3SQBB

Structure of the major type 1 pilus subunit fima bound to the fimc chaperone
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
145
structure length
145
Chain Sequence
EVVNAACAVDAGSVDQTVQLGQVRTASLAQEGATSSAVGFNIQLNDCDTNVASKAAVAFLGTAIDAGHTNVLALQSSAAGSATNVGVQILDRTGAALTLDGATFSSETTLNNGTNTIPFQARYFATGAATPGAANADATFKVQYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Quality control of disulfide bond formation in pilus subunits by the chaperone FimC.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural protein/chaperone
molecule keywords Chaperone protein fimC
total genus 19
structure length 145
sequence length 145
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2011-07-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 3sqbB00
4XOBA 1KIUB 3ZL1A 5IQMA 4J3OH 3JWNE 2UY7B 5LNEA 2W07B 4XODA 3BFWA 4X5PA 5FLUA 4AUYA 3ZPDA 4ATTA 4CSSA 3RFZA 3JWNH 3BFQG 4XO8A 1KLFB 3ME0B 4X50A 5IQNA 1TR7A 5AB1A 3ZL2A 5AALA 4XOEA 1N0LB 4AVHA 5AAPA 2XG5B 2JMRA 4AV0A 4AVIA 3JWNG 1QUNB 3BWUF 2JTYA 4J3OG 4LOVA 4XOCA 5FS5A 4AUJA 5FWRA 3SQBB 4AVJA 2UY6B 2XG4B 5JQIB 4AUUA 1ZE3H 2J2ZB 3MCYA 4CA4A 5ABZA 5LNGA 5F2FA 4BUQA 4X5QA 4X5RA 4XOAA 5F3FA 5FX3A 4AV4A 4CSTA 2VCOA 1PDKB 5IQOA 5CGBA 2WMPB 4AVKA 4AV5A 1N12A 4J3OF 4XO9A 1UWFA
chains in the Genus database with same CATH superfamily
4LVOC 1QSZA 1BG9A 2HT4D 2NR6A 4JQXA 2NX5B 3UG4A 5B3NA 2Y1YA 2GJ6A 2GSGA 1E5BA 1NMCB 3O0LA 1SJHA 2NRDA 4MQ7A 4N6QA 1F3JA 2B39A 1ADQL 3NDYE 3DPDA 1CIUA 4OD2B 4WU7B 4FC3E 1UB5A 4FNPA 3MRPA 2LVCA 4LSUH 1MFEH 4ODTL 4XPAL 4YPJA 1BFSA 2CG9X 1WZ1H 3IS1X 1HKLL 3MX0A 4RGOL 2EIMB 2WOBA 1Z5HA 1QBMH 2Q20A 1G1CA 1LHZA 2VC2B 2YGPA 5CIPH 1ZOXA 4ZFOA 4LE8A 4XWOC 3VGHA 4R7XA 2BC4B 1CDCA 3RDTD 1XH1A 5F7DB 4GI8A 1XGZA 1UOLA 1A9BB 4LPWA 5FW7A 2GTWB 3TN0B 4C4KO 3PABB 2CUHA 2IPKA 1P7HL 4NRZA 1FO0A 3T3MF 1J9TA 3ZE1E 3ARGA 4ZDHA 1BF5A 2WNKA 4UT9L 4NZJA 1DBAL 1TJIL 4KUCF 5HVGB 4RFEA 4AK1A 3UZEA 1VENA 1BYPA 1N0XH 1TZAA 3AMLA 3BSZH 3WJMA 2W95A 5J11B 5C09D 5SWSA 3RLSA 2COQA 1PLAA 4RDBA 4CU7A 3A4FA 2QHRH 4JL1A 3ELAT 3HE6D 4PJ8B 3H9SE 4GQ9L 4L48A 1IARB 4H8WL 4M7KH 1LE9A 4YX2L 3Q2CA 3G5WA 3M07A 4P4KD 5F70A 3W5NA 1MQKH 4AL8H 1TLMA 3HR6A 3WS6A 2P52A 4CC0A 3LEXA 3WMPA 4O2EA 4NQCE 3Q5TA 1SOSA 5AWNL 2HLAB 2Y5TB 3N43F 5J1SC 1EVUA 2FJSA 5L6YH 1VESA 4PJAA 2AJVH 1FL5B 5JW4N 3FUDA 4XBPB 5JXEA 2H6PB 2K3TA 2XXCB 5F1IA 4H0LC 4ZOEA 5AOJA 3IGAA 2E6JA 1UA6H 3K46A 5AZEL 5FOBA 3UAAA 5IIEB 4CJ1A 2DYPA 4GUPB 3U2SB 3U4EA 1QWNA 5F9JA 4N6RA 2AQNA 4N5EC 1L5GA 1N7MH 2PNDA 3SKOA 2O6FA 3BZFB 4UM9D 1E67A 1BAFH 4DO4A 1PGRB 5LO7A 2BWDA 4XPTL 1FVEA 1MAML 1YYCA 3CX5K 3EHBC 5F3FA 1UWGH 1GMIA 1U8CB 3G7TA 5I1IH 4H2AA 1XAKA 3HNSH 5HGDB 4OGXH 2NW2A 2ARJQ 5F0LB 5IBLC 5J3HC 2ZPKH 3VG9B 1MCCA 4MD0B 1SUJA 2IDFA 4QXTB 4KRMB 5FOBB 4G6AC 4P9ML 1L6XA 4IRSB 1E4JA 4AC2A 1BREA 1OB1B 5G4NA 1IKNC 4JFHD 4WUUA 1RIHL 4XZUA 3SKJH 1IEBA 2UXGA 2C7FA 2HRHA 4OJFH 5JMRA 1MFCH 2QV2A 2WLLA 2XTJB 3PF2A 5HYJB 4D8PB 4H5SB 4IHBA 4YC2B 5I2IA 1RLWA 2Z7UA 1X5LA 5L0QB 3BDYL 5DS2A 2VISB 3V0VA 1SOQA 2CKNA 4MKTA 2DY2A 2QADC 2Y3AA 4JQVC 4LRIA 4OB5H 1FGVH 3HMWL 4Y1AD 1HHKA 2GG1A 1LP9A 2IWKA 3DX1A 3CC5A 1XF4A 2GIYA 3ECBB 1DQMH 3GSUA 4GAFB 4IRJB 4F37K 3N41B 3DURB 5LUMA 3S3CB 2ICWJ 3A4EA 1MJ7H 3B9VA 2ZX9A 4FQJL 1I9IL 3QXVA 4FNSA 5HHMB 1MY7A 4QRTA 1FZKB 2DTML 4AG4H 1NWPA 4QHKI 5ADPH 3LKPA 4QHMB 3ARGB 2EEDA 4ZDHB 5HBBA 5I18H 2UVEA 5IBTH 3DGGB 3QORA 1G4RA 4CVXB 2Q1EA 4FP8H 2Q8BL 3FT1A 3GHBH 5EU7C 4Y2DB 5D6DA 4IGBB 2OL3L 4PJ7F 2XBDA 4LOVA 3F7YB 5JXED 4TVPL 1TSHA 4OCWH 2J25A 4CUCA 5AYUL 1WAAF 3FSOA 3TTYA 3LRKA 1FN4B 3B2MA 1U92A 3VGEA 4MCZB 3HAEG 2NY7H 2E7CA 3PGFL 5DJCA 3ESPA 4X6BA 3EO1A 2Y72A 1N59A 1BWWA 2AAVA 2XIBA 3DDGA 3M1CA 1KELH 3FB8B 3II2A 2BVQB 1N2RB 2IH3B 1IV8A 2OJZL 1JL8A 3LDBC 1RULL 3C6LC 5E4OA 2R2EA 1ADQH 4QHUA 3OLEA 2ERJB 1EFXD 4HBQA 4Y16D 4DPCX 5I1DA 2R7EA 4FOMA 3VI3E 1SJHB 4RGNC 3P3YA 2YUWA 3N42B 1OKEA 2XWXA 3LPFA 2ICEB 1J1PL 3VFUA 1CTNA 1A1NB 3CFTA 1MDAA 4OZHA 3CWGA 1D5BA 1JWUA 1VACA 5LGHH 5KJRL 2XWDA 4F7TA 5F72S 5CSGA 2EYRB 1UWEH 1PNDA 4Z7OB 2HT3C 1FFNB 3RIFF 4X9BA 5JPNC 1E4XL 1S78C 3TZVA 3B5GA 4BQCA 2CO3A 1O0VA 1XCXA 1ZT7A 5EORL 1OSZA 1KXVC 1TCRA 4L05A 4OJDH 5EUOB 2GJ6B 3RVXD 3IDXL 1AOZA 5L9DL 3EG9A 4B50A 1QOKA 2VXVL 4KHXH 1EHKB 1GOHA 1NA8A 2IFFL 1BMWA 5C7ZA 5SWSB 3DHMA 5CILH 5IVXB 4Z8FH 4PRID 4GFTB 4OQTL 4CADA 3KYNB 1OCWH 3WTSA 3CHPA 3MRHA 3OG4B 4OCXH 4RFEB 4X7TB 3ABMB 2AEWA 1GYWA 1GGTA 3MJ8B 3UXFA 5IB3A 1EVTC 3DECA 3FCUB 1VRSA 5IW1A 1DVFD 4RGMC 2IPKB 3BT2H 5IJBC 5CSZA 3P11H 3ZQ9A 4JGJA 4RWYL 3EYVA 5I73C 5TD4A 3BN9D 3RY5A 1CFTB 3EH4B 2WP3O 1WWAX 3M6DA 1X9QA 4E2OA 4APQB 3RX7A 3L3IB 2M1KA 3HZYA 4OV6F 1OEZW 1UJ3B 2XZAH 1KB5A 4Z7QB 1CPUA 1JRHL 3MNMA 3QYMA 4JO1L 4LEXL 2BFGA 1YNKL 2PWHA 1KG0B 4LLQB 3NRPA 4Z78B 1V7ML 1DSFH 1T1XB 1XSOA 2G30A 2WXMA 3NRQA 1J7VR 4N25A 5DMYA 2LAGB 3GJFH 1R5WB 5ACLA 5IHBA 4I7ZC 2QTVA 4OQTA 4R7DB 4HLEA 4XCFH 3KXFD 4OLVH 1ZA3B 4UT7L 2DQHH 3EJJX 3CVCA 4FEIA 1BYOA 3TYFA 4B9ZA 1AD9A 3BVVA 3IFNL 3VFTA 4BBWA 4IIQB 2HRPH 1NCNA 5F7BA 3UACA 2RA1A 2EIDA 3GGWA 4HXBH 2AXJA 5C0FA 4X4XB 