3SQBB

Structure of the major type 1 pilus subunit fima bound to the fimc chaperone
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
145
structure length
145
Chain Sequence
EVVNAACAVDAGSVDQTVQLGQVRTASLAQEGATSSAVGFNIQLNDCDTNVASKAAVAFLGTAIDAGHTNVLALQSSAAGSATNVGVQILDRTGAALTLDGATFSSETTLNNGTNTIPFQARYFATGAATPGAANADATFKVQYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/chaperone
molecule keywords Chaperone protein fimC
publication title Quality control of disulfide bond formation in pilus subunits by the chaperone FimC.
pubmed doi rcsb
source organism Escherichia coli
total genus 19
structure length 145
sequence length 145
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2011-07-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 3sqbB00
5FWRA 3ME0B 4AUJA 2XG5B 4LOVA 1KLFB 5JQIB 1KIUB 4XOCA 2W07B 2UY6B 4AUYA 5F3FA 1PDKB 1TR7A 2XG4B 4AVKA 1ZE3H 4AUUA 3BFQG 4ATTA 4AVIA 3JWNG 3JWNE 3BWUF 4J3OG 4AV5A 1N12A 2J2ZB 4XOEA 3ZPDA 3RFZA 1QUNB 1UWFA 4AVHA 1N0LB 5IQOA 5IQNA 5AB1A 4AVJA 3ZL2A 4AV4A 2UY7B 5CGBA 4BUQA 5AAPA 5F2FA 2JMRA 4J3OH 4X5RA 4XOBA 5LNEA 3SQBB 2VCOA 2JTYA 3MCYA 3ZL1A 4CSTA 4XOAA 5ABZA 4X5PA 5AALA 4CSSA 5FS5A 4XO8A 4X5QA 4XO9A 4CA4A 5FLUA 5LNGA 5FX3A 3JWNH 4AV0A 3BFWA 4J3OF 2WMPB 5IQMA 4X50A 4XODA
chains in the Genus database with same CATH superfamily
1HQ4A 4JG1H 4XCYB 1DTUA 4HXAL 3CFUA 1QWNA 1QACA 3BHBB 3FCTB 2K78A 3MLRL 1W6WA 4IRSB 1CLCA 2D7NA 3W0WB 3WYRA 4E41E 1JPSH 4M00A 5EWIL 5E00B 1HSAA 3NACL 2VLKB 4JBSA 2R39A 3FQ1A 5LN8A 4K4KA 1FSKC 2UXTA 5JQIB 4DGYL 3BH9A 3FAXA 2W9DL 3QXAB 3RZCB 1QLFA 1YJDH 1B9ZA 1YPZB 2BM3A 3FQWA 8CGTA 5AYTA 3L2MA 3FQUA 4HLZG 2WCGA 3V4LA 4ENEC 3QDJD 3A6OA 1DVFC 3IXAB 2HZHA 4BQ9A 1IFHH 1YMMD 3EO0B 3NSFA 2IAND 2QMKA 1IEBB 3POHA 1LEGA 3DUUA 2VZ3A 3BC9A 1INDH 2FX8H 3BQUD 4G7VH 4LDEB 2AV1B 3KYAA 4ZMWA 5IREA 1BYNA 4YX2H 1QSEB 4WUUA 2KL6A 1FV1A 2NW2B 1CTNA 2OMXB 2WVVB 4GO6B 3ATDA 4ZMOA 3LB6D 5I74C 1TSHA 1BVNP 3ROOA 2AJUH 1AO7D 5ESVA 3LEVH 3S35L 4MNHB 1PYWB 2DBJA 2HAZA 3W39B 4NNPL 5DZ9A 2HJLB 1E28B 1PX8A 1DHKA 3A6CH 4EE2A 2FBRA 5L4IA 2IOOA 2LT9A 4DP0X 1IAII 4NNXB 4HK0A 1J5DA 4EIBA 5DC0A 3RA7L 4GIPD 3CFKA 1H0DA 1RJCA 2P45B 5BVPH 2XPZA 3ZQWA 1FN4B 3BW9A 1QSFE 4R96A 2KDGA 1I1AA 3L3KB 1IQDB 3JV0A 1OPOA 2DWTA 3BH8A 4A7VA 3RPIB 4LZKA 1UURA 2A73A 4QRSA 1L0YA 3INUL 3UJTH 4XB8A 3KPOA 4EN3C 4PJCB 2BNUA 2VSKB 1YUHB 1ZEAH 3D33A 1Q9WA 5HJ3B 5ABZA 9PCYA 2CK0H 2BS8A 3PE9A 3T1FA 2GPZA 1K6QL 2ZCHL 1BLNA 4PTTB 1KG0A 2QVKA 1S4IA 2WXIA 2ZUYA 4GXFA 3ZE0E 4GG6A 1JJUA 5C6WH 4K2UH 1JERA 3FRUB 3FU7A 1HIML 4QF1B 3ZKMC 3LD8C 3IJEA 2YKLH 1SOXA 1E9QB 5J4MA 1XZWA 3WEMA 1DUZA 4F80A 3C5XA 4LSSH 5D5ME 1YAZA 4HKBB 3AS3A 1QBAA 2H6PB 3BN9D 4UM8A 1V3JA 4L8SA 4KKBD 2B4CC 4Z18A 4OIFA 3IDNB 4RLDA 2Z7UA 5DK2A 1GKOA 1S2EA 2FO4B 5D4QA 1U4FA 3HC4H 1J8SA 2HUHA 3T0XA 4YAQA 5GS0L 4TLTA 2G30A 2QZ5A 2YGOA 4KZDH 5L0QB 5DZNA 5GZNC 1T1YB 4WU5A 3GHPA 5BRZD 4UT7H 3VI3F 3JV4B 1OCOB 4JFZL 3BUQA 1QYGL 4ALAL 4XCYA 3BKJH 2HLFD 4L0ZA 3SOBH 5BUAA 5KSAD 3BHBA 4IRSA 3QEQA 3SO3B 2BSSB 1R3HA 3NCFB 4PRIE 3QUHA 3U4BL 2VLKA 1KZYA 5E1AB 4NUJB 1HEJC 1OGAD 2Z31A 3UEZA 4WW1B 1CURA 2X7LA 2DMKA 3KE0A 1FG9C 3EXJA 4XO5A 1D6VH 3MR9B 3RZCA 3QXAA 3FHQA 1YPZA 1RUAH 4FFVD 4XVUC 3QEHB 4C4UA 2BERA 2J1XA 3EO0A 4PV9A 4MDJB 3MBXH 1AXTL 1REIA 3O4LE 4XCCH 5D7LD 1ZJAA 2AV1A 5D1QD 3P3TA 5TFSL 2YK1L 3DBSA 2PWDA 3MZGB 4PJ8C 4HJIA 4XPGL 4HMDA 4KTEH 2NW2A 2WVVA 1GC1L 2FHCA 2VDOH 2BVTA 2YD1A 3OGOE 4MJ2A 4FP8H 1JXGA 4IDJL 2C3VA 3NZUA 4OW6A 4G59C 1PYWA 2CCVA 3HFML 3MLSL 4MNHA 4XVJL 2MJWA 3W39A 2CALA 3QG6B 5IBUG 2HJLA 1E28A 3F12A 4AV4A 5HVGB 2HRGA 4WHCA 5IBLD 2E6JA 4JJ5B 3VWKB 4AG4L 2Z7ZA 4NNXA 5J6HA 2GI0A 4IKKA 3OAYK 1OO2A 2K70A 5HPOA 1M1XB 2JQZA 1VPOL 3NABL 5JIQA 1FN4A 3ULVH 4XBMA 2NY2D 3HR5A 3L3KA 2Z64C 3LX9A 4PS4H 3D50A 3RY4A 5D2LE 2GITB 3RPIA 4N87A 2EEBA 2EE0A 1G6RB 4PJCA 1KCVH 2XETA 3BDYL 1RUKH 3UAAA 3KWWB 4QNPF 3T2QA 1JGUH 1IARB 1S7TB 5CUSH 4U0QB 1JFHA 3FUJA 1KC5L 5KVFL 1OP5K 1IBGL 1WBZA 3FRUA 1B4JL 4QF1A 2ITCB 2NNAA 3C8KB 5A2CA 1T3FA 4DKTA 5L0QC 1E9QA 1SJXA 1VEPA 1UJTA 4MCNA 3TZVD 3O6FD 1AOZA 3DNKA 4HKBA 4UF7C 2H6PA 5HHXL 5CLWA 1JP5A 2DM2A 3SO3C 1I8MA 4HC1A 3GXNA 3IDNA 2NY3B 4HPYL 2FO4A 1MREH 5HDQH 4YHLL 4HZ1A 3EZ8A 3IDIB 4U33A 4R8WL 3GSOA 4JDZB 4WHTB 3DLQR 3HMXL 1BVOA 5DMYA 3QZPA 2OV0A 1T1YA 2BNRE 4PWGA 3JV4A 2CHZA 4HF5H 1U30A 4WWKD 3GB7A 3FU0A 2EJ1A 4FLQA 1TVHA 1UWGL 1SN0A 2R2BB 4JFFA 3Q05A 4XWGL 5D1ZC 2BSSA 5INCA 1ZIBA 1F58H 4GIAA 5HDWA 4LHUD 4KY1L 5CJBA 1BZ9B 4MSWB 5HYJD 2WO2B 4OF6A 3MR9A 3VMPA 2DJUA 2P52A 4JAMB 2R2HB 2EDQA 2JJTA 3KWXA 3K4ZA 4MXWL 5DS8A 3OVUB 5IQ7H 4ZMPA 4MDJA 5FK9B 4IDLA 1KJVB 3K0YA 1U58A 2WVTA 3ABLB 5EU6D 3OGCA 3VWKC 5I1EL 1M57B 3EKCA 1S7QB 1XGTA 4FF9A 1GA2A 4PSRA 5SX5H 5BVJA 1N7ML 3FFDB 3L54A 1PZBA 4TTGA 1Q72H 4GSDL 1N6UA 2AI0L 3NIDF 4WDIB 4LBAA 4KXCA 1KIRB 4ZPTB 4O02B 1E67A 4AT6A 2X2UA 3MLZH 3PWVB 2VDPB 1A6PA 1QHQA 5ID0B 2AV7A 3UIZA 4NWUH 1QI3A 3C6LA 4JJ5A 3ZYIA 4BQ6A 3MCYA 1DLHA 4FEMA 3AGVA 1QSFB 5GZOD 4A6YB 1O5DT 1RJLB 1ZE3C 1LK3H 4R90H 1M1XA 1YECL 4N8PA 2CRZA 5GJSH 1FFOB 2ZNXA 3NIDE 