4XPAL

X-ray structure of drosophila dopamine transporter bound to 3,4dichlorophenethylamine
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
214
structure length
214
Chain Sequence
ENVLTQSPAIMSTSPGEKVTMTCRASSSVGSSYLHWYQQKSGASPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSVEAEDAATYYCQQFSGYPLTFGSGTKLEMKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Neurotransmitter and psychostimulant recognition by the dopamine transporter.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transport protein/inhibitor
molecule keywords Transporter
total genus 52
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2015-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xpaL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xpaL01
2MCPH 4HIJA 2WIIA 1CFVH 4NBZB 2YK1L 5INDB 3C2SA 4FNLL 1L0QA 5IVZA 5HYJE 2EIDA 1I4FA 3JWNC 3CH8A 5EZLA 3RL2B 1LEKA 1ZHLA 3L3DB 1R3KA 5K9QG 3SDXE 2VLKD 5D7KD 4C59B 2YD3A 4PG2C 5ETUA 4YDLB 1JWUA 3U6RB 1BFVH 2WZPD 4CDHA 3PHOA 1I1CA 3NCJH 2X44D 5KJRL 5DJAA 3HR5A 1LEIA 1JWSB 2OZ4A 2GJ6E 3OKLB 1DEDA 1TETL 1YECH 3VCLA 5IGXH 1VADA 2W9EH 1KYOK 1C1EL 3IDYB 5DK2A 4RISH 1DTUA 4ZMAT 2UY7A 4OI9A 4EKXA 4K2UL 3FQXB 5ESAA 2F58H 2WWMC 4GW5B 4NPYA 3TBSA 4XNUL 1T1ZB 1AD9B 3O3DA 4KJWD 3FQUA 4U3CA 2AXFB 4Y4KD 4CAGA 1A4JB 1FNHA 2W92A 4DUVA 1UXSB 4XAKD 5GISH 4W4OA 1FVDB 3KR3L 3RZCA 3U0WL 4EXPX 4ZODA 1CDJA 4TVPH 2C1PB 2ICEB 4MS8C 5I19H 3SJVB 2FD6H 2FO1A 4U1KA 4OZIE 2DBJA 2BRRH 2GAZB 3V0WH 1CXEA 2BVYA 5JW4M 4MXVE 2F19H 4ONHA 1DL7H 35C8L 1D5MA 4HUUA 4DK6A 1AXIB 2P24A 5DUML 1XGTB 1KB5L 4WRLA 1DBML 4UT7H 3JWDL 4JM2D 3UJTL 2B1AL 1YY8A 5AZ2H 4C56B 1F13A 4BKLA 1EAPB 2E9IA 4XMKL 1MHPL 2VDKL 3ZTJG 4O51B 4LMQE 3PUCA 4P5KA 4HDIA 1U3JA 2JJTA 1AGDB 15C8L 4U0QB 1IAKB 5CCKL 5A3ID 4KJYB 3QDJB 1AI1H 3S97C 4BZ1H 1CF8H 3N9GL 3F7QA 1EHXA 2FHBA 2HJFA 5C08A 3S3PA 1ZVSA 1Q94B 4LLVA 5JR1H 4O9HL 4NO0A 4C83A 3NGBB 3IKCA 5LAXA 3MRMA 4WEMB 5JUEH 4KKBC 1DBBL 2R4RH 1AXSA 2HT4C 2RCSH 1HHKA 3UTTD 5KVMC 4EJ1C 4G6MH 4LCCA 5EZOH 2ENYA 3NCMA 5DJCB 5DUBA 1J1OL 1KF9B 1QHPA 2LU3A 1GOHA 3LIZL 4HKZA 3T4YA 3BYYA 4RMRA 2R8SL 2APWA 3DGGB 1YN7A 2FJGA 3QQNA 3QDJE 4PJAE 3WS3B 3ROLA 4HUWA 4WDIA 1ZOXA 5TDNA 1EGJL 3MV9D 3RZCD 4P57B 2QQKH 5TPWH 2X89D 4X83A 5DUPL 5CZKA 4Y1AE 4FFYH 2HTLC 4HXBH 3VFSA 5CKGA 1FGNL 2BHZA 4XP9H 5CJBA 1IAOA 5ALCH 3QUZD 2AQ2A 3HC4H 5IROA 2FSEA 4KROB 1QR4A 3CXHJ 1HSBB 4LIQE 5T1KB 5I17B 4Y2DB 2VL5B 1OAYL 3K46A 4GRWB 5J9PA 4KJWC 4DN3L 2D7OA 2ILLA 1D5ZA 1CN4A 3C09B 3ZDXE 3MRKA 4GG8B 5IVXE 1OAQH 3OB8A 4L4TB 3QRFM 1NGYB 1SYVB 3KHQA 4LSTH 3KPRA 3RL1B 2FHCA 5JORB 3D5OF 4NO3B 3TBVB 1KN2L 1N4XL 2DL2A 3ILPA 3LQAL 3O3EB 5ADOH 4OAWB 4TOYL 1RJLB 2FCBA 5DMIH 3VJ6A 1FVCB 5HI4D 1Q9OB 3VFPA 4JFED 3GMPA 4XPFH 3W0WD 4QYOB 4KJYA 4JHAL 2NY2B 1FZJA 1RJZA 4HWZB 4O2EB 1FP5A 1ZLVH 5LGHL 3O6FA 4XCFL 1EAJA 1IC1A 4ETYA 4KZDL 1GC1C 5AZEH 1P5UA 1ODAA 1P7KA 3KG5A 5TQ0L 5C0IA 3GSWB 2EDFA 4JY6A 2YPKA 4KKCC 2PYED 4NFBA 1OQXA 4LCYA 3MUGB 4OZHF 4LASH 4JY4A 3BHBB 4NCDA 5KSUA 3HZVB 3MUZ1 1RHFA 3ZDYF 4ZSOA 2YUWA 4JKKA 1JPGA 4XBGA 2HJFB 3D48R 5E8NA 1G9NL 5E99H 3VRIB 1SVZA 3K81A 1ZVYA 4OF7A 5F7EH 1MFDH 3TBYB 4YFEA 1IAMA 1EO8H 3Q48A 4N0UA 4MAYD 1MCFA 3UC0L 1A6UL 1PW3A 3MRJA 2IMMA 2CJUH 4JLRB 4XRCA 4PD4K 4OD3H 3LVEA 2FLRT 1F3RB 1RK0A 1CGVA 4PJCE 1KEMH 3RY6C 3S96A 3QCUL 5DJCA 4M4RA 1S7SB 4U6HB 1HKLL 4M6OH 3TPUB 2B0SH 1NC4A 4G9FE 3HPLB 2Y23A 5SX4H 4HWBL 3F7PC 2VXSL 3W9DA 4HX1A 5E2WH 3KPRE 3GSUA 2J6EH 1YC8A 4F57L 4JFPA 2NMSA 1AQKL 1PEWA 2OK0H 3DARA 3QEQE 3O8XB 4GG8A 5H35A 1NCWL 3IB4A 1ZA6B 4LVNC 4PY8J 1N59A 4QXUH 4M9PA 1FCGA 3QQ9C 2BCKA 3IDMA 2A83B 2PTTB 1P6FA 2Z8SA 4UUJA 4RAVA 5TF1L 4NKIH 3L6FA 5IG7B 4ENEC 4QRSA 4ZS7H 5K93A 4KRPD 3Q6GH 4CVZA 1IAIL 4PUBH 3WDIA 4CJ1A 4UILL 4JREC 5DHYA 1IRAY 2YXMA 3NFNA 1EH9A 2QHRH 1TVBA 2NW2B 4EBQL 3NCEB 3UPRA 3GRWH 4O00A 1NDGB 3IFPA 4WHTB 4NQEA 3RWFB 3LN5B 4EI5B 2N7BA 2CK0L 4JFZL 4JO1L 2A9NL 1A7QL 1YNTB 1ZHLB 2Q3AA 5MEQA 4I0PA 2DMBA 1OCWH 1P1ZA 2QKIB 4QOKB 4IRJA 3MNVA 4HUVB 2EE2A 2PO6C 3WBDA 4NOBA 1P7HL 3QHZH 5DD1H 4P23B 5D2LE 1Z5LA 4XCYA 2A9NH 5HY9B 1PY4A 2CK0H 2H1PL 4JFZH 2AJSH 4YAQA 2ZNWA 1WUNT 5IFJA 4JFOA 1S7TA 2YA1A 2IADB 3PDGA 4HS3A 3T0EE 5JW4N 1U91A 1DANU 5I1JL 3SDDC 5EO1B 2EDOA 5HVFB 1S7UB 2BMKA 3PP4L 4GAGH 5A2IH 1MSPA 3MA7A 3NABL 4OBRA 3TWCL 3W2DH 1EIBA 3OSKA 5ID1B 3HE7D 1T4KB 2VDQL 3T65A 4WWID 1QVOA 4GG6F 3F7RA 1KPUA 4G9FD 4S1RH 3OKOA 2M8XA 3BH9B 1H3WM 3T4AA 1JYVA 5EDXA 5C09E 4LLWA 4Q2ZB 2NY2D 1U8JB 4CMMA 3PGFL 3GB7B 1QQDA 3P9LB 5I1GL 3BX7C 3D39A 2AJVL 5D7LD 3WFDL 4PRHA 4Z7UB 4QXUL 1YEHH 3RGVC 1D5BB 2EKSA 3WDJA 4MXQD 3QULA 2NY6C 5DHVH 1Q9WB 2Q76A 4U1KB 4G6FD 4PTUA 2ZUYA 4K07A 2GAZA 5DMKA 1U8OB 1ZEAL 2RQ8A 5D5MB 3ROOB 4CU7A 1RZJL 1LNUB 3FO0H 3RX7A 1BFTA 2V7NA 2BVOB 2VXSH 3HMXH 4DVBA 3CMOL 3KLHC 4HXAL 1ZHBA 5JW3H 2AP2A 3GSRB 3RWGB 2R2EB 1QFUH 4KVNH 4RDQF 3TZVA 1M7XA 1MCSA 4DFHA 3B4NA 5ITBL 1W72L 2J6EA 4R97B 3LKNB 5FYLE 3GSNB 1AP2A 3F6IA 1JN6A 2VAAA 4QTIH 1EEZA 1IEAB 4GXVL 5CSZB 4JN2B 3RPIA 3VH8B 1IGML 1FGVH 1J18A 2NXZB 3P77B 4ODTH 1OLLA 4Z7WA 4YNYA 4XNXH 3ZKMC 4GUPA 4M62L 