2E27H 3EYVB 3P40A 1M2VB 5I74B 1P2CB 3S34H 2GSMB 2DZEA 1WEJL 2HKAA 1H6FA 2PP9A 3C08H 1MCFA 3AWGA 2DQCH 3MLWH 1LWHA 4HC1A 1COBA 2OYPA 4YAQA 5K59F 5L88L 4TUJB 3Q05A 2ZUYA 4L8CA 2XHNA 2C3XA 2D7NA 3FT9A 3ZDXF 3C8KA 3BP5A 3NP3A 5FYKE 1YEFL 4XNXH 4G7VH 1MCBA 3QHZL 4ADGA 1G9HA 1YMMD 1XDTT 3FSZA 5I82A 4Y4HC 4WHYG 4AITA 3DI2B 3VFVA 1W0WA 5DVNA 4J3BA 5E1AA 1KPRA 1NM4A 3R06A 2NMSA 2A6IB 4NHUB 1A7BA 1DUYB 1L5GB 3LMJL 3VO0A 2XXMB 3MRIB 5E8NA 4B9FA 4LK4A 43CAA 1RUKL 1SXBA 3WIFB 1A6WH 2HWZH 2VXTL 1M9WA 1T03H 3NH7L 4Y19B 1KB9K 3EGDA 4Q9CA 2IXQB 5T1DH 1M7DA 1TTGA 4P2RB 2VZOA 1G9MC 2VC2H 4WI2A 5CIPB 2QVIA 3VJ6B 3S88H 4X5XA 1WWCA 3EXJA 1I9IH 1JPGA 4K7PX 3SDAD 3SPVB 4XCCH 1DBJH 1P1VA 4HPOH 3UG3A 4TNWF 1DCEA 3I02B 4NUJB 1QYGL 2DBLL 4J3OH 4M8QB 5B4MD 1K5NB 3QSKB 3PHAA 1T5WB 4WFHE 4EBQH 1OAYH 5E6IA 4Q56A 1S5HB 5A40E 5LAXB 4LCYB 1HZLA 5C9JB 4X50A 2YWYA 2JIXD 3OJDA 4UV4L 3MXVL 1G9NC 4E41B 2AQSA 2J20A 3E8UL 1UZ8B 3M1OA 4PJCF 2DS4A 1D5ZB 3KPOB 1URLA 3MNVB 1DBKH 4MAYC 4U1GB 1KZQA 1QBBA 4PRDA 3TO4C 3EJUA 1C16B 1FORL 4RQQB 4AW4A 4DHLA 1XGPB 2ED7A 3MFFB 4GG8B 1W72B 5A6IA 2NY7L 3PGFH 5LJYH 1FFTB 2IVFC 3QUXD 1RZKL 3MRCB 4QXGL 4Y5XA 3SD2A 3KS0J 1N0LB 3S3JA 2NY5H 1HHIB 2D0HA 4OCNC 5DT1L 4PHXA 2NQ3A 3QJSB 2OR9H 4U0RB 4HUUB 1AE6H 5CBAB 1IFHL 4XN7A 2VDQL 3GK8L 2QQKL 3UO8B 1GYUA 1ZS8A 5GGUA 1E2ZA 3ZW3A 1AS6A 1RERA 3CVBA 5L8LB 4NQSB 2VZTA 2XQYG 5HPMB 2J72A 3KLQA 4PJ5A 3SO3B 5IY5B 4PCYA 5C6WH 2KMWA 3QCVH 5I0DA 1E5UI 1S5HA 4HU8A 2VE6B 3U46A 1MVUA 5C9JA 5TGBA 4L3EB 5IJVB 4WWNA 2Y5QA 4R96B 5HDOA 3WKML 1I3RB 5D1XC 4J3WA 1KTRL 3LS5H 4Y1TA 5HDRA 4U6TA 3ZHKA 5I76A 2ITFA 3FQNB 3QDJD 4GS7C 3R19A 4J2QA 3JV5A 4OT1L 2QSQA 3UBHA 3QUHA 2CRZA 1UWGL 5C07D 1EJFA 4L2YA 2ZG3A 2P42B 4W93A 3B9KA 4X80H 2KH2B 4IEFB 4KZCA 5ESAB 2MCPL 3F00A 3UTTA 1ZVYA 1GOGA 5GGTH 3DBSA 2G60L 3CVHB 2WK2A 3CH1B 1SN2A 3NOIA 2R29A 3C5ZA 3GJEB 1P4LB 3QDGA 4PCKA 4TLTA 4XP9L 3CK0H 3QRBA 2LLGA 4F2MA 2QLVB 3OKDA 1T3FB 2CLZA 3HFML 3DMMD 1M7IA 4NOFA 2XN9B 1JVLA 1MN4A 2G3MA 3QUYB 5F6IC 1KNOB 3MCLH 5EZLB 2DAVA 1FVDB 3BGAA 4YUEH 4RMTA 3WXWH 4ZW5A 2ICWA 3L3JB 4K3JL 1U3ZA 3ZE2B 2AMGA 4Y88A 5KSVB 1CTMA 4JE4B 5C0CD 3BZ4A 2A4CA 2FNWA 1TZGL 4ELKB 3O3AA 4FL4B 3L2LA 1V3MA 3WS3B 2P47B 4WGVB 4GBXB 1WRFA 4Q9BA 5LGKA 4HA1A 4AMWA 1Y1UA 5LGYA 5JHLL 4N86A 1JNHB 4MRCA 1S7TA 1P7BA 5CEYB 4UT9A 4M9OA 4I9WD 3APFA 3RVTC 1FSKC 4DVBA 5EDXA 3D9AL 4I18B 1LTXA 5JOFB 4NWTH 1PZCA 3ETBF 1LEGA 1NKGA 2W0FB 3QFGA 4TUOA 2N3JA 3TYFB 4CBPA 4K5PA 5F7MC 4UTAH 3NA4A 2P5WA 3FH5A 3L5WA 3ARRA 3B7SA 4N1HB 1X5ZA 4J4PD 5I66A 3ZDYB 4GRLC 3GLEA 1C5DA 4N90D 4Y4HD 4NQDD 3KDMB 3TPKA 4DETA 5HHQB 1WCBB 4L4TB 4NKMB 3MA9L 5KVFH 3HI1A 4G7VL 4KWUA 5I1LA 5B39A 5TDNB 2KL6A 3SDCA 4OBSA 3INUH 4NUMA 1RSYA 4D0DA 5A2JH 1ADQA 1ZLVH 1PYWA 2DB8A 3LZOA 3VXRD 3PDOA 2GC7C 1BFOA 3BO8A 1WISA 2KS0A 1Z6JT 4G8GD 1A6ZA 2YIHA 2H5UA 4UQ2B 4OFKA 1WWBX 2H7WA 3QQ4A 4HWBA 8PAZA 2OMXB 3UBXG 4PJBB 3GMPB 4MX7A 1JF1B 4K7PL 2ZF9A 4YEEA 5DVMA 2F74B 3BH9A 5I75B 3DXAA 3S6CA 3GSWB 5HYSG 5CHNA 4FXKB 3NJFA 3FSAA 4Z7UE 1CDJA 4L4TA 4BINA 2BFVL 4NP4L 4PIRF 2YSSA 1TTUA 1I7ZA 2NR6C 3G6DL 1OCZB 1SBSH 4RX4D 4JG1H 1ZSHA 3QDAA 4OCRH 1NBZA 2WIIA 4JRXE 4QRBA 5KW9H 3C87A 4Q6IC 1QHPA 2WXKA 3DSNA 2QTEA 1M3JA 4OCYL 1X5FA 2IQAA 3TV8A 3VYPA 4PJHF 1WV7T 5CGYD 5LLIC 5FKPA 5IEHA 2ALWA 5KYXA 3HE7B 5HDBE 1XV8A 4BZ1L 1NFDE 2CHXA 4HCFA 5I17B 2BVYA 3PG2A 4FF9A 1MRFL 4KDTC 2WBJB 5AUMA 4H0GA 3ULVH 3TCLB 2VLJD 3U36A 1S9VB 4XN2A 5CZKA 4G83A 2BZCA 2CXKA 5DK0A 1NQBA 3U7YH 3E80A 1ZANH 4HOWA 1GW0A 4H1LH 1XMEB 1X9LA 1JV5B 1EBPA 3UIYA 1JF5A 2CA4A 2OMVA 5EBGA 1LVEA 4O58H 5KBLA 1U3JA 1QA9B 4E5XG 4TSCL 3D12B 4KJYA 2EEFA 2Y7MA 3RL2B 1I7ZB 3P4NA 1E9QB 3IPFA 1HOCA 1K4DA 4ZNEA 1IFHH 3MZTA 2IV8A 3VXSA 1AXSA 5BVJA 2BMKB 1ZTXL 5H35A 4KAQL 3X3GL 3RWDB 4JPIB 4ZO7A 4BUHA 5EUKB 3ATBA 1PDKA 4L3CB 3CFBA 5H2BA 2NTSP 4PGDB 1WFMA 4B97A 2JB5L 4W9CC 2CDGA 4DQOH 3MJGX 4W6YB 3QORD 4WKXA 4WJG3 7CGTA 3NN8A 4UTBA 1V54B 2DBJA 1CICD 2V9TA 3S35L 5JR1L 4KZDH 3F64A 1FNEA 1PFCA 3D7PA 3P4OB 2QVFB 2GFBB 2H2SC 3T3PB 4M7JL 3CZEA 1FNGB 3U6XS 4KRPD 3JWOC 2ZXBA 2ZCLL 3S4SB 5E5RB 3Q2LA 2YK1L 1KJ3H 4J3VA 5ANMA 4F57H 3WDHA 4A7VA 4I87A 3VFSA 4BFRA 3DVGA 1JGLL 3DURA 3EO0A 5KVDL 4RFNC 4PLJD 1N9PA 2ORBL 3NSDA 4MMYB 4WWKC 5ESQB 4AV4A 1UM5L 1NAML 5DEFB 3REVA 1E9OA 3WNKA 4ABQA 2ARJA 1EIBA 1A2YA 1T4KA 4WHTB 5DJAA 5ISZA 3LV3B 3T08A 1YAIA 4HH9A 2Q2LA 2GT9B 2SEBB 3QHZH 4YE4H 4GO9A 3TJHC 5BV7C 2WBWB 1MZZA 1X5IA 2ADYA 5H35B 1S46A 1XF2B 1WFJA 4FQ2L 3WV0A 1XGYL 1ZHKB 4PREB 4WO4B 3S0PA 4XBEL 3WD5L 2NY4C 3FQ1A 2VM4A 4FXLA 1NGXB 3QFDB 2ADFH 2J6WA 4U49A 4JCWA 4YPGA 3VD1A 5T1JA 5C0JA 5JLZA 3ORJA 5DJ8A 3BIKB 3CN4A 5FO8A 5ABZA 2NCEA 2W9EH 2XETA 1HEJC 2XICA 5LWYL 4ZFFB 5K1NA 3BW9B 1P6AB 4H0IA 4F9PA 1YECL 4MVBC 2C8NA 4R4BB 1TVHB 5DQDH 5FFOA 4OM0H 4PFEA 3CCHA 1IBYA 3SBQA 2YJQA 4HKXB 1PMYA 2KKQA 4NJAL 4L4VD 4F37F 3WIAA 3GKZA 3QUXC 3C8DA 2WIMA 4UM8B 3BCDA 5KYXB 5EUOF 3GLAA 1QYGH 2UX6A 1KB9J 4K3EL 2AANA 1GSKA 1RU9H 5AENA 4UTAL 4XTRD 2EC9U 4PRHA 5F7FA 1BBDL 4HOMA 3S36L 3BKCH 3PQYE 5E6SB 5DK0B 3X12A 2EDXA 3L5JA 4NAJA 4ADJA 2NOYA 3Q6GH 1OW0C 1CE6A 