3SQBB

Structure of the major type 1 pilus subunit fima bound to the fimc chaperone
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
145
structure length
145
Chain Sequence
EVVNAACAVDAGSVDQTVQLGQVRTASLAQEGATSSAVGFNIQLNDCDTNVASKAAVAFLGTAIDAGHTNVLALQSSAAGSATNVGVQILDRTGAALTLDGATFSSETTLNNGTNTIPFQARYFATGAATPGAANADATFKVQYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chaperone protein fimC
publication title Quality control of disulfide bond formation in pilus subunits by the chaperone FimC.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural protein/chaperone
total genus 19
structure length 145
sequence length 145
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2011-07-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 3sqbB00
4AVJA 2JTYA 4BUQA 3RFZA 2UY6B 4XOBA 5LNEA 1PDKB 3JWNH 4AUYA 5FWRA 3JWNE 1ZE3H 2XG5B 1UWFA 4J3OF 4XOCA 4J3OG 4LOVA 4AVKA 2WMPB 4AV5A 1KLFB 2VCOA 5ABZA 3JWNG 3ME0B 5IQNA 4XODA 4AV0A 4X5PA 4XO9A 4AVIA 4X5RA 3SQBB 3BFQG 4XOAA 5FS5A 2J2ZB 5FLUA 3ZPDA 4AUJA 4CA4A 4AUUA 3ZL2A 4X50A 1KIUB 5AAPA 5AALA 4CSSA 5CGBA 1QUNB 4XO8A 4XOEA 2JMRA 2UY7B 1N12A 5IQMA 4X5QA 5JQIB 5FX3A 4CSTA 3MCYA 5LNGA 5IQOA 1TR7A 3BFWA 5F3FA 1N0LB 5AB1A 4AVHA 4AV4A 4ATTA 2W07B 4J3OH 2XG4B 3BWUF 5F2FA 3ZL1A
chains in the Genus database with same CATH superfamily
1KPUA 4M56A 5CGYD 3V4PA 1K4DA 3QYCA 4S10A 4C55A 3MODH 2JJSA 3AG2B 1BVOA 1E4XH 1TTBA 1DQLH 2WWMC 3CFMA 3O8XD 4JFQA 4U6VH 3UO1H 3CFEA 4LE8A 4JANA 1XGQB 3LVEA 1AD0A 1UCTA 4JVWA 1QWHA 3VGBA 2DWYA 2EIMB 5IVXF 1HXMB 3HPJB 2XFXA 1XB3A 2WLNA 3P2TA 5H4ZA 5JXAH 1CN4A 1MRDL 1JPSH 5DQ9A 5EUOB 2VB5A 4I87A 4PJFE 3AFLA 3P4MA 4A7UA 3Q43A 3DA0A 1E4KA 3QC6X 3AGVA 2IBBA 2N4IA 4FKEA 2Z34A 4RSVA 1J8SA 5EPMB 1SVBA 2ZX6A 3JWNG 2YWYA 3NGBC 3QRGL 1SYSA 1SQ2N 4JQVC 3WFEH 3WCYA 1RULL 4IOIB 3ECWA 5ITBL 4ZUVA 4LLAA 4P4RA 2WTRB 4HT1H 3TBVA 1LJMA 1A8JH 3FMGL 2HWZH 4JO3L 4N2GA 1T5WA 3DIFB 3CVHA 4A7GF 7TAAA 4HS8L 2WWKO 5E08H 1CFVL 3EOAB 4PN6A 1BEXA 2V5RA 3JUZA 4AUJA 3DJ9A 3H6JA 2FDBP 1FHGA 4OIIH 3FTGB 1UZGA 3CFUA 3PQYB 4NEHB 4A6YL 3RNKB 2XRAL 4UCFA 4Z7WE 1QLFB 1CDCA 3O45B 3ERXA 2JH2A 3ZGHA 4JHAL 1BGXL 5HHOA 4NAJA 5BRZD 3WEXA 2D7QA 3H3PH 3RWEA 4P05A 3AS2A 3HFFA 1D5IL 1YO4A 4RMVA 1JXKA 1NGXA 4MJ2A 1AHWB 5DZNA 3V6FA 2ZNWA 5KYYB 4HSAC 5FUZL 2FZ3A 2OPCA 4DN4L 3RL2B 2CLRA 4PWHA 4JR9L 1NCTA 4JDVB 3OF6D 4OLVH 3ZJAA 4UWQB 2W65B 1OGPA 1CFNB 1P84K 4HF5H 3W2DL 3ATFA 3UBXA 2XX0A 1FFQA 3C8KB 2OTUB 4JFPA 4OI8A 3HMWH 2NR6D 4I9WE 4QXUL 5I2IB 4TTGA 4LSQL 2KLSA 2XPGA 3L3HA 4FERA 4W9EC 3UPRB 1ZT1A 1BXAA 3B1UA 5ID0A 3QDMD 5F7KC 1MIMH 4LCIH 5FCSH 32C2A 1WCQA 4MMXA 1IBZA 4P2OA 4PRIA 3D2UD 2XWDA 3NCYP 3H9ZA 4DKFL 4LOFA 3MCLH 1J1XH 2X1QA 4DQOL 2CK2A 2VDQL 3UFIA 4YDVB 3VMPA 4QTIH 3OJVC 4OY9A 4MCMA 1Y6NR 1MXDA 1ADQA 3D09A 3IDUA 3B3IA 2A6JB 2X0VA 4G6FD 2FH8A 4HU2A 5AYUL 2BSSB 1L9PA 4QT5B 4A55A 1ZWIA 3GNMH 1FFNA 1CE6A 1FIGL 2WVTA 1ZE3H 2PXYB 4QO1A 3MRCB 1YY8B 2PTTB 4KO7A 4MA3B 3SKNA 1F2QA 4EO5A 1GY1A 3PV6B 4JJHA 1YMHA 2EH7L 4MYWB 1KLFB 4DW2L 2MSPA 2CKBH 1P69B 1GIGL 3BVNA 5EF3A 1JYWA 3P3UA 1SJHA 1XIWB 1KEMH 2ZZUT 4MNGB 3VD9A 5CEXA 3M88A 4S1QL 5ANMB 1IGFH 4NC1C 5DWUL 4QTHB 4MJ6A 2BVPB 3KWWB 3MV7B 1OIOA 3W0WD 1WBYB 1GS7A 1R3LA 1S9YA 4FTVA 3T04D 1ADWA 2W59A 3ZZSA 1TTGA 2ZXDA 2JQAA 1WQVT 2Y2WA 4NKIL 2H2PC 2VZOA 1D9KB 2JLLA 4J8RA 4LNRB 5E2UL 3BDYH 1C08A 2VR4A 4YNYA 3QIWA 3FQNB 1MJJB 3P77A 4R4NC 2CDFA 1J5IA 3KYMB 3RWFB 1OAQH 2QR0B 4HVBA 3I3DA 1EUUA 5BRPA 2VAAB 2HJKB 1PAMA 5J6SA 3VWJD 4N6RA 1W15A 3ALXA 1NCAH 4YH6A 4DHLA 1P9MA 1HEHC 2JCCE 4FLQA 1C5DB 3C5ZC 1LVEA 1RL1A 4NN7B 1M1SA 5I6XB 3C6LA 3U1SL 3ZHFA 4ELMF 2AQNA 3IJYB 3BWAB 4R2GB 5D7EA 3WUZA 1TPXB 2CUAA 2NYKA 5JIMA 4FCHA 3MBWA 4PRNB 5BVPL 3V6OA 1E40A 1BJMA 4WW1A 4XB3A 1F4YL 5JW3L 2CJTA 4RLDA 2GSGB 1CVSC 4BBWA 2WLYA 3BP4A 3WY1A 3GSRB 4NB7A 1KYAA 3KL0A 4TUJA 5A6LA 3D08A 4CNIA 1BAFH 4I9XA 1FPTL 1RKRA 4KY1H 1NPJA 4M1CD 5GS1B 5IHZB 4LDCA 1IB5A 3X3GL 4P23C 3L08A 3LZOA 4KO9A 1CS6A 3FSVA 4FNQA 5HI4C 4JKWA 4YOKA 3O3AA 5EU5A 4PJEA 2H5UA 2HLEB 4K3JH 4NQCE 1T5XB 4HIJB 2JKRM 3SBQA 3HUJA 4YE4L 3VFNA 1P5UC 4FFWD 3VXNB 1SEBB 5ICYB 3LNFA 2HSIA 1J18A 3L3KB 3NK3A 4IKKA 4R7NB 1ET7A 2C5DC 1AGBA 2ZP8A 4H5SA 1AZVA 3MUZ1 5AOIA 2XA3A 4EI5A 5KN5B 3HG3A 2Y6SD 4EDXA 3NCXA 3NJXA 2ADGB 5CWSB 1FVDA 1JD7A 2EO1A 2XWEA 2ZUSA 5DJ8A 3VXPB 1MOEA 3O2WH 1T4KB 2EKSB 4Y5XA 4DKEH 4IBWA 4GQPH 3I6GB 3NSYA 1JGUH 1F0LA 1QBAA 3MXWL 4XNAA 2X3BA 5FOJA 2IBZY 3WNIA 3HNSH 3MGOA 3T0ED 4NKMB 2RFXA 3HC2A 4HUNB 5AZUA 3C09B 2X2JA 2A7BA 2WKOA 2WWKT 3A6BH 2YXFA 5E2JA 2OYLA 3SGKA 3VFUB 5HVWA 4L9LA 1KGCE 2IOMA 4YQXL 2N3JA 3OJMB 4OSUH 3NIGF 4OU3A 1GH7A 4FADA 3BISA 2R29H 1C8PA 1LEKB 1CDIA 2JIXD 1HHKA 3CHPA 1D5XB 1WZ1H 1VFAB 1P7BA 1T21B 2E9WA 3O11B 4FQ2L 2YPLB 1J1PH 3TT3L 2Q7YA 2VTFA 1JV2B 3EOTL 1I8UA 5C0GB 1KWGA 2AI0L 3GLDA 4A7GA 1GL4B 1UD6A 1ZT7B 2K70A 2YBRA 2Z4TA 1RU9L 4LLMA 4HPYL 1T89A 4GP4B 4UMSA 1CURA 3D39D 1JWUA 2UY7A 2CA4A 2HN7B 1R46A 2WQWA 3DX8A 2VZ1A 3QFJD 3RU8H 3ZKSD 1K8IB 5CINL 5B39A 1SDAB 3BZFA 3QZWG 3EADA 4NI6A 1S9VA 2W0FA 5D72L 1FNGA 5HHVH 2GJRA 5DD1L 5E8DL 4QRRB 