4R2GC 4A38A 2VM3A 3DHMA 3FTSA 4M8VA 4U1NB 5IEKA 3HG0A 4G6ML 3FH8A 3UTSE 1I8LC 1A66A 4M93B 2BC4B 3AT0A 5DMKB 3G5XB 5M94B 1NGYA 3JWDL 4XP1L 1CDUA 5D9SB 2HT2C 2GC7C 1AD9B 3MRFB 5CR8A 4BE5A 3HHSB 1S7TA 4WI3A 2MH4A 3ARUA 3RKDC 3EFDL 4UILL 3NA9L 2QV2A 3WNMA 1MI5D 2NY3C 2G5BB 1BZEA 1CDYA 3NRQA 1EHLH 1N8OE 3ARGA 5DGRA 4ZQKB 3KPNB 1HT6A 3S37X 5HYEA 2ITCA 3GSUA 4UT9H 4AUJA 3C8KA 1CG9B 1DQIA 1YY9D 3H4FA 2XV2A 1QI4A 2JQMA 5TF0A 4IBUA 2WN3A 4I3SH 3MVSA 4PREB 1HYRC 3O6LL 2VL4A 3CLFH 2NY7L 3IGAA 1FHGA 3AFLA 4KNTA 2H2SD 1CFSB 1J0KA 3QEGH 4NBYB 5MEQB 1QABA 2ZWLT 1Y6NR 4I85A 1G7IB 4IS6B 3UGXA 2WK2A 1MJ8H 2C7UA 4XP6L 2RGSA 4JDZA 5E5LA 3CVHH 4WHTA 1KJ2B 5E70A 5CZVL 3IRZA 4M8QB 3S37L 4JG1L 3IU3A 4PD4J 3N91A 2R2BA 1VEMA 3QAZC 3VXPA 1WZ1L 4YEFA 5L8LB 4MXQC 2WQWA 1N12A 1HSBA 3CVCA 4EOWH 3DOHA 5BMFH 1AANA 1TO5A 2Y36L 4BFRA 3VI3B 1P0SE 1BZ9A 4YHIB 3HE6B 1ZD6A 1CL7L 4ZTEA 1QUNB 3P40A 3SD5A 2PCFB 1JD7A 1YJDL 5C2UB 4JAMA 4Z7UA 2R2HA 5DJXA 4HJ1A 2WQAA 4Y4FD 2ZXBA 1XGYL 1YEEH 4O2EB 4YLQT 5FK9A 3PL6B 1K5WA 4AE1A 3LKSB 4JY4B 3V4UL 2VC2H 3U36B 5J11B 1KGWA 1INDL 1OPGL 4Q6YA 4FXGB 5GGVY 4JR9L 1S7QA 5E8NA 3EH4B 4UTAL 2FB4H 3IYLW 2H26A 5J6SA 3FFDA 4OUOA 3OPUA 1MG2C 1XAKA 3H55A 5IW1B 5EF0A 4N25A 4WDIA 5D7HA 3T77B 4ZPTA 1CUOA 1KIRA 4O02A 3VFMB 4GSUA 4E9VA 4P2RE 3LEVL 5EC2B 6PAZA 2PYEA 2XZZA 3CDGA 4GI6A 4PG9B 4X5LA 5ID0A 4M93C 1JVLA 1WWWX 1RZ7H 1IM3B 3A6CL 4KJQC 2ATAA 1T0OA 5I9QB 3KPLB 2NNRA 4FHBD 4FTVB 1XCTB 4Y19D 2A77H 1M7DB 4A6YA 3PWLB 3CZSA 2X6VA 1BPVA 3DHJA 1WDAA 3BLKA 2GTWB 2R51A 3EJUA 3QIWD 4PP2B 4JQXC 4U1NA 1PTZA 1SYVB 2HJFB 3ZDZF 3I9GL 4LQFH 1SLWA 4E9QA 2DDQH 2BC4A 1QPPA 3UJTL 5DMKA 3LNEA 2MEJB 4ZMNA 4F9LC 1WGVA 4BWWA 1ZEAL 5DQDH 1WCQA 1HCFX 3K91A 1AD9A 3CSFA 4TNWF 4UDTB 2O5XH 2VMCA 1KCRL 3HHSA 2CK0L 2W60B 2CRMA 4BA8A 4AGPA 4LNRB 1OALA 3J2PA 1JGIA 4ZQKA 1PF3A 2ARWA 4OU3A 3U2IA 2AQSA 4BFJA 1Z6JT 3QAQA 5I1HL 1WD9A 3QFJB 1AI1H 3GKZA 4QAWA 3SGKA 2C3HA 2XWZA 3F64A 4PREA 5ERWB 2EDBA 2Y4SA 1ZA3B 1WZAA 2ADIB 4NENB 1ZTXL 1CFSA 3V6OA 3Q13A 5MEQA 5HXMA 1GIGH 1G7IA 4IS6A 4U1LA 4MX7B 4XPAH 5FYJH 4AKOA 3F84A 2GTQA 4QRUB 8FABB 3HE6C 3F6LA 5J6GB 4L1BA 1KJ2A 3P69A 4YS4A 1I9EA 2BSDA 1ET5A 3FTVA 4M8QA 1JPTH 2BXZA 1OP4A 1TETH 1SXBA 1JBJA 1QLEL 2C3XA 2DM4A 2IAMA 2EVJA 2PW2B 4GQQA 3PL6C 4X4KA 1RVFL 3CC5B 3I50L 3VW3H 3PAYA 1IC4H 2XKUA 1JSYA 2IO5A 2BIMA 3VI3A 3VXQB 4YHIA 3HE6A 3NDYE 4MS8D 3NCCB 5LJYH 3SGJA 2PCFA 2NY6C 5DMIH 4ADGA 1DVTA 4MJIB 3QUYB 5C2BL 1T4WA 4HJSA 3H85A 5D72H 3I02B 1IRAY 1A6TB 3OPZH 1MFEH 1E5YA 2SODB 2XJKA 2WBJB 4O2EA 1PBYA 3BLPX 5LNEA 3UFIA 3LKSA 1HXMB 2WVUA 4JY4A 4OCLC 2DQHL 3U36A 4KK9D 4OCYL 3HZVB 4FXGA 4WV1B 2WXMA 4RCAA 5FOJA 1VF5C 4KTEL 5JMRA 2NXZB 5IW1A 4H88H 2VXUH 3UROR 3OKYA 1MUJB 4G7QB 1KFAH 4PG9A 2K7QA 4X5XA 4L3CA 3JYCA 1A4KB 1IM3A 1RP9A 5DVMA 4IRZA 3KPLA 4PJ7F 4FTVA 1XCTA 4MQXD 3NIDB 2FSDA 1M7DA 1RJYA 1WE5A 3PWLA 3NFNB 2GTWA 2J12B 2OSWA 3WJJC 1EDQA 3B83A 4GQ9H 2AXFB 2QPDB 4PP2A 2ZXGA 4HKXB 4PS4L 2CDGB 2HJFA 3B43A 1G1OA 3V6ZB 3B2DC 5IT2H 5F0JB 3PNWB 2TSBA 1XZ0B 4XMXA 1U91B 2DQDH 2E6PA 4LSUL 5DMGD 4APXB 4HK3J 5E8DH 5DT1L 5I18L 2WCPA 3A67L 4HCRA 1MSPA 3RUGF 3E9TA 4OLWL 2I85A 4JO3L 2W60A 4OCNC 1T5XB 4I89A 1TR7A 3QHZL 4LNRA 2HN7A 4TM9A 3ZKSD 5EIQA 3PAZA 4LL1A 1OAZL 2MNJB 3CIAA 1G9EA 3QFJA 4IGBD 3TVMD 3MODH 4H5SB 4BV1A 2MRYA 1F00I 5ERWA 1ZA3A 2ADIA 4NENA 4LMQI 2D3NA 2PCYA 4PYHA 4Q0XH 4JPSA 1OD7A 4MA7L 4MX7A 3APDA 3KBFA 4Z5RB 2WUBH 3GTTA 1IGIH 4C58B 3MJWA 5D93C 4MAYB 2WUCH 5J6GA 4CDHA 5M95B 5D2NB 1T04B 2RTTA 1QX1A 5AVTB 1HH9B 3FB5A 1A6WL 4N0UA 4DN4L 2QFRA 3FOMB 3EOTH 3CCHB 4CVWA 3HG1E 1JGLL 2PW2A 3JWOH 2VDLL 4ODTH 5GS2H 1V7MH 3EOAB 5C6TL 1F58L 2NYYC 4DJMA 4Q9QL 3CTTA 2VDRB 2OYPA 1AZVA 1CD8A 4WV1C 3GRWL 4N1EA 1UA6H 1J0YA 4X5RA 1HKLL 3NIGB 1IGCL 2E7LA 2FCBA 2J3SA 2NXZC 2VSDA 3LVTA 3BUYB 4KV5E 4MJIA 3QUYA 4S1QH 4B0MB 1YEGL 4Y4KB 5EF2A 2MCPH 4IKJA 2JJSC 3THML 3GTNA 3I02A 5DEGB 2ZXAA 2DLHA 2HG5A 5F7EL 2WBJA 4A39A 5IQ7L 1HXMA 4R0LC 4BJLA 3MNDA 4ZMTA 4RMQA 1ZLWH 4U6VH 4QI3A 3HZVA 1G7JB 3KR3H 3QIUC 1X9RA 4F24A 4NC1E 4UBDD 2QDWA 3GMMB 1OAUH 2ZOKB 5KBLA 5IF0B 2KUTA 1Q72L 2CLVB 2EDEA 3EBIA 4GINA 4PJIE 1E7UA 1ICTA 5CN1A 1G5AA 5AW9B 1G7HB 5L9DH 1MUJA 3CGTA 4U1KB 3L16A 3QWRA 4F58H 1G1CA 5EIVA 4ETQB 1NJ9B 5E6ZA 1X4YA 3LPOA 2YBRB 2CWRA 1WF5A 3WNKA 5A7BA 1RURL 1P4BL 1BBDH 4FG6D 4LSRH 4XVTL 4DTGL 2NDFA 5LHDA 2MTPA 3SCMC 4JO2H 4GRLD 5EZOH 1SN2A 3W2DH 4XNXH 1BM3H 3NFNA 3DBXA 2AXFA 2VNCA 1Q0XH 2DMGA 4CU8A 2OXGB 4JMNA 5EZLB 3M46A 3V6ZA 2KC0A 4JB9H 2W07B 3BPNB 3PNWA 1XZ0A 3AMKA 3BWSA 4CL7A 3TN0D 4APXA 1IAKB 3WXWL 1SN5A 1XB6A 1PQZB 4PY7B 2DEXX 4FQ1H 4K9EL 3ZDZB 1FC1A 3T4AB 3IMWA 2HTLD 1T5XA 2J5LB 5E9DD 5IGXL 3TFKC 4JPKL 3CHXA 5DVNA 2LAGB 1T0NB 2IGLA 4XTRC 1M7XA 4PPTA 5BQDA 4UT9L 2WQ8A 1A1NB 4H5SA 1MCSA 2YAEA 3BIKB 4ATWA 3SY0A 1UWFA 5MERB 3HNSL 2D03H 3QEGL 1W15A 1E2ZA 1FIGL 3S4SB 1MJ8L 4Z5RA 4DZ8B 5EC1B 2BWDA 3QGVA 4K7PH 4MAYA 1AGEB 2EO1A 3VYOA 2ADGB 3R1GH 4ZMZA 5D2NA 4S0SD 3DXAA 5C0DA 4AYSA 3LHPH 2O6DA 4GKOA 4FQCH 1OF2B 4X99B 1HH9A 1PMYA 4L4JA 1J5IA 3FOMA 3CCHA 4KRLB 1O9WA 4D0BB 4EOWL 3GM0A 3LEYH 3ALWA 1DBBH 1MCWW 