4RDQF 4JJOA 2D7PA 3F04A 2APTA 1MFBL 5A2FA 5GISL 4ZNEE 4M6ML 5K33A 2HA1A 1DQVA 4PJAB 1KTLA 3LH2H 3ME0B 4BQ9A 1DE4B 2GABA 5ITBL 5MERB 1FL3B 2R0ZH 5FDYA 4RGNB 4P2OB 2Y3NA 3GMPA 3OB0K 3PJSA 3IB4A 1S3KL 4HSAC 2Y7QB 2R8SL 2NNXA 2G9KA 4NO0A 5DFAA 4DP6X 3A0OA 2FBRA 4BJLA 4LIQH 4TMPA 5LN4A 5ERWB 2YSSB 1F3RB 2J8UE 3ILEA 2D7OA 3EDEA 4NC2B 4RQQA 4WNQA 3NCJL 2WP3T 4NN6B 5I8EA 3ZT7A 3MR9A 5JPNB 2F7PA 3P54A 3B2UC 5FDWA 2KHAA 1CN4A 1WA1X 1WCBA 2HX9A 5D1QE 1ACZA 3W37A 1OVZA 1FO0B 4F2ME 4Y2NA 3IMVA 4NFBA 4LHUA 3ZUCA 5KW9L 2H9GB 4ZBJA 4FLQA 2HJKB 5G55A 2N7BA 4ONHB 5AKVA 2DMCA 1MRDH 4OGAD 4U2ZA 4ABUA 3CXDH 2LU7A 3OWRA 4FRWA 4ONFH 5F7WC 3C5JA 4BHUI 4LVEA 5I16A 3SPVA 5KSUB 2AKRB 4WDIA 5I6LA 3AS3A 3VFRB 3WFHB 2NSMA 4N8CH 4R8WL 4ELMA 2OKMA 1M05A 1N3NA 2VMJA 4RBPK 1IE5A 3IJ9A 4JMNA 4E42B 3FZUD 4POZD 1BXAA 1MSPA 2QVKA 4G71B 5CD5D 3OSKA 4G9DA 4NNPH 1BZOA 3QXDB 1F90L 5GIRB 2ZNWA 3DTXA 3F7VB 1UJ3C 2H0EA 1BF8A 3T2NL 2RQ8A 3RWCB 2FWLB 2GEQA 1FNHA 4C8XA 4X4ME 1Q8MA 4AL8L 2Y07L 3E9TA 4XPGL 3ZOAA 1PY0A 3W82A 5C08E 2PR9A 1LNUA 1NWOA 5D55A 3BWAA 3C6EA 3OKMA 2VJ0A 3LPGA 4J5VA 2IDCA 4HDIA 2F54D 3C8KB 4IKLA 2RACA 4MGXA 3T0XA 2CBOA 3MJWA 4EI6A 1KIPB 4AXWB 4AYGA 3KPRB 2J1WA 4OIAA 4P5TD 1VGEH 3N06B 4YSEA 4F2EA 3ISWA 2Y9RT 3V6BR 4BYHA 4HEME 3VXQB 2CGYA 2VDNH 5HJ3A 2NW3A 2WTRA 1HXYA 2XU9A 5D7JC 3QJZA 4UTCA 5FYKH 4CSSA 4MMXB 3IJEB 1F58L 1X7QB 3QRGH 2QMJA 5IMKA 4HF5L 4ORGB 1P4BH 5HHNB 5KVGE 4B7IA 2HLFD 3HNSL 2DWYA 1DP0A 4PRAB 4P46D 1PG7L 1TOXA 2VUYA 1NEZB 5E56A 4D3CH 3Q2WA 1LDPL 1JXKA 1Z0NA 3MI6A 1UT9A 2WCSA 3QE5A 2PO6C 4GAGL 3SCMD 4JE0A 3BDBA 5CNHA 3EJRA 3PWNA 3RGVB 3ZHFA 3PAVA 4WCYH 4KNSA 4KMTL 3UJTH 2Q86A 4JREB 4KK6C 3RBSA 3EOAA 3EO9L 3MRQB 1MFCL 4YZWA 5JOFA 3C5SA 3DETD 2X53A 4BGLA 1O5DT 5J4MA 2R7EB 1NMCC 4TULH 3T4YA 4I0PC 5DR5L 1JWMA 2VXSH 3MLTA 2YD9A 4Q74A 1MI5B 5G5DB 3W39B 1PBYA 4QTIH 1NIFA 4GXFA 4MCNA 5FDWB 4P8QA 4S1DC 5BRPA 2UUDH 1XEDA 3CSGA 5E00A 2WTOA 2EXSA 4XH2A 1B9ZA 1SJMA 3GINA 3NFSL 4U1IA 1XGPA 4ZMQA 3UYPB 2ED9A 2AQRA 1VEMA 1MJ7L 2VL4A 4NP4H 1X5GA 4GMSH 2OMYB 4YSRA 2OK0L 5T1KB 4U4IA 1S7VA 1FAKT 3LZFL 4KY1L 1Z9SA 2OM5A 2FATH 5CBAA 1QR1A 4QRRD 1A02N 3N42F 4XOEA 1IGIL 5IBTL 3EYSH 3FOLB 3HTLX 2P7TB 2DQUH 4ZS7L 3TO4B 2VDPB 5DU7A 2ZG1A 4DZBA 4Z23A 5I1HH 5I23A 5D71L 2A9MH 1BVKA 4FJYA 5E0FA 5FO9A 2EIBA 5EFIA 2JKLA 1VCAA 4ZMYA 5C09E 2RGSA 4AYDC 2YGNA 1ET8A 3HUJB 5D1QA 5AYUH 1EJOH 3IDMA 1OAZL 3K71B 1Q0EA 3KBPA 4RIRB 3SQOL 4U7KA 1PZ3A 3WLWC 3VI3B 2Z35A 1I1FB 2BOBA 3T71A 4WI0A 5I76B 3ARTA 5GGSB 2HUHA 1KTKE 3VNYA 2X89A 4FD0A 4EQ3A 4R96A 2GBUA 2MIZA 4Z5RA 4JFTA 1B4LA 3EO1B 1QQDA 3O41A 4UM8A 5JW5B 5KYYA 1WK0A 1UHVA 1GGCH 2IWGA 2CA3A 4Y19E 3UX9B 1T7XA 1CUOA 4QO1B 1YVLA 4OF0A 2DQGL 5CSBA 2P8MA 3AAZB 3OKNB 4W9EC 5IKCA 4LQFH 2EH8H 1YYMH 4HZ1A 3FFCB 1IGML 2A0LD 1SYSB 1ZKAA 3D85B 1C7TA 4QWWC 5H37H 3PXLA 3ZU8A 4UILL 4YBQD 5ABDE 1XF5A 3VGBA 3CIAA 3WIHL 1W8NA 5EBLB 5DJCB 3V4PA 2H6OA 2F53B 1A6TB 5K39B 1UZGA 1FN4A 3BVTA 4B96A 3NZ8B 4XPTH 3IDIB 3FO0H 4MXVF 4XO9A 1JZGA 2NY3D 1Z9PA 1E42A 4LCVA 5GZNA 3WE6B 4Y9GA 2KPNA 2CAKA 5FA4A 4BRVA 3IJYB 4XP4H 4X99A 1E9OB 3Q0HA 4P9MH 1W72L 5AYTA 5I19L 2FJUB 1LILA 4GNKB 2QR0A 2CE6A 3U30B 2WJ5A 4DN4L 1DQJB 3MJ7B 3WEAA 3ZKMC 2VZSA 4YDVA 2Y07H 3DDFA 3E0GA 1ZVSA 1ZK5A 1U91A 3TBSA 4MSWA 3SPJA 1WBYA 4MJIE 2IAMB 3BKYL 1KB5B 4M8RA 1RZJC 1ILSA 4X6DA 3HZKB 4I0KA 3JT0A 4PUBL 2VDQB 4OD3L 2MKLC 4AOFA 4FFYA 5GS1A 4JM4L 5E7BA 3QNXA 1TQBB 1SMOA 3OMIB 2UZXB 4IRSA 1Q9LA 4G42A 3UPRA 4A7GA 3L5HA 1XIWB 3E6FB 4WEUD 2VXUL 2WQWA 4U6XB 4G8IA 3GC3A 4ZUVB 5KG9A 4ZTPL 1GAFH 3WUWA 4Z78A 4OCSH 2QADD 2BMKA 4OM0L 3MJ8A 3CXFA 3LZLA 3S96A 5IB3B 1YEKL 2X4RA 4R9HA 2F6AA 1D9KC 2A9BA 2DW5A 3ENEA 5LBVA 3IFNH 4LPVA 5HYSA 2D9QB 2PPDA 5IGXL 5KBDA 1RPQA 1MHCB 2PPCA 4G6MH 4EDWL 3TASA 1J05B 3DOHA 1OHZA 5EULV 1CFTA 4M6OL 2AV1B 4J6RL 4KHTL 1JV2A 2IG2H 4RA3A 4APXB 2BZ7A 2KUTA 3OZ9H 3NSXA 2PCFA 2X4PA 4WFFD 2YFNA 4ZPTA 2XWJB 2NW2B 4OVVA 3UTOA 2JJUA 1QFUL 3TIDA 1SEBA 2C9PA 5FYJD 1QFWH 4MA8L 1HHJA 4AKOA 2AXFA 1GYVA 4FYSA 3U2JA 3ULVD 2AQ2A 5FKPB 1DVTA 3V4VL 2B5IC 5B7MA 3QNYA 1PAMA 3MNZB 1YA5A 2WBJD 1YMME 1RZIB 4ZMLA 1TTRA 3R0MA 5ECGA 5IEHB 2OZ4H 3HMXL 1YQVH 4MYWB 1T2JA 5FM4A 2GI7A 3LDBB 4WI9A 2IQAB 1V3KA 3LV3A 3H9SB 2X2HA 5CJQL 4XN5A 1I3GL 1Q0XH 1JDCA 3FUFA 4X0KA 3UDWC 4YHOL 3D3VB 3CFJB 3JV6A 3A4AA 3SOTA 3SE9H 1GPOL 5TDPA 4L4TD 4YDKL 4EI0A 5ITFB 5LGJA 4QRRE 3QEHA 1B6DA 1J1PH 5MEQA 3CZNA 1A4AA 2CR3A 3U0TB 2R0LL 4WDIB 2NY1C 4L18A 3GQFA 4N0YH 4ZPTB 2MHAB 1HEZA 1LE9B 3CZUB 1S9WB 4XBGA 1JGEB 5CZRA 1N5YH 3WEXA 1TVDA 4Q6KA 3QGVA 1JYVA 4ZMWA 1XF1A 2IAAC 4MNHA 1MXDA 2A38A 2XTSA 2ZJSL 3SDXE 3WY1A 4FTVD 4KTDH 4ZFZA 2EYSB 2ZYRA 4OZHE 3BO8B 3T0WA 3CFBB 4X8GA 2H4EA 3VTMA 4NO2A 4HFWA 3QPKA 3FN0H 2FJHA 3K72A 2P8PB 1EO8L 3WHE1 3WHXB 1RUPH 5B3JF 5INCA 3UERA 4C4KT 1QLFA 1EAQA 3D2UD 3S4SG 1DJXA 2B3IA 4CILA 3LN5A 2PCXA 5MEPB 4NNPL 3A6BH 3QDGE 1L3NA 5KYUB 3N6YA 4LKCB 3FUMA 2EXYC 1ANUA 4PJ7A 1XF3A 4HCRL 3DRTB 4XCEA 3H3PH 4LCWB 3LB6D 1FFNA 2AJYL 2MOVA 1I8KA 4OSUL 4PB0H 4ESKA 2AQ3A 4HUXA 5D2LB 1EJ6A 3MLSL 4Z7IA 4G8FB 3QJXA 5MERA 1F2QA 3FTVA 4R5XA 4EVNA 1TETH 