA 4NSKA 2X70B 2EEAA 3VI4E 4PRIB 4JHAL 4I4WA 2X9XA 4A7GA 4Q52A 3WAJA 2BSED 1PJ9A 1NM4A 4GXUN 5FB8A 4K3EL 1MOEA 1YEGH 1CGYA 5KUMA 5DUJA 4X6EB 1MUJB 3TPKA 3VNZA 4FQXA 1A1OA 1QHOA 3ZHKA 3GSXA 4AW7A 4XCFL 1P6FA 5AZ2L 5ITFA 3VRJB 3I85A 3BW9A 5ADPH 4LEOB 1OSZB 2ENPA 2OP4H 2ZWSA 4UZGA 2EDTA 3IN2A 4GG6A 1J87A 4HMEA 4WTXA 1BZ8A 4ODUA 3G5VB 4RAHA 4K9EC 5FV1L 5JNYB 1KGJA 3FUDA 2P45B 1CXEA 2MPVA 5G4NA 4YOKA 2CH8A 1UB5A 3OL2A 7PCYA 1PEWA 2OSWA 3TH2T 3LZPA 5CP7A 1BG9A 2BH0A 1RFDL 1C1EH 4PLJD 5F9AC 4BCXA 3PDOA 1IBZA 1X5KA 2XUWA 3QFJD 4EQ3A 3E3QE 1Y07A 3OGOE 5E9DD 4XI5C 2CLVA 4Y9BA 4C56E 2EYTA 1BQUA 5C3TA 2HLAA 3QEQD 4TSAL 3KLHC 3RWDB 2EDYA 5JYLA 3CZFB 4NZDA 3EYVB 2V5YA 1SRDA 3BUTA 1OAZL 1F3JA 3SDAD 4CGUB 5DD1H 4M3JA 1MXGA 2WN3A 4L9LC 4OCXH 3ZE0B 3O4LA 1PX3A 1SFDA 1XCWA 2IAMD 4JHVA 4R4ND 3QEQB 1RFDH 5BUAA 2WZ6A 4U1JB 2XBZA 1JGUL 2CK0H 3DSNA 1ZHNA 5EO1B 1AKJA 2F7PA 5F9DC 5FGCB 2RBLA 5C0CE 4ONGH 1E5UI 1S8DB 3GKWH 1WE5A 2IXQA 4GKSA 2CBTA 5KJRL 5DRZA 2Y1AA 1HWGB 1PZ5A 3DUUB 2IAMB 5KN5A 2GY7B 4DKEH 2DMBA 1VFOA 2L8AA 1MJJB 1PY9A 1T2QH 3IWVA 3VFWA 1T2JA 3WNNA 2NW3A 1T04A 2JH2A 2KQNA 3MJ8B 3EDEA 3OKMA 2QPFA 3DVIA 3IGAA 3QH3B 4JRXA 3LN5A 3QGVA 4N22A 4J3UA 1R3JB 2APSA 3WXWH 3I6GA 5FR3A 3R1GH 1S5IH 4L5FH 4QHUA 2E27H 4NHCH 1WG3A 2HRLA 4LLVA 1MJJA 2B16A 3BAIA 3PAZA 3BCDA 5GZOD 2Z35B 4FQJH 2DLHA 5MP6H 1BCIA 2DBLH 2NLJB 4FQLL 1U8PB 4P2QB 1BZEA 2DQ6A 5B38G 2LFEA 4QO1B 1CYWA 2IF7A 2UZIL 4ZW7A 1UGKA 1NGYA 3VE0A 4BFOA 3L9RA 2YSSA 3NJFA 5JDJA 1SN2A 3MO1A 2BSBA 4IDLA 2K6ZA 3UBXB 3QO1A 2Q7AA 3DIFB 1YEGL 4FD0A 4HKZB 5TF0A 3VFOA 4E0RB 4PCYA 3CFCH 3BP4A 3WJJA 1QLEH 1IO4C 2EAEA 2JF1A 5FYKU 2YQ2A 3U0WL 1MFAH 1HINH 1S9VB 4FS0A 1LEKA 1GR7A 2C9XA 1XTLA 2FYYA 2ICEA 3D3VD 5HHOE 5FO9B 4AI7A 4AEHL 1I1CA 1JF1B 1JWMA 1LO3H 4MJIA 2NSXA 2N1KA 1DVFB 1ODUA 1KJ2A 2FATL 3B7TA 2DEXX 4YXKH 3RL2A 1JF5A 3NIFE 3O0RL 2WMPA 3V0JA 1WEJH 3KLDA 1GSMA 3OPZL 3VWKD 4RMQA 1DJZA 3SDDA 1KPUA 1U92A 2CNZA 4HF5H 2ATKA 4GYBA 1SXBA 2PO6D 4PBVC 6TAAA 3R4DA 3HOGA 4MJ6A 5AKTA 5E08H 5I82A 4XO5A 25C8H 4P0DA 3AGWA 4PB9H 3COOA 3MDJA 5D4QA 3F62A 4G72B 1FGNH 3AG3B 4NKOB 3MV8D 5SWSD 3TO4A 4ZAKD 3VXUB 4EIZC 1UJTA 4LSSL 1GMEA 1WEJL 1MELA 1NCIA 2PO6B 3WTVA 4HOXA 3M1OA 2VDPB 4KHXL 1HFUA 3DO7A 3PP4H 3W1ZA 4PEEA 1H9VA 3U2IA 3QDGE 2BW4A 3E6FA 1TZHB 3RZCB 6PCYA 2VLKA 2ALWA 3TJPA 5CINH 1N4XL 5GXBB 4PW9A 4M4RA 2BHYA 2Y25A 1IV8A 1WVZA 1IEBA 2JWYA 3GXUB 1DVUA 5LG1A 5J06A 3EYFA 4A38A 3L5WA 3ZZSA 5EUOF 3RWCA 4QNPE 4XOAA 1CXHA 1YUHB 2K70A 1KB3A 3L5XH 1RZ7H 