4XPAL

X-ray structure of drosophila dopamine transporter bound to 3,4dichlorophenethylamine
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
214
structure length
214
Chain Sequence
b'ENVLTQSPAIMSTSPGEKVTMTCRASSSVGSSYLHWYQQKSGASPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSVEAEDAATYYCQQFSGYPLTFGSGTKLEMKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transporter
publication title Neurotransmitter and psychostimulant recognition by the dopamine transporter.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transport protein/inhibitor
total genus 52
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2015-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xpaL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xpaL01
5D1ZA 4ZFZA 1RU9L 3AGVA 3KYOA 3OJ2C 1NFDE 1TTGA 4L3EB 2X6MA 3HI6L 4BUGA 3C08L 4QHUA 4JQXC 2NZ9D 4POZC 4WV1C 3KPMA 3QEUB 2X42A 1OPGH 2XA8L 4XNYH 5CZXD 1YY9D 4P5TA 5GRJH 4YHYB 4P2RE 1T89C 4X6DA 3GI8L 4HXBL 4PRNA 4AEIH 5E95B 1IGJA 4P5KB 5D6CA 3C6LB 1JWMA 1IGCL 4HS6B 4D0DA 3CPLB 3LS5H 4WWKD 3D0VB 1QLEH 3HI1B 3A67L 1P4BL 4G6AC 2FECI 1CCZA 1CD1A 1JNLH 4NN6C 5FYJU 5GS3A 3SDDA 3MO1B 4WEBH 4Y5YB 4GG8A 4D9LL 5I16B 5E9DD 1Z5LB 3QIBA 4L8BB 2GYSA 3TYFB 1XGQB 2FHBA 4Q6YA 2VE6A 3ULUC 1EHXA 2I9TA 1T2QH 5F1NB 4LSUH 3PGCB 3EDEA 3F65A 5D7LA 1R24B 2QSCL 2H2SC 1CD0A 1AR1D 5DF0A 4DQOL 1ACZA 1Q72H 3RTQA 3C87A 1KEGH 2PO6A 4NFCA 4ZOCA 4PR5B 4Y8AA 3T0BA 3DRTA 1BVLA 4OSUL 4U1GB 3RWEA 2J6EH 2XTJC 1U8OA 1CG9A 4R26H 4HWEL 1YC8A 1ZXQA 3Q3GA 4MAUL 4KTDL 3V6OA 3QEQB 2XWTB 2Q76A 2IJ0C 2D7MA 1Q94B 5TE6L 2A1WL 4D3CL 4KH2A 4GQ9H 3UBXA 2L7JA 4BM7A 5C3TA 5KSBF 5IB4B 3WL9B 1BJ1H 1I1AA 4HUMB 2DQFA 3T2PA 1WWAX 1RHHA 4JM4H 2VISA 3TN0D 4NKIL 1B0GB 4DN3H 4J6RL 5KG9A 3OPZL 4CAGA 2GK0B 2MQCA 3VRJB 2FIKB 3LOWA 5DGQA 1MFAH 2XNAB 5I75C 5L8KB 4ZSOE 5C0CE 2YN3A 1X5GA 4I0KA 3KAAA 4O2CA 5JLZA 5KVEH 3KPSD 4FG6C 4FXGA 1N3NB 2NCMA 5HDBE 5TQ2H 1E4KA 3RNQA 4IRSA 1ACYH 5HHQB 4Y1AA 1LO3H 4NQEE 2R2BB 4M5ZH 2FRGP 1LNUB 4LOUD 5IG7A 2CDFA 3VGAC 5IVZA 3LN4A 3QI9B 4KHXH 4JFFA 5FKPB 1WT5A 4G80B 4Q6IA 2D31A 3QXVA 3O3AB 4BZ2H 3BH8A 4PTTA 3QFJB 1EXUA 4ETQB 1BLNB 3PNWB 3MV9B 4S1SL 1A6AA 1QO3A 3QIBC 3WNNA 1KNOA 3U30C 5D7IB 1DE4A 2D2OA 2APWA 1QFWM 5DQDH 3KR3L 5CEYB 3ECBA 1QNZL 3SGEH 4F7EA 3OKLB 3MRBA 1DBBH 3L3JB 1HYRC 4QRRD 2XZQH 4HGWB 1J0JA 3T65A 4P3DB 3MACH 1G0YR 1G7IA 1N26A 5I8KL 2DYPA 5KSVB 5IM7A 3TVMD 4HZAA 4MQTB 5ERWB 3LEVH 3V6OC 3OXRB 1L6ZA 1TVBA 1X4XA 4RX4D 4YDLB 4GJTB 4M7LH 4QXWA 2R39A 1OWRM 1HEZB 2V5RA 2V6HA 4LF3B 5T33L 3W11D 2ZPKH 2CIIB 3VFSA 3MLSL 3HPJA 1MSPA 1EFXB 1ADQL 3SDCB 4FZEL 1IQWL 3MROB 1T0NB 5EB9A 5EUKA 5LXGL 4G43A 5ISZA 3QNZA 5DD3L 5LG1A 3MRHA 3CFCH 3MJ8A 3MRLB 3O3EB 4ZAKC 5I1IL 1MIMH 3GI9H 5J9PA 3VFGL 1I8MB 5E1AB 1V7NH 4CJ0A 4UT6L 2BJMH 5DUPH 1C5DA 3FT3B 3BGAA 1E4KC 3MV8A 2BFVH 3W39A 3VXMD 4HS8L 4EN3D 4A2LA 3C6LD 1DANU 3O11A 5F7DA 1CFSB 5CEXA 1WT5C 2DLTA 4KKBC 4OD2A 3RWGB 4EOWL 4G42B 3F7VA 3FONB 3VXSD 3PHOB 2P7TA 3C60B 3IVKA 3OKOA 2VLKA 4WNQA 2X4SB 3TA3A 1JFQL 2CMRL 3LQZA 3ILQC 2JE8A 1UJ3A 2AEWA 5JQ6L 4PRHA 1DANT 3MMEB 2XQBH 3WFEH 4PGBA 1JI2A 1LDPL 2HJLB 3TH4T 4HIEB 1T83A 3ALWA 3K2MC 3JSSA 4TUOB 3MRJA 2GTWB 2ICCA 3ARGD 3HMWH 1BREA 3QDGA 3WKML 4X4YA 5TE4H 4Z0BL 1Y0LB 5HHPB 1BECA 3QH3A 3L1OL 3KYNA 2CO7B 1CDGA 1S9VB 4OLZH 4OLVL 4GW4B 1A3RH 4YBQC 3GJEA 3MGAA 4HS3B 2WINB 4XAWH 3TCXA 2FCBA 3DGCR 2BVPA 3D5OF 4R4ND 4Y5VB 3EYFB 3MRCA 4U31A 1OAYL 5IEHB 1Z3GL 4IOIA 3CZFB 5LGJB 4JY5L 1BGXH 3QHZH 4KKLD 5J3HC 4UV4L 1UZ8B 1IM9A 1OSPH 5IMMA 2CQVA 2P5EB 4M1CC 4OIIH 3PHQA 4GLRI 2BY0A 3E3QE 3C5SA 1CGYA 1KCKA 3ULSA 3ZT6A 4QRPB 3WUWA 1OWWA 2Y5TB 4G6JH 2J8UF 3KLSA 4WUUA 4P9HL 4PG9A 2NY1B 1T21B 1TPXB 5SWZB 3ZHKA 5IEKB 1FL3B 3LKQA 3C2SA 4JHBA 1NBVH 4AIXA 2DWDA 2F54D 3TA3C 1SJEA 5DRZB 4PJFB 1RZJH 3FCTB 3HUJB 5JIHA 4V1DE 3CVHA 3VXOB 5F97E 3RY6A 1MPAH 4JLRA 4WU7A 3RVVC 4KVNH 5DMGC 4EDXA 3HAEH 3OG4B 3UJJL 5D7SL 3JUYA 4XBPA 4X5XA 1L0XA 3RZCC 3QP3A 1S5HB 3WE6B 3GSNA 1NDMA 3IU3A 3IDYC 1RUMH 1ROWA 5K9OA 2VIRA 4G3YH 3MGOA 4K55A 2FO4B 1MEXH 1RPQA 5FYKD 5CS7A 1T1ZB 3T0ED 5E2VH 1QKZL 4UIMA 4L9DA 3UZQA 3TPUB 4JY6B 1EPFA 5KS9B 3Q5TA 5DTFA 2BNRB 1X5AA 3QDJA 3TV3H 5B38B 5KVDH 1RZIB 3L95A 4FQJL 5F7UA 5F9DC 3SE8H 2BVOA 5SX5K 3ULVC 1M6OA 3DX6A 3J8F7 2BOBA 4GS7B 1LMKA 2EE3A 1OTUC 3NIDE 4HJGB 5C3LD 4YGVB 3OJDA 3MRMB 3RDTA 5SX4H 1MCSA 1CTNA 2EZ0C 3CFKB 1F4YH 2HWZL 3KJ6H 4BFIB 5I1JH 4L4TD 1EO8H 4XTRC 5MERB 5DUBA 2CRMA 3RBGA 4C59B 2B20A 1OOAA 4FNLL 5DHVA 1KELH 4KHTL 1T4KB 3BZEA 1G7MA 4WEUD 2P8LA 2OP4H 3WHXA 3WHE0 2WWKT 2NY2C 1NCNA 4IMLB 3VRLF 4MA1B 3RWDA 4YWGL 4YR6A 1QR4A 4JPIA 1DSFL 1G9NL 1WUNT 5CWSB 3QEHA 4Y8DC 5DRXA 1VFBB 4ODTL 5D93C 3SKMB 3CDGA 4RZCA 3JWOL 5F6HI 3OAYK 4R3SB 2XN9A 2AEPL 4G9FE 4P5MB 3DV4B 4L4VB 5IW6A 1Y18B 2OJEA 5F1IA 4GAJH 3S5LG 5IHLB 4Y2DB 2X1WL 5GJTH 1H0DB 4KMQA 4XNQB 1WWWX 5FYJE 7FABL 4CVZA 4PTUB 4XMLL 3V52H 4LCUB 4KAQL 5T1KD 4APQA 4XP9H 4Y4FC 2F58H 4TVPL 5EZLA 4MQSB 1FZJA 1L7IL 1JHTA 3PWPB 2JK5A 5D1QB 1MJJB 4QNPE 4WO4C 4X7SL 3QO1A 1A9BA 5GGQH 2AEQH 1T22A 2EDNA 3TLRA 3ILPB 4X6BA 5ID1B 4CGTA 