3SQBB

Structure of the major type 1 pilus subunit fima bound to the fimc chaperone
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
145
structure length
145
Chain Sequence
EVVNAACAVDAGSVDQTVQLGQVRTASLAQEGATSSAVGFNIQLNDCDTNVASKAAVAFLGTAIDAGHTNVLALQSSAAGSATNVGVQILDRTGAALTLDGATFSSETTLNNGTNTIPFQARYFATGAATPGAANADATFKVQYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chaperone protein fimC
publication title Quality control of disulfide bond formation in pilus subunits by the chaperone FimC.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural protein/chaperone
total genus 19
structure length 145
sequence length 145
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2011-07-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 3sqbB00
1TR7A 5LNEA 4CSTA 5AB1A 1N0LB 4XO9A 4X5RA 5CGBA 4X5QA 4ATTA 1N12A 4X5PA 2JTYA 4CA4A 4XOBA 1ZE3H 3JWNE 1PDKB 2UY7B 4AVHA 3BFQG 4AVKA 2XG5B 5FWRA 4X50A 4LOVA 4BUQA 4AV4A 4AVJA 3JWNH 3ZL1A 5ABZA 4AV5A 5AAPA 4AUJA 4J3OH 2W07B 1UWFA 4AUUA 4AUYA 5IQNA 5FLUA 4XO8A 2UY6B 2VCOA 2WMPB 3ME0B 4CSSA 4AVIA 5IQMA 4AV0A 5LNGA 2J2ZB 3BWUF 3ZPDA 3ZL2A 5IQOA 5FS5A 1KIUB 3RFZA 4XODA 4XOEA 2XG4B 4XOCA 4J3OF 5AALA 2JMRA 5F2FA 5JQIB 1QUNB 3JWNG 3MCYA 1KLFB 4J3OG 4XOAA 3SQBB 5FX3A 3BFWA 5F3FA
chains in the Genus database with same CATH superfamily
1GC1H 5IW1B 5FGBA 1DVFC 5AYUL 4Z77B 1FFOA 4NZDA 3H6JA 1MFEL 1G0YR 4QHNA 1RZ7H 1U8JB 2KPNA 4TPRL 5FC9A 1I3RB 2FUTA 3KBFA 4GFXA 5DC0A 5GPRA 4J3XA 5F7AA 2JQZA 1OB1A 1A7RH 1FAIL 4LRIA 3T6QC 3ALPA 3BAKA 4I9WE 4HUUB 2RCSH 4JRXA 5I2IA 5B3JE 2Y5TB 4O2FA 1BOYA 1HHIA 3UROR 3M1OA 1KDIA 2FR4A 4UIKH 2X12A 1YC7A 4A7QA 3C6LD 4WO4D 2IGLA 4A7SA 4CKQA 1HHGB 1OSPH 1WYJA 4QRFA 5KOVC 4HK3J 3WFDL 3I02B 1HS6A 4IRZH 1D6EB 3KVDD 1GZPA 4BJLA 1BQHG 5INCA 3NP4A 5DZAA 3ULSB 2NQCA 3L4CA 3ZL1A 3WUZA 3UPAA 6FABH 1HL8A 4YSOA 5IZ7A 2Z7ZA 2OL3H 4PJ7E 4LBAA 4LNRA 4ZNEA 5DUPL 2EYTB 3O45A 4Y9GA 2ICCA 4RBPK 1EO8H 1GVIA 3U9PL 3WEAA 4E9RA 3RWGB 3S8FB 5C0JB 5E4OA 2APSA 4JGUA 3T4AA 2G60H 4HJIA 5BZZA 2G5RA 1JI1A 5BNXD 2CCLA 1MFUA 5D9SA 3T2OA 3WKNA 5CP7A 1YUKB 3KBEA 4G8IA 4KJQD 5K93A 2AZUA 3OAZK 7FABH 2Z4QA 3L4XA 4HF5H 3ETSA 3ZL2A 3IDXH 4ZQTA 3B9KA 3NSYA 2IPUG 2VLJE 3OSVA 1BFTA 4BWUA 4DP6X 3EBAA 4KV5F 2WSPA 1JJUA 4NUJB 1OF2B 1LO4L 3TNNA 4EZJA 4N5UA 3CLEH 3P9LA 4UQ2A 1ETA1 3ISRA 1NEZG 4AI7A 3DJ9A 2IBGA 3IDIA 1U8PB 1JOIA 3WLBA 4FQLL 4XN2A 2AEQL 1CK0L 4HKZA 4AZ8A 5DJXB 5HI5C 3FZUC 4J8QA 3EHBB 1BEXA 3X14A 4GRLB 3BVWA 5DHMC 5HHXH 4KMQA 2XN1A 2WW8A 1PLGH 2X6BA 2NXZB 4IBZA 4PJBF 1T1WA 4HJ1A 2R59A 3JV6A 3SKOA 4WSKA 1LNUA 4B5EA 2IAAC 4Y1AB 4A2DA 2A9AA 2OK0H 4XZUB 3KYOA 5BRZB 3PGDB 3PWJB 4WRLA 2R2HA 3ABKB 1FHGA 2NYZA 1EERB 3NSXA 4IRJC 1V7MH 3DBSA 5I0DA 4GLRI 5FGSA 2AVFA 3C09B 3GIZH 3M7FB 5C7XL 3QNZA 1QEWA 1NCHA 2CALA 5AKRA 4M4RA 4X6DE 2F19H 1QLFB 4XNYL 1RZ8B 4X4XB 4JFEE 5B3NA 1AGEB 2JTYA 3NCJH 1BD2A 2Y0SA 4LVHC 1ZXQA 4U3HA 2KDYA 4W9GC 5JIMA 1TZIB 1RCYA 3G04A 2IJ0C 2FB4L 3ILQD 3Q2VA 4QAMB 4EIBA 4E68A 3O6ML 1SN0A 3G6JA 4WU5B 5DJCB 4S0HA 4PJ5A 4KI5C 3Q3GA 1QQDB 2WOYA 2UUDK 5GSVB 1J1OH 1G7HB 3B83A 4FTVD 1X7QA 4XMLH 4HXAL 3G5XB 1TITA 4LLDB 2BNRD 1YEDB 1CMOA 3P73A 4NRYA 3NYKA 2XG4A 1W91A 4P5TB 3FQ1A 2G4GA 5DJDA 2Y7QB 4ZAKA 5H94B 5C0AB 4UDTB 2FDBP 2UZIL 3F85A 3OHMB 4PW9A 4OI7A 1TCRB 1EHLH 2ZCLL 3BKYH 3ZSTA 2XFXB 1UUSA 4WV1B 6PAZA 1ZHLB 1PYWB 1MCLA 5GGSB 4GKZA 3O2DA 4IEFA 2DIEA 3O41A 4OFVA 4M61A 5TTRA 1HQRB 3GBLA 1ETZB 3BUDA 4Y2DC 1VSCA 1SHSA 4ZQKA 4ONHB 1AGFB 3O9WD 4B95C 2EH7L 4Q6IC 2DQEH 5ABAA 4OCYL 3HMXA 4AOFA 3S3BB 4NO3A 3CZGA 4G43B 4YHNA 5FV2A 1A7QL 4Z7UF 2CWRA 5HYJA 1BAGA 1E2WA 3VG9B 2AJSH 4ECNA 2HVKB 4WUUD 1JTOA 3RGVB 1UWXH 1KTKE 1FNGA 5AB0A 3WNKA 1UJ3B 5JLZB 5DJAB 1E27A 1UD4A 2YA2A 2HRPL 1BQLH 2B7DT 3GGWB 2C1OA 3HS0C 5B39B 2C3XA 5BOZG 3LJ3A 1ITBB 4WI0B 1AG0A 1YEWA 4BQ9A 2VLME 4XO4A 3VDCA 2XRAH 2WYIA 1EDYA 3GKWL 3O3EB 4NHUA 4UAHA 5IROC 4TTDD 3VI4E 1KXQA 3N2JA 5I6PA 1QATA 5C0ND 5D70H 3UABA 4DPAX 2HN7A 4N8UA 1I1AC 2HRLA 3B7RL 3FU3A 4R7NB 4UUJA 1WV7T 1S7VB 4PU2A 2KPWA 1JZJA 1I9JL 5CMAB 1QWNA 2LV4A 1IBGH 4B9FA 3SGDH 1IC7H 5T5NG 3QI9C 5D96B 2VR3A 3HI1A 5C0EB 3S3JA 3BN9C 2GSIA 3FQWA 2J73A 1QPKA 3FN0H 3KE0A 3PFUA 4MA1B 4TLUA 1E8WA 1JPGA 1KTLB 3CJJA 4FNTA 3Q8FA 4NZUH 1QPPA 4NDMA 5BRPA 5CSZB 3DECA 5D7KE 1MREL 1B9KA 1Y18B 5ESVA 5EZIH 1B0RA 2E4TA 2QKIA 1MW3A 4PS3A 5DT1L 1VACA 4MQTB 4X6BA 12E8L 1JRHL 5FV1L 5KSBF 1GS8A 2HFEA 4P23C 3F01A 2HT3D 4BRJA 3R19A 5EOTB 4GY4A 2IH1B 4Y16C 3K71A 2GC7C 3FQUA 1CXHA 2AGJL 3H4FA 4M1CD 3VX1A 3FQNB 3OX8A 4JHBA 5BVJA 2V3DA 3KLDA 1U91A 3MV9D 3S4SA 3Q6FA 4AWJC 5B1AB 2AXGA 3IXAB 3O6LH 2CGZA 3M86A 4QHLB 3RWHA 3O0LA 4WWOA 1HSAB 1J12A 4FKKA 1RSFA 2YJLA 4WWKC 4NZRL 3UZEC 1D7DA 1I82A 1KGYE 1AC6A 3ZW3A 1X7SA 4MCZB 2QGCA 3VXMA 4BZ1H 4BZ2H 5I30L 1W72B 4AJYV 3B2DC 2RTTA 2FQGA 3WUWA 4I18A 3WKML 2ZSVA 3DIFA 3MJ9A 2BHZA 1FH2A 5L88L 2VDKL 2A1WH 2B4CH 1MSPA 3BYYA 3CFJA 3KXFB 4QGTA 2BHFA 1KPRB 1JD9A 1JFQL 4P2OC 1QKZL 4EQ2A 1BAWA 2E8ZA 1OOAA 4O5LH 1KCKA 2HX9A 1JV2A 1NBZA 3VI3A 1E9OB 3DTDA 4PGCB 1YQVH 4AQEA 2GBUA 2HFFB 4NM4L 3GMLB 5TDNB 4QF1B 3U0TA 1GA2A 