4XPAL

X-ray structure of drosophila dopamine transporter bound to 3,4dichlorophenethylamine
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
214
structure length
214
Chain Sequence
ENVLTQSPAIMSTSPGEKVTMTCRASSSVGSSYLHWYQQKSGASPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSVEAEDAATYYCQQFSGYPLTFGSGTKLEMKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein/inhibitor
molecule keywords Transporter
publication title Neurotransmitter and psychostimulant recognition by the dopamine transporter.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 52
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2015-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xpaL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xpaL01
1FC2D 4Y5YC 5IW6B 5KS9E 4AT6B 3E8UL 4XWGL 1OAUH 4NZUH 3O0RH 4JRXA 3GBML 1IGTB 2R0ZL 4NDMB 3UC0L 5K9KB 5L8LB 5EBGA 2HJFA 2VB5A 4MXVF 5MEOA 25C8L 4HX1B 3BI9X 1NMBL 5ALBH 3VH8G 4C56A 3L3GB 5AAWA 4F9LC 3VXSA 2XZAH 1UM5H 3PWLB 1Z5LA 1JFQH 4S1RH 5JZ7D 3TPUA 2WWKO 3FQTB 4G8GD 3P77A 1HXMA 3RZCB 1F4XH 5C09E 2RFXA 2VKWA 1JRHI 4KK9D 4MMXC 5L2KD 5AYQA 4K3EH 2V2XA 2DLFL 3BZFA 2IAMA 3QUZB 3ARUA 4Z95L 3UTTA 4X98B 2ZSWB 3VDBA 1C5DA 3IFNL 3X11A 2V5SA 1XGQB 4QHLA 3OKYA 3DYMA 1UA6H 2ZNWA 3LRSB 5C0BA 2ESVD 5HYJD 4UILH 3B9KD 4WEMB 4XPAL 3RNQB 1UQSB 2PO6A 3I02B 1JZ8A 5FIEA 1YYMH 2R1YB 3TJHC 3BKYL 4LKXB 3V7AE 3TV3H 1T5WA 2VQ1A 4PRPE 3ZHKA 3MLSH 4JDZB 1BQHG 1IGIL 4P59H 5BCAA 4ZXBB 1DQDH 3EOAB 3T4YB 2QHLA 4OZ4B 1DLFL 5EU6A 1MHPL 5GGUB 5D7LA 3TH2T 4NRXB 1JWMA 4O58H 1BQLH 1G7MB 2VXTL 2W9DL 2P5WB 5AAMA 5I2IA 3TYGH 3VXRB 2FH8A 1JL8A 4AIZA 3J7HA 3V6ZB 5CWSA 3L1OL 4X80H 1JZ7A 3SO5A 2VLJB 3HI5L 1KJ2L 4ONGL 4LPYA 4PJ8A 5CSZA 3T2QA 2VIRB 3L3KB 2ZZUT 2QKIB 1MSPA 1ZT7B 3U6RA 2ID5A 1P53A 1S7QB 3VXPB 2DWDB 4W70A 3GMLA 3PP3K 4YO0A 4P3WA 5C3LD 2JK5A 2N4IA 2OJEB 4Y19E 3ARPA 2DRUA 3CVIH 4JZOA 4L4TA 4LVHC 5CSBA 1XR9A 3IAQA 4OGZA 4M4PA 1JF1A 1U8NB 2EC9T 2FLRT 4HMEA 3TT1L 3FFCA 2GSGA 3LN4B 2DQEL 2FO1A 3C9NA 3MRQA 2HFFA 1KJ2B 1FSKC 1WLHA 2CMRH 2BSED 3LKPB 4ODWB 3IDXL 4F2MB 4PJAB 1YYLL 1JJUA 3OG6B 5IBTH 3FT4B 4ZFGL 3PWPD 5HPOA 3BMVA 5F3BA 1EXUB 5EZOL 1JUFB 4NRYB 4I3SH 4F33A 1TMCB 4QY8A 5BVPH 5I15H 4I18A 4HCRL 3QQ3B 5FYKE 4L8BA 3MRCA 4MLSA 4NGHL 2EDJA 3MRIB 2H41A 2IBZX 4PJFB 5SV3A 4X6DF 7FABH 5BZWA 3ARZA 4K94H 1KJVB 4FQCL 5FYJH 1K4CB 4PG2C 1KIUA 4LPUA 5MENB 3SDAD 4R0LA 3F5WB 1CGSH 5I9QB 4HF5L 2AV7B 1AXIB 1TCRA 2FRGP 1FORL 1B2WH 4Y16D 4GBXA 1CF8H 4XNYL 3DETD 4B5EA 4GAYA 3MCKA 2DMKA 5EOQH 3MRNA 4JQIH 1B4RA 3OB8A 2ZKHH 5I30H 4KZEL 3QEHA 3SCMC 4JPKH 4NN6C 2EDOA 3FHQA 3OKDA 5J13C 3IJSA 3TIEB 5J1AA 4Y8DC 4Z7VB 3ZKND 4JREC 4U1JB 5GS0L 3BPLB 4M4RA 3EJZD 1CDUA 4LKCA 4RWYH 4FQ1H 1R5WA 3KYOA 4G8FB 1V3KA 2A6KB 2OXGA 4YNYA 1HE7A 5IGXH 3F58L 3S88H 4NQVA 4GMSH 4JRXD 3OKMA 4OIBA 2MTPA 1I1FB 5L2KE 5EZLB 4L8DB 2Q86A 5DA0B 3BGAA 4PGJA 4ZOAA 3O6KL 3FZUD 4OLXL 5E1AA 1MCWM 3VXSD 1T0MA 1KPUB 5DI8B 1JPFA 1UWXH 4FFYH 4KU1A 1AE6H 3WE6B 1FVDB 5IQ9B 1VADB 1BGXL 5I75B 5HYJE 2JB6B 3QUKB 3TWCH 3R06A 4PJ9A 4APQA 4RFOL 4Z7OE 4R7NB 1P7QB 4HV8A 3GIVA 4KK5D 4CW1B 1QBLL 1PD6A 1K5NB 3MRHA 3PHSA 1MCPH 4A6YB 3T08A 1BFVL 5GS1A 3HR5A 4QXWA 4HXAL 3MNZA 4XBPB 4WEBL 3UTTD 2C4XA 3AS3A 3ZZ1A 4ERSH 5I76B 4M1CD 2LTQB 3AVEA 5C0BD 5E6ZA 5E9DA 3LQAH 5FHAH 1FCCA 2GK0A 3KS0J 4KHTH 5GIRB 2PO6D 3L7FA 2NW3A 5JNYB 1N6QL 1UCBH 4JR9L 3GM8A 4Q0XH 4QHKI 5DMGD 3CVHA 4PRAB 3V5KA 1U6AL 4Q6YA 5C0AE 5F71A 4D94A 1S7UA 2BMKA 4IJ3C 4RNRA 2O93L 2R1XB 3SE9H 5FECA 3PQYB 3JTTA 3NH7H 1BAFH 1T21B 4L29A 3VRJB 5GGSA 4M43L 1RZ7L 2BZDA 1EVUA 4JO3H 5BXFB 4HGWA 4Y89A 4MD4A 2DLHA 1A6AA 3VFGL 3FQUA 5D2LE 4WV1A 1F02I 2FJFB 4UIKL 5J8OA 1LMKA 3EYQC 1MCOH 4N0UA 2DQGH 4QTIH 3MLXH 1C16B 1AR1C 1OAZH 2ZSVB 2HFGL 4O2EB 4NUGH 1FYTB 3CFEB 4JN2B 4PJ8D 3ZHLA 1YQVH 3CMGA 1NGWA 2R23A 4HSQA 2GY7B 1CXFA 1YMME 3ILQC 3D5OF 2GYSA 4EI6B 1W0WB 3PL6D 1DVFA 4PRNA 1X6NA 1JE6A 3PWPE 2BY2A 4NO2B 5F6IB 1OSZA 1H15A 1JZ6A 4NPYA 5LGJB 5KZCD 2R8SH 3VWJB 1U2CA 4PJGA 2B1HH 4KGLA 1G6RH 3FFCD 4K9EH 5LWYH 3OSKA 