4R7VA 1KCUH 3R8QA 1O7DE 4MYPA 1FCGA 4N85A 5IF0B 4GBXA 3ZYZA 3QHFH 4YXLH 4XXCC 3PP4L 4L37A 4XN4A 3EFDL 1KTJA 3K7UA 1YYML 1A3LH 3HBQA 3X3FH 2V9QA 3TYGH 2BSTA 4XE5B 3EH2A 3C2AL 3GHPA 5T8IA 4Z3FA 2PPAA 1GZQB 1UD4A 5LXGL 2WLIB 3NJMA 1CJYA 5BW7A 2IO5A 5IEKA 4NFCA 3SZKC 5DFTA 4KK5C 1BXUA 2W38A 1P4LA 4Y4KC 2AEIT 2IPTH 3OKDB 4Y2OB 3UTTB 3EGXA 2OMNA 3BW9A 3MV9E 2WMPA 2X6BA 4Q4IA 4RMQA 4CSTA 1DL7L 4KKRA 1KBVA 1JPFB 2UWEB 3IMRA 3DGGA 3QORB 1RZGA 4L23A 4ENEC 4O51B 2G5RA 3L2NA 5IMOA 2EP6A 4HIEA 4KROB 1NPNA 4U1LB 4F1ZA 1UYWL 2YAEA 5HI3C 4YR6B 4YO0A 3RDTB 4V1DB 5GGRY 4R4FH 3WTXA 3P0YL 2NYYD 4JCLA 1HAWA 3EKCA 5F9JB 4YLBA 4IS6A 4YIQB 5M95B 5FYLL 2Z6FA 5CJ5A 1Z5YD 5D7IA 5TGBB 2QR0B 2G75B 1V7NL 3GMRA 4G7RB 3TA4D 2UZXA 4PJIF 4Y1AB 1S5IH 1YPZE 1D9KA 4JX0A 2NXYB 4L29A 1S7XB 4W9DC 3BFOA 5IUSA 1KC5L 3WE6A 4LLUA 2F08A 5GRWA 1X4ZA 3VSUA 3AREC 4FA8A 3GNMH 4QYAA 5IHUL 1TPXB 3NFPA 1G9NL 5IREA 4H1LG 1SDDB 4EOWH 5E6ZA 4F3FA 1KPVA 4UIKL 5IT2H 5T1MA 4HFUH 2GKIA 1OAUL 2VLRD 3RPBA 1FDLL 2WVTA 1CLYH 3MLUH 1HH9A 1RK0A 4WWPA 3JYBA 3A6OA 4HP5A 3TWYA 5AB1A 2DYRB 4GSDH 2WSKA 3P4MA 4WLCA 3WS6C 3QQDA 1TEFA 1JI1A 4M29A 1OCCB 5F7AA 3VD2A 2NX5D 3RU8H 3JXAA 2Y6SD 1EK3A 3LPWA 3O45A 4F7PA 4UQIM 3DUUB 4I0PD 3H6JA 3D50A 2NTFA 2J71A 4LBAA 4P23B 5EBWB 2VSDA 3SPCA 2VN4A 1A66A 3IGKA 3U4EB 4BD4A 3CDYA 3TV3H 3S2AA 4PJDF 1KGXA 3OV6A 1IKOP 3CBJB 4DT2A 5CZVL 3RFZA 2VZ3A 4U6YA 2EDBA 4F3FB 2Z0UA 3PP3H 3FZUC 4POZC 1NDMB 4IOSA 1IT9L 3ALWA 4JO2H 2IF7A 2F5AL 2RR3A 1FNSH 3GSXB 1DN0B 2I85A 4BH7A 2DQGH 1YEHH 4G9FD 4F7KA 3MGOB 1F2XK 5KS9B 4L4VE 4PJXE 3V4UL 2MWCA 1ZV2A 5SWZD 3FU3A 3TFBA 1ZEAH 3Q06A 3MDJA 1B0IA 1KYUA 4X4YA 1NFDB 1A14H 3TJPA 1AI1H 1EHLH 1MHEA 5E8DL 5IBUG 5F3HA 4HV8B 4AZUA 1BIIB 5BOZG 4I4WB 2CGRH 4X98B 4ZQTA 2JKTM 4ODVL 3FJTA 2E3VA 1CQYA 1H3TA 3RI5F 1QFHA 5DMIL 4YJZL 1HX0A 3F7QA 3DUUA 2VERN 3HNTL 4LLMB 4C54A 3QA3A 1CBVH 3I6LE 1H0DB 1G7HA 3Q8CA 4N2DA 4M5ZH 1JPFA 3GBLA 1T1ZA 5I6MA 5I1JL 3J07A 4X4KA 5FM8A 3VRLE 4C4BA 4PJFB 3ATEA 2VITA 3RAJH 3OHXB 4N1EA 1W72H 1YPZF 5C3LD 1LP9F 4N2MA 2WZ5A 4GQ9H 4DN4H 4YL4A 1NGXA 3QFDA 4GKSA 1S2EA 1S8DB 4QRPD 4YHPA 2OYKA 5K9JH 1KB5L 1UATA 1O7VA 2QDVA 1QEXA 2W65B 3TWCH 4YHLL 4BM7A 4HOZA 3RIAK 1AMYA 2XY2A 1TLKA 3EDFA 4LU5L 4NLHA 4QD2E 3SY0B 1KEGH 1U0QA 3LRSB 5C71A 5I6XC 3IDUA 5ICYA 3L3OA 2PO6D 3S8WA 1BMZA 1Q72L 2I5YL 5AVVB 2IMMA 2WXHA 2WKGA 2HG5B 3OBAA 4G8GE 2EVIA 1RJZB 2FIRT 3G08B 3OZLA 4JANA 1TMCB 3W39A 2VXUH 3A22A 3NK4A 5DFWH 1YN6A 5JUEL 3UTPE 1T83A 1F02I 2Y2WA 3OSVA 3T4YB 4JFOB 4Y19D 1DR9A 3I85A 3BDXA 4EVNB 1QFWM 3LZQA 4IOFD 1FSKB 3S35H 2GFBA 4KZDL 2CBPA 4PTUB 1TENA 1TKWB 3EOAB 3BN3B 4U3XA 3NIFB 4M7JH 4X5XB 3ROLA 2R15A 1ZT4A 4XCEB 3L3GB 2YA2A 3GMQA 5T1LA 3T65B 4ZFGH 2XY1A 1J8HB 1N19A 2QEJA 3HC3H 4QHLA 1R9FA 3P0GB 4YHPB 5E5MA 1IC5L 3BMWA 4PB9H 4FHJA 4Y19A 3RWIA 1F41A 3HG1B 2A4ZA 2X28A 3EGXB 4S10A 2XX0A 2WXQA 2Z92A 1I3VA 3QUZC 5FOJA 1VLXA 1SYVA 5IK3B 1I8IA 2AMUA 3VXSB 4BFBD 1A6UL 2C1OA 3LD8C 3VSQA 2AK4D 3KWWB 3KWVA 3BVDB 3BGFB 3QWNA 5D7KE 4OZIB 5JTWA 4AEFA 4WI6A 5KEZA 1AMXA 2MQCA 4R0LB 5C3IA 1JHKL 2A7BA 3B2UD 5B38B 4WI7A 2EYRA 5CP7A 5KAQG 1WHOA 4H8HA 4JR9L 4YHKL 5BXFB 3LXBA 1SMAA 2X6MA 4OGYH 3ZZSA 2QGBA 4LSUL 1SVZA 4ODTH 2Q8AL 4FFWD 4LLWA 4ODSH 5J06A 2R4RH 3R7RA 4QKXB 3QAZB 4WW2C 5M94B 1QACA 2GTQA 4HAGA 4HC1H 2PXYA 3OG6B 3VFUB 3DROB 3EH1A 2VXQH 3SO5A 4J8RA 4GY4A 4I5BB 1M6OB 3FCTA 3L17A 4N0YL 4XO4A 2R0WH 4WK0B 3JZ7A 4PRHB 3SDAB 5EU6D 4MZRA 2NY2D 4HFUL 1E28A 3GRBA 3STZA 4ONHA 1GGUA 1FFQA 3L3HB 1OP4A 4UQ9A 3A47A 5CJ8A 1CFNB 5DJ2A 1KXHA 4EF3A 4L3ED 4LGPB 4PJEE 3KR3H 4W4NA 3L5IA 5EO1A 1BVNP 3BP4B 5KYUA 5GRUL 1PW3A 2NZIA 4PJFE 2AJZB 4YGVB 3HE7C 1MVUB 1CLZH 4Y7MA 4MAUL 4UAOC 4PY8J 4JFXB 2FEDC 1ZY9A 1IBZA 4GRWH 4ZPVB 5CWSA 2DQIL 2EDWA 4M6NL 5GRVL 4DPAX 2ZICA 5EOQL 1UJ3A 4RRPG 3RKDD 4L9LB 1G5AA 4EZKA 5D70H 4PGCB 5DTFB 1OAKL 3B1TA 4GXUM 2Q7YA 4KKPA 3TVMD 3ZKXB 3BUTA 4C59B 4Y5YC 1WFTA 2EC8A 4J3OD 1URZA 2W5PA 1XGRA 4HJSA 3V7AE 1KJ2H 3E9UA 1FCCA 4WSKA 1AKPA 4A2LA 3K6DA 3FK3A 5I1KL 3HI1B 4U1KB 1KLUB 4WNQB 3T0ED 3NT0A 4KTEH 4F33B 2M2DA 2TRHA 5HXMA 1M57B 4QOKE 4WJ5A 2WYHA 4AEHL 2VDLB 3R0NA 3JV6B 3G5YB 4QDGA 4UOZA 4I2XA 3FXIC 3ABZA 3OXRB 5E99L 2VLKB 4JG9A 4TNWK 1R5VB 4NERA 4JEGB 3HZKA 3BPCB 5AZ2L 1ZWIB 2JI1A 2Q5BA 4E9VA 2HXAA 5H4YA 3V0VB 1FV1B 1CFVH 1SVCP 1G6RL 1R6VA 3BGMB 3SBRA 2W9DH 5LVEA 1S7TB 2NNAB 4GAJL 4RVBA 4NZTH 3V0GA 3ZL4H 4JJ5B 4DQAA 3HR5A 4LNRA 2PABA 1QI5A 2FUTA 3P9MB 5I1JH 2WNXA 1W8OA 4UU9A 1CFSA 2C9AA 4CSZA 4N26A 3K2MC 3EGDB 3M86A 1PDKB 4L1BA 3IJSA 3VFPB 4AQOA 3ET9F 3JVGC 1Z3RA 3VD3A 4APXA 4F8NA 1S7QB 3QH3A 3T2NH 3SOBH 5FAAA 3X14B 3F8UB 1JJUA 1FFOB 5IB1A 3S5YA 4RISL 3SKOB 2XWZA 3V4PB 1XIWC 3DO3A 2KQMA 3H4HA 3MRFA 3OAZK 4G43B 1DFBL 5F0JB 1R75A 4LEXH 1ORQA 1KXQA 1R1CA 1NIEA 1G7LA 4NZFA 2IOMA 1WE5A 2P46B 1FH2A 4NSKB 1CFSB 3CIQA 4GBXD 1DQDH 1KC5H 3EH5B 3BLBA 4NQEE 3TA3A 3G9AB 4IJ3C 5C3TA 4XBPA 5IHUH 3BH4A 3MRBA 5D72H 3UZQA 1CT8A 3QDHA 3ESMA 1KPVB 1A7PL 3ZKQD 5ISZE 2LLLA 1IILE 3MROA 2BIQA 3H9HB 3PS6A 4G11A 4YDVB 1B9KA 2XV0A 4FA6A 3PUUA 2AJXH 4K5MA 4ZFGL 3T6XA 4LP4A 1JZ7A 3CLEL 1IC5H 5BUPA 5IV2B 