3EDKA 4JPKL 1ZLWK 3L5XH 3NIGF 3PP3H 4KDTA 3QG7H 4XCNB 1JUFA 4NT6B 5ANMB 4ZPVA 4H1LB 3RDTC 4KI5C 2DLFL 2DQIL 3PJSA 4ONFH 4PJIE 4LBEB 3EO1A 1N5YL 2DI7A 4AL8H 5E8PB 2NY3C 1NC2B 3MLUH 4ZO9A 3GSQB 2HFGL 4D9QE 3EOYG 1C16A 4N8CH 3MLRL 4X5LA 1IAOB 3HLAB 5HYSA 4ZUUA 4JCMA 1G6RL 1P2CA 3FRPA 1CVSC 2BMKB 1YN6B 3KPLA 4LSSL 5EU6A 3FO2A 3IAQA 1TCRB 4NRYB 4DUVA 2VRAA 4QCIB 2KH2B 1KV3A 3RPKA 2C3GA 2HKHH 4MCYA 3VD3A 3V4PL 1KCLA 3U46A 4U6XA 3RNKB 3EO0A 3T2NL 5HHNA 5K9QI 1T0MB 1X3DA 2OM5A 4X0KB 1R3LA 5FYLL 3DSFL 3WNKA 4P57B 4JM2D 5C7XL 5DDHB 1A7PL 5MEOA 2HT4D 1PAMA 5IKCA 1NPUA 3WSQL 4YFLI 4X98A 1B4JL 2YZ1A 1DEDA 1RURH 2WBJD 3WKNA 2CR3A 1QACA 4PJHB 5I1EL 2YEZA 4KY1L 1JNNH 4FQIH 3MRNA 3QG6A 4APQC 3TJHD 4U7MA 5I8CB 3T4YA 3V2AR 1JZ6A 1RULL 3LRSA 2RAMA 1CLOH 4IRJB 4C56B 2DOCA 4OLEA 2VLRD 1CGXA 3U79A 5TH2A 3NA4A 1FC2D 4FQ2H 4MHHI 5L9DL 1F4AA 1OARL 3AY4C 4JO3H 1ZE3C 4ZS7L 5FHAH 2VZTA 4KI1A 3QIWA 1IL1A 2WWKO 3GFUA 1PVHA 3BP4A 3UXFA 4HKJA 3RKDD 5DJDB 1HH6A 3E6FA 4Q9BA 3WV0A 4K9EL 4KQ4H 3BIKB 5MHSE 1AO7A 1VFAA 3WIHL 2XTLA 2LQRA 1U91B 3O6FA 3OB8A 5B4MC 1YNKH 1OAZL 3QJFA 2Q8AH 3G6JB 1Q0YH 3CX5K 3IFPA 3SGJA 4JO1L 1W0YT 3HZMB 3DX9B 3ARBA 2IADB 5HI5D 4IS6A 1V3KA 5C0EB 3HI5H 3JTSB 5AAWA 1ZS8B 5DJXB 3LRGA 2DBJA 2OI9C 4NRZA 3R8BB 5CGYC 4R8WH 4L8SA 3H3PH 4LIQH 2R56H 3MNWB 5BOPA 1VHPA 3TH2T 4GFTB 2ZP0T 1LP9F 3I9GH 4JDZA 2FEEI 4ODXA 1TZHA 5ITBL 2BP3A 2Q86B 2AJYH 5B8CA 2JKXA 1EAPA 2BNQA 3TT1H 1NCAH 4Y2OA 4GXVL 1P7HL 2I9LA 1NLDL 1RIVH 3WFHA 3TNNB 4YO0B 3ROLB 1A1OB 2Z92B 4FXKA 2UZIH 4WFGE 1UCBL 3QIWC 1J8HB 3RIAK 3UAJD 1OAKL 3VFUB 1WITA 1RY7B 1M4KA 2E8YA 2DQJH 1WK0A 3PWJB 5FECA 4BSVB 3DVFA 2FGWL 1EK3A 2ZJSH 4KROD 4XMPH 3HZVA 5I0ZA 3V5KB 5F7HA 3O6FC 4EIZC 2L0DA 4GAYB 4NQSB 4DKFL 3FT4B 4N1EA 4FQ1H 1N0XH 3BD5A 2VQUA 3BP6B 4GKNB 3SGJC 1ZHNA 2DD8H 5H94B 3WXWL 3P3YA 4TSBH 5C2BL 2PW2A 1UB5B 2EDDA 4X6EA 3L5WA 3W0WB 5DT1H 4PLJD 3QEGH 2LAAA 4EVNA 4MD4A 1VESA 4ZUVA 4ZOAA 5FF6B 3LKPB 2D7TL 1MWAA 1FL5B 2V5SA 4X83A 3MCG1 3X3GL 4OUOA 2AVGA 5E2UL 2NXYC 4KWUA 5E94A 4HK0A 1ED3B 3IXAA 3ZKXB 4L8SC 1KN4H 1P69B 1AKJA 2A9MH 5C0DB 3I3BA 3DVNA 5CIPB 5B8CC 2XFXA 4MXVE 2PXYA 5IHUH 2BC4B 5TE7H 3HNVL 4AH2B 2ZOKB 3H7LA 3S3PA 3EYUL 4MJ6B 4OLWL 1GOHA 2XWJB 3D3VD 1JHLL 2FH8A 3MRDA 3WEXB 5IB2A 1VGKB 1VADB 3WNMA 3BAEH 3GM0A 4M6MH 5J89A 1SJVA 4XCEB 3CX2A 2X5PA 5H8DA 4LSPL 4JRYD 1JF1B 1AIFA 1FZMA 1W0WB 4LARH 4QKXB 1UH2A 2XI9A 3VCLA 3HN3A 3V6BR 2CKBB 1YYMH 2OL3H 4PREA 1SBBA 1L7TH 4HV8A 3PABA 4ALAH 1S7WB 3P4OB 4G6FD 3QR2A 1N59A 3VG0L 3HG1A 4ZQKB 1A5FH 1A6UH 2ITCB 5EUOB 1EEUA 3CZJA 2J8UA 5EA0H 3SPVB 2DB8A 1NGZB 2AJXH 5CEZL 3KPPB 3HE6A 1W0VA 1FAIL 4JFED 4LCWB 3VRIA 1NC4A 2XACC 3G9AB 5SWSB 1KJ3L 5J1AA 4LNRB 3SGDI 1JMXA 3HMXL 5L2JA 2NXZC 1BFOA 3L6FB 4KDWA 4Y19A 4TRPH 5K9KA 4CNIB 4HKXB 3ELAT 3UTSB 1ZT7A 4W68A 5JXEA 3D1MC 1FNAA 2PXYC 2BSTA 5F7EL 1JGLL 5KSAB 4MA7L 5BRZB 1F6AB 3HNTL 4G8GA 2PCPB 2O26U 4YDVA 1KCRL 4YHMH 5K59E 3CK0L 3U0PA 3C5JA 3SGEI 3AREC 1GVIA 5CJBA 3UTPD 3DI3B 4FP8L 1S7XA 3NPZB 5MI0B 5HDBF 3WDJA 4U3HA 4RWYL 5T3XL 5BS0E 4I2XA 3FB7A 3QIUB 4S1DC 4YIQB 3RWCA 5AUMB 3NN8B 1BMGA 4H5SA 1RIUH 5J06A 3ZT5A 3IDJB 2N4IA 4QHNB 2X4NA 4IHOA 2F8OA 3MLYL 5E2TL 1CVRA 4Z7VE 4JRXA 2R0WL 3EYOB 1FLTX 4K94C 3DX8B 1KJMA 1KXVC 3BSZH 2AJ3B 4TNWK 1KTDA 2F19L 2HLAA 5EO9A 5B38G 4KKCC 4BZ1L 3ZL4H 1CR9L 2R0KL 4B7LA 4NKMB 4Y4KA 1FL6A 1WIPA 4N0FA 4XPAL 1SY6A 1RJLA 2DL9A 4P23A 3HE6C 1I1YA 3BH9A 1DQJA 4KTEH 3LZFH 4Q0XL 5DMIL 1KGCE 2JCCE 4G9DB 2R2EB 3BP5A 5HJ3A 4LEOB 3GUTA 1FIGH 4YX2L 4X6FB 1FJ1B 5F21B 3CDCA 3AMLA 5JA8B 1EGJA 1IFHH 3QZWA 2PKDA 4XVJH 5JTWA 3L9RB 1PLGH 5JXEC 1MH5B 1U93B 2C3VB 2XQYK 4WTZA 4F9PC 1NEUA 1MJ8H 2PYEA 5DK2A 2BHZA 3X17A 1ZWIB 1F02I 15C8H 4G5ZH 2H1PH 4L3CB 1E27A 3G9VA 2EICA 3LY6A 3K81A 4NKOB 2IMMA 4NNPH 1TNNA 4XPGL 3VU2A 4AIZA 1QR1B 4UDUA 3LDBB 1GZQB 4PD4J 3H6JA 3ZKMD 3DROA 1FCCA 2E7MA 2VXTL 1LE9B 4FTVD 4U7SA 4G8FB 3TBSA 4MD4B 1C5CL 1YDPB 3HR5B 2FX9L 4LAQL 1H3XA 2PYFA 3MBED 1QOKA 4AG4H 1A1NB 1A7RL 5HYJB 5FDWA 1LD9A 1EHLH 2HT2C 1MHHA 4J3SA 4PJ5A 4JHWH 4KV5E 3L5HA 1KIRB 1QD0A 5KW9H 1T20B 2UYLA 5D7JC 5C07D 3WDIA 3SBWC 5EZJA 2ZUUA 2HRPL 4E41A 4W6YB 3P4MA 4LLYB 4PP2B 4H8WL 3JV4B 4P46B 4Y4KC 3SDAB 4EDWH 5FO8A 4K3JL 4H1LG 2ATKA 4ZXBD 3REWA 3TH3T 1HE7A 3PDOA 2VO5A 3UJTL 3GMRA 1S7SA 5SWSD 3K1KC 3F7PC 3DPBA 2NLJA 3NZHH 1ES0A 2ZCKL 5FUZH 2CLZB 4HWBA 4AENB 4OB5H 3ALXA 4HWZB 3OR7A 1F2XK 4OCXL 1FRGH 4AZ8A 1UADC 2OTUA 3BKJL 5FHBH 3MCKB 5KOMC 2CGRH 1UKQA 2GSGA 1JRHI 5T1LB 5C09B 1RZKH 5C9KA 5EOTB 1S3KH 5DFVC 2R4SL 2X4RB 4MNQB 2ZUXA 3N1QC 1LEIB 4ZS6C 1OGAB 2CLRB 3EGSA 2QSTA 1XF2B 3GSXB 5C0FB 3KPQB 1D5MB 1KFAH 1L6XA 4XP6H 4DAGL 4ERSH 1T6WA 3DTXA 2ATPB 5C0IA 4Q9RH 3GSRA 3O9WD 3EJJX 1A2YA 4MVBC 5EC1A 4AY0A 3SCMA 3LHPH 4PJ8B 3T0WA 3LB6C 5FXCH 3TO2B 5GZOD 2I07A 4XPFH 5HGBA 5CJXC 1YEJL 4L3AA 2XZAL 4KJQD 5ALCL 4HUNB 4FZ8L 3IDUA 4NJ9L 2FIRT 5SV4A 2ZG2A 1L9NA 3DO7B 2VZSA 5T1MA 1JV5A 1XZ0A 1TLKA 2WQRA 4WHCA 4PJBB 2WUBL 1RMFL 4MNHB 4CU8A 4Y16B 2HT3C 4PRBA 1GGYA 4ODWB 3VD4A 1J05A 1QRNA 4GRLA 3VFVA 4OZHB 3C08H 4C55A 5KVFL 1JI1A 1WQVT 2NX5D 5KN5A 4QT5A 4ELKA 5AZEL 1EEYB 