3KHOA 1TQBC 1CFSB 4WI8A 1KTCA 1OTSD 4PMEA 1UADC 2V8MA 3N1FC 3ARBC 4N2BA 3RVWD 1EXHA 3F62A 4FXTA 3CZUB 4B6ZA 4ABVA 4HPHA 3SYCA 2P5EA 1CXIA 4F33B 4JG0L 3DX7B 5FYJU 4IK6A 2E27H 4OVUA 1U95A 5B1AB 2A77H 2NY6B 1HQRB 1UJ3C 3LMJL 1MJ8L 1L9QA 3CSTA 4PEEA 1Q72H 3MGTA 2VM4A 3WE6B 1L3WA 1P4BL 2NSMA 1FE8L 2Q20A 3ZDZE 4XMKL 5DVNA 1UWGL 4X6CF 4OT1H 4WU7A 3QDAA 4NP4H 3RVXC 5FO7A 2H32A 2YD4A 4P5TD 4W9DC 1F1DA 3MRHA 4Z1PA 1NCCL 3HZYB 1FO0L 4Y2DD 2AEQL 3OAWA 3VCLB 4UBDD 1TENA 2BXYA 3MC0A 2HPTA 4KTGA 2R2CA 3D50A 2X88A 4JG9A 2K0RA 2ITCA 3V4PH 2DF3A 2PO6A 4AITA 3BT2L 3QPQC 4KKAD 1RLWA 4HGKC 2R1WB 1NMAH 2YA1A 1CGTA 5CJ8A 1M7DA 1I9EA 1JFQL 2H4EA 4V1DD 5D7LB 4I8DA 3ZE2B 1HINL 3ULUD 1BM7A 1G1KA 4I3SH 1MLCA 1Q1JL 1PG7W 2EADA 2YAEA 3CFIC 3B7RL 2FWOA 4YDKL 2K4AA 2KZWA 2UVFA 3FB7A 3OKDA 3TH2T 1CFBA 2EZ0D 2ZX8A 3V5KB 4Z3GA 1IMHC 4WI7A 3CLWA 2FRGP 2WB1A 1ASPA 4N6QA 1CGVA 3RLSA 2DLTA 3PWPE 2IH9A 3UJJL 1DO5A 4L4TD 1KTBA 1UB5B 2Z1PA 5EUKB 1XR8B 5HHPA 3CTTA 4PJIE 3IXTB 2OXHB 1ETB1 3AACA 3HVDA 4XH2B 3C60B 4H25A 4KPHH 4MCYB 4U4IA 2A9ML 4HOWA 4IBVA 3VDAA 2BWDA 1LNUB 3M86A 1JYNA 3NQIA 3O6FB 3PIQA 1NDMB 4Z7NB 1NCGA 1SHMA 4ALAH 1G6VK 4NO0B 3HBPA 2OMYA 3ATDA 4X4XB 3E6HA 5ENWA 1CZ8H 4QXWA 2AJYH 2GC7C 2JJTC 1JS4A 2Q6WA 1OAZL 5DHXB 3U0WH 3BZ5A 4FZ8L 3A47A 4PJ7B 4AGPA 1WFJA 3QRLA 5GRJH 2Q8AH 5IROC 1H3XA 2ZOUA 4LPTA 4L4VE 4L8SB 3MDJA 3S6CA 4XVTL 3AT8A 3SE8H 3P73B 4XPAH 5B21A 5CJBA 3EKCA 4AIXA 1V5JA 4NO5A 4ZDHA 4RMTA 2GIMA 3LZRA 3S35X 2I9TB 2ED6A 1UFGA 3F5WB 4OLUH 4BKLB 1XX9C 5EIQA 4UUJB 4Z7QF 1DEEB 2FTAA 5AW6B 1HCYA 1WF5A 4AENB 1X5IA 5EZLA 5T1LA 3VXUB 1QNIA 2EAEA 4XP9H 5EWIH 3T9WA 1R5WB 2VDRH 2FBJH 4R9HA 2X2IA 2DQIH 4LPWA 2I7OA 1PKOA 1F90H 1UA6H 3FQUA 1TYEB 1NFIA 1CO1A 4XWGL 3G5XA 2XU9A 2XBDA 4HWBH 1DQMH 3Q1SL 3QYMA 1NJ9A 3UTSB 1S5IH 3LNEA 2F68X 5ANHA 5BZWB 3N9GL 5EU6E 3CH1B 3EBGA 4FFZA 3GMNB 4TUKH 2UX6A 2YRPA 3OAUH 4PR5B 1UA7A 4DAGL 1QTYT 2ZSVB 2NX5B 3QRBA 3TP4A 4TVPE 1IARB 4AYID 1QX1A 4N1HB 1BIIB 1BZQK 1PZ5A 1HI6A 3BN9C 3S2CA 1QEXA 3N41B 4GSDH 1CT8B 1GGBH 1GHFL 4IJTA 1MCCA 4Y16C 5GGRB 2F1AA 4ODTH 4P3DA 4M7KH 4G6KH 4I88A 3QW9A 3KHQA 5BO0D 1AZCA 2WLLA 2J72A 1G7IA 4OFVA 1KULA 3LKNA 4PJ6A 3E9TA 1AZNA 2BSRA 4F7MA 2HVJB 1Z5LB 4ANKA 4ZD3H 3O6KL 5FK9A 4J3VA 3RJDA 5C1MB 3D69A 5LHDA 5FLUA 4I9WD 2PXYC 1OPGH 5MERB 2BNRA 4XX1G 1MWAL 5IK3A 5F88A 4PP2B 5BZZA 1DQQA 5BV7L 1Y18A 3HNTH 2H0PA 5DQDL 5DUBB 3ETBF 2JKSA 4JW3A 4GMTH 3KWXA 1EJOH 2BSTA 4R7XA 4HBCL 3TV3H 5HXMA 4XE0A 2H41A 2NY7L 4MA1B 3SKOB 3EH5B 4BZ1H 2DRUA 2Y7MA 1T0OA 3IWUA 3PFUA 2BVTA 1FAIH 3HFML 3TBWA 1YEFL 4AYDC 2VERA 4EXKA 1QR1A 1KYOJ 4XBPA 1D9KC 4LSUL 4PJ9B 1CLZH 3KPRB 4G7VH 5F9WB 4D0BA 2V33A 2GJ6A 5AOKA 1IV8A 3DVGB 2EIDA 4ZS7L 4XVUD 4AG4H 3LD8C 2VNCA 2QPSA 4NSKA 4OCLC 5C08B 1J0IA 2EXYC 2GK2A 2OP4L 3TVMD 2VDLB 4PUBH 4AVHA 4P46B 1XXDC 4WHDA 4O2EB 2NYYC 4LP4A 3LQMA 4NENA 3VXTA 25C8L 3SGEH 4PTTA 2ADFL 4NN7C 5ISZE 1BCIA 4C4KT 5I6XC 4CVZB 1UC6A 2J6EH 3CZFB 4LF3A 3L5HA 1DSYA 4FABH 4R2GC 1TPXC 3T65A 5ERWB 1UWEL 4Q0XH 3HAEA 5DT1L 3VQ1C 4HUVA 2ARJA 2PCPA 1PDKB 3T4AA 2EYRB 2DN7A 4YHZL 1MCWM 4NPKA 4GW5B 1YVLA 3O0LA 4IRZH 5ID1A 1UXSB 4CMMA 4Y2NA 2EXWC 5C7ZA 4M6OH 4Y19E 1UXMA 5GS1C 1ZV2A 4NQDE 4J7RA 4ODUA 4MJ5A 2DMCA 1ET5A 2OZ4A 4W9ZA 4UTAA 1QUPA 3D0LA 2WXLA 5EF2A 1C5BL 4GRLA 1ZMYA 3LZFL 5CHNA 4ZOEA 1I8IA 3DKHA 4WKXA 2YMXL 2AJZA 4EAEA 3G6JF 2OL3L 5KTEH 3ZE0F 2VABB 3HRZA 1MH5B 4K55A 4LKCB 2HMID 5GGSA 3S88H 4OD2A 4D3CL 2NY5L 2VR7A 3FUJA 3APMA 3MV11 1AKJD 3QJFB 5AKVA 3SQRA 5ECJE 3QXDB 2NUPA 3QIBB 4YGAB 1FBIL 1K3IA 1RZJC 4HHAA 3VRJB 3RIFF 4M8QB 2D9CA 2XI9A 1KB5L 5C07E 4LARH 5SWSA 1UVQA 3QWRA 4FYQA 1PS3A 3A4DA 2AHIA 4F15B 2AQSA 9CGTA 2N1TE 5DMKB 1R19A 5JHDE 3C09C 1INQB 1AY1H 4NQCD 1ANUA 3BWUC 1PU0A 1RZ8B 4HJGB 4J3UA 5DJDB 1KENL 5CLWA 3FH8A 1L9OA 4HQQL 4PVLA 1PJ9A 2H47C 4YZFE 4MBRA 5M94B 5TQ0L 4WK4B 5E8EB 4YX2L 4H26B 4R97C 3T0AA 4Y5VA 4OGXH 1SNRA 1FQ9C 1X6NA 5G4MA 5LGJB 3VNZA 1Q1PA 1ZS8B 4PWFA 4GRMB 1K4CB 2AC0A 2JQMA 5IV2B 2PETA 2L7JA 2RMNA 1MLBB 1HYSC 1GMIA 1KXHA 3DVFA 1Q9WB 2ICEB 3NACH 5L2JA 4Z0BL 2DQGL 1UM6L 2LFGA 2ZJSH 5I17B 3CG8A 5FHBH 1KGCD 1XCWA 3VU1A 1C12B 3OQ3B 2DYSB 3OL2A 4I4WA 1ZPLA 1KPUB 4B97A 1KSRA 1UGKA 4NNPH 2GBAA 3V4PB 4XX1E 5AZEH 1G1OA 4YWGH 1K4DB 4JRYE 3CQPA 1TZOA 2AGJH 4WFHE 1SJMA 5DD3L 3O2VL 4JFQB 4N3TA 4U1IA 4QXGL 3CFEB 1KTJA 4JANB 1NAML 1AD0B 1MKFA 2BY3A 2V5TA 3LNIA 4JS7A 2O5ZL 3CZKA 4OJFL 1NQBA 3N55A 4Y1AE 4KXBA 3SSGA 4U2ZA 4FL4B 4AYMC 2XFXB 2VAJA 3UTPE 4Y5YA 2J8OA 2UZYA 2NY6C 2ESVE 3NFPA 3HE6A 3EFDH 5DQ9B 4W4NA 2QL1A 3ISRA 1MEXL 3P4MB 4FXGC 3ZMEA 4JFDE 2DJ4A 2CBOA 1B3IA 1A1OB 1FHNA 5FGRA 4YXLL 5ADOH 5G4NA 4OJDH 3MNVA 1OM3H 1SYSB 4B0MB 4UU9A 4ZZFA 2WLHA 3TBVB 5T33H 2X40A 4QKTA 2ZP0T 3SQBA 1R47A 2MQ0A 4IRSA 2FSEA 4HMEA 1T5WB 1UB6A 3CVHB 2QDVA 4A6YA 2GPZA 4RRPG 4J2QA 3C5XA 1A7NL 4A7TA 3K6NA 5GGVH 5AENA 1D5ZA 2UZXA 1FDLL 3JTSA 3PXJA 2DAVA 5IT2L 1GYAA 1UT2A 4FEMA 1RK7A 1RVFH 2W9DH 2GABA 5HHOB 3WEXB 5EEXA 4ZMZA 3VGDA 1R75A 3QNXA 3QXWA 5B7MA 5A3IC 3RWEB 3SGDI 4TRPH 1BFTA 2DQUH 1FSKC 2FUTA 2ZCKL 1NGXB 3V6FB 4E0RA 5KAQG 4PIRF 5KSAA 1YEJL 4Z7UA 2FZ3B 2ZUUA 3H6AA 