1EO8L 2Z93B 4E41B 2NR6D 4IM8A 2WUBL 4V1DB 1Y18B 4H1LA 2VZ3A 3CLEL 1HNFA 1MCOL 2YN3A 1R0AH 3BZ4A 4Z95H 4JDZA 1E4XH 4XCEA 4DKEH 1A2YA 1BFSA 2IEPA 3QEHA 4L5FH 5IWLA 5E6ID 3T0BA 4NQVB 2MQ0A 2FEEI 1G6RH 1FGNH 4XP9L 5BZWA 2NY3B 5DHVB 4E42B 1FRGL 1Q72L 4B0MM 2P47B 2V2WA 5DJYA 5DUPH 3DHJA 3VW3L 5TPWL 1NAMB 3QNYA 5E2VH 5JOPE 1FNGA 3SDXB 3DO3A 4RMTA 2GK0A 3QWQB 4M1DL 3BKCL 1I3RA 5CJ8A 3TH3T 2LABA 2MPAH 5D1ZB 4GRLC 1CICA 4WTZA 2PXYC 4Q0XH 1YMMA 1R5IA 5HHVL 1N0XH 4J7RA 3SE3C 3L7EB 2GHWB 1PFCA 2R1XB 3SE3A 5I1CH 4Y7MA 5DURB 1S7WB 1UKQA 3SDAA 2UWEB 1IGJB 3QDJD 3LQAH 2DTSA 1UB6B 4HSQA 1MRFL 1UEYA 3VD3A 2AJZA 5DD6B 3OTTA 2WAHA 3BMVA 5IVOA 1N5YH 3ZE1F 5ILTL 1D3CA 1NCBH 2XXMB 2UVFA 2VR5A 4WTWA 1J0ZA 4RGMC 3DXAD 3LKOB 1KPUB 4LARL 3BH9A 4PJGF 5EU6B 3NFPA 2XPGA 2ICWI 2A9MH 3SY0B 1EJ6A 4F7EA 1JZ4A 5FUOL 4NQCA 2Q8AL 2Z92B 5GGUB 5EWIL 4MQ7B 2IQ9H 5KOVC 5C3TA 4NQDD 3CVHL 5GXBB 2GK2A 4NRZA 4ZO9A 4OM1L 2Q7YB 4HGMA 5DRNA 4FFYL 1B4JL 3EAKA 2WINA 5DJDA 4U1SA 1UVQA 5I1DA 3CPLB 3G6AA 3QXUA 3KLAA 1OWWA 2IAMA 3WFCH 4AL8L 1XCTA 5EULV 5L8KB 1OAZH 2VLJD 3GSOB 5D2NA 5DFWH 1U8NB 2A6JA 2DQTH 3BIKA 3CXHK 3AS3A 1Z6JT 2PR4H 4OV6F 3WKNA 1R24A 3PWVA 1SJHB 2W0PA 5C0JA 5D93B 5GJTL 5KVDL 4OTXL 4Y5YA 4PY7B 5FYJD 3OJMB 1DP0A 2P49B 3JTSB 3O6LH 1ZT7A 1MFEH 2J5LC 12E8H 4OLYL 5EZOL 5AG8A 2FYYB 1GZPA 3QI9B 1N6VA 2XIDA 3RKDC 3P77A 1CU4L 4U3HA 1MRCH 3KWWB 5CMAB 4K3JH 9CGTA 2D7QA 2MOVA 4LQFL 1RVFL 1CFNB 1F3JB 3NIDF 4CMMB 1S7QA 1PG7X 2KQNA 3BESR 3BWAB 1MIMH 2P5EE 4NQDB 4U6XA 2X7LA 5IM7A 1PG7H 2APTA 2KL6A 3FAXA 3S3JA 1S9VB 2R1WA 5T3ZE 3JV5A 1IGTB 2BDNH 2E27H 4CMHB 4TSCL 5K33A 4YJZL 1UM4L 4KK6D 4O58L 2YWZA 3R06B 1VEPA 4F8QA 3IJYB 4UTBL 4ZOEA 1D9KC 3JTTA 4PRIA 1EBAA 3HZKA 2G2RB 4Y0GA 4YHOH 5JPMA 1NBVL 4KK9D 4OUOA 3ZL4H 5FM5O 4R7NA 1E28B 2BDNL 2E27L 3UPCA 3UYRL 3E3QC 2IALA 4L4TE 3B9KA 1KB5H 2GY5A 5F3BA 2FGWH 1JPSL 1MOEA 2AK4B 1PAMA 1IM3B 2WV3A 3B9AA 3F62A 4LLDA 5LG1A 4NT6A 1AD9A 4ZTPH 1WCQA 2WSKA 3MV7D 1OAUL 2LE9A 2AI0L 5I8KH 1BOGA 2P8LA 4NQDE 1JYNA 1A7NH 3LKSA 3CFJA 4CU8A 3FFCD 3P40A 3B2VH 4K3JL 1MRCL 1HSAA 1QP1A 2I07A 2ERJC 4FP8H 3KXFA 3L95A 1CLZL 2MCPL 5D7JB 1TZIB 2D7MA 3U9PH 2R23B 1DBJH 3UJIH 1ZWIA 2QSTA 1WICA 12E8L 3Q3GA 1P7QB 3O2WL 3O0RH 2V5RA 5BV7H 2R29L 1PGRB 2OSLA 4J6RH 4JPIB 1X3DA 2R1YB 1LHZA 3PWPB 1D5MB 3KS0J 4LHUD 4PJHB 1M05B 3GUTB 4U1NB 5SWSD 4JO3L 5E7FA 1SJHA 4KGJA 2ATPA 5HTSA 3QIWC 4S1QL 4AIZB 3U9UA 4ZO6A 5INDA 2K1MA 3QNZA 4U0RB 3AM8A 3QXAB 1PKQA 3M8OL 4R2GD 4GQ9L 1TVBB 3CMGA 4EZMA 5C0ND 4KRLB 3KLAB 1LO5B 2GSGA 4MNGB 4WW2F 5D8JL 4Z7UF 4JM4L 1E4WH 2CGRH 4DVRH 1ROWA 3PGDA 5D1ZC 1MCDA 3MA9L 5IHUL 4J3XA 3VGEA 4KY1H 2IQ9L 3CFDA 3NPSC 4I0PB 4RMQA 4KK8C 4EVNA 2HP4A 5K9OA 4HMEA 4P2OC 3GBML 2WBJC 5EUOF 2P8MB 3G5ZB 4NRYB 4XVJL 4PJAA 4R26L 1GAFH 3U46A 3UTSD 5HVHB 1Z9OA 3MR9B 3QIBD 3IVKA 1GIGL 1PSKH 4F2MB 2DLHA 1I1FA 5DK2B 2FL5B 4JRYD 4JPKH 4WW1A 5ESQA 4LVHB 1JZ5A 4EI6B 3K2UH 1H8NA 4AK1A 5F6HJ 3ARGA 4UU9A 5ELIA 4NHCL 2GJZA 1NBZA 2LV4A 5DJ8A 3T0ED 2GITA 2XN9E 3MLUH 1A9BA 3I50H 5SWZD 5E95B 4MJIB 2CO6B 1S9XA 1U8LA 4LKCB 1I9RL 4NQDA 1EXUB 1X5HA 1H5BA 2Y06H 5DQDH 1YPZA 5GRJH 3VWKD 3D69B 1WIOA 2GT9B 4K7FA 1H5BC 4XHJD 1QSED 1IGTA 3K4ZA 5C09D 2IAMB 1I7UB 4O4YL 2K3TA 3IDNA 3DMMA 4PJIF 4LPWA 3CFJB 2DI7A 3RWEB 4MXWH 4FA8A 1ZA3B 3HAEG 5JA8B 2G2RA 1R24B 3VW3H 1F6AA 4DCQB 2F54A 3SO5A 3MUY1 1M7DB 1NEZA 4UIMA 1CWVA 4OJFL 1AD0B 1G7JA 3ULVH 4P2QA 3DX8A 5DEFA 5L6YL 1H8OA 2XZQL 4NZUL 1IM3A 4LLDB 5B8CB 2NNAB 4X9IA 5I17A 4XNMA 4QRPD 2AW2A 4NZUH 3BKJL 3CLEH 4ZPVA 1A47A 1YMMD 2WUBH 4OZ4A 4ZQKB 1IEBA 1AC6A 4TVSa 4GMSH 4M62H 5EU7C 2DIJA 5EUKB 1K8DA 2Z4QA 1EDQA 1DN0A 5FDWB 4PJ8A 2WUCL 4D9RD 4IRSD 1KLUA 5C0NC 5JPNA 4M7KH 1W72H 4GKOA 4ZAKD 3HG1E 3PL6C 2XTLA 4YEFA 4LP5A 5B3NA 4FMKA 5KW9L 1EZVY 3VFPB 3T2OA 2LAGB 2DBLL 3CMOH 1TJHL 4PRBA 1MY7A 3KLDA 4OFVA 2IPTL 1WVZA 2EE9A 2FX8L 1FG2B 3QUYD 3ZHDA 3RUGF 1LK3L 3EO0A 4UOW1 3RAJH 1LO3H 2DQCH 5FCUH 2VJXA 1E28A 3VFWB 4P5TC 3L3OA 2JK5A 1K4DB 3TO2B 4ONFH 1FH5L 4UAOB 3U0TA 4IDLA 4E5XB 2YKLL 5MHSE 2ZUTA 4L8CA 4HBQA 3IU3A 2IQAA 2H32A 5J1SC 1YMMB 4JPKL 1UC6A 3HZVA 1BREA 1NFKA 3BHBA 3I3BA 4MNQD 3P11H 2NY1B 3MLSH 4LCWD 1FYHB 5GS2H 3B6SA 1JMZA 1CGWA 3W81A 3IAPA 4FS0A 5IB2A 3S36H 4JFFB 4WWKD 4L4TA 3WFHB 1G84A 1DQLL 1S9WB 3GBMH 5I8CA 5F7HA 5ESVA 4L3CB 4PD4J 3SDDD 3GFUA 1FL6B 3S88L 1CGSL 4P59H 2QQQA 4F7TA 2BY3A 4PBXA 2ICES 3MRJB 3VDAA 4JM4H 1Q9OA 5SWZA 3O6ML 5E00A 3UDWA 3FT3A 5LCVL 1MY5A 2VISA 4YUEL 3TT3L 4WI7A 3G04B 4XMLL 4LF3B 4IOFC 1UZ8B 3EYQC 5GRUL 4O2CA 5FM4A 4NPYB 4L8SA 2XWBB 1OY3B 2EEBA 1YMME 4AQOA 2WIMA 4HHAA 4P5MA 4MA1B 4I2XB 4MJ6B 4M5YL 3MRFA 4DAGH 5DI8A 3PWLB 1DZBA 5D1QD 1L7IL 4I0CC 3V0VA 4MD0A 1CXHA 3QIUD 5E1HB 3SDCD 3QO0A 1FFOA 5F7WC 5L8LB 3AS0A 2P45B 2GTZA 1AIFB 1CD0A 1T0MA 4PJEF 5EH1A 4QRUA 4P46A 4Q6IC 1DVFA 3HI1A 2VLJE 4Y4KC 5HPOA 3FO2B 5C0CD 4DOHB 3L6FB 4FOMA 4KHTL 3H9SB 3JVGC 4OT1H 5E2TL 1HCFX 4ZTPL 4K3GA 2FIKB 5ID0B 1RJYB 1UGNA 3D85D 4I3SH 2KZ1B 3PJSA 1HXMA 4XZUB 3KYOB 1SEBA 4QNPE 1LO2L 3OKEA 5J7CC 1EAPA 3EJZD 1SMOA 4BK5A 1FJ1B 4P3DB 1W0WB 2NR6C 4IRSC 2C4XA 1R5WA 1GGTA 3KYKL 1W72A 2J6EL 3SDYL 