2EC9T 3DVGB 5E2WH 1TXKA 2J6EA 2XVBA 3K8MA 4AUUA 3FL7A 4J1UA 3S37H 2NLJB 1OPGH 3D87B 2BVUA 4F7MB 5CUSL 4F1SA 4XMTA 1EZUA 3KLAB 1FNGA 4X7CC 3ASWA 5HGAA 3TO2B 1U42A 2BIHA 2FX9L 1PD0A 2HFTA 4LFHG 2GAZA 2J3SA 3FO2B 3QULB 1Q9KA 3FB7A 1F4WL 2CKBB 1CGXA 3DIVA 4XVUC 3TV3L 3VXTA 4FNRA 2D0GA 1ET5A 3DOSB 3LMJH 4XNUH 4GQZA 4PBXA 4BFGA 4LL1A 1T0MA 2NDGA 4QTIL 4XPBH 1LO3H 4UYQA 3RHWF 9PCYA 3K0YA 3ARGC 2OMYA 3M1BB 1EXUB 2YBRA 3QWRA 1F13A 1J8HE 2WYTA 2WUCL 4ZW6A 3SDDD 4JRXB 3N5AA 4XNZC 1I9EA 3V6ZA 1HOCB 3KDMA 5HHQA 2KERA 4NB7A 5LGHL 3GB7B 4P05A 3TBTB 4FJZA 2ENJA 5C0NC 1E7VA 3MV01 2HYMA 1TJGH 1BV8A 4HJUA 5ETUA 2CKBL 3P77A 4GI9A 2BSED 3QXWA 4FFZA 4G8GB 4MQ7B 2DBLH 5E4IA 3NCCB 3ARDC 2RH0A 4Y16C 4ZS7H 1TQSA 3TCXA 4M3KB 4UIMA 4QRPE 3A3YB 4JQXC 1Y0LB 3HI6H 3CFUA 4MNGE 4FTVE 4WWID 3W11C 3ZMRA 3HUJA 4HQQH 4K3DH 4LDOB 1DEEA 4P2QB 3ZZ1A 4CW1A 4HJIA 1T7ZA 2H3NA 1KACB 5FO9B 2K7PA 5JO5A 2BS71 3CBRA 3RAJL 3MRIA 3ZUNC 3IGFA 1NL0L 5CGYC 3CFEA 1T2QH 4HGWB 4HBCH 3WLWD 1JD7A 3I3DA 1CTOA 2VLRA 1E6JL 3VE0B 3RGHA 4L4TE 4AJ0A 2Y06H 2XX1A 2GEEA 3BXNB 2OV0A 3FB8A 5T3ZH 1U8NA 4YHYB 2ICWB 3L3JA 4YHLH 4ZOCA 5FF6B 4QRQA 4X6DE 4UT6H 1OAQH 2G2NA 3U7WL 4WTZA 4Z7UB 5ISZD 3EYQD 3SDCD 3V0WL 3VVVA 1NPJA 3M88A 3SDXA 4XMPL 4DO6A 3LYRA 4LL9A 3HZ3A 4JFFA 4J3OG 3UGUA 3HHSB 2WXFA 1BFTA 1C5DB 4LVNB 5D2NA 2X3BA 3HN3A 4S2SA 2OLDA 5EO9B 4DF9A 3QW9A 1VGEL 3H9ZA 3KHOA 3AU1B 4N5UA 1FO0H 4MQSB 1PZBA 3FUNA 1ZD6A 1A7NL 1KIUB 1NLBH 1MIMH 5AW2B 4HK3J 2XC8A 4Y4KB 4LARL 5C07B 4U1MA 3AT0A 5CINL 4YZFF 3ROLB 3MFGB 1QNIA 5I1LB 5K9OA 1G6RH 2Z4TA 2E86A 3MACH 1AFVH 1WGVA 1D6VL 3AITA 4L4VB 2YXVA 4PJXB 5IVXF 3LKNA 2OW7A 2P5WE 3CFQA 4M7ZB 1JWSB 1B0WA 5FIEA 1FLTX 2J8UB 2YRPA 5E9DB 2GJZA 5C0AB 5L2KA 2VLLA 2HB0A 4OD2A 1S7SA 5F2FA 3H9SA 5T3XH 2DIJA 3AW5A 3G9VA 4E9LA 4JREC 1SLWA 2XJKA 4KNTA 4ELMB 4JB9H 1J5HA 2CD0A 2VDLL 2Y4SA 3QEUA 3QO0B 5KSUA 2WTRB 4KXDA 5ADOH 4PRPE 1MW1A 4FZ8L 5FUOL 2LT9A 1MHPH 2UX7A 4H13C 1XR9B 3NCFB 2WBKA 4I0PB 3ZTNL 4ZUWB 1D6EA 3I74A 5EZPA 2YA0A 1WAAE 4LCIH 4J6IA 5CJBA 1S8DA 2F61A 2BNRA 3F12A 1NCTA 3MRCA 1ODAA 4U3SA 2OMZA 3WEBA 2OTPA 3VXNB 4LLYA 3VB9A 1HZKA 3MFFA 4IBWA 1CXIA 4GFXA 5ID1A 3NFSH 1LE5A 3VWKB 2BCKB 1KTBA 2VDMH 3PWUB 4LVHC 4BCZA 3ARED 1J12A 1J05A 4JPKL 3IKCB 3HG5A 1AO7D 1LNUB 4MJIB 3T0EE 3UEZA 1H5BC 3PDGA 2FATL 3D9AH 4HIXL 4JM2B 4ORZC 4BZ2A 3V6FA 4P57B 3MXWL 3DUHA 5B1BB 3NABL 4EDWH 2FGWL 1D5XB 3DX9B 4FFZH 3TEUA 4DW2L 2I9TA 3CZSA 2E4FA 4F27A 2G9HB 5F1KC 4OF3A 1JWUB 2ED6A 1W0VA 3LVTA 5F3BA 3MGOA 1LMIA 5IMMB 3PPSA 5KN5B 1WAPA 4FFVC 1ND0B 3QNXB 5I6NA 3MV9D 5KYWA 3NIFE 2ALAA 2FK9A 3MNDA 1DN0A 2DWSA 3FQNA 4FNUA 3SE6A 3PAYA 2YKLL 4TSAH 5IHLB 1J8RA 4TSBL 1KENL 2FX9H 1OT4A 5E51A 1AP2A 1KIQB 1PSKL 2HVKA 3BPLB 2OXGB 2NY5L 1N4XL 1A47A 4L3EE 4F7EB 4XMWA 3RNKA 5IB4B 4CRPA 1GJUA 1NGWB 2NZ1A 2WW8A 3GSQA 4JDEA 4LSSL 5BRZA 4XPBL 1Q9WB 3IU4L 1NZRA 1M71B 3F7YA 5DA4A 3QWRD 3FU7A 1M7UA 2L7JA 2X9XA 2DQFA 3APMA 1ESOA 2B4CC 2L4OA 3U1SL 2V2TA 2NUTA 3CD4A 5F89B 3TBYA 1SLXA 2AABL 1ITCA 3LZPA 1EEZA 1FIGH 5DJZB 4H8UA 4ZG1A 1NKOA 2TSBA 3CVIH 4PGEB 4HJTA 1BIHA 2UZIH 2O5ZL 1FVCB 1TZIA 3QG6A 1N67A 4WO4A 1ZJAA 3NIGF 3D4ZA 4MS8C 2ZSWB 5E2JA 4KU1A 4P3DA 2F0CA 4HGMA 6FABH 5GS0D 2JI3A 4P4KC 1PZ5A 3ESVF 2Q87A 4E41A 4Z7WF 1MPAL 1T4KB 4WHTA 5DJAB 2LVEA 3RYMA 2WTPA 1C5BH 4Z7AA 1BOGA 5C2BH 1JDDA 4ZZKA 2WHVA 4MMYA 4PJ9D 5ESQA 2YD1A 3HCVA 5SWZB 1ILUA 1F56A 4N28A 4PLNC 5DS1A 3ALPA 1SJVA 2XNAA 3O2DL 5I15H 4AYBA 3GMRB 5I6XB 1C9SA 5I2IB 4A6YL 1IBFA 3SO3C 1X6LA 2EKSA 3HA0A 3QJVB 3ML9A 5T3ZL 5KS9E 5DLMH 4QRUA 2ZXEB 3T2OA 1IAIH 4MMXA 1A3RL 3DMMA 4K3JH 1YNLL 4LPXA 2J73A 2HFFB 3RP1A 3ARVA 2XIDA 1GS6X 1V5JA 4M02A 5CZXC 5GRVK 1G7QB 1CZ8L 2R69L 1TQTA 2BCKA 4HETA 5EO0B 3VD0A 2WO4A 1MLBA 2ZUWA 3QJRB 4L2LA 4NNYA 4OUUA 3RKPA 4FQCH 1F97A 3B9KD 3P1VA 2CH8A 4YDMA 4POUB 3RVUD 1ZK9A 2K70A 2A6IA 2BVEA 3CXHK 5JHLH 5A16A 4HJ0C 3DO7B 3KPRD 5D2LF 4BEIA 3ZHDA 1JE6A 1SFDA 4HHGA 5DHVB 1AR2A 4XVSH 1FJ1B 5IROC 2HJLB 4F92B 2P5ED 4LVOB 4G8EA 3CHSA 4OJCA 3D69A 2YZ8A 1FRGH 4L3FA 3QUZB 3H55A 4CMMA 1A3QA 2IG2L 1Q1JH 1U4EA 4B3VA 3KL0A 4AEIL 1EFXB 3B56A 4OGXL 5JZ7D 3GIZL 2DIBA 3NFNA 1H6TA 2WAQA 4JFUA 2WZPA 3WJLA 2FB4L 3UEQA 1YEGH 1T1XA 2HT4C 4E5XA 4EKJA 4GO8A 4N0FA 3TXAA 1RK7A 4HEPA 4NPKA 5IM7B 2F54A 4GQPH 5J1AB 5CN1A 5F7EL 4AKQA 4XRCB 4FQPA 1UEMA 2WZAA 3OB8A 4D9LH 2D7QA 2HLEB 4XNQA 1IAOB 2OMTB 4HS8H 3ZTNH 3MBEC 4KOBA 3TZVD 1T1YB 1TSRA 1A6PA 1Q0XL 5F0PB 5A7BA 1HL4A 1YEJH 1OAXH 1CDYA 1FGVL 3HMWH 4R97B 4IHOA 4ZSOE 4PY7A 3WJMB 1HIML 2L7QA 2XG4B 3CQPA 5FECA 1RQ5A 5GGQH 1HKLH 1HWHB 3OAYK 2ZX7A 1TITA 2DI7A 3QJHB 2VDML 1H15A 2GUOA 2RTTA 4Z0XB 4FABH 1NLDH 3EYFA 1QKZL 1SYVB 1SJEA 4FHBD 5KSBF 2QDWA 4FQXC 4JO5A 2BRRH 1Q9OA 3HS0C 1XGRB 1JVKA 4HT1H 4Y8DC 3TEZA 3P4NB 3HFFA 4S1RH 4S1DD 4NCC1 1ED3B 5H8DA 5F9AC 4Q2ZA 4ZMNA 5I0ZA 3DOSA 3WU1A 3UFIA 5EEYA 3FFCD 3NIFF 1TMQA 4Y2DD 1PZUB 4HJEA 5IUCA 4MA1C 4WFED 3K2UL 1D7FA 12E8L 4MA3B 2QGEA 4OZIE 2FO4A 2NY0B 4EI5D 3X1BA 5DJYA 4ALAC 1RUPL 1H15B 1SEQH 3AJ7A 1RZJH 5MEQB 5CGBA 3MUGB 2ZP0T 1I1AD 1T0PB 3Q3GA 1E6OH 3ULVL 3GM8A 2ADGB 4IHOB 4U33A 3WKPA 2ZWNA 2AEQL 1KENH 4DUXA 