2CA3A 2CLRB 1BQRA 4LVHB 1C9SA 1U0QA 2J88L 3IKKA 5JR1L 3KBPA 3QQNA 5AYTA 2VGLM 5I6OA 1PKQE 1JV5A 4EIUA 3SKUD 4AKQA 4HJSA 3C60C 3KPSE 4RRPM 3UBXB 2NY4D 1A9EA 4JFPB 2M1KA 2PP9A 4IMKC 4UDTA 3O6FC 2QVFB 3D3VE 4PJHE 2MIZA 2XPGB 2ZWNA 3L3HB 1ZT1B 2OM5A 1CIUA 3CHOA 3TU6A 3QJOA 2VRQA 5ID0B 2VDRB 3QUML 1IQDA 32C2B 4L3FA 4MMXB 4P2OB 3WTXA 2E46A 2VUOA 4PRIB 4MAZA 4ZYKA 4S11A 2J7LA 1T22A 3LRSA 3TA4D 2OMBA 3E38A 1NAKL 2C8NA 3PWPD 4IMLA 1YYCA 3WTVA 4N2NA 1BM3H 2RTTA 3LHAA 4LRIA 1SDYA 4OLXL 1TFHA 3GXPA 1HNGA 5GZND 1ZOXA 5EA0L 1JPGA 3UZEC 4RX4D 3NSFA 3FFOA 3B3IB 1E67A 5EEWA 1BD2E 3NJHA 3ETBJ 4M61A 2Y2YA 2CJUL 1KC5L 1ZANH 4Y4FA 2RD0A 4A7QA 1ZWIB 1Q90A 3AC0A 4M4PA 4X7DC 1FFNB 1CE6B 1FG2A 4QO1B 2OYPA 3SKNB 3QJRB 5L4JA 2ZOWA 2IGLA 1E3ZA 1K3ZA 1LDPL 1YMHB 4N8UA 1WA0X 3RJOA 4WSGA 4AV5A 4XMZA 2BH0A 2VDMH 3ESUF 4O58H 3F58L 1CDUA 3BKCH 4YHKL 3DMMD 5FUCE 3NDZE 3BVNB 4FCAA 1SJHB 4JKPH 4Q74A 1RZ7H 3ZKMD 4LIQE 4Z77A 5IQNA 1O5PA 5CEXB 1ZE3C 3O8XA 1TJXA 1MUJA 4MJ6B 4L4VD 3GYRA 1HEJC 3KEDA 1HC1A 1R3LB 3QAQA 1S9YB 5KJRL 4FTVB 1R0AH 1PFCA 1TEYA 4URTB 2L04A 3NCCB 1CD1A 5I30H 1JHLL 2ZUXA 1WA1X 2GW5A 2L7UA 3FO0L 4J8RB 1V05A 4F7KA 3JZ7A 4GW1A 5A2BA 5A6IA 3S8GB 4OF7A 4GQZA 4MB5A 1C08B 4YNYB 3DOHA 5FHAL 3QIWB 4ODXA 5DC4B 5E6YA 3P77B 2F2HA 3DRTA 2CDFB 5JHBA 2X0WA 3OR6A 4DO4A 1OSPL 2B0SL 3LZQA 5KANG 3TZVD 5IQ7L 3D06A 1JMXA 3BLKA 3KBHE 3PGDA 1T66D 4OCNC 5BNXD 1NIDA 1LE5A 2WBWB 5FDYA 1P1VA 5HD8C 4C54A 4N6RB 4YXKL 4NZUH 3UJIH 3UAJC 3NCJL 3BW9A 4TSCH 1H15A 1WFUA 3DSFH 3WUWA 4MFHA 3JV0A 1GR7A 1AOZA 2RR3A 2YK1H 4AOFA 2CRYA 2ZG3A 5EU6D 1B88A 1YMMA 1QOKA 4PSPA 1OL0A 3C6LB 4QDGA 2C26A 4OGAC 3UYRH 5IZ7A 2P5WA 3APDA 4WEBH 4ZW8A 5JHLH 1PX4A 4TVPD 3MBWB 3IDMA 3QPXL 5C86A 1QACA 4WW1B 2A38A 1EDHA 2QPDB 2HKHL 2R0WH 5GRYA 1SXCA 3BP4B 4TSAH 4FLSA 2ODIA 4MA1C 4TUJB 1U8JA 3W81A 2QTVA 4CNIB 4H8PA 1F1AA 2F58H 5EH1A 4PRDA 5JW5A 1PZUB 4TS6A 1GS8A 3S35L 4F5CA 3OXRA 2PW2A 2EDOA 2OLDA 2KPNA 3L9EA 4RVBA 4FQLL 4UM8A 1H3UA 3O3AB 5EU5B 4PJEB 3T2PA 3VE0A 4PJ9C 4BSVA 15C8L 1CGSH 1JGVL 1NGPH 4F91B 3HUJB 3VFNB 2NR6A 4S0HA 4LSTH 4HG4J 4LU5H 4B7IA 1AHMA 3DX1A 3PNWA 5FC9A 1AZZC 3P3YA 5LB1A 1AGBB 2VM3A 1RZPA 3CK0L 4H5SB 1AS7A 2NT0A 4XNYL 3VW3L 1OAXH 3Q44A 4EI5B 1BQHG 2E7CA 4EDXB 3D2UA 2GB2A 5LCVL 4P46C 1FVDB 1LP9A 5DJ8B 4EEEA 4E36A 2D3NA 2R2HA 4Y5XB 4IQHA 3NZ8A 4NT6A 4TNEA 1LQSR 1NMCB 1WA2X 5DC9B 4LCCC 1B2WH 1QHQA 2ZX7A 4P9HL 5DJAA 3VQMA 4EZJA 1UXLA 1YJDH 4XNUL 1JZEA 3MGOB 3VMOA 3WY2A 2JELL 4XP1H 3DYPA 2OZ4H 2RFXB 4UAOB 2HYMA 1V7NH 3GZOA 2JCWA 4FHBD 3MCKA 3WBDA 4PP1C 3NEEA 4L9LB 1MJ7L 2ZTBA 2FX9L 2GI7A 2HTLD 4OTXL 3UG4A 2Y3AA 4IBUA 2B1HL 3NIFB 1H0DA 1MCLA 1HHKB 3CMOL 4H0IA 5I6PA 1RIVH 1JVOA 4L3EE 4O5LH 1XQ4A 4I7ZC 4F2FA 5IMLA 3OKLA 1O7DC 4JKNA 1P7KA 3BWSA 1SEQH 4LVNB 2Q7YB 3WN5A 4A7VA 2R0LL 5ISZD 2YBRB 4JHZA 5J1AA 4LLMB 4EDWL 4IOSA 4IU3A 4TQPA 1BYPA 2EKJA 5F7UA 1JWUB 4NZRH 2UY7B 3KLKA 3T0XA 3DX8B 1BX2A 1W0YT 2YJQA 4ELKA 5B39B 3BZFB 1CDYA 3GBEA 5H94A 3GC3A 4XMWA 1S9VB 2W0FB 4UIKL 1FNGB 3LQAL 3MLSL 4F7CA 5C0DA 3BHBA 3H3BC 2XWBA 1CYGA 3FS9A 2YEVB 2K7QA 1QI3A 3QIBC 3BD5A 4WWPA 5DTFA 5CR1A 4IIQA 2HT3D 2XWZA 4WNJA 4Y19D 1MVFA 4LRNH 4NQDD 4OLWH 3P4LA 4TUOA 3DOSA 3PHSA 1PL3A 1QZNA 3WJJA 5AD0A 4YR6A 2XZQH 2CHWA 4F15C 2NRDA 2IMMA 1OSEA 2ED8A 2P5EB 5T1JA 4KVNL 3WELA 4Q89A 5DDHA 1U95B 4UYPA 5JZ7C 1RLBA 5A2FA 4Y8DC 3MGTB 3MV01 4WTXA 3KZ8A 5D2LF 3EO9H 2Y72A 1QFUL 3GI9L 3VXRE 5F93C 1FO0A 4OCRH 4WU7B 4RCAA 3T3PF 2K6ZA 2AEPH 5FO7B 2H32B 3S98A 5B1JA 3MRHB 3VFGH 5IEKA 4OIAA 3D05A 3BZDA 4TPRL 3H42H 3AVEA 4BHUI 3SN6N 4F8PA 2HFFA 1ZHKA 1CGUA 3CH8A 4K23H 3GB7A 3LZPA 4Y9EA 2E0PA 2ZCZA 1A3QA 2ITCB 2PO6B 2JKIS 2ICEC 1E6JL 1BG1A 1T83C 4JM2D 2ENPA 1M7DB 1CLYL 2YJLA 1YN7A 5L88H 1B6UA 3VDCA 1IJNA 1H8SA 4XCCL 3JT0A 1MLCB 2FWOB 2UXFA 3I2CH 3U6XA 3UXFA 2XFGB 3FB7B 2XVLA 3OKDB 4R4FL 1HDMA 2EILB 2YQ2A 4H4NA 4R0LA 2Q0ZX 3KGTA 3VFVA 4MX7A 2JJSC 3JXAA 2WO2B 1HVXA 3P40A 2EE0A 3WFDH 4HKZA 2HZHA 5AVYB 2XN9E 1RFDL 1Z9OA 3P3TA 4RAHA 3D9AH 4K9EH 4FL4C 4LCWA 4I77H 5D6DA 3GHEL 5HHPB 1GCFA 1CFVH 1A7OH 5D7IE 2Y23A 4H25B 4D8PA 1F11A 5GHWH 3T0EA 1ZLDA 1LO5A 3CZGA 1B0RA 2JB5H 3SDCA 4B9KC 5I1KL 4HLZH 4U3HA 4LHUG 4KRNA 4UQEA 1KB9K 3GFUA 3GZKA 3PIQB 5CKAA 3QUKA 2OJ1A 3MTRA 5CJXA 4UNTA 5ALCL 5IBUB 5IGXL 2WP3O 4PRBA 3BVWA 2OMYB 4JRYD 5ENWB 2ROXA 3E6HB 3UIZA 4KZDH 4WFHD 2EEAA 2Q6WB 5LNDA 2JIXA 1CQKA 4FXLA 4DN4H 1FFPA 3UAAA 1FNLA 1A6VH 5EZOL 1U8IA 4WAFA 3RFRA 3B9KC 3QUGA 4Y1AD 1S9XA 1L7TL 3UTPD 4JUSA 4ALAC 2WO3B 2NY3B 3PL6A 2ESVD 5GRWA 4KKQA 4U0QB 4XPGH 1T7XA 5I75B 2MTPA 1A4JA 4NO5B 4ZDHB 5FFGA 2JKJA 4JFDD 3KGRA 5F0LB 4ONOA 4GKOA 3RNQA 3R06A 4LSQH 3TA3D 2D03L 2EDRA 2R59A 3ESVF 5EZLB 4JAMA 5T1LB 4AY0A 4AGMA 4LVHC 2HKFL 1XGZA 3B7SA 4RMSA 3RX7A 4DOHE 1FNEA 2K6YA 2Z65C 3OLGA 3FQUB 2YQBA 1P53A 1NFIB 4NUMA 2EEFA 3GS0A 2DTSA 3G5XB 5DR5H 1F3DH 1L7IL 5AL0A 4IGBA 2CBMA 1NJ9B 3BE1L 4XCYA 5D71L 5IOPA 3O9WD 4X83A 1MRCL 3K5RA 2F08A 4C59B 2AZAA 3UOAB 1I1RA 3ZDYF 2COVD 2VDMB 4K8RD 4MXVE 2YN5A 4WHYG 5DUPH 1RZIA 3MNWA 4BV1A 5AFAA 4P2OC 1WFIA 4WWID 3WNJA 1PZ5B 1HI6B 4XVJL 1KBWA 3TTYA 4UQ3A 2XQYK 5D1XE 1O75A 4OFQA 