2WUCH 2F5BL 3DMMA 1CU4H 4XXWC 2Q3XA 3JV4B 4G7VL 4QXVA 4I3SH 3LZPA 4FFYH 4LCUA 5AKTA 1F4WH 1KBPA 4UU9A 5I5MA 2WZ6A 3F62A 1U42A 4G2AA 4LXFA 4RMSA 4PJ9A 4DGWC 3FB5B 3LEVL 2R4RL 1IGTB 4HEPA 4QLRA 4DO5A 1KJ2H 1KBKA 5BZDA 4P9HL 1IAOB 2A6KA 1V55B 2CZNA 2JKRM 1OB0A 2VJ8A 2W91A 3E9TA 2ATKA 3KPRD 4ZTOL 5KBMA 1T7YA 2D03L 4GUCA 5DJ8B 1A25A 1YYLH 2DQCL 2YPVA 5FGRA 5T3ZD 1YNLH 3CQQA 1S7QB 4Y19B 3ZDZB 1BOGA 3GSWA 3IU3A 1B88A 2PO6C 3JWDH 2WIIA 3MLUL 4JMNA 4LP4A 4WJ5A 4XMWA 3DTUB 3FSZA 1QBLL 1YECH 5FLVA 3BZ4A 5KG9A 2DQDH 1C8PA 4WU7A 4ODBD 2X6CA 1JTTA 3PPSA 2AV7B 2DLGA 3QC6X 4YBHA 1FDLH 2WJ5A 1QSFA 3LNDA 1SOSA 4QRSB 4BSJA 4R26L 3UMNA 1ND0B 4CMMA 1T1ZA 3GHEH 1AANA 4DESA 4OV5A 3IMTA 3DX7B 4PJEB 4W6XB 4X50A 2F8XC 5IVXE 5HYSB 2CJTA 3N5AA 1DVXA 1L7IH 3ZXAC 3MZGB 2WP3O 2NY4B 5FGBC 1IZJA 4Z3JA 3QORA 3LEYH 3O2VL 2R0ZL 4HSAC 3FFCA 1T7XA 4GIPD 3K74B 2V3FA 4YNYA 2B15A 2ZOOA 4U6YA 2O5YL 3WDHA 5LGKA 3IDNB 2VLKD 3OBAA 1M2VB 3QZNA 5E8DL 5IQNA 3HBGA 2K9UA 4NPYA 2QZ5A 3GXDA 4LVOB 5F1KC 5ISZA 3C2SA 1GRWA 5ITBH 1IBDA 4ODVH 4MYWB 3L3GB 1Y6KR 1UXMA 4EIUA 1FV1A 2XWRA 3C9NA 2KI6A 3CMOL 4U1MB 3V5KB 2XPGB 1T0OA 4XP6L 1MCPL 3BWUF 5CCHE 4PW4A 2DEYX 3KL3A 4JY4A 3ZO9A 4L4VA 1YUHB 2HG0A 1M53A 3H0TA 2YQ3A 4H1LA 1WFJA 3T09A 3PL6D 4MBRA 3IGFA 5A6LA 5GGTH 3VE0B 3MKKA 2AF2A 3NJMA 4IIZA 5D72H 4YOKA 3V4PL 3WTXA 1FYHB 4WO0A 1QRKA 2NY2D 1ZEAL 1E40A 3QA3A 4JQVA 3T4AC 4CU7A 3RKDD 2DQJL 4ELKB 3WI9A 2JMRA 3QIWB 3FTYA 2P3YA 1HJCA 4KRPB 1H0DA 1CWVA 3G6AB 4EDXA 2K6WA 2FEDC 4XP5L 3Q1SL 3ARBD 4X6CF 4NGHH 2QQNL 2ENSA 4BH8B 2ZCKL 3MBEB 4GRWF 3PWPD 3NDZE 4KKAC 2ITDA 3B9KC 4G42B 1IKFH 1WQVT 3FW6A 4RGMB 4AM0A 1E5BA 3RIFF 4ZXBA 1NEPA 4J3SA 5EG6C 1MVUB 2P52A 2FH6A 35C8L 4NQSA 4QTIL 5GRWA 1HH9B 4R7VA 3WIAA 4I1NB 4HWZA 2XN9D 3W81A 1E9PB 1RURL 5BS0E 3C60D 3HZVB 1HKLH 5EA0L 3KLHC 2CRMA 2CJUH 4MHHI 1YZZA 3VXSA 1PZSA 2DB8A 2CKNA 4NO2B 3O2WL 4IKIA 1J8HA 3KZ8A 4JG1H 5DD1L 3WOVA 2VZ3A 3MLPA 4KO9A 1INDH 1II4E 1MAJA 4YL9A 2ZOLA 5A2BA 2X3CA 5FDYA 4GINA 4PLOB 3ZHKA 2BW4A 4K7PL 1FPTL 4OZ4B 4G1EB 3I6GB 2J44A 2VXVH 4P3WA 1Q9WB 3AQZA 1GGBL 2P5ED 1TQCB 4GKSB 4PJ7B 1PNCA 3LKPB 4LGPB 5F3HB 5FPIA 3I3EA 4FS0A 5BZXA 4XN4A 1AY1L 3CHPA 3DI2B 1A6VH 5KVFE 2QFPA 4KK6D 3DPDA 4Z95H 5BPPA 4I3GA 1NCAL 3D0VA 3LSOA 3DO3A 3MV8A 2BVUA 2Z8SA 3ZZSA 5FLUA 3F7YA 1H3PH 1U92A 1V27A 2FJHB 2NZIA 2PPCA 2MNUA 3TF4A 1G6RH 1DJWA 1FFQA 5K59F 1ASQA 3BKJL 2OYKA 1JNHB 1W0VA 5IG7B 2ZCZA 5FO7B 4GG8B 3S5ZA 3A21A 4IBTA 1F11B 4JCMA 3FAXA 5KS9A 2VLJB 4HALA 4HPOH 4KKQA 2A83B 4O4YH 2E86A 5MERB 3TO2A 1M05B 4JO5A 3UTSD 3ARQA 1NAKH 1XWVA 2X9YA 1CDJA 1COBA 4TOYL 2HVBA 1JGEA 4TQHA 3U4EB 1CGVA 1ONQB 1NGQH 1OK8A 4U1GB 3GZQA 3V6FA 3ZZLA 1KYUA 5IHBA 3QJVB 1LDPL 4ZAKC 4PJFA 3JQOB 4L8DA 4AEHH 2V6HA 1PZ5A 1FL5A 1HZHH 3JUYA 5EIVA 3T0ED 2VDRH 1IAMA 2KQNA 2DICA 2JK5A 3LH9A 3MN8A 3NGBC 4HV8A 2X2YA 4JGJA 4Q89A 5J6HB 3QUZD 1XCTA 3MDJA 1JK8B 5C07A 1KELL 3SE9H 3KLKA 5IHLB 3DXAE 2DI9A 1CBJA 1IGYB 5D1ZD 5D2LF 2R7EB 5J5EA 2G3ZA 5FYJE 1RIVH 1CE6B 1FZOB 3OZ9L 1VGEH 1JNJA 3THML 4X6DB 4YSAA 4U1IB 5F6IB 4GMSL 2JCCF 4JFEB 4G8GA 4PB9H 3OLIA 3ZLQC 2WWKT 2J4WH 2EIZB 4HQQH 3MRJB 3FTZA 1T03H 3GMPB 4CMHB 4YSTA 4K3JH 2FL5B 3S96B 1AD0B 1ETB1 4AGNA 2V2WA 3V6OA 1GGIH 1XGUB 1DANU 2LHAA 3T65B 1N64L 3KHOA 5CU9A 5I17A 3S88H 3O3UN 1OM3L 4HS8L 3TVMA 3AREA 2P42B 1QO3B 4QRBA 4UTBL 5CCGE 3LB6D 4PJIF 4HLZH 3BH4A 1IM3A 5I8CB 1TZHA 4HK0B 4X7SL 1GSKA 4AG4H 3NJFA 4DEUA 2VXUH 4W9JC 4FMKA 4ZO6A 4MNQD 4L4TD 4D0CB 5DYOA 4L5FL 5TQ0H 4HHAA 2QHRL 1ZXKA 1YEFH 1N5YH 2WXKA 5DUJA 3BDYL 4GS7C 5E2VH 4Q2ZB 4MX7A 2QTVA 5TDPA 4MAYA 4YX2L 2AQNA 3RTQB 3L3OB 3PQYD 4HKXA 1JWUB 4L9DA 5EU4B 5C71A 4UZUA 5LXGL 4XBPB 1U8OB 5ESQB 3CWGA 4L4JA 1U9KA 1VPOH 2LU5A 5C09D 1MIEH 2J57A 5EU5A 2X09A 1ET7A 2YKLL 2PYEA 1KIQA 3MRHA 3QQ4A 4LSPH 4OZIA 4OZFH 4W9IC 2DQFA 3ARFD 3MNMA 3E38A 3VXRD 1IM9B 2QKIC 4NWTL 1UUNA 2Z1PA 2Q8BH 5T1DL 3NACL 2EXSA 1DLHA 3FUJA 1WBYA 3VRJB 5FS5A 3QQDB 3SZKC 3MUY1 5J9PA 2DL2A 5IW6A 3HI6H 1MZZA 2O6FA 2OTUA 3JBG7 5IESL 1B2WL 4TM9A 2AJYL 5DCCA 1YY9D 1KJ2B 2B20A 3P1VA 5HJDA 2JB6B 4CU6A 4F2EA 1ZPLA 4OQTL 2VMJA 1C5CL 4UWQB 3SDDB 1T7WA 5J6SA 4EUPB 2DZEA 3AMKA 5DJ6A 5EIIG 3G5ZB 5I16A 1TVHA 1KGUA 2ESVD 4TNVF 8PAZA 3BPLC 2HMID 4JB9H 3VI4B 5JQIB 4HGWB 1AS7A 2GJZA 4DK6A 3ULUE 2EDKA 4NO5B 3QFGA 5IQ9B 3CSTA 4Q9BA 4BZYA 4Q9RL 4I18C 2J7LA 4W6YB 4RAHA 4JG9A 4G5ZL 3VXUE 2VKWA 5B38A 2DWXA 2DIAA 3O11A 3UACA 1DJXA 2CGRL 2FSDA 4D0BB 5DJZA 4UM9A 3UPCA 2Z3FA 2EZ0D 4XI5C 1V5JA 3CCHA 4WEMB 1LO5A 1BFVL 4UQIM 3SJVE 1GGUA 1MFAL 1NFDF 3U0PA 2D7NA 3ZKNC 3GRGA 1VCBC 2XOTA 4FZEL 1YN6B 3RY5A 2FJUB 3VDAA 4G5AA 1ZA6A 1Z3RA 1DN2A 3QG6A 2Y1ZA 1LQBC 5IFJA 1KSRA 1I3GH 4K9JA 3DMMC 5D7EA 3SKJL 2G5BA 2ZX9A 3KHQA 1G7QA 1BEYL 2F54B 5EN2B 5K1NA 4HCRL 2OSLA 4POUB 3ZTJH 3ZT6A 4HS3B 4PJ9C 3N85L 1QASA 4E9SA 2VMEA 5DHVA 4XCNA 3NK4A 4HX1B 1JWSB 1H3GA 2PW1A 4APQD 2QADC 4KUCD 1O5DT 1ZK5A 2XTJE 4HS6B 4J23A 3WN6A 4O2EA 3FO1B 5F0JB 3QQ9D 1OGAA 4WI4A 2WB7A 5T5FA 1AKJB 1GW0A 2LT9A 1YPZA 5D1XD 5ACZA 4K3EL 2W65B 2YPLA 3LZFL 4NNYB 3H9HB 5JIDA 1CQKA 3DX6A 1R24B 3QDMD 3MXWH 1XH2A 3V4LA 5FOBB 4UOW0 4DP4X 3S36H 1S9WB 