4LOUD 2ZUSA 3K8KA 4MAUL 4H26B 2C3WA 3BKYL 5AWNH 4N90E 2ZSWA 3QDGE 1NFDA 4XBPB 5B38G 4N0YL 3QI9D 1MJJB 2B0SL 5BOZG 1QZ1A 1VENA 4OQTH 1HKLH 4K9EH 4M6OL 4ZYKA 3RWDA 1IZJA 4P23A 4GKSB 4ODUB 3UBXG 2FIRT 3QUXC 4Z7OE 2P5WB 2W60B 4KKAC 1BMGA 4UNTA 3EOAA 4XCCH 4A2LA 1HOCA 1UT9A 3O4LB 3IDGB 4LQFH 1MCKA 1XEDA 2HVKA 4KRMB 4AIOA 1YYLL 4NC1E 5LGJB 1BD2A 2XKNB 1S7UA 3ZDZF 4U1GC 2W07A 3BUYB 1YEIH 3DYOA 3T65B 3LCYA 5ID1A 5EA0H 5H2BB 5AG9A 1MREL 2D2OA 25C8H 2L4OA 4JG1H 2CQVA 4LLWB 1KSRA 4OTXH 1ZT4A 3G5VB 1INQB 2ORBH 4H1LH 3W0WE 1UEMA 1VFBB 4OBSA 3T2NL 1J8KA 1BZ9A 3KPQA 2VN4A 4PGBB 4X7TA 3RY4A 3FZUD 2JKXA 1NDGA 2OP4H 4WHTA 1GGCL 4C4KT 4NQEB 3RWFA 4WGWB 2C1OA 5D1XA 5JMOC 3FFCE 4MJ6A 3EHBD 1DLFH 1TZIA 2CLRB 3REWB 4HIHA 2DWDA 3DURB 3WFCL 1FAKT 3G9VA 1UWEH 5SWQB 2QKIA 7FABL 3RFZC 5LGHH 1XAUA 1JTOA 2NXZD 1CK0L 1UZ8A 3PGCB 4YDLC 1G7QA 4OFYA 4U6VH 3PIQA 5DJ0A 3SKNA 1CDIA 1H3TA 4U6TA 3STZA 3VXSA 3TZVB 3OKDB 3IFPB 1NKOA 4JFOB 5I2IA 4KMQA 1NCDL 1AKJD 3L3JB 3PWJB 5ADOL 4G8FA 1GGIL 1YNTA 4PJ7E 3MLPA 5EC1A 3L5XL 5D96C 4NN7B 3VXQB 2B1HL 3DIFB 2OR9L 4FQJH 3R1GH 2HKFL 1X4YA 2IH3B 3SKJH 1EJOH 3S35L 2FH6A 2ESVB 3FN0H 1DE4B 3LEXB 5ACZA 3BXNB 1E6OH 5JIPA 2AEPL 2BSTB 2C5DC 4KQ4L 1UADC 4LSDA 1OAYH 1BM3H 4NKMB 1DEEB 4KJQC 4OZIB 1XGYH 2ITDA 3GB7A 3P9LA 5FFLA 3VXMA 5GSVB 2DJ4A 4HWEL 3C6LA 3U4BL 1AO7A 2H32H 5HI5C 1C8PA 2R0LL 1EK3A 3OAUH 3AM8C 4J4PD 1UCBH 4MDIB 1UWGL 4RSVA 2FEDD 4ZO8A 3B5GA 4U6YB 3VFUA 43C9A 1ZHNB 3BJ91 4LF3A 5CILL 4E0RB 4Q2ZA 3OL2A 1TPXC 3BIBX 4OKVA 4OZFG 3HPJB 3HNSH 4S0TD 5DWUL 1WTGT 1GZQB 5SWZE 2AJYH 3RUGE 4YDJA 5HHMD 4JPWH 5KSUB 3U36A 3V2AR 2VO5A 4L5FL 1FV1B 5EU6D 2ADFH 2Y5EA 4P46C 1MCOH 5I76A 2RCSL 3IFNH 5BXFA 1O7SA 1A6AB 1DBBH 4G6JH 3BT2H 1OTUD 4OLXL 2UZXB 4NUJA 5HHOE 1QBLL 1N6QH 3VFNB 5FYJH 2BY1A 3AU1B 1A3LL 2Z31D 3WIIL 4EDXB 5F9JB 3RI5K 5HVHC 3CJJA 5D6DC 1NCDH 4JDVA 3NZHH 3NCCB 1YYMH 5LXGL 2XPGB 1CF8L 3LQZB 2CIIA 3N9GH 3HFML 3EYVB 4OFKA 3RUGB 2DD8L 4E9LA 1AO7D 2BNRA 5E94A 2MFNA 15C8H 5C0AA 1WSST 2XZCL 4YHML 5CBAB 3I3EA 3G6JE 2BNQD 1XCQB 3DUSA 3TN0C 3C60B 4PRIE 7FABH 3O9WD 1ONQB 1T1YB 2GCYA 3ZZ1A 1HWHB 1F4AA 5IF0B 5D2NC 5JPNB 1BQSA 3C2AL 1KCUL 1N59B 4L4VD 5LQBL 2V17H 3E6FA 5ALBH 2H6PB 5BJTA 5GS0H 5I1GH 1A64A 1KG0B 2P24B 3GNMH 1LP9E 5L9DL 2VH5L 2PW1A 5I8EA 4MNQE 2OJZH 3KLSA 4RQQB 4BQCA 1ND0B 4FABH 5EA0L 4IMLA 3A67H 3STLB 2VXVL 2QSVA 3QUXA 4P0DA 1WV7T 1P9MA 1X6LA 4XHQA 8FABA 5IB1B 2W65A 5D7LE 3CZFB 5CJOH 3VA2C 3GBNL 5KVGL 4P9MH 2VERN 4XC3H 3CVHB 3QUMB 3KNBB 1YEJH 3FFDA 1OL0A 5ITFB 3DX7B 4QCIB 1OLZA 1JMXA 3T1FA 2FH8A 1UJTA 4R4ND 4MDJA 1WWBX 3QSKB 1LK2A 4X6DF 1ETZB 4XNUH 3JWOL 4QTHB 5ICZA 4JN1H 4N0YH 2DDQH 1YEEL 2AV1A 1YN7B 3IDJB 3EZJB 4KU1A 3FAWA 4MNQB 1FZOA 3VFUB 5DLML 3JTTB 4PRIB 1W0VB 1S7TB 4XGZA 3LN9A 4H0IA 5T1MB 4RFNB 5MENA 4M6AA 2E8ZA 1T0NB 5I6XB 1UACH 5I2IB 2XNAA 3IDXH 4MCZA 2O5YL 1D6VL 5DRNB 3W82A 1FCCA 2C9AA 5EC1B 3TVMA 1JZ7A 3LS4L 4PJCB 3WD5L 4HGWA 3WS3A 2DLTA 1DR9A 2GFBA 4KGLA 4YR6B 4OLWL 4AMKL 5E08H 3GKZA 2B4CH 3QG6A 5BQ7B 1A5FL 3V0AC 5FO9A 2CUIA 2A73A 3V4VL 5IFHL 4KZEH 3ZE0F 3P30L 5LBSL 3RL1A 1RMFH 5C0GA 2VXUH 1GPOL 3EYSL 5JOPD 3RY6A 4JREB 3D85A 3BOVA 3L1OH 4TPRH 2NY3D 3N1GC 4XP6H 2D4DA 4B5EA 1IT9L 4QRTA 2APFA 1M05A 3GUTA 4BUHA 1IC5H 5HD8C 1CVSC 4LVEA 4YBHA 1CL7L 2ED7A 3F7VA 1RZKL 4XMLH 3BPNC 3GKWH 4HF5H 4Z7WF 4J3SA 1SEQL 3H42L 1DQDL 2D7TH 4L4VB 4YK4C 3QG7H 3O6MH 4JQIL 1RUML 1VKXB 1VACA 4G7VH 3MACH 4JFFE 4P59L 2CR6A 3S88H 2VLME 3HMWH 4FTVB 4P49A 1LDPH 5FF6B 4IMKC 3VMNA 3MLVH 2PKDA 4QHMB 3CC5A 5DT1L 1B2WH 3T8XB 2NY5L 4ZD3L 1IBGH 2B5IC 3ROLB 2P8MA 4NRYA 4QLRA 3U82B 4QRPA 1MJUL 1BEYH 2F74A 2I07B 2EIEA 1KGCE 4EIGB 3IFOB 2APXA 4I0PD 3RI5F 2ZJSL 2BHUA 3CFCH 3VXRB 3V5HB 1TPXB 2K9UA 2NPLX 4Y16C 2IALB 4BSJA 5T3ZL 1I75A 2XOTA 3I2CL 4NT6B 4X6DE 4EUPH 3AREC 1VADB 5AZEL 3RTQC 4KI1A 2BFVL 3PABB 4AIZA 1LK3H 4XCFH 4QHNA 4OLEA 4M7LT 1UH3A 3TYFA 4LRNL 3WLWD 1E6JL 2VR4A 5GRXG 2EXYD 2GQHA 4F80A 1KEGL 1A8JH 3GM0A 4MJ5A 1KJMB 3U1SL 4UTAL 5DJ6B 1P7QA 4M48L 3T0XA 2Y07H 5IQ7L 1RFDL 2J88H 4HFWB 3RZCB 3MRCB 1YNLL 3KXFE 2CDEA 4TSBH 1MWAL 2DQFB 2H2PC 2HT3D 3OPZH 3U46B 1DBAH 4P2RE 5AUMB 2HLAA 1RJZB 1XH3A 3HHRB 5FV1L 5C6TH 1G7QB 1MJ8L 5SV4A 5F88B 2Q6WB 5D71L 4I3RH 3EDFA 2H8PB 3WDHA 1II4E 1W2KT 4R7DA 1JHLL 4GRMA 4M7LH 1EBPA 5GZOD 4JDTL 4LHQB 5DHXB 4J12A 4KFZC 3CIQA 4WHCA 5L6YH 3I6KB 1QRNB 3BZFB 1VB9A 2YD6A 5I1KH 5FEBA 2FHFA 3DWTA 2UYLB 5GGRA 4R96B 3GJFK 5DJDB 5FUCC 4J1UB 1KFAH 4K8RD 3SJVA 2Y4SA 5MERB 1EO7A 2NLJB 2E8YA 1QO3B 3GSXA 1IQWL 1ZSDA 1KN4H 5T5NF 1ADQH 3K7UA 4XC1H 5DK3A 3HI5H 2EDKA 1X5LA 5LVEA 1REIA 2GTWB 1BWMA 3AFLA 4F7MB 1T2QH 4MD4B 1IGIL 2BY0A 5D5ME 5MP6H 3VXNB 4AQ1B 4WFHD 3VFTB 3VGGA 2CIKB 1AXTL 2ZSVB 2OI9C 5GRJL 2RHEA 2WBJB 2Y06L 4MA7H 2IBZY 1F6FB 3MLZH 5GQBA 3WE6B 5T1DH 5IKCA 5I9QC 3OF6D 4P2QD 2FYYA 3PHSA 1ZANH 2D9CA 3ULSB 3H3BC 1X4ZA 4U0RC 3S96B 3U2SA 3RX5A 3WL9A 1K4DA 4LOUC 3TH4T 2NY1C 4N8PA 4ZFFB 2IC2A 2ZZUT 3TT1L 2ADIB 4NUGL 3LKQB 5MI0C 4P9HL 2H9GB 5C7XL 2W91A 4JZOB 1G7HA 2BC4A 3MGOB 1AH1A 3S6CA 5EG6C 5TDOB 1C08A 5JXAH 3KYMA 5IB2B 5I1IL 2EDLA 4GRWH 1CIUA 2FDBP 3WLWC 2XZZA 5HPMB 