2E9WA 5HI4D 3EDJA 4MRBA 3PXLA 3FT1A 5F71A 3NJKA 5I6PA 4B0MM 3AXHA 1IBDA 5DS1A 2VLRA 3AGWA 1NWOA 4HQQH 5E2WH 3TT3L 2OR9H 5LWYH 2K3HA 2FQDA 1ZANH 4Y4KA 4MBRA 3BPCB 4PJDE 5FM5O 3NCJH 3ZHKA 5DEGA 4AKQA 2WYZA 1KJ3L 4PVMA 4R6UA 1USQA 1MCQA 4NQXB 4OQTH 3T2NH 4ZD3H 4B9FA 2ZCKL 1D5MB 4NLAA 5F9AC 1LP9E 3I6GB 4Y1AE 5KJRH 1MW0A 1G7JA 2A9CA 3SHSA 4GRMB 2FB4L 3GMMA 2ZOKA 4PRBB 3OJDB 5E6YA 3CFEB 5IF0A 4LKXB 4EBQL 1NGQL 1RIHH 1KIQA 1KOAA 1G7HA 3GRGA 3QJOA 5F6IC 3M45A 2OTWA 1BBJB 3X13A 4U1KA 1AD0A 1FYTE 4GRWF 3EHBD 3BPNC 2WYTA 2XV6B 4IU2B 4U1JA 4ETQA 4MRCA 2YBRA 5C86A 1BA9A 5LXVA 1C5BL 2WHVA 2VWEE 5GSRB 4YSEA 4F7PB 3GBNH 3LDBC 5FYKE 5SWZB 2CHWA 1VFBB 1HCZA 1NCUA 5EN3A 5I1CH 3P9MB 2B8OT 4B60A 5AOZA 3LS4L 2OXGA 2ZAIA 5HVWA 5ANMA 4M9OA 1C16B 4ZFFB 1FE8H 4PJ7B 4OQ1A 2W07A 4LQFL 4ODWB 2FJFB 5IROC 4GFXA 1Q38A 1I8KA 4XXCA 1GJWA 1HL8A 2RCSL 3KYNB 5I1JL 1IO4C 3II2A 1IAKA 3RNKB 5DQDL 4XN2A 3WLBB 2JJWA 3HIZA 1PD6A 1SHMA 2PABA 1PQZA 2Y1VA 3P30H 4GMSL 1AZNA 3CN2A 3KH3A 4G5AA 1KGYE 5E4EB 3T4AA 4CUCA 3C09C 2WLLA 3HE7B 3WUWG 1I75A 3UJIL 1ADQA 1JI2A 5HVHC 2CLRB 3IN2A 3WFDL 3U7YH 1A1NA 1A9BA 3RUGB 1PIFA 1AI1L 3WIIH 3ULVD 4OSUH 5GIRB 3BIKA 4OLXH 4M43L 1WSST 2CH8A 3VXRE 3ULUF 1JK9B 2VUKA 4GPVA 4JS7A 3KW7A 5DHDA 1PAZA 5MERA 4WFHE 1AZUA 2WWKO 2YC1B 3IDXH 5J9PB 3NH7L 3WUWB 4K3GA 4ELME 1BWMA 2BSRB 3S4SA 4MNGE 3NCMA 4XPAL 1F13A 1SZNA 3DUSB 3VFNB 1DJGA 2E9IA 3S88L 1AGEA 3IWVA 2ADGA 5IVXF 1UZ8A 2BXYA 2IH9A 2G3XA 3F7RA 4BM7A 2CJUH 4H8QA 2ITFA 1N26A 5I8KL 5AFAA 3L3DB 3S97C 3VD0A 4X5QA 4YSDA 2CK2A 1O7SA 4K5LA 5B4MC 1B4TA 1JXDA 3MV8A 3NFSH 2IFFH 1UUNA 1IE5A 2VR3A 3BWUC 1JXJA 1V55B 2G2PA 2XHNA 2X89D 4LP5A 4KMLB 5FHAL 1P7HL 4E9RA 3FNKA 4L3EE 1OAYH 2WTPA 3WE6B 3UZEC 1AZRA 2CM6A 5AW6B 5JR1H 2R29A 4HALA 2GW5A 1SVCP 1T5WA 3BPCA 3FT0A 2K8MA 4L37A 3OR6B 1HINH 4G7SB 1ZIAA 1MDAA 3AAZA 4ZTOH 5KZCB 3F04A 3U2SB 1DN2A 4D0DB 1SQ2N 2V7NB 2XI9A 4KXAA 4WSJA 4HJ0C 5ECGA 2WYIA 1AS7A 3BKCH 1G7PB 1XD0A 3TA3D 3WCYA 3I6GA 5CBEB 2F5AL 4GRMA 4JKWA 4MZIA 2BPBA 1P9MC 4PRBA 3BP5B 4ZW7A 4F8PA 3CFEA 3EO9L 3EYQD 3UAJA 3V0WH 1KCSH 4BUHA 4H1LG 2Z1KA 2XICA 2PTUA 1IM9D 3MJ9A 4RAHA 5EH1A 1H8SA 1FL3B 3CVIL 1KENH 5FF6B 4YBQC 1BBJA 1KDJA 3VX1A 2FSEB 4IU2A 1JWSB 3K2IA 3B9KA 2V6HA 4X4MA 5L7XL 3QSKB 4OBRA 2DN7A 3ESMA 1EXUB 4LLUA 3D09A 4N2GA 3W9EB 4F7PA 5SWZA 4H1LB 1VFBA 5E4EC 1VLXA 3WKQA 4P3WA 5JZ7C 5DD5H 3FRPA 1U36A 1PNDA 2WAHA 5EU3B 1C16A 1FCGA 5FFOA 1TTFA 4PJ7A 4G72B 3QQ3A 3KDMB 1AC0A 2E9BA 2FJFA 4N2HA 1X4ZA 3KYNA 4ZPVB 1NZRA 4U6XB 2NTSP 3AY4C 4Q6IB 1EGJL 3QFDB 3WLBA 5A1AA 1DBKH 3DDFA 3SDAC 4N2KA 3VQ1C 1J11A 2BMKB 1U3HB 4N5EC 4X4XA 3AG2B 4GP4B 4TQHA 4XCNB 4YFLF 5G5DB 4NCC1 5GRJH 4HJUA 2W65B 4LAJH 3HE7A 2HSIA 5HGDB 5F8QC 3BYTA 2DEWX 1A14H 5JW4N 1IJ9A 4YLCA 5I1DB 3TNMA 1JGDB 2CLRA 3QXDB 1S3RA 5ADPH 5JYLA 3RUGA 2J6EA 4GSXA 3CFTA 1PZUB 2AXGB 1ZT7B 2QQNL 4HV8B 1UZ6E 2BDNH 5GIRA 5F9OL 5GS1A 1JK9A 3EJZC 2RA1A 3CQPA 1VESA 4OM0H 1PD1A 4RISL 3SIKA 4X6CF 2YC1A 4O58H 4RGOH 5HHME 1A7PH 1Y1UA 3O9WD 3BFOA 4FABH 2F19L 4PJ5D 1ETZB 3DUSA 5HJGA 5E08H 3VFNA 1MFAH 4DH2A 3CFQA 1TOXA 2JWYA 4IJTA 2E0PA 4YXHL 3CFDA 5C07B 2WUCL 3WHE1 4XMTA 1J1PH 3HAEH 3ILDA 3UC0H 2AHIA 2GIMA 1D5RA 1DUYB 1YMME 2EIKB 3CVBA 1BP3B 5AOIA 1LYQA 1RZIB 2EIDA 4KJWD 4U3SB 2X9ZA 3L3DA 5T5FA 3WE1A 3HVNA 2HB0A 2QVTA 5HBBA 3JWOL 2R7EB 5I5IA 2CMRH 3HZYB 4NC1C 4ONGH 2ORBL 4GBXD 3C60C 5KS9A 3VGFA 1F4YL 1CR9H 2VDNB 2ZYSA 4H8WC 4KO5A 4F2EA 2IPUG 4WEMB 5C0JB 4PGDB 4LRIC 2R8SL 1UA6L 1UD4A 3WE6A 5CCHE 4S1QL 1FNGB 5B22A 1HWGB 2QFPA 3GTVA 3OR6A 4N2IA 1I31A 4FQ2H 1D9KD 3U2SA 4D0DA 2X4TB 2IWEA 2V7NA 4MDIB 1INQB 1R47A 5AZ2L 1G7PA 4OFIA 1DDHA 3BVXA 4JRXD 4U6VL 5DR5H 3WKMH 3ARDD 5CBEA 1QWUA 2E6QA 2ZUQB 1HAWA 3EH5B 2Z0UA 4P59L 2L7EA 2VDML 2X9YA 4B9JA 3BESR 4MJJA 1FL3A 1IC5H 2YPVH 4NCC2 4YDJB 1GZHA 5FF6A 3JBG7 4OIBA 3BPOB 5JPNC 3SJVA 1TQWA 5DFAA 2FSEA 4ZOEA 1JWSA 3B8YA 3S36X 4OZFA 3UADA 5CMAA 5EO1B 1NOFA 2ZAGA 4XRCB 1D5ZB 5I6OA 3GEWB 4Q6IC 3PXHA 1BBDL 1EXUA 1ZS8B 5J7CC 4C83B 3W9EA 1A4JB 2XWRA 4PB9L 3B2XA 4JO2L 4H1LA 1AGFB 3KLDA 4MLIA 3W2DL 4APQA 4M1GH 1PSKL 4GRWB 3Q01A 3EJJX 4NZTL 4NZUH 1L9SA 3CD4A 5EU3A 4O2CB 2VYRE 2OMYB 4G2AA 1QQDB 2XTJD 1D2OA 4PB0H 1IKOP 3GRWA 3HTLX 4N9GB 5LCVA 4Z7IA 5CP3H 4PWEA 2W9EH 4YSCA 3FH5A 2BLFA 4X8XA 4XX1G 4BFKA 1JZDC 5AVUB 3L4UA 3ZTNH 3KW8A 2QBWA 2DQJL 3CHPA 1FBIL 3U7AA 3ENEA 4PU2A 4XBEL 3S36L 3SBWC 4U1GC 1MW2A 4F7KA 1U3HA 2VLME 1YRKA 5G5DA 3OZ9H 2W9LA 2W65A 3PHOB 2E9JA 3PQYD 5CSBA 5HGDA 3S3CB 4OLUH 1DVXA 1E4KC 1GGIL 3RPKA 5I1DA 3JVFC 5BRZE 4X42A 4MQ7B 2DTML 4J1UB 5EA0H 3QXDA 2A7BA 4UOW0 2IQAB 1G9NH 3QCVH 4KNQA 1ZT7A 4HV8A 3H9YA 1TJHH 3HN3A 4P3DB 2Z9TA 3UX9B 1UB6A 4XO8A 5ID1A 4N90D 1JZ5A 4XVSL 4HJGB 5LGJA 2GSGB 2OULB 3L5IA 1ERNA 2D03L 3FFOA 2FD6H 3FCBA 5AOKA 1MQKH 5GGSY 3VACA 1KTRL 4LLYB 2LAAA 4MA1C 3OHXB 5E6RB 1V8HA 2Z4QB 5DK3A 3PWUA 5J57B 2HH0H 4L1LA 2HWZL 5AL0A 3D2TA 4J3TA 4AK1A 1RZIA 1L9NA 2GEEA 4U3SA 1IC7L 4HEMA 4K8RH 1TNMA 1QFHA 2OSXA 2B5IB 5IVXB 1DBBL 2KI6A 4OT1L 1VCAA 3D34A 3GKWH 2VQ4A 1F45A 1UXWB 2B1HL 3ABZA 4P9HL 4X7SH 3WO3B 5AENA 1CXIA 5C0JA 3MMEA 2EXWC 2DWEB 3DX3A 3H2WA 1FJ1B 1QP1A 