3GMOB 4JAMA 1BD2E 2NYYD 2XA8H 4G7VH 4ZFGL 3OR6B 3J7HA 1Q9OB 2BRRH 1PEWA 4P0DA 3GI8H 4KMTL 2ZUSA 3QAZC 4BH7A 5ADPH 4MS8C 3FB6A 4YHKL 3TBYA 4OZIE 5I1LA 4K8RD 4EI6A 2YD5A 2FSEA 4LCCA 2YSSB 4H20H 1BJ8A 5SX4I 4UAOB 5B3NA 1BVKA 3X12A 4KK8C 4Y88A 5H2BB 1U92A 5BVJB 1HILA 1P4BH 1CDBA 2IQ9H 3PUCA 1P84K 1MNUH 5I17B 1OD7A 2HFFB 3MV7D 4PRAB 3VWKC 4Y4HA 5IHBA 4OTXL 2GSIA 1U8MB 4PV8A 3QISA 2YC1B 4NN5C 1I8KA 1K4CA 2OQJB 3FAWA 2N56A 4NO3A 3ROOA 3RWFA 4P3WA 4WV1B 1B0RB 4DEPC 5IT2L 5L0QC 2QSCH 4GXUN 4LSVL 4NUJB 4G8IB 2KBGA 2XZCL 1ZHBB 3NIDF 2Y6SC 5E6IB 1I7ZA 3SCMC 3CH1B 2UY6A 3QCUL 2Y7QA 5CMAB 5IQ9B 4M7KL 3RAJH 4MAUH 3N50A 4KTDH 1E6OL 2A0LD 2EC9T 4L9LB 3QUKB 1U41A 1QSED 4K8RH 5TE6H 2A1WH 1KLGB 4YHIB 4UQ2A 4PRIA 1NCBH 1O7VA 3ZE2F 3EDDA 4P2OA 5DEGB 1JGEB 5JQHC 5JXAL 1QBLH 3E6HB 1VPOL 4GRLC 3WXVL 5TGBA 4J6RH 1G0DA 3OB0H 2FNBA 3ARDA 1OP3K 3H9ZA 4A6YH 1UZ6E 3IGAB 3DUUB 4JFZL 5HTSA 3WBDA 1R5WB 4XC1L 2LFGA 4KZDL 4JPWL 1GGIH 1AGEA 2XTJB 4JFQB 2ZWLT 2V2TB 4LCCC 3O4OB 2B1AL 1FNGA 2AERT 2ZSWA 1FSKB 3VD9A 1SEBA 1DVFC 2EKSB 2NW2A 4O02H 4XT1C 3PXHA 3P77A 3H3KA 4IMKC 4PLNC 4LEXL 4ACPA 4LLWB 3O3DA 4O2FB 1IE5A 3OKDB 1X5XA 1ZMYA 2ADFH 1SYSB 3RI5F 3GB7A 1U8LB 3WLWD 3FB5A 5D1ZB 5EBLA 4K7PY 1A6VL 4S1SH 4Y4HC 3KPRA 2LAGB 3BQUA 4DK3A 4QNPF 5DLML 1R3KA 4I8DA 4Z95L 1WC7A 3KR3H 4NC2B 5EO0A 3TZVD 4QHUB 1QNZH 2QJDA 3KPMB 2ARJA 2HAZA 4WI7A 6FABL 5DSCB 3LKOA 4P5TB 2FR4A 3PGDA 5IJVA 3KPOA 3QQ4A 2WLZA 2NNAA 5I8KH 4PRNB 1IGJB 1YYLH 4PJGE 4PJIF 5D6CB 1AR2A 5T1DH 3OHXA 3ZDXE 1RFDH 4XP4L 1AD9A 2I26N 4D0DB 2VUYA 3RPIA 2VDKH 4CU7A 1CD1B 5T33H 1M7IA 3SDDB 3DXAD 2ITDA 3MLSH 2NY6D 4GG8B 3IDXL 1ADQH 4U0RB 1MCHA 3FT2B 1I9JL 4HUXA 5HHOE 3QUMH 4HH9A 1IAII 1E28A 1I8IA 5LXGH 2I9TB 3DECA 1QPXA 3PQYD 3E1F1 4RGND 2APTA 3ARDC 4NGHL 4Y5XA 4P2YA 5DD3H 5DS8A 3BT2L 3B9KC 2P48B 3PL6D 2OTWA 4OFYA 2EEBA 3VFGH 4KRPB 2HMID 3RTQB 1HH9A 1X5JA 2PO6B 5IW1A 2J2ZA 3S37L 3DRTB 5BOZG 3RWEB 4WFHE 1VGEL 1CG9B 4HUUA 3Q3GB 4HGMA 4HS8H 4OD3L 2EYSA 4TTDD 3LEXA 5F7LB 3TO4D 4NQDA 4DFHA 5JHDA 2VXVL 2FATL 4X7EC 3UBXB 1GGBL 2YBRA 1KB9J 3V4VL 4M7LT 2OSLA 4NHUA 3ARFD 1I1AB 1T7VA 2DQFB 1RHHB 3QWRD 2VISB 4OIBA 1ITCA 4LHJB 5KG9B 1XR9B 3GSUA 1RQ5A 5IGXH 3NA9L 5FGCE 5FIEA 1FORL 5ILTL 4JHAH 2ZUQB 1JFQH 4POZD 2I5YL 2CMRH 5DJ6B 3VFRA 5JLZB 2W91A 2HJFA 5JQ6H 4FXGB 4NM4L 3SGKA 1Z9SA 4IRSB 3P11H 4Y1AB 1LDPH 2DQTH 1LILA 3FQRA 5EU7E 5IG7B 2CDFB 2W9DL 3OMZA 5JMOC 4Q97A 3MODH 2CUIA 1YPZE 5IVZB 3LN4B 4JFFB 4AM0A 3MV01 5GQBA 3WKMH 3W5NA 4Q6IB 2BOCA 1WWCA 2D31B 3U7YL 2F53D 3BH8B 4PTTB 4G6AD 1EXUB 1P5VA 1A6AB 4X6CE 1I1RA 4LK4A 4ZSOB 1KNOB 4JGUA 4PYHA 1DE4B 5DD6A 4BFEA 4OLVH 4BQ9A 1IJ9A 3L3IA 1YMHA 3ECBB 2CJUL 3ULUD 4ODSL 1AGDB 3KXFD 3QFDA 3STBA 1GGUA 1MQKL 2VZVA 2VLMD 3MRBB 1Q9KA 4W4NA 2MQ0A 3T65B 1OAYH 5D8JL 3REVA 4LLDB 2H2SD 1G7IB 4JY5H 2DYPB 5IM7B 3UYPA 4JN1L 1IMHC 1UC6A 4P2QA 2XTJD 5IB1A 2ZUTA 1C1EH 1TVBB 2YUZA 1G1CA 5LGHL 1JYWA 1NCCL 2KDGA 3QULA 3HPJB 3DURB 4P9HH 5MENA 1TTUA 3P73A 2G60H 3BMWA 4G43B 3RU8L 3WO4B 5ISZB 4OBSA 4XZUA 1YMME 3FN0L 3MJ8B 5D72L 5J9PB 4D0BA 3ULUH 3ZLQC 1C5DB 1OY3B 4ZTOL 4FG6D 3W39B 1QBML 3SJVA 3Q6GL 1M7XA 4MLIA 1AE6L 1NCUA 3H9SE 3D69A 5D7SH 4R6UA 5F7DB 5CEXB 3VXRE 1MCOL 4OD2B 3MA9L 2VLJD 3F7VB 1DN0A 4W6WB 4R97C 1FE8L 2P7TB 4NN7C 4JDTL 4PJCA 1QSFA 3IVKB 3D39D 2VLKB 3O41A 4N90E 4WNQB 1TQCB 1K4DA 3QIBD 4YHPA 4P48A 1AJ7H 3TA3B 2UWEE 1X5IA 4DK6A 4PS4L 1H3PH 1WFOA 2VKWA 3LQZB 5IB3A 3JV5A 5D7LD 1MHCA 4NP4L 1UJ3B 5EOCJ 3OSKA 2F5AL 1UM5H 4PFEA 4RFEA 3CMGA 5ITFA 1RIHL 3WN5B 4H0IA 4PGBB 4WFEE 2BSRA 1KSRA 3ZZ1A 2MJWA 4NDMA 5HDOA 3MRJB 4CVUA 3QDGB 4X99A 4X4YB 4HLZG 3NACH 3TPKA 1BBJA 5JIPA 3OBAA 3QH3B 1H8OA 3KYNB 4K7PL 3IDYB 4XVTL 1CFTA 4EQ2A 4BYHA 2B2XL 1T1YB 2QQNL 3S8WA 4PJAF 2VDNH 4FNLH 4KHTH 1KPRA 3ZE1E 4D9RD 3GJEB 2KPNA 4ZNEA 5EU3A 3BJLA 2BVPB 4YWGH 3V6FA 5GRUL 3MRCB 4PBWD 4NNYA 4ZAKD 4IOIB 3A6BL 4ODTH 3BGFB 3I2CL 5HD8C 1CK0L 3C6SB 3VXTB 3S98A 5IMMB 4WI3A 4JKKA 1YEEL 5FYKU 3HB3C 2AEPH 3PHQB 2VAAA 4XCCL 5ECJE 3IKCA 4LVNC 2GTZA 3C5SB 3ULSB 5CP3H 2Y4SA 4KKBD 3KLAB 5F72S 3VWJA 7FABH 1BFSA 3CJJA 4HJJL 3WUWB 4BH8A 4KAQH 2EH7L 1UXSA 4WUUB 3LKQB 1F90L 4LPTA 4TVPH 4HMEA 3THMH 2DWDB 4HIXH 3ARRA 2VQ1A 3FO0L 5FO9A 2V2WA 4IEFB 4LHQB 4PLKC 5IK3A 2MPAL 4X7SH 1MCKA 3CVHB 2X9XA 1T03L 3ILQD 4KK6C 5D93B 4JLRB 5LWYH 4WU7B 5I71C 4NSKA 3HC4L 2AJSL 5EULV 4EDXB 3K8MA 2NY4B 5BMFH 4XBPB 2DQIH 5F93C 4X5XB 3VG9B 3BDXA 3TBWA 2ESVE 4HAGA 2VLLA 4U1NA 3GIZL 3GSNB 1NDMB 3IU3B 2XYCA 5K9OB 2VIRB 3MGOB 3PGFL 5F7YC 1FFQA 4OM1L 3SKOA 1EH9A 3MLRH 3LH2H 3MYJA 2IFFL 5C0BE 4JKMA 1KLFA 3ARYA 4WHDA 1G6RH 1JTTA 4YBQD 1ZGLP 4OUUA 2YPLD 5TDPA 4BKLA 5DTFB 4NQCD 3QDJB 4PBXA 2E9IA 3V4PH 3L95B 2BVOB 3AU1A 3T2NH 3FN3A 2LU3A 1M6OB 3DX6B 5JHLL 2BOBB 5AZ2L 2IG2L 1NAKH 3MV8D 5J3HD 3DSFH 3G5XA 4GRWB 5E9DE 5LQBL 2J6EA 3OJDB 3UTTA 3E3QC 1A7PH 4M1CD 3RDTB 4AMKL 2OXHA 3WSQH 1EUUA 2YOCA 4KY1H 5IOPA 5DUBB 4X7TA 4M4PA 5DHVB 3BZEB 1RULH 4P4KA 2R23A 1G7MB 3BISA 5E8DL 3BMVA 2P8LB 3WHXB 3TA3D 3RWDB 3ARPA 4YR6B 4JPIB 1U8HA 5EORH 3QEHB 3ZHLA 5DRXB 1NBYA 4KJPC 4GMTL 4O5LL 2LTQB 5FO7A 5K93A 3FQNA 3ZO0A 4Z5RA 3CDGB 4YQXL 