1X9QA 3X1EA 4P3DB 4PJXF 3SQOL 3DX3A 1MF2H 3OJ2C 3GMQA 2WLLB 4KITB 1WEJL 4UQBA 3TFKD 1G7IB 4Y2DA 5CEZE 3T0WA 3L4CA 3WN6A 3K2KA 1YEWA 4BQBA 4LHQB 3LKNB 2NY2D 4NQQA 2VXUL 5D2NA 2BSRB 4F7MB 5D7JA 5CP3A 1H8NA 1CYWA 1GYUA 2XN2A 4HIXH 5FK9B 5K9QG 4DSYA 2EDBA 1O9WA 1MDTA 1MWAA 3D69B 1MCEA 3BXNA 3O3EA 2E74C 4QHNA 3D3VD 4H8VA 4XP6H 4V1DA 3S3PA 3C5JA 2BNRB 5H37A 4NKIH 5IK3B 3ALPA 5F88B 4ZFZA 1DQQB 4GRWE 1Y18B 3HC3L 1E5AA 5GJTH 2GITA 1KBGH 1K8DA 2XQBL 1ORQA 2VLJA 2CBQA 1BVLA 1FCCA 3A21A 3KBEA 3KPLA 2IALA 2GIYA 4CILA 2BSTB 5LXGL 5TDPA 2QVTA 1BZOA 3B2MA 1B9KA 4L4TA 3TXAA 3S3JA 3TBWB 2Y9RT 2BP0A 5LO7A 3EF4A 2APFA 1BD2D 1SY6A 3TONA 3V10A 1QR1B 2R2EA 5E5UB 2DPKA 4HOMA 5F9OH 4XBPB 1E0OB 2Z92A 2A4CA 1W0VA 4OGQC 1CI3M 3WO4B 2GJ6B 2C7UA 3IJ9A 3REWA 5BVPH 3H0TA 5K1JA 2Q8BL 3MQIA 3EBIA 5JW3H 3HMXL 2P44B 4U6XA 3GBDA 4N8PA 3IDNA 3OPUA 4NSKB 1AFVL 3FUNA 3T3ME 5HGDA 2KERA 3L4YA 1PMYA 4Y7OC 4FLRA 3GS7A 2VN7A 1P9MC 4JDZA 4QRPE 2G5RA 4NENB 3VXTB 1NH6A 4XMUA 5TF1H 4PTTB 2BIIA 1Z3GH 4Q2ZA 3C6LC 4RFNB 2MQCA 4LF3B 4TNVK 5CCKL 5B8CA 3T65B 2XV6B 2VL4A 4P0DA 3EYSL 4KDTA 3HAEB 3V6OC 3PUUA 4HUVB 4PJFA 2ARJB 2PCPB 4UZSA 1SLVA 3T4AB 5IHBA 3F00A 4YE4H 1E6OH 2IV9A 1DBKH 5T5FH 4YHLH 5HP5A 2AQ3A 3INUH 5ID1B 4CMMB 4DEWA 5DYOA 1I9JH 1BYOA 4GQ9H 1CBVH 1XAUA 5GQBA 3M8OL 4ODUB 3S3SA 4MJ5B 1T04A 2WGNB 3ZKQD 2X4NA 3D0LB 2VUKA 1NANH 3MV8E 3E1F1 4GRLB 4AM0A 4ZO6A 1BEYL 3QHFL 4M6ML 4CU8A 5LWYL 3FUFA 5CHNB 4QXTA 2OL3A 1I8IB 1SHXA 2J1KA 3FCBA 4RESB 4U1MA 4Z7WA 5AVVB 1UKTA 2AJZB 4ZNEE 4JBSA 2IGTA 4F57L 4PCKA 4YIQA 2JXMA 3HRZB 4JKMA 5GGSB 4OD2B 1YSOA 4G6JL 4EI5C 3NUKA 2R8SL 3ZY7A 1EBPA 4F24A 4OCWL 1KB5A 1X3DA 2DEXX 2NUPB 4M6NL 4Y5XC 4HHAB 1DBBL 1NMCC 4HAGA 4ZMVA 1CDGA 1IEBA 5AAPA 3BAYA 1DVSA 4WI0A 2GFBA 2IPTL 1UVQB 3GXDA 4R90L 1U41A 4KV5E 4UNIA 4D7BA 1KXVA 3IT8D 3EOTH 2QADD 4JCLA 4KKBC 4HP5A 2AI0H 5E9NA 4YVNA 5F7FA 2N59A 4QRTA 2WQRA 5DI8A 2EXTA 3WD5H 3SGKC 5K1VA 4L9LC 3F7KA 4KKLD 1TJHL 1DP0A 5I8OL 1EGJL 4ABWA 5CZKA 3MUY1 1IGJA 1P6WA 2VWEC 3MCG1 1GZPA 2WB7A 3M7OA 3NJLA 1A8ZA 1OGSA 3A67L 2YZ8A 5DJ6A 4JPKH 5I1HH 3K2UH 4NN6B 3NJJA 4Y5VB 1XCTA 4LCUA 3TN0C 2CO6A 4BFJA 1E90A 1IKFL 4BFNA 1YY9D 1UURA 4KI5E 4LVNC 2HLFD 4RGNB 1VFBA 4GJTB 3RPIA 2QMJA 5AAWA 1EHAA 1BQLL 4ZZKA 5F3FA 1T89C 1X9LA 5HHXH 3PP4L 4M5ZL 2IAAC 3U46A 1A65A 5L2JB 1MFCL 2R4RH 1B4LA 4ZBJA 2PP8A 4QXVA 4S1RH 3RKPA 2DLGA 2JJVA 3U6RA 2GCYA 1DJWA 1KMGA 2E6QA 4RNRA 2NSQA 3WS6A 3BYTA 1JRHH 1VPOH 1QFPA 4XMKH 3NOIA 4I4WB 4WW2F 2IO5A 3MU3A 3ARWA 4RDBA 1XEDA 2ITDA 4JB9L 3VI4F 4Z7QB 1RIHH 2B9BA 4NJAL 4BCXA 4L3ED 2XQYG 2YKLL 2FJGA 4U1IB 1OHQA 3U9PH 5D9SA 5IFAH 2Y07H 1CIDA 5FYLE 4KKZA 4UOQA 4Y5YB 3SJVB 3S36H 2UZYB 4LIQL 4I0KA 4OZGE 3KLQA 1GC1L 3NFPB 3HE6B 3R7QA 2VLKB 3U7YL 4XAKE 1JFQH 3HR6A 5IBTH 5CGMA 3V7AE 5E6RB 4LL9A 2GSIA 1SJXA 3ARQA 5DEFA 5LKNA 1IFRA 5DGQA 1DN0A 2CUIA 3QORD 1DCEA 5DHEA 3MNVB 3ARED 2BVQA 3QIUD 1A21A 2VIRA 4UU9B 5HY9A 2NZ9C 1KJ2L 3FHQA 1NCBL 1DJGA 3SQBB 4RBPH 1IEAA 4IRSB 2FSEB 4JQXA 4PJXA 2PCFA 2PO6C 4ODWA 1UB6B 3TJEL 4N9GA 1A5FL 1FYHB 1TETL 3B34A 3UJJH 4A6YB 1X5MA 4G6ML 4P3WA 5LN8A 3MLRH 2DI8A 5CLTA 5I0DA 5IM7A 1I1AA 4AZUA 4ATWA 2JCCA 1JPFA 5SWZA 1D5ZB 2UZXB 2EE3A 3JTSB 4Z7VE 5TFSL 4IKLA 5JW4N 4FQXC 1EANA 4GYBA 4UNUA 5E4OA 5DZJA 4G80A 2PPCA 3EDEA 3QNXB 2MCMA 2BWQA 3BGFC 1HJCA 3D0VA 4Y2OA 4A66A 5IF0A 2LU7A 4HWEL 4IIZA 4FTDA 1WT5A 1IT9H 4E0RB 4OB5H 1UEMA 5JXED 1KYFA 5KSAB 1AKJA 4Z7UB 1VGEH 2UUDH 1G6RL 1EZVY 5F7EH 2OMTA 4WJG3 1MFMA 4CC1A 2X1OA 4GY4A 4JG1L 4JDTL 1N2RA 1T7ZA 4OZIE 1OCZB 3QHTC 2B3RA 3ZOAA 4PV8A 5GISL 5IB3A 5FGBA 1VGKA 1J86A 1HAUA 3RTQA 2BP5M 4M4RA 4FZ8H 1JV5B 1ZLEA 3EHBB 1A9EB 5FDWA 1OM9A 4ZFQA 3SDXE 2VDOH 3QUMA 4UDTB 3RHWK 1CF8L 2FVNA 2XTSA 1EJFA 4NQCA 4PREA 3LS5L 1TQSA 4L1DA 1MVYA 4WTWA 1ODUA 5F0MB 3NJKA 3I3BA 3V4LA 1IQDB 4IHOA 4K4KA 2QLYA 4ZYKB 1EEQA 2O5XL 2CR3A 1T22B 3LRSB 1NCJA 3WIFA 1G7PA 4IMLB 2XN9D 4KVCL 3CAFA 5E9DA 2WZ0A 2HT2D 2NY3C 4AEIH 1DJXA 1JPGB 4Q6IA 5K93A 4XWGH 2V3EA 3N40P 2NXYB 4R8WL 4M61B 1C16A 5I75C 1VACA 2BZ7A 2Q9OA 2ZOKA 3IMBA 4Y4FB 4ZFOL 2A74A 1FG2B 3ZR5A 4IKNA 3M1BA 4OBSA 2X9WA 4IJ3B 2PR9A 3KPOA 2KT6A 1Q4NX 4Q9RH 5F8RC 3KGSA 3FQRA 5C6WH 1NIBA 1VERA 3ES6A 1HIML 4CBZA 2GKIA 1WH0A 2H1PH 2XPZA 5FEBA 4Z77B 3U30C 4OF5A 5JQ6L 3O8XB 1X5LA 1ITBB 3M07A 1MUJB 3MXVL 1MI5E 1P4IL 4O02L 4RMBA 1V8HA 1XHHA 4ZUSA 5D1QC 1CD1B 3EFFA 5HDBF 5JW4R 3GZPA 2F53E 2WVUA 3QS2A 3V9FA 4JPQA 3KYKL 4WUKH 1NEUA 2VLME 4GW1B 3FN9A 2VXVL 3TYFA 1GOGA 4ODXB 5GRZA 4AQ1A 4YSSA 4J4PD 1J88A 3DRTB 3OR6B 1FZKA 4HIIA 5I5JA 1VFOA 3ULUH 1BOYA 4S1SL 4YUEL 3TV8A 3PGDB 1ZLWH 2G75A 2GBUA 1LE5B 3RWCA 4HCRH 5FB8A 3QEUA 3GHBH 3WTYA 4WUUE 1DQDL 3BW9B 1H15B 2X7LA 3WUWB 5IFHH 2UX7A 5HYSG 3IKCA 1BVKA 1S78C 1F4WL 3GIVA 1WIPA 1XWVA 4X7SL 5FW6A 1YMMB 2R9HC 1UACH 3G5YA 4N8CL 1LXMA 4BWWA 3TH4T 2P5WB 1HZHL 3FW6A 3IDMB 1SY6H 2HFTA 1WWAX 4Y9BA 3DHUA 5D1XD 5AAMA 4J8QA 3CZJA 5DD0L 4HWZA 1PLAA 2ZX9A 4TV3A 4P3CH 5HDLA 4LZKA 3WEOA 5DZOA 1U8JB 3UJTL 5CEZD 3POCA 1C1EL 4PRDB 5JW5B 5E51A 3VTTA 4X80H 4E9SA 3OXRB 2PW2B 4JFHE 4UM8B 1F58L 25C8H 4R83A 1IJ9A 2NW3A 1VEOA 4BSVB 2AQQA 2XN0A 2B9AA 2BNQE 