1I7TA 3QEUB 4KDTC 4X8CA 5GRXG 4RDQF 4Z77B 4NQSB 3JWNC 2KUTA 4OJYA 4JFTA 3HBQA 2ADGA 2F58L 3R7RA 4ISVA 5IG7B 1CTMA 4LT7A 3VG9B 4Z3JA 2CM5A 3R1GL 5DMKA 2YAPA 2A7BA 5DMJB 1TTCA 3TVMC 3GXMA 1QR1A 3TYFB 3ZE1B 4R3SA 4NI6A 3TYGH 3LSOA 3PV6A 1CN4A 1SZNA 3NA9L 4HKBA 1Z5YD 2Y72A 4MZIA 4EXPX 4LU5H 5F7MC 3ARFB 1A4CA 1X7SA 1DANT 1XMEB 2DQDH 3QXVA 3D69A 1YQVL 1U8CB 1HHGB 2IAAC 1XF1A 3FTSA 4PVMA 4MXVF 2HLFD 1G84A 3GM0A 3F7VB 4S1SH 3SBRA 3BAXA 3MBXH 3T2QA 5GRJL 4ABWA 3HNSH 4ZMPA 3FCTB 3IK2A 2G75B 5IOPA 1WQVT 3VMOA 3GMMB 2B14A 4F7MA 4D9RD 4Q6IB 4JFZL 5CWSB 4V2BA 4KJQC 2NLJA 5M7QA 2I60L 1HIML 1SYSA 1X5GA 4XHJD 1AQHA 4N2AA 3QC6X 3L3GA 4D0DB 3GRWA 4UQCA 4CSTA 2W94A 5C7ZA 2NX5A 2WNGA 2CR0A 3ARWA 3HZ3A 5FGRA 4U05A 5FYJE 4JE4B 5E4AA 1F90L 1B90A 2IPKA 2HT4C 1EWHA 4GPVA 2VKXA 2ZUVA 2YRBA 4FFYL 2G0LA 4R7NA 4AVHA 1WO2A 2DYSB 2JLLA 5BRZE 5DVLA 3NFPA 3SY6A 2K7PA 1X5LA 4J3OC 4IU2B 3SKOA 2JV6A 3KBFA 1PIGA 3FU3A 3EJTA 1U95B 3S2AA 1DP0A 4G8FB 2Y0SA 1A65A 3QEGH 1UADC 3EF7A 3OKEA 3UROR 4IRJB 2L04A 2J6WA 3BVNA 3VGGA 3EO1A 2YXFA 4PLKD 2G2PA 1H3PL 5CJBA 5AYUL 1G7PB 4Y16A 5HPMB 3NQIA 3GGWA 1CJYA 1PZAA 5I6MA 3OC8A 2L3BA 2NNAA 1IVLA 2NCEA 3V4VH 2BLFA 4X5PA 4ETQB 5HI4C 1F2QA 1DQML 5ICUA 5KVFE 2P49B 1HCFX 1W15A 4JO3L 1WITA 4IRSB 4P4KA 3WFDH 4CVWA 1MIEL 3ETBF 1L6PA 3L4VA 5CJ8A 3C8HA 5DJDA 2CO1A 2Z7ZA 1OSYA 1HOEA 1AC6A 4JCWA 3QXDA 4RA3A 1NGQL 3U0PA 3DECA 4ODTH 1RU9H 4LCWB 3RDJA 5SWZB 5TQ2L 2YBRA 2Z31A 4P5TB 2CDEA 2FT6A 5AZEL 3SBWA 4OLYL 3TURA 4QRRE 2FJSA 3GSRB 3NZHL 4JHAH 3VA6A 3TN0A 4F58H 2BIQA 1XIWD 3KPLA 4RA0C 4Y16D 1ASOA 2F15A 5CSZB 1R3IH 1V7MH 2OMVA 2XN9A 3INUH 1PZUB 4QXGH 3BW9B 2XXFA 4Y5YB 1FFRA 4UOQA 1E9OA 5BQDA 3HS9A 2NZ9D 4ZODA 1PX4A 4DGWC 1OGSA 1AS7A 2DMCA 3Q0HA 2BCKA 2XZCH 3D05A 4NJ9L 4TSBL 3HMXA 4OIIH 4MCYA 4WHDA 1CFVH 1K3IA 4S2SB 4JRYE 4UBDD 5GRWA 1A64A 1UVQA 3QDJD 2BZDA 2IDTA 1EFXB 1IM3D 2VNCA 1RVFL 3PL6C 5FO7B 3HNSL 3WTUA 2VZSA 4BZ1A 2F53A 1MREL 5I66A 1UKQA 3JWDL 1IIIA 4GRWB 5EBWA 3FB6B 4LSDA 5IB4A 3ULUL 5ETUB 4RX4A 5I73B 1HHKB 3QJTB 5JDSA 1J7VR 4YSOA 3ZL4H 4LEBA 1IAKA 4LKCA 4JQXA 4YLQT 4U2ZA 4PI0A 1KELH 3FB5B 3L5IA 2VDQL 4WWPA 5MHSD 1WBZB 4LDOB 5LQBL 2B1HL 3L7FB 3WMPA 2VLRD 1JL8A 3E1ZA 4DTGH 2CRIA 2D7OA 5I1GL 2MKLC 4P9HH 2GAZA 2P8MA 3II3A 4FNRA 4YHZL 2X0UA 4NERA 3B3BA 2AJ3B 4WDIB 4J3OH 2IOIA 4PY8J 2VXTH 4KJWC 4XZ4A 1A1NB 2MHAB 3DJRA 3FZUD 5E1QA 3O2WL 5FLUA 3MLWH 2YMXL 1EA9C 4U6YA 1VKXA 3DX2A 1RUAL 2AF2A 4Z8FH 4OZIA 2P5WD 4HAFA 2HJKB 4NO0B 1CXFA 4Q6KA 4WF7A 2XWXA 1V5JA 4Y2DD 3MNZA 4WTWA 