1U3HD 5FEBA 1E5AA 2Y2YA 5DZVA 4YXLL 1PW3A 3LX9A 1A1NB 2J8UA 4YBQC 1RVFL 5T33H 4XCCH 1NGYB 2OQJA 5JIKA 5LQBL 2QSQA 1J1XH 1ZV2A 5TGBB 2QSCL 2DN7A 1UWXK 1HH6B 1I9RH 4NC2B 2PWEA 3EO9H 5FKAB 1GGCH 4X5XB 3QJHA 2K45A 3QPXL 3WFCH 4DEWA 5ADOH 2HLFD 5L2JA 3QORC 1TETL 1QRNE 2EJ1A 2ARJA 3JTSA 2Q76B 3R4DA 4Y4FB 5TQ2H 4G9DB 4ZS6D 2CIIB 1B3JA 2SEBA 3SBWC 1CDIA 4URTB 5DZ9A 4Z0XA 5T3XE 1FP5A 2W9DL 4MASA 3CHQA 5D6CA 5DRXB 5BVPL 5LN8A 3AQDA 3WTUA 4YSRA 2CJ3A 3IXTB 1BYPA 1Q8MA 3MLTA 3C5ZA 4AENB 1KGIA 3CFIC 4QXGL 5LDUA 1BCIA 3AXLA 4MA8H 3FRPA 4XO3A 5C08A 4DP7X 1JZ4A 4ZDHB 5DZOA 1T20B 1YNTA 2EE0A 1J86A 2ZSWA 3MSPA 4ZYKB 1HXYB 1S7XB 3D85B 1OWWA 5FYJU 1D6VH 4KQ3L 2VZVA 4TMPA 1KPVB 4LLUB 3QEGL 2LQRA 3DETC 5EOCH 3AJ7A 1DR9A 1FBIL 2VDPL 3EBGA 2VQ1B 3FU5A 4IOSD 4ETQA 4JO4H 5GS2D 1HWWA 4I0KA 1A0QL 1QHQA 5IOPB 1JGIA 1IU1A 1ZS2A 1J05A 3L7FB 3W11C 5GZOA 4LLVB 4K3GA 1AJ7L 3UIYA 4JQVC 3WEMA 4DW2H 1ETJA 4OAWA 3E9UA 4NENA 4XBMA 1AR2A 3E3QE 2J1KA 1KGCD 2PWHA 4JL1A 4WTZG 5IK3B 3VH8A 4ELMF 5D71H 4YHLH 1C7SA 1M56B 2J2ZA 1NINA 4PW3A 5IVXB 2D9CA 5KSVB 1TJGL 2MOQA 3VSUA 1JHKH 2Z7UA 3HC3H 3U82B 2NCEA 1KIUA 3KBPA 4LFHG 5LLIC 1G6RB 4JJ5B 5C86A 3FT9A 1EPFA 1A9BB 3BHBB 4ZXBC 2LOEA 1RIHL 4OCSL 2FX9L 3UAJD 3H56A 1D9KA 2FSEA 1P7QD 3TO4A 3IGAA 5J6GA 5AG8A 1E4HA 3QIBB 4TUJB 4Z7WE 5I15H 5FB8B 1NCWH 5HHQA 3L3HA 1RAMA 2CIKA 4IKNA 3ZDXF 3QVAA 3R18A 4YSUA 4HWEL 3QB7C 2HLEB 2NY6C 4JFSA 1GGYA 4RFOH 1KLUA 2JXMB 2ZOUA 3RG1C 4CNIA 1JHLL 2EEFA 1Z0MA 3QEUA 2H32H 3AS0A 2HG5B 3F2LA 3EGSB 1NCDL 4KDTA 4HBQA 4P5KB 3WCYA 1U8QA 1URIA 3O6FA 5DZLA 4DVBA 3VU2A 3WIFB 1HN1A 2VDRB 1H3UA 3ZMRA 1FRGH 2CO6A 2CU9A 2DI7A 5L4FA 5EBMA 2DV6A 3MOBH 1GAFL 2WNGA 4XCFL 1RPUA 3FU7B 4LSQH 1SQ2N 1WA1X 3LXUX 4QD2E 1UVQA 4O51B 4UTAA 1I7TB 3HKZA 1NCCH 3IMUA 2VLRE 2N1KA 4AQ8A 4RA0C 4LOUC 2PTUA 2BSRA 2X0WA 4N90D 4Y88A 1UZGA 3TTSA 4OJAA 1SDYA 4XAKD 1X5YA 1QLRB 3KPSE 4OF8A 4CUCA 3SDXA 3PDDA 4KKCC 4BUHA 3MLRL 5BXFB 2OXGB 5EBLB 5T3XH 3RVTD 1JPTL 1QSZA 4D9LH 3HJEA 1FZJA 2IH3A 5L0QB 4XRCA 3U48A 3LNEA 1SJHB 4GAYB 2Y5QA 1TJIH 1WAAA 4LSVH 1SEBA 1K8DA 2GEEA 1EAQA 1N7MH 2R56L 3LKQA 4K7FA 5E5UB 2XLLA 4FLSA 4YZFE 5BS0B 5DRNA 5L8JB 2ENYA 3ZDWA 3MRIB 5DTFB 2D3JA 1FNSH 5CD3B 4IGBA 2HT4D 3VFSA 2ALWA 1J0HA 1E2VA 1N8ZA 5CSGA 2VLLB 3L9YA 4UNTA 3ZE1F 1NLBL 1QW8A 5KYYB 4AYMC 3VXOB 3WEOA 2YBRB 4JG5A 2JI1A 5TPWH 3GJFA 1ML0A 5DUMH 3QUYD 3MPCA 3FO0H 4BKLA 4KJPD 3EXLA 4R6UA 3BVDB 1YMMA 3OD3A 3VRIB 4J6IA 5HBBA 3R0NA 4NQDB 2VZ1A 4U1NB 3ARZA 1FYTD 3ILDA 1N68A 3CDZB 5E6ZA 2IPTL 4NO0D 5IUCA 5INDA 2Q8AL 1XF2A 5IQLA 4E5XB 5HHOE 3AADB 4OZFB 4MNGA 4U1SB 1IT9L 1NA8A 3OTTA 4MMZB 4N9GA 5FA3A 5IVZA 1BVLA 3D48R 3HB3C 4NN5C 3PHOB 3I50H 4BFEA 5DI8A 4EBQL 2GKIA 4K71C 4XNUL 4J8RB 4GRMB 4HKJA 4NXSA 3RVUC 2EVJA 4IRSD 2BDNL 5I1GH 2A6IA 4LLAA 4AKQA 5KTEL 5MEND 2R23B 3TVMC 3AREC 3N1FC 1QLEL 4L1SA 3L5XL 3UEZA 3WXWH 3ZGHA 2F7OA 2VXSL 3BWAA 1T22A 3ECQA 4RAUB 5KUMA 5DMKB 4MXVF 5KN5A 1S7WB 4AMKL 3LH8A 4RZCB 1XCXA 4UNUA 1A8ZA 1MEXL 1MCEA 3MXVL 4TNWF 1MQKH 5IKCA 2H6PA 1ZTXE 4Z77A 5IW1A 2Y7LA 4PLJC 1G87A 1VESA 1U8JA 2RA1A 5E6UB 1F41A 5F9OH 2I5YL 1G84A 1I3RA 4MAYC 1V7NL 2G30A 2GBAA 4UM8B 1M1XB 2J20A 2Y7SA 3VYPA 2VUKA 4M7LH 3IJHB 3GK8L 2DDQH 4PJCE 1IBBA 4RFNC 3MBWB 3T2LA 4HUUA 4KKLD 4BRVA 2Y5TA 5DD5H 5GJTH 4DEPC 1MCWW 5CEXB 5DK2B 2XUWA 1HHGA 4EI0A 4KK9D 4HXBL 4S1RH 3I02A 1DCLA 5D5MF 1D6EA 4I0PD 2V7HB 4IW4C 3MROA 3LN4B 1U4EA 4P4KD 3ULSA 4U6XB 2WP3T 4FTVE 2YRBA 3FN3A 4F93B 3NJIA 5CR1A 2EYTA 2DI8A 2WBJB 3F58L 3QEQD 4UOW1 5I71C 4S0TD 3RWGA 5C0JA 3JWNC 2D8KA 5ACMA 4YSDA 4NQVB 5KYXB 2HJKB 2K3TA 1OCWH 4YK4C 4XMPL 3WO4B 4FFVC 5C2BH 4ADJA 3TYFB 1UEYA 2K70A 3VFWB 5B22A 1R17A 4DN4L 3OJ2C 4B27A 2CLZB 3QXDB 1ADQL 4RMWA 2V2XB 4YVUA 2EH8L 4G7YH 4JAMB 4S1QH 5IHZB 1HZLA 4GKLA 4NUJA 1OF2A 3CXDL 2FYYB 2B08A 2JLPA 2IH8A 3IK2A 5F9WC 2F61A 4GBXD 4XVJL 2B2XH 2P7TB 2ENJA 2BY1A 4O58L 1U8PA 3UMTA 1AQHA 3US1A 1J8SA 2WXNA 4TSAL 5DJXA 1PD0A 1L0XA 3IJ7A 1B4RA 5KSUB 4LOEA 4WUUE 1LGVA 2GY5A 3QJFB 4GRLA 3VO0A 3PUCA 2Y3NA 4H40A 1CI5A 1OL0A 1KF9B 5J13B 4Y1AA 3R0MA 1D2PA 2EDDA 2WBWB 3FBKA 4XZUA 5BRZA 2BRRL 3D87B 1SGKA 2AXHA 1F58L 1O6TA 3PGDA 4UV4L 1OAXL 3PWJA 2WJ7A 2MPVA 4F80A 2VUYA 3BISA 1SBBA 4GNKB 3ZUCA 1RZJC 4JS7A 5JW4M 1QLFA 1RZ8A 3V4UL 4X4XA 3FMGH 1AGEA 1ZWIB 5D4HA 4ZZFA 3CSPA 1IB5A 1TZIA 3FQTB 3QWNA 2FATH 2PABA 2W5PA 4Z76B 4B9ZA 2OP4H 3TJHD 4WU5A 5DJCA 4ICXA 3A0OA 3VXUB 3LNIA 1GH7A 1QQDA 5KSAD 1FFNB 5GSVA 2ZUQB 1G7HA 1X4ZA 3GKZA 5C0BD 2BFVH 5K9OB 4DPCX 5I26A 1I4FB 1RUQH 3FYIB 4PY7B 3SJVB 4WFGD 2XWCA 1UT9A 3G5XA 1I8MB 2R15A 1SDDA 4NI6A 4XOAA 4HFUL 4LLDA 2BY0A 4POYA 1YEDA 1A14L 2HCZX 3F12B 4P5TA 2WQWA 4MVBC 5EOQH 5J7CC 2Y7QA 5H94A 5C0AA 5L8LB 2IDSA 3VDBA 1EA9C 1LO0L 4UDTA 4F7MB 5F72S 3M88A 3SE8H 3L4VA 4XPBL 1TCRA 2ARWA 2YRLA 4A55A 2ETWA 1BJMA 2XXGA 3MV9E 1E7VA 2WYZA 2GSGB 2XFXA 4WV1A 5F7BA 3D39D 1ZHLA 1PYWA 5GGSA 3OL2A 2ZYIA 3C5ZC 4HHGA 4KV5E 2WXGA 5JHMA 2O5ZL 1IBZA 2E7BA 2ZJSH 4X7TB 1HQRA 1HIMH 2ZXQA 4XP1L 1ETZA 2H9GB 5GGQH 4ONHA 1AGFA 4XPTL 4DGIH 4KQ0A 3RPKA 4B41A 2XTJB 1MNNA 3LS5L 4W68A 1DLFL 2Z7WA 3O8XB 3UJTL 1PSKH 3BH8B 3DX9B 2B1AH 4G43A 