4Y4FC 1WIUA 5JORA 4JJ5B 1W72A 4P5TA 1Q1JH 4XRCA 4Q7DA 4ELME 5F9AC 4WO4A 1BD2A 5E8PA 4LPXA 1BZ7B 3V2AR 5DJZA 3JXAA 1YPZE 4MX7A 4LCUA 5I16A 1S7RB 3U7WH 5L88H 3MACH 4AH2B 3Q6GL 2J12B 3IFLL 2EEDA 3PWUA 1FVCB 5AWNL 3S96B 1HDMA 1CQYA 5IMLA 2VSCA 2VLRB 3H7BB 3LHPH 4JFXA 5L8KB 1SJVA 4QRUB 1RV6X 3HUJB 1MNUH 1ZXQA 1CIDA 1F2XK 5KW9L 4UV7H 2DWEB 4IRJC 5GGRY 5F7YC 2AW2A 2IALB 5AZ2H 1U8PB 1KELL 1UB6A 4HJJH 3OMZA 3O41B 3CZFA 4MNGE 3JZ7A 5GSRA 4KVCL 5ESAA 3QPQC 2VMFA 5DF0A 4K23L 5DJCB 2B4CC 1QACA 3GSNH 1HNFA 1HHGA 4YHMH 1X5YA 1CT8B 1PKQB 2HLFD 4OGAD 2AGJH 4WHYH 4B7LA 1MH5A 1D3CA 5GRJH 5DR5H 1MIMH 3QG7L 3D0LB 3SDXE 3UJJH 5IHBA 4ZUTB 4BA8A 1OHQA 1VFBA 1I7ZB 2J4WL 5LBSH 5D1ZC 1KBGH 3HE7B 2VDKH 4GT7A 4NNPL 2Q1EA 4C55A 3K8KA 3IDMA 1BREA 1LEKB 2DL9A 4ZAKB 5AUMA 1QEWA 3BDYL 5HI3C 4LHUG 2OM5A 1A14H 5CBAB 4M6MH 3IVKA 1DUZB 3FTGA 3MJ9L 4KXZH 4N0YL 3GHEH 2AK4E 4W68A 5MEQB 4HWZB 4HFUH 1XGPA 3LVEA 1TCMA 3GSRB 3QUMA 3PABB 5C0BE 1MCLA 3LKRB 4P3DB 3HNTL 1T1XA 4APQD 3OKKB 4KJYB 2ORBL 1T89C 4XVSL 2EC8A 4PYGA 2LFGA 2ARJQ 4HIHA 1MWAA 2EICA 1FBIL 3GSUB 1MCFA 4HUXB 2EDKA 1KEML 1S78D 5E2WL 4LCYA 1RULL 1M4KA 1RJYB 4NHCL 5HGBB 5I8EA 5DEFB 1T22A 5E4IA 1PY9A 3FQRA 3W39B 5CZVH 1TJGL 3IT8D 4RMUA 3FOLA 2VLKE 1HWHB 5FCUH 1PGRB 2Z35B 4KKNA 2FZ3B 1EHAA 1RHFA 1FO0L 1SEQL 2ITCB 5MEPB 2DL2A 3LAFA 1A7RL 1ZSDA 4AK1A 1T7YA 3ZE1E 4LCWB 4U6YB 1NBZA 1UB5A 3LKSB 3R4DA 1YY8A 1EIBA 3GJEB 3G6JA 4ZQKB 2Z4QB 5EOCL 2GJ6B 3SE8H 4JFFB 4X4XB 1GGUA 1RUMH 3H3KA 5CBEA 2VDNH 4EUPB 1AIFA 1TXKA 3MLVL 5FKPB 4EDWH 4IOIA 1GYAA 5FFLA 1N0XL 4LEXH 3UCRA 5AG8A 1XCQA 1VGKB 4XXDB 3ARGD 1CYGA 3WNKA 4XGZB 1OAYL 1RURH 4HBQA 3OJDA 3NACL 4MGXA 1ZT4B 1P69B 3OXSA 3SN6N 1DVFD 1F00I 3LMJH 3ZE0F 2W60B 3HS0B 3MV7D 2MCPH 3MRPA 4PRBA 1NKRA 1ZA3A 2P8LA 4LIQH 3C5JB 4YDIH 3NIDE 4PRIB 1SJHB 4WCYH 1KTLA 1A0QL 4WDIB 3VXNA 4OQ1A 5DK0A 1WWCA 1RJLB 4PJ5A 3NGBB 4R4NC 4F3FA 3UPCA 2DQFB 2WQ8A 4WO4D 5IMOB 3K7UA 5I17A 4PGCB 3U1SL 3W82A 4DKDC 4GSDH 4XVUD 4NQDD 2X40A 5C07D 1UH4A 5C2BL 4ENEC 5IIEA 2XN9D 4EBQH 3RWCB 2QTEA 1AY1H 2J6EL 3V6FB 1AHWB 4D0DA 4M1GH 5JIHA 1NCUA 4KPHL 4HHAA 3INUH 3C60A 1H5BA 2CJUL 1OTSC 1CU4H 4TQEH 3RWIB 5ICYB 3T09A 3DO3A 5IF0B 1FIGL 4AMKH 1MCQA 4ZYKA 3S35X 4TNVF 5CZXD 4HS3B 1Q94B 5H35A 2OZ4A 1J1XL 3GMMB 5H37H 1A2YA 1J1PH 1D9KB 3BKJL 3W2DH 4OT1L 2F53D 3CFCH 3LEYH 4HXBH 5JA9A 2GJZB 4F7EA 5GGVY 3RQ3A 4L8CA 2QHRL 4X7DC 4F15C 4FXGB 5F88B 5EFIB 4ZUSA 1S8DA 5ADOH 3BZEB 5KVDL 4DKFH 2WUCL 1J8KA 3L7EA 3I3BA 4OIIH 1ADQL 2ZCLH 3ARFD 5AD0A 1A9BB 1RJCA 4BK4A 2ITDA 3OGCB 4Y5VB 3B3IB 5FK9A 4K94C 1NUFA 5C0CA 5TE7L 5IESH 4JFEA 4LRIC 2BNRD 2A73A 1J0YA 1FAIL 5IB5B 5HBBA 4HEME 2P24A 4KI5D 5HI5C 4MAYD 4HPYH 1T1YB 4QXGH 3TF7C 1XGRA 4V2CB 1A1NB 4MJ4A 3RI5K 4Z7QE 4XNUH 3CXDH 4KKLD 1NCNA 5D71L 1C8PA 1YC7A 3ZT6A 3KXFB 2IFFL 3VXOA 4NQED 3EFFB 1HH9A 4ODHL 3RNKA 1AXTH 4XVUC 4HMDA 3O4LB 1JHLH 2MQCA 5EPMA 4GW5B 1TTFA 1J0JA 4PJXE 1A1MA 1N5AA 1UACH 4KHXL 1LK3L 3IGAA 5ID0B 1WTLA 5J3HD 2UVEA 3BW9B 4ZOCA 4OZGE 3HMWL 2QQKL 1LO2H 2EO9A 4QRTA 1E6OH 4ZTOH 2CLRA 1H3XA 4H88H 2XWBA 3AGVA 5I74B 1ZV5A 5ENWB 4NKIL 4G6JL 2KQNA 4R26H 3MGOB 1RMFH 4UIMA 5AYUH 4P23C 4XNQA 1GAFL 3HRPA 5F6HJ 1EDQA 3P0YH 4QHNA 4IDLA 4HLJA 5H2BB 3MOAL 4NN5B 3QIBC 4BZ2H 2O26U 5EH1A 3TBTA 2ENYA 2FX9L 5FYJE 2G5BA 5IM7A 1PG7X 1EBPA 3V4UH 2QLVB 4U6XA 3RWDA 3PP4H 4FQJL 3MV7E 3LQAC 4GW1A 4NM8H 1IKFH 3SDCA 3C09C 3S4SA 5MHSD 2AJXL 4GAJH 4NYLB 2C5DC 2YPKB 4PJGE 3MCLH 5DJ2A 4HKBB 3L5IA 5CUSH 3H9HB 2FX7H 1JP5A 3QIWB 4MAYC 2L7UA 2NMSA 1NAML 4KTDL 4XMKH 1FN4A 4NZRH 1BWWA 4LNRA 4PUBH 4ZNCD 1UENA 4NQDE 1IARB 5C07E 3MLYL 2XN9E 4WW2C 1GOFA 2DF3A 4FQLH 1XFPA 1PX4A 4J3SA 1PSKH 1YNLL 3IDJB 4ZPVB 4WIQA 4JFOB 4X7SH 1M71B 3O8XB 3DX7B 4GG6A 2UYLA 4R7DA 1ND0B 4U05A 4G8IA 3QNYA 1FH5L 2R1WB 3N06B 1F8TL 1QSFA 2NY6B 3D69B 2XQBL 4RQQB 1G0YR 3P4MB 1GGCH 1TQCC 2F53E 4N9OB 3U4BH 5DHVA 3N50A 5I66B 3U0TB 4CADA 4TUKH 3WHE1 3QCTL 5F96H 1FZJB 2X4QB 4UTBL 2YK1H 4JDVB 3GI9L 4R2GB 3C5ZB 4H20L 4MQTB 2HMIC 4F7MA 4E5XA 4FN0A 4UAOB 1IQDA 4K7PH 4K9EC 3DMMD 2OCFD 1XF1A 2Z91A 