4LEXL 3BEWA 1NCAH 1GHFH 1U91B 2E9BA 5IHUH 5FGCE 3MA9H 4JFDD 4OCXH 3HZYA 4PJ5D 3MRHB 1M7IA 2VDKH 4N1HB 1RZ7L 5D5MA 1HH6A 1CYGA 1U6AL 3FRUB 5BS0E 5TE6H 5JW4Q 1BF2A 1F02I 2Z4QB 2HYMA 3C08H 3NCYS 1O5DT 4LLQB 4PJ8B 3IS1X 2ITCB 2JJVA 1HKFA 1KACB 1YJDH 5DUMH 4MJ5B 2AJXL 3MFFB 4MJ4A 1QA9B 4O02L 4P5MB 1DL7L 1IM9D 2IWGA 2R29H 3ZLQC 3ARWA 3C60A 3QEQD 3JUZA 3B2UC 5E4IA 4J3VA 2FD6L 2VQ1A 3RGVD 2Q76B 4PRID 2NY6D 4KQ3L 1QBAA 4NYLB 4IBLT 1JNLL 5AUMA 1NJ9B 4DW2H 4PIRF 4IMKA 1MELA 4RFOH 3GSRA 3RWGA 5HHQA 1RIUH 3GIZL 2JK5B 4BQ9A 3W0WA 1WFUA 3TV3L 3VXNA 1BGXH 3MLYL 2CIKA 3LN4A 5DVKA 4OFDA 4R4FH 3A6OA 1FO0L 4POZD 4GLRH 4ZUVB 4WO4B 2HLFD 3P0VL 3B5HA 4HEME 4HD9A 1YPZF 4YXLL 3LMJH 4OFPA 1JGVL 4LSSL 5KJRH 2O26U 3EJJX 1KT2B 3D39B 1UKTA 3BVNB 4ZFZB 5DJZB 2V2XA 2KKQA 2ZUQC 4Z78B 5H37H 1MJJA 4MSWB 5DI8B 1TVDA 4HIIB 5DGQA 2EKSB 4X4XB 5TF0A 5IKCB 4NFDA 1AGFA 2PYFA 4G8GA 2QSCH 3FT3B 4M02A 3GGWA 3RTQD 5IMKB 3LMJL 2A0LC 2NZ9D 3PNWA 3P0VH 1MAKA 1NGWB 3NZ8B 3QEGH 5FCSH 1CDYA 2X4NB 2X9XA 4UINL 4X6DA 3D3VD 1T83A 1SBSH 3SGJA 4KVCH 2R0ZL 1U8QB 1XZ0A 4X6FA 5M7QA 1I1YA 4PRAA 4ZSOB 1WIUA 5DC4B 2F15A 1XF5B 1EEZB 4OZGF 3MRLB 4QO1A 2I60H 2GT9A 2XTJE 1CICC 1AGCA 2V7HA 5MERA 3GMRB 1VEMA 1C5DB 4CJ0A 1RULL 4PJGA 4LCIL 4RGNC 2DICA 3GSUB 1JNLH 5EBLB 1BX2A 1QFWL 1GXEA 1U8MA 1A6ZB 1VGEL 4G8IB 1S7VA 1CFTB 4K71C 5IHZA 3CDYA 1KJ2H 2E7CA 2YD4A 4UDTA 3UTZA 5DDHA 3P4LA 5I1HH 3O8XA 2X70B 4TVPE 2Z31C 1IKNA 1P84K 5A2KH 3MV01 4OD2A 1TDQA 3HG1D 3ARQA 4PJXF 5L2KD 1KNOB 4XAWL 2DWEA 3BSZL 2XQYG 4CW1A 5A16A 5IB3A 2ZWLT 2VXTL 5D7IB 4I48A 2X4PA 1RV6X 5DHYB 1FZMB 5J13C 4LSQH 1I9JH 4F3FA 5ILTH 2E6QA 5ERWB 4ZOBA 5EZJB 4Y2DC 4HLZH 4RA0C 3ZYZA 3VWJD 3G6DL 4HIXL 4ORGB 4FQHA 5HHXH 1MFCH 3P0YL 3QUKB 1S5IL 5I73C 5E6IA 3FMGL 3L5WB 4NWTL 2DN7A 3VMOA 4YDKH 4P3CH 2X7LB 5IM7B 5E6ZA 1P1ZB 2OBGA 1HCVA 4JGMA 4LCUA 5JXAL 3ZDYE 3T0DA 1F4WH 3DX9A 1AJ7L 1MCWM 4JLRA 2QQNH 2ESVD 5JW5A 3RPKA 3LPGA 4UIKL 4MWFB 2EDQA 4PJDA 5EIQA 4KC3B 1RIVL 1A1OB 4E0RA 3HS0B 5J3HC 1T1ZA 1S7QB 4W81A 3VGDA 1JUFA 2D31A 2JELH 3FHQA 4HUNB 4DZBA 4DEPC 3LKRB 3IETB 4Y8AA 4AH2B 1ORQB 3TGXA 3WS6A 3X3GL 1T89A 5HYJD 3JXAA 4D3CH 3RTQB 4HIIA 4Q6YA 2XTJD 1WCBB 4EN3D 1F90H 1IGFL 5BV7C 4XNQA 5CD3B 4WU5A 2R0KH 3ZMRA 1UJ3B 5DMGC 1I8KA 2WK2A 3IJYA 2ZCLL 4WU7A 4YAQB 5JTWA 5FUCE 1KN4L 1G9MH 5EBWA 5JPMB 4CNIA 3PWVB 4XNXL 2YPLD 5EBLA 3AREB 1IC7L 3MREB 3PL6A 4UDTB 3UTZB 5JHLH 2GJ6D 3Q1SL 5EIVA 3PV6A 1H3PL 2VC2L 4G6AD 4GKNA 5I15H 1YC7A 5EZIL 4FXGB 3HCVB 4J23A 4L9LC 1CQYA 1EHLL 1IFHH 5IB5A 5GJSL 4FTVE 4YHPA 5E94B 1OQOA 1MJ8H 4F8TA 2GCYB 3I9GH 1LO5A 2FX7L 1GC1H 3TCXA 5E4EB 1Q9LB 3BVNA 4ZFZA 4OIAA 3C6SA 3OGCB 2J88L 1IL1B 2G5BA 5TFSL 1JPTH 4U33A 3M1BB 5FYKD 1A7PL 2HFEA 4YIQA 4M48H 4X4XA 1QR1A 1XIWA 1KG0A 3HNTH 3QZWA 4H1LB 4S0SD 1CZ8H 2IG2H 2PW1B 2XG5A 1A6AA 1R3JB 1XIWD 5K9JH 4F37K 3IF1A 2EICA 2NTFB 1MNUL 1C5CH 1M6OA 4F9LA 1Z3GL 2VAAB 2YBRB 4QHKJ 1UZ6E 3QB7C 4MQSB 4TTDC 5HHNB 5FKPA 1MHCA 5DJYB 3C8KA 4EXKA 1OGAB 4L8BA 2CLZA 2X4SA 4DKFL 1YEFH 2BVQB 2CIIB 4LHJB 2GK0B 2NY4B 2QV2A 3MGOA 4MDJB 4K23H 3HRPA 4Y4HD 3TZVD 3RVVD 3EJZC 1S9KC 3DSFH 3CSYA 1JYWA 3J8F7 4P57A 3F5WA 1HH9A 4JG0L 1UB5A 2OTWA 5E8OB 5C2UB 3ESUF 3QIUB 3SDCB 2OCFD 4JQVA 3MACL 3IFLL 2XT1B 1C5BL 4WI3A 4M5ZL 2W59A 2OQJB 2FEDC 3QEQB 3ARPA 4NO5A 5L0QB 3DMMD 2EDHA 4ODWB 1YPZB 4BH8A 4KKAD 4P4KB 1CL7H 5GGVY 4P2YA 4JHWL 1FZKB 3TVMD 4FXGA 1IEAA 2OTUA 3MFFA 3ZKXB 2CDFA 3V6FA 3G5VA 2BRQA 2GJJA 3RDTB 3FQNA 2KZWA 4NM4L 4OZ4B 4ZQKA 1GOFA 5GGUA 3R0MA 2LU4A 4O5LH 4OGAD 4CVXB 2PYEA 3MRDA 4Y4FA 43CAB 4IRZL 4X6CF 1Y18A 3BD5A 4RWHA 1MHHA 3H9ZA 4EOWL 4HBCL 1IKFL 4NWUH 2MSPA 3ARBB 5IJKC 4OLWH 4AMKH 5E08L 4X7EC 3TIEB 4LKXB 5T3XL 3FZUC 4U1IB 3FO1B 3MNZA 4HKXB 3O6FD 1ZLUH 3LKPA 5ADPL 3NACH 3RVUD 4XPTH 3VE0B 5HDQL 4NKOB 4TUJB 2V2WB 4YGVB 2BNRD 3ARDA 4YBQC 4ZNCD 2G9HA 3SE9H 2XYCA 4OLZL 3IDXL 1F4HA 4IS6A 1X5KA 4BKLB 1R3IH 1DQMH 4KK5C 1JHKL 1T5WA 4LGSB 1A1MB 4M5ZH 4PS4H 3I02B 3L7EA 3QR2A 1BP3B 2A6JB 1HIMH 3TCLB 3T77A 3BXNA 1X5IA 5HVWA 3OB0K 1PZ5A 1JGDB 1F2XK 1A14H 1DN2A 4WU7B 1C12B 2E6JA 2XV6B 5IMLB 4XNZC 5L2KB 1J0KA 2UWEE 3U7WH 5DK0B 1JWMA 4KK8D 3OGOE 3K8MA 4RAUB 4YX2L 1S5HA 2AV7B 2C1PA 4HJ0D 1P4BH 4XPHL 1I1AC 4PJ9C 5CGYC 4PJAF 4X6EA 3VFRB 4YHKH 1JNHB 1YA5A 5C0BD 3BAEL 4IRSA 4JFYA 2CUMA 1D5IH 2AXJA 5GSRB 3V5KB 5T5NG 3O8XD 4JM2C 1LILA 2HH0L 5E5RB 2GUOB 4GAYA 2APVA 2CDGB 3Q5YA 5CINH 3QISA 1P4IL 1P69B 1MNUH 4KZDH 1AHWB 2QQLL 1MRDL 32C2A 5F70A 5HGGS 3MYJA 1MLBA 5F89B 5KZCB 3QCVL 3ULUD 5ICYA 4TULH 4YHNB 1RZFL 2I9LB 2Y9RT 3MPCA 3FQNB 4GS7B 2F54D 1UM5L 3CU7A 3TNMA 3UTTA 3H9HA 4RAVB 3AXLB 1HN1A 4M6ML 2Z35B 1T0MB 5IIEA 5EOCJ 5M95B 2VQUA 3H3PH 4X6CE 1BFOB 3KDMA 4WW2C 1QSEA 5B8CC 4JRYA 3ETBF 1YQVL 5C0DA 4RNRB 3HI6H 4U7KA 3MO1B 1EHLH 5L2KE 4JM2B 3ZTNH 4H0HB 5IHBA 5I1AA 3QRGL 4Q9CA 1HNGA 4PPTA 3I6KA 1U8PB 4DGVL 4FQ2L 4LAQH 3BZFA 2IPKB 3W5NA 1A3LH 1NH6A 4YQXH 5ALCL 3KYNB 3ZHLA 1BAFL 5FYLL 3T3PE 4MAYC 2P1YA 3MLRL 5CAYB 3KPRD 3WNKA 3KPLB 5IFAH 1GGBH 1TQCB 5GRZA 2QQKL 2LU7A 3CSBA 3D0VB 3IFNL 5HI3C 4F58H 3CSYB 4GMTL 4FQCH 2VB5A 3DUHA 2XQYK 1GSMA 3F5WB 5JQ6H 3F58L 1YEGH 2OX5A 4U1GB 