4IBVA 1HVXA 1IGFL 2ZUQC 3P0YL 2DQIH 1OHQA 3HVDA 2HFFB 1BZ7B 2UYLB 35C8L 4P46B 3E2HB 1U8LB 1X6NA 1ZRUA 5CILH 5FYJD 5LWYL 5DF0A 3NCJL 4MD5B 1M6OB 3L7EB 4A7SA 3VYPA 5I1KL 4OQTL 3T2NL 4MDIA 2BOCB 4BEIA 2J2ZA 2Q10A 2VWEC 1WAAF 1FCCA 4YGVA 4R84A 1IEAB 3ZO9A 4FEIA 3MBWB 2G60H 3T8XB 1RZJC 5KG9B 2JJUA 1GGUA 5T3ZE 4M7ZB 2NX5D 5EZPA 1PG7W 2HT4C 3PHQB 2F5BH 3D85B 5T33H 2JJVA 2DLGA 4Z3GA 3WIAA 3UO1H 3WJMA 1EQWA 1Q0YL 4YDJA 3L5XH 3ARBC 3ASWA 1E9PB 1UH3A 1ASOA 4EIUA 1DQML 4DKFH 1M1SA 1MFNA 4DUVA 3S96A 4KVCL 4HP5A 1ZS8A 2O30A 3MRRB 4C83A 1A4JA 2TRHA 3K8KA 3Q2VA 2P5EA 4MDRA 5DLML 3SPJA 3JV6B 1AGFA 5DHYB 1JF1B 2BZDA 4UT6L 2A1WL 2AK1H 1NGXA 2CBMA 3U9PH 4JDEA 2BSED 4O2CA 5JHAA 1FE8L 2OMYA 3FZUC 3KNBB 4KKAC 2PETA 4N9GA 4CC4C 3MI6A 5E6UB 2KQMA 4ELKB 1GYVA 2V17L 1GGTA 3FTWA 3AS1A 3U9UB 1SXCA 3TX4A 5I19H 2XXGA 4JKPL 5JW4R 3TO2B 5H4YA 4KVNH 5LBSA 4AGQA 1F86A 5HJDA 2BOBB 5C70A 4Z0XA 3U9WA 2V9TA 5EO9A 3OHXC 4MQ7A 4J1UA 4EF3A 2ZWYA 4BUGA 3ULUC 5KWYC 3U7YL 2IQAA 1KXQE 4LPVA 3N44F 2ENSA 4F8NA 4ZTPH 3SPHA 4OLXL 1ROWA 4HIXH 4OKVB 4AV0A 1XEDA 1JGEB 2GSGA 4NO5B 1ILSA 3OSVA 1PIGA 1J0ZA 1IE4A 5DHVH 5HHVH 2KBGA 3OKOB 5CEYB 4OGQC 3V0EA 1KSRA 4P48A 2E7CA 3QDJB 3ZDWA 1K5NA 1OP9A 4J3WA 1YMMB 4XHJC 3MCLL 3L9RB 5C3IA 2IANB 4LESA 2Z4QA 3BGMB 4GIOA 3TBWA 4X6CB 4P46C 1IAMA 2CJUL 3E2HC 3BQUB 1SLUA 3CN3A 4TQIA 5F1IB 2XG5B 1BMZA 3BD3A 2QL1A 5CR1A 5B8CB 2O6FA 1MFUA 2DQCH 4NZFA 4CVZB 4N0FB 1EEZA 3ATBA 3KEDA 5IVXA 2HRPH 4FD0A 1EO8H 4W6YB 4GAJL 2BHUA 3KLHC 1AO7B 1KLGB 1K85A 5JHLH 2P1YA 4HMEA 5AUMB 1QO3B 4M7ZC 1M05A 1BIHA 1LGVA 5JR1L 4P46A 2UYLA 3KBHE 5LVEA 1DL7L 1GRWA 2AQNA 2FJGA 1HINL 1M6OA 2GSIB 3QR2A 5KYYB 2BOCA 1I4FB 1E5AA 3MLWL 4P49A 5E0FA 1L6ZA 3EDFA 4YXKH 1IEAA 4Y1SA 4HCFA 3MBWA 3V5HB 4W1TA 4BFOA 2J88L 1M2VA 4WENB 5ESQB 3RWHB 5ALBH 5KG9A 3BP7A 1RLBA 1I1FB 3PHQA 5GS2D 4NEHB 3D85A 5F44A 2DQFB 2FEEI 1FO0B 3VXTB 2YBGA 2Z8SA 3SKOB 1QFOA 3LRLA 4NQCA 5BV7L 2HX8A 5BW7A 1O7DE 3BKML 4A68A 1E9PA 2AJZA 1XR8B 2LABA 3F5WB 1XGPB 4QTIH 5CLYA 2XQYG 2PPFA 1BFOB 2IPTL 5H37H 2E3VA 1NPNA 2GY5A 1IX2A 1ZK9A 4NJAL 4CDGC 3GSRB 2IADA 3DUHA 1XMEB 3BPLB 4WW2C 3JV6A 5KOMC 5DHYA 5SV4A 4AEFA 3OM3B 4AMXA 3WY4A 5AAWC 3QUZB 3WI9A 4TNFA 3EGDB 2EYRB 3ZXAC 1IKNA 3O8XC 1SHSA 1BVLB 4BGDA 4M3JA 3R4DA 3NTCH 3X3FL 4H2AA 1KFGA 4B9CA 1JV2A 3ZMEA 1LJMA 2CGZA 5T1MA 3D9AH 3MNWB 4OCSH 4I77H 4ELKA 3P2TA 1IGJA 1FZOB 1IU1A 1UXSA 3PWPD 5A16A 1N18A 3U9UA 3D06A 1MCHA 1VGKB 2F2HA 2A4ZA 1SUJA 2QGDA 1U2HA 4U7SA 1DQDL 3CLEL 3MROB 3K46A 5IW3A 5BS0D 5JLZB 4NNYB 4LLWB 5KSAB 2GC4C 4XPHL 1UM4L 3A47A 1DSFL 3DX6A 4S1SH 1ZT1B 1FUNA 4K3JH 2OCCB 3BQUC 3CFNA 5C0IB 1OGAB 1KPUB 4NCDA 4JHWH 2WSDA 1CTOA 5JA9A 2PN5A 1MCBA 4U6HA 3HFFA 4ACPA 3RIAF 3S3PA 3VO0A 2R0ZL 3VGAC 1ZPLA 3OKOA 1LK2A 2XBDA 3UTZB 4F91B 4W9EC 3QDJA 2J71A 5E08L 1Q1JH 1MFAL 1PFOA 2RJMA 2YR3A 2Q87A 2IANA 4M7LT 3FSAA 3NZ8A 3X3GH 1MWAL 4Z95H 5G2NA 3BGMA 4BELD 4X6CA 3LNHA 3AB0B 3HR6A 3S0PA 1HCYA 4PRHA 3BQUA 5D7LB 5JHDD 2XG5A 5D1QB 5HDBE 5B8CA 4YHZH 4HG4K 1PZ5B 4M29A 4CVZA 1KEGH 3RIFF 4JCLA 2CMRL 1CF1A 2ICWI 3PP4H 3QUXD 4PS3A 4WLCA 3BSHA 1AO7A 4MTMA 3VD4A 4FI7A 4KROC 4A7GF 5AUMA 5C0BE 2AERT 1KTJA 5IB1B 3MLYL 3JWNE 2XWBB 5TD4A 5D7SH 4BSVB 1J88A 1TQVA 5I0YA 4JFEA 3MBED 4QRRD 1E5UI 1PY0A 5KYYA 3VM7A 1I4FA 4HJEA 2L7QA 1QI5A 5ESAB 3FQ4A 2AK4A 2NY2B 1OQXA 5EORL 5ESQA 3RWHA 5EBMA 3ZDYE 32C2B 2X1QA 2EVGA 4LSTH 4TLUA 1I1FA 4OFDA 4TXVB 4MHHI 4RDQF 2DWSA 1GAFL 2DQFA 3IVKB 1FO0A 4XNUH 1MLBA 1R17A 1FFQA 4M6ML 5B1CA 3S48A 3SKOA 6FABL 3VD7A 5HYQB 3BN9C 2YPVL 1HXYA 3ZYJA 4XNBA 1SM3L 4LSDA 4KKBC 3F5WA 4N2DA 1XGPA 2B20A 3LN4B 1CS6A 4ODBD 4AGMA 1BFOA 4LL4A 4JRWA 3U82B 1LO4H 5I6XB 4GP5B 4P07A 4HX1B 1ZLUK 1ZVYA 3GSRA 2C1PB 1QLRB 1FLTX 3PRZA 5FO7A 4N85A 1VFOA 3QUMB 5FKPB 1S7XA 3TZVB 1Q94B 4M1GL 4EN2A 1U8MB 3QUZA 3SDDD 5DI8A 3O6FB 5HHQA 4M56A 4NZUL 1UATA 3S98A 5IOPB 4XX5A 3KPRE 1ZTMA 1ASQA 3EH2A 1LE9B 3N0PB 4G6JL 4JW3A 5KSAC 2YGPA 3RHWK 4N0UE 3GK8L 1BX2B 4PB0L 2VRAA 4LGRB 2BNQA 2YSSA 4G83A 1WWCA 5ETUB 2W9EL 1MW3A 1AYRA 3E80A 1UYWL 1WP6A 2DLFH 1FZOA 2XVGA 5FOBA 4J6RL 4QJ5B 3ZTNL 1AS8A 1MRDL 3PAUA 4LHUG 1CDBA 2WWMD 1N0XH 3GJFK 4PJXE 2BHFA 4N8UA 3MROA 4H26B 5JLZA 5C0AD 4FFVC 5TE6L 4NNYA 2JIXA 5F9JB 4LLWA 2WAQA 4JQIH 4LAQH 1J8HD 3K6NA 4KK5D 1IIIA 5KVFE 1USZA 1FI8C 5EA0L 2G2RA 3G5YA 2H3NB 4X8CA 1G9NL 1N5YH 3AB0C 4LHUB 3EH1A 5C0IA 5HYJB 1OGAA 5D1QC 5L88H 1T1XA 1KLFB 1R3JA 5EBLB 3VD9A 3JTSB 4I4WA 1R4XA 2FD6L 5G55A 4XZUA 1IBBA 3LKQB 1EFQA 3UTZA 4DO5A 3LKRB 1F1GA 1UZGA 5AL8A 4DPAX 1FFPA 3K81A 3N44B 3WTSA 3L1EA 2QVMA 4KJPD 4OD3H 1AQKH 1P6FA 5IBLC 3C8HA 5EU6B 3S5YA 1HX0A 2UWEE 5LDUA 1YEHL 3VD2A 5KJ4A 1QNZL 5D1QA 5F97E 3MX0B 1PZ5A 3B2VL 3SZ6A 1R3IH 2D3JA 1IAOB 3NCYS 3IDGB 2X1OA 4K23H 5B1JC 3GDBA 2Z6FA 1R5IB 4PGEB 2FYYB 3APCA 2NY2C 4X7SL 3P3SA 4MCZB 3DGDA 1VENA 4Y2DC 4ZO9A 3RL2A 3LHAA 5IB1A 3HC3H 1S9XB 2XWBA 1XSOA 2FEJA 1EZUA 2DQIL 1FIEA 4M1DH 2H0PA 4NBXB 3DVIA 4B7LA 2N4IA 2Y23A 4KC3B 4YQXH 4OZ4A 1BF5A 1OCZB 2FX7L 4BSVA 3NDZE 1B2WL 1T1ZB 1TTRA 2VAAB 1N70A 2I26N 1L4IA 2QADD 5DUPH 4FZ8L 4X2UA 4F2FA 5TE7H 1HC1A 3RWCB 5AVZB 4Z7WF 1PZ3A 5EF3A 2OTUB 3MDJA 