1Q0XL 3GJFK 1Z6JT 4LCCB 3H7LA 4UINL 4RMSA 1KIQA 1MF2L 2ILLA 2VE6B 1OVZA 4BH7B 4CVWA 3EHBD 2BNRE 2Z0BA 2V7NB 4XPHL 2A74A 3QUYC 4X6EA 2WINB 3UMTA 2EDRA 3IJYB 1KB5B 3ZKXB 4ONFH 3WFCH 1GGTA 2OL3H 1MLBA 3IDIA 3QWOA 1MRDL 3TA3C 1W0VA 1BZ9B 3K8MA 3KPPB 3F7YB 4H8WH 1NMAL 1DQJB 3JWOL 3SPVA 1INQB 2B0SL 1XZ0A 3QDAA 1FPTH 3QULB 1NKOA 4YC2B 5HHPA 2B39A 1XF4A 4HZLA 1AGFB 1U95B 5FM5M 5C0CD 4JLRA 4JFED 4DZBA 2WP3O 5HYSB 5FM8A 4NQEE 3OR7A 1CFVH 4JKKA 1FL6A 5DS8A 1T7VA 3K74B 4XI5C 2P7TA 4O5LL 3NPSB 5E08H 3WNLA 4M7LH 5JIPA 3OR6A 3P2TA 1AGDB 2AJSH 2D2OA 2FIKB 4PJEB 4LDEB 3QHFH 2QR0A 4LVEA 1MQKH 1HI6A 4F7PA 5TFSL 3O9WB 1JZ4A 1OP5K 1WEJL 4QRSA 1ZTXL 5I1KL 4X4MA 4Z6AT 5FOBB 3VFOA 3LZFH 3QO0A 3P9MA 5LVEA 2W1NA 4PJDF 3FMGH 5TPWH 2VISA 3V95A 3I2CH 2ADIA 5IFHL 1NCDL 5JOPD 4R96B 1FL5A 4PJIB 5B38G 5T1KB 1YMHB 4X6BB 3DO7A 3V6OA 4ZO8A 4UT6H 5I1AA 1J5OH 2VRAA 1UVQB 3MODL 4OBRA 2DKUA 3NPZB 2YBRA 4JHZA 3BQUA 1KN2H 1QA9A 2MKWA 2NZ9C 3VW3L 3O3DB 3G6JE 4JAMA 4GRWH 5INDA 3DMMC 1KIPA 5DFVD 4P5KB 3O2DH 2YRPA 3EO9H 1CTNA 3KLDA 1KV3A 4P3CH 1R3HB 5F9OL 5MHSE 4N8VA 3BZ4A 4S1QH 1QTYT 1J0ZA 1LNUA 4M7ZB 5HVHB 3TO2A 4JFHD 2BY3A 3QG6A 5I0DA 4Z78B 1KG0B 5KSAD 2VKXA 2AJ3A 2AJYL 5HJ3B 4G6ML 3EYFB 4NM4L 3TJEL 1MAMH 4YBQD 3SDCD 1MJJA 43CAB 4OZHE 5LAXB 3RVWC 1WBYB 3H3PL 5HHNA 4XP1L 3BH8B 3MA9H 3GBNH 2CUHA 4AEIL 4S0SD 3GDBA 3U2SA 4U1NB 3W9DB 3FQNA 3ZYOA 5DEZA 4O4YH 3SKMA 1CBVL 3DURB 1MVUA 5DD5H 4GRWF 3DRQB 2H26B 1NCAH 3TVMD 3RGHA 1NQBA 4U1LB 4J3WA 2CKBA 4HWBH 4YXKL 4ELMF 4N1CA 4JRYA 3O3BA 1VFMA 1B6DA 3BYYA 4TN9A 2PTTA 3RGVD 4MAUL 3WXVH 1ONQA 5DMKA 3RX8A 1J10A 1CZ8L 5F9JB 1G9NH 2Q76A 5GRUL 3N9GL 3RVXD 3OAUH 3GB7A 2CIKA 3RBGA 4FQHB 2H9GA 5BOPA 4GKOA 4WENB 1FNEA 4N5ED 3TZVD 1CFNB 2FIRT 2OI9C 3CCHA 4Z0BH 1QG3A 5EWIH 3T3PE 3BSZL 4JPIB 4HW6A 2GCYA 2H6PB 3BP7B 4DQOH 1QQDB 1UM6L 3QSKB 3KPMB 5CZKA 4HS6B 1MJ7L 4GRMA 32C2A 4P2OB 1HHIA 4D8PB 1UKSA 4Q6IB 4U3XA 1FDLH 4XVTL 3U9PH 1DUYB 3A6CH 5TGBA 3BKCL 5KSAC 4XHJD 2GSIB 2Y36L 4HIJB 2UZIL 1NCCL 4LGRB 1OGTA 4WFEE 5KTEL 3S6CA 4OCWH 1ES0A 1JYXA 1DL7L 4NO0B 3DHJA 4WHDA 1CR9L 1QOKA 3K4DA 4QT5A 5IB4A 3ARQA 5BRZA 1K3ZA 1MFEL 3ULVF 2YSSA 2FJGA 3MFGB 1BBDL 4KDWA 5E5MB 5I71C 1OOAA 3WBDA 3MREA 5CD3A 2HLAB 5KSUA 1LK2B 1QSED 4JM2A 4FXKA 3W81A 4FZ8H 1JK8B 4PD4K 4FQXC 1K4DA 3CH1A 5ETUA 1ZK9A 3E6FA 4HH9A 5JOPE 3ARYA 4M61A 4MJID 4QKXB 5HI4D 2F5BH 1N5YL 5A43C 4XPGL 4PJHA 5D1XB 4DZ8A 2A38A 1C08B 2D7PA 4G8EB 3RGVC 1IAMA 5C71A 3KPQB 5HYEA 2A77L 4JFPA 1U8KA 1VFUA 5DO2C 4UDUB 2YN3A 3LN9A 2VLLB 1E4KA 1JMXA 2VR9A 2UWEA 1YECH 2UVFA 4KK6C 5T3XD 3PE9A 5L9DL 2R4SL 2HWZH 4WI7A 4LIQE 4LLDB 4YQXL 2BSRA 1EEZB 1WFUA 1IRAY 4OZIE 3FQWA 4RMVA 1P1ZB 3S3PA 2BHYA 4JFHE 1WFTA 2Z92A 3Q3GA 3S9DB 1CE6A 4QRRD 3BQUD 4N68A 3AREC 1WJ3A 1I7UB 4U1GC 3GJFH 3HC4H 4PJ7B 5J57B 2Y06H 4Z0XA 3EYUH 1ZHKA 5DK2A 1P7HL 3EO1A 5EDXA 5BW7A 4JFQA 4UB0H 2DQIL 4PPTA 4NOBA 5L0QC 3L95A 4U1HA 1ZANH 1NC2B 5J6GB 3CDFA 4IMKC 4AY0A 2FHFA 4WFGD 2EE2A 1AGEB 4LVOC 4EVNA 3C5SA 3KHOA 2P5EB 5INCA 3UO1H 1NDGB 4DTGL 4H0HB 4OM0L 5IVOA 5BZDB 4PJBE 5IW6A 4AT6A 3ZKSD 3P9LB 5DEGB 3SQOH 4LBEB 1C1EL 2XZQH 1CLZL 1IGTA 4NDMA 4JVWA 5GHWL 3W9EB 5IOPB 5K9KA 1H3UA 4GMTL 1KPVB 1V7NL 1CICC 4HX1A 3L3GA 4IIQC 5F7KC 3T2NL 1FZKB 3PWLA 4YBLC 5TE6L 4KUZL 1OP5H 2W07A 3OKEB 1IVLA 3FQTA 2KUTA 1H9VA 4KV5E 2XT1B 3RZCA 2QADD 4HAFA 1U3ZA 4OQTH 1MRFL 1YNKL 1A1OB 3LB6D 1IM9D 4C4KO 4HWUA 2EE6A 2AEQL 2EEBA 3HG1B 3MJ6A 2NXYB 2EECA 5IVNA 3D39B 1QFWH 2YN5A 3QUZA 2PTVA 1KCUH 3X13B 4TSBL 4X98A 3T0VA 1IGYB 2J5LC 2ZSWA 3TLRA 3I9GH 1VESA 4KTYA 1XGQA 3VI4E 3SDYH 1LP9B 2DQJH 3LRSA 3BGFB 3BP4B 3EJJX 1S5IH 1LD9B 3RNQA 4JM4H 2D7QA 1NFIB 1UQSA 2DIJA 2LQRA 3I02A 3U30C 4YHLL 2R1YA 2Q8BH 4LKXA 2HRLA 4LAQH 5F1KC 5B8CB 2BFVH 1S7SB 2OTUB 4JDZA 4AG4L 1IKNA 4IMLB 3QCUL 1DQTA 3MXVL 4WNQB 4ZXBA 2DQTL 3EOAA 5JXAL 2EH8L 1XIWB 2F54B 4QHKJ 4OZ4A 4Y5XC 5GGUA 2V2TB 4MJ2A 5K9JL 3C6SB 1XCTB 4NRXA 4OM1H 1T3FB 1G7MA 2P5WA 1QSEE 3VXRA 3R8QA 4OF3A 4HUUB 5DRXB 3V6ZA 2ZUQC 4OTXH 1IC4L 1L7IL 3SJVE 4MJIE 3T0EB 2VLJA 2NY1B 1UJ3C 4K3GA 3VXQB 