5EWIL 2VZSA 1KJ3L 4KXZH 3CXHJ 2FEEI 5KJ4A 4HZ1A 2ADFL 2H32B 1HINL 1U0QA 2CR6A 1DJYA 1IGIH 3D52A 3Q43A 4HIXH 4AIOA 1ZPUA 1DJHA 2HVKA 2NCMA 4PJBE 1G9EA 3RGVA 2PTVA 1UJ3A 2ZNWA 4BWTA 2J5LC 5JLZA 5DJAA 5GZOC 1L9QA 3GGWA 3UOAB 5DR5H 5B39A 3L16A 5CLXA 1A6UL 4LEBA 4WAFA 2OA9A 4WI0A 2B9BA 2GBVA 3STLB 1PY0A 4G82A 1HCVA 3Q48A 4EAEA 4ZX4A 3K6SB 2OULB 3O3EA 4PWIA 5E2JA 4J6RH 1AO7D 4OIFA 5JYMA 2XY1A 1DFXA 5AW9B 4J3TA 5LWYL 1NGZB 1R3HB 2CPCA 4WCYH 4EN3B 3QGVA 4KNSA 1GXEA 2W88A 5EO1B 3LS4L 3NK3A 4R7NA 2XNAB 1E0OB 1S7VA 1U8LB 2J6EL 1QRNB 3TWYA 1NMAL 3DBXB 4KTEH 3RDTB 3UP6A 3LIZA 5CMAA 3TEUA 1D9KC 2GTWB 2G9KA 1AZZC 3TO4C 2ATAA 2WQXA 5T3ZE 3F7QA 1SFHA 2WYHA 5C0EA 3QXUA 1R3JB 3G7TA 1A5FL 1EHAA 5F7HA 5CR8A 1KTLA 2M2DA 1TVBB 4JFVA 1A1OB 1UD2A 2XZCH 4QJ3B 5LXVA 5CSZA 3Q2WA 4GQPH 1L0QA 2GK2A 3UJIH 1JCKA 1HEZB 1Y18A 4KDTC 3ULVD 1NCNA 4E9VA 15C8L 2XWEA 3O6FC 2FWUA 3QS3A 5E4AA 5KW9L 3U1PA 4XC1L 2Y1YA 4LF3B 2E9JA 3NCCB 5D1QC 3H9YA 2PN5A 5TF1L 2L4OA 5EOTA 4JBSA 1J0JA 2IH1A 4DGVL 2NT0A 2YD2A 1RUAH 3CBJB 1A7PH 3FQNA 3B6SB 3ZYJA 1RZQA 2A74B 2VDQH 4M5ZH 2PP8A 5DO2C 4U3SB 1CICB 3KPOB 2VNCA 3IXAA 4J39A 1MFBH 2VLKE 4QHLA 2NY0C 1HSAA 1S6NA 5IBLD 3UTZB 3J8F7 2XQBH 5B7FA 2IQAB 5HJGA 4MCZA 4Z7UE 4XNZB 1W72A 1M6UA 3NAAL 4L18A 1O9ZA 2BNQD 4A2MA 1F1AA 2AK4E 3NOIA 2IMNA 3P30H 4LQFL 4MXQD 4PHZA 4XX1E 4AVKA 1G9HA 1LHZA 1E4WH 3KXFA 5GGRY 3M17B 5B1JA 3E8UH 3T2NH 1KPRA 2ERJB 3CFEB 4URKA 4QJ5B 2OMWB 4MS6A 5ENWB 4C58B 1WZKA 4Z7WB 2NZ9C 1E9OA 4PGCA 5D7JD 4BCYA 2Z92B 5ANME 2HFFA 4YJZL 3GMLA 5TDNA 4QF1A 1ZHNB 3JV0A 4NNPH 5J0BA 1C16B 2TSBA 2Y5EA 4IGBC 1OV8A 2X89D 1ADWA 1WDAA 3JV4A 4OFYD 3RNKB 7TAAA 2HPTA 1ILUA 5JR1L 1DEDA 3FTXA 2Z31D 1ZLUH 4OZHF 4XC3L 2V5RA 4R2GC 3X11B 4U6TA 3FB5A 1IGTA 3VFMB 1AZUA 2QFRA 1IAOA 4R3SB 2X7LB 3KLAB 3QJRB 5CEZE 1LILA 1OP9A 1VEOA 1IO4C 5DJ8A 1WZ1L 3PWPE 4K8RL 1Z5HA 1CXFA 2VLRB 3PXJA 1HHKB 1S7QA 1ZIBA 3NCYP 4Y19A 1JYWA 3PGFL 1DZ0A 3GSNL 2D7QA 1JGVH 3KPSB 4XODA 4PRPE 1TIUA 4P5MB 3SKNB 1DUZB 1IFHL 2XN9E 2APXA 2AV7A 3A67L 2BJML 1F4XL 1LWHA 4K94L 3KW8A 5KSBE 4LL1A 4QRSA 4PWJA 3T71A 2FQFA 1ND0A 1AZRA 5B4MC 2J1WA 5HI4C 2CMRH 1BZQK 4HWBL 1U30A 5FK9B 3U0WH 2BXYA 3DX7A 4PJEA 1OP3H 1UWYA 4BXSV 5HYSA 1QI4A 1U8IB 2P1YA 4ZFOB 2FLBT 5J11B 4OCRL 5TDOB 3X1GA 1RZKL 1IQWH 4A04A 1WFIA 4GO6B 1M7IB 4LEXL 2XN2A 4KI1A 2QEJA 3BFWA 3CN1A 4LLQB 3SQOH 2UZYB 2YOAA 3BQUB 3IDNA 1J48A 3GBMH 4WENB 3HNVL 1M2VA 4XE0A 4Y89A 4EI5D 4ZTPH 1NDGB 3D06A 3GHBL 4GMTH 4LCVA 1UZ6F 1EEZB 2JQAA 4XNBA 5LBSH 1O75A 2BNUB 3NCMA 2FIKB 5I8KH 1FO0H 3N06B 1OT1A 3H7BB 5FCUL 1KZQA 2ZWLT 1BPVA 4WW2B 1XIWC 4OCLC 3ZYIA 4TSCH 3L3GA 3T2PA 2VMCA 5HHME 4ABWA 5E8PB 5I1JL 4P46B 4U1MA 2K78A 3V5KA 1F45A 2XPGA 3FUMA 4LSUL 4QXUH 1BMWA 2HJFB 3KEDA 5F7EL 2XA8H 4H20L 1B4JL 4JE4B 4YXKH 1YUHA 1ZT1B 4P3CH 5HHOB 4L8CB 4UT7H 3SPCA 2CKBL 3NJHA 1HDMB 3UTSE 3BKCH 4FABL 4JZJB 3EW3B 1BZ7B 2CO3A 4WHYG 1RP8A 4AYSA 2WXOA 5DC2A 1DBML 1KN4H 3PIQB 1G9NL 4ELKA 4JO1H 5FYLL 3QIWA 4HISA 4LO9A 4GB9A 4JFQB 3AFLA 3T0EE 4QHKJ 3G6AA 1KCRL 2DQIL 1I9EA 1BYOA 3A6CH 1X5HA 2H2SC 4BH8A 5I0YA 3UPRB 4I88A 3MBEA 3M8OH 1A4KB 4G42A 5AVTB 3E6FB 3P4MB 4JHZA 4IMKA 5JDSB 3EKCA 4JZNB 1MVUA 2BS8A 4ONGL 1F6FB 3MOQA 5AZEL 2GIYA 3II2A 3WENA 1HH9A 1KEGL 1T5KA 4PJCB 4MA7L 5CEZH 2NX5D 1E9PA 1KN2L 1CFVL 1PKQE 3HZVA 4JO8A 3EHBC 1M7XA 2IG2H 3K1KC 3L45A 5BW7A 5PAZA 1ECZA 2EXYC 5HPOA 4WI6A 3PNWB 2NNRA 3B1TA 4NO2A 1SEQH 4JN2B 2NXZC 4ZD3L 1KTJA 1JDCA 2V3EA 4OGAC 3RVWD 3OKEB 3ZZ1A 1WS8A 5A1AA 1DSWA 2QT6A 3LPGA 3NA9L 3I6GA 4G1EA 4XNQB 5D7LE 3KDMB 1Q9WA 3VJ6B 3VSQA 2FEJA 3V9CA 4GKSA 4PJ7A 3WEBA 1L9SA 1UG9A 3LKPA 5F3HA 3RL2B 2UV3A 4ALAL 3VGAC 3EG9B 4MNQE 1T0NB 4L4TE 5KVFL 5AUMB 1ZHKB 4AMXA 2YFOA 5LNEA 1UQSB 1B0GB 3HC2A 4HKBB 2C3VB 3HW7A 5DS1A 1JPFB 2NY5L 2FJHA 3N6YA 3PQYE 3UIZA 4JJOA 3RB5A 3US0A 1JNHA 3FTWA 4NEHB 3GEWB 3NEXA 5IG7A 5FO7A 1J9CT 3QHTC 4GG8A 4ZK8A 1F11A 2VLJA 3CD4A 5HHPB 5C09E 2DLIA 1IBYA 3O9WB 4QTFA 2A83A 5MERA 7CGTA 1XEDA 2ZOTA 5HDQH 1OXYA 1M05A 1P7KB 1F4AA 1OAUL 1ZANL 3VXRE 1HNFA 4IBYA 3TC9A 3U4EA 5IT2L 3UO1L 5J1TC 2IF7A 1UEMA 4P5TC 3BRFA 4R7LA 4WUUB 1OAYL 4FNUA 1LK2B 1TJHH 3B2UC 1JUFB 1E28B 4GRWE 4RRPA 1K6QL 4NBZB 4WV1C 2TRYA 5J6HA 5GHWH 1VGKB 1JK8A 4G9FD 4HIPA 1HCFX 5I8OH 4KKBD 1D2OA 2ESVE 3GBEA 1P4IH 1RERA 3I3BA 1IGYA 4O2CB 5DHDA 3S4SG 2BVYA 3C08H 4Z0BL 2R7EA 1G9MC 1GCFA 1Q9OB 2IAMD 4CGTA 4HD9A 1CE6A 3OKDB 2YSTA 1FZOA 2F6AA 3IE9A 4X6DA 3VG9C 1D5BB 4Q6KA 4U1IA 4PIBA 6TAAA 1ET8A 2KT6A 4JFEA 4K5OA 4XHJD 5D4QA 2PW2B 1NMBH 3DVGB 2BRQA 2HTLD 2EIZA 5DD3L 3RGVC 3MRJA 1UJ3C 3B3IB 3WUWG 3GMPA 4KTDH 4OD1H 1QR4A 2F5AL 2FL5A 3S96A 5GS0H 1AD0A 4YDNA 4R9HA 1XGUA 3T65A 3BSZL 2WWMC 3H3PH 3ML9A 1F8TL 2XV6B 5DZPA 4D8PB 4IHBA 4Y4HD 5BV7H 1QO3A 2VDQB 4XCEB 3QZLA 1D5RA 4XMKH 1JXGA 2PCFB 2YQ2A 1S3KL 5I8CA 4HK0A 4K5MA 2WKOF 3TH4T 4S1SL 3H42H 5DFVC 5K9QG 4JK0D 1M9SA 2EVFA 4D0CA 2C9QA 4R4NC 3QIUD 1J0ZA 4QHMB 2FQDA 1E5CA 4KHXL 3WNPA 5F9DC 4KPHL 5GS3A 4BZ2A 2CAKA 5K59E 5D96C 4DUWA 4WWID 3CX5J 3RTQA 3VGGA 2JKSA 3L3OA 3TA3B 5EU4A 5JOPE 1JWUA 1OEZW 3MV9B 4HEPG 2R4SH 1N0LB 3LD8C 4ZUUB 4MA1C 4HP5A 4XBPA 1U8OA 5ESQA 2JIXD 4U31A 