4JKPL 3FU9A 1NGWB 4ODWA 1A7NL 1ECYA 2DWDB 4OJCA 3GKZA 2IADA 3KJ6L 5T1KA 4ZUWB 1CYXA 2G60H 4XPBL 1A47A 5D1XC 2H1PL 3S3CB 4F58L 4Y2DB 4W6XB 1JV5A 1OE2A 4D94A 1Y6KR 3I02B 4PGBB 5I8CB 2FJUB 5HHQB 4Z76B 2ZXCA 4ZW8A 4PLNC 4DK6A 4XN7A 1K2DA 3T04D 4ZFFA 2E47A 4Y4KC 5H37G 5FK9A 3TEXA 4P4KD 1L9RA 3QQ3B 3MBEC 3NJIA 3D30A 1A7RL 5F6HJ 3NK4A 2PWGA 1CLOH 5CR8A 5C97A 3T08A 4UIMB 4IM8A 4HH9A 1NOAA 3P2DA 4PPTA 3X3GL 5B3SB 1KXTB 4PS3A 4BUGA 1CL7H 1E65A 3MRNA 4HIJA 3EO9H 3KGRA 3NAAL 2Y6SD 4OUOA 4A7SA 1RPUA 4GW1A 4ODXA 1J0YA 2WGNB 4GRWF 1XD1A 2GVYA 2DBJA 2IH8A 4AQ8A 1HXYB 2ZX6A 3KPRD 4P8QA 1G1OA 1VAHA 1EHXA 1AH1A 4YO0A 2JIXA 5EIIB 1QAWA 1OCWH 1J8SA 2EABA 3HEIB 4XPHL 3WEAA 3CFDA 5DD5L 1HNYA 4OF8A 3G6JB 1S7XB 5KZCD 3D50A 4M62H 4OKVA 4DP2X 1KDJA 2ZWLT 3VU2A 2P4AB 4P2QD 1QEWB 1U36A 4PY7B 5MI0C 1ZWIB 2J8OA 2H41A 3GZQA 4M61B 4V1DB 1J1OH 4I3RL 3U79A 3DGDA 3OAUH 4LXFA 4Y9EA 1IT9L 3OZ9L 4JKKA 3CFDB 5L6YL 1UWEL 4Z3IA 3L45A 4F24A 3FT0A 1BD2D 5DS1A 2JIXB 2C9SA 4HCRA 1SHXA 3ATEA 1RV6X 1NFDE 3FMGL 3NCBB 1U93A 2EKJA 5GJSL 1NIAA 1CQYA 3HI1A 4LSQL 2R2CA 3SPVA 2VQ4A 2DYRB 2B2XH 3KPSE 3WE6B 1M2OA 1K5WA 1MFMA 4MJID 3GPEA 2H0JA 3BVUA 1P84K 4W9IC 4B95C 3IGLA 3MKKA 4TSAH 2OCFD 4HW6A 1AIFA 4MVBC 1IC1A 4DFIA 3G5YA 2ZUWA 4ONHA 4UM9D 4GAAA 1VACA 2AV7A 2XTLA 3QUMA 4HIEA 4FGMA 1QFWL 5HHMB 1TU2B 2WUCH 3MLUH 4H8PA 3ESMA 2GBVA 4MX7B 2VAAB 3QZBA 4FFWD 2OTWA 2WJ7A 5EA0H 5DD3H 2I69A 2UVEA 3GHBL 1S78C 5BRZD 5C0BA 3C6LC 3QZOA 2XRAL 5B1CA 3QG7H 5I0WA 1NEZA 1X4ZA 2RA1A 4MVBD 3BFOA 4WSGA 4HWBH 3NCYS 4X4XA 5JW3L 3H3PH 5J56B 1E2ZA 4I48A 3EOTL 1NAKL 5F0MB 3GBEA 3APCA 3QUMB 4OCMC 2ADJA 3MNZB 2W0FB 4ONHB 4YE4H 3QEHB 4AIOA 4N3UA 5L88H 2VO8A 3N6YA 1OGTA 1QFHA 1PD0A 5LKNA 2H6OA 4LSUH 1OLLA 2ITDB 2FWOB 1Z0NA 1P6AB 3V5DB 2Y7LA 3EUDA 1T7WA 2AI0L 4P59L 4NUQA 3X13B 2ZPKH 2QFPA 1D7CA 4FAAB 2I07A 1MCQA 5KSAC 4YHIB 4L3ED 3S9DB 3W0WE 2E9JA 3QZWB 2CAKA 4XMLH 5JW4Q 4NPJA 4Y8DC 4XN2A 2ZKXA 1BEYH 3OKDA 4WRLA 3K2KA 2VABA 3UGUA 5DVKA 3DHPA 4M7KL 3EO0B 1JWSB 5DD6B 1EK3A 1XCTB 4PJAB 4F2FA 2VDPL 3TBYB 4LCYB 4R8WL 2AXGA 1M57B 3C60D 3S5LG 3K2UL 1ACCA 4QHKJ 3UYRH 1A6VH 5BS0E 5CBEB 1I8MB 3LHAA 3BZEA 4YSCA 2HVJA 4OZFB 3OPZH 4ANUA 1GGTA 3VTAA 4RBPK 4OW6A 4ZDHB 4BH7B 5KG9A 2A4ZA 4OZIF 2XSKA 2E6QA 4Z95L 3ZR5A 4OD1L 1IC7H 1MLCA 4AEHH 3TWCL 1GGIL 4M7LH 3CWGA 2WLMA 4P3WA 3DRTA 5LBVA 1QLRA 4XODA 3MJ6A 3P77B 4AWJC 4KPHL 3GSNA 3FQ1A 3VFWB 1WAAF 5IF0A 5E8NB 1QMUA 4UOZA 3WCYA 3WLBA 1HSAA 4P9MH 1XSIA 1ZK5A 4JZJB 2DQCL 4KNUA 3VYOA 4CBZA 3EYQD 4MYWB 4BM7A 4UCFA 