4B0MM 2Z8WC 1RZIB 4FQIL 2VIRA 1R24B 3L3KA 2QKIA 4NP4H 4P2QE 2GTWB 3QHZH 3QXVA 3RIAK 2CR3A 1YJDH 1ZT7A 3VXTB 1NFKA 5HDLA 1S7QA 3VXPA 1L4IA 2DWDA 3E2HB 4UI2A 1I3RB 5KS9B 4WUKL 2HRPH 4GXVL 3QCVL 2YRZA 4XP6L 3MR9B 2OJEA 5T3XE 2QADC 3HLAB 2VC2L 2Y1VA 1EMTL 5I18L 1YY9D 1U8NA 3OX8B 5FYLH 4U6VH 3EJYC 3LN4A 2E7LC 5C70A 1JZ3A 1KJ2A 4D9RD 4DUVA 2I5YH 4QRRE 3SKJL 4KKCD 4N1EA 3ALWA 1EO7A 3BAEL 3MXWH 3LKPA 4H8WC 4ODWA 5CJBA 4F2MA 3MOBH 5C09B 3T1WA 3O6FB 4PJAA 4UTAL 5HPMB 3FT4A 4HD9A 1W72H 5J12C 2LU7A 2NR6D 1EXUA 1JUFA 4NRYA 1BJ1J 5EU4B 3RL1B 1FG2B 3HPLB 3GK8L 3QQ3A 3ZE2E 1T1WB 5JW5B 3QEQB 1SM3H 2FHBA 3MRIA 5CINH 4QNPE 4I0CC 4PJFA 4WFGE 1CXIA 1KJVA 4NZDA 1OLZA 1K4CA 5CEYB 5MENA 3RHWK 1BOGB 2X1XR 3F5WA 5C92A 3CX5K 2AV7A 3V8CA 1AQDB 4CN1A 4M6NH 1KACB 5I73C 4BQ8A 2HJLB 1ZLUK 1IGFH 4LSPL 2Z31B 5FGSA 3GM0A 1EX0A 3QNZB 5F72S 4Y5YB 3TIEA 1NL0L 4PB9H 4Z7VA 4PJGF 3NZHH 4U1JA 2WIMA 4L8SB 3MLUL 2XV6B 4YZFE 4C83B 4G8FA 1MCSA 2CR6A 2A6KA 2RQ8A 4RZCB 3ALPA 1I1FA 1JI1A 3ZKMC 4ZMAT 5EZLA 1H3PL 4L8DA 5B4MD 3PNWB 3ORJA 5CP3A 1FGNL 4Z8FL 5EIIB 1BP3B 1Z9SA 1KPUA 5DI8A 3WE6A 1G7QB 3BPNC 1FVDA 4WHYG 1VADA 5IQ9A 3STZB 4G6AC 1DZBA 1RZ8B 2JB6A 3P30L 3QUKA 3P9WB 3DARA 1G7JB 1UZ6F 3RZCD 2DB8A 4R7NA 4YDKH 4KTEL 1P7QA 1MI5E 4CW1A 4L3ED 2M1KA 4Y19B 1K5NA 3D9AH 3RWGB 4A6YA 3G08B 3QUMH 3QUZD 5JW4R 1S3KH 4XBPA 3FO9B 5JIKA 3PGFL 4AJ0A 1Q9WB 4N0FB 2NR6C 4MDJB 5I76A 4LVNC 3B4NA 1AJ7L 1A6UL 1DANU 5JW3L 1TJHH 4X9IA 1PAMA 5GIRA 4BQCA 4TRPH 5JNYA 1J11A 4YX2L 1MWAH 4PY8I 4PRAA 2XFXB 3H42L 5DVOA 4RBPK 3H9ZA 2EH7L 15C8L 5HTSA 2HT3C 3AS1A 4JDTH 2R1XA 1OWRM 2EXYD 3PQYA 4XNXH 3TBVB 2P48B 3RY5A 3G6AB 1T21A 3VRJA 3D48R 2NY5L 5A2IH 4J3OC 1EVTC 4MA1B 4I0PD 4KI5F 8CGTA 5BXFA 1G9NC 2DDQH 4OF6A 2DKSA 3W11D 3V52H 3VXRD 1G7HB 3DRTB 1FFNB 1CD8A 2NLJB 1A5FH 2FJFA 5ESVB 2IAMC 4O51B 4J12A 1DJSA 3QEGL 1FRGH 4ZO6A 1C16A 3HI6H 2VLJD 4XCFH 2ZSVA 4O2EA 3OQ3B 1A6WL 1FYTA 3CFEA 1P2CB 4JN2A 4B41A 1G7IB 2YD6A 4YLQT 4K3JL 3RWFB 5F7EL 1WBZB 1GGBH 2FGWH 4J6RH 3BP5B 1X4ZA 4MZ3A 2P8PB 3GIZL 1S9YB 4EI6A 1W0WA 2EYRB 4BQ6A 4M7KH 1OAKH 4GRLD 3TO4D 1X4XA 3WSQL 2JKXA 4GAGL 3BEVB 4NO2A 3WUWB 5L2KB 5FXCH 1KXQE 5LGJA 4UV4L 4LDOB 3HAEH 3VWJA 2YUWA 3BMWA 4O2FB 4OLUH 5A2LH 5GJSL 3T2PA 4JJ5A 5T1DH 3NCEB 5I1IL 3S35H 1BZ7A 5HYJB 3NCFB 1A7BA 1S7RA 4AH2A 3VG9C 1FLTX 1A6TB 1FVCA 3DGGB 1I1AD 2A9ML 3S96A 2PYEB 2VLRA 3H7BA 1S7WB 3G6JF 4QRUA 3HUJA 1VENA 1U41A 4M8QB 4F80A 2DWEA 1CGXA 2IALA 5DWUL 1U8PA 1RD6A 2XRAH 5HVGB 1OSPL 3O41A 3FN3A 1QYGH 3K1DA 2AXHA 3FN0L 5D70L 1B0WA 2BP3A 2XI9A 1N8ZB 1F58H 5EU3B 4KROD 5EZIL 3W11C 3MV01 1UH3A 2NTSP 5C0AB 5DJCA 4KXZI 3FO2B 3SCMB 1OCWH 1CT8A 1PKQA 4NN6B 3WO4C 1I9IL 5J13B 3D0LA 4JREB 4ZUTA 5HVFB 1QNZL 4PP1C 1I7ZA 4RGOL 4W81A 1MY5A 4DGVL 4OD2B 2EDHA 3HE7A 3CFBB 4I13B 4KJQD 4JPWH 1R5IB 5D2LB 2G60H 1LEKA 2VITB 5F21B 4L3EE 3PV7A 5F8RC 4ZAKA 4LLUB 5JOFB 1C5CL 5B21A 4PBWD 3ULSB 2DD8L 3Q0HA 1X5HA 3UTSE 2IPKB 5CBAA 1DUZA 1P5UA 2ZG1A 3C08H 5MEQA 2KH2B 4HWZA 1WAAE 5F44A 3GSRA 3PABA 1YMMB 3LKRA 4P3DA 4R4FH 4YUEL 1Z0MA 3OKKA 4KJYA 4HLZH 1JNHB 1JPTL 4B53A 4YAQB 1U92B 2XA8H 4NOFA 3PWPB 1OF2B 1UYWH 4YGVB 4I9WE 2ERJC 4LL9A 3VFPB 3D3VE 4U49A 3RIAF 4Y4HC 3KYMB 1I1AC 3GSUA 3RVUD 4AEFA 4HUXA 2G9HB 4JFDD 2K7QA 4HULB 1TZGL 4ODTL 4HIIB 3MJ9A 1RJYA 2XTJC 4OCRH 3FJTA 1YPZB 3IFOB 3L3JB 1GC1H 5HGBA 1IC5H 1X5XA 5DEFA 4ALAL 1PG7H 1FHGA 1X9QA 3OBAA 2X6MA 5DQDH 4JHAH 3W39A 2DQDL 1GL4B 4IJ3B 4CJ1A 4TPRL 2WWKT 5JDJA 3AC0A 1KENL 1JPSL 4ZOBA 2Z35A 2FZ3A 2YD5A 1BFTA 3ARDC 5DJYB 1ZLUH 4DGIH 4KROC 5J11C 2Z93B 5MEPA 2ITCA 2KQMA 5EULV 1WGOA 5IT2L 4DCQB 3U9UB 5KJRH 5E8OB 4LCWA 3O6LH 4U6YA 1R0AH 4HH8A 3LKSA 1Q38A 4MCZB 1EJOL 4JO1H 2DQUH 3GJEA 4MNGB 4ZQKA 2Z4QA 3WIHL 2GJ6A 4JFFA 3ULVL 4X4XA 1C7SA 4L9LC 1PEWA 4EUPA 1MREL 3F6IA 5FKPA 5TQ0L 3SDXB 1JZ2A 1G9MH 2J88H 5L7XH 1VGKA 4XXDA 4XGZA 4BM7A 3X14B 2CRYA 3WCYA 3VGHA 1J0KA 1GPOH 1ZT4A 3SGJA 3L5JA 4FZEL 5C6WH 5K59F 2W60A 4TSAL 3HS0A 3UTPD 4W4OA 1DBMH 4HQQL 4HIXL 3N1FC 2WQRA 1RJZB 1IGMH 2A6JB 3C5JA 3TBSB 3K81A 4PRIA 3IU4H 1SJHA 2QV2A 4DN3H 