3P02A 3R1GH 4JHWL 5BO1H 5IFAH 3K8KA 3ZE0F 2BZCA 2Y06H 1TTBA 4HC1A 4P3DB 3TIDA 6PCYA 5E94B 5CJOL 1QSVA 4OTXH 5E1AB 3HBZA 4N20A 1IM9A 1VZGA 1RU9H 2NTSP 2O30A 3QUKB 2E5EA 3MOAH 4X4ME 2ZAIA 1TSRA 1UXWB 4FFYA 1I1YB 2E6QA 1TQVA 3NPSC 3VRJA 3QQDA 2VDNL 4PJBB 3QJQB 3ZHFA 3LMJL 5CUSL 2JJUA 1KJ2A 2ED8A 2JB6A 3WDIA 3SDDA 4FQ1L 3W3BA 2ZXWB 2CDGB 4JG0L 4EUPA 2F15A 2WZAA 3G5ZA 5D2LE 4L1BA 1P4LB 3KWVA 3VI4A 4GSXA 1UD6A 4HGWA 2K9FB 4GKNB 4ERSL 5LVEA 4U3XA 4NO5A 2UY6B 4LQ1A 5IQ9A 5HI5D 2AJUH 1KBGH 1AMXA 3W57A 3UTQB 2JCCE 5D7IF 2B59B 5CO1A 1IAII 2D0HA 5CFHA 5GGSY 1HVXA 3ZZQA 1BIHA 3W37A 2AK1H 4K55A 2FWOB 4GT0A 5B1JC 4TUKH 4D0BA 4GG6F 1AXTH 4M7ZB 4JFFD 4IU2B 4ODUB 4GI9A 4MMYB 4TNGA 5E08L 1KJMB 1YN6A 5I24A 1ZGLM 3DSFH 2H0JA 4DQOL 3SE3A 3P0VL 4PJIE 4XVSL 4X7FC 3I84A 3BE1L 1RULH 3KYAA 1L9RA 3KGSA 3KW7A 3LQAC 5E6ID 4AZUA 3KYMB 3QUML 3OV6A 3PNRB 5KANI 3K2IA 1P5VB 1SOQA 4IJ3B 2F54A 5EN2A 2DF3A 5A6IA 2FCBA 4X7DC 4H1LG 5F93C 5AW0B 5FHBL 1GCYA 2AKRB 4HS3A 5JQHC 4PTTB 1LE9B 2FO1A 2EDBA 2RHEA 3MO1B 2DQTH 2VN3A 4FA8A 3TESA 5E2TH 1RFDH 4HX1A 1JWSA 3IF1B 2MTPA 3S35L 1LK3L 2AABH 5ALBL 5E51A 1SHXA 3CPLB 4HS6A 4ANVA 1BAFH 4H44C 1MF2L 3FO1A 3CIQA 2B3RA 1UACL 1GGTA 2C5DC 4E9XA 5CD5D 4OCWH 2C9XA 5TE4L 2BIQA 1AKJA 1OTTD 3IMVA 2PMZA 3D4ZA 4OLWH 2W65A 2A0LC 4NNYA 2R83A 1TTRA 2VLKB 3CZEA 2ZG2A 3H9HA 4G6AC 4JY5H 1TMCB 4ZSOE 3UYOD 4JM2F 3LV3B 4Z78B 3FF8A 1X5XA 1R24A 5I74B 4G59C 4XN9A 1SF5A 5FOBA 4G6KH 5DMYA 4XVUC 4IMLB 4Z7UB 3Q0HA 4XMUA 4ATTA 1S9WA 3BP7B 2CDEB 4MRBA 2FECI 4NCC1 3MYZA 3MUGB 3PABB 5GGTA 1DBBH 1A1NA 1DSFH 1ID2A 1IFRA 2RJMA 3FSAA 2AK4B 5AZUA 5IBUG 1NGYA 3HG1D 3HFFA 3OKYA 3T6ZA 3T3PF 5TGBA 1HH6A 2EE3A 4U05A 1KCUH 5EORL 5FKAA 4N2GA 1NBVL 5LO7A 2A3TA 4X5XA 4Z8FH 3BAIA 4ONOA 1PL3A 2E9WA 3AUWB 3RLSA 2VR5A 2NY4C 5ANMB 2BSDA 1QI3A 3T0VA 4Y4FA 2O6EA 2Q76A 4TUUA 4Y2DD 4G9DA 4NYLB 5K33A 2W59A 2X4UB 1CF1A 3FT0A 3UO8B 3PDGA 3US9A 2ENPA 4PGBB 5DRXA 3TJPA 4RX4A 4LVOC 1A3LL 1ACYH 3IXTA 5B8CB 1JN6A 3MRBB 4N90E 4JN1L 4AENA 5DD0L 3B5GA 4G6FD 1ZSDB 1R4XA 3MJGX 4ZW8A 1OPOA 5CFAA 1AHKA 2FX7H 5KYWB 3P4LA 2Y25A 1JF6A 3DK0A 1NFDE 4YVNA 5C6TH 2WMPB 4U4IA 4ZDHA 1T20A 5LG6A 4R84A 1OGTB 1WEJL 1QD0A 4N1EA 3PWPB 4ZYKA 1HXYA 1S7XA 3D85A 4YHKL 1T80A 2DLTA 4L9LB 1KPVA 3MA9H 4LLUA 1XQ4A 4D3CL 2HT2C 1QHPA 1MELA 3GSNA 2FBOJ 4NUQA 5IROD 5EEYA 2VQ1A 4PRPB 2FBJH 4N2EA 3PY9A 5SV4A 1OTSC 5AW3B 2JKJA 3X12B 5IOPA 1I1AD 2XN9B 3FT4B 3L7FA 2ZNXA 4LLVA 3N9GL 3C60B 5F71A 2BS9A 5MP6H 1SJMA 5KSBB 1PCSA 1JNLH 2B3IA 3QIWC 5J8OA 5K9QI 4MAZA 4OIAA 5AKSA 4PG2A 4ZT1A 5FW6A 3NH7L 3QI9D 3FUHA 3OMZA 4KRPC 5IK3A 4J3OF 4L8BB 1N2RB 1PFCA 2OR9H 3Q5TA 1P84K 5I1CL 4IRJB 4JQIA 5IVXA 1T2JA 5KSVA 1JPST 4AYGA 2A9ML 3MBEC 4JFZL 5E5RB 4Z7NF 2EVIA 1ZKAA 1KT2B 1U8NB 4JVWA 1G6RA 4JJ5A 1I9IL 4YEFA 1AZBA 4IMKC 1A9BA 1JAEA 3BHBA 2LLLA 3GC3A 2QDWA 4YXHH 5C8JA 2OW7A 5I1KH 1K4DB 4YFDB 3HR5B 1J10A 2NPLX 5AYQA 1VB9A 1G7LB 2PR9A 3QIBA 4HPHA 3C5SB 4TUJA 5FUZL 5FB8A 5F88B 5J56B 2JKXA 3PJLA 5JA8B 1CLZH 2E46A 2XXMB 4AQAB 3RVVC 3L1OH 5BW7C 5HHMB 2JXMA 4XB8A 3KGUA 5DS2A 1M6OB 3MLZH 2LVEA 2HG5A 3UBFA 4HSCX 1NWOA 2PP9A 1GMIA 4HK3N 4MA3B 3V5DB 1F3DH 5MENE 3WIHH 4AL8C 2AAVA 2OJEB 3EYSL 3N50A 1F90H 2Q5BA 1TTUA 3WIFA 1Y07A 3I9GL 2P5PA 1QPXA 3LOWA 3RE0A 4F20A 1TQCC 3FU7A 3ETBF 3UTSB 2ID5A 3U7WH 4O51A 1RMFH 1ZVSB 3SQRA 1I7TA 1NIBA 1T2QH 3MRCB 3V2AR 4BSWB 1UCBL 5CZVL 2VM9A 2GITB 4X80H 2JF1A 2Z1KA 3N43F 4M48H 3CLWA 4AEIH 1E6OL 2TAAA 4UT6H 3MYJB 1QLRA 3QWQB 3BIBX 3T0EB 2OW6A 3HC0B 4Q6IB 3WU1A 2W07B 3VYOA 5BXFA 2B1HL 2OXGA 2VDOL 5EBLA 1OPGL 4YDJB 2CLRB 3QUZB 4ZFFB 3W56A 4K3HA 1A7NL 2J8OA 1XGRB 4EVNB 4N2CA 3HUJF 1LDSA 1SJHA 4GAYA 1HU8A 3Q8AA 4JPWH 4N2OA 4WHYH 3HRZB 4Z1PA 1J9SA 3QCTL 5IQMA 1SJXA 1K3IA 4OD2B 1RI8A 2NY7L 2VDLH 3OAUL 3OZKA 4N26A 3U36B 3W2DH 5BV7B 1NSNH 2H41A 3WE1A 3HS9A 4U1GC 4XPAL 5BS0A 1F2QA 4I7ZC 1CGSL 3LNGA 1SXBA 4ELME 3MRIA 5DTFA 5AENA 3V9FA 2VITB 5F9JB 5I1LB 3NJKA 5ELIA 1VZIA 2Y69B 5CD3A 2DYRB 1IIKA 1AFVH 2OJZH 3QEQE 4JPKL 4JZOB 2F8OA 4P5SA 1SY6L 3VA2C 4QHKI 2VLLA 1OP3K 3QRLA 2DAVA 3GSVB 3V0JA 3JT2A 1P2CB 5ECGA 5KYYA 4R0LB 5HYFA 1N6QH 3VXOA 4WUKL 1KB3A 4H88L 2FWSA 2YBRA 1UM6L 5BQ7B 3IGLA 3AC0A 4KAQH 5D7LB 3QHZL 1KCBA 1X5IA 4JM2D 1CZ8L 3BO8B 3JWNG 1IAIH 4FG4A 2A99A 3VRIA 25C8H 4NQDA 4U1NA 1ZVYA 4XBEH 4MNQB 4L4TB 2VB5A 4UIMB 3ZDXE 3CDZA 3VGHA 5DVKA 4WNQB 3MCLH 2W80C 4E5XA 3AW5A 2V8LA 4OZFA 5F6IC 1T3FB 5CGYC 4U1SA 4UQAA 3S3CB 2X4OB 1CGYA 4MMZA 2H45A 3PQYB 2D2CC 2SODB 4MQXC 3CSBA 3PHOA 3UYPB 4J3UA 1MFNA 1FLRH 3QZBA 4CMHC 3QZWB 2J12B 4QY8B 5B38G 4J8RA 4GRMA 5CINH 1KIRB 4OW6A 2A4EA 1OSZB 3TWCH 3KWTA 5C09B 3ERXA 2PF6A 4IBUA 2H1XA 1U8MB 4N8VB 4RAUA 2JJTA 1JGUH 4JM4L 5DMKA 2CUMA 3FOLB 1OVZA 1S7WA 2DM2A 3OMNB 3EJUA 4MDRA 1PLCA 4WGWB 3ARFB 3VXRB 4RZCA 2BWIA 5L4MA 4MZRA 5ICZB 3SKUD 4JRXD 2UXFA 1ZTXL 1SM3L 2DMBA 3JTTB 1MDAA 5L6YH 3TV3H 3RZCD 5B3SB 2WXFA 5F9AC 4X6CB 3SDAB 2AEPL 3L5WB 4KY2A 4AVJA 4FRWA 4UM8A 1M1XA 3CBRA 3RTQC 3L3OC 4GRWB 4M6NH 3H8NA 3IJHA 1RK0B 3RWDB 3JXAA 3HZYB 3SYCA 2B4CC 4ZFGL 3MBWA 5FGCE 3TCXA 3I75B 3IBEA 1Q1JL 3S34L 4FYSA 2UXVA 1TNMA 5SWQB 4WHTB 2ESVB 4UCFA 5HGGS 