1PVHA 2ADFH 3IPEA 3VE0B 6TAAA 1SQMA 2PR4H 3OZLA 3DJRA 4D0DA 4PSRA 3RDTC 3HKZA 3NZHH 1UWEH 2JF1A 5AQ0A 4X9GA 1OKEA 2VDKH 4Q7DA 1WPCA 2V17L 3LS4L 4JLRA 2APBA 4MNQE 3TYGH 4DO5A 3EJSA 3PNWB 5IUCA 4LSRH 5LCVA 1S9WA 5MEPA 5DLML 2Z6FA 1L5GA 1E43A 2J8UE 4GAGH 4H7VA 1MNNA 3BH9A 3D2UB 4Q56A 1GTFA 2FEEL 5F7DA 1LP9B 3ZT7A 1HQ4A 2R2HB 5IB5A 3HNVH 2WMPA 1BIHA 2AKRA 3VI4A 4BFBD 1N68A 1CXFA 3NZ8B 3PWPA 4NT6B 4POZD 3BZEA 2E7DA 2ITFA 3DX9A 4HJIA 1J5OL 1I7UA 5DJAB 4RFNC 1J9RA 5JMOC 3VB8A 4HC1H 5E2VH 4PJIA 4RX4A 4OZFH 3RILA 3PHOB 3EJRA 1MY5A 4G6FB 3T4AC 1T03H 1I9RH 4XPHL 3MCKB 5BOPA 5BS0D 5F7AA 4TNWK 1BVNP 1S7VA 2J2ZA 7FABL 5CD5D 2DQMA 2O61A 4QGYA 1MRFH 3ARPA 4K2UL 1H0DB 1MAJA 1YJDC 2VW6A 3GINA 1EJ6A 2PUQT 4U7SA 2XV2A 3DMMA 4D2NA 3OKEA 4QRPD 5IMLB 3OKLB 5SX4H 2XN1A 1P7KB 2H0JA 1PQZA 2Z7UA 4GRLC 3WN5B 2HTKC 5L8JB 4FJZA 5J1AB 4M62L 3VWKD 2O1AA 5CFAA 1IE5A 1ZD6A 3IGAA 4IU3B 4OLYL 3C08H 4KUCF 3G6AA 2ADYA 4B5EA 3W38A 3T4YA 1BX2B 2X1XR 3ILQD 3TBSA 4ELKB 3HRZC 2H0EA 5H94B 1BG9A 2P24A 3MREA 5F9AC 4E9XA 4F7CB 1J9TA 4H8WL 2MPVA 3KJ6L 5EU4A 3BHBB 2HRHA 2EO7A 2XWBB 4KK6C 5C0DB 1E5UI 5DTFB 5B1KA 4IIQB 1BA9A 5JYMA 3U79A 5BO1H 3TZVA 4TUOB 3DOSB 2O72A 1NGZA 4N87A 5AD0B 4YR6B 1CE1L 1L0YA 1DDHA 3MV8D 4JO1L 5GRVK 1EO7A 3TEUA 4DZBB 3VQLA 2ZXGA 3BSGA 5DDHB 2DIAA 3QDGE 2A9NH 2ZP9A 2I9LA 1QLEH 4KK9C 5FYJE 3FQWA 4CGTA 5EU6A 5TQ2H 4XPFH 4OCSH 4ETYA 4Z76A 4P9ML 4NN6C 4Y5VC 1FO0B 1PZSA 4UZGA 4B0MM 1X5XA 4NXKA 3FFCE 3QZWA 4H20H 4IOFC 5IEKB 2MFNA 2W9LA 4RGNC 1TZGH 3T2NL 3P11H 2HFFB 1ZHKB 5I9QB 1XZWA 1H3VA 4S0TD 3GB7B 4KZ0A 4RGOL 3WSQH 5DFVD 3OWEA 1INDH 3NP4A 4PJ5E 3UMNA 3LN4A 4EQ2A 3MI6A 5I15L 1JXGA 1J1OL 2IGFH 1GJWA 2KBGA 4FA7B 4TOYH 1YN7B 3MZGB 2IDFA 5CS7A 1I3GL 2XA8H 2A2QT 2V2XA 3ZTJH 4APQD 1HDMB 3NABL 4JPVL 4Z8FH 5EIVA 4R0LB 1OCWL 2ENJA 3VFVB 3X1GA 4LSVH 4MX7B 1QSFE 2V5MA 4YXLH 2LV4A 2Y5TA 4DP1X 4Z18A 4HKZB 4LSDA 4GQRA 4KI5D 4P57A 5FO9A 3B56A 1YEKL 3UC2A 3GSNL 3T08A 4LCWB 1D7CA 2PTVA 1K6QH 3AGWA 2F7OA 4Y5YC 4PVBA 3NRPA 2KI6A 3E0GA 4M48H 5C0BE 4BFOA 2DW5A 5K59E 3HE6C 2WKLA 3R8BB 2XIDA 2XOTA 3W9DA 1FH5H 3HN3A 4D8PB 1F11B 3NA9H 3T0EB 1LO5B 1B0RB 1XH3A 3SDCB 5IT2H 1WFTA 1NUDA 5ETUA 1KGXA 3FHEA 4GEIA 3UTOA 3QUKB 4NQTA 2CO7A 3L48A 4K9EC 3K0WA 4Y4KA 4Y88A 5ILTL 1N12A 4PRBB 5L9DH 4DKAA 2ZCKH 3ISYA 3LQZA 4ANWA 2IH8A 2LABA 2JIXB 3SBPA 2IQ9L 1R17A 1FFPB 2VH5L 5TE7L 1U8IB 2P47B 1MREH 2YGNA 3BJ91 3BAJA 4FFYL 5FYLD 3UBHA 4BGLA 1S9XB 4TVSa 1MAMH 2L8AA 3AS1A 4JN2A 3QS3A 4G9DA 1F02I 1XMEB 3PL6B 5ISZA 3EO1A 1NL0L 4XAKD 1IBGL 3MJGX 5C0IA 2HA1A 1A4JB 4P4KC 3FB8A 1OP5H 1BZEA 5DC0A 5INDA 2YLHA 3N43B 3R06B 3RNQB 4U2YA 3TURA 1A22B 1SVZA 5KSAC 2AMUA 4JAMB 4PJBF 1KTKE 4ZXBD 2WOYA 4Y19A 1FNEB 3B8SA 4AYGA 4NQDA 4XXCA 3MLTA 4MJ4A 43CAA 1IC0A 5B3SB 2JKWA 3QZBA 5I0ZA 1N7MH 4YHML 4IGBB 1IBHA 3NQKA 3EHBC 1QLRA 4JFTA 4UT7H 4XCYB 4A2FA 5IOPB 1CXLA 4BCZA 1OB1A 2XPYA 3C2AL 4MJIE 2KQMA 3BQVA 2J4WH 1I82A 4LGSB 4XPBH 1RZIB 3MNWB 4KK8C 3MN8A 1BZ7A 4M1GL 5I0WA 3SBRA 3SE4A 1UCBL 4P2AA 4UQ3B 2FNBA 1R6VA 3JVFC 1LDPH 1KZQA 2IPKA 1RZQA 4PLJC 2D7TL 4LLWA 1M6OA 3GMQB 4XP4L 2FB4L 4AC2A 3ARDD 4Y2DB 3R1GH 5I8EA 3QXAA 4PV1C 4P06A 5C07A 5D2NB 3MJ9L 5D7JB 2GC4C 2NXYC 3SZ6A 4G43A 1TO5A 4KH2A 3WKML 2C9RA 5H4YA 2X44D 4I0PD 3RWHA 3ZIMA 4ZW5A 1HZLA 4JM2A 3EAKA 5KJRH 1G9EA 3BXNB 5F0JB 5JHDA 3O3EB 1E4HA 4QHNB 5BV7B 4V1DB 3C5JB 4IJ3C 2AXHA 3QISA 1OT1A 1E9QA 4R26H 4X7CC 4JGNA 3FO0H 3U4BH 4PIBA 4ZFZB 3U9UA 1BJ8A 1W2KT 3TEWA 5ABAA 2ICWI 3AY4A 4FYSA 5B4MD 4NOFA 5CGYC 3NPZB 2GITB 1K8DB 1ORQB 2VLJB 1BVLB 3OKMA 3KPLB 4TSBH 2IALB 5FCUL 5TDPB 2JI3A 3RWGA 3O8XC 3ZRSA 2ZPKL 3MUGA 1BWWA 5IQMA 4FQQA 3OKKA 4L4TB 5EC1A 5I5MA 4Z7OF 1F1GA 4O51A 2EC8A 2ZXBA 2F5BL 1T7VA 3PWLA 2BP0B 5DFAA 1QTPA 3CDYA 4PJDF 2R2EB 3VD2A 2XZCL 2UWEF 3UZVA 4DGVL 1T2QL 2Z92B 1XF4A 3FUHA 1W0VB 2VJXA 3RPBA 3HMXA 4MDIA 1FYTE 3BEWA 2C7UB 4NN5B 3REWB 1CR9L 3RGHA 1E3FA 3GS4A 3H0TB 1SUHA 1ZTMA 2EE6A 4AMXA 1PAZA 1TJGH 5G5DA 4U6XB 1EH9A 2VRAA 3IDNB 5HGDB 4JRYA 1U91A 1WAAF 1KELH 3GI8L 4BFIA 5TTRA 2IH1A 3DPDA 4X0KA 4JDZB 4HEME 1BOGA 1AANA 2LVEA 1GZHA 4PWKA 1MI5D 3ZMRA 2IDUA 3CLEH 4Y1AA 4Q2ZB 4XX5A 1MZZA 4FQLH 5B8CB 1UD4A 5C09E 2ESVA 2F53D 4OZHF 3LN5A 4PJFB 2VLMD 2EH8H 1NBZA 1KBKA 1SYVA 3HKFA 3MBED 2EEBA 3GO1L 1WFMA 1IUZA 3IEAA 5DYOB 4MRCA 3UABA 3L3GA 3IFLL 5EBLA 4PGEA 5DMGD 1R3KA 4JFEE 2HH0H 1T04B 1JCVA 3CIQA 4WUUD 5E5RB 4YAQA 4L18A 3IVKA 2X4NB 1YQVH 5E4AA 2EUXA 3Q3GA 4QUOA 2BX5A 4B41A 4AM0B 4KROD 1YEDA 3ZDXE 4CN4A 2OL3B 4XODA 3MLWH 2NR6C 4G71B 2ALWA 4U1MB 4Z7WB 3TF7C 1SLWA 1JERA 1CXHA 1AI1L 5TDNA 3B2VL 4YIQB 4KZEL 4HSCX 4X5RA 1TTAA 2JXMB 2G60L 3FTYA 1VZGA 1QW9A 4A7SA 1MJ7H 3WIHL 1QRKA 3MLVL 1QNZL 1I3VA 1KB5B 4KXZI 2YC1A 3QXTA 3UGEA 4BUHA 1E2WA 2DYPD 3ZL2A 3EYQD 4GSUA 5E9AA 1QSEA 5FGCE 3O6MH 1IEBB 3NK4A 4H1LH 3DPBA 2R0KH 2TSBA 4WI0B 2GFBB 3PG2A 2XJLA 4U7KA 5DHVA 3O2DL 4MA8L 1QRNE 5DMJB 2YEQA 5KUKA 1MHPH 1ES0A 1PKQA 3PAZA 1OOAA 2JWYA 4TYUA 2BNQD 5FYKE 3E2HC 1NZRA 3KPSA 4QRTB 1ZHLA 3G3LA 5JUEL 5DI8B 5L2KE 3CXDL 3EH2A 4QHKI 1A02N 3DO7A 3D3VA 4PJHA 4MNQD 1IGJB 5DHMC 1AXTH 2F7IA 2ICWA 4NPJA 2BDNH 1GZPB 2IANE 4GQQA 4JY6A 