4WDIA 1QRND 1RJLA 3DSFL 2AK4B 2X05A 2DQFA 4O00A 3MROB 1CQKA 5IMOA 4HFWB 1LO3H 3EBAA 1RQ5A 2BDNL 1BBJB 4WV1C 4OF8A 5FCSH 3P3YA 2O5XH 4XT1C 1MFAL 5FGBA 2NX5D 2WIIB 4V1DD 4AIOA 3RWCA 1YEGL 1RU9L 1KLGB 1PW3A 4RBPH 3V6FA 1AHWA 2VZ3A 3P0VL 3QXAB 1YEJL 5HXMA 3RWIA 5ICYA 3HNSL 4LQFL 4XCCL 5IF0A 5JPNB 4U1IB 2FEEL 4HS3A 1Q94A 4J1UB 3GMMA 5DYOB 1ZVSB 1D9KA 3MV11 2CLVB 2HH0H 2AK1L 2EKSB 5C0RH 4JO2H 1I3GH 5I1HH 3MO1B 2GJZA 2CH8A 3B9AA 2VLKB 2AQ1A 1D6EB 1CDIA 5GGTH 1PBYA 4FXGA 5F88A 4P5TC 5EFIA 4DAGL 1DSFL 1IC7H 1NBQA 4X8JB 1IE5A 3BZEA 2HN7B 4Y0GA 3ULUD 4YWGL 1JCKA 1U8MB 1A9BA 4GKNB 5D8JL 1O5DT 1ZWIB 3OGCA 3B3IA 4Y5VA 5CGYC 3F7QA 3O0RL 4WGVB 1X5JA 3PL6B 4C58B 4GG6F 3RY6A 3U7AA 4I2XB 3SDDD 3X12B 1IFHH 1UZ8B 3QZWB 4QWWC 5IB5A 5JR1H 5KZCB 4KV5F 4EOWH 3WHE0 1X5AA 1O7VA 3KLHC 2I26N 1T1YA 4GS7C 4JFDE 1E4WH 1A1NA 2EXWC 1UEYA 1K8DB 4KI1A 3O3AB 1S7XB 2FEDD 3ZO0A 2OK0H 3KXFA 2NPLX 3VI4F 3EFFA 1E4JA 1KC5L 4MB3A 5HHMD 3NFPB 5IK3B 2I9TB 3O4LA 2HKHL 5HHOE 2ZCKH 1EFQA 3GHBH 1U8HB 3MTRA 4GW5A 3G6DH 3AXLB 2WUBH 4KWUA 2X4PB 3QDHA 1OARH 1OTUC 2VWEE 5D1QC 1UA6L 5FYLE 2FYYB 5E6YA 1M1SA 5I1GH 5ID0A 1TENA 5DD0L 4DOHE 4NKQB 3BW9A 3IKKA 2IAND 2JJTC 2CKNA 1H3WM 3MUY1 2WLYA 5E99L 5J9PB 5EC1B 1NGZB 3HI1B 4NFDA 5I8OL 1HQ4B 5IHZB 3KYKL 3K4AA 4TVSa 1LDSA 1FVEB 5ENWA 5C6PB 4HWEH 1IMHC 2B1AH 5KVFH 3MGOA 5CGMA 4XWOC 4OCMC 1U93B 3TEUA 2RHEA 5ADPH 5CD5D 4O58L 5H2BA 1HIML 1VFAB 3D6GA 2GJ6D 4FRWA 3UTPE 1OL0A 1DN0B 4X80L 4EIZC 2WWMC 5EUOE 3QPXL 3TCLB 5IVZB 5K93A 2P8MB 3KJ4C 4NYLA 2YPKA 2FNBA 1NGQH 3SDDC 4HKBA 3S34H 4E41E 1QRNE 2UZYB 3H9HA 3DVGB 5CCKH 4CDHA 1NCWH 1CD0A 2IWGA 3QIWA 5MI0B 3ARXA 3G9VA 4RX4D 5JIIA 1JNJA 3BP6B 3BKML 2EKJA 1QZ1A 4FG6D 3CVIL 2BRRH 2NX5E 1SEBB 5T3ZH 4V1DE 3JV4B 2PCPB 1T7ZA 3IDJA 4ZPVA 4PRID 1GZQB 2Y07H 4HUNB 3M8OL 3CXHJ 2XA3A 3NTCL 4ZS7H 4JFOA 2Z9TA 3GKZA 2DQCL 4AIXA 1M71A 4CMMB 3O8XA 3VFMB 1EHXA 2CKBH 3DX7A 2PR4H 4I3RL 3SKNB 1ND0A 4BUHA 2M8XA 3RA7H 2R1WA 3D69A 3MLTB 4RQQA 5FUCC 1YEFL 3P4MA 4V2BA 4Q9RH 3OKNB 3WLBB 3B6SB 5T1LB 4JKLA 2XYCA 1NEZB 5I66A 4M1DL 3PWNB 3U0TA 4OCSL 1V7MH 1AO7D 2ZUYA 3HZVB 3R0NA 1FZJA 1PKQE 2X4QA 7CGTA 4JDVA 4PJXB 3QAZC 3C5ZA 3HMXL 1EPFA 3A67H 3U7YL 4LSUL 4OZGB 3HNVL 1BM3L 4YHYC 1OD7A 1QKZL 4LCCA 3WKMH 1RIVL 1FIEA 2VE6A 5C0GB 4BH7A 3MC0A 4RISH 1CTOA 4WFFE 4F15B 2V7NA 1N7ML 2FBJL 2WINA 3HB3D 3IJYA 1KB5A 4MA7L 3BPCB 5ANMB 3QXTA 1EO8H 3IFPB 4F57L 1BZ9A 3KPPA 2H2SC 3F7YA 4HS8H 1DQJA 3NA9H 1INQA 2ZP0T 3ARGB 5HYQB 3PIQB 1JNLH 2Q8AH 4FQ1L 3QULA 5DJ8B 3S88L 3GO1H 4KUCF 1AGFA 4GMSL 3B9VA 1U95A 2D4FA 3B2UC 1R3IH 3MV7B 3I6LD 5HYSA 2F58H 2VZOA 2B2XH 5HHME 1F6LL 4KQ4L 1QD0A 1IM3B 1T0PB 4CVZB 4X4ZA 1AQKL 3GNML 1AGDA 2FIKA 4PJEA 1A64A 2BRQA 4PLNC 1AI1L 3S5LB 3QQ9C 4JN1H 1OW0A 3HHRB 3O9WA 1II4E 5J6HB 4XNMB 2LAAA 3QXUA 2IANE 3QUXC 5EA0L 3OF6D 1KEGH 2E7BA 1CFTB 3KXFD 2BK8A 5FOBA 4NQDB 1LVEA 5C07B 6FABL 2V9RA 2XN9B 3S3JA 2VABB 4PIRF 4IEFB 1D6VH 4R96A 4PJIA 5T1KA 1A47A 1YMHA 4X6BA 3QFDB 4DVRH 3GMPB 1WZ1H 5DJAB 5GZOC 4Q9QH 1SY6L 3RWEB 2DM7A 2XTLA 4WY7L 3ARSA 4Z7WB 3IAGC 4XNZC 5ID1B 3RVVC 3O3DA 1E28B 5CIPH 2F53B 4P5KA 1RHHB 4BZ1H 1R3HA 3QQ4B 4M6OL 4JM2F 3QIBB 3K2UL 2FCBA 3HTLX 2LE9A 1KG0A 4Z78A 3CSGA 3V5DB 5HJ3A 1MFCH 3EYFA 1BZQK 3ARFB 1NAKH 4U31A 4IOFD 3SKUD 3C09B 4PJHF 3OZ9H 2C1PB 2F19H 1MCOL 43CAA 5LAXA 2BNRB 1GC1C 1MPAH 1LEIB 1A6ZB 1WBYA 3CFJB 4FNLL 3TT3L 3BH8A 1YQVL 4P9HL 4YXLL 3L5XH 1CS6A 4K3DH 1VPOL 2UWEF 1U0QA 4MAYB 4LFHG 1XGYH 2DAVA 4U1NA 3W9DA 4Q9CA 1A3RL 1WT5C 5KVGL 4PJCE 3DURA 4L5FH 5E94B 5IV2B 5IFAH 3P0GB 4ZTPH 3DRQA 2V5RA 4WW2B 2CRIA 3WDHA 1DQML 2H26A 4NQTA 1LDPH 4U1LA 1RZGB 3KHQA 4NQEB 2M2DA 2CK0L 2IBGA 4MXQC 3GMRB 3R1GH 3WIIL 1KB9J 4RWHA 2IQAB 1DEEB 5F1NB 1AO7E 3P4OB 1UM4L 5F9JA 1JMZA 3O8XD 4M7JL 2NY2D 2JJUA 5HHQB 1SYVB 3WS3B 4MQSB 4NHUB 4XVJL 4FQHA 1G9MC 3E8UH 1S5HB 1TQCB 4XWGH 5EORL 1A7PH 1CFNA 2W91A 1L0XA 3GBMH 2R0ZH 3UC0H 4NCDA 2VDRL 4JPIA 5DUPL 5I8KH 3F12B 2C1OB 25C8H 2H6PA 1NMBH 3BP7A 1Z3GL 3BO8B 1QQDA 3LEVL 3KPMA 2BOBB 2D7NA 3OKOB 3VRLE 5FGRA 4RSVA 4HS6A 3DV4B 4K7FB 4P2OA 