4YDLB 1SXSA 5CEXA 1CDBA 4DVRL 1YO4A 4P2OB 4ZMTA 3ZHNA 3QYCA 2R29H 4I77L 3WJJA 2V7HA 1WF5A 3W9DB 3LN4A 4DAGH 4FJZA 3D9AL 4F9LA 4U6XA 4LCCB 4FFZL 4KKPA 4UQCA 8FABB 4Q74A 4OGXH 5C0FB 2NLJB 2WBJA 2IQ9H 3BKMH 4EOWL 1DHKA 3E0GA 2PETA 2B39A 5EDXA 3K2KA 4PJDE 5KYXA 4NQVA 3B9KD 1NQBA 3U7YH 2FD6L 2HJKA 3QQXA 3SDDC 5AD0B 2OCFD 4F8NA 1UKSA 3GBNH 4BFIB 1QVOB 3GUTB 1PZ3A 2VRKA 2OM5A 2Q87A 3V10A 3T08A 5JYLA 3TYFA 1QFWI 3VFWA 2WK2A 5MHSD 1IC5H 1DQQB 3AU1B 3DO7B 3EIFA 2HVJB 4X0NA 3D39E 4Y1TA 2CLZA 3QXDA 1ASPA 4DJMA 1DVQA 2HUHA 4H8WC 3FK3A 2V2XA 4K4KA 2R8SL 4JAMA 1OAKH 5IHZA 5DQ9B 1FIGL 2WZ0A 1DZBA 1KB5L 2FYYA 4LDOB 3O3AB 4NP4L 2P7TA 3WKQA 5A6MA 1PEWA 4KZCA 4UBDC 2E7HA 3FRPG 5J12B 3GXMA 3TP4A 5IQ7H 3SE3C 2Q10A 4Z7QF 1MRFL 5KSUA 3QJFA 4LSSL 3UP1A 3J2PA 2IOMA 4JDVB 4GUPB 1M1SA 1IEHA 1MCNA 4PRDB 4UV7H 1U3HB 2V7NB 5CN2A 1W0YT 3MLSH 2NSMA 5CCKH 2XQ0A 2B77A 3BIAX 1PZBA 5CNHA 1FFOB 1AC0A 1TZGL 5IMOB 5BOPA 1EUTA 2V0AA 1ZDSA 2RCSL 1S9XB 4LGRB 1ZCRA 4UT9H 3RKPA 2EDJA 1MPAH 4PBVC 4R8WH 4PJ8D 1FNLA 4IOFC 3K2UL 4PJ5D 1P4BH 4F58L 3VH8G 3L1GA 2J6WA 4IRZL 4OQ1A 4NZ8A 4BA8A 2XACC 2Q1EA 3VQLA 1ZWIA 4AIZB 5FFLA 5D5ME 3PHAA 2OL3L 3FQTA 5LBGA 2EEXA 1EGJL 2H2PC 1HFUA 5HVGB 3VUAA 2J88H 1KEML 3PP3H 2AVGA 4WF7A 4Z76A 3F7VB 1PEZA 1EO8L 4RLDA 3HS8A 3QAZB 4IDLA 3EYQD 4OGYL 3VXUA 1EK3A 5LUMA 5KJ7E 1FFNA 5IV2B 2G60L 3TBTB 5K9OA 1I4FA 3QNYB 1NICA 4PY7A 1L6XA 3SJVA 2R39A 3P40A 1CLOL 3RVXD 5ILTH 1I8MA 1CL7L 2D7MA 4XNXH 1W8EA 1M3JA 4JFDD 5B21A 3ATFA 1UKQA 4KH2A 3F12A 3MRMB 3SN6N 1NUFA 4J1UA 4PJIB 4Y4FC 5E2WH 1J0KA 3IDXL 1J9QA 5DWPA 4N0UE 4CW1B 4F7MA 3L7EB 1QSEE 1G1OA 2W8CA 3N04A 3D25B 4M5TA 2WD0A 4J4PD 4TQEL 2GSGA 2MOGA 1T6VN 2IOIA 3NRQA 4X7TA 3TFKC 5I6LA 2H9GA 3BAYA 4N0FB 3AAZB 5AW4B 2BERA 1T2XA 4K23H 1GY2A 4WDIB 5I73B 3O8XA 1Z9PA 3FS9A 4K8RC 5CSBA 1BDYA 5HHXL 3AGWA 2AFNA 2Y6SD 3BH8A 3QJSB 3DX9A 3BEWB 1PLGL 4QCIB 4IBWA 3PDOB 4KK5C 4CJ1A 1A8JH 1BQRA 1CO1A 4M03A 4EDWL 2CBMA 4LHUB 4N3TA 2H32A 4XPGH 3SGKA 4F15B 1A7OH 3SQBB 4JKWA 5DSCB 4TULL 4ZSOB 5HVHB 3E1F1 1JV5B 3CHSA 2MHAB 4W70A 2E7LA 4ZMWA 2LAGB 4JPQA 5A2CA 1V7ML 1LNUB 4LAJH 4K5PA 4UMSA 2Y9RT 2ZD0A 3STLA 5CGBA 2CO2A 3BGFB 4PG2C 4K07A 3K6SA 4FJYA 2MWCA 4JHVA 1J8RA 1NGZA 1MDTA 1R3HA 3QJOA 4EN3A 1MNUH 2I60H 1UA6L 3KPMB 5TFSH 2VXQH 5EO1A 2XNAA 5DK0B 4ACTA 4JPVH 4GAAA 1U8LA 2OCCB 3EJZD 1QRNA 3PHQB 4HUNB 1JRHI 3DBXA 2YD9A 1R5WB 3RDTA 3VACA 1UM5L 2Q7YB 4GW1B 5HHNB 4JMXA 2FUQA 2AJVL 5AYUH 3OQRA 2GTWA 4Y9FA 4TPRH 4GQ9L 3QIBC 1G0XA 1R3JA 4GFTB 2HX8A 1HSBB 2VISB 3BAJA 2CH8A 1NIEA 3ZYOA 1ZOXA 3CZSA 3TZVD 1FAIH 1WBZB 3GXNA 1TVBA 1A1OA 1CYXA 1NFDB 2N3JA 2O5XH 2YAEA 3RIFK 1Q0XH 4ODXB 3BMWA 1HEZA 2LU7A 2B5IB 2ZUXA 3AACA 2CM6A 2N7AA 1EHLL 2VDMH 4KROB 3D69B 1S78C 1TPXB 4LF3A 3ZJAA 4UNIA 4ZAKB 2BOLA 5EBGA 2FGWH 2XZQH 1SQMA 3KLQA 3VXMD 2E6PA 2A74A 2DQEL 4OJDH 3LN9A 4PP1C 5DU7A 4AKPA 1G9NC 4U3SA 3GZOA 1KV7A 4MAUL 1CICA 1EQWA 3KPOA 2DQGL 4HU2A 3U9PH 4FQPA 4LNVA 4DT2A 2C9RA 2IDCA 4YSSA 1NC2A 2AS5M 1I7ZB 3UTZA 3CHRA 3R8QA 3ZKND 2IQAA 3APMA 2PXYB 5FW8A 5PCYA 3CZLA 1BQLL 4BV1A 5L0QC 1LE5B 3QUYB 1TQWA 2KLRA 3UC0H 4KBPA 4R4BB 3M17A 2A9CA 3FKUS 4NM8H 4CVXB 2EDTA 3CFEA 3WD5L 2OMWA 3ZMEA 5ENWA 3S35X 5I19H 1EZUA 4UQDA 4Z7WA 1LO4H 2H0EA 3D12B 3M1BA 4PJ9D 3WKPA 2Z92A 1T1YB 3FONB 3I6LE 2XC8A 1YEJH 1ZHNA 1Z9NA 4FQLH 3ESUF 2AEQH 1CK0H 1C16A 1EFXD 2QADD 3RNKA 3HN3A 5E7FA 2KH2B 1J18A 2D73A 1IBGL 1F2XK 1JP5A 1BZOA 5AVVB 2VE6B 4IRSB 1QFWH 4MS8C 1AI1L 4ABUA 5MENB 3FJTA 3X11A 4W6WB 1XD1A 5F7DB 3UAEA 2EIBA 4Q14A 3EYOA 3VFMA 2MTAA 4G8FB 3FNKA 4R3SA 1G4RA 2X7LA 1I8AA 1XSKA 3KLAA 5AKVA 1ITCA 3HAEB 3AG2B 1C8QA 4NZUL 4AVHA 4HSQA 1UURA 2VLRA 4I4WB 1HHKA 2Y7NA 3Q6GH 3K0YA 4NIYE 1OP5H 1TNNA 3QP3A 2C7FA 5JO5B 5C7XH 3KPSA 4MMZC 5GRUL 3GTVA 3X17A 1GYUA 4P5MA 1N10A 1DUZA 3SKNA 4AV5A 5I1EH 1BF5A 2HLAB 2NX5E 2EIEA 4Q58C 2ZUVA 4I0CC 3QORD 5AW8B 3FUKA 2VM3A 3ABLB 4N68A 2A9NH 2BINA 4WVRA 4A7TA 4FA7B 2Z8RA 5IBTH 2VSKB 2V5MA 3O6MH 1MRCL 3O6LL 2JJTC 5JXED 5FK9A 1OZUA 3RTLA 4KZEL 3G6DH 3VGDA 1U8IA 3STBA 4ZFOA 5AVXB 4PJHF 2BLFA 5TDOA 3WFEL 4HXAH 1M7IA 4BZ1L 3S0PA 4ELMB 4F1SA 1F6AB 4QNPF 3ZUNC 1MJUL 4LLQA 2UZYA 1ZV5A 3BQUA 1MCDA 4P2QB 4DK3A 4O9HH 2A1WL 1NDGA 1F1DA 5BZWB 1EEZA 4HYTB 2BNUA 1X6LA 2FIKA 2WC7A 3H7BA 2BWQA 4WW2A 4DKEL 2YD7A 2ZCLH 3K6NA 1YQVL 5E8PA 4P46A 5F7YC 4AYFB 3FTVA 1QHOA 2WUCL 3K6IA 5I8EB 2HJFA 4XCYB 1CU4L 1JVKA 3WJJC 3ZDXB 3N55A 1B3IA 3BAEL 4MJID 5C92A 4GXVH 2GUYA 1ZT1A 4OCYH 4F9LC 1E5YA 5HHOA 4XPFH 4ES8A 4L8CA 4XPHL 2LLNA 2MPAL 1P6FA 3FTUA 4IKKA 1KYDA 1HDMA 4GBXB 2WBJC 4OZHE 4PRNB 4JZJA 1BZ7A 1NM9A 3QFJD 3HHMA 4ANKA 2CUIA 2JLLA 5AAMA 4E41D 3FH5A 3U46A 3PIQA 1NC4D 4JM0A 1YYLL 3ZRCC 5JXAL 4AJ0A 1YNLL 4Z7VF 4W9KC 3WO4C 3TNMB 2HRPH 3CSGA 4JFQA 5E99H 4IQHA 3PFQA 5GRJL 3ZKSD 1JIBA 1UYWL 3T3MF 2XYCA 3KLSA 4FL4C 1DJGA 3NJLA 2X38A 4DKFL 3UPRA 1D7CA 2DQDL 3GKWH 1XL6A 2Z35B 4AXWB 1A4KA 2ZUWA 4G9FE 4UZSA 4R5VA 1J7VR 3A23A 2NY6D 2ITEA 3P4MA 3U4AA 5I1HL 2WIIB 3ATAA 5JDSA 3SPIA 3VXSD 2O61B 1W0WB 4JZNA 1YEKH 3DJTA 1WFTA 4GP8B 4N2HA 5EEVA 3GHEL 1I9JH 4UMGA 1G7JB 4PJCA 4ZODA 3LHAA 4YDMA 3PG2A 5FGCB 1KG0B 4OCXL 2N4IA 1U93B 