4PRHD 2VN7A 1BLIA 4E0RB 1J5DA 3PL6C 4X7EC 4C55A 3PNRB 4RETB 3F65A 2W81C 4Y16A 5SX5K 3WKNA 3FHQA 5I1CL 5ICYB 1NBZB 1CXLA 5D7HA 2Y0SA 5CCKH 1I75A 3SY0A 3O6FB 3UGEA 4UT6L 2R4SH 4FQHB 4PP2B 3VW3L 2M26A 1SY6L 4PRIB 2VWEE 4JFPB 2ODHA 2ICEC 5I28A 3DX0A 1FNSL 2OXHA 2DLHA 5KBNC 3F3HA 4A2HA 2F74A 1TU2B 3WL9A 1WBZA 1BMGA 2KDYA 1GYAA 1JF1A 3Q44A 3PV6A 5BS0D 4ZQKB 3SY6A 1A3LL 3KBEA 3N55A 5EC2A 4AGMA 4N22A 5E8EA 4QHPA 2NSXA 1ASQA 2X4SB 4CNIB 4FYQA 5HGDA 4JZNA 4B95C 3QUZA 3IDJB 4G5AA 3BQUB 3CFCH 1L0YA 4H44C 1KCVH 2P1YA 2J1YA 2X4RB 2V3FA 4OZHF 3S3BB 4BUQA 3EJQA 2XFXA 1A4KB 5DRXB 1EDYA 2OYLA 2EILB 4PJGF 2IH8A 1WJ3A 4RGMB 1XIWA 2XVGA 4Y0GA 3WUWB 3K3QA 3FUHA 3DA0A 1IGJB 2A83B 4U6XA 4LKXB 1WQVT 4DKEH 5C1MB 2GIXA 2Y7SA 3BT2L 3G6JA 3PWJB 3KHQA 5B3SB 3EJPA 3PHQB 4XPHL 4D9QE 5C8JA 5IR1B 4MD4B 4WGWB 3HUJE 3N1PC 4WV1B 5DUML 1TJXA 1BQRA 2D2CC 5AOIA 1E8ZA 4NJ9H 4F15B 3US1A 2XQYA 5T3ZD 3GUTB 1HXKA 3H42H 3L4XA 4PG2A 1AO7E 2J1KA 1B0RA 3QDME 2Z31C 1VSCA 2HKFH 2EO1A 3BFWA 3O3BA 4MJ6A 1RJZA 3QO1B 2NYKA 3V5DA 1YDPA 4CU6A 4EXKA 3QJFA 4YWGH 4U0QB 3HBPA 3GSNB 4OZIF 2QPEB 2VDOB 4E41D 1DTUA 3GRWH 5KVEH 1DBBL 1UVQB 4P3WA 5EIIG 1GMEA 5L8JB 3P3RA 3JV4A 4XNYH 2OMWB 4L8BB 4KK8D 2NXZB 5MENA 1ICTA 4HGKC 1F45A 2IBBA 2X6UA 2DTMH 3ML8A 5BVJB 2NY4D 1GS8A 1FBIH 3U6RA 3N1QC 2ZT9C 4FKEA 3CN2A 4BZ2H 2ZYIA 1SM3L 3U2SA 1QRNA 3WO3B 2YC1A 4I3RL 3G5ZB 3CSFA 4YHNA 3N44B 5G4OA 3HE6A 1CGTA 2K9FB 3RGVD 1AHWB 4GSDL 4JUSA 5C70A 1RMFL 4BFJA 5DC2A 1BX2A 2YAHA 5DO2D 1L4IA 3B6SB 1MFBH 2LV4A 5DWUH 1HU8A 4ZUTA 4BZYA 1IKNA 4FE9A 5BRZD 5F7EH 5BUAA 3L9RB 1P5VA 1LWRA 4P23C 3STLB 3LKSA 4FG4A 2JKWA 2E75C 2R0KL 4HS6A 2GT9A 4FTVA 5F6HJ 2W07B 2APBA 4Q6IA 1I1CA 1XGTA 3EDJA 3VDBA 1CURA 2PPFA 1RUKH 4NYLA 2Q7AA 3IPBA 4L4JA 4YR6A 3A6CL 3RDTA 4OFIA 3FPYA 1T03L 5B4MC 1K8DA 1RJYB 2R4RL 3HS0A 2J8OA 2IGLA 4QUOA 4Z76B 1IQWL 2L8AA 5A6MA 5EOTA 4KMQA 5F96L 2VLJE 4HMDA 4O2CB 3VXNA 5DFVC 4BKLB 3N40P 3KPNB 5TE7L 1CI3M 3O11A 4H25A 3T3PF 2A6JB 5HGBA 4G80A 3TBVB 1A6ZB 3QQ9D 2EXYD 3LHAA 1ZLUK 2FR4B 1AS8A 1QD0A 1DDHA 4XP5L 2IH1A 4I48A 1WBXB 4BCYA 3CZGA 5C08B 4ZX3A 1MIEL 5IFJA 5T3ZE 1D5ZA 3KPOA 2BSTB 3QYNA 3LIZL 4NT6A 5GGVH 3HPLA 4YHYC 4XX1E 3HKFA 4DK6A 4HWBH 2ZOWA 1INEH 1J8HA 3WJLC 2QPUA 1R3KA 1ADWA 3W9EB 4NN6C 4DCQA 2JCCB 1ID5I 3RX9A 4AV5A 5I1CH 1BQKA 3DHPA 1E50A 4ONOA 5DZAA 2YPLE 4K7PY 3OMNB 4FTDA 2YO3A 1KXTB 2JJSA 1XR8A 1CICC 3QEUB 3SKUD 4M5YH 4I5BA 1DLHB 2GJRA 4IIQC 1KJ2B 3AB0B 3KM2A 4XE0A 2J2ZB 4PEEA 1ZA3A 2FSEB 3CNKA 5TQ2H 3K91A 4PTTA 3GXNA 3CN0A 5FHBH 2PXYC 2E7MA 3VI4E 3F7RA 3FQWB 5CEYA 2XA8L 2G75A 2J8UA 4TRPL 4Y4HA 2GJ6E 5FCUL 1IL1B 4JKMA 4IS6B 1JFHA 3DX6B 3INOA 1YUHB 4Q0XL 4PJDB 2HAZA 1CLOL 4ZD3H 3RDJA 4UT7H 3O6KH 3DTUB 3FO9A 1KPRB 2ESVE 3F6LA 1U8PA 2A74A 2J4WH 3R06B 4RAVA 4V1DA 4Z7VB 5TH2B 1HHHB 3BMVA 2NY3B 4LAJH 1CD0A 2H26B 3VUAA 1KXQE 1IFRA 1AO7B 4MJID 1NBVH 3PREA 4XB8A 5C0CB 3UTSA 4PJCE 2BY1A 4AQ8A 5F6HI 1LO4L 2FLMA 3H9SD 4QOKB 3KJ6H 2A99A 5GSVA 4F9LC 1NGQH 2C9SA 2OS7A 4XXDA 2MNWA 2BP5M 1AXTH 1I85A 1OGAA 3E3QE 1PD1A 2ZD0A 3MRHB 3QEHB 4PRHE 3DK2A 2RQEA 3GSOA 4R5TA 5DD3L 2JELL 1G7HB 5F6IB 3VQ1C 1GCYA 3OGOE 2BJMH 3LD8B 4OUOA 3QG7L 1JCVA 4U1JB 3MUY1 1AKJD 3S5LB 1AC0A 3IDGB 1F8TL 4RAVB 5CR8A 4CC4A 2Z65C 3QJOA 5EU4B 4F9LA 2DL2A 2FL5A 3JSSA 5IB5B 3FO9B 1F4AA 2D3VA 3CMOH 5CN3A 3D06A 4OF6A 1AANA 2K0RA 1OAXL 4M1CD 4POYA 4P46C 1CE1H 5E9DD 2YZ1A 5GGTA 2VW7A 4JPSA 3LQZB 4EI5C 2QVTA 4JM2C 4KXZH 2ZXDA 3TZVC 3PWPA 5F88B 4XWGH 1GJWA 3NEXA 1ML0A 3BT0A 3ECQA 4YOKA 1F6FB 1TEYA 4U1GC 3RJQB 3U9PH 3KLHD 4JY4A 2W91A 4KKLC 4M7LL 5DGQA 3U9WA 4F8OA 1JPEA 4U6YB 3MRJB 4E9WA 1KCRH 1FBIL 3NG5A 3QRFM 1U6AH 1JV2B 3CDFA 5AQ0A 1K2DA 5B1AB 4PJXF 5FCSH 2CJSA 5T33L 3EFOA 12E8H 5F89A 3TBYB 1WFOA 1VIWA 2XZCH 4YK4C 3HPLB 2LU5A 3QJHA 1TR7A 5AAWC 4IBLT 3D2UA 3OC5A 3KEDA 3WLBA 5HI4C 3GSNL 3IT8D 4LDEB 3VXRB 1E5ZA 2HKHL 2NQDA 1DVUA 1PIFA 1EHNA 5AW6B 3AT8A 1MQKL 4CDGC 5DDHA 4EZLA 3D4GA 2R1YB 3NTCH 4ZJ9A 3UH8A 4G7SB 2PYFA 4PRPB 1JYWA 4N2IA 5SX4H 1I3GH 3D30A 1AE6L 5B39G 2WANA 1X6NA 4Q9RH 2ZAGA 3QUXA 1YNTF 1LK2B 2G3XA 2HRLA 3LIZA 1K8DB 1RJYA 3SDDA 1CE6B 2VDRH 4S11A 3EJTA 2GJPA 4OJYA 1A6VH 3MCYA 1XWVA 1NM9A 2HT3D 2CBMA 2ZWSA 2VTFA 1UUSA 4Y2LA 3KVDD 1BZ9B 4WW1A 2XQBH 4F5CA 1MVFA 1ROWA 4MCMA 1YY8B 4QHKJ 1CO1A 4PWEA 4G8GA 1Z5LA 1OTUD 2XWEA 1JGUH 3L9RA 1MJ8L 1OD9A 3VYNA 3GB7A 4P23A 5EBWA 1JERA 3VG0L 1CFVL 3MSPA 3V6OE 1N26A 3B9KC 1UXWB 4HIEB 4A7SA 4O51A 4JKPH 3MV7A 4A39A 1OSPH 3F6JA 1KGUA 3TNNA 3QWOA 3BSZL 2AEOA 3ULUD 3AG1B 1KPUB 3DSFL 4JDVA 4MXQC 1E43A 2DD8L 5FX3A 4MDJA 2EDJA 3IM1A 3US9A 3WAJA 4Z9KB 1DLFL 5IBUB 1U8IA 4YPGB 5GGRA 4FAAB 1AGBB 2P45B 4JZOA 5JLZB 1NC2A 4HISA 2ZCHL 5KSAB 1HNYA 1MFUA 4WI5A 1BD2A 4UQ3A 1JSYA 4AYFB 2VERA 4IOFC 2EO9A 4NM4L 1FAIL 4PJCB 4FQIL 3VXMA 5FWRA 3I6GA 4L8BA 5G2NA 1YY8A 3Q8FA 1PPIA 4ANKA 5DHYB 1I7TA 3D33A 4IRSD 1R5IB 3BFQG 1O6TA 2KLSA 2ZX6A 3QZLA 4R5VA 5GZND 3FQYA 4TVPD 5DUJA 2J1ZA 1FH5L 1CLCA 3WAKA 4A63A 4ZTEA 3ABGA 4KO7A 1RZ8A 4BV1A 1EHAA 1R3LA 3Q48A 3GUTA 4U1KA 2C9VA 3KYKH 4QXWA 2PTTA 1AG6A 4JHWL 5DRZB 2MMXA 2AK4E 2F7QA 2ITDB 3MACL 4MAYA 4E68A 1MAMH 3L16A 4M6OH 4IQHA 