3VFVB 2QQLL 35C8L 4D8PA 5A1AA 4Q6IA 5T5FL 1DUYA 5LGHL 1LO0L 4NO5B 2IF7A 4N8CL 4R4BB 1T0NB 3QUYB 2GSIA 4HUKB 5IB2B 4ODUB 3ARWA 2DLFH 1T66C 4HIJA 4KRPD 3CSBA 2NXZD 3O2VL 3CFDB 4MLIA 3VRIB 3V0WL 1KULA 3IFNH 2JCCE 4NO0A 4YHIB 2NY3C 5CILL 2IPUG 4GW4B 3TBWB 2AKRB 4XPAH 1D5ZB 3WUZA 2W9LA 2APVA 3QEUB 5E5MA 5EC2B 5BQ7B 3BKYH 3OXSB 2HLAA 4ZD3L 1LK2A 3UTQB 1R3LB 3CLFL 4OZHB 1JK8A 1IGIH 5E8NB 2WANA 4BFGA 1YN7B 4JZNB 4FTVE 3HC3L 3SBWC 1DLFH 1MHPH 1D5XB 2OZ4L 5D1XA 1C08A 3LY6A 4G8EA 5IB3B 5FUOL 1ZGLB 1UWEL 4M6AA 4MXWL 4BSJA 1FNSL 3KPQA 3O9WD 4OV5B 1A3QA 2VXTH 2W9DH 4UDUA 2NY2C 4HC1H 2VLLA 5JQ6L 5DD1L 1E4XL 3L1OH 1I7RB 4JO4L 2V5YA 4MB5A 5DGQA 3HI5H 1KJ2H 3LKQB 4ONGH 3ZDYF 2HKFL 4ISVB 3V4VL 1ZAGA 3MZGB 4XP9L 5D2NE 4G42B 1CDHA 4LLDA 4R90L 1EEZA 2R29L 4XTRD 1P1ZA 4G9DB 4E9LA 2E5EA 3MYJB 5GXBB 4KMLB 3MA7B 1MCIA 5TJWK 1B88A 2R56L 1Y18B 1FNFA 3DMMB 1OD9A 3MUZ1 5EBLB 1I7UA 4NWTL 1UT9A 4XP4L 4PJ7A 3L5WB 3HE6D 2VZ1A 2BNUB 3TT1H 1QBBA 3SE4A 4UNVA 2DQEH 2PUQT 1O0VA 2DJSA 4KRPC 4CMHC 1NC2A 3BDXA 5J6GA 3ARBC 2K1MA 4OD3L 1ZHBB 3KPOB 4F9PA 4U0QB 1AGEA 3IDXH 4XXCA 4JY4B 1N6UA 2P5EA 1NDGA 1YYLH 2EDEA 2LAGB 5BZDA 5ITFB 2VDLL 3D1MC 2X09A 3P9LA 4JKPL 5DEGA 5EZOH 4LBEA 2R39A 1QFWI 4HCRH 3W9EA 2HTKC 1RZFL 5IOPA 4RMQA 4NGHH 4G7YL 5IHLB 1KPVA 2QQQA 1WTGT 2YOCA 4PJAF 3S97C 2FX8L 1F4YL 4WHCA 4FQCH 4IDJL 1FZKA 1CFQB 3EUUA 5KSBB 1AC0A 1V5JA 4LSQL 3OKEA 4HF5H 3BJLA 1KPRB 4IRSD 1LEGB 1PFCA 1V3LA 2GT9B 1FORH 4K7PY 3L3IB 4XNYH 4PJFF 3E0GA 1A1OA 3HG1A 4KZEH 3IDNB 3D39A 3EDJA 5EU7C 1FCGA 2XPGB 1BLNB 3X13A 2SEBB 4MS8D 3JBG7 1IGYA 5DC9B 2W0KA 5GS0H 5TE4L 3RVTD 2OI9B 2Y4SA 1LP9A 3BP4A 4UOW1 3F58H 1LD9A 1I8KB 3AU1B 1NFIA 1MCBA 1TVHB 5ISZE 1SYSB 1DBKL 1ODAA 3NCCB 1MFNA 2LU4A 4Z7VF 3O6KH 4OLXH 4CVXB 5B8CA 5DA4A 1S7SA 2OTUA 1KOAA 4IMLA 2XQYK 4TQEL 3HE6C 3BN9C 4WUUB 5GZNC 4YHNB 4OZIB 1A6PA 1ZS8B 4WNQA 4AMKL 2IGFL 3KLAB 4P2OD 4OLYL 1BGXH 4YHZL 1N0LA 4GLRH 4PY8J 5ACLA 1XIWA 2F54A 1QBML 4M5YL 4RGND 5KSAB 2P44B 2V2TA 1U58B 4RFOH 3C6SA 1XCTA 3W2DL 3TBYB 4G43B 1QBLH 1T3FA 4OZFB 4HXBL 1JHTB 1LO5B 1BFVH 4HXAH 4WEBH 4HUUA 5DRXA 4X99B 3X3GL 1Z9MA 1MLCB 4G5ZL 3FB6B 5HHXL 4DGYL 1OAXL 5TF1L 1BHGA 3T0EA 3VXQA 1RZIA 1R24A 2DI7A 5I71B 2VDML 2GTWA 3IAPA 4OFPA 4KY1L 1B6UA 1MCKA 1EO5A 3VXTA 3LS5L 4JHBA 2RIKA 2IFGA 1N6QH 2X7LB 4JR9H 1I3RA 3VA6A 4PJBB 5KS9A 1U6AH 2R4RL 4FQXB 2VLMD 3TVMB 3UPRB 2MNUA 3U46B 2FB4L 3MR9A 3OKLB 1SBBA 2Y6SC 3HLAA 3UBXI 1NUNB 2YPVL 1MAJA 1YEHL 3RGVB 3OX8A 4M43H 1RZ7H 1U3HD 3CXDL 5FHBL 1DCLA 3VFGH 1J8HE 3SGEH 4NBZB 3FQXB 3TZVB 1N64L 4UIKH 2Q87A 5C09A 3O6FA 5HPMA 4NKMB 3NFSL 5F7LB 2HFGH 1TLKA 1CL7L 5TQ2L 1M05B 5K9QI 3DI3B 3EGSB 3BRGC 3EZJB 5EU4A 3RL1A 5J89A 1FG2A 3HPLA 2M26A 1T1WA 5JW5A 3QEQA 1CD1B 3AREB 1L6ZA 4U1GB 2IH1B 5JW4M 4U1SB 1IL1B 2GK2A 5E4EC 3D25B 3SE3A 2BOCB 2GI7A 5CEYA 1JPGB 1AGBB 4JM2C 2A6IB 3AM8C 4D3CL 3P73B 3TCXA 3ZKQD 1BOGA 3RX5A 5L0QB 4NC0B 1BFOB 2NY4D 5TF0A 1VFOA 1AQDA 3TN0C 5D72L 5JXEA 3DBXB 1S9WB 2HJLA 4U6TA 4UNUA 1EJ6A 4LVOB 5E2TL 2Z31A 4LARL 4G7VL 2B7DT 3QB7C 3QNZA 3TH3T 4Y5YA 3CIQA 2VR4A 4D0BB 4OFDA 4L8SA 1U8IB 3Q6GH 1AGCB 5T3XL 3IFLH 4RZCA 4C83A 1QSEB 1FZOB 5FO8B 5LXGL 5AWNH 4PLKC 4MQXD 4JZJC 1UWGL 2Y72A 1I9RH 2JE8A 5E6IC 1CICB 2VZSA 1QVOB 4IIQB 5KW9H 3SJVB 4MJIB 5EN2B 4DW2L 3NIFF 3PNWA 1KELH 4YFLI 4P2QB 5EIIA 5F1IB 2YUZA 1NBVL 1HI6B 3BUYB 1FNGB 1G7QA 1RPQA 3STZA 3VD9A 3QWQB 1KF9B 1U3HC 2VO5A 1RZ8A 3HUJF 4XZUB 1UXSB 4KVCH 1SMOA 5BW7C 1G7JA 5GS2D 4Y1AD 2R2HB 4KRLB 4Q97A 4K23H 3RY4A 4UQ2B 5I8CB 2BSSB 4Y19A 3MNWB 2NXYD 4O02L 3RWGA 4PRHD 1HQRB 3QG7H 4QOKE 3RTQC 2J5LB 3D39D 3G08A 1NLDL 3GRWL 3FO9A 2J4WH 3S37L 1Q9WA 4P57B 4N0FA 4MDJA 1S7VB 1GOGA 5C9JB 4RGNE 3WNNA 4QRRB 4NNPH 1Q0YL 3U30B 4UDTB 1NEUA 2NQCA 1QSZA 3BD4A 3IETB 1NGYB 1MOEA 1SBSL 4ETQB 3EW3B 3QFJB 3RDTC 4TUKL 2XFXA 3BDYH 3RRQA 5F96L 4YDVB 4BFIB 3ULUF 3W0WE 4HLZG 1RFDL 3MJ9H 2FECL 4N0YH 1BIIB 2NY4C 3T1FB 4LPTA 3FO0L 4Y5XB 1JYWA 4F7CB 3TBVA 2VH5H 4Z76B 3G6AA 2F54D 4BQ9A 3SO3C 3HNTH 4K3HA 1CFSB 4RMWA 4ODXB 3T0BA 3VI3E 2DIBA 2ORBH 1XAUA 1U8LB 4EN3C 3E3QC 