1B88A 3N85L 1TZHA 1F90L 4NJAH 1VSCA 4JPWL 3LIZH 5I9QB 4XZUA 3PWUA 5J6GB 2IADA 4IS6B 5E00B 2Q8BH 1I8MB 3C5JB 1JF5A 4UDUA 1OHQA 3EOAB 4GQPH 3O4LA 4PGDA 2FRGP 4F58L 3VFRA 2ADGB 3IDUA 1NBYA 1CLCA 2PF6A 3AY4C 3EGSA 4YK4B 3LHPL 5JUEL 2XWBA 4UAOC 5T33L 3QQ9D 4MA3B 1V7ML 2ZCHL 4AEEA 2VITA 4I2XA 4P5TB 1SY6A 3T1FB 4JY4B 4LSVH 1QRNA 3U4BH 2DQIL 3DUUA 1EGJA 5F6IB 1CGUA 1NDMA 4U31A 5GZNC 4I0PC 4YDKL 3TBTA 3FOLA 2HAZA 3MGTA 3MRNA 3RWHB 3X3FL 1F4YH 2DM4A 5HHXL 4QRUB 4AJ0A 2YEZA 3QUZA 5DD6A 2Q6WA 3EOBA 3IDNB 3FN0L 3R8BB 3REVA 4FQIH 3O3AA 2WP3T 1NLBL 4HKXA 4GAJH 1LEGA 2HKFH 1T7YA 3BP5A 2FR4A 2EE3A 4GO6B 2HRLA 3H9HB 1CFBA 3PWPE 1UM5H 1SJEA 3D18A 5IVXB 3CAFA 5C08D 1NGYA 1SYVA 3O2VL 3D0LB 4XAWH 4XVSH 4YHZL 5ICYB 2AABH 35C8H 1P9MC 1CK0H 1BLNB 1BJ8A 3V0WL 4G5ZL 4JY6B 3JBG7 1VFAB 3NTCH 2DQGL 5I74B 1UXWB 3DV4A 2HRPH 2VDLH 2FLBT 3TNNB 2A73B 5F9DC 3LB6C 2X9YA 2EYSB 4H88H 4WO4D 3GSQA 4P2QB 1R5VB 4ACPA 1QSFE 1GGCH 1BVLA 3WFBH 3FHAA 1A7RH 2SEBA 5DA4A 1S8DA 3MJ6A 2BZDA 3TJHC 5HI3D 2CKBH 2ZNXA 4QHUB 4EDWH 4WI8A 3H7LA 5LJYH 3E6HB 5I0DA 4H5SB 3OHXB 3C9NA 4PJ9A 2JTDA 5D72L 1H9VA 4LLAA 4LIQL 3VWJC 3WO4C 3S37X 1LO0L 3MUJA 1YECL 3MV11 4J4PA 2JB6A 4N90D 2CPCA 1MJ7H 1D7FA 3RIFF 5F44A 1XGPB 2Y36H 2H26B 1I1AB 2X1XR 2BHYA 5HGAB 4AENA 1NLDL 3S37H 3MNVB 1UQSA 4JFPB 4TTGA 4M43H 3ES6B 1FG2A 4E41D 1F6AB 2KH2B 4LLVB 4CVWA 5C6WH 3KPPB 3QT2A 3E1F1 3PQYB 43C9B 5JDJA 5KSBA 2FJHA 5IIEB 2BXYA 5D2LF 3QFJE 4HWUA 2EIZA 3P4MB 3HPLA 4OF3A 5CZVL 1K5NB 3SCMB 3ULUC 5CJQL 1U93B 1AKJB 1FO0B 5ANMA 5EFIB 3ZKMD 1F4XH 1MAJA 4PY8I 2VITB 2VZTA 4ODBD 3AUVA 5E8EB 3WEXB 4O5LL 2D7PA 5LWYH 3KHOA 4KTDH 4P23D 4R4BA 1NDMB 1F42A 1YY8B 4GKZA 2ZPKL 4HKZB 3VGHA 4KAQL 5FYKL 1QYGL 1WBXB 1YNKL 1M71B 2FWOB 2VDNL 3BPOB 3PHQB 5DJ6A 2M26A 3RVWC 3G08A 4JFDA 1NL0H 1QLEL 5IW6B 1DEEA 4ERSL 5IHZB 4HUUB 3VXMB 3BQUA 3Q3GB 3KJ6H 1TJIL 3QDJA 4P4RA 4JKMA 3PWUB 5J6GA 2LVCA 4PJHA 2V7NB 1F11B 1BBDL 4PP1D 3RUGA 3V4UH 3QCTH 1YJDL 2MHAB 5I1EH 4M7ZB 3RDTC 4RGMB 4X7SH 5A16B 4JB9H 4ELKB 1FC1A 2Y7QA 4HIEA 4K8RL 1NAMH 5D7IA 2APBA 4KUZL 4LDEB 1NAKH 2HTLD 4TSAH 1F3JA 5L0QC 4FN0A 1CDBA 2EEDA 5ERWA 3LZFL 1CGSH 3P9MB 4G7YL 1OAKH 3AVEA 1KYOJ 3ILPB 4JPVL 5AAMA 1U8KA 5IOPB 1WFOA 4PJCF 5C8JB 3P4OB 1T21A 1IM9B 3QUYA 5I1IH 2EDTA 5DJXA 3R06A 3MLSL 1K6QL 1MAMH 1YN6B 3MOBL 3MQIA 3QFJA 5K9JL 1NUGA 1SY6H 5J12B 1A6ZA 4G8IA 3OR7B 3L3HA 2XZAL 3DX9B 1CFTA 2CKBB 1VFUA 4P9HH 3BUTA 4NUGH 1KC5H 3UPAA 3KPOB 1U8QA 5FYJE 4OGYL 5FOBA 4X4YA 1NGQH 1W0WA 5D2NE 4JVWA 5JDSA 3MZTA 4ALAH 1P7KB 3SJVD 3PL6D 2HT2C 5C92A 3NGBC 4JZNB 1AC0A 3GSVA 4PJ5B 4NQSA 4OUUB 2AK4A 4UT9L 1LWRA 3TFKD 3STBA 5C0RH 2FJGB 1G1YA 1XR8B 3K74B 4CW1B 3FCTA 1NCNA 3BUYA 2A38A 5T1DL 5CBAA 2YD8A 3ULVC 4NBXB 1TJHH 1DVFC 5B4MD 3U30B 3BGFB 4YBLC 1LP9A 4R4BB 5GIRB 4YO0A 3L95B 4KPHL 3U4EA 3DVIA 5CLWA 1H0DA 4NNXB 4C57C 2P43B 1VFBA 3WFEH 1AIFA 2GFBB 1JF6A 1RZGA 4N8VG 2CRZA 4OD1L 4KMLB 1BQHG 1H3PH 2VC2H 1OAKL 4JPVH 1TTGA 4J8RA 4JJHA 5EU7E 5FO9B 1JTPA 1CE1L 3AXLA 4FHBD 1DQQB 4U1HB 4GXUM 2DWDB 3DURA 4HIHB 2OLDA 5I1KL 4FFZH 1G9ML 1CFSB 4WV1A 1HXMB 2PN5A 4RDQG 4WWKA 5EO9A 1KJVB 3WFEL 1BJ1H 3KYOA 3MO1A 4KI5D 4M1GH 2YRZA 2UUDK 3P9WB 4D3CL 3HE7A 4MQ7A 1CLYH 1QPXA 4ORGA 5EUOA 1XGQA 5CGTA 1J05B 3RP1A 2DM7A 4JFDB 5EZLB 3RL2A 3GMLA 3QXVA 1LP9F 3L9RB 4U1SB 5DSCB 3X13B 1YNLH 3O2DA 1T04A 4JFQB 3CUPB 3VWJA 4CGTA 2YSSA 1NPUA 4ERSH 2YC1A 1L0YA 3TF7C 1RIVH 5IW1A 5IB4B 3P2TA 3PGCA 3RWDB 5TGBA 3VXTB 1NJ9A 4PRDB 1A6VL 1MCIA 1JF1B 3EOTL 1T1XB 1JWSA 1WIPA 3MLWH 1MFNA 1PYWA 5IQ9A 4X9BA 2IBGA 1UB6A 1NEUA 2ZPKH 5IBUG 3HZMA 3AB0B 3QIUC 3IFOA 3LOWA 3SDCC 1NGXA 4H8WL 4UV7H 1K5NA 5LWYL 4OCWH 4X5WB 5B39B 1GZPB 1SJXA 1JGEA 3INUH 4X80H 3MV9E 4IJ3C 1NC4D 1OPGL 2XNAB 4M03A 4XI5D 1U3HB 4JR9L 2ADGA 3DSNA 3SJVE 3BPLB 3O9WB 5CZVH 4X4MA 2ESVA 4X98B 3PWNB 2BVQA 5E5MB 5ABDE 1OSPL 4WNQA 2PO6B 3SPVB 4P3WA 5JO5B 1WBXA 3O2DL 5CSGA 1MI5A 4MAYA 3QPXL 4NKQB 2VXTH 1FYTD 5EN2A 3VI3E 1GIGH 1C16B 3WFHA 3ZKXC 1BF8A 2WINB 5JW4R 3B9KD 5DT1H 4XPBL 3SHSA 3V4UL 4G8GB 4N8CL 3I3DA 2FNBA 1YJDC 3TZVC 1YDPB 5TE4L 3SGDI 3V8OA 3OG4B 1MJ7L 4KUCF 2UVEA 3UCRA 1G0XA 2VTFA 4KI5F 4WHDA 3SBWC 1NC2D 3SY0A 2Q7NA 2JIXB 4LPVA 2E3VA 3NCYP 4W4NA 2WQRA 3QDHA 2YWYA 1SEQH 5I30L 4IIQB 4HULB 5DR5L 4R7NB 5F71A 4PRHE 5D6CB 3RKDD 5F8QC 2DQDH 1T4KA 4R8WL 4NO0D 1ZE3C 4NNPH 4S1QH 5HYJB 4EDWL 1UH4A 1IC5L 2CDFB 3V6FB 5EOCL 3C6SB 3MC0A 3QIBB 4TPRL 4MHHG 4K7PY 4HLJA 3FT4A 4CVXA 2NQCA 3BQUD 3A6CL 4GOSA 2A6KB 5BV7L 4LVNB 1RY7B 1CCZA 3MRDB 4Y4FB 1S9YB 2YA0A 4KVCL 2VXUL 1F4XL 1FFOB 3WXWH 4I4WA 4GSDL 5CJQH 5CHNB 3FQWB 3CU1A 4JKWA 1IE5A 4PTUB 3IF1B 1U8OA 5E6YA 4G5ZH 3HUJF 1IAIM 4WV1B 4M1CC 5FGBA 2BVOA 4DVBB 2AABL 4QHUA 1QFOA 5HYEA 3QYCA 5K59F 3ABZA 4URTB 2G9HB 3T0EB 4OKVB 4E5XA 1TZGH 3OMZA 3MRQB 1G6VK 4NM8L 5DD3L 3FB5B 1KTRL 3U2SB 3DETD 2X4QA 2NLJA 3BPLC 3QAZC 1JNNH 3DRQB 1QBML 4PRNA 2Y6SD 3V4PH 2AEWA 2YC1B 2E7BA 3C60D 4Z7QE 4E41A 4FQQB 4YXKL 1I9IL 2X89A 5EOQH 3WMSA 1K3IA 2WMPA 1ZGLA 1PYWB 3CFIC 5L2KA 2EH8L 4APQC 1IGCL 3SDAD 3MRCA 1MIML 2ZUWA 1FL3B 4LSVL 4XB8A 4HMDA 4NQVA 4ETQA 1IQDB 1G7IB 2PTVA 3N0PB 4XP5H 4ZTOH 3RJQB 4U1HA 