3U30C 5EEZA 2VUYA 1KV3A 4I2XA 5TPWL 5FIEA 1JCVA 4O51B 5I6XC 5HGGS 4B27A 3UMNA 3WDHA 5JNYB 4GKSB 4X5WB 1AG6A 1UOWA 2P42B 4WFEE 3IVKA 1DLFH 3CXHK 5AW1B 3TEXA 1FRGH 4LGPB 3LKOB 5E6IB 1DBAH 3O6FC 4QOKD 2WLYA 2NNCA 5HYQA 5EU5B 5EUOF 1H9DA 4JM2D 3QJHB 3ZU8A 2XRAH 4HJJL 1A25A 2NUPB 3LN4A 1MI5B 3VXSE 1AJ7H 4Q9RH 1JPST 4DKFL 2PXYA 2FX9H 1UADC 1SNRA 4UUJB 2C1PA 4NN6C 5E94B 1QLRA 3E3QE 2BY3A 1RZFH 3QUMA 4KTYA 2GKIA 5FKPA 3RVTC 3TZVA 1NKRA 2AK1L 1JHLH 3COOA 1U92B 2EDRA 3HC2A 4UM9D 4N9OB 4WWKC 1LE9A 2EO9A 2R0KL 2P43B 4DQOH 1BX2A 1BXUA 5SWSD 2VDKB 4PWKA 2R27A 5I1AB 1TJXA 5CIPH 3JT2A 1MAML 3RVXD 1PLBA 1CYGA 2JELH 2F7IA 2XX0A 3EJCA 4YSUA 5CFAA 5ICXA 3ABGA 5FFGA 1IEHA 3DDGA 1A3RH 5EEXA 1B90A 1RXLA 2VLRE 3M1OA 1I7RA 4H26A 4HKJB 4ZK8A 5I30L 2VM9A 1YZZA 1KN4H 4UTBH 3GMOB 1FF5A 3LNIA 3Q5YA 2G75B 4G8GE 1Z1WA 4YBHA 3K4AA 4XVOA 4TNWK 3TJEH 4LHUA 1LD9B 3D30A 3MZTA 1OP3K 3QIBD 4HHAB 5HYJA 2ZKYA 3D4ZA 1KLFA 4JUSA 4HIXL 2FGWH 2XVBA 1TCRB 2IGTA 5EBLA 2A6DB 3JTSA 2GAZB 4HISA 3MRQB 1D2PA 2V2XA 3LKRA 4YZFF 4UV4L 3D3VD 3MTXA 4GUPB 3JWNG 4Y4FB 1H19A 3TT1L 4FNPA 2CO2A 1T0MB 1F4AA 5JO5B 4ADIA 2F7OA 2ESVD 4AEEA 5ICZB 4OZIA 4ZSOB 4TSAH 2BW5A 1IBHA 5PAZA 1JGVH 1RUML 1BZDA 4FQHA 4RVBA 5DUBB 1IBZA 5E8PB 4B95C 4GOSA 5GZOC 1GVIA 3KH4A 3MX0A 4JFSA 3V2AR 1IAOA 2GJZB 3IDGA 3VD3A 2KHAA 1QFPA 1R5IA 1EO8L 1P6WA 2WLHA 4PGEA 2FYYA 3WL9B 5JHLL 4NQEA 5AOMA 1S9XA 5IFHH 1V54B 3OAYH 1FAIL 1G9ML 1G0DA 1IC1A 1N8ZB 1U8KB 2OI9B 5LQBH 3T2OA 2ROYA 3BJLA 4Y19B 4G3YL 5GZOA 1T1ZA 4LEBA 2OMTA 1I9IH 2VKXA 2VAAA 4XNQB 4MMZC 1JPEA 5IIEB 3EJYD 3RWCA 1U4EA 3QIWB 4YXKL 4TRPH 4DKEH 3KPMB 2NT1A 3CSYA 3QC6X 2VR6A 5ALBL 1U93B 5JNYA 1WFTA 4Y5YC 1VGEH 3QPXL 2GIYA 4X5WA 1YY9C 1F6LL 1W72L 4LVNB 2VZTA 4AYFB 4GQPH 3ZHFA 3LKOA 5E6IA 4TUJB 1SOSA 3C8DA 5EU5A 3L4WA 1GY2A 1J1OH 1Y7VA 3BRFA 2H8PB 1OP5H 1H3UA 4WUKL 2H2SC 2NUPA 1UJ3A 3T3PF 1MI5A 1G0XA 4HAGA 4Y5VA 4DSYA 2QTVA 1NFKA 3T0ED 1FH5H 1I8IB 4YVUA 3O45B 1QVOB 3GLAA 2AQQA 4MB1A 4UUJA 1J9SA 5E94A 3WY3A 1GOFA 4PRPD 1ZJBA 1S9WB 3I6KB 4PJEF 5IHWA 2XA8H 3CH1B 3OQ3B 5CZXD 1KTBA 5FC9A 5CF3A 1U92A 4LKCB 4YUEL 1IL1B 4NKQB 2X3CA 2VN6A 2CNZA 2MFNA 4AH2B 1ZLSH 2AQ1A 4EUPH 3E1F1 4LOEA 3Q44A 2EDJA 4LF3B 3D9AL 4OCSL 4Y1TA 1RERA 2OL3L 2XG4A 2XYBA 5I1AA 2JTDA 1T7WA 3S7GA 2APTA 1AHMA 3A21A 1SQMA 3SE9H 3ZE2F 2ZSVB 3V4VB 1HOCB 3NIFF 2FBJL 3QNZA 4HKJA 1E4XI 1S5IH 1EJ6A 3DARA 4WTXA 1ZGLB 5GS0C 4ZMAT 5K9OB 2IALB 4Y4FC 3DPBB 3FB8B 3WIHH 2EH8H 1T6BX 4W9FC 4ZOAA 3VQMA 1KYAA 3ZOAA 5GSVA 4ODSH 4ALAC 3ESVF 4ENED 1CD9B 4FG2A 5I15H 5JXAH 4HHAA 4R7NB 1DVFD 5C0ND 2X6BA 1A7QH 1A7OH 4PFEA 1BFSA 4OM1H 4QXGH 3U6XS 1AHWC 2A6DA 4NM8L 3VA2C 3NESA 1ZTXE 1AYOA 2WJ5A 1JDCA 3JWNC 5EZIL 2WQUA 4XXDB 2ZX7A 5DJCA 4E9WA 1T0MA 2O93L 5JO5A 2J43A 4Z95L 4IBWA 3AXIA 3FBQA 4ZSOA 4ZUVB 1ZV5A 5DUBA 5B3JF 5EOQH 4K0OA 4YHZL 3BI9X 1KGCD 2GJZA 3R8QA 1JFQL 1S9VB 4V11A 5K5YA 1LE5B 2C9UA 3QIWC 3HI6L 5F7DA 2AKRB 2FQFA 2QHRL 4X7DC 3OTTA 4TOYH 2V9RA 1F8TL 1KDIA 1KB9K 1W16A 5F3HB 1JV5B 2VLJD 1GC1C 1EAPB 4LVNC 3SYCA 4O4YH 3B9DA 3MC0A 5C0GA 4KX7A 1G4MA 5B3JE 4MGXA 3L13A 4Y19A 4NZDA 4F20A 4RBPK 4XNQA 2Y9RT 3ZTEA 4A7GA 5IIEA 2QLYA 4OB5H 5K59F 1T83A 2ZNWA 1GGBH 3QIWA 1JYWA 1NAML 2CO6B 5DURD 1O75A 3O0LA 3KPMA 3LZRA 5CSGA 3U1SH 4M61B 4K8RD 4M6OL 3LSOB 1MIMH 1U93A 4YC2B 2C9RA 2W38A 4LSTL 4DZBA 3VGDA 4PW9A 5SWQA 1UB5B 2QSTA 1MVUB 2WXQA 2DQEH 2RMNA 2WZ5A 3EBHA 4Z7WB 4KQ4L 1NOLA 1KB5L 5K59E 4ANKA 1I7ZA 1LLAA 1MEXH 4WK0B 2R0LH 1P1ZA 1ULVA 2WYHA 5FGCB 4HWZA 3REWB 4WTZG 1R3LB 2OMUB 3KCPB 1I8IA 5A6IA 3QDME 3O45A 1QVOA 4MNQE 4DP6X 4K3DL 1JZIA 2EYSB 5EUOB 3WSQH 4IGBB 3TVMB 1ES0A 1A9VA 2C9XA 4ZMQA 3O3UN 4WGVB 3AREC 3CH1A 1E4JA 2CIIB 3GXUB 4A2LA 5DFVC 2X88A 4BSWB 5AYUL 3ZVVA 4LKCA 3RWFB 1IL1A 4A55A 3U7WL 1WH0A 2DWYA 4JO4H 5I6MA 2RBLA 4NI3A 1UWYA 2RH0A 5GZND 5C0RH 4XMWA 3C5SA 4LF3A 1XFPA 2YSTA 2PO6C 2DLFL 4X83A 5T1JA 3IAQA 2VSCA 5KS9E 1CQKA 1JTOA 1CT8A 4LCVA 1ZGLM 1N0XL 3QRBA 5D71L 3B1UA 1GJIA 1HNFA 3TP4A 3V4VA 4LSPH 3EBAA 4OZHF 1R19A 4BZ1L 5K9OA 2IALA 4LAQL 3FB8A 1EMTH 1HQRA 1K8DA 4HZLB 1XIWD 4OGZA 4QHPA 1KELH 2C1OB 2VH5L 4KK9C 4RAUA 2AJXH 4AITA 2AJYL 4R7NA 4XVUD 3CU7A 5L88L 2F8XC 4YHYC 2ZX5A 3TF7C 4P5TA 4Y2NA 4PI0A 3KLLA 2WP3T 1Z9NA 1I3VA 4PJ8D 5JOFB 1WFIA 1XF4A 1F02I 3FB6A 2OP4L 3BEVB 1AQKL 3ZRFC 3TF4A 5KW9L 2O72A 4EXKA 1LWRA 3HRZB 3A24A 3QZLA 4MQXC 2YA1A 3QJZA 5AEAA 3VQLA 1A7RH 3KBEA 1S9VA 3CFBB 4K23L 2WXJA 4MQTB 1YEJL 4PJ9A 2AKRA 4KK6C 5LLIC 2P28B 4TSBL 2IOIA 4YC2C 1IAIM 2R69H 2F54E 2PMZA 5F3HA 1JV5A 1YYLL 4NSKB 1NUNB 1H5BB 2A83B 2FT7A 3FO1B 3NJVA 3D48R 2WKOF 5M7QA 4ESKA 1RK1B 4R5VA 4W4OA 5EOCJ 5CBAB 4OI8A 4GRLB 5DUPL 4PUBH 3CDZA 3M6DA 2DW5A 1DN0B 1FL6A 4LCCB 5TE7L 1FZJA 3Q43A 4OCXL 3E3QC 2GK2A 3IGLA 4WEEA 2W5PA 3LSOA 2Y6TE 2A2QT 2FWLB 3QNYB 1H6TA 3KXFD 1UB5A 1MVUA 4IGBC 3TVMC 3IFPB 2APWA 1DLFL 1UKTA 5TF1L 3TN0B 3Q48A 4Z7WA 2JKRM 3DIFA 3O4OB 1QFUH 3P3RA 4KPHH 4OFKA 3JWDC 1XF2B 1AJ7L 4IU3B 1B0RB 5E9DB 4BGLA 4HIEB 1R3LA 2OMUA 3IU4H 1E4XL 3TC9A 4F8OA 1CFVH 2QQKH 4YL9A 3GSNH 3FQ2A 4BQBA 2A6JA 1FNEA 5EUOA 4C54A 1JZEA 2UVFA 2WZPA 3TVMA 4EIZC 1RZFL 3PGFH 4XPTL 1ZHNB 1FPTL 3T3PB 