1JZ5A 3FB8A 4K3DL 4RZCB 1BBDH 4PRHD 3UPCA 2XN9B 1WISA 3MJ6A 3MYZA 3RVVD 4G7YL 4XI5C 5IW6B 2OJEB 4K9EH 5F1IB 5DMGD 3WIHH 1CIUA 3RZCD 3MCLL 1FLRL 4CVZB 1B4RA 2E6QA 3KPSE 2R4RL 4APQB 3UTZA 4MDIB 1NGPL 4NZRH 5J57B 4MQ7A 5EZLB 4JO1H 1JHTB 2AXJA 3SDXA 2X05A 3OKNA 4GAGL 3QO1B 1T22B 3Q6FA 3S7GA 3TN0A 4X6BB 4M4RA 1UM6H 3CXHJ 3LQAL 3SOBL 3F6LA 2H6PA 2Q1EA 1OF2A 5ID0A 4KV5F 1GOGA 3ULVD 4QY8A 1IM9D 5CZXC 1JUFB 5AYUL 4ZPVB 2CRYA 1OTUD 3EOTH 5I8OH 3CFBB 3PJSB 1ZLUH 3EO1B 3RHWF 4EQ3A 3GHEL 2EZ0D 4UILL 4O9HL 1RZFL 5HDLA 1HZHL 4JZNA 5ESVA 1C16B 5DXWA 4XTRD 2P42B 3LMJL 1VFUA 4JFDE 4P4KC 5HYSB 1P2CB 5EU6B 3FO2B 5DYOA 3MRGA 2NY2D 4MCYB 3BE1L 3INUL 4M5YL 1S9XA 4U6XB 3U46B 3EO0B 2GAZA 5HHNB 3VA6A 2BSSA 1OAKH 1R3LB 2DM7A 4QHMA 5JW4R 4UTBL 5DVOA 4ZFOB 4QRRA 4U1MA 5HI3C 2FGWH 4L3EE 5IKCB 3ULVH 1D5XA 1SBSL 3TVMA 4X98B 4DKFH 5CKAA 2YEZB 2EO1A 4PJ7A 4QF1A 4UV7L 4RX4A 1KT2A 1H3UA 2BVEA 1GC1L 4JGMA 3QG6B 1IAMA 1RUAL 3MNVA 3T4YB 3WXWH 2C1OB 3LRSB 5C2BH 1X9QA 4ESKA 2PTTA 4JDVA 4Y4FD 2JJTC 5TH2B 4U1SA 2VL5A 3ZHDA 4WO4D 4ODUA 2D7TH 4XP1L 5E5MA 4RMSA 1IL1B 1HKLL 3X3GH 1NFIB 3U7AA 3UBXG 3BP4B 3S88L 1FVDA 4HKJB 4OV5A 3OAUL 2HH0L 4JPVL 4LLMB 1HH6B 5C0AD 3K46A 1FZOB 3E6FB 3N85H 2YD2A 1AO7B 3HRPA 3RDTD 3BZFA 4KI5D 2XG5A 5CLWA 2VXQH 3PWLB 5E99L 3VXMA 3FTGA 2H32H 3RX8A 3QJFB 5FUOL 2NY3D 1U8IB 5GRWA 4EN3A 2IAMA 3Q48A 5D5MF 3IFPB 4YC2C 2HLFC 2Q6WA 1KPVA 1ZANL 1XF1A 5CEZD 1MRDH 2AQ3A 1C08B 1ZHLA 4H0GA 3ARBB 3VXSA 1JHLH 2FB4L 3K0WA 4IS6B 1N6UA 5CSBA 3G6AA 3QEQE 4QOKD 1JWUA 2DQHH 4JG1L 1ZT4A 3LN5A 4GSDL 5E1HB 4F7MA 1T7YA 3EJYC 4NRZB 2B1HH 2FBOJ 4U1IA 5IVXA 4OZIF 1IGIH 4LSPH 4QWWC 4KK5C 4L8SB 3STZA 3FOLA 1U58A 3TVMC 1E4JA 4JDZB 4ODXB 1TZHB 5C0JB 2GITA 5B8CB 3FZUC 2GY5A 4K71C 4DUWA 2B5IB 1EAPB 1CFVL 2BNQB 2FEEL 2I9LB 4YNYA 3ARGA 1NUNB 4APQD 1OAQH 5HGHB 2FJGB 4N0UA 1W72L 4YHOL 4FXKB 5HYIA 5FB8A 5C08D 3C2AL 5CEZH 2DKSA 3PP3K 1FAIH 2YA0A 12E8H 1CDCA 4HFUH 4WI9A 1AY1L 1KJ3H 5B3JE 1Q0XL 1QVOA 1HDMA 1FG2A 3MV9E 5DD1L 1QYGL 4URTB 5D7IE 3TT3L 3HZVB 3HAEA 3DETC 1QFHA 5CZKA 2DDQL 5B4MD 3CVHL 1AFVL 1BAFL 3MOBL 5F7EH 2IAMC 4M93C 4PG2A 3BRDA 4GOSA 1ZHNB 1NANI 3HNSL 3HNTH 4JY4A 5F9JA 4X6EB 3L5WB 3RVTC 3BP7A 1KCRH 2YWZA 1KTRL 4EVNB 1D5IH 5DJ0A 2XWBA 3CK0H 4OZFH 3MLVH 5EN2A 1MWAB 3GSNL 1KG0A 1NQBA 2F54A 2N7AA 3L3GA 4FP8H 3GSWA 3X13A 4U05A 1IVLA 4HK0B 3IXAB 5E94B 2DWEA 5T3XH 4HSQA 5FYKE 5CGYD 5FYLE 4JGJA 1AKJB 2A73A 4PP1C 5IFJA 1ZKAA 3DVNB 3MLYH 5E2TH 3FHAA 2NW3A 1NGYA 2PXYB 3AROA 4KQ3L 1VEMA 1DL7L 2X4QA 4BZ1H 2VTFA 1CR9H 1R3IL 3D48R 1XR8A 2JIXD 3KPTA 2W65B 3HC0B 1A7OH 4PJAA 3B3IA 3MRDB 4AYFA 1RZJC 4XPAH 3HFMH 3T0EA 1KENL 5IFAL 3IF1A 5DMIH 1J9CT 1MCJA 3QIWD 4F9LC 4L4TE 4MJID 4PGCA 4WHYG 4S1QL 3BEVA 3ZDXF 2V2XA 3PE9A 5DURD 3NTCH 4M1GH 5GXBB 3VCLB 4RGOL 1E4XL 3D85A 2ZSVA 1S9YA 1BHGA 1X4YA 1YNTA 4QYOA 4TULL 3O6FD 4HX1A 3PABB 1MCDA 5I74B 1N59B 3GMLA 2A38A 3DGGA 5CILL 8FABB 4BFBD 1X44A 3VW3L 4XPGH 2GT9A 4LCIL 3HE6B 1W0VB 2M8XA 4IRZH 4U6VH 1N7ML 2ICES 2KQNA 1NC4B 4I9WE 4KJYA 4XAKE 3VRIB 1C5CH 2FX9H 1WVZA 2Z0BA 1GPOH 4HG4K 2NXYD 4Y89A 2P43B 1A7NL 4U1JA 1J5OL 3WUWG 3IU4L 4FFYL 3RHWK 5L2JB 1T04A 1BFOB 3U9PL 4HF5H 4Y19B 1TENA 2NY0C 2VR5A 5CINL 2AQ1A 3CGTA 1ZT7B 2BSTB 4ONGL 1FFOA 1DBAL 1A21A 4DW2L 4G8GB 4XWGL 1G1YA 2CRIA 4J7RA 5FYJL 4YDVB 1B88A 1NFKA 2P5EE 1KACB 5GGVY 3U0PB 2IMNA 5T1KA 3C5JB 4ODBD 4UBDC 3DHMA 1BM3H 1K3ZA 5KSUA 1JPFA 2JJWA 4LLQA 4QRPE 4I2XB 1UB6B 3FB7B 3HA0A 3RWCB 5DEZA 4H5SB 2ZCKH 2KKQA 5SWZE 3GMPA 1YPZF 2X4NB 3T0DA 3T1WA 4JN2B 2VH5L 1CIDA 3CU7A 3WO3B 4JRXB 4DKDC 1DQDL 1U95A 3HUJE 3SE4C 1X5HA 5J12C 2GK2A 5GS1C 1KJMB 4X6CF 3JWDC 1KTDB 2HLAB 4F33A 5EO9B 3CMOL 3RVUC 3PWUA 1FYHB 1C12A 2FBJH 3VI3E 2I24N 4ZFOL 2D9QB 2BVQB 2R4SH 1FL6B 1UYWH 3TIEA 1WIOA 4N0FB 1RJLB 4P23B 5CKGA 1NUGA 3U4EA 1DQJB 2COQA 3LKRA 4PJ9A 2X1PA 4OI8A 3BP5B 5HJ3B 4BQ8A 4Z7VB 2B4CL 5I9QB 3WJLA 2VDOL 1NGWA 2VNCA 3F12A 3AM8C 1EO7A 3QZWB 2O5ZL 3M17A 2NXZD 2PTVA 5BZWA 1U3ZA 4LLAA 1YEJH 2XZAH 4JM2A 5ALCH 4FZ8H 3IXTA 4NBZB 4ZG1A 5KS9E 4NJ9H 2PXYD 2BNRE 2PYEB 2R1YB 3HC3H 5DK2B 1N64L 4PJDF 2GKIA 1E27B 1I9RL 1N6VA 3HCVB 2WBJA 5L6YL 2JCCB 2WUBH 1RMFH 4TQEL 1CXHA 4P49A 4DN4L 3V0WL 4UDUB 1F3DJ 4JFPA 3DROB 4MWFA 5EG6C 2B0SL 3IDGA 1UEMA 4ISVA 1FCGA 3ARED 3TBSB 5AZEH 2ADGA 1SMOA 1S7VB 2VLRA 4OCWL 1PZ5B 2PYFB 3I02A 3BJ91 1MFBL 5FDWB 3S34L 4KMTH 1Y6KR 1MHHB 4PJ5B 3O2WH 2R0ZL 1KJVA 3O6ML 4S1DD 1EJOL 4OF8A 5E6ZA 4JR9L 2ADIA 1IZJA 2UYLB 1NAMH 4MXWL 3RX5A 1A22B 4LHUD 2RB8A 4K7PX 4MLSA 4E41B 1IGML 1OT2A 2R8SL 3P4MB 3VFMA 1CDUA 4KUCF 3HG1D 1PKQA 4KKCD 2UWEF 3RY5A 2LU4A 2Z8RA 4PV9A 4I5BA 1HWHB 1X5ZA 2EDEA 5FO8B 4M8VA 4L4VE 3D18A 1V7ML 3REWB 1F11A 4PJ9C 4LVOB 4PY8J 4M61A 5IT2H 3GMRB 4QHKJ 4U6TA 1DCLA 3GSOA 1ZHKB 3ZKNC 1S7SB 3BZDA 2XZCH 4X4ZA 1S5IL 1NMBH 1F3JA 3MZGB 3GGWB 1OP5H 1ES0B 3QCUH 2J88L 4JANA 1IKNA 1EJ6A 1RZ7L 5HYSG 5J11C 4Y19D 3FRPG 3OR7B 3PWPE 2OTUB 4TVSa 3HPLA 5JXED 1RJCA 2GSGB 5E03A 5GGSA 4FFVC 1F4WH 2AK1L 35C8L 3ZE1F 2WBJC 1WAAF 4G8GD 4R0LC 1I9EA 5JXAH 1QLFB 5EIVA 2YWYA 3ZTJH 5JZ7C 5ANME 2O5XH 3WXVH 2YUXA 3TYGL 4Q9QL 2OBGA 1PG7L 1HYSC 3GJFH 1UM4L 4NQVA 