3TH2T 4JE4B 4TRPL 2FBJH 5LGJA 4IIQC 4NQEE 3KGRA 4P4KA 3WHE1 4LDLB 1KJVA 5DJ8B 1IAII 2R1YA 3LD8C 5J4MA 3WIHL 1MIEH 2VDLL 1T6WA 2V9RA 4PV9A 32C2B 1Q0YL 4AEIL 5C0BA 1RUKH 3TA3B 3RVVC 3JV4A 3KPMB 4YHZH 3GNML 4Z7OF 5F7LB 5ISZD 4DN4H 1ZS8B 3CUPA 4JO2L 3C08L 1H3GA 1KGCD 1V8HA 4MMXC 3VH8A 4FQCL 4GMTH 1NFDE 3H0TB 5TE7L 2A77L 1OAZL 4UT6H 3RWJA 5JA9A 1TENA 3O4LD 3U9UB 1T03L 1N3NA 5E9DD 5FYLH 4PYHA 2UUDH 3WXVH 1VGKB 3WE6A 3FQTA 1F11A 2AJUL 5CIPH 3ZTJH 1QSEB 4DGVH 1X44A 5FECA 1L7TL 1L4IA 1P84J 3O45B 3ARVA 4RGOH 4L3EB 3ARGB 4WY7H 3MJ9A 1A4JA 2WIIB 4HIJB 4PJHE 3MRBB 5C07D 4L8SC 2R56L 3BO8A 4B50A 5FYJL 4GLRI 4N5ED 3G5ZA 3KPLA 1T03H 1LO4H 3SE8L 4NC0B 4WUUA 1NFDB 6FABL 4PJXA 3I6GA 1I1FB 3B3IA 5D7IE 1A4KA 1NEZG 3BW9B 4OM0H 5ESQB 4L4JA 2IANB 3D85B 1NMCC 4EEEA 3DV6A 1DLHA 2Q8BL 2O5XL 4RFEB 4C58B 3CC5B 2IGFL 4N0UB 3RWCA 4L1DA 3C6LD 4A6YA 5HHVH 3UX9B 1J87A 5C0CE 3RWEA 3T0WA 2VZSA 5I66B 4ISVB 4XRCB 1ZHKA 4X5XB 2Z0BA 1Q0YH 3EO1A 3DXAA 4G9FA 3WLBA 3HNSL 5C9KA 2X4QB 3QJFA 3HI5L 2AK1H 3CVIH 2Z31B 3D69A 1IQWH 1EV2E 5FKPB 1T3FB 4FRWA 4OQTA 4MNHB 3QWRD 3LRSB 1LE9A 5HHOB 1FNEA 5DRWB 5BOPA 3WNMA 3I6LD 2X5PA 5CWSB 5I71B 5CEZE 3UTPD 3TN0B 1RI8A 5DURD 1ZAGA 1GJIA 4JDTH 2DQUL 2W9LA 3ZTNL 3U7WL 1EVTC 3HUJB 4FXKB 4POZC 3HI6L 4F7PB 5DQ9B 3KPMA 3FQWA 1MUJB 4ZXBB 5TDPA 2NW3A 1PY9A 5HXMA 3NZ8A 5DFTA 3G6JB 5B4MC 5IROC 3NFPB 3W39B 5D7JC 4FZEL 3LQAC 2B1HH 1T2XA 5A2FA 1NQBA 2XACC 4MXVF 3QHTC 2IANE 1QRKA 5TQ2L 3G6JF 1EHNA 2VXQL 5KANG 3CX5J 5H8DA 3L3KB 2KPNA 3EYVA 1WFNA 4WHYG 5HYFA 3QCVH 1G6RB 5GS0D 4KXZH 1CICD 5KSBE 1AE6H 4A6YH 3BGFC 1U8MB 4YBLB 3VFMB 1ZEAH 4FTVA 3WIFB 4OFIA 1UKSA 2QQLH 3EFFA 3BIKB 2X4OB 43CAA 5IUSA 3EJYC 3WV0A 3O6KH 1KT2A 3OX8B 4H20L 3ULVF 4LSRH 1PX4A 4G3YL 1EFXD 4Z7NE 2HTKC 2V9QA 2GY7B 4Q9BA 5EZJA 3ZE2F 5GGTA 4JQXC 1A9EB 1DVFB 4NZJA 3UBXB 4KKBD 4JFFA 5FV2A 4X7DC 4KK6C 2P5ED 1F97A 3VJ6B 3IKCB 2RFXA 5F96L 4NO0B 2ORBL 1CI5A 4YX2H 4LSUH 3E8UL 5F6HI 3VFTA 4U6YA 4RRPA 1EUTA 5IP4A 4RFNC 2NY5H 1FIGL 2VISB 4BYHA 3KPRB 1J10A 2CRIA 1ACYL 5C0BB 4B7LA 3MBEC 5GS1B 3RGVB 1RUPL 2DI9A 1J12A 3KNBA 4D8PB 2FO4A 3IFLH 4OAWA 5F7MC 1HK6A 3T4YB 1I85C 3JV4B 2COQA 1JHKH 4D2NA 1WT5A 5GGVL 3UJJH 1OW0C 4OZGE 5FHBL 3GKWL 4EUPA 1WFTA 5CP3H 5I76B 3IDIB 2J3SA 2VKWA 2XRAH 2XWTA 1VFAA 1T7WA 3OG6B 2M2DA 1RZIB 4EN3A 1MF2H 4W4OC 1OP9A 3PQYA 4MNQA 5KSBB 3CFEB 3IT8D 3A6BL 3VFSB 1GH7A 4ENED 2KBGA 3VG0L 3SCMC 1ZHBB 2HT2D 1H15A 2IPUG 3TIDA 3VGAC 3WHE0 3SCMA 4JR9H 1MVUB 4OGXL 2VL5A 4RZCA 3R0NA 1HSAB 4YPGB 4X8JA 1AR1C 3QBTB 2P7TB 5FO8A 4LPYA 3ZYOA 1I7RA 5EU4B 4KHTH 1CXLA 4OT1L 5E2TH 1URLA 2UZIH 4Z7WB 4N0CC 3MLWL 1YPZE 1EFQA 1D6VH 1BVLB 2O5YH 2QADB 1JPTL 1RJLA 1J1PH 3L7FB 5F7YC 5CD5D 2WBJD 1RAMA 4L4VE 2HKHH 3QEHB 5IJVA 3T0VA 4UOJA 4HC1A 1T66C 1JRHH 1YUHB 1I1RA 1TFHA 3QWOA 2WBJA 1E0OB 3AAZA 2AEQH 3HCVA 4XMPL 5E2JA 3S34L 3H9SD 5KOMC 4PP2B 4UNVA 1TCRA 4AEHH 3NCBB 3D2UB 1FN4B 3SOBL 3UTSE 1Y6NR 4M1GL 3VXSB 2DDQL 4XNMB 1JHTB 1CDCA 3QDAA 4DOHE 4OGZA 3SDXA 3GSNL 5MEND 4PP1C 3VFMA 1CLOL 4Y4FC 4YUEH 3TT3H 5JHDD 4HK0B 1Q9LA 1YEDB 3DYMA 1RURL 3ZE1E 5IJKA 5D7IF 5DD0H 3B2UD 1WCBA 3CNKA 4G8GE 4PJIA 1E4JA 2FL5A 3QXDA 4IRJD 5HPMA 4N9GB 4JHZA 1EX0A 4YZFE 1MUJA 4ZXBA 4KROC 3CCHB 2VDPH 3VGAB 4ODSL 1LEIB 3D25B 5B3JF 2WWMD 2DJUA 5DJZA 4IOSD 3G6JA 3H8NA 3F6LA 4PRBB 4Y16B 4I77H 4V1DD 2CLRA 3KYAA 4LGRB 3TBWB 3VXUE 1ORSA 2DTMH 5JXEC 3MRGA 3QEUA 3MYZA 5C0RL 2QL1A 1NCCH 5J1AB 2ICWA 2X4UB 1S78D 1ZT4B 3ARDC 3IJSB 1INDH 1MPAL 3FFCA 3O4LE 2CXKA 3O6KL 4OCYH 5H94B 2CUHA 4MA3A 4GBXD 2CMRH 3MV8B 4JFEE 3FQUB 4R0LA 4HGWB 1AJ7H 4YHMH 3UYPA 2AXFA 2Q7YA 3AROA 4PJEB 4G8FB 4JHAH 2Q86B 1FVDA 2YN5A 1XF5A 4AY0A 1H0DB 4M7JL 1KCSL 3LSOA 3OKKA 4PRPD 1P53A 3UMTA 5INCB 1L7TH 2YPLE 5E2UL 2IFFL 5DRZB 2J1KA 3G6DH 4HIXH 3SKNB 1WBZA 4HUMB 4PRHB 3VXRD 2DF3A 3QHFL 3LZFH 4ONHB 5C1MB 3AB0C 4BH7A 4NIKB 2WUCH 5FA4B 3QUYB 1NKRA 5IBUB 2ZG3A 4FQLH 3MA7B 4TSAL 1NAKL 3HC3H 1OAXL 2VLRE 1XGTA 3FO9A 5F88A 1KLGA 2L7JA 1KIRB 1I7ZA 2P5EB 4L9LA 1QUNA 4U1IA 2A77H 4X8JB 4YXHH 4YHYB 3T4AB 1Q8MA 4F9PA 2OM5A 5I75B 4FTVD 4X7SL 2HFTA 1FN4A 1NANI 2V7HB 4N5UA 4OIIL 5C9JA 3U0PB 2OS7A 5JDSB 5ENWA 3C5SB 3I85A 4HXBL 1OGAD 4QF1B 2VDOH 2O5ZL 4U49A 1PX3A 1WC7B 2JB5H 4HAFA 1V05A 4G43B 3ARBA 1FZMA 5FYKE 4QGTA 1NGZA 1VGEH 3D39E 3QWOB 4U4BA 1XFPA 4WUKL 5IESH 2E7HA 4C56D 4Z0XA 3HI1B 1UWXH 5E8PB 2FBJL 2IJ0C 5LGKA 5E8OA 1QYGH 4XCYB 3LPWA 1C12A 3V5HA 1U95B 5DFVC 5I8EB 3OJVC 3VG9C 3UZEA 5KS9B 4WW2A 3FMGH 5L8JB 1ORSB 2X1QA 3AC0A 3MJGX 4N8VB 1YEDA 4OM0L 5FDYA 4RWYL 2R4RL 4JFYB 4AG4L 4Q9QH 3S35H 3V5KA 1X4XA 3OKOB 3CDCA 1QSZA 4LPUA 1C7SA 1L9MA 4TTDD 4FQXB 4P99A 3L3DA 1XGRB 3SDAC 1TXKA 4MAYB 1R3KB 4FQ1L 5DD3H 2R2BA 3I6LE 4L3CA 1RU9L 3MV8A 5CEZD 4Z5RB 5TJWK 5HGAA 1RZJC 4M8QA 1DANT 3U6RA 1A3QA 4JGJA 3QEUB 5GS2D 2Y36L 4OCSH 1CGYA 2EC8A 4JQVC 3OXRA 3MLTA 3EW3B 2EKJA 4LSSH 4D9RE 4MZ3A 5J1AA 3T0AA 1LNUA 1Q9KB 3MRRB 3ROOA 3LS5H 4XGZB 3C5ZD 1I3UA 3VE0A 5JIHA 4K94H 1QFWH 4Z7VA 3FTGB 4ZUWB 1I3GL 3MOAL 2BOBA 4UT7L 5DTFB 1KULA 3IYLW 3RTQA 4OLUL 5IMOA 3UP1A 1BGXL 5EU6A 5CD5C 5D9SA 1U9KA 4JO3H 4U7SA 3S5LA 1INQA 3PQYE 3QFDB 2IAMC 5H37G 3RVTD 