3DRTA 2DJUA 5D7JC 2VLME 2ZUQB 1FFNA 3RUGE 2NLJA 2IBZY 3DV6B 3VGAB 5ESVA 1UJ3B 4O51A 1MAKA 1YN6B 1FBIH 2EZ0C 2P45B 3ZDXF 2NY1D 1KEMH 1P2CA 5GSVB 1G7IA 1FAKT 1RULH 3RWFA 3VU2A 4OSUL 1FPTL 4NHCH 1WBZA 4NZJA 2PXYD 3BP5A 4GQ9L 3MPCA 3N0PB 2P8PA 1S9YA 1TJGH 2EYRA 2ZPKL 3TFKD 2QADB 3T77B 3BHBB 3KDMB 1FO0H 1IM9B 3BEVA 1SEQH 4HK0B 3PDGA 3WUWA 1BOYA 5L2KA 3C6LC 1A7RH 3FB8B 4JJHA 5SV4A 4I3GA 4O2FA 1RUQL 3O6ML 3TIDB 4PYHA 3EAKA 1MHCB 4DFIA 5EOCH 1O7SA 5HYJA 1F6AB 3GMNB 3G5VB 3HFML 3UX9B 2BHUA 5C09D 1I8LA 3S4SG 1MI5B 5J12B 2DTML 2DYPD 3MLVH 1UFUA 5DMIL 3O45B 1A6TA 3DGGA 3AY4C 1N0XH 2PYEA 4MJ5B 4TVPD 3UYRL 2WBJC 2ICES 3SOBH 1OAYH 2E27L 3QEQD 4M8QA 3QIUC 1HHIB 4PG2A 3NACH 3J8F7 5L2JB 1URLA 4WWKD 3NCJL 3BUTA 2JJVA 3D0VB 3FT3B 5I73B 2ZJSL 1N8ZA 5EU3A 4LP5A 3FRUB 3MYZA 5C0AA 4FOMA 3T0WA 1A0QH 4XH2B 5JXED 3FO2A 3SCMA 1T20B 3Q1SL 2HYMA 3QI9D 1QLRB 3LD8C 5D93C 2GHWB 3MBED 5IJVB 4CU8A 3DSNA 4X6CE 2W65B 4X7FC 3U1SH 4YFDB 1MAML 4OD2A 5C2BH 1Q72L 3CFBA 2PXYC 1J05B 5GQBA 4XBEL 2J6EH 5IB1B 4YE4L 3UAJC 4Y1AE 1R5IA 5D2LA 2CGRL 5E00B 2VITA 4KPHH 3LH2L 4LLUA 5JOFA 4H1LB 2CJUH 3ULSA 3CAFA 4PRHE 1CGYA 1RZKL 1JBJA 3D39E 2IPKA 1FIGH 3IB4A 3U36B 3WV0A 3DVNB 1J1XH 4AL8L 4LSDA 4TULL 4LQ1A 3BKJH 4JFPB 1YMMA 4OT1H 3QO1B 2WSKA 2CO7B 3GKWL 2EDDA 1JNHA 1OT2A 3VFNB 1JNNL 4QGYA 1JGDB 3EZ8A 4YAQA 2QHRH 1U92A 3S36H 3PWPA 1DTUA 1OF2A 5FUZL 3Q5OA 3WXVL 4M7LT 4YGVA 1KIRB 2BSRB 4PGEB 5CJXA 5KVDH 3VFPA 2WUCH 3KYMA 1ADQH 5IROC 2G9HA 3I3EA 3BIBX 3ET9F 2F54E 3KYNB 5EOTB 5GGSY 2J3SA 4L3AA 4DEPB 4HIIA 3BIAX 3KPSE 1AKJB 3TJHD 1YPZA 5TE7H 3U0PB 3IFOA 1LE9B 1X5KA 3L3JA 5GRVL 5E24E 1WFOA 5DVMA 1I7TB 3JUZA 5T1MB 3BH9B 1NGPH 3QRGL 3NA4A 5C2UB 3QA3B 1PY4A 5DVNA 4ZDHB 5ACMA 3WYRA 5CAYB 1T7WA 5DJYA 2GY5A 2Z93A 3ESVF 3L3DB 4QTHB 4R3SB 1CLOL 5MP6L 5I75C 1C5BL 4DCQA 2N1KA 3U9UA 5E8OA 5D71H 3T3MF 4JQVC 2IFFH 3MBEC 5GS0C 4MCZA 3ARTA 4ODHH 2YKLL 4MNGA 1EERB 1AXSB 5EUKB 5FGCB 3TYFB 4KHXH 2LTQC 1LK3H 3SDXA 4FA8A 3CPLB 4WFHE 1EEUA 4EI5D 5J1TC 1JGVL 3HMWH 2QQKH 3D85D 3X14A 4P2YA 4PGZA 3LKNB 4TUOB 4X6FB 4NKIH 1HKLL 2AABL 2EIZB 4G6JH 4N8VG 4L3EB 3WIHA 3PGCB 1GAFH 1RJZA 2A6JA 2CPCA 2XACC 2YMXL 3TBSA 5HYIA 3VFSB 3UTSB 4TVPE 5E2UL 3MOAH 4PREB 4O9HL 3QEQE 2AK4A 2FX9H 4X5WB 3MROA 5HSFA 4HFWA 4WJ5B 5B39B 5I1EL 1B0RB 5EBMB 1F4WL 4FQJH 4WI8A 4Z7UE 1I9JL 1BBJA 3UYPA 1IJ9A 3AB0B 2AJXH 3DROB 2WIIA 3Q6FB 2HWZL 2PKDA 1HSBB 2GTZB 1KLGA 4P46D 2PYED 4I48B 2HP4A 2H8PB 3QXAA 3HCVB 4WEUD 1BVLB 3D3VB 5CMAB 1NAMH 2E3VA 2D9CA 4KTDH 4X9GA 5JPNA 4U1IA 1CLYH 1MFDL 3HC4L 2V5TA 1TZIA 1I85C 4I0PB 4J1UA 5DYOA 4ZG1A 1I1YB 2H2PC 43C9B 4URTB 1ZVSA 4JPVL 1INDH 2CLVA 3VGGA 1ZLSL 1CXHA 2EKSA 1T6WA 1YNLH 3MO1A 5C0AD 2V6HA 1J18A 2K9UA 3ALXA 4ZPTB 2VLKA 3VWJC 3WO4B 1P84K 3GSQB 1D6EA 3SCMD 3KLSA 3QQNA 1INEL 2EDNA 4X8JA 4HK3J 1FH5H 1F8TH 3RU8L 3SKOB 1ZGLM 2HN7A 2YPLD 2XQBH 3WO3B 1U8MA 4GKNA 5ECJE 4EI5C 1ZWIA 2FHCA 3PL6A 5GPRA 4GRLB 3TO4B 1ZVYA 4I2XA 3X12A 3JV0A 3QCTH 5HDQL 1UZ8A 2EIDA 3MV8D 3QZWA 1GGYA 4UTBH 3GI9H 4DJMA 4H20H 2WNGA 2ICWB 2NY0D 1Q0XH 5MERB 3MJ7B 1K8DA 1F6FB 1YMMD 4UZGA 4UINH 4HJGB 1MF2H 2NW2B 5JPMB 3L5HA 3O3AA 1S7XA 1T89A 3HZKB 3CUPB 1FZMB 3ZT5A 4CDGC 3NMEA 2HFEB 1DQLL 2ERJB 3MRRB 3NFPA 5IK3A 2I9TA 1MRDH 4Y4HB 1I1AB 4OFYD 5D7IE 1UH2A 4LPVA 1U8HA 4OCLC 3AXLA 1NMAH 3QDME 3JWOH 2X4PA 5IKCB 4M9OA 2B0SH 5BO1L 5J56B 2VDPL 4P46C 2IADB 2FYYA 1XEDA 2D0GA 1T03H 2E8YA 1BVKB 3SGDH 4JHWL 4PLOB 3GI8L 2GUOB 1SJXA 5J9PA 4D0CB 4U7SA 5EC1A 4O5LH 4D9LL 2WLZA 1M7IB 1NGZA 3HI1A 3S98A 5IHZA 1HQ4A 2O5ZL 3ARDB 4KROB 5J11B 1FVEA 4UU9B 2C26A 2ATPB 3WN5C 1WZMA 2J8UE 1U93A 5TFSH 1WEJH 5T33H 5JLZB 1ZTXH 1GIGL 5I1KH 1CLCA 3NAAL 3T0AA 1VFAA 3MLRH 5IFJB 4PJEF 1OAQL 4L9LB 1JV5B 5KVEL 3EYQD 2R69L 4A6YL 5IFHH 1NCDH 3VDCA 3PXJA 2ZWLT 1DN0A 5DDHB 1AR1D 4DVBB 3MRLB 2JELL 4HAGA 3TCLA 3FONB 5IVZA 2P8MA 4KDTA 4RGMB 3MODH 3BE1L 1N4XL 4OCNC 2MOVA 3ILQD 3DVGA 5FO9B 1G6VK 3VW3H 1RVFL 4NBYB 4PJIF 4QXTB 5HHVL 1F90L 2NY0C 4TNVK 3BP6A 5CJOL 3WMSA 1DLHB 3BT2L 3JTSB 4OI7A 1TNNA 1Z2KA 3H3BC 3PHQB 2JIXB 5I1CL 1SEBA 2OP4L 