1P4LA 3DTXB 1K9TA 5C0IB 4Z18A 3GSRB 1XF3B 4DGIL 5JNYB 4CMMA 5EC1B 5T3XE 4XC1H 1KIQB 3IS0X 4JPWH 4HK3J 2HT2D 4BK5A 1LDSA 3RL1A 1YEDB 2I07B 3AS1A 5HGBB 1D5BA 4LEXH 3VE0A 1MWAL 5D7JD 4AEHL 2NTSP 4D2NA 1FGNH 4OAWA 5T1MB 1JV5B 1XZ0B 4ZDHA 3T2OA 1H3VA 4EKXA 5D5MA 5DLMH 3P0YL 4PRBB 4Y4KD 4Z95H 1J05B 1QRNB 3VFVB 1EX0A 4BELD 5GS0C 1KCVH 5L88L 5KN5B 4QT5B 4ELKB 2DLIA 2RGSA 5GGRY 4JAMB 1KUMA 5L7XL 4OLUL 4PJHE 4YHNA 2A9NL 4F58L 2QHRL 2XXMB 5FFLA 1JZ8A 4BH7B 1QBAA 5JR1L 3TBYB 4KRLB 3WS6A 5I1LB 3O2DH 4OZ4A 3OZ9L 5D1XB 4EI6B 2BXYA 2FSEB 4LCCB 4UB0L 4R7DA 5CHNA 1CDIA 4C56E 1BVKB 3X12B 3OJVC 1U92B 5DJ2B 1RAMA 2DM4A 1HILB 2NY5L 3U9UA 1FV1A 3U1SH 3FO9A 1TFHA 3IDXH 4Y4HB 1YN7A 2GSIB 5GGVL 1MI5D 5DFVD 3EOAA 5L8JB 1I8KB 1K4CB 2GJ6A 2V5YA 4NGHH 2PR4L 2X89A 4NO3B 4WI4A 5DRWB 4ZS6D 3E2HC 3BT2H 3ROOB 4U6YA 2EDOA 2XRAL 1P6AB 3D3VA 1MY7A 3VMOA 1U36A 2AQ2A 3FFCD 3CSGA 3G6JE 1VSCA 1I7ZB 2AK4D 2Y7QB 4ELMF 4MVBD 1R0AL 2OZ4L 3LB6D 4RAVA 1MRFH 2A6KA 4JRYA 4GW5A 2ARWA 1RUKL 2F9BT 4LPUA 2VXVH 5HY9A 2FATH 2DKMA 4UQ2B 3KHQA 4PRIB 1I4FA 2FHFA 1UT9A 1DBML 4P2OB 3SN6N 4LQ1A 3JWDL 4FFZH 4K2UH 5TGBB 3K1DA 3S36X 2HT3D 3NA9H 4UZGA 3ARDB 5ILTH 3I6KA 1CFNA 2AKRA 1CF8L 2WANA 5J7CC 4M6NL 1AC0A 4NM4H 4X9BA 1SJHA 2AJUL 3QUZA 5EWIH 1AGEB 4JFEA 2APFA 5F44A 1WSST 2ZSWB 1FNGB 4MS8D 2C5DC 1QFWL 1SEBB 1JYVA 3VXUD 2NW2B 4S2SA 2X4OA 3QDMA 3P77B 1JF5A 4JCLA 3O3DB 4W4OA 4C83A 4KK8D 5HHVL 3UTPE 1J8HE 5EBLB 3W2DL 4WI8A 3IDIA 3KPRB 4EI5A 3BQUB 3VWKD 5F9WB 5IROC 5LAXA 4Q2ZB 1LEGA 1WC7B 5EO0B 2VERN 4YHZH 2CJUH 3ZMRA 5AD0A 5C0GB 1MQKH 1TJHL 2ARJB 4OF6A 2AW2A 2BNUA 3LKOB 2FR4B 3IFOB 3KPOB 1U3HC 3QQ4B 5D8JH 2X09A 1SVZA 2Q7YB 2NNAB 4JN1H 5AG9A 2UV3A 1A3LL 3NFSL 2Y6SD 5ESAA 3SCMD 3H9YA 5I1KL 3OHXB 1KTLA 1AD9B 3W0WE 1SY6L 5LGHH 4LVHC 3RPIB 1MOEA 3T77A 1FO0H 4HW6A 1D6EA 1M7IB 1C5BH 2ITDB 1KYOJ 3GBML 1PYWA 5JPMA 4CMHB 2AV7B 1QRKA 4HH9B 1YQVL 2C7UA 1I8IB 3MGTA 3RU8H 4YLQT 3WLBA 1EMTH 3T09A 4GRLD 4PRDA 4JREC 4Y5XB 5F70A 3LV3A 5DS8B 3V5DA 4WU5B 5D72H 1KJ2L 5BQ7B 2OTWB 5LCVH 4BSWB 5H37H 4WCYL 4HDIA 1BQLH 5IW1B 4OZGA 5C6PB 2IAND 4H25B 5BZDB 4ZTOH 3QUZC 1TIUA 4HUUB 1DR9A 2EYSB 1AE6H 1RV6X 1HI6A 5ALBL 3LEXB 2HVKB 5JW5A 1MCNA 3HTLX 4NQDB 1DVFD 5JOPE 1TQBB 2FJFA 5JHDB 1CT8A 2P46B 1HSAA 2YBRB 3MA9H 4X9GA 2P8PA 1FHGA 2OSLB 4NHUB 4PJXA 4EI5C 4UI2A 4DGVL 4HIJA 3LS4L 2HVJB 2F8VA 4Y4HD 1U42A 4RGMC 2IFGA 2JTDA 2IPUK 2HN7B 3GSUB 5IESL 5FDYA 5TQ0L 2NY7H 3VFRB 2VWEE 4NP4H 1IAKA 2HJFB 3SQOL 5C0RL 2P5WA 1MF2L 3PV7A 4FTVA 2VDQH 3IJYA 4EIGB 1RIHH 4MQXC 1AGCA 4U1KA 1ZA3A 3FQRB 3MBEA 2R1WA 1TJGL 1YPZA 1P7QB 4AM0B 1HK6A 2BOCB 1T0PB 4MAYC 4K7PH 4PRID 4L4JA 1WZ1L 3AMKA 5SWSE 5JOFA 4NN7B 3OB0K 5C07A 5DD6B 1N2RA 1S78C 4TSCL 2QQNH 1C8PA 3L3IB 2J1KA 1YMHB 5CAYB 4HWBL 1TJIL 3QFDB 1OTTC 2WNGA 2RFXA 1NJ9A 1UG9A 3UTSE 3B9KD 3W9EA 1Q9KB 5GRUH 1P1ZA 3REVB 1CGSL 5ADOL 3A6BH 1BF8A 3I2CH 1CK0H 4ZXBA 2PTUA 4ZPTA 1TZGH 2QQLL 4P2QB 4M62H 1KB5L 5IB1B 3EUUA 3FKUS 4XCCH 3EO9L 4FQXC 3D2UD 1KCSL 1MCWW 5EOQL 1DQTA 2GFBA 4DCQA 1NMCB 4GRMA 1BEYL 4HJJH 4I77L 3CC5B 2DBLH 4Z7WE 3KPRD 5MENB 3P73B 2PW1B 1PFCA 5L8LB 4PJDA 1F90H 1RJZA 2FX8L 1U6AL 3U4BL 3FO0H 3QZWG 25C8L 1P9MC 4XZUB 2VR4A 4L8CA 5B3JF 4D0BB 4UU9B 1T03H 4WTZG 4P2RD 3KYKL 3TGXA 4TPRL 5D7IF 5D2LA 3GIVA 3BN9C 3SJVB 5IBLC 2ICEA 3HC4H 5EU7C 3AXLA 4OM0H 3BPNC 4KVCH 3QB7C 3D69B 1S7UA 2Z8VC 4LPWA 5GS2D 1LO4H 4LVNB 3S6CA 2EE6A 3AC0A 3UDWA 2M1KA 1DN0B 3ZDYE 3PGFH 3L3HA 4PJCB 1QSFB 3VGHA 4L29A 3S96A 3UO1L 4OM1H 2FX7H 3O41B 2EXYC 1K4DB 1Y6MR 4YHPB 1YEIL 3FN9A 1KIUA 4PB0L 1AXSB 3ETBF 4O2EA 5EBMA 2ADJB 5F7MC 5IB3B 2VAJA 1HXMA 1XIWC 4NPYB 5AYQA 4ZD3L 1MHCB 3LEYL 3BIBX 2H9GB 2X10A 4I3SL 1VFOA 2NX5A 3VXRB 3VDBA 5I71B 5ITFB 5AZ2H 1U8LA 1H9VA 2BSRB 5LQBH 5DMKA 4NDMB 5E8EA 3UYOD 4IBLT 2YD6A 5GISH 4X99B 3ZSSA 1IM3A 3AB0C 1BBJB 3HE7C 5GS2H 3FRUA 1CFTB 1VDGA 2EKJA 3CDFA 5GIRA 5HYJE 1KPRB 5FA4A 3X11A 1WAAA 2ZOLA 5EU3B 3QCVL 3MV7A 1MCEA 5CGTA 3V6FB 4R2GC 4A6YA 5C0CD 3O4LA 5D6DC 4O5LH 1K8IB 3O3BA 4K3DH 2YD9A 1F3RB 4E0RA 5GRXG 2VAAB 1AXIB 4JKPL 4NQED 3IKCB 2XKSA 2YRLA 2GTZB 3T08A 2WIIA 1T7WA 5D4QA 3BRFA 2V7HA 3MOAL 5ETUB 5CGMA 3N9GL 3VWJB 3QXDA 1DFBL 3NAAL 1JCKA 1H8SA 1I1CA 2R4RH 1QSEA 2MCG1 3NGBB 1NGPH 3BIAX 5I30H 5F9OL 1PSKH 4RA3A 4OJFL 3RWHB 4DKEL 1IGTA 2W9EL 2VQ1B 3QQNA 2Y9RT 5FO9B 1DTUA 2V2WB 1JTOA 3S36H 1WZLA 2G9HA 4JVUA 5TDOA 4GAGH 1J0IA 1DQML 4XHQA 1BX2A 4LDLB 3SHSA 4MD0A 4YDIH 4UIKL 2X7LA 3LQAH 4FN0A 5C09E 3B9DA 4W6XB 4KK9C 4NSKB 3K3QA 3KNBA 5AYUH 1CXIA 1K2DB 2XQYG 4MNQE 3BD3A 2AXFA 5KVGL 3OKMA 1AQKH 3OQ3B 1H5BA 3V7MA 5J13C 3TBWB 3TWCH 1OGAE 2VLLB 4U1NB 3GHEH 4UILH 4O9HH 1HNGA 4XWOC 3UC0L 1CL7L 1HZHH 3SKOB 3MYJB 3LMJH 1ADQA 3R06A 3QUMA 1B9ZA 3QRGL 4OUUB 3ZYIA 5TDPB 2SEBA 4BKLB 5JORA 1A0QH 4HFWA 4HK3N 3VA2C 4PBVC 3FO1B 1JPGA 3INUH 3VFTB 3T3ME 1HQ4B 4HCRL 3TZVA 1A6TA 1ZA6A 3AU1B 4XNXL 3DXAE 5HD8D 3RRQA 4M9PA 4UTBH 1J1PH 3UTTB 1CLZL 4PJBE 3RJDA 3HB3D 3ZE0E 5LJYH 4PJFF 4Q9CA 3HUJF 2VDRL 4FQLL 4ELMA 4ZMAT 1SBSH 2RIKA 4JZJC 4OZHE 5GRYA 2A0LC 3VJ6A 4UV7H 3VGGA 1AHWC 1F8TL 4LRIC 1HNFA 1RUAH 4HUKB 4X7TB 4GBXA 1Q9WA 3H42H 1AI1L 3IS1X 5J6GA 1U8HB 