4Z77B 3WENA 2D7TH 2EIZA 1LO4H 2GVYA 4YHIA 5GGRB 5I1IL 3VD4A 5DHYA 5F71A 3SODB 3KJ6L 4ZX6A 4JVWA 4D9RE 3SGJC 2EUXA 3I50L 4P5TA 1QABA 4IRJD 5D5MB 1YEEH 1Q9OB 4AZ8A 4HPYH 1QRNE 2GCYA 2DJ4A 2QFRA 2XLLA 3EYFB 2FHCA 5BVPH 2XFXB 1PG7W 4GB9A 5EU7E 5LNDA 4JFQA 3X17A 5INCB 5B1KA 4MMZA 3OWEA 5LHDA 3I3EA 4W1TA 3BRDA 2PO6A 5IB4A 3RNKB 3N9GH 1XT5A 4HKZA 4AUJA 4QAMB 4M1DL 1XXFC 5I0VA 3FQUB 1ECYA 1GZHC 4YDZA 4I88A 4UUJA 2E5EA 5T5FA 5HHXH 1LEKB 2L7UA 4I1RA 3MRKB 4N3TA 3MC0A 4TUJA 3GKWH 1NGPL 2VJXA 4NGHL 4GW4A 5D1QD 3WFDL 4O9HL 3MRRB 4O4YH 5CWSB 2VZUA 1U8QB 1JXFA 4XTRC 4EO5A 3ASOB 4H26B 1OANA 3PWNB 4Z7QE 1IGFH 4N0FB 3S37X 2JTDA 4ERSL 2Y6TE 4JQIL 2K6WA 3DO4A 4OKDA 4DTGL 1IU1A 4TUUA 1FF5A 4AG4L 2OCCB 3GBML 2J8HA 5CFHA 3B8SA 4AGOA 4ODHH 3A5VA 4Y16B 2I25N 4S1SL 1QEWB 3KYMB 1HC1A 2EDOA 4R0LA 5F9OL 1PVHA 1WG3A 2I07B 3AT9A 3FN0L 3UDWA 2F5BH 4JVPA 4MCZA 2C5DC 4LEOB 3OMZA 1BD2E 2CO4A 1E8WA 3QQ9C 2ZWZA 3KJ4C 3DRQB 4OD1L 4BKSC 4MBOA 3C60A 2ZKXA 2PP8A 4YZFE 5FM5M 4CC4C 4OF5A 5DMGC 1NC4B 4ZFQA 1QFPA 3ZE2E 4AGNA 1I1YB 5JHDE 5D96C 2WB1A 5E6ID 2FEJA 1R24A 1GL4B 2CO2A 2FZ3B 3HG1E 4C56E 2GTWA 3RIKA 5FPIA 1B2WL 1MCKA 1Q38A 2V2XB 4WAFA 3GS4A 3TVMB 1JGEA 2Y2TA 1WVZA 1R3IH 2E7DA 3UBGA 5E0QA 3MTRA 2X10A 1UZ6E 1UH3A 2UWEE 4M5YL 4IBTA 1N5AA 3B5TA 3EOYG 4PTUA 4XAWL 1IT9H 1DEDA 1CU4L 5E03A 3VXUA 4AIEA 1RZFL 4HAKA 1XCQA 1JRHI 2VM9A 3NSYA 5I66B 2QKIA 4WUUE 3JV0A 3ARWA 1SPDA 4ACTA 3KDPB 2ISDA 1UT1A 3PP4H 2VDKL 5EA0H 4DUWA 2IC2A 5E5MB 2VB5A 2LQRA 1NANI 1TCRB 4KRPC 5E94A 3H7BB 4YBHA 3CC1A 1EZSA 2JV6A 4WUKL 3SPHA 2P80A 4FI7A 1Y07A 4Z77A 2PW1B 2VLKD 4YHZH 3C5SB 2UZIL 3KGUA 2K9UA 3MREA 2X70B 1AGCB 5LXGH 1JZFA 2WXGA 1CL7H 4QLRA 4EN3C 2Q86B 1QBAA 2FECI 3TBBA 3HNTH 4WWKD 3K8KA 3KPSA 4NI3A 1KJ3L 3U48A 4PGEA 1RP9A 1BW8A 2F54B 5FGRA 5J1AA 3QZBA 1GA2A 3UC0L 3FFOA 5A7EA 5AB2A 1NH6A 3X1EA 2DD8H 3EXLA 4KMLB 1YO4A 1T5XA 3L81A 5FYJH 2VRQA 1IKFH 4NNXB 4RRPM 2CDFA 3S5ZA 5HVFB 2P5PA 5I15L 3TNNB 3MKGA 3F7PC 1UH2A 2YWZA 4FERA 4F8LA 3MAWA 3H0TB 1HSBB 1L9SA 3S7GA 3NZ8A 1AJ7H 3DK0A 2EH7L 4IM8A 3V2AR 5EMYA 2F53A 3EOBA 4CKQA 5CEZL 4PV8B 1C08B 3BHBB 3AWEA 1PLGH 4LASH 3QFJB 1A5FL 4HGWA 4RMRA 4HHAB 3C5ZB 3GJEA 3QDGB 3D85A 1CZ8H 2R69H 5IG7A 3A21A 4F2MB 1BIIA 4NNYB 4PJAF 3WUZA 4LGRB 1FL3A 2NXZC 2W9EL 1V7MH 4DVRH 3CH1A 1ETZA 3MLZH 5IROA 1AQKL 1G7QA 4K8RL 4PW3A 5CBEA 1P6WA 1TQCB 3P9MA 4IU2A 3RA7L 1QR4A 3NPSC 4BSJA 4NUQA 2XXGA 3CFKA 4E9RA 2BSCA 3L6FA 3ROOA 1EWHA 1LD9A 2YRZA 1AGDA 4LBEB 3K4AA 3VM7A 1R3LB 3DVNA 4UINL 3KCPB 1FRGL 5I18L 4OF8A 1IL1A 2AXHA 2BP8B 4IU3B 3HG1D 3ILDA 2YQGA 2XTLA 1UD5A 3OM3B 4J7RA 3HC3L 3CSTA 5I1GH 1NFIA 4WI0B 25C8L 4HJJL 4AQ1C 3QJUB 4FFTA 3RPIB 4OLXH 1KBKA 2DRUA 3ULSB 1N6QL 1XCWA 4R2GB 4NC1C 2WINB 3P4LA 5I8CB 2XDHA 1UOKA 5C08A 3LRSA 4JFSA 4N8UA 3PNWA 2JCWA 3Q5YA 2J56A 2WO3B 1KLUA 1OM3H 4BQBA 4F91B 5ITBH 5I5MA 2MCAA 5B3JE 3V8CA 2XYCA 5GRYA 3QC5X 2OR9L 4B5EA 1K2DB 1KELL 2P49B 3PABA 3SE8L 1D6EB 1MHHA 3JUYA 4ZTOH 2E74C 1U8LB 3OHXA 4LSSH 2E47A 3KYOA 4PREA 5EHFA 2OTWA 3BH8B 3D25B 4OW6A 3SBWA 3ZTJG 2ITCA 4JLRA 5I8CA 3D39A 1S7RB 2IH1B 4I48B 3MRDB 4JAMA 2AK1L 2R39A 1WZKA 2VM3A 2Y6SC 3OKYA 4DAGL 3WMSA 2Y7NA 1IM3A 1RLBA 2A6DB 2ZWYA 1CD1B 3Q1SH 3RBGA 3AY2A 5CS7A 3BAXA 2V5RA 5IFAH 4YXKH 2IPUG 3NQIA 3WTYA 4QXUH 3MUUA 2V3EA 3E2HC 1JGUL 4B9PA 3KE0A 5T1MB 3ZJAA 3HRZC 1FGNL 5HHOE 1SDDA 2Y1AA 5I1HL 2XN2A 2IAMD 3CPUA 2V7HA 4MNQE 2XWCA 4HLZH 4RX4A 4WKZA 5IHZA 2X44D 2L04A 2R56L 3BP7A 4PG2C 4A2GA 1OW0A 2VMFA 1C5BL 2DQIH 5C2BL 1H5BA 3VGAB 5KJ7E 2ENPA 3DXAD 4ODXA 4JZJB 3QEGH 4K5LA 2CIIB 2CO6B 3CK0L 2V0AA 5CLZA 1U33A 3JVFC 5BS0E 3NSCA 3MRFB 2GBVA 3ZRCC 3HFMH 2PCYA 2X9YA 3RY4A 1IIKA 2X2JA 5KVGL 3BHBA 4O02H 1CCZA 1PCSA 3ISRA 1X5JA 2OULB 5HHOD 5IMKB 4HHAA 4X5RA 3L3KB 1RZQA 1CD1A 3QS2A 2KBGA 3VXRA 4GBXC 4LU5H 3W81A 3T0DA 1GY1A 3CAFA 3VW3H 1UB6B 2XZAL 2H26A 1XGQB 2QQKH 4NN5B 3KWTA 1RZGB 3NA9L 2BNUB 1JNLH 1CU4H 4XMZA 5DZPA 4DKFL 3ZZLA 3ARUA 2F7OA 5IQLA 1I8IB 1U3HA 1V05A 4ZW8A 1HWWA 5IFHH 3IJHB 4ZOBA 1BVNT 1YEDB 4OLYL 3TCLA 2G2RA 5C0RH 1NMBH 1T0NA 1EAJA 1FH5H 2H3NB 1U2YA 3MLVL 2QPFA 4NEHB 1JWMB 3KPSD 3T5WA 5MENB 3VWKD 3DVFA 4WEMB 1FZJA 1QWUA 1XR9A 4G8FA 4UOQA 3EFFA 4HUXB 5D2LA 2QJDA 1S9YA 4M00A 4B9IA 4NZRL 4HF5H 2FT8A 2WINA 1I9RH 3ULVE 3RUGF 4NPYB 2P48B 1EUTA 1UKTA 2X1PA 4PJ7B 1MWAL 5F1NA 2HCZX 4UAHA 3O9WA 4XMVA 1NJ9A 3VFWA 3WYRA 4XN1A 3EH3B 4YDJA 4GRLD 4BRJA 5KBMA 5DUPH 4OGZA 3P73B 3UTTD 2FDBP 2ZXCA 1FC1A 1FQ9C 2H1XA 4JRXA 1E4XI 5FGBA 2WLMA 4JG0L 4D9RD 3LS4H 4AE0A 2H32H 4WV1A 4H8QA 5HDQL 3GEWB 4U3CA 2OQJA 4XAKD 5GHWH 4UM9A 4Y4KD 4KROD 1FZJB 3ZYJA 4TULL 3BQUA 3OHMB 4M8VA 1A5FH 1T66C 1RUML 5KYNA 2EXWD 2FQEA 2EXWC 4JO3H 4EN3A 3TPUA 4H25B 1NIDA 4JR9H 4YHKH 5MEOB 1V8HA 5DFVD 4Y2OA 1E4WH 2MHAA 4DN3L 2VNCA 3U4KA 4AM0B 1DFXA 1N8OE 3S48A 5MENE 4ZODA 2D31B 1IBHA 4HDIB 1R0AH 3ZDZE 4OCSL 3RVWD 1HSAA 1N68A 5IEKB 1SBSL 1A0QH 2P8PA 4ZYKB 3MA7A 5HD8D 4CADB 4PVMA 5IOPA 4NS0A 3IXAB 2B59B 4X6CF 3IN0A 2DLGA 4NC0B 1KT2A 1B0GA 1LK3L 5BZWB 5AW1B 1T1YA 3GJFK 3H6AA 3EF4A 5E5UB 4P2QE 4LL4A 1RVFL 2WBJC 5MP6H 1FG2B 3CFEB 5I1AA 4G3YH 5IJCC 2NY0C 1NFDA 1D5MB 4YFLI 5DHEA 3B2VH 5JO5B 