4GBXD 4TLSA 2LE9A 4QRSB 4UIKH 5DJ6B 1PZCA 1A6AA 3GK8H 1J0KA 1XCTB 4LCUB 2CO6B 3MODL 4GLRI 3BCFA 1E4XL 1DJIA 5J12B 1DQLL 4U6VL 2QKSA 4JQVA 1AYRA 3UO1L 3WN5C 1ZEAH 3QP3A 1QLEB 2G5UA 1VFBB 3RPIB 4POUB 3TT1H 4WV1A 1E2ZA 2FJUB 1IU1A 3SY6A 3PF2A 3ASOB 3L2MA 3U46B 3VJ6A 1JPSL 3SO3B 5GGVY 1BD2A 2VZVA 4OFPA 3VI3F 4KVNH 1M2VA 2D9QB 2OXGA 1NWOA 4MZ2A 3U6RB 3X13A 3BVTA 2GCYB 2KLTA 3K6OA 4RNRB 4N2EA 4M8UA 3VFSA 2ZKYA 1YEEH 3CN2A 3DURA 4IIQC 5I0VA 5BUGA 3AUVA 3GI9H 4WU5A 3WFEL 2ITDB 2BY0A 1TYRA 4HT1L 1GKEA 4FQIH 3B3BA 3WJJC 1N19A 3FOLA 2CU9A 4PJBA 2H45A 2HWZL 4TVPH 3VWJC 2FJGB 2ICWJ 3CVIH 5D9SB 4ZW7A 2CNZA 3OR7A 5E08L 3L4TA 3U4KA 3IU4H 4OIIL 3BIKA 2P46B 2WINA 1E6JH 5T3ZH 3LN9A 3VX1A 5B22A 1CLYH 1T7YA 1YEGH 3ZZLA 1HOEA 2BFVH 2R0ZL 3LIUA 3H3PL 2GSIB 2K8MA 4AL8H 5DEFB 3I6KA 1DN0B 3FFDA 4GSRA 4Q14A 1KJ2A 5B1JC 1AP2A 3MNDA 4PLOB 4GMSH 3ZHKA 2BVQB 3N40F 2VIRB 4XNZC 5HY9B 4OCMC 4E5XG 4X5PA 4B53A 5I9QC 5MEOA 1YECH 1IEAB 2LOEA 4MVBD 4XOAA 5CO1A 2PCFB 4CJ1A 3GTTA 5BUPA 4ODWB 4OLVL 4N9GB 1WRFA 2WCSA 4HF5L 4MB1A 5IM7B 1I1AB 4KHTL 2JCCB 1JPFB 5SWZB 2I5YH 3QDGD 1VZHA 5FW7A 3IDXH 3HMWL 5FYJD 3GTNA 5AALA 1OWWA 5TE4H 3K2MC 1U58A 3UEQA 1FL3A 4G80B 1ONQA 4GP5B 1JWSA 4B50A 1OW0A 4R0LC 3IJHA 3D0VB 4Y2OB 1GYCA 1MIML 3FQYA 4LCIL 1P1ZA 5IF0B 4ZW6A 3FFCD 2ZXAA 3LX9A 4ODSH 3CSGA 1AKJB 2Y6SC 1J1XL 1G9NH 3FAWA 3MCLL 4QY8A 3WFZA 3H9SD 2OMTB 2FX8H 3P9WB 1N2RB 2KPWA 3VB9A 2DQCL 3HBGA 4PV8B 5D6DC 5IB3B 1VGKB 3CWGA 3MA9H 1U8PA 4Q58C 4QTIL 3RTQB 2VISA 3K71A 4M4RB 4NWUH 1TQCB 1DSWA 4PJ5D 4E9YA 3BRDA 3WEBA 5C97A 3T8MA 3RYMA 3BPCA 3A24A 3T0EC 5KANI 1U8QA 5FDWB 2YD0A 5EUOF 3SDCC 4K07A 1FN4A 4QOKE 3QUMB 4PJDA 4RRPA 2UZIL 3GNML 4PREB 3MOQA 1DQKA 4NQCB 5DC2A 4J3OC 2UWEA 4W93A 3WEMA 5A2IH 5EC2A 5CCJA 2FQDA 4ZS6D 2X09A 1ML0A 5CJXC 2H26A 1WTGT 2GK0A 2Y25A 3Q8CA 5HGHA 4IHOB 1QSFD 4YBQC 2CKBL 2DM7A 1EFXD 2FEEI 3CCHA 5C6TH 3WIFB 1G7PB 3HPLA 1KEML 2FO8A 1LM8V 3DGGA 4G6AD 5E1HB 4GG6E 4Y8AA 5E9DB 1IGFL 1DSFH 3NRQA 4WFFD 3ARXA 3PL6C 4Q6IB 1IKNA 3ABMB 4I1RA 4ZFOA 1BDYA 4H2CA 4TLTA 3WGVB 4RZCA 4PRAA 1KF9B 4OV5A 1C16B 3TM6A 1VACB 4KRPB 4KRMB 2ZOKB 1MRCH 4N26A 3QNFA 1SXNA 2A74B 4C4BA 4Q6KA 4GKNA 1U8HA 2Q1EA 2Z9TA 3M1BB 4L1HA 4TKWA 4OZHA 1OAYH 1LGVA 2H3NA 3BDYL 3T0VA 4GKZA 1FF5A 1PD1A 3KPOB 3LJ3A 1CFQA 1XTMA 3MLZH 4WVRA 4LNVA 3B9EA 4QHKJ 5I5RA 4XVJH 3TH3T 3FQRB 1OAQL 1OTSC 2FO4A 2F61A 3ES6B 4NKQB 2FJHA 2BMKA 4X8XA 3W11D 2Z8RA 3FN0H 3RVWC 3N91A 4BK8A 2MPAH 4L3EA 1WEJH 1NCAL 1RHHA 3BYYA 3NESA 1BPLB 2EIKB 2ZD0A 4F7EA 3OD3A 4ZUSB 4MWFA 5FIEA 3HZKB 3DXAE 4FG2A 3RI5K 3EFFB 4ZODA 1X5AA 1NBQA 3IDYB 3R7RA 3FZUD 4NQXA 4X8GA 3MSPA 3TYFB 4ZSOE 4AQ1B 2FYYA 1ZK5A 1P5UA 4QAMB 4YBLB 3QORA 1FZKB 4HIIB 4P5TC 4L0YA 3T3MF 7PAZA 4OM0H 2H6PA 2GIXA 4Y2DC 1BAFL 2G75B 2ZYSA 3Q8EA 4KY1L 4PHXA 4UBDC 3RWCB 5FB8B 1M71A 3QEUB 5D2NC 3QDJA 3KS0H 3SDDD 1Q9KA 1KCRL 2X7LB 1EAJA 3DX0A 1JE6A 1G0XA 1TKWA 1CL7H 4KKAC 2ZAGA 1BVKB 3IKCB 4UTCA 3RWJA 3GIVB 3OZ9H 4GO9A 4DO6A 3BUYA 3O4LE 4K3JL 4ZQKA 4MJID 1KWKA 3G5YB 2G30A 3ULUC 3US0A 2FWSA 1QD0A 1KY6A 1A7QH 5PCYA 1ZK9A 5C0CA 4FNSA 5GS3A 4GKSA 4NYLA 2LLLA 5DHYA 3ZDZB 2E8YA 4ONFH 5B3NA 2PPFA 3VXRA 4GO8A 2VITA 2VR6A 4JQIL 4MRBA 4HWZB 1EAPA 1UUSA 3CQQA 2OCCB 5JXEA 1PNCA 4QEGA 3O2WL 2VQTA 5HPMA 3B7UX 1MNUH 1MQKL 2A3TA 3SD2A 3FT3A 5GGSY 3ZX1A 1BBDL 2C1PA 3VXME 3HNSL 2NW3B 3K2IA 1RUQL 2P28B 4DP4X 1LWRA 2NY4B 2K4WA 4D0DB 1SJEA 3S0PA 4NN5C 2VC2H 3A6BL 5KG9A 1NGQL 2FHFA 1NWPA 2ZUWA 2NCEA 4WWKD 2VERN 3GSQA 4JLRB 3CFDA 2AFNA 2WVSA 4OSUL 2R29L 1S9WB 2BW4A 1IGTA 5MEPB 1DVFD 1L5GB 3BH9B 5BZXA 1WZ1L 5F7DB 1JPEA 3Q05A 1HQ4B 2IDCA 5IB5B 5IHHA 2WMPB 3UP1A 2AKRB 3VI4B 1J1PL 3FQTA 3PWPB 4G8GE 2XN9A 5AWNH 3BZEB 4MAYD 3DX9B 3M8OH 2XXMB 1I7UB 1GGCH 3BEVA 1J05A 2AXFA 4XNXH 3GF8A 4TQIA 4J1UA 1T0MA 2GJJA 4LOUD 3PHQA 4U1NA 1CC3A 4PJIB 5I66A 1ETA1 5KBKA 5LWYH 1BEYH 3QHFH 4NI3A 4ONGH 3RU8L 1LO4H 5D7IA 2CRZA 5HJBA 3D07A 1FYTD 4M5YH 1E9PA 2G5BA 4W6WB 1B6DA 1S7VB 2J2ZB 1W8NA 2O61B 3QO0A 4Q4EA 3EBAA 3GD1C 1EO5A 1AR1D 3KH4A 4K8RH 3D7PA 2YN3A 4HKBA 5D7SH 3MA7A 5CCHE 3DMMB 1NSNH 3HI5H 3OKEB 1XGTA 4DGIH 3Q8FA 4NO2A 1URLA 1PQZB 1BQHA 4ADIA 1JN6A 1XSKA 4BZYA 4OM1H 1O5DT 3LRLA 2E27L 3IGAB 1WZLA 2A77L 4JRXD 1FZJA 1KN2H 5C09D 4ZMNA 1U30A 4JHUA 1M05B 1CDJA 3G6AB 3L5WA 3T4YB 4E2OA 3TBSB 4H8UA 4RA0C 2CLZA 2P24B 2VYRE 4NC2B 4NZDA 2I25N 4BQ9A 3MREB 4POYA 1L0XA 3N1QC 4OT1L 5EU4B 2O93L 2J20A 2ZWKA 4NP4L 1U8MA 4J4PA 4X5XA 4NIYE 1JYVA 5JMRA 3TZVB 4JFED 1NGZB 3VMNA 3LPOA 2O5NA 3WNMA 3V4PL 1DDHB 1SOKA 5C3TA 1KXVC 1V54B 2NT1A 4RWYH 3V8CA 1MW2A 1NMAL 1BQLH 2LAGB 5D93B 5LG1A 1THCA 3PP4H 5JORA 5G2NA 2I9LB 1RMFH 3FQWB 3PQYE 4BA8A 5EU6B 4DP9X 1TQTA 4I3SL 4R6UA 3V5HA 2DI9A 3BWUF 3ZU8A 4Z76B 1X5KA 1ZT4A 2OAAA 3EJJX 3RUGE 4QR7A 3WMSA 4UNVA 4X8JA 4FHJA 2ROYA 1ETZA 2GSMB 4PVMA 1NEZG 3MTXA 3QZWB 4I1NB 5D1XA 2OMWA 4FI8A 3CC5A 5J12C 1OY3B 2DH3A 2OYKA 1KBBA 1A4CA 4H0LC 4JB9H 4KTYA 4KJWC 5AAWC 5GRUL 5JPMC 3RIAK 2R23A 3POHA 2JJTA 1QRND 1J87A 4JGUA 4EI6A 2D2OA 5DK0A 1ACCA 4MZRA 2DBLH 3QUYD 3LN4B 5FYKD 2F8XC 3G5WA 1MHCA 5EOQH 3D4GA 4KPHL 5L2KD 2X6BA 3HG2A 2XZZA 3LKOA 1LE9A 3OLIA 1GC1H 4BWTA 