4PLKD 1A4KB 1NBYB 4XP1H 2EEAA 2A77L 1HHGA 3FQNB 4HKBB 1HKLH 3FB8B 3PQYA 4KK6D 3OAUH 4GG6A 2HH0H 1FC1A 1LHZA 3PL6A 2VITA 4KRNA 1QA9B 3EFDL 1BQSA 3O8XC 5KS9F 1QQDA 2QADC 5KAQG 5E99H 3BDYL 4U3XA 1ZTXH 2X44D 3TO4A 4XHJC 4OD1L 3ARWA 1G9ML 4FMFA 4I18C 4MQ7B 3G5YB 2Q7NA 2DJUA 4Z7UA 3SO3B 3SDXB 4OT1H 5CP7A 2FB4H 1PGRB 3ARFA 3OKNB 3O2VL 4WJ5B 5DQ9A 3QWRA 3C5ZA 3TN0B 3UPRA 3OKEA 4GSDH 1AP2B 2H6PB 1OF2B 5ID0B 4YBLB 4QY8B 1ZV5A 4RIRA 2XY1A 3KPSB 2DQDL 1T89A 3RGVC 4NHCL 1RD6A 5HSFA 2VLME 2XZZA 4QO1A 5HHXL 5BJTA 4JZNB 1ND0B 5ESVB 1CFVH 3F6IA 4X4MA 1I9IL 4GBXC 2WUCL 2AJVL 2DQCL 4YC2B 5GHWL 1KC5L 1WEJL 2Y36H 3DVIA 2XTJE 4YEFA 5DYOB 1W72H 4PY7B 1PG7X 1FVCA 5F6IC 4ODHL 3C2AH 2KZWA 3L3DA 3B5GA 5GRVK 1S9XB 4V1DD 2H26A 1U8KA 2GAZB 4KJPD 2BSSB 3KXFA 1AY1H 1Q0XH 5BO1L 4QHMB 3CFEB 4QRRB 4U2YA 5DD1H 4U1MB 1QYGH 5TFSL 3TT3H 3SE9H 3CSPA 4XI5D 5JW3L 1D5XB 3TVMB 4TSAH 5FGRA 1G7QA 2ERJB 2YRZA 4M7ZB 4BQBA 1ZSDA 3EYVA 1MRCL 3B4NA 1J12A 4PJ7B 3QEUA 1UENA 1KT2B 3MOBH 1X5LA 3MNVB 4IIQC 4Z78A 4X6DE 3CU1A 2RR3A 3JBG7 3MJ9H 2PTTB 4JDVB 3UTOA 3BGMA 3TF7C 1QSVA 2M26A 3BKCL 4YHLH 4U1SB 2FJHA 2VL5B 4XP5L 3C5ZC 4ODUB 4OCRH 5E5MB 2VDPL 2CO6B 2Y06L 1FVDB 4OV5B 5KZCD 3MLWL 5DR5H 3DYMA 2D9CA 3UTTD 1XGQA 1S9WA 3BZFB 5INDA 3VXMB 5JW4M 3PGCA 3PIQA 3CLFL 3STLA 2VSCA 4XNUL 5D7LE 4EN3B 4KQ3H 1DL7H 5GSRA 3CFIC 2VYRE 4P9HC 2Q6WB 1KPVB 1R3IH 2VLJA 4P4KD 1ZHLB 5F7FA 4NYLA 4PY8I 4OCMC 3VXSB 4QHKI 2DTML 4NIKB 3V6OE 1MCWM 1OQXA 3D39A 1JWUB 2XWTA 4PJHF 1JYNA 1KENH 1FN4A 5IFAH 1KLUA 1ZT4B 2VABA 3LN5B 4F7MB 3QUYC 4XB8A 2HKFL 4U1IB 5IVXB 5CUSL 1QFUL 3STZB 3WDHA 4DWHA 4OFKA 3FOLB 4HH8A 1U58B 1QG3A 2W1NA 4RGOH 5HI3D 1B0GA 1E4XH 4CDHA 5CSZA 1YEHL 4JB9L 1KXTB 2GITB 3ARUA 4TULH 1EHAA 4GW1A 2OCFD 5CP3A 3CXDL 5DEFA 3RA7L 3RFZC 4YNYB 3ARGB 5K33A 4XPBL 3RVXC 5DVNA 5M7QA 1JJUA 1MIEH 4N0UB 1F6FB 2HYMA 3VW3H 4Y1AE 5HHQA 4LCYA 1YECL 2R2BA 5FB8B 1LNUA 3U36A 1FFRA 2EDLA 1I3RA 4LCIH 4CU6A 3G6JF 4JFFE 4I1NB 5FKPA 2ICWA 1VFMA 2YXMA 1QVOB 2W60A 5LBSL 1ZLUK 2C26A 2E3VA 1HDMB 3QFJA 4Z0XA 1FG2B 1A7NH 1J5OH 4WTXA 4HQQL 4ZAKA 1I1FA 2NR6C 2AABH 2H2PC 5CINH 2JB6A 3HAEB 4C54A 3E0GA 3SGDH 1GIGL 4TOYL 3EZJB 3T1FB 1JVKA 4OV6F 1NMAL 5GRJL 4Q7DA 1K6QL 1D9KA 3WD5H 5C0NC 4JY4B 1S7RA 5F9JB 4AEIL 5FYJH 5JPNB 3BP7B 1TETL 2HLFD 5ICXA 1G6RA 5DJ0B 5EN2B 3F58L 3LS5L 2ZZUT 4RNRA 1BZQK 5BV7B 1G9NC 1FYTA 1KG0B 1QLEL 2F54B 3L3GB 5E8OA 3GSWB 3X13B 1JNLL 5FM8A 4XH2A 2DWEB 3EJYD 4WEBL 3BKYL 3JWOC 2DQGH 2DRUA 5EC2B 3UYRH 3SDCA 1D6VH 4QWWD 4KK5D 1JZ3A 1G7PA 2Z8WC 4XXDB 2A73B 2DI8A 2AXGA 3U2SA 5ISZE 5IFJB 5EZOL 1DQDH 1NGYB 1LE5A 3O3EA 4XPHL 3FZUD 1PZUB 3DWTA 3VGBA 1Q72L 3BI9X 4NUGH 2X4QB 3CMOH 1MAML 2A6JA 1XEDA 4TUKL 3FL7A 3MV8E 1XR8B 3O6KL 1RUPH 2OJZH 4R26L 1ETZA 4PJAB 3B3IB 3CVIL 1BZ7B 3T0EB 5L2KA 1YQ2A 2EDXA 3GNML 3QI9C 4UINH 1RZ8A 5F7NC 4HXAL 2DIAA 2MNUA 4G42A 4N1HB 4HMDA 4NWUL 4YZFE 3BEVB 3MLZH 2YPLA 2B4CH 4ZO8A 4NQCA 2V2XB 2VDOH 2VLKE 1IBGL 3VGFA 1DLHA 4JM4L 1WCQA 1OSZA 3D85B 4DN3L 1OL0A 1S9YB 3LRHA 4R4FL 3WIHA 2AS5M 4QYOB 3RVWC 1MFAL 3DETD 5IMLA 4HX1B 2XPGA 1D9KC 2IAMD 2NZIA 1N64H 3GMLB 4PRHE 1I9RH 5DHXB 3MMEA 3DGGB 5TQ2L 3T3PE 4L4TB 1P53A 4RBPH 4TQEH 3RVTD 2XXCB 3V0WH 4YDLC 4OCSL 4HIEA 1ORQA 2GT9B 1A3QA 4NQUA 3QDGE 3BWAA 4KJYB 4M7JH 4OCWH 3VXNA 4EUPB 1JTPA 4MSWA 4M03A 1XGYH 1MFBH 3SDCC 1SM3H 1T04B 2R0ZH 5DQDL 3PXJA 3O6MH 5D70H 1EJOH 4R7NA 2D4FA 2WINA 4JR9H 4NO0D 1V3JA 3P4NA 4MXWH 4PP1D 5M95B 1ZGLM 1EBPA 2LVCA 4Y5VA 1FFOB 1IGMH 3L3OA 2R8SH 1WF5A 3CX5J 4S0TD 3RZCA 3MXWH 5JDSB 5HDQL 3LEVL 2E7CA 4UOW1 5ABDE 4QRTA 5T1KB 3F7YA 4WFGD 4UDTA 2EDQA 3NPSB 3PP4L 1V7MH 3QUXA 4NRXA 2F74B 2NQCA 5KSUB 4LASH 2ZPKL 3N1PC 1S5IH 4O00A 3C60C 5EUOF 2D7PA 4WUUE 3GMPB 2E8ZA 4K9EC 2D7NA 3UROR 1YEKL 5ACMA 2CK2A 5T5NF 2EDKA 4C57C 3PF2A 1U95B 4PJFA 1A14H 3HUJA 3BPLC 2ZUVA 3CFCL 2R69L 5E4IA 1MIML 3GI9L 4F33B 1QFPA 4D8PA 5DUPL 1C12B 2AK1H 3NCYP 1J8KA 2YKLL 4YXKL 4B5EA 3ESVF 1JRHH 5IIEA 3TIEB 2AV1B 4Q9QH 1PG7H 4XC3H 1UM4H 3LKRB 4PJEA 4N9GA 3TBTA 4DGIH 2FO4A 1MJUL 1NGWB 2P47B 3EBAA 4FABH 3F12B 2IQAA 3M17B 5BZWB 2QL1A 5J11B 4KZEL 2NY0D 3MR9A 5FV1L 4JM2B 4Y5VC 1CFQA 1CGUA 1LGVA 2HTLC 3IXTB 1N4XL 2H32A 4NM8H 4WGWB 4AEHH 3QDJE 1Z9OA 3V8CA 1MCFA 2WBJB 1CLCA 2XQBL 3WFEL 3I6GA 4GRWE 1HHJA 1ULVA 3P0YH 4JFPB 1N5AA 2BVUA 3IDGB 3QUXC 3UJIH 4F3FA 4ISVB 4DGYH 4Y4FA 4UBDD 2ADGB 5TE4L 2VLRB 2FL5B 5EH1A 5L7XH 3I02B 3HS0A 1NH6A 2A9NH 4F58H 1AGBB 3IRZA 2BY3A 4WO4A 2NY1C 1TPXC 5JR1H 1P7KA 1T4KA 3OZ9H 4UB0H 4XAWL 2ADIB 3D85D 3GKZA 4G6KH 1S8DA 3OX8A 3U0WL 4ZUWA 1E0OB 5C0AA 3ZDYF 4CVWA 3DO3A 2NY5H 1VFBA 3VFMB 1BGXL 3KPNB 1PKQB 3RVUD 3VMPA 1EDQA 2XN9E 4PV9B 4I5BB 1NGXB 5GGVH 5JIKA 1GJIA 1JN6A 3NFPB 3MV11 4JG0H 2A83A 3D18B 3DV4A 4NO5A 5I1CL 1F11B 2PR4H 3E8UH 3MUZ1 2XV6B 3HRZA 4M61B 3VMNA 2XRAH 3GSOB 1BOGB 3UBXI 4WUKL 3NOIA 4KFZC 4H88L 4G8EA 1F3JB 1IT9H 3B43A 1X4ZA 4G6JL 4QOKA 1L9MA 3O45A 1MHEB 4EXKA 5IBTL 4JANB 5D71L 4ZUTA 1G7LA 1R0AH 2OZ4H 1HCVA 2APBA 3HPLB 1D3CA 1RUKH 4X8XA 1HSBA 4TN9A 4N0YH 3WFDH 4NKQB 4MCZA 3MLTA 3AVEA 1DBMH 4PGEA 4GS7C 4CJ1A 3JWDH 4OZFA 2Y23A 4NQVB 2OR9L 2EDBA 1P4LB 2C4FU 4OQTL 5CJ8A 2VXUH 