2XWJB 1LWRA 2ZYRA 4C57C 1L7IL 3IETB 2X42A 4YHPB 1R34A 2ITFA 4OJYA 4XTRD 3PNWA 4HIHB 2W0PA 4JN2A 1H8NA 3MV7D 4OLUL 4UOZA 4JFOB 4KHTL 5KVGH 3L3IB 5D7SH 5J13C 4XO5A 4LP8A 4HOZA 5IIEB 3D2UD 2XY2A 3OKEA 3DX4A 5KSAB 1DL7L 3AXIA 4ZUSB 1GPOH 4JO2L 1OAQL 2YXWA 4XNQA 2MCAA 3KDMA 3VJ6A 5ITBL 5DT1H 2GB2A 1BMZA 4FDWA 4S11A 12E8H 5B39G 1JRHH 1UZ6E 3OKMB 3RL2A 3ZE1B 5JHLL 2XA3A 5DHVH 3TOPA 1T0NA 4QXWA 3EJQA 5AUMA 1ZHKA 2WCPA 1ZGLB 2AGJH 2IC2A 2XFGB 2AMUA 1MFDL 1UQSA 1RIUL 1V8HA 1B0GA 4RA3A 4BYHA 4HKBA 2C3VA 4Z5RB 1PZUB 1JPFA 1RZJH 4CKVX 1JBJA 3Q9QA 5T5FH 3BW9B 5JOEA 3ULUC 3D39B 5AZ2L 1BXUA 2GAZB 3NBNA 4GKOA 2X1QA 1Q1PA 4U7MA 1R9FA 2J8UF 5HHPA 1USQA 2ZUQC 1CLYL 3O9WA 2QPUA 5I30H 4WHDA 5CLTA 3VFTB 2WXMA 2NXYB 3WKMH 3OR6B 4G71B 1P7KA 5ERWB 4C56D 2EVGA 3WKYA 1QABA 5L88H 2CBTA 2IDFA 2VDKH 1K5NB 3O3BB 4OLZL 3N41F 1JFQH 1QKZH 2IDUA 2NNCA 2EE2A 3B37A 5K69A 2I32A 3TEXA 1ZTMA 2ADYA 4WUUA 3R7QA 1N4XL 3PJSB 3DX1A 1IKFL 3SD5A 3X3FH 4ZMZA 1LK2A 1JUFA 1E28A 2ZKHL 4MWFB 2WGNB 2F5BH 3WELA 4L2LA 1UA3A 2NRDA 3T0AA 5JIPA 1DEEB 1F6LL 2G2RB 1AOZA 1KCWA 1VGKA 2ZWZA 1DJZA 4D7BA 1E4KA 2EDXA 4RDQF 3QR0A 2DEXX 3ALWA 4PY8J 4ZOBA 2XTJC 5J06A 2CJUL 3LEVH 3O8XC 1Q9OA 5EULV 5JIIA 3OKDA 4RSVA 3LN5B 3LRHA 4JG1L 4ETYA 4HIEB 3ARED 2VJXA 1D5BA 2DQCH 3SGKC 1A6WH 2ICES 1OK0A 2PW2A 1IM3D 2XWBA 3DVGA 2K6YA 4U6HA 3SGEI 4NFDA 2VXVL 2HFGL 5D5MB 3B3IA 2YSSB 3MLUH 4JKPH 5EF3A 1J8HB 4X5WB 2E7LC 4N0RA 4GAFB 1QBLH 5GS1B 2NW3B 4PLJD 1A6VL 2YAHA 3CN2A 4D8PA 2G0LA 4MAYD 2WWOA 4XCEA 3UZQB 2PCFA 4TVPH 3NCBB 3IRZA 3H3KA 4FXLA 4R26H 4EN3C 5C1MB 3D50A 4EPSA 3GS0A 1X5MA 5H4YA 2X3BA 3EDEA 4OD3L 3DYPA 4D9RD 4OUOA 4QHMA 4AW4A 3RDTC 4WEBH 1DDHB 4ZMVA 3W0WD 4N0UB 4CSPA 2PYED 2KZKA 2X41A 2A73B 4BFFA 1QSEB 1LEGB 2CXKA 1HCYA 2QSTA 4Y7MA 3EJSA 5FHAL 5FUOH 4HG4K 3TA3A 4A39A 3IDUA 4AW7A 3MV9A 1SJVA 3QH3B 3OKNB 2O5YH 1N0LA 4ZUUA 2DYPD 4UQEA 5E8DH 1J5DA 4NKOB 3L4UA 3RBGA 5H4ZA 3E2HB 4P3DA 2OMUB 3P0YH 4AM0Q 5BUGA 5E94A 3LRGA 2GEQA 3QPQC 4HT1L 1TU2B 5E1AA 2NUPB 3SDCB 3CMOH 4A66A 3QUKA 4XP6H 1MCPH 1YYCA 4FCHA 3HG1E 1UXWA 4ODSH 5C0IB 3VMPA 3BVXA 1I1YA 5FYLD 4UINH 5F44A 1EVTC 2R69L 4ABVA 4PJBA 3BZEB 1UT2A 5BMFH 4GEIA 3SE9L 2FHBA 4AE1A 2BSBA 2BZ7A 2A74C 3WXVL 2XI9A 1SN2A 5D7JB 4N2AA 1K85A 1CICC 3WJMB 2CDGA 1RIVL 4UTAH 3HNTL 4JFXB 1JK9B 1ZEAH 3E3QC 3OM3B 4IK7A 3X1FA 5HYSG 4FMVA 2DQJH 1P4LA 4TQ8A 2OYPA 1RZGB 5C70A 1KB9J 2Z31B 4TLKA 4GKNA 4PB9L 1C5BL 5IVNA 2UY6A 4HQQL 4ZW6A 1CI3M 2WINB 4F8PA 2HSIA 4XP5H 3UTQA 5JW4N 2B59A 4FX5A 1XDTT 1NFIB 3R06B 4PJXE 2FWOA 2YEZB 2ZCKH 5I18L 1FCCA 3S88L 3VNZA 1V3KA 1DTUA 4DFIA 1ERNA 2ERJC 2YUXA 2OSYA 3HB3B 1XB8A 1H3XA 2GPZA 4IU2A 4X7EC 1MCOH 4ODUA 4MMYA 1KJMA 5KWYC 4M6ML 4AG4L 35C8H 3JUZA 2JJVA 4QTIH 3VD2A 1PBYA 2BM3A 5TQ0L 2QTEA 3VXPB 1YEFL 1CFNB 1IGML 1RURH 2W38A 3KYMA 3NIFF 1N5YL 5EA0H 1NBCA 3TONA 5LCVA 4YHYB 5FFGA 4AYID 4WI8A 4L5FE 2AKRA 1E4XI 2P9RA 2J55A 3AG1B 2F18A 2YPLD 3AY4A 3O2WH 4PTTA 1TF4A 5DD1H 3GXFA 1LE9A 3MO1A 3NZHL 2L0DA 2G3NA 2VZOA 4FHBD 3IF1A 3CPLA 4K7PH 4P8QA 1EANA 3ARPA 3GJFH 3UXFA 1IFGA 1GGBH 1KY6A 1NGWB 3GLEA 3BRGC 3AMLA 4RFNB 4YQXL 3CFDB 3V0VB 3ZE0E 3L3JB 1HX0A 4W9FC 1BJ1J 3FOMB 2VLKA 1TG8A 1NCAH 3X2QB 3LV3A 4Z78A 1GR7A 3DC0A 3S8WA 1A6ZB 2JELL 4IMLA 4Z7UA 2DPKA 5CLWA 5CGMA 3BP7A 2CDEA 1U6AH 8FABA 1TTCA 2VZUA 3PABA 4GO8A 5E2UH 2AK4A 4IS6B 1O7SA 4WO4C 3OXRB 2BP8B 3WMPA 4PRHE 3UAFA 2V37A 3LY6A 2HPOA 1XZWA 2YUZA 1NAML 3S37H 5FW7A 4LLMB 4N3UA 5J11C 2LFEA 3C5ZD 3AS3A 2GABA 2CR3A 1FFRA 1ICTA 1DQDL 1PG7W 1X5GA 5ANMA 4YK4B 4BFBD 2I24N 4PUBL 1JGDB 2EACA 5FYKD 3DOHA 3O4OB 4NYLA 4M1DL 2X4UA 4NZFA 1C1EL 2OMZB 4JNXA 3BQUC 2VZTA 4V2CB 4PGBA 5I0ZA 3T4YB 2V17L 1BFSA 4RVBA 4NI3A 3AZUA 5D7IE 5B8CA 4AKOA 3NZUA 3MRBA 4WK0B 3MRGB 5AB1A 3IBOA 1ZSDA 2DW5A 4QYOB 4WW2C 2RACA 4NIKB 4GG6E 1UJTA 5KYWA 1LYQA 5AOLA 4P46C 5EC2B 5TE7L 2DWDB 3ARBA 2WMPA 1A3ZA 2FAUA 2OPCA 1I3GL 3OXSB 5F9WB 5TK4A 1OGTA 3QRBA 4A67A 5GZOD 3PWPA 2WBKA 5C0DB 1NL0H 4L9LA 2X1PA 1S4IA 2AJ3B 3POCA 4XE5B 1NGPL 4LCWB 3CZJA 3BUQA 4NN6B 4BH7B 2CQVA 4PRPA 2WKGA 4JZJC 3X12A 4GMSH 1EEYB 2XN9A 3FT4A 2NX5B 4KJYB 3C60A 5AAMC 3RYMA 2YXVA 5KSBA 1H8LA 1EAOA 3B3BA 3PF2A 2WCSA 3GJEB 2YAFA 1UH3A 2PTTB 3B2PA 3LPFA 4TRPH 1QTPA 4X99B 3V0WL 4L8BA 1N2RA 1N64H 3TO4D 2YBGA 3TJEH 5C0GB 1XAKA 4GUOA 1OM3H 4HS8H 4UB0L 1NEUA 4JHUA 3P3RA 4UTBH 2VMDA 1E43A 2W9LA 3GD1C 2W92A 3MXWL 1KT2A 1U8NA 3GHPA 2ZF8A 1CVRA 4X7SH 2COQA 5K9JL 4GAGL 2WLHA 2RR3A 4CSSA 4RRPG 4EIZC 4X8CA 3HR5A 2QHRH 4XCCL 4BQ6A 2P44B 5G4NA 3A6OA 4ZUVB 1G7LA 3BDYH 1N5AB 2ZX7A 5F88A 5CHNB 3SGEH 3CNKA 4YX2H 3QG7H 2KZBA 4BFJA 2EKSB 4GPVA 4RH4A 3WFCL 4AQAA 3T3PE 1VEPA 2VDKB 2D3NA 5ADOL 2P45B 2KS0A 3AS1A 1SBSH 4OLEA 3ZK0A 5TQ2L 2GTQA 2R27A 1OQOA 3MRKB 4EKJA 1M6OA 3KGRA 3QSKB 3ILQC 5FO2A 3BUIA 3SYPA 3NFPB 2BSCA 3DARA 4MA3A 2YKLH 3V5DA 4NQCE 3Q01A 3ZU8A 2OJEA 4BGLA 1OW0A 1PD1A 5HP5A 1YLBB 2NY0D 4NWTH 3DKHA 3UTSA 2F68X 2ADJB 2YA1A 4FFWC 3E8VA 5T1DH 3NACH 4MA8L 4OZHB 1ZVSA 4RAVB 5JPMB 3MRCA 4BSWA 1NWPA 2GITA 2WVUA 2XSKA 2EIKB 1W9XA 3BWSA 4PWHA 1B2WH 3WLWC 2JKWA 5E4IA 2AJYH 2ZCHL 3EO1B 3MYJA 4HMCA 2KMWA 2IO5A 2P8LB 4XP4L 3HC0A 4OQTH 