1ZLVK 1MCNA 1BIHA 1A7RL 1H3XA 1MREH 3ARYA 4GUPB 4R4NC 1CTOA 5CP7A 2XTJC 2BRRL 3WUWB 3GMMA 4JZJB 1PZ5B 4Y16D 4OCRH 3WIHH 3TPKA 2NY0C 4J4PC 1FORL 2QADD 4I4WB 1XGUB 3QEGL 2HRPL 5AD0B 1T20A 3MXWH 4QKXB 4XP4L 1KELL 3DO7A 1FQ9C 4KMTL 4ZTOL 1FFNA 4LCWE 2DAVA 2LVEA 2W65B 3LH2L 2EECA 4OCSL 2C3GA 1NAMA 4H25B 5C0FA 5F9OL 5FO7B 2D0FA 1B4RA 4BSWA 4IJ3B 3GHBL 2GKIA 3IRPX 4G42A 4NP4L 5MENB 4FQ1H 3FT2A 5DQJB 4YXKH 3L5IA 2YBRA 1CDUA 3CH1B 3SDYH 4XH2B 3WHXB 4P46D 3RGVA 3VD7A 4U2YA 4N0UE 3RDTD 5F7DB 4JRXE 5F1SA 3WNOA 2H2PD 2HFEB 4YIQB 3KYMB 3OXSA 4JAMA 1GHFL 3F12B 4FQXA 5FIEA 1TLKA 1QSFB 4UBDD 5DD5H 4RMUA 4M61A 3DUUB 3MUHL 3HKFA 3T09A 5E8DL 1JCKA 2HWZL 3GIZH 3HE6C 3PDOA 3CFEA 5FYJU 3NOIA 5F1NB 2FB4H 2FGZA 3MXWL 1A0QL 1JGLH 2QBWA 4K55A 4N0FA 1CFVL 3O11B 1BWWA 4XX1G 1FFPB 2X4SB 3ARZA 4K8RC 4KQ3H 4R3SA 3GJFH 3JV6B 4OZHB 3WXWL 4P5TA 5F3HB 4ZPVB 1MQ8A 2EDNA 1ZV5A 2JB5L 3HUJE 1G7MA 3OJDB 4F37F 3UTOA 4Y4HB 1I3VA 3SQOL 3D18B 5IVXA 2W9DH 5EUKA 3CXDH 1VESA 4F15C 2AJXH 3VXUA 1U92A 4G43A 4AT6B 3J7HA 1UZ6F 1NUDA 5D1ZD 4BA8A 1Y0LB 4NNXA 4KRPC 2ZCKH 2P8LB 3MOAH 5GRUH 1I3GH 1U3HD 4JZJC 3QIUA 3SDCA 3M1BA 5TDNB 3GM8A 4PLJD 3N1MC 1U8HB 4HH9B 2HMID 3WUWA 1TZHB 1OAXH 1TTFA 3MLRH 5IFAL 3LEYL 4MLSA 2NY0D 3MTRA 5JOFB 2C3HA 1QNZH 3FTGA 1T5XA 5E6IC 1R5VA 2DMCA 5GGRY 2J4WL 5EIIB 4WJ5B 1J8HB 3MBEB 4XPBH 3UDWC 4FG6C 3HR6A 4NOFA 3LQZA 2A9ML 1KCSH 3MRMB 1ADQA 3HB3D 4OLVH 3GMOA 1RU9H 5IVNA 3EJYD 1T22A 2NXYC 3RNQA 5ACZB 3O2DH 3QUML 1NMCB 2FEEL 2OMNA 1N5AA 1PKQB 4F3FB 1OSPH 4OZIA 4U6XB 4MCYB 1MPAH 1MEXH 5I1LA 4ONFL 2QR0A 4PYGA 4FFVC 4WFFE 1ES0A 1ZANL 4JKLA 1FV1A 3MSPA 1RIHL 4ZFOA 3BDYH 2VABA 4UV7L 3EOBB 1WWAX 1KEGH 4XCNB 4A6YB 5KANI 5E03A 1FYTE 2IMNA 4NFCA 3QXAA 4OI7A 1T2QL 3EO1B 5MP6L 1WEJH 3BD3A 3BKCH 3LD8B 3OAZH 4M1DH 4L3ED 1ADQL 4XC1L 4M3KB 3CZFA 1WQVT 4HAGA 1S7XA 1J8HD 1FPTL 3MBED 5F6IC 2YMXL 1G9MC 1LD9A 3BAEH 3O45A 5K9KA 5HBBA 3LKSB 5IK3B 4LBEB 1KXVC 5DK0A 3O9WC 3KLHD 3KXFB 4WU5B 3CX5K 3LSOB 3OKKB 2VR9A 3QUZC 4GJTB 1D6EA 1N3NB 1NFIA 1M71A 1P2CA 3T2PA 2VMFA 4MVBD 1HILA 4Y2OA 4N0FB 3HMWL 5IW6A 3S3SA 1N7MH 2EXWD 1DLHB 2GUOA 4DCQA 3WN5C 1ED3A 3GI8H 3MXVL 1UG9A 1WZ1L 5E2UH 4L9LB 5C0AB 1NL0L 1QLEH 5IB3B 2P48B 1QFWM 4ZPTB 1AR1D 1WEJL 5K59E 1QFUL 4KVNL 3P4NB 5T3ZD 2GSGB 2UZIL 4HXAH 4MNGA 3KPSA 3HMXL 3I6GB 1F6LL 3QIBA 4G8EB 5I1AB 4FXLA 5HHOA 3HN3A 2PETA 4NWUL 1WZLA 2WM0A 2FJFA 1I1AA 5DO2D 5C0EA 1V3JA 2VRAA 3SKOA 2NX5D 4NHCH 1JWMB 3BP4A 3IGAB 3STLA 4ZDHA 3BQUC 2W60A 3BPNB 3TA3D 3A6BH 1DDHB 2ZJSH 4HC1L 4LSPH 1MF2L 3W0WB 4WHYH 3QZWG 1V7NH 4W6WB 1PSKL 3ISWA 2D0HA 2YPKB 3TJHD 4J3WA 3NABH 4WV1C 4LHUA 3TWCH 4ESKA 5HHNA 1BQLL 1LEKB 3BPCA 1KIQA 5GGVH 1RK0B 3UJJL 4WO4A 1KLUB 1Z0NA 4HJJH 1HEZA 3LEYH 4K71B 1E4WL 2WBWB 3LRHA 2ED9A 1RUAL 4GW5A 3TBSB 5ICZB 2AJSL 2FZ3A 1WBYB 4ZOAA 1ES0B 4BQ6A 5D1QC 4PTTA 4LFHD 5C0AE 1QA9A 1OP3K 3VFOA 2P42B 5SWSE 5T1KD 1FIGH 1KTDB 1QSFD 1X5FA 5JLZA 1F45A 4JN1L 2G75B 2X4TB 4MSWA 4DTGL 5B3JE 2EO9A 4JKPH 4Z7NF 3BQUB 1FL3A 4PJ7B 2ZKHL 1IT9H 3QFJD 1G7IA 2V9TA 1WF5A 1A7QH 2W9DL 1MWAB 1RK1B 2AEQL 2VZVA 4TQEH 5F96H 2MMXA 1ULVA 3RHWF 1OT2A 3KJ6L 4XC3L 3MV9B 5JQHC 1OTSC 5GS3A 2DB8A 2ESVE 4F7TB 5KSBF 4H88L 3P30H 5LBSH 4APQD 4MXQC 3RBGA 3GO1H 4ZUTA 3THML 3V4VH 5IFHH 4G3YH 4LSRL 1Y6MR 1CLZH 1JV5B 2F53A 1Z3GH 1UENA 5HGDA 1PBYA 3A67L 4OKDA 5E24E 4GXUN 3QIWD 4WWKB 5EO9B 1MFBL 4ZAKC 2V5YA 2OJZL 4L9DA 4ZUVA 1CZ8L 1OTTD 3WS6C 1RHHA 3TLRA 1MLCA 2VZ1A 4Y89A 3H9YA 3R8QA 3O3AB 1ZTXL 1UJ3C 3QWRA 5TQ2H 2LTQB 1S7RA 5J06A 1T04B 1GC1L 4DK3A 2MQCA 3C6LB 5C0JB 2FJFB 1AQKH 4POUB 3WSQH 1I8IA 1JI2A 2I27N 2X1OA 4H0GA 3OKLA 1FE8H 1NLBH 5TGBB 1I8LC 4O2CB 4MDIA 3JTSA 5E2WL 1VEOA 2V2TB 1BZ7B 3WNLA 2BP3A 4NP4H 1AGBA 4M3JA 4HWBH 4ELMF 2WLZA 4JFXA 4L1HA 3MLXL 2DQIH 1BLNA 2BJMH 4L8BB 4QWWC 5FHBH 5HYSG 3X12B 4JFQA 2EYTB 2HT3C 1NBQA 1YEJL 4QOKA 1XR9B 2PCPB 3S5LG 1RUPH 1QBLH 1N6QL 2AEIT 3O9WA 3EDJA 3LHPH 1NMAH 2F53E 2HTKD 4LIQH 4EN3B 2X2YA 1FORH 2Q1EA 2PO6A 3SPVA 5C0AD 3VWKC 4Z0BL 4ZDHB 1NFIB 3VI4F 5IQ9B 2ZCLH 1S8DB 1CXIA 1G9NH 1BQHA 1DJSA 4MD4A 3V79C 3CX2A 5T3XD 3L7FA 4IOFD 4K3EL 3OZ9L 2AERT 3TYGH 3DJ9A 2XWJB 4RMWA 4KXZI 4OIBA 1QVOB 4NZDA 3MMEB 5JQ6L 1OB1A 3KXFD 2R4SH 3C2AH 1LQSR 5FK9B 3MV9A 3C09C 5FA3B 3OKNB 5JMRA 3LKQA 3LS5L 1UWGH 3HRZB 5EUOB 1S78C 3OR6B 2F53B 5ISZA 2R0LH 2BSSB 1D5BA 2EE6A 3TFKC 4PJBE 3VWKB 4XVSL 3U30C 3VWJB 5CD3A 3HUJA 2CDEB 2I9LA 3JVGA 4TNWF 5DMKB 4KTYA 4NWTH 2DQFA 3NZHL 4R96A 1QKZL 1S5IH 2DL9A 1YQVH 5D7SH 2NYYC 2PUQT 5EBWB 5L88H 4MQXD 3RA7L 2BNQA 1W8OA 3UTQB 1TNMA 4LSTL 3SKJL 5MHSD 4LSQL 1F58L 3L5HA 5GZND 3SKMA 3L5XH 2B4CC 4Y4HC 5F93C 4ZFGH 2P46B 4DZ8B 4NZRL 1Q38A 4JN2A 4FFWD 3RPIB 5JW5B 2OI9B 4JM2A 5C71A 5JZ7C 4U1MA 4DN4L 2DQUH 4BJLA 4PGBA 5ACMA 2MCG1 3U4AA 3BP6A 4N0CD 1CG9A 1FAIH 1V5JA 3GI9L 1VPOL 4U6VL 3CZJA 3WNNA 4PJIB 2OL3H 4RIRA 5SX4I 3NCFB 4WNQB 2BSRA 4PJBB 1FLRL 4HIEB 1WC7A 5DWUH 2PW2A 1O7VA 3QQ3B 3RIAK 3S7GA 2QR0B 4XNZB 2DLEA 2Q86A 1DLFL 4HS8L 2R2CA 2NXYD 1OP5K 4LCIH 4X9FA 3UBXA 2O5ZH 2X42A 5D1QA 4ZFOB 1LMKA 1U8KB 5IOPA 3TYGL 1FL5B 1IM9A 3OZ9H 1KOAA 5GHWL 4LMQI 2XN9B 1HHIB 2B5IB 1D9KB 5BO1H 4PV8B 4LU5L 