5E24E 5JIIA 2PWFA 4WTWA 1JMZA 3RWFA 4GY4A 1LWJA 1GPOH 3DYPA 2QGBA 4JFDD 1MFVA 4WTZA 1OOAA 3RGHA 4C59B 3BEWB 3W81A 4PJEB 5EZJA 4ZFQA 4ANXA 4D9QD 1AGBB 2JELL 4JY6B 3EF7A 4AK2A 5D1ZD 4PS8A 1IMHC 1X5YA 4NJ9L 4PJ5E 1U8QA 2VW7A 4N2CA 5A2AA 1IT9H 4JANB 5CLTA 4BZ2H 4C47A 4R97C 4LCWD 2VXVH 3RY6C 3OB8A 3BDBA 2DBLL 4J8RB 4XNAA 2C1OA 3MKGA 3ZE2B 4GLRH 4QGYA 5F7WC 3TJEL 4ZRGA 3NIFB 3OB0K 3HRZC 2X2HA 4P23A 2AJVH 4LCUB 5IHLB 3ARFC 4POYA 3C6SB 4UBDC 3EAKA 4HUCA 1EDHA 5IMKB 3U4AA 2X44D 1NFDF 2W80C 1MF2H 2LU5A 5AKRA 4L8CB 2I5YH 2LU3A 4YZWA 3RTQC 4UOW1 3CFJB 3LKNA 5E51A 3TONA 3BSZH 4WJKB 5GJTH 2FVNA 2PP9A 3DI3B 3V6BR 3O2DL 1NGZB 3BEVA 1H5BC 1YJDC 3O11B 3SODB 1AQHA 1RIUH 2CQVA 2ZJSL 2H32H 3W5NA 4FMVA 5E9AA 2OJZH 4N6RB 3CFBA 4LCCC 2P5EE 1BOGA 1U8OA 4JREC 4JKKA 1S78D 3BWZA 3LXUX 3OC8A 4KNSA 5HY9A 5DVLA 2B08A 3EHBB 1AXSB 2DQGH 2ERJB 4NSKA 1OW0C 5E9NA 2A83A 1NAKL 1RJZA 5TDOB 3TN0C 3PNRB 4R2GD 3H9SD 4ZUWB 4HS6B 1RK1A 4P5RA 5CBAA 2PYFA 1I9IL 4GRLA 1MFDH 1DN0A 4Z0BH 3I6LE 4LCCA 2HTLC 1L6PA 4Y7OC 4JQVA 2DKMA 1NCCH 3MV9A 3H9ZA 5J12B 2XKNB 2JFCA 1IFGA 3IKKA 3QNYA 4IRJD 4KXBA 5CJOL 5IM7B 1U33A 2EH7L 3MOQA 1G1YA 2VDOB 2F61A 4G8AC 4LEOA 1M42A 3P0VL 3TN0A 5BUPA 3QJTB 1JN6A 3T6XA 3N5AA 4HAFA 1WIUA 3B5TA 1J1OL 4GI8A 3CX5J 4EDXB 1H3WM 3TBBA 1WFOA 2WXKA 1QKZH 2B0SL 3L3HB 3S34H 3TO4D 4E41D 1B0RA 3BZ5A 1NSNH 4HS3A 3BMVA 1FH5L 4XMUA 4GFTB 1JG9A 4X6DE 3RTLA 2BVUA 2YZ8A 3PQYE 4DGVH 2OFQA 5TDNB 4FFZH 1ZHNA 4U1HB 3HG5A 4HWBL 5JIDA 1S3KH 1T66D 4JL1A 3ZL4H 1MNUH 4R5TA 3RL1A 2CKBH 3MUJA 1I3GL 3UABA 5HI4C 3BEWA 4CSZA 1TTAA 3HW7A 4PJEA 3BO8B 4M1CC 2EDWA 3VTTA 2Z8WC 1AGBA 1PKQB 4JY6A 2YZ1A 2XT1B 4MXQD 3SQOH 3AM8C 1OB1B 3GMLB 4I88A 1NTDA 1S5IL 3ILEA 2FLMA 4JANA 4WIQA 1BQHG 5IFJB 5JIKA 1C1EL 3UTTE 4M9PA 3V7AE 4TSCL 4LK4A 1SY6L 3TV3H 3WIHL 4HCIA 4FNTA 4QXVA 3V9FA 1EAJA 4J8RA 3STLB 3LJ3A 2B14A 4OZHB 4YE4L 2BP0B 5IMKA 4QXGL 4OM1L 4X0KA 1VFUA 1BQHB 2IIJA 3QDGE 4L8CA 2ADFH 1A0QH 4PJBF 4AMKH 1K4CB 3FTUA 3CFJA 5J89A 4IBZA 5B7FA 3EHBC 1NGZA 3TL5A 2P5WE 2H6OA 2ERJC 4LOUD 3WJLA 2FLBT 5KYXB 3MV7B 3TA3B 5KSBB 2X2IA 1NCWH 1UXMA 5AZEH 5F6HI 1RMFH 1URLA 4HBQA 4N6RA 1RAMA 5CD5D 3IT8D 1T89A 3RU8L 2WGXA 1IM9B 2CSPA 5IR1A 2BK8A 4IYKA 5FCUL 4N86A 4KFMA 1RZ8B 5J12C 4OIIL 3BAXA 3IBOA 4LVHB 5CD3B 3VRJB 1MCDA 3FFCE 3KYMA 4O4YL 4PP1D 3WD5L 4QYOA 2D7TH 5GGUB 4ZUWA 1AE6H 4HS6A 3HRPA 1PKOA 3X1EA 3KPTA 3IF1A 3HZMA 4L3FA 4JL2A 1F5WA 4X8JB 3QJRB 1HN1A 4X7TB 3CJJA 2XKNA 1CE1H 5DD0H 1YQVL 4HUVA 4KBPA 1UA3A 2VZ1A 4DN3L 4R3SB 2IF7A 4LSVL 1BQUA 3B56A 2AQPA 1H8NA 1C5DA 4PWJA 2X0VA 2RHEA 1EFXD 3EFOB 5GISH 1M71A 4ZW6A 3L3HA 3O6ML 4C4BA 3IDJA 4UQ3B 1MFCH 5FUOH 1Y18B 3QARA 2AW2A 1N4XL 1MJUL 1OSPL 4J2QA 5D7JD 4OJYA 4U1HA 4PSPA 5DEZA 1D5XA 3TIEB 2I9LB 1PVHA 2P44B 3GNML 4HWNA 4YL4A 1A5FH 1CGVA 4CC1A 2ODHA 5C0RL 4DIXA 4PI2A 1FVDB 3O9WB 2VN3A 3WOVA 4KXDA 5FYKH 1SFDA 4PJ5B 4AVJA 3AADB 4J7RA 3UACA 1PKQA 2VZSA 1YQ2A 4EZMA 1YVLA 3BKYH 3FSVA 3IBEA 3MUGB 1OB1A 2PW1B 2UX6A 4LRNH 3EFFA 1JVKA 4MXVF 1WJ3A 1JXFA 5IFJA 4G8FB 4N2EA 4I5BA 3V4PL 4ZMLA 4JO1H 2OXHA 4JFEE 4BQCA 2NY6D 4XCEB 2ITDA 4GBXB 1CK0H 3TA3C 3JYBA 2XJLA 5DZOA 2VITA 3K72A 3L7FB 4TL4A 2G0LA 3MRIB 4OZHA 5EV7A 2X89A 1X7SA 1KB5A 1A1MB 5LXGH 5C0CB 3MU3A 5F93C 3HN5A 2ZOOA 3EYQC 3QDAA 1L7TH 1M53A 4AM0Q 2M83A 3SKNB 5FYLL 4DUWA 4XMVA 4Q7DA 3IS1X 4P4KD 3CVHB 4RGMB 3PY9A 1D9KB 4XC1H 3H3BC 5EBWA 4RWYL 2Q8BL 3MV7A 4HU2A 5KYXA 4JRXB 4NUMA 3QQDB 2W0KA 3V0VB 4ONHB 3FQNB 5KSBA 1NFDB 4ZFOL 2NY1D 3ARDB 5E0QA 4JJHA 4J12A 2FO8A 3QJFB 3EYFB 3PPSA 5B7MA 3KG5A 1J8KA 1A7RL 1GH7A 3VTMA 5ABDE 6TAAA 4ZT1A 3CZLA 1U6AH 3CFIC 1RV6X 3AABA 1XVSA 1IM9A 1NGWB 1XD1A 1OK0A 2W0PA 4JFOB 1RZ8A 4NHUB 2QQQA 1B9KA 5CD3A 3BT2H 3UP6A 5IB5B 5GGUA 1KN2H 2X6UA 3FK3A 3NJMA 1NICA 1L7IH 1ZXQA 4F33B 4K7PX 4WI2A 4H20H 4PUBL 1L0QA 1OSEA 1CZ8H 2VC2B 3MRKA 5T5NF 1RZPA 3WIFA 3HMWH 2VDQL 4X8JA 3X1BA 2H1PH 2XTJB 4Z7VE 2FBOJ 5FYJU 2L3BA 1A3ZA 3TIDA 3UBHA 4NO0A 5F0LB 4HIQA 2F74A 4PGJA 2ZUWA 2BNRD 1JHKH 4OF7A 2JE8A 2DQTH 3K6FA 5DWPA 3QK0A 3PWJA 4LNVA 1J1XH 4ZOCA 4KKCD 3VRLF 4F7CA 2JK5A 4E42A 1WV7T 3EUDA 3O9WC 3PQYB 4PCSA 4UQ3A 4ADJA 4XMLH 5A2LH 2QQKL 4KVPA 1UH2A 3GSNL 2A6KB 1NCJA 1NDGB 4K9EC 5BS0E 3US1A 1AR2A 2OTPA 2AQ3A 4BHUA 4YXLL 1WFNA 2Z65C 3RZWA 3SBPA 4AMWA 3V7AG 3WFCL 4TNVF 3N1FC 4KJWC 3TIEA 2I9LA 1DBMH 1TZHB 2P8MB 3VRLE 2OX5B 4XAWL 4P2AA 1OSZB 1FVDA 3O9WA 4GBXC 3OJVC 2B1OA 2XIBA 3JZ7A 2EKSB 1FGVH 1CBVL 1CC3A 5CGTA 2EDLA 2ZG1A 5F7YC 4AX3A 5GHWL 5GXBB 2DKSA 4C4KO 4DCQB 2YN3A 2K6ZA 3MUGA 3CZUB 3L45A 2PW1A 1FLRH 1RZKH 2NYYD 4BCYA 4ZG1A 2X4QB 2N3JA 3P77A 4RGMC 3ETSA 3ET9F 4X5PA 1D9KC 4JPQA 4L1HA 3MV01 4FYSA 3C5ZD 4XCEA 1WBYB 2KKQA 3L7FA 3CC1A 2EO7A 4ISVB 3ARDC 3MRIA 4I2XE 1WUNT 5C0CA 1J9QA 4N0YH 3W9DB 4PMFA 2EIJB 3SKNA 1JZ6A 3QIUD 2KLSA 4GXVH 3BT0A 1MFBL 2HG0A 2OMVB 3CVHA 3CXFA 3GSVB 1D9KA 1BQLL 3V7MA 3U6RB 3AG1B 3DVGA 1DCLA 1PEZA 1BGXH 2FRGP 3L4VA 3OXRA 3ELQA 4FMFA 1SPDA 3QQDA 4JRXA 3UTSD 4ONHA 1NFDA 4IQHA 3CXHJ 2X4NB 5KYUB 1HHIA 4A2GA 4PJBB 2NX5B 3QJFA 4H8PA 2JB6B 2OZ4L 2CO3A 2OJZL 4YPJA 1U8CB 4ABWA 5A2IH 4QCIB 3WFBL 3D1MC 3MOAL 2QKIC 4FNLL 3X2QB 1QRKA 4NQDA 