4M29A 4D9QE 2ZXGA 4Y2LA 1MI5D 3IM1A 3FT2B 4NAQA 4RDQG 4QRSA 3DVGA 1MCSA 1F4XL 2AQNA 2HPOA 3B37A 4XNQA 2H0FA 2J8UA 2APBA 5E5UB 1MCOH 4XP6L 1ZGLP 2WCPA 2JQMA 5C08D 1SYVB 1WCQA 3GMPB 2XXGA 4ZTPH 3U0PB 4JFFE 3D18B 4K94H 4N0YL 4RGND 1IL1B 3QWRD 1AGBA 4U6XA 2XTJD 1DQJB 4CW1B 5I1AB 4YFLI 3MOQA 1TOXA 4F93B 3I9GH 3VWKA 3QBTB 2ZUTA 3ZX1A 1Q94B 1MCLA 2V37A 1KYOJ 2OYPA 3GGWB 6FABL 2RGSA 4XVJL 4MZ2A 2LR4A 4YQXL 3QA3A 1OVZA 3V5HA 2EIDA 3L2LA 1KTJA 1WA1X 4DZBA 4CKVX 2N4IA 1OAXL 2HSIA 2I9LA 5C0GB 4JZOB 3TCTA 1YMME 3C5ZC 4P2AA 3AREA 5F7FA 3EYUL 1ACYH 4MS6A 1E28A 5EOCH 5L2KB 1OGPA 4OUUA 5EO9A 2K6WA 4P2CG 1SHWA 2JTYA 4RGOH 3UGEA 4MA3B 5IY5B 2IFFL 3UCRA 4GNKB 3WS3A 4GQRA 1QSEA 2PR9A 3B2VL 3BSZH 1U4FA 4G71B 2F8XC 1H3WM 4X4XB 4HAKA 3H54A 2CRZA 1DUZA 5HGHA 2QHLA 2VH5L 1H3UA 4AK1A 5GGSY 3WKMH 3K2UH 3UYRL 1GSKA 3QJFB 4N5ED 4GLRI 2X70A 3RGVC 3V6OA 3H6AA 3FOMB 2DQTL 2R29H 2RQ8A 1XF3A 2BNUB 3EDDA 3LHPL 5TDOA 2C7UA 4OF5A 5EBWB 3F5WA 5ID1A 3LQMA 1MZZA 3P69A 4FLSA 4AYEC 3UTSB 1OZUA 2VABB 4S0TD 1TF4A 2OR9H 2ZOOA 4B60A 2AJZB 2ZWKA 3GTTA 1U8LB 3UDWC 4YXKL 1O6TA 2EUZA 5MI0B 3GMQB 3UZVB 3T2NL 1NWPA 1PTZA 1A7PH 1KC5L 1UM6H 1DYZA 1K4DA 1IQWH 2ED6A 3IDXH 1OTSD 2Z64C 2DTSA 3JTTB 4OY9A 1YN7B 1T2QL 4MDIA 2IWGA 5D1QA 1OGTB 1J1XH 4PIBA 2WY3B 1A66A 2F7OA 4ZTPL 3HB3C 1IKFL 3EJUA 5IHUH 2VZUA 4N20A 2APTA 3D52A 4MXQD 3ILQD 2QBWA 3VO0A 5CLYA 3FT1A 4PJIA 3ZXAC 3VWKB 4WSJA 4L8BB 5FGBC 2J88H 1PZ2A 4M5SA 3IFLH 3FFCA 4L5FE 5E2WL 5C0NC 1SM3L 2EE3A 4R6UA 3LIUA 4LGRB 4KKAC 1D6VH 2GG1A 2OR9L 1BW8A 4AQAA 2R2EB 1A8ZA 3VRIA 1LO2H 2FUQA 4HC1H 3AG4B 1G9HA 2UZXA 2AGJH 3EBGA 5BV7C 2ZAGA 3D2TA 1KBWA 2Y4SA 1W9XA 3BKJH 3LRLA 1XGZA 2BP0A 4H13C 5SX5H 1WD8A 5K9KA 1WRFA 1F86A 1V7ML 1QHQA 2UWEE 2V9UA 1MDTA 4HZAA 5AQ0A 5ACZB 5AKRA 4I3SL 2V4LA 4F27A 1WS7A 3AWGA 1C16A 3SE9H 4JFEB 1BZ7B 3KH3A 3HE7A 3KYKH 1AR1D 2A9ML 1BVKB 5IQ9A 3R7QA 2V9RA 3PP3K 4QJ3B 2FO4B 5GGTH 3V9CA 4ADJA 1GVIA 4KQ3L 3RTQB 1FFTB 4WZ9A 3QHZH 2W0KA 3TZVA 4AIZB 4RZCA 3MX0B 4JKNA 1KPUB 2HFGL 1YMMA 4UM8B 4ZAKA 5LN4A 5TTRA 2G2NA 3QWNA 3RJOA 2QSTA 2Z0UA 4BA8A 5IMMA 1YEIH 1NGPL 3BKML 2CRYA 4J7RA 4IOIA 1F00I 4QGYA 3VQMA 2P42B 2P5PA 3GQFA 3F01A 3RILA 1WWCA 4D0CB 1MLBB 4ZUSB 4ZUWA 4AG4L 2KERA 4QTHB 3JV5A 3C8KB 3MLYH 5FCUH 3EYOB 3HC4L 3C5ZD 3RKDD 2HT2D 4MA1C 2RFXB 4W4NA 3UTQA 4JPVL 4PJ7F 5D7IF 1C7TA 2Z7WA 3BGMB 2J8UF 1RIVH 4MJJA 3D39A 4EOWL 2DYPA 4DZ8B 3MBEA 2F68X 3AW5A 1NMBL 4I77L 3E6FB 4PJ5D 4XBGA 3BEWB 3VH8B 2LLLA 3WDJA 1AGFA 3WLBB 3PFQA 4YSPA 4X4YB 3DNKA 2DM2A 1U8QA 4XMKL 