3GT6A 3FCTA 3P30H 3II1A 3J7HA 2WQ8A 2ZOTA 4GI6A 2V2XB 3SE6A 1Y6MR 3U7YH 4KVPA 2BVOA 2IAND 4IDLA 4XVUC 2VW4A 2QBWA 3CX5J 1OE2A 3L1OH 1ZPUA 3GSNA 4F93B 2Y5TB 4ZUWA 2Q7NA 1CZ8L 4AVIA 2AJYL 2AP2A 1D2OA 3TVMC 4PJGF 1DVZA 2ZUYA 4P57B 5FO9B 4Q97A 1KLGA 2X4RA 4XB8A 4U33A 1KJ2H 5LGYA 3TWCH 3U0WL 4F9LC 1N0XL 4S0SD 3B6SA 2Q8AL 5GRJL 2PCXA 3FU5A 4DQAA 1OPOA 3F7LA 4WENB 3EXLA 3W9DB 3SDXF 3SE8L 3BQUA 3UEZA 3AS3A 4XPAL 2ZE0A 1ZLVH 1VCAA 1XH3B 5AB9A 3PS6A 3Q0HA 1S7QA 5ETUB 4OLUL 1EBAA 3BFOA 2CO7B 3BP6A 4Y4KB 2CR6A 3TJHD 2XZAH 1EERB 2E7BA 5K9QI 5IQLA 5C0ND 3LQZB 4JQXC 4XP9L 5EWIL 3LXAA 4B9FA 1J12A 4FFYA 4YO0A 4ZNCD 3P0YH 2VDRL 2FBJL 4Y16A 3CE1A 2DQIL 1F90L 5GJSH 3VFRA 4MNGE 4QRPA 2Y6TE 4HWBL 4KAQL 1DQML 1CK0H 2H3XC 3QEQD 4OFYA 4RBPK 3FNKA 4JN2B 4WSKA 3P3RA 3VFOA 3BMVA 4G9DB 5ISZB 3JYCA 4GFXA 3EO1B 5KVFE 2X6VA 5C0IB 2YUZA 4YSTA 3OAUL 5IMKA 3FB8B 4GS7B 5EFIA 3VGEA 2NTFA 3CSYA 5INDB 1YNLH 1JHKH 3PCYA 2HMIC 3AQYA 4GSDL 1GGBL 4NRXA 1BP3B 3S5LG 3MAWA 4ODTL 2VZ3A 4DESA 4M7KL 4LHUA 2Z7YA 4G6KL 5DCCA 5FGBC 1TVBA 3FT4A 4Y19B 5FFOA 4GLRH 4NQDB 1TQCC 3MLTB 3FSAA 3OJDA 4KVCH 43CAB 2Q10A 2UUDK 3L3IA 2WQSA 2CE6A 2AW2A 1QLRB 1WGOA 4BQ8A 4ZD3L 2YOAA 2ED9A 1OB1B 1RUPH 2ZXWB 1IAOA 3F64A 2MCPH 2WBJD 1OPGL 5HYFA 2N0MA 4X7FC 1HTYA 3QJSB 1IL1A 4PBWD 1KCUH 3US9A 1G7QA 1BZ7B 3TCTA 4ZNEA 4Q9CA 1IBYA 4GMTL 2IPKB 1KXQE 1WCBA 1EJOL 4EIZC 3MV9E 4LLWB 3TLRA 5A7BA 1M6OB 1UZ8A 3NJGA 5JHMA 1IKOP 4BZ1L 4NCC1 4DEUA 3VQ2C 5I8EB 3QXAB 4AK2A 2TSAA 2CO3A 5C07B 2DWEA 1LDSA 4G43B 4D9QE 4KRPC 7CGTA 3RWHB 4JM2B 2X4SA 1P4IH 4QOKD 3M1CA 2QKIA 2HVBA 3CHXA 3ZPDA 5JHDB 4HIEA 4XHQA 2DLHA 1ZVHA 1JAEA 1CLZL 2QQQA 4B96A 5BXFA 1E9QB 2PYEE 2X87A 5FYKL 4J3BA 3U9UB 4APQA 5A16A 4AG4L 2X38A 1JDCA 4K73A 4YXHL 3LYRA 3OKMB 1OEZW 3KLHD 1E4XI 12E8H 1ZDSA 3GMPA 3RWGB 2PW1A 2FCBA 4ADGA 3MUGB 1G9HA 1KTLA 1CLOL 2CG9X 2F1BA 4FQQB 3OKKB 5EC1B 1OAKH 4O51B 2UXTA 4G8EA 2ZYHA 1N70A 3PWLB 2J6EL 1XSIA 2QGCA 3UBFA 4ODBD 4FA6A 4YBHA 4FABL 3FH7A 3UZVB 1Z9SA 3KCPA 3IDYC 5JIQA 1XF4B 3SD5A 4FZEH 1S9KC 4AQ1C 4MDIB 3BEWB 5E6ID 3BIBX 4YBLC 4FMFA 5F7MC 3N41F 1ETJA 4IRZL 3CFKA 3T6ZA 1ACYH 5G5DB 4QJ5B 1K85A 4M6OL 1JTOA 4JRYB 1U91B 4E41E 2Y1VA 4BFIB 5T3XD 2IH1B 4PU2A 4X0KB 1L9TA 1BOGB 3EZJB 4A39A 1ZLWK 1MIEH 3GXUB 1SFHA 2VC2B 4PM1A 4UOW0 5LAXA 4ELDA 1MN4A 4Y1AB 3L4ZA 2WN2A 3O6LH 3OQRA 1IGMH 1N4XH 2WBXA 1QAWA 4OZGA 3THML 2ESVB 1NINA 1S5HA 2DS4A 4KMTH 3S97C 3LN5B 3W39A 1JZ6A 1P7QA 3NCMA 1ESOA 5KTEL 1XH0A 4WTZG 4Q9QL 1NBZB 2UVEA 3ZTEA 1SYVB 1VFMA 4GSXA 3S88L 2AVFA 2V17H 3LS4H 1HT6A 4TNVF 2RAMA 4N9OB 4LSPH 4W9LC 3FU6A 1ITCA 3VVWA 5L8LB 3CDGA 3O41A 5ESVA 3L3GB 1JYXA 5D5ME 5EBLB 4PGEB 4ZXBA 5KS9E 1R3KB 1SBSH 4BQ6A 5GRVL 4LARL 3FK3A 3AU0A 4YAQB 1NCIA 1PY0A 3Q3GB 1FLTX 3ARFD 3QJHA 3WMQA 3IF1A 1YEDB 1UD2A 3WFBH 2NY4C 3O4LD 4PG9A 1T6BX 5F7HA 3RPKA 1DUZA 1JNNH 1AY1L 2NW2A 4JHVA 4U49A 5AW4B 1S3RA 4Z7VA 2V2WA 3KJ4B 1ROCA 5TDNB 3H1ZA 1FFRA 3GSXA 2BLFA 4F7TA 2YFNA 3KLDA 4HKXA 1QI5A 1HSAA 4OGXL 1FVEA 1WE5A 4P9HC 2J6WA 2YC1B 3O2DA 4MGXA 3BRFA 1QSEB 1AXSA 2MJWA 4PJGA 3DPBB 4Z95H 4OZIA 3ARDA 1XF1A 5GZNC 5DHVB 5C0AD 3F8UB 3VXMD 3OMIB 3MLXH 5JA9A 1ES0B 1PKQB 1OSZA 3QG7H 5IOKA 3UX9B 1UKQA 3NACL 3KPSB 1FG9C 3HG4A 3OXSA 1ZHLB 1ZLSH 2PP7A 4I0PA 1SDDA 3SDXA 5IY5B 2ZJSL 3D1MC 5D7LE 3KYOA 5FHBL 3ZE2E 2BJML 4YFLF 5AVZB 3DO7B 3RQ3A 3AQXA 3D3VB 4PJHB 2ICWB 1T2JA 2B7DT 3H3KA 4JY6B 4XGZA 2I27N 1W9XA 1VA9A 2P52A 4FXGA 1A6AB 3MYJA 1M7UA 3DMMC 2C1OA 3NGBB 3ZKMC 3IPFA 2GVYA 3HBZA 2PWDA 2FBRA 4Y9GA 2UXGA 3BUPA 5GPRA 3CDFA 3OG4B 1TQWA 1VIWA 2WIIA 3GEFA 4JFVA 4WV1B 3EO0A 3C9NA 4QD2E 2HKAA 1U33A 1W16A 4FI6A 3VJ6B 4L0PB 4CKVX 1BD2B 3EFDL 5HTSA 4PMFA 1IC5H 5HJ3A 3RL1A 6PCYA 1M2VB 2OXGB 5E6ZA 1F56A 4HGWA 2CHZA 2X9XA 3X13B 1RZGA 3Q06A 4MKMA 3LZLA 1AQDA 3B5GA 3VFSB 1NM4A 1V10A 1FNHA 3W3BA 1BMZA 2VQ1A 3DURB 5ADOL 1WC7A 1A3RH 3AM8C 3QDME 4YSCA 4LCVA 1TCRA 4WU5B 3TZVC 1HEZA 5T33L 1T66C 2H3KA 3BJLA 3FOLB 4PJBB 3FDWA 1Q38A 2FBOJ 5JOFA 5K9KA 1YLBB 4G59C 2A0LD 3OR7B 4KXCA 3N1GC 3WHE1 5D93C 1AGEA 4PJ7E 5GGVL 2MMXA 4W9JC 2HT4D 2W81C 3BIKB 2WINB 3OC5A 2GEQA 4AKPA 5EIIB 1NCDL 1T6WA 1RVFL 2W9DL 2OR8A 5CEZH 1IBBA 4G7QB 1P7HL 1Q0YH 1KB9J 1LNUA 5EHFA 1KIRA 3I6KB 4IMKA 4MDJA 4TRPL 2DQUL 1HCZA 3FFDB 1KJ2B 2W80C 5E99H 1AP2B 2B08A 3MRRA 4TL5A 1OQOA 3MBEA 3VXSE 3OX8A 3JWDH 5IB4A 5MEOB 1MG2C 2FEJA 1RZKH 2NCMA 4S1DD 4XCEA 4KQ3H 1JD9A 4AL8C 1U8CA 4EUPG 5LDSA 3AMLA 2XQYA 3X1FA 3CDZA 4L8BA 1P2CA 3PQYD 5GS2H 4NFDA 1W72H 4YHOH 1U58B 3CGTA 1FL3B 5DS8A 1ONQB 1H6FA 1JWSB 3K8LA 3IJHB 3SDYH 1PX8A 1DVTA 2AABL 4PS4H 2NX5E 1P1ZB 1SOSA 3RVTD 3TIDA 2YUWA 4YFLI 1RP9A 2WNGA 1XL4A 5IB2A 2I7SA 4QY8B 3TESA 5F70A 1LWJA 5KOMC 3BESR 2HG5A 1BM3L 4H2AA 2DYPA 5CJQL 1U8PB 2ILLA 3W56A 2IQ9H 2VISB 3K71B 2CDGA 5TE7H 5DVKA 3UCQA 4NHCH 5I74C 1EDYA 3SKJH 1EMTH 2Y7OA 3BPCB 3WGUB 1U8QB 1OE1A 2AJUH 3IGKA 1FN4B 1ZANL 2BNQA 1G9NC 4PJDB 3BFWA 5C0JB 5KVDH 2PF6A 2UWEB 1HHIA 3K4ZA 3LHPH 5EC2B 1QW8A 2CKBA 4BKTC 4YLCA 4FN0A 2DIJA 1GZQA 2H26B 2HTLC 1EO8H 2GK0B 2ZYRA 3ARRA 4MNQA 2EDTA 2WNWA 5HGHB 2VDML 4O58L 5ALBH 4KQ4H 3CCHB 3BKCL 2FD6H 3RHWF 3L4UA 2J8UA 3HPLB 1RZ7L 3WS6C 