5E8PA 3N1MC 4GH7B 5C08A 4M6NH 4CMMB 5BS0D 4J8RA 1OAUL 1WTGT 2AJUH 3AY4A 1JPTH 5E2VL 3HLAA 3V0AC 5IW3A 2YD4A 3RL1B 1QTYT 5EU6E 4MA1C 1MJ7H 1D5BB 4YK4C 3VE0B 2FH6A 5BV7L 1JNHA 5T3ZE 1UFUA 2VDMH 4KROB 1XGTA 3TV3L 4XNZB 2W0KA 3CD4A 3RNKA 3W2DH 4ZDHB 5I73B 1T0MA 1WCBB 1NCWL 2EH8L 4HC1H 4DOHB 5D5MB 1MLBA 2C4FT 2F15A 5IWLC 1CGWA 4HHAA 3QRFM 2H8PA 4Y2DC 1F4YL 4PJ9D 4YHNB 2FZ3A 3IJSB 4ZOBA 4LLUA 5EOCL 3ZKND 2QEJA 2DIBA 1A3LH 1FP5A 1NSNL 3DJ9A 4HT1L 4XCFH 4OZ4B 4P99A 4NZJA 1SEQH 4LKCA 4R7DB 5CSGA 5CHNB 3EFFA 5FYKL 2OP4L 5D1QC 2R29L 2AJZB 4FXLA 1VERA 2BDNL 3FO9B 4FFVD 2BRQA 2X4UA 4BQ6A 1YN7B 4CW1B 4NCC1 4J3VA 5DJDA 3EOAB 1HXYB 5D2NB 5JZ7D 3BIKA 1CLYL 1TMCB 1AO7E 1GGTA 3T3MF 3QNYA 2R15A 5KSBA 1FVEB 4U6YB 5A2LH 1IAIH 1KJ2H 1U91A 2JIXA 1HYSD 3D3VB 4L5FL 1KULA 3MNZA 4PRPA 1M71A 3V52L 3RY4A 4U4BA 3ZE0F 3KLDA 2C4XA 1WTLA 2F58L 3V79C 4OZHF 2QTEA 4MJIA 4RAVB 6CGTA 8CGTA 3DX9A 2A6KB 4JRYB 4HZLA 1M1SA 4J23A 3WS3A 4GW5B 4D0CA 4LVHB 5C0EA 3D6GA 2XOTA 5HY9B 5DJXA 1I4FB 5HVFB 2ORBL 4KXZI 3BO8B 2VB5A 5EO1A 1LEKB 5I1HH 2HFEA 3LS4H 3QG7L 1GSMA 4G6FB 4PYGA 5DVKA 1IC1A 1CQKA 1HHHA 3F7RA 3KS0J 1UJTA 2DICA 3G6DL 4ONFL 1DN2A 5GS0D 3I6KB 5IESH 1H15A 3HAEG 1U3JA 4AL8L 1CFNB 5TQ0H 1OP5K 2G2RA 4CADA 2AKRB 1G7JB 3MRKA 5HHMD 2J5LB 3SQOH 5C0RH 2BNQE 1MF2H 1SJHB 1X5KA 4QTIL 4JFEB 1A6ZB 1UKTA 4IRJC 3EIFA 5FV2A 1NL0L 4S2SB 2PUQT 4P3CL 3BPCA 2X4OB 1VKXA 5LGKA 1TJGH 3QDMB 3ROLA 4LLVA 3MRRA 2DL2A 2J7LA 3H3BC 3DNKA 3PV6B 4C83B 2G5RA 4YXLL 4N68A 2PNDA 3U82B 2C9AA 3C9NA 4TSCH 3GJFK 3L5IA 5LAXB 1LEGB 4FQQB 3F7QA 2JF1A 1INEL 2IGFH 3RJQB 5AD0B 1TJIH 2Q3AA 4JQVC 3V5KA 3PWVA 3QDAA 3W81A 5IMOA 1S7QB 4GAYA 4NQSA 3BYYA 4OFVA 1JNNL 4FQIL 5D96B 5GS0H 4UMGA 4GKNA 2X1XR 2YR3A 5ESAB 4OGYL 1KB5H 1A1MA 1KTLB 3EO9H 5E0QA 4Y7MA 3T77B 1BJMA 2AI0H 3B9AA 1J0YA 1D6EB 3PDGA 3GKWH 5HPOA 3KGRA 1BEYH 4YE4H 4I77H 1PYWB 4H8WC 5JPMB 3PHSA 4KC3B 2RHEA 4XBEH 3MGTB 1A6PA 4RMUA 2CDEA 3BFOA 4PRDB 2FX8H 1U6AH 4KQ4L 3U4BH 3LV3B 25C8H 4N0CC 1OVZA 4GKOA 3GRWH 1BD2D 3BKML 2BC4A 4OZGB 4O51B 4UQ3B 3ZT7A 1QHOA 4N8VA 2XWJA 5IMKA 1HI6B 5JW5B 1PG7W 4MX7B 1NAMA 3WYRA 2FJFB 1CT8B 2QR0A 3RUGF 1FGVH 1HSAB 2P8PB 4MA3A 1OD9A 3MTRA 4PJXB 3NCMA 4HIJB 4EUPG 1JF1A 1YEIH 3ARVA 4LIQL 4PB0H 1NFDF 1DBKL 1FNHA 2FD6L 2GJ6D 4LFHD 2X89D 1OW0C 1MHPL 3G5VA 5D7KE 2AJYL 5E5UB 4ZD3H 3BRGC 4M6OL 4S0SD 1IAKB 4I3SH 1U3HD 3TT1L 4KGJA 1NCAL 4FTVB 5HBBA 4XPTL 3IJYB 5GJSH 3HG1E 3AREA 1AGCB 4U1KB 4ZQKA 1ZA3B 5EUOA 3MBEB 2J8UE 2R1WB 4M1DH 1GCFA 1E4XI 1CZ8H 2UZIL 1KXQE 1P84J 4LCWA 3Q1SH 1MFCL 5JOFB 5C07B 3ZKXC 1N2RB 4DVRL 3GHBL 3H9HB 4LHUA 3H0TA 2HA1A 4PGZA 2C1PB 2BX5A 4XMPL 2EDRA 4WHTA 3K4AA 4Y19E 2RFXB 4RISL 3NFNA 1NJ9B 3GJFA 1U8NA 2D03L 2GJZA 1AD0A 1CU4H 4ZXBB 4ZPTB 2HG5A 1E4WH 5BRZA 2DD8L 4G8GE 3QUZD 5ICYA 4JKPH 1MFEL 3R1GH 1F4HA 3QEGL 3ARZA 4WRLA 1U9KA 3ES6B 1FNFA 1U8JA 3QDMD 2GFBB 1IGYB 5IF0A 1P4IL 3MOAH 4DCQB 3AB0B 3N9GH 4GRMB 1NLBL 5TDNA 3NAAH 4U6HB 1BIIA 4EI5D 4I2XE 1G0XA 4OJFH 3VH8A 4F9PA 4DKEH 2W9EH 3EDFA 2CPCA 5DVLA 1CE6A 2BXZA 1WFNA 4JRXE 1LO2H 2VWEC 5IHUL 5EDXA 2Z31A 2VDLL 5D2LB 3GIVB 4CN1A 2ICEB 4NNXB 2BSED 3AXLB 4MQXD 3K8LA 5ENWA 3O2DA 5KTEL 1S7UB 4NKMA 3O9WB 4Z7WB 4TUJB 2CH8A 1IC5H 2MSPA 2HJKA 3VRLE 3WJJC 3UC0H 5HYEA 3FOMA 4M6ML 3WIFA 5I1AA 1RUQL 2EXWC 3L3HB 4MAYD 4L29B 3S96B 4HBCL 5A2KH 5I2IA 5HHOD 5D7JA 1FJ1A 1S78D 4BK4A 3SBWA 3B5TA 2C3WA 3QJHB 2FGZA 3QRGH 32C2A 4O2EB 5EBMB 3NBNA 1OTTD 1YY8A 3MRFA 1HXMB 3D0LA 1U93A 4ALAL 4HCRH 3KJ4B 1SYVB 2YMXH 2NX5B 3ARQA 2PYEE 1ZWIA 4WFHD 5KOVC 5DMKB 3P30H 1CLZH 4NKOA 5E8EB 1IQDA 1YJDC 5DMYA 4FQXD 2F8XC 2AJXL 1IM3B 1LE9A 3IDNA 4G8FA 4JZOA 1T6VN 1UEYA 1QLRA 3FRUB 4GKZA 4X9HA 4YFLF 5C71A 5MI0C 4NC0B 4JKWA 3MC0A 1A02N 1REIA 4LSQL 3C09B 4W70A 3BPOB 5GIRB 3QIUC 3M07A 3OXSB 5FA4B 3X11B 5HI4C 2ZOLB 2ARJQ 3NIGE 4PJ5E 4EBQH 3MV7B 4OF5A 5JIIA 4A6YB 1MI5A 1JL8A 4YZFF 2Z31C 3HKFA 4E41E 3O3BB 2P5WD 2FO1A 2R2HA 4YAQA 4E0RB 3QHTC 4QHLB 3P0VL 3BN9D 3FFCA 3EFDH 5IBLD 2CK0L 2WIIB 2AK4A 3UZVB 1I7TA 2JJVA 2V7HB 3ARTA 4X8JA 3QXDB 1JPSH 4UT7H 1ZGLA 1XGPB 5C70A 2DM3A 1QSEB 5CJXA 1G9MH 1EO5A 2EXYD 5DZLA 1IGTB 2Z91B 4WW2F 3EAKA 2VUOA 2G9HB 4K23H 5TDOB 1FZKA 4AENA 5HVWA 1BX2B 3MCKA 2X7LB 4XMKH 1XIWD 1UXWB 1BFVH 1HHKA 3DOSA 4MZ3A 5E08H 1MY5A 2X4RA 4K3HA 3V7AG 2AXFB 2DQDH 3OKMB 3LDBC 1H5BB 1EAJA 3V5HA 3O0RL 3TJEH 1FO0A 3QWOB 3LZFL 5T5FH 4F15B 1D5MA 2D0FA 3HE7D 3VXUA 2ATPA 1I9IH 4XGZA 5DGRA 4JJHA 4MNGA 1DJSA 3R06B 1WGOA 1KC5H 3QUMB 1WEJH 1BWMA 4XVJL 4OFIA 5E4EB 3VD7A 4X80H 4F2MA 3ALPA 5JORB 1YMMD 4ODHH 4RQQA 4MD5A 3VWKA 4HFWB 1JPGB 4I0PA 2VXSL 3TZVB 1MJ8L 3CDYA 4R2GD 1ZA6B 3W5MA 2AGJL 1JK8A 3QHFL 4OLXH 3MBXH 5BO1H 2H1PL 5E70A 4P46C 5EFIB 4J4PA 3SDAC 5E8NB 2YD3A 4ZO6A 4WGVB 5TFSH 2YUWA 3H9SD 4GKSA 1LO5A 1QRNE 5JW3H 3D25A 1BZ9A 2Z93B 1MRCH 5J6HA 3VJ6B 3CUPB 4XVSH 4AG4L 2CSPA 4OIAA 4GBXB 1Q9WB 5HVHB 4KUCD 3DXAB 1JF6A 2NY6B 5J6GB 3BKCH 5KW9L 1TVHA 1RU9H 2VN4A 4BFGA 2VZ1A 3QA3A 1IEAA 5CD3A 1HHGB 3NCCB 2K9UA 3HI6H 3PQYB 4RGNB 3GK8L 3UTQA 1MFDL 2A6DA 4GG6B 1T1WA 3MLWH 3PL6B 4KK9D 2VITB 4HGKC 3ARXA 4WFED 1DBJL 3SEPA 3ZDZE 3D9AL 2IANA 1QQDB 4HXBH 1VEOA 3O6LL 