4UILH 5F1IB 2A0LC 1C5DA 4B7LA 3ZTNL 1SUJA 2L0DA 1BQKA 1XR9B 4NC1C 4NNXB 3WJJC 2YXVA 2FSEB 4FRWA 5DYFA 3IFNH 1Q72L 5DDHA 5A16A 1MJ7H 3ZQ9A 1TZIB 3D3VA 1U3YA 1ZANH 3KS0H 2BP3A 1NCGA 1YY9D 3NESA 3QS3A 5C2BL 1GCFA 5IBUG 4AYSA 4WNJA 4YHYC 2A83B 2O5ZL 2NCMA 3BIKA 3MRIB 1QZ1A 3OD3A 4WK4B 2Z8VC 4PRHE 1USZA 1AD0B 5EO0B 4TV3A 2WXJA 2FYYB 2I7SA 4KC3B 4OM0L 1WD9A 2ORBL 3SJVE 4IOSD 2QFRA 3I3DA 5CU5A 3PP3H 2QT6A 4WW1A 3UTSE 5KVEE 1BQLL 5FX3A 4MLIA 5DJ6B 4I3SH 1OB0A 3HZKA 5FYJH 3V0IA 1T03L 3M17A 2DKMA 1EXUB 3POHA 2WGXA 2P48B 1KCRL 2VXTL 1TPXB 4NWUH 2VZ3A 2XACC 1G5AA 3MX0A 3LXAA 4X5RA 5AAMC 2O6EA 4XNZB 5EUOE 1NCOA 3MJ9A 1BYPA 1CFNB 4L4VE 2VW4A 1SY6A 2A9CA 1CD1A 3AS0A 3HKZA 1OCWL 5AKSA 2GAZB 2L4OA 4AMKL 3KPQB 1O75A 3P2BA 4TSCL 4FF9A 1XTMA 1PU0A 4X4ME 3MNWB 2ZSVB 5F6HI 1PKQB 5AKVA 5K59E 2BFVH 1U41A 2AANA 4H8QA 4EBQH 3BKMH 4X8GA 1TETH 4QYAA 1VEMA 2R7EB 3D08A 4BFGA 3GJEB 4BK8A 5E24E 2JCCA 1NL0H 4DP5X 1IFRA 1HOCB 3CSGA 5DR5H 4FXKA 4MAYA 3AG2B 1G7PA 3I50H 4WKZB 4Y16B 1ADWA 2IV9A 2ICWI 1UXLA 3LEVH 4KGJA 1WHPA 5B1KA 1G9ML 5JLZA 3DGGA 2EUVA 3QEQA 3NFSH 3QO1B 3VFOB 4NCC1 4CU8A 5F1NA 2PLTA 2B0SL 1DLHB 3QJRB 1WTLA 2HVJB 4LHUA 4OZFA 2K9UA 3TF4A 3SY0B 3QDGD 3TA3D 3VDAA 1ESOA 3BT0A 4JFFA 4G80A 1I4FB 2BNQA 2O26U 5K9JL 5DHYA 1P1ZB 2WNKA 4PJIE 1E8XA 4MD0B 2EYTB 4K7PY 1JHTB 3EFFB 4TULL 2GBTA 3LEYH 3HMXL 4TL5A 3NBNA 3EADA 3MQIA 1U8HA 4WI7A 1V7NH 4Y2NA 2X4PB 5CSZA 4G6MH 4ABQA 4HIIB 5E6YA 2VQUA 1B4RA 1ACZA 5JHBA 2VLJB 2ZX8A 3O2DL 2YXWA 4HK3J 3R06A 4I18A 1SLWA 3OKMB 2YA1A 2ZT9C 4UF7C 1CICA 2D7NA 2YPLB 4MKMA 5D9SA 2X4OB 3X13A 4C54A 4EVNB 1DBJL 4WI5A 2E56A 2NYKA 3ARBD 2R56H 3EUUA 4HJGB 3SOBL 1R9FA 5HHPB 1XR8A 1TZGH 2OL3B 2E4FA 3I6LD 3P2TA 5D1XD 5I1JH 2K4AA 3CH8A 1ACYL 2DQFB 5EOCL 1ID5I 1OALA 1LO5B 2EADA 1P7QA 3DV4B 1AQKH 4JMXA 5FYLL 4I0PA 3CN2A 3VG9C 4OKVB 4FFVC 3UOAB 5C08B 4BZ1H 4XBEH 4RGOL 1A7QH 1KBGL 3CG8A 2LVCA 1FCCA 3SPIA 4CAGA 4JANA 5H35B 1TJMA 4Z7VB 5T5NG 5KANI 4HK3N 4YO0B 5EU5B 5FO8B 4LLDB 3Q13A 4G8AC 3UPCA 5KVEH 1U8JA 4MSWB 3HC0A 3LKOB 1NCDL 1AXIB 1OT4A 4GW4B 3LEXB 1FFQA 4PG2A 4AC2A 2HKAA 2ALAA 5IBTH 4HIJB 3L3HB 3CXDL 2X4NA 4P23C 4YEEA 5JA9A 5DJ0A 1CLYL 3BUYA 4K3EH 1W0WB 2BJML 5F9OH 3ZKMC 2P9RA 3L7FA 4EUPH 1L0YA 2AXFB 2H9GB 4U1NB 4G9FB 1A1MA 1WFMA 2NY6B 3N85H 4RNRB 1QKZL 2Q76A 4FP8L 2Y3AA 3SGEH 3W3BA 5D7IA 4NQEE 1UACL 3GIVA 1KJ2L 1OAUL 5H2BB 3ROOB 2R9HC 4KJYB 4BZ2H 5LGYA 3IMBA 4U1SB 3RDTA 3TEUA 1DBBL 1MCIA 3HLAB 3L5WB 3LKOA 2VDLB 2TSBA 4H8VA 1HN1A 3NYKA 3RPIA 3H9SA 2QGEA 3FT3B 3UZVA 4BYHA 