2ENSA 4JEGB 4MGXA 4GG6B 2IGFH 3QFJB 5T5FH 2IFGA 3F58H 1YY9C 2CKBA 1A9BB 4MCZB 4YH6A 1AHWC 2IH1B 1WZMA 3FQRA 4TUOA 3KWWA 4P2RD 1J11A 1T89C 2OR9H 4FQJL 1YYLH 2FO4B 3GIVB 4PJ5A 3QHFH 4GRLB 4YQXL 5KG9B 1K8IB 5L88L 4NQCD 4Y4KA 1J0HA 5DRZA 2WWKT 3NFSH 4LNRB 4OLZH 3SE9L 1FVCA 4RGOL 3PG2A 4M7JH 2GSIA 3ET9F 2X09A 2VLKA 5GIRA 2AJUH 3DTXB 1M1SA 3KYKH 2CMRL 5JHDE 2A83A 4J8RB 5D6DA 4ZUUB 4XMKH 2DM2A 4GSDH 5ANME 3BDXA 4GBXB 1ZTXH 4YHYC 3MJ8A 2AJVH 2B7DT 1NCCL 2Y5TB 1DBMH 1RZFH 4PRAB 4JO2H 5I18L 3ARFC 3MJ7A 3OF6A 1CFQA 2DTML 4HUXA 1RD6A 4Y5XC 2JJSC 1RUKL 3WKMH 2VQTA 4IEFB 2NY7H 1PVHA 5EC2B 2VIRB 5T1LD 3NA9H 4AEIH 3ULUE 1QR1B 5HSFA 4QHMA 3X11B 3TBYA 5I30H 3GO1L 3THMH 4QRSB 3SKMB 2LTQC 5EBMA 1A6TB 3LDBC 2BX5A 3GJEA 5CKAA 1T7XA 3N06B 4TQEL 4OD2B 5D4QA 1AGFB 3L5JA 4N8CH 4DGIH 3MLXH 3O41B 1NUFA 4QXTB 1IGCH 4LLUA 2ZOLA 1ITCA 1MCRA 1JHTA 4ZNEE 2C3VB 4KK9C 1A14L 4LRIA 3OJ2C 1N8ZA 3W9EA 3BKYH 4MAUH 4PJ5E 5IB1A 2IQAB 4FFVD 5J57B 2UWEF 5GGQH 2VOTA 1KCKA 1VDGA 1I1YB 1QFWI 1YEKH 1JNNL 5BJTB 2HKHL 4DQOH 3OXSB 1R3IL 5EB9A 2BY2A 3F12A 1J1PL 1QFPA 4HUKB 1OPGH 3DX6B 4R0LC 4HUWB 3DI2B 4LLYA 4X0KB 1C5CL 2KDGA 1ITBB 5DS8A 1J1XL 2DYPA 1ZHKB 1DQTA 4X5XA 1QEWA 4LNRA 1FBIL 3REVB 3KPPA 4F33A 3GRWA 2NY3C 5IG7A 1AQDB 5TDPB 4EDXA 4PRPE 3AU1A 3EOTH 4FNLH 1A1NA 4K9EC 3B9KB 4QHKI 4YDVB 3FQRB 3TJEL 1CDGA 1HSBA 3DNKA 4HBCH 5D5MF 1UA6L 2YA2A 3HS0A 2V5TA 5L7XL 3KJ4B 3D0LA 1EZVX 4WGVB 3VGFA 3OJDA 4IRZH 5IBLC 3ZT6A 1LO3L 3GMRA 4H8WC 4PJDE 1D5ZB 2FX8H 3DVGA 3VDCA 2IPTH 1MQKL 5ISZE 3NIDE 4HW6A 4WEUD 1UXWA 2CXGA 4CN1A 5IF0A 2VLKB 1IGIH 1T20B 1I8KB 4R8WH 5FHAH 2DQDL 1EFXB 3WIFA 5EZIH 1JVKA 5I15L 4NDMA 5DR5H 4M7KL 4S1SH 3GI8L 3MXVH 3E3QE 3Q6FB 5IBTH 2W0KA 5LCVH 4XNYL 2SEBB 1AD0A 1G7JB 1U3HC 2OXHA 3IDYC 4PG9B 3L3KA 4HJJL 4PJDF 5IEKA 4GMSL 5C09A 5DMYA 3ZKND 4ELME 1BQLH 2EZ0C 3FN3A 2DLGA 3T1WA 3K8LA 3WHXA 3DSFL 4YC2B 2HVJA 1JPFA 3QPXH 4PRPA 4LSPL 4LSUL 3X3GH 3QDGB 3T0EA 1KJ3H 2JB6B 1OF2A 3DI3B 1K8IA 5CWSA 4QF1A 3OPZL 3BYTA 4JDZB 4XCEB 4M93C 2PXYA 4TSBL 1AHWA 1WK0A 4UT9H 3HMXA 3D3VE 4MYWB 4GS7C 1HDMA 1I7TA 5J56B 4RAUA 4Y19A 2YUZA 2PNDA 1NGZB 1NGQL 1VCAA 4JANB 5A43C 1F3DH 3RAJL 5I0ZA 3QZWB 2JJTC 4YEEA 3V6OC 1B90A 1KC5L 1R3HA 3G5XA 4PJGE 1L6ZA 2P5WA 4M6NH 4JQXA 2GITB 1K6QH 4I9WD 2VLKE 5D7KE 5C07B 5T3XE 2XKNA 4ZUUA 1I8MA 3BGMB 3EYFA 5F7UA 2VE6B 3FQXA 4L4VA 1KJ2B 1A7PH 5DMIL 1FIEA 1HQ4B 2J8UF 5EO0B 5ESAB 4PJBF 5I8OL 3DX8B 5DEFB 5DJ2A 1S7XB 2X1PA 5DYOB 1MLBB 5F89A 2FX7H 3OKMB 5K9KB 4FZEH 4YHNA 1CT8B 2XICA 5FM8A 3V7AE 3KPQB 1N64H 1JZ3A 4QGYA 1M4KA 2IBZX 4UBDC 5GRYA 3ARFA 2J7LA 4OLVL 3L3IA 4OF0A 4YPJA 3PP3K 1IBGL 3MREA 4JRYE 1NMBH 5C0GB 2ICEA 5J0BA 3R4DA 3K3QA 3KDMB 3BWUC 2X40A 2QTEA 3O81A 5C07E 3KJ4C 4G7VL 4JY5H 2CGRL 4DVRL 4QNPF 5BRZD 1X5GA 2VZOA 2VZUA 2XN9D 4PJFE 5IBTL 4D0CB 3AAZB 1OD9A 3IJHA 3TYFB 1VGKA 3PWJA 4HEPG 2W0FB 1T6VN 2NXYB 5M94B 2AQ1A 1Q1JL 1IGFH 4NQTA 3VXQA 4DJMA 4NN5C 3BP6B 4PGJA 3LV3B 5AYQA 1MQKH 2HVJB 1G1CA 1RIHH 2O5XH 1CR9H 4HK0A 5IJVB 3EYSH 1ERNA 4W68A 4OQ1A 5BW7C 5KAQG 1OF2B 2H3NB 1UA6H 1MEXL 3V95A 3VCLB 4OF8A 1L0XA 3TJEH 2BK8A 4D94A 2IAMD 3RVTC 3TM6A 4LKXA 4UIKH 3B2VL 4N9GA 3UAJD 1A3RL 1OVZA 4C83B 2EZ0D 4G80A 1K2DA 2R56H 3LS4H 2HWZH 1D9KA 2CSPA 2QSCL 4MB3A 5JIKA 3VXMD 2YD9A 1MAML 3MOBH 1FHGA 1J1XH 2YUXA 5EO1A 4R26H 4BSVA 2HG5A 2MJWA 3FL7A 3HZKB 2KUTA 3M17A 4M9OA 4QRQB 5SWZB 4AEFA 3QDGA 4JZNA 3P0YH 1RZ8B 4X6BB 1FJ1A 4P3DA 3BIAX 5GS1C 3O4OB 4DQOL 4QHNB 4YXLH 5C2BH 4WFED 5GGQL 2VN7A 2JF1A 4JHBA 1H8SA 3EFDL 2HJLB 4Z77A 2DM3A 2OTUB 2ZSWB 4KJPD 3GHBH 4JZOA 4NQCE 3H0TA 2ZCKL 5JLZB 1RUQL 4M61B 2FECI 2X4TA 4DFIA 1X5ZA 2E6PA 1PG7L 1UFUA 5C70A 3TV3H 3QO0B 2DOCA 3LH2H 2GTZB 4QRRB 3VXPB 1KJ2A 4YE4L 3FRPG 4KRNA 4X9HA 5KSAD 1TJIH 2JIXA 4L8SB 4JRXB 4S11A 3VRJB 4JFFD 5BRZE 1DBJL 5CJOL 2E7LC 4XVUD 2VLLA 5FGBC 4POYA 4XXDA 4KKLC 1A0QH 1QLRA 5HGDB 5GISL 3TO4D 4OLYH 1MFEL 2FB4L 2PYEB 4EQ3A 2NY7L 2R69L 4U1JB 4UNUA 4OF5A 5I8KL 3MYJB 2AI0H 4XP5L 3N1PC 5JXED 3BWAA 2VH5H 1N2RB 5E8DH 1JTTA 3DVNB 4OLUH 2A6KA 1A1MA 3G08B 1WWCA 4U1LB 3QXDB 4K2UH 4BFIB 4H26A 4UINH 1S7RB 5CHNA 4PTTB 1KTLA 4K94L 4MVBC 3FO9B 4WCYL 1RPQA 5F9WC 2BOCA 5EBMB 1EA9C 1I8IB 3E6HA 4Z18A 2A6DB 5J11C 3X14A 4NC2B 3QNXA 4OM1H 1X6NA 2EDRA 5C0CB 4NM8H 1KIQB 1F4YL 1BFVL 2ZOKA 1QACA 4Z9KB 3WL9B 1HQ4A 1YZZA 3HFMH 4NRXB 5EO0A 5F7NC 2L7UA 3UAJC 4B41A 3QH3B 2JCCE 4Q97A 1OGTB 4R2GB 4I18B 3W9EB 3T77B 3WJLC 3X12A 4LCCC 3BH8B 2OR8A 5IEHA 1JGVH 1A3RH 2XG4A 1CICB 1V7MH 1PKOA 1G7PA 4P2OD 2VLJA 4NGHL 4UQ2B 3VXOB 5BRZB 1TQBC 1N5YL 5EN2B 3MRKB 3LDBB 1J8HE 1FO0H 5DQ9A 4PJFA 1CR9L 4X0KA 4K94C 5T5FL 4LLMA 4N68A 1I7UA 1FZOB 2C7UA 4Z8FH 2GIYA 5JXEA 1N0XL 1P4LB 1HXYB 3L3HB 5LKNA 4Q0XL 3PL6B 1TJGL 4RFOL 3N85H 4PLKC 3WFBL 1Q1JH 2AVGA 2AQ3A 2PR4L 4NNPL 4Y1AA 4YDVA 3SEPA 3OQ3B 3FRPA 3VD5A 2V6HA 4HS8H 5E2VL 5FKAA 1JNJA 5IB5B 4JRXA 5CEXA 4LGPB 3OKDA 4WVRA 5B8CA 2VDOL 4JY5L 2I9TB 2XY1A 1HHJA 3DRTB 2AJ3B 5CIPA 2EH7H 2BNRE 3RWIB 4OZHE 3CFDB 1NC2B 2R0WL 3ZT5A 5BW7A 5DEZA 3OX8A 1ZXQA 4LP4A 4NN5B 4UIMB 4PJAB 4QHLB 4L8DB 2L0DA 4I3RL 4XBGB 5BXFB 1JRHI 4ZFGL 1HILB 4U1LA 1EJOL 1H15B 3TIDB 2RFXB 4FQLL