2QLVB 4QEGA 4OGAC 5DQJA 4XNUH 2O5YL 4LSDA 4XWOD 4HUWB 3IKKA 1IGCH 3I3EA 4G8IA 3TO4B 3RWIA 1DVFA 4GRWF 5DJ8B 3NZHL 4IMKA 1LP9A 4PJ8C 4O4YL 1TITA 4RFNC 3A67H 4Z7UB 1FPTL 4HULB 1CBVL 2IH1A 5FUZL 2EC9U 4OKDA 5CP7B 1EEZA 3ARFB 4MA8L 2DTMH 5DJYA 3BUTA 4D9LH 5DQ9B 3AS0A 4I0PC 4L9LA 5C92A 5FHBL 2CGRL 1A4JA 3O4LD 3OKEB 4Q74A 4WDIA 1EERB 4ZYKA 2HKFH 4PRIE 2CKBL 1RZKL 1QFUH 4AEFA 4J4PC 1S3KL 4LSTL 1B6UA 1BVZA 1EZVY 4RIRB 4Y16C 4DZBA 4DQOH 3LSOA 2DLEA 5I66A 1XAUA 1BJ1J 4JB9H 4OSUH 1IEBA 4J12A 2NTFA 5EIIA 4HWEH 4HPYL 4RFOL 3CXDH 3DUUA 1CXFA 3W9DA 5FKAA 3LHPL 1BIHA 2F53B 4D3CH 4F8TA 4NN6B 1FVCB 1YECH 2AP2A 3MUGA 4YPGA 4UAOC 2DMCA 3L3DB 2H26B 4NKIH 5DFTA 3KXFB 3OPZH 5DUML 5LBSH 3Q5YA 4LU5L 4MJ2A 3B9KA 3KPRE 4HQQH 5MEPA 2V17L 3QBTB 4NO2A 5DRNB 3I84A 1QFWI 2P8MA 1YUHA 1G7QB 3O8XD 1ZSDB 1GIGH 4TOYH 2ESVD 3EYVB 2QADD 3NIFE 4G7VL 5DSCA 1NMAH 1YJDL 4QGYA 3D2UA 3RUGA 4YFEA 2BRRL 1K6QH 4Z78B 5E6IC 3M1BA 2BCKA 4XHJD 5C0BD 5CBEA 3BGMB 5ADPL 1TETH 5A40E 1XCQB 1MCIA 3B9EA 2FJHB 1NANH 4H20L 4XVUC 4ZFZB 4L9LC 3F58H 3KYOB 1T80A 1NFDA 5EU5A 3G04A 2MMXA 4JFXA 1UKSA 1JP5A 2IQ9L 1MNUL 1BP3B 1OM3L 3BKYH 5KANG 3N1GC 5IJKC 1TTFA 5I75B 3FT2A 2EDFA 1JZ7A 4P2RA 1S9WB 4X6DB 2E9BA 1NGQL 5INDB 5EZOH 3RGVD 3PIQB 3STLB 2W07A 4XPHH 4LVEA 1JWMB 1HIML 4OCLC 1AGFA 5GSRB 4JVWA 1MAMH 2R1XA 4RDQG 5TJWK 3VGAB 4TUKH 3O6KH 2VLJB 1RK0A 4GBXD 4NYLB 1JBJA 3O4OC 1ZVSA 5GGTL 3RAJL 1FSKC 2Q8BL 3CVIH 3JV6A 4JFYA 3D39B 4FZEH 1IQWH 3QIBB 1FN4B 4NQDE 3GNMH 3U30B 1KLUB 2VABB 4K8RL 2VE6B 5JHDE 3TC9A 4HXAH 3ZSTA 2CXGA 5D1ZC 1NCBL 4NWUH 1ZAGA 4K3EL 2Z4QA 5D7LB 3S4SA 2YHGA 5I1IH 3I6LE 1QBLL 1IBGH 4AK1A 4UT6H 5CSZB 4HJ0C 1XR9A 4R4FH 1BVLB 3OF6A 5EU4A 1U8OB 2VMFA 4GW1B 4A6YL 3JVGA 4P5TC 5DEFB 5DJ6A 1L4IA 4FFWD 4TYUA 2Q76B 4WIQA 3KVQA 1GGIL 3CAFA 4EOWH 4LCYB 4OCSH 3U36B 5KVMC 4O02L 1I3RB 1R6VA 3C5ZD 3N0PB 2ICWB 2ADFL 3SDDC 2W60B 1UQSA 4Z0XB 4U0RC 1WFUA 3GMQA 4ZSOA 4ZAKB 5C0CA 1I1FB 1LK2A 4NQXA 4O2CB 2G5BA 4PIRF 2JB6B 2DQEL 1AGDA 3RNQB 3V0VA 4NQEA 4NWTL 4KRPC 1D9KB 3RTQC 1QSZA 4LLDA 2PO6C 1S7RB 4BQCA 1H3WM 4JFDD 3RL2A 4Z0BH 1YYLL 1W8OA 3OG6B 4P2QE 5HDQH 1G6RB 2D3VA 3L1OH 5DK0A 5ICXB 5T1DL 1Q38A 1RFDL 1QO3B 2WLYA 1I3GL 1Q9LA 3PP4H 1KIPA 4RNRB 2FYYA 3CCHA 2DTSA 1FYTB 1R5IA 2VDKL 4YUEL 5E8OB 5J1TC 3LPFA 3O3UN 3QUYD 4XH2B 5DO2C 4NQTA 4F7EB 1GZPA 2YD1A 1I1AC 3DURA 2WBWB 3IB4A 5MENE 3QUML 3AUVA 3T0VA 1G7PB 1Z3GH 2K3TA 2AXGB 4L3ED 3U2SB 3MFGB 1YEKH 1QP1A 4ORGA 4UV4H 2ZUQC 3JVGC 3UX9B 1LE5B 2R69H 5BVPL 3C8HA 2KZ1B 2IPUG 2EIZA 2A6JB 2YKLH 1AQDA 1KPUA 2Y72A 4YXKH 7CGTA 4IRSC 3VFOA 1SJXA 3RVXD 1ETZB 3SJVE 3VFSB 4WFFD 5GSVA 4NZTL 5L2KB 4D94A 1IAIM 4QTHA 1RZ8B 5EUKB 4Q6IC 1NDGA 1MCPL 5FCSH 3QNZB 3LQAC 2YPLB 3MRHB 4YDJA 1MJUH 4NQCB 4PJCE 5FGSA 1QSFE 4Z7NE 5EZIL 1DLHB 1EVTC 4U1LA 3LN9A 1X5FA 1OSZB 1T5XA 2NR6D 2H2PD 4KZEH 5IGXL 4N8PA 3MV8B 2P24A 1IARB 4JHAL 5IMLB 3BPLB 5F8RC 2ZKHL 2EYTA 1N4XH 4E5XA 2XPGB 4RRPA 3UJJH 3GMMA 5SV3A 3SKJL 5I8EA 3O11B 4ENEC 5C0ND 2W0FA 4Z7QE 3WN5A 3P11L 5JOEA 1GL4B 2DQTL 1ORQB 3VDAA 3MODL 3OKOB 3QEQD 4WW2A 2WQ8A 1QKZH 3BWAB 3VFWA 1VA9A 3VXNB 3GBLA 4MSWB 5IUSA 5B39A 3BXNA 2E9JA 2O61A 3LKNA 3TBVA 1T1YA 4R7NB 3WO4C 4FQJH 4PRHB 3EYQC 3TFKC 4ZNEE 3P4NB 3UP1A 3U0WH 1A64A 2X2YA 1FH5L 2D7OA 3L3OB 4XCYA 1GC1C 1Z9LA 4MXVF 3RZCB 3C6SA 1PDKA 2HWZH 3VXTA 4MB3A 1TZIA 4YDKL 4TVPD 1C1EL 4QRTB 3DVGA 3OL2A 3F7YB 1W72A 1FFNA 4UDTB 5DHYA 5I1CH 2W92A 3QUXB 4NRXB 1CTOA 2ILLA 3QI9D 4WUKH 3KLAA 4H88H 4S10A 1LWRA 3QFJD 3MV9D 1DSFH 1G9NH 1TQCC 4ZOEA 2G60L 5IBTH 5D71H 3VFPA 4NKDA 5DA4A 1X6LA 5ICZA 4X7FC 3JWOH 4H26A 1IM9B 5I1GL 3TEUA 2D4DA 3RVWD 3BEWA 3NH7L 3K2UL 4D8PB 3ULUL 1UJ3C 1D9KD 1EHNA 1FIEA 1UA6L 1IKFL 3QNXA 1CWVA 3RI5K 3SKNA 3WN5C 3MJ9A 4MJ4A 3IDMA 3RIAF 5IIEB 3BHBA 4FQCL 1T83C 3ESUF 1FNEA 1OT1A 4XMLH 4WW2C 4PG9B 1T2XA 2NPLX 2OR9H 2LV4A 3L7FA 4WW1A 1FYTD 4OQTH 4N9GB 4PJEB 3TBTB 1L7IH 1SJEB 3G5ZA 3GEWB 2NY2B 5E56A 1KOAA 1EFXD 2IQAB 5FYLD 1OAUH 3SDCD 4V1DA 4GXUM 1AJ7L 4JPKH 3WNPA 3MR9B 1T3FA 2YPVL 3DHJA 1CFQB 1H3PL 1T7ZA 5BV7H 2H32B 1B2WL 3WFCL 3BW9A 2DLFH 3BGFC 1CL7I 3F5WA 1QHPA 1N5YH 1NCWH 1NKOA 1UM5L 2EH8H 3I6GB 5F3BA 1HHJB 2HFGH 3UTTE 1N5AB 1P6FA 4HEPG 4F3FB 1JE6A 5ESQA 1WBYA 5L2KD 4UIMB 4Y4FB 5K59F 4J3OC 1UH3A 2MFNA 4K07A 3NACL 1K3IA 1W8NA 2L4OA 3HS0B 4LSSH 5AWNL 5EOCH 3WFBL 4WO4B 2IF7A 5DFWH 3C60D 1NSNH 1P7KB 2VDNL 2GJJA 4HT1H 3ZE2E 3ISWA 3ZYJA 3NCEB 1S8DB 3OX8B 5FYKH 5JO5A 4ZUWB 2R29H 5FYLH 4UNVA 5HGAA 5C0AB 5IV2A 4YK4B 5C7XH 2BDNH 4ONHA 4RBPK 4Z7VF 3RY6C 2WK2A 3QDHA 4F7CA 1H3GA 4UTAL 4KPHL 1B4JH 4M6AA 2NY3B 3DRQA 3SO5A 5I1EH 1JN6B 5GZNC 3WHE1 2NY4C 2A83B 4NO5B 4HPOL 2R2CA 1U8PA 1CLYH 2FEDC 3VG9C 4Z76A 5HXMA 3HRZB 4PPTA 1KF9B 1HINL 4L5FH 4I9WD 4XAKD 3MLXL 3R0MA 1HHIA 3GZKA 4G8EB 1ZT1A 2CDGA 4QOKB 2JCCF 3O45B 5L9DH 1OARH 5CFHA 4MDIA 4ZS7H 5ELIA 4ZUTB 1G7LB 4OF0A 3THML 2WIMA 4HIXL 5F1OB 3SDXE 1J18A 3KG5A 4G9FA 1HSBB 2HTLD 1U8QA 2ORBH 3ET9F 4MCZB 3MLTB 4EUPH 2YRPA 5LWYL 3MFFA 4PGEB 1DP0A 4KUZL 5GRVL 1OAZH 3GSVA 3LKSA 2P5ED 1VCAA 3FHQA 5BMFL 3CFBA 3G6DH 4OZFB 3QUXD 5DWUL 1FZJB 5C86A 2JJTA 2JK5B 2GCYA 4HG4J 4UUJA 5C08B 3KDMA 2G75A