3T0EA 1C5CH 3TL5A 4Q6IA 3QDJD 4NBYB 2W07A 1A4CA 2NOYA 4JFYB 4ZFFA 4YDJA 2CLRA 2NZ9D 3QUZA 4HIIB 4JO4L 3V0IA 1FH5H 4G9FB 4ORGB 1XGRA 3EJCA 4EVNA 1B0WA 3BJLA 1T04B 1OP5K 3O9WC 2ZWNA 1P53A 4DW2L 4H8HA 1MWAL 4FA6A 4ZZKA 4Q9RH 4ODHH 3HRZA 1VA9A 1RD6A 3P54A 5IOKA 4OD2A 2IAMB 3HI5L 4R2GD 1KLGB 4TUOB 4JCLA 3U36A 2EC9U 5GRYA 1YVLA 4ZMYA 3EGXB 2VITA 5F9JA 5I1LA 4YZFF 2EO9A 1CDGA 1KCSH 1NOFA 4FZEH 3LPOA 2DMCA 4EO5A 2Q86B 1UB5B 4JZOA 2DBLH 4NB7A 4Z7NE 3PWVB 1GOFA 1QP1A 3QISA 3GSVA 3AQYA 3P3YA 1P2CA 4R0LA 1N19A 5BQ7A 3K72B 3AABA 3FT1A 4RFEB 5I15L 3DI3B 4Y4HB 3F05A 1BEYH 1NCWL 4RETB 5D7LA 1E4KC 4TTDC 1BJ8A 2F9BT 4PI0A 3OPZH 3BO8A 1KPUB 4M02A 3N85H 1LD9B 4N28A 4PHXA 5HYQB 2AJXH 3ZTNL 3JWOL 4JFHD 3EJRA 5CBAB 1E5UI 4MNQA 4L4TA 4EUPG 4A2EA 2XVLA 2X9WA 3QIUB 1AS8A 3FBQA 3ME0B 4UIMA 5HI3D 4B9YA 5AQ0A 3H2QA 4WNQA 1JZHA 1CGWA 1T3FA 2Z0UA 4D0DB 2X4OA 5F7WC 1FRGL 3F6JA 3PQYA 1OSEA 1WTGT 5E70A 3L1FA 1DN0B 3UYPA 4K3EH 1OAJA 4OU3A 2YD3A 3LZFH 3QZWA 4QY8A 2YPKB 1KIRA 1IJ9A 1UKTA 2BVEA 1OSZA 4OKVB 4YPJA 4GI6A 1N67A 2PPDA 3BSGA 2IDQA 5CIPH 5C09A 5D1QB 4TQIA 4WLCA 4YHZL 1OCCB 1U8MA 4KJWD 4N8VA 4YXLH 1E4XH 4HUXB 3FOLA 3K2MC 3V4PB 3POHA 5CLZA 3ARFA 2I7OA 3VXRA 3HA0A 2AERT 3QXAB 4Y5VB 4XMVA 5ICZA 4GXFA 1XSIA 4XWGH 1IGCH 3JTTA 4YHOL 5TD4A 1JFHA 3L9RB 3INUL 5C0RL 1CUOA 4M1CC 4OZGF 4X6CA 3SDAA 3L5WA 2HKHL 3RIAF 1TETH 2C4FU 1TJIL 1IC4L 1IKNA 1U8KB 1RK0A 3RWDA 3HZYA 1F3JB 1T89A 2PNDA 2ZXDA 3E1ZA 1XCQB 2BVPB 2Y7MA 2W9DH 3HUJE 3VWJD 3I75A 1ILSA 1WZAA 3LH2L 5SWQA 4WHTA 2ESVA 2E4FA 3U4BL 3BPNB 5EF2A 4QXGH 2CLVB 1DBKH 4P2OA 1XXDC 3ILEA 1CXLA 1GIGL 3UGUA 3VD3A 2CBPA 2DIBA 2EO7A 3MZTA 3EF7A 3W9DA 5LDSA 3ESNA 3FB6B 2HTKC 4YIQB 3B2XA 3BZFB 4LCCA 2WWKO 3MAWA 4KY1H 2HFTA 3REWB 4DO6A 1CGUA 2P5WE 4KQ3H 4PS7A 5TPWL 3IAQA 4LRNH 5A16B 2DD8L 2NLJA 3N42F 5C0FA 5DUML 2MFNA 4JFDE 4PFEA 3FO0L 1FBIH 2EIMB 5A2AA 5AD0A 4Y5XB 4DKAA 4FE9A 3DJZA 1RJZB 1QVOA 3HG0A 4KVCL 4BFIA 2DYSB 5E6IB 3GUTA 4LIQE 3WTVA 1WE5A 2BSTB 1AJ7H 2Z4TA 3V0AC 3D18B 1DQQA 3AU1A 3DO7A 2HVJA 4J3OH 4UOJA 3M7OA 2PWGA 1A64A 3IJEB 5HJBA 4B0MM 3I50L 2H1PL 1YEIH 2YD1A 3T2QA 4FQ2L 4PBDA 1TJGH 5DQ9A 4GRLD 5I1GL 3IWVA 1LEIB 1W72H 1ES0B 2EXYD 1MG3C 2P43B 3O3AA 1SN5A 2EICA 4MYPA 1RZFL 2AQ1A 2DL9A 1OLZA 2WLJA 4M7ZC 5CN1A 4OGAD 2X28A 1RIHH 2O6PA 3T6VA 1UD8A 3K81A 4DQAA 4B53A 3BT0A 5ID0B 3D30A 3N0PB 2WZ5A 4U1LB 5HGDB 4I85A 3KH4A 3DIDA 4JRWA 4JQXC 3DNKA 4PVBA 1OD7A 1TQSA 2GJRA 4JDVA 4GUPA 4PRDA 3T8XB 4HWEH 4KQ4L 5A2FA 3NSCA 1U3HA 2MRYA 2V7NA 1QTSA 4IJ3C 4R7DB 4F33B 4XP9H 1JHLH 3BGAA 1HEJC 1JDAA 4X4MA 3AY4C 5IMOA 3HG1B 5E9AA 1NCDH 2FO4B 3U4KA 1JNNH 1S9XA 3EOAB 1QYGL 3T6XA 3MLVL 5DD5L 5GJTL 3QBTB 1BXAA 2AANA 3B5HA 3VWKD 1GAFH 2WZPD 2FRGP 3MUUA 4DERA 4JR9L 5JPNB 1XIWB 1BGXL 3SE6A 1WICA 5D2LA 3MKGA 3WY1A 4M29A 4AIZA 4DFHA 3UDWA 5IFHH 5I74C 3TM6A 2NY1D 4NKQB 3F7VA 1RUMH 3M45A 3CFMA 3MROB 4OVUA 3KNBB 4GIAA 5J3HD 2RIKA 5IV2A 2UXGA 3QPKA 3TBTA 1JPTH 3QNYA 2G2PA 5EC1B 2L7EA 3ULVL 5ICYB 4XT1C 1VFOA 4GJTB 3MRMA 1OCOB 4OFQA 4FKEA 5IF0B 4TL4A 4H7VA 3O0RL 4PJIA 2VIRB 2R56H 3HRPA 3WFZA 5HDBE 2GK0B 4CW1A 4HIQA 3L7EA 5H37H 1AP2B 4HJ0D 4L2YA 3VXME 1DJSA 1E30A 3LXAA 3D25A 3CN3A 1MIML 2P49B 3EJJX 3RKDC 5B8CC 4X4ZA 1TQTA 4WFED 3QS2A 3VVWA 3IFLH 5KVDH 2N59A 3CFTA 3AM8C 2ZYSA 4KOBA 5IB1B 4LHJB 4BD4A 4N0FA 3AAZA 3RGVD 4YZWA 3ARBC 1ZVNA 4V33A 4WDIA 7PAZA 3GSXB 2X2UA 2N0KA 4PCYA 1EXGA 2IGFL 3GMOB 3BEWA 4QCIA 4Z7QE 3PDOA 4L9LC 4F7PB 3QCVL 4LHUA 5ADPH 2KLSA 5JMRA 1M9WA 1MG2C 2MKWA 3UAJA 3SQBA 5DSCA 2IPTH 4ZSOA 2Q8AH 1JV5A 2WTRB 3WIHA 4A6YL 5DZNA 1RP9A 2MHAA 1XH0A 1H3VA 3BD5A 5I75B 1IT9H 3WBDA 1HTYA 2ADIB 3X1BA 3C60C 2BIHA 4PB0H 1LMIA 1WIPA 3WG7B 1LO3L 3AITA 2XZAL 3MA7B 4EBQH 5DRWB 4PRHB 1LO2H 2OZNA 2Y24A 4MGXA 2BDNH 5DFTA 3QR2A 5HD8D 5KTEH 3VFUB 3EUUA 1HHJA 4HLZG 4A1RA 1QLEH 1L9OA 3KPMA 2WXPA 3VGAB 2Q6WB 4UT6A 3SYOA 3B5TA 4EZKA 3U6RB 1NFKA 2C9AA 4XWOD 5DK0A 4F2ME 1B2YA 2FATL 4TKWA 2MQCA 4NAJA 2Z7YA 4AMKH 3IDGB 3PHQA 3NIGF 2WLZA 5JHDD 1QFOA 1R5WA 1MEXH 2KHAA 2Q7YA 3MXVH 1SVBA 4GW1A 5HHNA 1U41A 4JEGB 1CR9H 4KK6C 2X4SB 2GI7A 4FYTA 2I5YH 5FKPB 1KYAA 1FFPB 1RUQL 5GISL 1V7NH 3X3GL 1E65A 2OMXB 1HSBA 2VISA 1YAIA 4F8OA 2X1OA 2ZXAA 3GK8H 3NCEB 4GG6B 1WBZA 3TT3L 5EOQL 1NFDA 2ZAGA 1TQUA 4WEUD 4ODXA 4V2BA 3S48A 5KZCB 1SDDB 4XN5A 4E5XG 4OZFG 3ELAT 2QL1A 1A1MB 4FLQA 3D69A 5E1QA 2J3SA 3K0WA 2PCYA 1LEKB 1OW0C 4HXBH 2X6UA 1TYJA 3AWFA 2AHIA 1J0IA 1JZFA 5CJBA 4R4FL 2ZJSL 4AL8H 1AR1D 5ABDE 1UWGH 4KKNA 1BREA 2OYLA 4HAKA 2CO4A 2RQEA 3F58H 4MD0B 1RK7A 5D8JL 5JW3L 4MD5B 3GQFA 5IY5B 1DJIA 4G11A 3T0EC 2ED6A 4PR5B 2XTLA 3HZKB 3FF7A 2IWEA 3ARRA 3HHSB 1I7ZA 1IGIL 4HIXL 3QWRA 3A4DA 3GJFK 5KJRH 4DGUA 3QUZC 4OF5A 4C4KT 2FJSA 5TE6L 3K80A 4CC0A 2PXYA 2F53E 1EH9A 4XVTL 1LE5A 4P2YA 1O7DE 4DN4H 3QUYA 4JM2B 3O6KH 3MRLB 2BY2A 1AHWB 3EOTL 4R4BA 1ADQH 5D1ZC 3VXQB 5GS0C 3BI9X 3HRZC 4CVXA 2EH8H 1OGPA 3FXIC 2EABA 1R0AL 5CIPB 2WQUA 3CXDH 4J6RL 5BV7C 4MJIE 4BIKA 4WCYL 1T5XB 4DNLA 4U1HB 3VFPB 5B1BB 3H9ZA 3HG2A 1T1YA 4O02L 1H8OA 3FONA 4AH2B 4CDGC 2D7OA 3FCSB 3T3PB 4O58H 1JF5A 4RNRB 3PV7A 5I9QB 4NC1E 1Z9MA 2BPBA 3S3SA 4TSAH 4WTQA 5E1HB 3ECBB