2P8PB 4JZJB 4NHUA 2NPLX 3SCMD 2XTJC 4PV8B 4Y88A 3FJTA 3OMIB 2DQGL 1NCAL 1JK8B 1YMHB 3WEXB 1VA9A 2DL2A 4PCYA 1F4WH 4AYID 2OSYA 4WWOA 4QEGA 4F33A 4W9LC 3U0PB 3MJ7B 3Q7JA 2J4WH 3NUKA 4G80B 2DWXA 2GY7B 3H4HA 1J10A 1O0VA 5D1XA 4HLEA 2PF6A 3LRHA 3RFZB 1VKXA 3FCGA 3OX8B 2CBTA 1BIIB 5HYSG 4YH6A 4PLKD 4XBGB 2YD9A 2HPTA 3ASNB 2FWOB 1PFCA 3HPLB 1VB9A 1DP0A 2X10A 3I9PA 2XKSA 4ZFZA 1SDDB 3PV6B 4KDTC 4ANUA 4LVEA 5F7AA 1BREA 3TPUB 1U8HA 4KHTH 4E0RB 3UZQB 2MOQA 5FO2A 3O2DA 2JLLA 4ODHL 1A4AA 4FFYH 1OIOA 5HYSB 1ECYA 4GSQA 1G84A 4PGCB 4QR7A 1QA9B 2RFXB 1NM9A 1KF9B 4QXUL 3BAEH 1N64L 4FYTA 1P4UA 1ZK5A 1NDGA 2EC9T 2HVKA 4F5CA 1J8HE 1PG7H 3FSOA 2Z8RA 5IVNA 4OZIE 4AJ0A 4G70B 1YEFH 3EGSA 5F9DC 2CPUA 1TZHA 3PGDB 4E9XA 2P8MA 3VXMD 2OX5A 1UWXK 3U2JA 4AY0A 1OSZA 5BRQA 1T1WB 3TBVB 4UANA 2EKSA 1CDJA 1IGTB 4M8RA 1EHAA 4N8CH 1DQKA 1FNAA 1UXLA 3X1NA 5C71A 4DCQA 1NLBL 1MPAH 2XWXA 3P4MA 1YNKL 1G87A 2OYKA 1KPRB 3PABA 3EYUH 1G6VK 1SGKA 2X4QA 3LEXB 4OUUB 3R06B 2WC7A 1R3KB 2IG2H 4P2RD 4ZQTA 3FH7A 2KS0A 4X4YB 1AKJA 1X9LA 2Z92B 5DYOB 4E9SA 2VABA 3EJRA 4ISVA 3VG0L 1SXNA 3MSPA 5H2BB 1RLWA 4M7JL 2YPLA 2YFNA 4HWEH 1AQ8A 3SDXF 2M1KA 1HCVA 1VACA 1MW1A 4ZS7L 1LEIB 4PJAA 3NJLA 1X5JA 2DJSA 1EZVX 1MCPH 5JOEA 4DVRL 1FH2A 3NAAH 2YIHA 5MEPB 1OM9A 3LIZL 2IOMA 2DS4A 3CUPA 4FG4A 5DVOA 1A4CA 1BAGA 4Z7QF 2GABA 4JM2F 3DETD 1JF5A 3E9UA 5KYUA 1NCWL 2ZKXA 4F15C 4N2OA 4PJBA 2NX5A 2JB6A 4N2MA 1QEWB 1SOKA 5E6SB 2J1WA 3SDXE 5A40E 5A2JH 1WK0A 4QCIA 1ITCA 2CUHA 4XP4H 3RFZC 1OXYA 2P8PA 3C75A 3NJGA 4JZJA 2XWTB 4KX8A 3FT4A 2X0UA 4PV8A 1BEYL 1DJWA 3QUGA 4HGMA 4ZMVA 1JK8A 4M6NH 1U8PB 2D7TL 3KL5A 1WITA 2WLIB 5T5NG 2A4EA 5EOCH 4L1DA 5FCSH 3U0PA 4DAGH 2IJ0C 1SY6A 5JMOC 1S7WB 3UYRH 1ZVHA 4NUGH 5BZWB 1W8EA 4IMLA 1UQSB 4I0PD 3RFZA 3H3PH 3VB8A 2YXVA 3OX8A 4BFIA 2BSEA 3IFLH 2ZG2A 4UIMB 4ZW3A 1CTMA 4M03A 1UASA 3LZPA 3LYRA 3FMGL 2FWOA 1QSZA 2AJSH 4U6YB 3KVPA 3PWPB 4P5MA 4XAKE 5SWSE 1SDDA 3PV6A 4QO1A 2P7TA 4XPBH 3VA6A 3ZZLA 4JKNA 1H3PL 3TPUA 5FGBA 3K6SB 1J9RA 1D3CA 5IEHB 3KYKH 5T3ZH 4UQBA 2XTLA 2MIZA 5BS0B 1MFCL 2DYPA 3CXDL 4U05A 1QA9A 2RFXA 3DSNB 4KJYA 2X5PA 3SKMB 1OTSD 5DZVA 2WNGA 5FKAB 5SV3A 3FN9A 4G1EA 3WFZA 3FT2B 1DEDA 4TPRL 1AY1H 2JCWA 1LO3L 3K2UL 1C5CH 4ONFL 3ZQ9A 3VXOB 1PPIA 5E95B 1WIOA 2B3IA 5ECJE 1T1WA 3TBVA 4AYGA 5TGBB 1MCOH 1OOWA 4U1IB 1IGTA 1T4KB 2V33A 3FB7B 2PWEA 1QFWL 4XNZB 4W9ZA 4BFGA 3F7YB 4WY7H 3FO0L 4JJOA 4H13C 3P9WB 2CIKB 1DJXA 4NN7B 4FDWA 2V7HB 4LRNL 1KPRA 4YWGH 5JHDB 1KWKA 2I60H 4GAYA 3RX7A 5FHBL 1GZQB 3LEXA 4OUUA 4YDIL 3R06A 4UB0H 5L2KE 2O5YL 3KLSA 4JO1L 4WI0B 5FFLA 3N06B 1KB9J 1R3KA 3V0AC 3QUXB 4X4YA 2Y7QB 4YHKL 1KGUA 5DYOA 5DD3H 2BFVL 3H7LA 2H0JA 4FJ6A 5H8DA 2R23A 4N2FA 5CCJA 1E6OL 43CAB 2K1MA 5H2BA 4AQZA 4N0RA 3JWOC 3LQAL 1ZVSA 2W91A 3BYYA 4HS8H 3B9EA 3OR7B 3LH9A 3QCTL 2FNWA 1UD3A 5EU7E 3MBEB 1HOEA 4QRRB 5MEPA 3KBPA 4KMTL 3EO1A 4N1HB 3GFUA 3BRDA 1UGKA 1QEWA 4YPGB 4N68A 3QPQC 1HILB 3N41F 1Z9OA 2HJKB 5T1DH 1XF1A 4OGXL 1U2CA 3SPGA 2A9NL 2X70A 3O2VH 2Y06H 4AV5A 4LU5L 4PJHF 4U2ZA 4DO6A 2ZUSA 3PFQA 2GUOB 4YMPA 2QV4A 4HXAH 1KN2L 1ZVNA 4DK3A 1YHPA 1CICD 2XXFA 5FB8B 3V4PA 2YWYA 1N0LB 3G9AB 4NKDB 5EWIH 3NACH 3T0EE 4OJEH 3HBPA 1CZ8L 2XFGB 1AACA 4KFZC 5BZWA 3SDDB 1B0WA 4ES9A 1UQSA 1R5WB 4PRPE 2I25N 2DZEA 3EG9A 3SDAD 3TJHD 4UIMA 2R1YB 3CZGA 4DGYH 4YDMA 1HS6A 3ILPB 1V5JA 4BQ8A 3N1MC 1OWWA 4U6YA 2D3VA 3PWPA 2BS9A 4BDVB 4WCYH 4XN5A 5DC4B 2ENJA 5E2JA 2P48B 5IEHA 3UO8B 2VCOA 2E9GA 3HG1D 2YKKA 4JVPA 5C0AB 4GUQA 4WGWB 3UG4A 3ML9A 5J13B 4ZFOA 2ZYRA 1RPUA 3DSNA 2X05A 1J8HB 3SKMA 4NP4L 4I3RL 1QRNE 3S3DB 2GUYA 5FKAA 3U46A 3G6DL 2ZZUT 2B1AH 2D7QA 3FT2A 5J8OA 4BH8B 2EC9U 4NN7C 1FNFA 2JKJA 1ND0B 1J5HA 2GJ6E 2YD6A 4LBEB 4NN5B 2DMCA 3S35H 1AXIB 1P7QA 3RVVC 1DBML 3T08A 3VXOA 1HI6A 3KLKA 2BP3A 1ADWA 4Y4HD 5TGBA 4U1IA 4PJFE 3ZY7A 5DD1L 3FB7A 2WO4A 5ALCH 3VWJD 4W70A 3F7YA 3VFOB 1PLAA 2CIKA 5MP6L 1UHVA 3C60D 3PFUA 1RZKL 1FDLL 5D6DA 2VQ1B 5JHDA 2H1LM 2CXGA 1GZQA 2B4CL 3MBEC 3AS2A 4Z7OF 3INUH 4MJ6B 4WI0A 1DJSA 2ARJB 1MY7A 4ONOA 3GD1C 3QUXA 5E56A 2Y7QA 3LZLA 4PN6A 4XN8A 4NFDA 4YDLB 2ZCHH 1K6QH 1GS8A 4J3XA 4P9HC 3UEQA 1J5OH 1JTTA 1EVUA 2LTQB 2FL5B 3BAWA 3OR7A 3QHFH 1HIMH 1EANA 2VJXA 4GB9A 3TXAA 3FL7A 3WY1A 4QRRA 2QADB 1ETA1 2QHLA 5HD8D 2KMWA 4JGMA 4AVIA 1WTLA 1BGXL 1TZAA 2H6UA 5JA8B 3SDXB 3WN5B 1IFRA 4HBCL 2BZ7A 2AMGA 4ODXB 2YRBA 5J3HD 4KQ3H 3PREA 2C5DC 1KT2B 1HE7A 2ENPA 3SGDH 4RETB 5DZLA 2QPUA 2HJKA 4QOKB 4WFFE 1QW8A 1I7TB 1TQUA 4JM2B 4CKVX 4F7TB 4Z7QB 1PCSA 3VTAA 3D0VB 4J4PD 1D7DA 3MO1A 1T2QH 1E65A 4YHNB 4IRZH 2WNKA 4JFZH 1QYGH 1J18A 1P84K 2GUOA 1F4WL 3VSVA 3G04A 2WWMC 3WGVB 4LFHD 4Y9BA 4NKDA 5I76B 2KYIA 3T04D 1HNGA 3U6XA 3MOBL 3SDDA 5D96B 2K3TA 3F85A 3FN3A 5IP4A 3QWQB 4UM9B 1PY4A 4I48B 3BDXA 5J13C 3EH3B 3P4OB 2HKFL 2VO5A 2R1YA 4OLYL 3HS8A 3QXWA 5FUCC 5SWSB 3LOWA 2WB1A 1S46A 4HA1A 3ILPA 4OZGA 3FQYA 4H8UA 2BINA 2QPSA 1HYSC 4KKLC 3KGUA 4P2YA 4HCRH 2E76C 4NN5C 2XY2A 4V1DD 1WEJH 3QORC 5F88B 5JHMA 2EADA 2XIDA 4L4TE 5ICYB 3UP1A 5IJVB 4KHTL 2FECL 1AXTH 2CDFA 4F3FA 4XI5C 1J86A 1QWHA 2WXHA 3CX2A 2IEPA 4RIRB 5C0AA 2JCCF 3DVFA 5AYQA 1KB3A 4AZ8B 5TFSH 3NGBC 2Q86B 