1UD3A 1E27B 2PCPB 4JFDA 3CLWA 1MG2C 2F58L 4GAAA 3KPQA 2Y5EA 3L48A 3VXRE 4BWWA 1WTGT 2DJUA 1H8NA 4NKQB 1QZNA 1RJLA 3QZWB 4UWQB 5D70L 4B5ZA 5JQ6L 4GIOA 1G0YR 5CLWA 1G7LB 3FW6A 3WEMA 1F11B 1NTDA 1JHTB 2R0KH 1KT2B 3MRNB 3GSRB 1RUQL 1PS3A 2LAAA 3C9NB 3ZZQA 2FO8A 4BSVB 2IDSA 4GW1A 1YSOA 3MA7B 4U1HB 1X4YA 3BI9X 1GGCL 1TT6A 1U92B 3DLQR 5GS1C 2UY6A 3JQOB 3ZT6A 1ODUA 1JPSL 5E8OA 2Q7NA 3RUGB 1NBYA 4ZT1A 5KS9F 2ITCB 2DMKA 2LABA 2EH8L 3W3BA 5C0DB 4WI8A 3G5ZA 5DMKB 4G70B 3ERXA 2CM6A 1DYZA 5JR1H 3B9KB 2A6JA 2I32A 4MJ6B 5J6GB 3NEEA 1N5YL 2BOCA 2IADB 1L9PA 1MELA 1HTYA 2UXTA 3BPNB 4P2OA 1EPFA 5JQHC 1CBJA 4LLVB 5EC1A 3KLAA 3D0AA 5HGAB 4OM1L 5GZNC 4C56D 2B2XL 2IAMC 5LBGA 4BFIA 1D5RA 2JB6A 3ZGIA 4MWFA 4X80L 5BV7B 1LJMA 1KZYA 1OARH 4G5ZL 4N68A 3KYMA 1MFAL 3EOTH 4NQCB 2W0FA 4TUOB 3FYIB 2WLJA 1QUNB 1I4FA 5T5FH 3AS0A 3JWNC 5DCCA 5EIQA 1OY3B 5E9NA 3TEWA 4WQOA 4PJ5E 4KKCC 4AQZA 4F15C 1UWXH 4RMSA 3RFRA 5J6HA 1GGYA 1ACCA 5BV7L 5KANI 4XMPH 3T1WA 1BM3L 4OY9A 2V37A 2Q7YB 3VG9C 4Z7NF 5C0IA 5I8OH 3CQFA 1VFUA 5DQDL 4HUNB 1UA6L 5L4IA 1KPUA 3ECVA 1NFAA 3MKKA 3QA3B 2CHDA 4AVJA 4GRMB 4C56A 5DZJA 1VZHA 1YEKH 4HKZB 4OFYA 5AKTA 1G7IB 1NLBL 5EIVA 2N0KA 5D7IF 1FVEB 4XVJL 1FFOA 3BISA 3PGDB 1Z2KA 3GTTA 4K3EH 5FV2A 3F62A 5L0QC 3V5HB 2YK1H 4K94H 2QPSA 5TFSH 4CNIA 4FP8L 2HVKB 5CEXB 4E9YA 3D6GA 3QNFA 4U7MA 1P4UA 2DF3A 3FCTB 4TL5A 3HRZA 1ERNA 1U9KA 3NJGA 1Q1PA 5EZIH 3TH4T 3U36B 5D9SB 4UU9B 3GSXA 4M6MH 1MW3A 3NBNA 5ENWA 3BUYA 5J6HB 1OPGL 3O8XC 3NDZE 2QQQA 3HR5B 2ICWI 3GO1H 1BA9A 1G94A 5JA8B 3D3VE 2CCWA 2B7DT 4QRSB 2WQSA 1LK2A 1F8TH 4MD5A 2X3AA 3INUL 3PRZA 4GW5B 4P5RA 2YMOA 5BO1L 4UF7C 5FUCE 2YN3A 5D1XA 1BFVL 5JIQA 3U46B 2QPDB 3MODL 4K73A 4E0RA 4NLAA 1A4BA 1TF4A 2A6DA 1FHGA 1XF3B 4HX1A 4KDVA 5GS0H 4WFGE 3MQIA 2XKNB 1MFDH 1JF6A 1KYDA 4RIRA 2CJUL 2YXMA 1YNTB 1DVFA 2EEAA 3FN9A 4LSVL 4ODBD 2ZXQA 3LSOB 2AK1H 5AB0A 2YQ3A 3AZUA 2ENQA 2V5MA 4XC1L 1BHGA 1WFUA 5AW7B 3TIEA 1QBML 3CV5A 2PMZA 1A0QL 1AIFB 2H0FA 3GEFA 3GIVB 5I1EL 1K4CA 1HE8A 3I75A 1C1EL 4YXKL 3RWIB 4J8QA 2MTAA 3QXUA 3N85L 4UQ2A 5BS0B 1IRAY 2CIKA 4N2LA 2VW6A 5G5DA 1A64A 2VIRA 3IDXH 4IDLA 2WPGA 2YGQA 4UDTA 2ERJC 5FGCB 4PWGA 5BJTA 3OKOA 4ZQKA 3MRJA 4ZFOB 1FG9C 4E9TA 4Z3GA 2BC4A 1I8UA 4JW3A 1INQB 1DQKA 4XH2B 4FMKA 4D8OA 4WHDA 5FECB 2JK5B 2HTKD 1XO8A 2HTKC 5E9DA 1M4KA 3ARBC 5D7SH 1XD1A 4R83A 4KZEL 1KG0A 4LLQA 3B37A 3MNWB 4Y5VC 3T3MB 4HHWA 5I8KH 5FYKD 3H3PL 3L3HA 3WMQA 2EQDA 3H2PA 1XH2A 3SDAA 3DX8A 3Q8EA 3WNJA 4FADA 1RZIA 3B83A 1BBJB 4B6ZA 5AWNH 1F6AA 2LFGA 4P06A 3QUML 4KRNA 2QBWA 4DESA 4ILDA 4DGYL 6PCYA 2Z93B 5I1AB 2NYZA 3B9EA 3NJHA 3TIDB 4PWHA 1QSEE 2BNQD 3F12B 3RQ3A 5D7JB 4XCFL 3O3AB 4BK4A 3QFJA 3TYGL 2W94A 3H4FA 3OKEA 4LCUA 4PV8A 3SN6N 3IK2A 5JZ7C 4L8SC 3LCYA 3U83A 5J9PA 1LO0H 3KWWA 3N43B 2GUYA 1DANT 2ROYA 2NY3C 4G8EB 4ODVH 4D0DB 4APQC 5FYJE 3SQBB 1V55B 4KROC 4PMEA 1VKXB 1LXMA 1YCSA 4OCMC 5B39B 4LGSB 2PO6B 4W9ZA 1EXHA 2YD4A 3H8NA 1EANA 4YXHL 3QQ3A 1BJ1H 3VCLB 1UACH 1GIGL 4AQEA 3IFLH 1F90H 4KQ0A 5JW3L 4YMPA 2W88A 1FYTA 3MBWA 3IU3A 3P11L 4CW1B 4JFEE 1F6AB 2Z91A 1U95A 3VXOA 1LEGB 1IGYA 1KB5H 1ZMYA 4Y9CA 1KEMH 4PHZA 2DIAA 3S2CA 1EGJA 2BX5A 3RG1C 1ZLWH 5KVEE 1G43A 2ZWLT 4LRNL 1KXTA 2BXYA 5I0YA 5DYFA 4GAYB 4HLJA 4KKCD 2JKSA 3W57A 4GG6B 5I74C 3UTZA 3VH8B 1TQCC 2GHZA 4M4PA 1OO2A 3DBXA 3KAAA 2R9HC 2JCCA 1B2YA 1VZGA 2ZAHA 3PY9A 1Y7VA 3QIWC 4P46B 2V7NA 5E6YA 2E8YA 2Z3FA 3LPOA 5I8OL 1P69B 4EI5B 2OI9B 3DV4A 3R4DA 4TTGA 1BYNA 1QLFB 1XSJA 3HB3C 3IRCA 5DD6B 4KV5F 2Y1ZA 4JY5L 4PI2A 3QQ3B 2AF2A 2FVNA 1SOXA 5SV4A 3RPKA 4R3SB 1TNNA 4Z7WE 1S7RA 1MRCL 1OK0A 4JBSA 5L8KB 2NW3B 4EIZC 4QRAA 2SODB 3ILQD 3OKOB 1LQBC 4W9LC 5IVNA 4YSAA 2ID5A 4HK0A 1U6AL 3PWPE 4PP1C 4QRPA 4R2GC 4O2CA 4KKNA 4AMKH 3S9DB 3HHSA 5C92A 4XNBA 5HYIA 3O11B 1T2XA 4UOW1 2NUTB 4R7NA 3MXVH 4LIQE 2IMNA 4IK7A 3OPZL 5EOTB 2XZCL 4Z76A 3ZSTA 1LQSR 5CLTA 1G5GA 3C60C 4NBZB 5C09A 3GHEL 2IANA 3BP6A 2O26U 1BP3B 4FQXD 3MJ9L 2HFFA 4I77H 5AVWB 4BDVB 3AC0A 1KDJA 5JQ6H 2O61B 1J5CA 2HZHA 3EZ8A 3EO9H 4R0LC 4LLMA 3EW3B 1Z9NA 3GTVA 4K5OA 4X6CE 2D4FA 4LDLB 4MNGB 3QUKA 1YAZA 2YEVB 3RWCA 3O81A 1EXGA 1OTSD 1T1WA 4WY7L 3OLDA 3H9HA 4ATTA 2H32A 3QXDA 1H5BB 4X4YB 5FYKU 1A6WL 1CT8B 2HWZL 4O5LL 3B1UA 4XZ4A 3RWEB 3U9UB 3K4DA 5IHZB 4HWZB 1JK9B 4G9FA 5EZOH 2F7RA 3ZE0F 3MCG1 2BWIA 5C0GA 1ASOA 3CPLA 3BP6B 3PWUA 3HRZB 5GPRA 1ZRUA 4XBMA 3C5JB 3SDAC 2FT7A 1BX2B 2NZ9C 2R2EB 3O2WH 3GZQA 4AH2A 4V1DE 1ZLSL 4EN2A 2DEWX 4HPOL 1XTMA 4YBQC 3VRIA 1MKFA 1WC7A 4JCMA 1Z9MA 5D1XE 1PQZA 5DDHB 3VGAC 4UTBH 4MMZB 4OGAC 2VQUA 1K4CB 3LVEA 3NSFA 4X42A 3JWNG 3D8MA 2DJMA 4HJGB 3ZTEA 4YSTA 4MDIA 5D8JH 2EE9A 4R90H 5JIMA 1ZE3H 3NCMA 3T4AB 3FT3A 1KCLA 3P02A 3WTUA 2VH5L 5GJTH 5IQ9B 1NCDL 5FHAH 4KK5D 5CD5C 1B0RB 4N8VB 1HOEA 1SXZA 3X1FA 3ZQWA 5KSAC 5I8KL 1TQBC 3FQXB 4XNAA 2Z1KA 2V8MA 2VQ4A 2XN9E 4RRPA 5EG6C 1NCCL 3QDJB 3F83A 4UYPA 3N1FC 2A9NL 1Z3GL 1YNLH 4NAMA 5ANME 3UZQB 2AZUA 4H1LA 5BMFL 3WXVH 1U8HA 3TA3B 1XH0A 3QZOA 4TNVF 5EBMB 3IAGC 1A2YB 5ISZB 3EAKA 3M7OA 2I5YH 4CA4A 4U7SA 5LG1A 4NQCA 3AM8C 1KGIA 1O5PA 3SIKA 3AG3B 3QPQC 3EHBB 4ZTPH 3AACA 5K9KA 4O2FB 4KC3B 4NQEA 1U58B 4EUPB 3DNK