3S8FB 4RRPG 3MCLL 5C0JB 3P4MA 5EORL 2FJHB 5F21B 1TZHA 3TWCH 1ONQB 2JFCA 3V6OE 3K2IA 1GAFL 4KK8D 2CDGA 5EEZA 4CVXA 4BUHA 5DK0B 4IBLT 2Y36H 3LZNA 3ZIYA 1CLYH 1RZFH 1QWNA 5HGDA 2YOAA 3TO4B 1MIMH 3VXUA 1S9WA 2G5RA 1DL7H 1OW0A 2GFBB 2ZSVA 2XV6B 3FBQA 3KYOB 4R2GC 2GITA 1EEZB 2ZCLL 2AV1B 3LRMA 3L2NA 3TX4A 1U9KA 4NB7A 5CGBA 3TN0B 4JRLA 5IEHB 4G7QB 4QHKI 4DGUA 1Q9OB 2J57A 4NN7B 1IAMA 5DD1L 3BQUB 4K3JL 3VD9A 5F88A 2X6MA 3G5WA 2VDRL 1YNLH 1P4LA 5AALA 4KXAA 4ZTOH 4XMUA 3T5WA 4IDJH 4NKMB 5BRZA 4U1GC 3A47A 4YPGA 4BKLA 4X7TA 3CDZA 5JORB 4PYGA 4G80B 3S48A 3W81A 5C3IA 3WNPA 2FVNA 1IFHH 4HH9B 5DZLA 2O93L 5CXPA 3ES6A 3QPQC 1ORSA 4QRRD 4XCFH 1RJZB 4GJTB 4OF0A 4TUKL 5DO2C 3AACA 2KZBA 2E7MA 2ZAHA 3BP4B 5CZRA 5BVJB 5JHDA 1T1WB 5BZDA 1A7QL 1KBGH 3G6DL 1MFEH 3QWOB 5LAPA 3BO8A 4GQQA 1UQSB 1EZSA 2KZWA 1MG2C 1HCYA 2Y5EA 4P2QA 4JY6A 4ZOCA 4I88A 1KCSL 3IU4H 5DZNA 3TC9A 4L3AA 2OMYA 4B6ZA 4YHYB 4JFOA 4W9HC 2QV4A 3Q8AA 1DQDL 4KKNA 3W2DH 5HDBE 4MQXD 5CJXA 4KPHH 1KTKE 4S0SD 5ABZA 5I76A 5ANHA 3HZMB 3GFUA 1IUZA 4AYDC 3H9HA 3FONA 1P5VA 3LMJH 5T1LA 1DJXA 3CZLA 1R3HA 3OHXB 1RK0A 1UCTA 3SYOA 4KRPD 4PGDA 4KTDL 1QSFD 1L6ZA 2OXHA 4AH2B 5KSAA 1TCMA 4M7JL 5I8EB 4N28A 3RIAF 2FD6H 5CEZD 4I9XA 3SDDB 2WVVB 2FATH 2NW2B 1DBBH 2YFNA 2I24N 3X1GA 1ZOXA 4JJHA 2VLKD 3LVEA 5IMLA 4X6CA 4XGZA 1HQ4A 4H20L 1M7DA 1VFAB 1UJ3A 1WBXA 3BD3A 1FL6A 4ZX5A 4UM9A 2F5BH 4Z7OB 1P0SE 3L3DB 1TQVA 3AADB 4HPOL 4PJBB 4MRBA 2Y24A 4R7LA 4N1EA 2YMTA 4H26B 3QDGA 3TA3A 1F1GA 2ZXAA 2XPYA 3QP3A 4L4VD 3L3DA 4XNXL 4HCFA 4K71B 4LIQE 1R4XA 4MNGA 3PHOA 1M7DB 3H3KA 3OGCB 5IV2B 5T3XD 1M53A 1QX1A 4NNPH 5DJ2B 2A6JB 1XCQB 2C34A 5D5MF 5HHME 5ETUA 3PGCA 1JYXA 1DANU 1T7VA 2DQUL 1RZ7L 2ZONA 5T3ZL 1FL3B 3FRUA 1ANUA 2WBKA 4JR9H 2G30A 3WE1A 3JT0A 2ZE0A 4NKIH 1WFOA 1H8SA 3FB7A 3FRUB 1NAKH 1UYWH 5AB1A 1TXKA 2WNXA 3PABA 2CZNA 3BHBA 4NQSA 2JJWA 4NNPL 3H2WA 4OGZA 1E9PB 3OPUA 1DJSA 2X0WA 3FAWA 1QVOA 2FBJL 3GKWL 2P5WE 3P11H 1XBRA 1RZGB 4HGWA 4K7FA 2AVFA 3KR3H 4FDWA 4A2LA 4PGEA 3BT2L 2HMIC 1ITCA 3WJMB 2WBJA 3TT3H 1D5RA 4J3OG 1AGEB 5FFOA 4XO8A 3FQTB 1NGXA 2BOBA 3L4WA 4HK0B 4JDTL 1G7HB 4FKEA 3JWOH 5SV4A 1BD2A 2AEPL 4IGBD 4W9FC 1WWBX 2K0RA 4Q9QH 4P5TA 1WA0X 4LMQE 1IC4L 2DWXA 1JMXA 1KYOK 1CFSA 4NGHL 3CHPA 1BD2B 3S36X 3VFPB 3SJVB 1M7IB 3BZ4A 1BOYA 3LMJL 3IJYB 4KI5D 4WWNA 3ARFC 2YGNA 1IIKA 4N25A 3UGXA 2VERN 3GC3A 4WY7H 4M7JH 3ZN6A 2OZ4H 5IKCA 4NIKB 4MB3A 1KY6A 1L9OA 4LKXA 4HU2A 1E5CA 2MCPH 3V52H 2FX9H 1F58H 5MEPA 1TEGA 1D7DA 1SJHA 1BF5A 1DQLL 4WEBL 1HQRA 4PREB 2WPGA 