2EIBA 2ZT9C 3BAEL 1EZLA 4FA7B 2G9KA 3BAIA 3QQXA 5DSCB 2OZ4A 4KJPC 1OGPA 3QNXA 4RFEA 4BH8A 4MKTA 1WZMA 1PG7L 3OKMA 4FHJA 3QIBB 1UGNA 1JMXA 3HFMH 3MLSH 3T1WA 5EFIA 1LDPL 4HC1L 1CXEA 4KTDL 5AW3B 2WIMA 5D7IF 4AG4H 3LVEA 2C9SA 3MRLB 1KBKA 3ESPA 3P1VA 4G9FB 4UV7H 3D3VB 4IHOA 1CDGA 1J12A 2BVOB 4LLAA 2HA1A 5KBNC 4YDLC 4NO3A 4FTDA 4Y1AD 5DJ2B 3VVWA 4U7MA 1VPOH 4FQXD 2ESVB 4ZAKC 2VQ1A 3CSGA 1XBDA 5IJBC 2ZX8A 5KBDA 1ORQB 2FZ3B 3CFMA 4U7KA 2QADC 3M88A 4MJ6A 2GBTA 3RGBA 1W91A 1WQVT 3GMQB 3K6OA 3HAEG 3X1GA 3BDYH 3RAJL 1FYHB 1FYTD 1ZWIA 4P9ML 2V9QA 3N1GC 5FDWB 5E2UL 5G4OA 3LZNA 3WN5C 3IMBA 1PCXA 5EEUA 4EI5A 4JPIB 4ERSL 4C56E 4Q4IA 4XC3L 5HHOE 2AVFA 1LEKB 1KC5H 1ILUA 3O41A 5KVFH 1V05A 4WHYH 5FYKD 1IBGH 2FL5A 4W4NA 1B4JH 4L8DB 3AMLA 4JM2C 5FR3A 5IFAL 3HAEB 4YNYB 3NAAL 2HT4D 4GKZB 5BZXA 5JQHC 3VB9A 1XSKA 2X28A 2ZOWA 2ZUVA 5JPMB 2UY7A 2WQXA 5HHXH 4DFHA 3BX7C 3ARBD 4CNIA 3OJ2C 3MGTB 4XB7A 4OV5B 4HPYH 1KT2A 1JZGA 2WOBA 4YHLH 3H7BB 2ZP8A 4QOKA 4KKZA 2PP7A 3HN8A 3QYCA 3UZVB 4F7TA 1D6EB 4NERA 4AIXA 3D0VA 3MGOB 4P2OC 1XBRA 4QT5B 4FKKA 4YHNA 2M8XA 4CMHC 5BV7C 5D6CB 3N41B 3BCFA 4K3EL 1UWGH 1JZJA 3IE4A 1TYEB 3RVXC 5D55A 3TASA 4TN9A 4AJWA 3FZUD 1YEDB 4KKAD 5EOCL 3B9AA 3VXRD 3WO4C 1ZHLA 3UYRL 2KLTA 4WFHD 4PJHB 4XOAA 1NKGA 2OMNA 4RSYA 4TV3A 2AEWA 3LZFL 4FE9A 4I48A 4KY1H 4UM9A 2F18A 3FXIC 3Q6GL 1ORSB 3SGDI 4Y16C 4LO9A 5TH2B 2NUTB 2AJSL 3MLVL 1QOKA 4Y9FA 4KRNA 2XIIA 3LRGA 3DGGB 5AW2B 1L9OA 3GJFH 3SE4C 1L6XA 4MXWH 4O9HL 4FKEA 2LLLA 5ICYA 2VQTA 3NSXA 5IJVA 1Y0LA 1ZSDA 2XLLA 4RIRA 4RSVA 5I1EH 3RE0A 3FOLA 4FCHA 1TVBB 2Q86A 3MLXL 1I9RL 1N7MH 2CBQA 2CNYA 3E6HA 4NC0B 2ZQKA 5DSCA 3HUJA 4E9YA 5H94B 5IMLB 1I1AD 1GYWA 1N68A 4AYBA 4GSDH 4LCWE 2AI0H 3DRQB 3S6CA 4L3ED 3QIBA 4L1TA 1KPVA 1DVFB 2UUDK 1WCBB 2ISDA 1GMEA 1KUMA 3IMUA 4JDVB 1KTLB 1X5LA 1BD2E 2IBZY 5KBKA 3FONB 3MRLA 2AEQL 4G9FA 2R4RL 5C8JB 2BVOA 5ABAA 2IDTA 5DJ2A 1TJIL 4OF5A 1TU2B 4OVUA 1BMGA 1XL6A 4FQQB 2ESVA 4AUYA 1LVEA 1M6UA 3BAYA 4I18C 5F70A 5I74B 3QQ4B 3KPSA 5A2BA 4G6MH 4P05A 3A4EA 3EJYC 4Q89A 3GMQA 3JWDH 4XP1H 4IM8A 2WSKA 1BXVA 1DQQB 1MVYA 1UCTA 3LRSB 5JPMC 2PCPB 1WT5C 4JPWL 4NHCH 3WV0A 3LQZB 4JPIA 4XMKH 1WC7A 4W9KC 4AC2A 4BFFA 4OR1A 3EFDH 4UILH 4KKPA 2VLJB 3NPZB 2AC0A 3GBDA 1LEKA 4HD9A 4Z7OB 4KZCA 2X40A 2IV9A 2OR8A 2KZWA 5GRUH 4L8DA 4NIKB 2YD2A 4P0DA 4NWTL 2GTZA 2DQ6A 4AXWB 1T0PB 4Y8AA 5DURB 3O6LH 1NMAL 1WT5A 3T0EC 3L4ZA 3QEQD 1MRFL 5C9JB 7FABH 2NY7H 3MXWL 5K93A 2ARJQ 3MGTA 1FNLA 4AQ8C 1A9EB 2CLZB 4X6BB 4OFVA 2AJ3A 2OSLA 5CZXC 4TQPA 2Z31D 4XP6H 4D7PA 4O02L 3UZVA 3L48A 4FI8A 1D6EA 3STZB 2VDPL 3MLTB 3O2VL 2V2TA 2Y06L 5IUCA 3MGOA 1HU8A 3IMSA 1L5GB 2UXVA 5CZVH 1R24B 4S2SB 3NJIA 1Z9SA 2O26U 3S37H 5D6CA 5CWSA 3LY6A 4WO4D 3O8XD 4G1MB 4LARL 4I1RA 4A6YL 1WZ1H 1YEDA 1EEYB 4FJYA 4LLQB 3R7RA 1XH3B 3ZR5A 2XYCA 3L1OL 4GI9A 2Y36H 2DIAA 5HHMD 3NVQA 5DTFB 1H15A 1UEYA 2VN7A 4PW3A 4IBLT 1CL7H 2B9AA 3OKLA 3BP4B 3P0GB 5IWLC 3MTRA 1ORSA 4HIIB 3SZKC 1OZTG 4JVWA 1Y6MR 3T71A 1NFIB 1OCWL 5TH2A 4H0LC 1L9TA 1ID2A 3IAGC 3DGGA 1TSRA 2MHAB 5C0NC 1XGYH 1F4HA 2VAJA 4WCYL 1DYZA 3LN5B 2UZIL 3H0TB 2Y5QA 3DX8A 3U4EB 3V4UH 1A6VH 1ADQH 4FKHA 1OPGH 4HIHB 3HS0C 5MHSE 1TF4A 3J27A 4JR9H 1TVBA 3HHRB 4QHNB 5ITBH 4UTAH 3REVB 4L48A 2IWGA 5CJ8A 1XIWB 3RGVD 5IMLA 2MMXA 2B1AL 1MG3C 3RI5F 3ESUF 2VM4A 4E68A 4DGUA 4UQ9A 1DVFA 2JCCB 3VSTA 4P8QA 4AE0A 2JKNA 4UIKH 1SDYA 1G9NC 3EYOA 1YN7B 2Y0SA 3FONA 2LOEA 1EWHA 1KYOJ 2WW8A 3LZQA 5JDJA 3CSTA 4FA6A 1TLMA 5ALCL 4PJ8B 4MYPA 1TU2A 2QVFB 3RLSA 1KJ2L 1JWUB 4BH7B 3ZE0F 4M3KB 5LAXB 4S0HA 1XSJA 4FHKA 2ILLA 5D7IB 1IVLA 4KROD 3RWEB 3DMMC 3I9GH 2IQ9H 3L4YA 2XN9E 4B97A 3CFCL 4G6KL 3GIZH 1S6NA 1NM4A 3VCLB 2ICWB 1DQQA 5D5MF 1NFAA 3LRSA 3SB3A 3LRKA 5T3XL 3NP3A 4ZYKA 3LQZA 4DO4A 1KCRH 1YG9A 1QPKA 4GS7B 1GL4B 4K8RC 4LOFA 1Z0NA 1E30A 2VLJA 3B5HA 2NCEA 4MASA 4I0KA 4EKXA 5DHVB 1HZLA 2O6CA 2C7FA 4MHHG 5FO9A 4HH8A 5GRZA 1J5OL 1HXKA 2LVEA 3FQRB 3QHFL 1TDQA 5HPMB 4D94A 1U9KA 4PIRF 1KYDA 5I1HH 4EN3A 5EU4B 4DETA 4KNUA 1OQOA 4AXWA 3WHE0 5IQ9B 1J0HA 4Y2OB 1RHHB 4JFFD 2DLEA 3SPCA 4O5LL 5C9JA 1ZTXH 3P3UA 3KXFB 4KQ3L 1A9EA 4QRPE 3VD5A 2CLZA 2OLDA 3GI9L 4X6BA 2DTSA 2NDGA 5IUSA 2VLMD 2OKMA 2GBUA 3FUDA 4DP5X 3MLTA 1GYUA 3ZGIA 1L5GA 2UZXB 2YFOA 1R24A 3FQTA 3RB7A 1T2QL 2XPYA 2ZX9A 4IRZL 3QFGA 3JQOB 4G1MA 1LQBC 1QLEH 2XFXB 3AW5A 3FCTA 1EEYA 5E1IA 4LLQA 3W0WA 5E7FA 1MRCL 1RVFH 3I50H 5E00A 1AHKA 2YOCA 1U3NA 3MNVB 5DWUL 1S7VB 3DRTB 3KS0J 4IJ3C 4ZUTB 4X50A 5TTRA 5H37G 4N4YB 3BP4A 4JFPB 2AVGA 4JFDB 3NZSA 4NLHA 5GZNA 1XIWC 4PLOB 3GO1L 1IKFL 5C2BH 3WU1A 4HUXB 3TBTB 4A2EA 1GCYA 5ITFB 2MHAA 3IXAA 4HCRL 4M8UA 3ZQXA 3H8NA 4KRPC 5D1ZB 1WEJL 5E1GA 1IEBA 5D4JA 1ED3B 3C6LD 3LN5A 1QBBA 2DQHH 3MRJB 2F53E 4CADB 6PCYA 1S7RB 4OCYH 2NXYC 3BMWA 1KIUB 2VXSH 4LCWB 5DRNB 4Z7NE 1QSEA 1ZDSA 5FWQA 1XIWA 2OMXA 5F3FA 2ZKHH 2FJSA 4HULB 4L4VE 4DGWC 4XCFH 5E8EB 1CL7I 1TTGA 4LDOB 2HT3D 5KVGH 4GAFB 1CF8L 3B3BA 1DSYA 4A37A 1E5BA 5D2LF 2CUMA 3BGAA 2BP8B 5F9WB 2IVFC 2GJRA 1YN7A 3C08L 4OFYA 3D52A 1A6AB 4J3OG 3W3BA 3R0NA 4UV7L 3SSGA 4PJ8A 4GS7C 4NQDE 4NZRH 2COVD 2J55A 5C3LD 4PGZA 3NG5A 5T3ZD 1M56B 3LV3B 4BH7A 3EZJB 3ARGD