4BFGA 3DGGB 3HTLX 2P80A 4N2MA 4X4KA 2IJ0C 1JPTH 1GW0A 2AV1A 4ZFOB 3JUYA 4TNGA 4BH8A 4OV5B 1R0AL 4RZCB 4PRAB 3NIDE 4G5ZH 3T6QC 2F1EA 4PW3A 5TPWH 3Q6GH 4KMLB 1QFOA 4GS7C 1T0NA 4KX9A 4BFKA 5A6MA 5I30L 3R0MA 3DBXA 1S8DA 2OFQA 4GKNB 1U8HB 4OZHB 2F8OA 2H3NB 3PLYA 2PXYD 4OQ1A 4DVBA 2F74A 4GKZB 4JX0A 2B2XH 2ZXCA 1CFQB 1F45A 5I8KH 4BWUA 3L1GA 1OP5K 4YSQA 3QUZD 3Q1EA 5DUBA 3RGBA 5B3JF 2XTLA 4BIKA 2FO4B 2HT3C 2FJHB 2BMKB 2MQ3A 4ADJA 1DCLA 4N1CA 3OMNB 4XXCC 5F3BA 4GOSA 4NZUL 1XIWD 4L3EB 4CRPA 4HXAH 4AV0A 1RHHB 4TSCL 5IMMA 3MLPA 3OAZH 2CM5A 4L5FE 3D87B 3DSFL 5CILL 2NNFA 3PWNA 2YK1L 4YL9A 3AB0B 4F7EB 5GZOA 4MWFB 5AL8A 2D8KA 3P9MA 3F6IA 5JHLL 4FNPA 3SE4C 2DBJA 4CKQA 1ND0B 4NQXB 3HN8A 2FYYB 2R0WL 4FFVD 1P5UB 3M45A 3QORB 4OZFG 4TSAL 2ENYA 2TRHA 2H6PB 4A2DA 4N85A 3IN2A 2F58L 2ZOLA 5FCUH 1M71B 1XSOA 2HLAA 3QDJB 2WJ7A 2C4XA 2QSVA 1Q9KB 1WIOA 5AUMB 1TKWB 3ZZQA 2WSKA 4X99A 3FXIC 3L54A 1DLHA 2EIBA 3RWJB 3ULVE 3RY4A 2NPLX 4JM2C 4RZKA 4F7PA 3BUYB 3L45A 3P69A 4J5VA 4LCCA 4ZQKB 1CGSL 3APCA 2NSXA 3QDGA 5I1CH 1NGPL 4LASH 5DO2C 3AABA 3D39E 4DGUA 1T2QH 3EYVA 4LSTL 4M3JA 4JQIA 2K6WA 4R2GD 5C0CB 5EEUA 4LU5L 4GKSB 4NYLB 4YE0A 3AY4C 5DHYB 3MNMA 3S36X 3VXRB 2XT1B 4U1SA 2VITB 1OAXL 4BELD 1EAPB 3CFNA 4A2EA 3FFCA 3MV9D 4I5BA 3FQ2A 1A7PH 3GSOA 3ZSSA 3U83A 5HPMB 3EXJA 2EXWD 1B0WA 4ATTA 4N25A 4DIXA 3FT3B 1B2WL 6CGTA 1CTMA 2C1PB 1DJSA 4D9QD 3ZDXF 3JBG7 1YJDL 4PRPA 5BQ7A 4C4UA 4PJ5A 2F18A 1P6AB 4XP1L 2Y06H 2R4SH 1DVUA 2OMUA 4XMVA 3QI9D 1SJEB 1V7NL 1M53A 1NBCA 5HYSA 5KG9B 4L1TA 4TULH 4Y0GA 3AXLA 2PYED 5FYLH 1O9VA 3GSQB 4K15A 3E3QE 1MFVA 3PPEA 5AOJA 3CFDB 5CEYA 1KFAH 1GKOA 4CN6A 1IGTB 2ODHA 3LAFA 1J9QA 1PPIA 4GXUM 4WY7H 3MFFA 2ED7A 3SE3C 1EFXA 1G87A 1RIVL 4O5LL 1TQBB 1I31A 3H4FA 3NSXA 3RZCD 1TTUA 3FQTB 3D85A 3RWIA 1GZHC 2XN9B 3IFLH 4CC4C 1JZ5A 1SEQL 2MQGA 2FGWH 3Q2LA 3BEVB 1J05B 2AXFB 1BFVH 4J1UB 1T0MB 4U1NB 3PHQB 1HILA 2W60A 5C0BA 5I66B 4KNQA 4NZRL 4YMPA 1RUAH 4QHUB 5D7IB 1FGNH 1A1NA 4Q6YA 1E9PB 4FQJL 2G5BB 1TVDA 4KXAA 1UYWH 3FSZA 4G82A 1H9VA 4RH4A 3QO0B 3MKKA 1ZVYA 4J39A 5GS0D 1S7TA 2OSYA 3MLVH 5H8DA 1QNZH 1WITA 5I24A 4HKBB 4LRNL 1R3IH 2OCFD 3MA7B 4OLWL 4U1LA 1A3ZA 1XT5A 3O0RH 4NKDA 3QEHA 2AQTA 4N1EA 5CFHA 4TNWF 1E8XA 1XGTB 3AW5A 4PJAF 4NO2B 1IGYA 2D4FA 1BQHB 4FMKA 1JN6B 1JXDA 3EDJA 1E5BA 1MHHA 5L0QB 4PJEF 3O9WC 2GHWB 5DVOA 2B8OT 3KJ4C 1FZJB 1TSHA 2QFRA 2YKKA 4MA7H 4QI3A 3L5WB 4IYKA 1NFDF 2WQVA 3HUJF 3IAQA 5MP6H 3NCWA 3EO9L 2CLZB 4GW4A 4KDWA 3UAFA 5C9JA 4OCRL 1FVCA 4LDLB 2AEPL 1U8MB 5DJZA 5T1KD 1IM3A 4X5XB 3ZSTA 1Y6KR 1RJZA 3VFGL 3ZR6A 1TMCB 3H42L 3TFKC 4K23L 4DOHB 1PYWA 2NY2C 5FA4A 4DEPB 3FO1A 1WBZA 3SDDA 2YQGA 3H2QA 3ABLB 3X14A 4YDZA 1F4XH 5JORB 5L88L 4XN5A 4XWOD 1JOIA 3OPZH 2G9HA 4MJIA 3AS0A 2WKOF 1MPAH 2NY6D 3V5HB 3VG9B 3I2CL 3ASNB 1KTDA 4EKJA 5KVEE 2IPUG 5CD3A 1ZT4B 3ASWA 4X6DE 3JWOH 3WS3A 3HVNA 4X8JB 3IJEA 3EIFA 1A1OA 1ETZB 3NIFF 3RFZA 1L6ZA 2D3JA 4JFFE 2BHYA 4PGJA 5D1XB 2OMWB 3CC5B 3WFDL 2ARWA 4MD4A 1S3KH 2ZXQA 2FIRT 1LD9A 1MZYA 2COQA 3BP7A 3V5DA 3U36A 1MVUA 1I1CA 5CN1A 4WV1C 3D9AL 4K9EL 5DZPA 1XR9A 2R23B 4I77L 4ANVA 5KVMC 4EI6B 2CHNA 5F9DC 5DK0B 1BJ1H 1FCGA 1HKLH 3N42F 4N2IA 3EYUH 2NY1D 3T2QA 1MHCB 2MRYA 3CXHJ 1HL5A 1A7OL 4NNYA 3B9KA 4NZTL 1UXWA 5GHWL 5HDOA 2JB5L 1LK3L 1X4ZA 3LKOB 1BSIA 1A3LH 3MFGB 5D7LD 1LE9B 3FCTB 1BZDA 5H35A 4KO5A 1WTLA 2BVOB 4LQFL 1CG9A 3WNLA 1JNJA 2R0ZH 5LJYH 3ARTA 4GRWB 3VGAB 5HI5D 3QBTB 2Z4QA 3GSNB 3TBBA 1V3KA 4ZUWB 5FUCC 5HHNA 4PRIE 4KZDL 1IQWH 5EU7E 1W8EA 1KLGB 2X4RB 4U3SA 4F2EA 3GXMA 1UD3A 1A6VL 1GC1C 3B6SB 4YC2B 3FB5A 3SGEI 4JO8A 4MAYA 4UILH 2FSDA 3QE5A 2VKXA 1TQVA 3TJPA 5L6YH 3BQUB 4KHTH 1WD8A 2HUHA 4XPGL 1CTOA 4BCYA 1G9MH 4FOMA 3VGHA 2ZUVA 3LRMA 1S7QB 3LXCA 1A7BA 5J6GA 1NKOA 1FYTA 3BP6B 4XOEA 3EG9A 5IJBC 5I28A 1FIEA 3BSZH 3EOYG 2A4ZA 5KSBF 5DSCA 2APVA 2WNKA 1NIEA 1VZIA 4PPTA 1UHVA 5HYJE 4YO0B 4HWBA 3T3MB 4Y16B 1UOLA 1JZ4A 2IEPA 2VM9A 4HETA 5TK2A 2W0KA 5D6CA 5DK2A 3VFRB 4N22A 5DR5L 3MUUA 4QRPB 2DQCH 5GS0L 5I76A 4HEMA 3NAAH 4LSSL 4N0YL 5FOBA 2K8QA 3OMZA 3VFOB 2QTEA 3FBKA 1UM4H 4PRHA 4XI5D 1ROWA 1FL6A 1OW0C 1DLFH 1Z9PA 2ZOOA 3VD3A 1BFOA 5IMKB 1OE3A 1WWBX 5DUPL 2VUYA 5IHWA 5EFIB 2NTFB 2UZIH 3CSYB 4JG5A 3C6EA 1Y07A 2WQUA 1YN6A 4NRXB 1HKFA 3MBXH 1HH6A 3VXSD 2VZUA 4LHUB 1MF2L 5HHME 5F2FA 1I8KA 4DWHA 1TVBB 1F8TH 3FO2A 3FT4B 4FRWA 2OI9C 2DOCA 2J1XA 4NKOA 3RTLA 1H9DA 4XXDA 1RUMH 3OJDB 3QK0A 4ORGA 3WHXA 4BSWA 2QDWA 3L3IB 3U2JA 2X9YA 3QUXD 4DUVA 4HIXL 2QADC 2HRPH 1MFBH 4NJ9H 1IAOB 3QJQB 4XMTA 1JI2A 4XP6L 4KKLC 5F6IB 4XC1H 1IL1B 4J3XA 1G7QB 2FLBT 3GHPA 1XMWA 2NX5D 2DQFA 5GJTL 2X89D 3D12B 1S7RA 2QV4A 1KBGL 1WCBB 4BZ1A 3HI6H 1BQ5A 2B1OA 3QXVA 4N2AA 5FV2A 2YWZA 3ZE1E 1YY9C 1KCSL 1AOHA 3JVGA 4XNBA 1UZ8B 3RZWA 3LD8B 3VRLF 2HLFC 2GBTA 1BXUA 2GUOA 3K81A 3L6FA 1IKNC 2DWEB 3KLLA 4ZMTA 2XC8A 4HJ1A 1RK1A 1C7SA 4Z3TA 3VG0H 2W1NA 4A38A 4BZ2H 4KO6A 2KDGA 5F9OL 2X4SB 3GBNH 3GMMA 2QKIB 4N2FA 3BMWA 4HIEB 2CXGA 4HOZA 2AK4A 4JK0D 3K1DA 5EBWA 5E00A 1ICTA 3L5JA 5BXFB 4R4BA 2G2NA 3I9IA 2BY1A 2F15A 2MEJB 4XB7A 5D4QA 5F1SA 5A16B 4APQB 4FYTA 4AEHH 2VXTH 3GPEA 2CK0L 1FH2A 3APFA 3NH7H 2X4QA 1N8OE 2WN3A