1QR1B 3FBKA 1XWVA 3BWAA 3U1SL 3SDCB 5HI3C 3BRGC 2J1ZA 4J3VA 1FSKB 1NIFA 4M56A 4CN4A 3I6KA 3C5JA 2W0LA 4HS6B 4WQOA 4ZG1A 4CU6A 3IMVA 2HT3D 4ZMNA 4AUYA 3ILQC 1I8KA 4G1EB 4YHML 4PJXA 4UTAL 1J1OL 3O6FD 5T5NF 2EDHA 3CV5A 1PY4A 1LEIB 3GWJA 1FIGL 1GC1H 5C0CA 3RHWK 4ZXBC 1X6NA 4L1BA 3OQ3B 4BSWA 1IFGA 3VD4A 3HRZA 4ZO8A 2Y1YA 4F37K 3V7AG 2WLIB 2WKOF 2QKIA 3D0LA 3QIUB 1F3JB 1KCUH 3CPLB 4LMQI 1ZK9A 2F58H 4FFYH 4H8WC 1OCCB 3SO5A 1KYAA 5KYNA 1D5IL 1G6RL 1VFBB 3SE8H 3ELAT 4P2QE 4X7TB 1AOHA 1OK8A 4PGBA 5E8OB 4U1MB 1KPRB 3RRQA 1RVFH 4I1RA 5I8CA 4BGDA 5IMLB 1QRKA 1YG9A 2C7FA 5HYIA 4LLVB 1JHKL 5EEYA 1WFTA 3MRFA 5KW9L 4U33A 1IZKA 2QKIB 1TQCC 3GSVA 1BBJA 1BVNP 3ME0B 3MRMA 3REVA 1IKOP 3HRZB 4GAJH 3V4PB 5A2KH 4I5BA 1UWFA 5B7EA 4YAQA 1VENA 4P46D 3ARQA 1T04B 2WZPD 3SYPA 3Q6FA 1KXHA 4JM2A 1VB9A 3UBHA 1G43A 3TLRA 1XH3A 3SQOH 5KS9A 1C12B 4EIUA 3MGAA 3OKOA 4OCWH 4UQ3B 2OBGA 2VLJE 2GTZA 1TVDA 2WKLA 5EBMA 1YRKA 5I17A 1FZOB 3OQRA 4TNEA 1OTTD 3N41B 3QRBA 3ZE2E 4LAJH 4A66A 1BIIA 5TQ2H 2O6DA 2IQAA 3M1BB 2VDKB 3PJSB 1NGQH 1SMOA 5F44A 5C09D 4UAOC 3RA7L 1XH3B 1Z32X 2PPCA 3GRBA 3C6SB 2ICEB 2V3DA 1S9VA 4Q9QL 2CO7A 4IBTA 4N0UE 2YA0A 3K74B 4AYGA 3T09A 3VFUA 2PYED 1A7OL 1E4KA 1V54B 2NY4D 4YAQB 4PJGB 2X38A 5KW9H 3QAZB 2DQFA 4GIOA 1LMIA 1HQ4B 5IW1B 3WV0A 1PDKA 5LCVL 1SMDA 5HHPA 1T5WB 3VGDA 2BVUA 4ZPVB 1AQDB 1YUHA 1NZRA 4JDVB 1YNKH 3N42B 2NYZA 4E9XA 4NWUL 3IEAA 1FNEA 2PETA 2Q3ZA 1UENA 3H1ZA 4G59C 4JFDA 1LP9B 3MFGB 2OS7A 3WIHL 3CU7A 2YAMA 1U21A 4NAJA 2CHDA 2CM6A 2Z92B 1ZTMA 2VDMH 2VUKA 4TLUA 5E5MA 4J28A 4EI0A 4L23A 5ALCL 2XIBA 2ZOWA 4KVNH 1U2CA 5FDWB 1BMZA 5BZWA 2XETA 4UQ9A 4G8GB 5BRQA 3TO2B 5F7WC 3A6BL 2ESVE 2PXYA 4YNYB 4IBQA 3NCFB 4WI4A 5BZWB 1BOGA 2Q10A 1GYWA 1RUQL 1E42A 5I8KL 3BDYL 2IGFH 3BKYL 4F20A 1IVTA 5D5MA 4DN4H 1A3RH 2EUXA 1TVHA 4PRIE 4DWHA 1YCSA 4TVPE 3V4VB 3IKCA 3KVPA 1FNEB 4JFDB 3DSFL 5D1QC 4Z7WB 2NOYA 5GGTA 4ERSH 1MQKL 3NMEA 1HQRB 3SDAB 3ORJA 4XOCA 1F4AA 4ABUA 5HDRA 1ZLWK 3AT9A 4FFZL 5EZOH 1PZCA 3PUUA 4WEUD 3HLAA 5F9JB 1EQWA 1WZ1H 4JQVC 5D96C 5DJZA 2RB8A 5K9JH 1GZQA 3T0EA 1NUDA 1ZE3C 5GS0H 2DL9A 4HALA 4HKJA 3RWEA 4S1RH 2VLLB 1SXZA 3VFPA 4YPJA 3P9LB 4JO4L 1IAII 1EUUA 5CP7B 2J21A 2BWDA 3SKNA 2XYCA 2J7LA 3V0AC 5INDB 4J3TA 1RURH 1CYGA 2ICWJ 4OFDA 4W81A 3N2JA 5AW6B 3UZEA 2B59A 5T3ZE 1KGYE 1FIEA 2BINA 3CNKA 2GHZA 3MJ9L 4B9JA 2OMNA 3DTXB 2VC2B 2LAAA 2FWLB 4JM2D 2CPCA 1IEAA 1JGVL 5K59F 1FC2D 4LU5L 1J0KA 2CR6A 1OCOB 2VITA 4O58L 3RURA 1RJYB 3S2CA 4P57A 1MCJA 5BV7H 4UT9A 4ZYKB 3NQKA 4GRWH 2NZIA 3MRQB 3UZQB 5AZUA 1KZQA 5A2AA 2A73B 1XZ0A 3GLAA 2OJEB 1YEWA 4EZJA 3R4RA 3C2AH 3HJ0A 5D7EA 1YN6A 1XGYH 3DUUA 4F8TA 3ASWA 1HKLL 3MN8A 5CGMA 5I1IH 1HJBC 3SDYH 5FOJA 2DMHA 2PYEA 4W4OA 1Z9SA 4O58H 2VLRB 4JHBA 2Z4QA 4OBSA 3GMMA 4KH9A 1O7SA 2WINB 4EVNA 2X2HA 4ZZKA 4HUWB 4XR8C 2ROXA 5C0AE 2ZTBA 4O51B 3MOAH 3CFQA 1MFDH 4I1NB 3RTLA 4XPHH 5HDBB 1S5HA 1ODAA 4W9CC 1ZV9A 3TNMA 2WZAA 3VFSA 4F7KA 3C6SA 1W72A 2EACA 3UPRA 1U8HB 3QJVB 2WKOA 3IVKA 3PAYA 4FJ6A 4HHAA 2B5IB 1EJ8A 2IAND 1A0QH 2BZ7A 4MAYD 3L5JA 2HVBA 2XCMC 4C47A 4QXTB 3ZY7A 2R29L 3RUGA 3WIHA 3QK0A 2BZCA 1D5MB 5ENWA 1UZ6E 4MSWA 2V17L 4HUVA 1G7JA 2ZYRA 1OPGL 5FM5M 1AP2B 5DXWA 2AABL 4BCYA 1CBJA 1FVEB 2NUPA 2N7BA 1UD6A 4FI6A 3TVMA 1DBML 4AH2A 1YYLL 2R1YB 3L9EA 1NBZB 3ATFA 4WK0B 3MCLH 1MHHA 1XGTB 5BVPH 4YSUA 4OIBA 4FXGA 4ZQKB 1PEZA 3VDCA 3KLQA 2ZD0A 2B1AH 3DX4A 1NOFA 2C1PA 3H0TB 2J20A 4NC0B 3KYNA 1ZCRA 4G7VL 4OSUL 4M61A 3L3JA 2NY0B 4M1GL 1NC2D 5IWLA 1MJ7L 2F8OA 3U7WL 3QQNA 4K8RC 1CCZA 5GHWH 4YSAA 3INUL 2EKSB 4JRYA 1HCZA 5D9SB 4FQXB 1TENA 1AFVL 4NQCE 5DFAA 4JFED 4KNTA 2D2OA 2R2BA 1CD0A 1NC2B 3HPJA 2Q9OA 4KUCD 1KJMB 3RVTD 1GGYA 4QUOA 4I4WB 5MERB 1BZOA 4EZKA 1SXSA 1BREA 2DLFL 1QVOB 3NUKA 3RFZB 3VQ2C 3ZKXC 1OARL 3BLBA 4ZSOA 1P7QD 1KBBA 2GIYA 2XY2A 4XVSL 4AEIL 5CN3A 5FWQA 1DEEB 2R9HD 2DI8A 4RNRA 5TE6L 4KK8C 3Q2CA 2DM7A 3THML 3JWNE 2ZQKA 3GNML 5GQBA 1GOGA 3LD8C 5DYOA 5AUMA 1NDMA 3D87B 2R51A 3L3HA 4TQEL 3RI5K 4DVRH 1EVTC 1CXKA 1R46A 1U92B 1OKEA 5ES4B 2VXQL 1B2WL 4WEBH 5DZPA 5F88B 3WKYA 1A22B 3CLEH 1OF2A 1IAIH 1OGAE 1Z9PA 5F7EL 2EC8A 3H9SE 3PU7A 5D1ZB 1FFNA 1TZGL 3GJEA 4KAQL 5EU5A 3UL4A 3BIKB 4MYPA 1GZPA 3D85D 3R0MA 2A9MH 4NENB 3EJZC 4U0RC 3CFKB 2M26A 5GRVK 4HQQH 2WBJD 4TVUA 2X3CA 5DYOB 2CDGB 1VPOL 2V7HB 4BELD 2ZCZA 3FFCE 1TFHA 3HAEH 1IGYA 1WAAE 3BPNB 1YYLH 2V8MA 3K8LA 3MV01 4HUNB 3C09C 4PJEF 4Z7IA 2BIHA 4XT1C 3ARPA 2XC8A 1RIUH 1SOSA 4M48L 2YKKA 2XPGA 4HUCA 4OIAA 5E5RB 1G7JB 4LAQH 1EH9A 3CZUB 4P2RB 1S9YB 2CGRL 3IJEA 3U83A 2EYSA 5H4ZA 3OAUL 1GYCA 2RTTA 3BP5A 2VCOA 4GI9A 3PUCA 1K4CB 1O7DE 2XY1A 1RK1A 1O6SA 3FMGH 3DYMA 1OB1A 5IQOA 4M62L 1ZS8B 2O5NA 1FWXA 4ANVA 5IEHA 1RIUL 3F5WB 2PR4H 4XRCB 2VDOH 1EX0A 2SODB 2VMEA 2EDBA 2H47C 2YKLH 4Z7QF 2UWEA 2Q1EA 5D55A 4L8BA 5FEBA 4WO4B 1JE6A 3IDYC 2QTEA 3IJHB 3ZDXF 3KPMB 5D7LB 3F83A 1UGNA 4NN6B 3GD1C 4UUJB 3HN3A 1ZLSL 4I0PD 2CDFA 2O61B 3NCMA 3HAEB 1KIQB 2NY6D 3KXFD 4Y1AA 2Z31C 1YY9C 4YH6A 2QGBA 1U2HA 4LDEB 5FYLH 2KHAA 3ES6B 1UUSA 4NOBA 3MUZ1 3M1BA 2DDQH 1IBFA 2NRDA 4PJBA 5SWZD 5DEFA 4I0PB 3KPRE 1FZOA