3RJDA 3JV4A 5J7CC 2PCPA 3AFLA 2PYEE 2W0LA 3NIGF 4IS6B 1GZQA 4Y4FD 1BF8A 1WCQA 1KCSL 2AJYH 4KVNL 3BZDA 4G6MH 4J4PD 4CMMA 2AK4D 2A6DB 4NM4H 3VFMA 4JFDB 3TJEH 3I6GB 3SKNA 1IQWL 3MOBL 3B9DA 3B2VL 4OJFL 1K6QL 4L4VD 3MLTA 2ZG3A 5I0ZA 4BFEA 3H3PH 3RPIB 1NFDE 1NANH 2DLTA 3OKNA 3WLBA 8FABB 3MQIA 3B6SA 5DMJB 5T1LA 4AEIH 4MA3B 2FWOB 1NEZA 4MD5B 5HHOB 3PWNA 3HZVA 4IRJD 4M62L 1R5VB 1CBVH 2YRLA 4PJXA 2CUMA 4LU5L 5JMOC 2XG4A 4XHQA 4DOHB 2PNDA 2YPLE 4OZGA 4FFZH 4JG1L 4LMQI 4YXKH 1BECA 2GKIA 3QPQD 3UP1A 2GIYA 5D5ME 3KR3L 5C0GA 4MD0B 1VKXB 5ALCL 2FLBT 2VLKD 4MAUH 5F9DC 4LLMB 1IGCL 3MV8E 4WHTB 1CZ8H 4YBHA 4BH8B 5GRUH 3N9GH 3T2OA 3BPCA 5ANMA 2APWA 3IFPA 1NGXB 3K8LA 4Z18A 5BVJB 3UBXB 5D1ZD 3VXMD 1ZOXA 3ARGA 5HYQA 1X5IA 3PIQA 2C4FU 4RIRB 3HMXA 1KCRL 5DJ8A 3FRPA 3BSZH 4LGPB 1NPUA 4HEPG 3MV7A 1GRWA 5HI3D 1UM6H 2D3VA 5EUOB 4RFEB 1IM3A 3MGAA 4PP2B 2X1OA 4CVZA 1MJ7H 1MIEL 12E8L 3MLWL 4GS7B 1CGWA 1JHKL 1N2RA 4XVTH 4E41B 2BNQD 3KPTA 1QRNB 3WXWH 3S5LA 3BKCH 4NKDB 1D9KC 3EOTL 1ZEAL 4J4PC 2HVJB 1CXKA 2AAVA 2Y36H 5J6HA 4XNMA 2AV1B 2UY6A 2UZIH 1NCCH 1CFTA 2JJWA 4NQDA 2X1PA 5EO1B 5C07A 5KTEH 2XN9A 2NX5B 2VABA 1P4BL 4V1DB 1DL7H 4TOYL 5GRXG 3ES6A 5D1QB 4LSRL 2D7MA 3QFDA 1MFEH 3GMPA 3EYSL 5DJAA 3ULUL 1BBDH 4C59B 3RWEA 1IAIL 4N0CC 1QBAA 4Z7WA 3HN3A 2HJKB 5ID1A 2ICWJ 3RY6C 1E28A 3NN8B 2F53A 4YEEA 1XH3B 5ILTL 1P9MC 1RHHA 3WFBH 1H8OA 1N5YH 5KVMC 2OJZH 3QQ4A 4Z7NE 5E95B 1I9EA 2A77H 3QIBA 1CE1L 1QFPA 3H8NA 3V5DA 4QHMB 5D7SL 5IBLC 4C54A 3V52L 3ARFA 1LO4L 1SY6A 2FSEB 4GJTB 3PP3H 4QXUL 2DIAA 2C1PA 2OLDA 2IPTL 2R4SH 5L9DH 2P46B 1U8QB 5HDBF 4OFVA 4YQXH 3KJ4B 1FRGL 3T4AB 2BNRA 1LEIA 1MCJA 1A6ZA 3SDDB 1D5MB 3CFJA 4W6XB 5E2JA 3DX6B 4MAYA 5E5UB 3N85L 2CIIB 5F8QC 3ZDZF 3FB7B 5E94A 4RCAA 5IV2A 2JF1A 4JB9L 4ONOA 4N90D 4WI5A 1NLBL 4WW2A 4L4VE 5DJ0B 1FFOB 3WFZA 5IMMB 3MRBB 5IQ7L 2DBJA 2V17L 2DQIH 3EFDL 1RZGA 4Y2DC 4NQEA 2AI0L 1KN4L 4J3VA 3DXAD 3GMRA 4OD1L 5HHMB 2APFA 1EUUA 4LCIL 2IQAA 1DEEA 2BVYA 4OLUL 4R4ND 5F1NA 4PJ7F 3VFUB 3CDCA 3BJ91 3P4OA 5HHQA 1SYVA 3WS3A 4DTGH 4NHUA 4OM0H 5IEHB 1OQOA 4RAUB 5JHDD 4ENED 1FNHA 1S5HA 4HKXB 1OB1B 5GGQL 2IANB 1C1EH 5IBUB 1CLZH 1FE8L 3MRKB 4MVBC 4YHOL 4S1DD 4GMTH 4XPTL 5T1LD 5LCVH 1V7NH 3F12A 2C1OA 1OTSD 4WI3A 4ZFOL 2C3GA 2GQHA 5KANG 3QAZB 4XMPL 3BO8A 3T2NH 2R0LL 3OKOA 1Y0LB 2BOBA 3P4LA 3HAEB 5KN5B 1I4FB 3DV4A 4K7FA 5TE6H 3VFVA 4KUZH 4MXVE 5FA4B 3VXME 5FEBA 2A9NL 3ZSSA 2Y9RT 4NO5A 2C7UB 5E8EB 1MRFH 1YNKH 3IDGB 4OUUB 5ACZB 4R4BA 3VJ6B 4IRZL 4P5MB 1T0NA 3QUYA 1M7DB 2AEQH 5IB2A 4ODUA 3CFKB 2KBGA 4I2XE 5JMRA 3OTTA 3CFDA 3VRIA 4TSBH 3B83A 1EZVY 4YHIA 4ZFOB 4GW4A 2BNQE 3TBWA 2AKRA 1HYSC 4LSTL 3OJ2C 1D5ZA 3MNVB 2NY6C 4PG9B 1CN4A 2IC2A 1TQBC 5FYJD 3QEUA 5IW3A 4YHLH 5EC2A 4UOW0 5BQ7A 3S7GA 3O2WL 1FLRL 3UTQA 4AG4H 1R3LA 4IBLT 4OZHA 1LP9F 3QCUH 2YR3A 5HI5D 3MXVH 5E8NA 1EFXD 3REWB 1G9EA 1YN7A 4I5BB 2DQTH 4JZNA 1U2HA 4R2GC 5JXAH 3EO0B 2EH8H 1LILA 1D5XA 1ZVHA 5K9JH 1S7TB 4UAOC 1VACB 1NCBL 4AQOA 2HG5B 4RMTA 5IB3A 1ZGLA 3ECBB 3QUXB 4H26B 4PJCB 4OV5A 4RAHA 3VGBA 4ZODA 3I75B 2GEEA 5HGHB 4MYWB 4J2XA 3GGWB 1IC4H 3NABL 1I7RA 4ELKB 1L7IH 3TPKA 5EBWB 3SGKC 3LKQA 4ISVA 4G42A 4E42B 1AO7B 2AEWA 4FQIH 3LIZL 4S1DC 4FQQB 4FXLA 3IJHB 2ZOKB 5D9SB 3RKPA 2DMBA 4G9DA 3FOMB 3MYJA 2HTLC 3WJLC 2CLZB 5C08D 3MA7A 1HHHB 1Y18A 4H25B 3DMMA 4WUKH 5EBLA 4GXVH 5BJTB 4XP6H 1QLFB 3L5WA 1W2KT 3MLPA 2DI8A 1G7PB 2VC2H 3ZTNL 1EMTH 5F7NC 2WBKA 4P23D 3I50L 4JE4B 2BNUA 5K9OB 3MV9D 4RDQF 5KS9F 3D2UB 2CXGA 2CDEB 1D7FA 4LGSB 3JVGC 3QIBD 3SKJH 5BMFL 3BAEH 3CDYA 1ZHBA 5LG1A 3VFWB 3JWOC 5CEXB 3KPOA 1X7QB 4JY4A 4UTAH 5KANI 4N90E 1CDCA 5F7FA 2BY1A 2RR3A 5ITFA 1EBAA 4JQXA 5DVKA 4U1MB 1YEKL 3C8KB 4U1KB 3DXAE 3LOWA 3GK8H 3G9AB 4OLVL 1HWGB 2CK2A 2JCCB 3IRZA 4YDLC 5H94B 5SWSE 1CFQA 2XXCB 5KSBA 1G84A 2VN7A 1ITCA 5JHDE 3WD5L 3BYTA 4NQXB 4X6DE 2N56A 3R8BB 1KPRA 1WSST 2CXKA 1LEGA 4TTGA 2GT9A 2CDGB 2RCSL 3L3IA 3AUVA 2E6PA 2IH3B 5HVHC 1KSRA 4LSPH 3IDNA 1I3UA 4FTVB 4GLRI 5GGRB 2XPGA 1BLNA 2F8OA 4XX1G 2SEBA 1VHPA 4HJ0C 1NL0H 1TDQA 3MLUH 3RAJL 4PGDB 1MQ8A 4YK4B 5GISL 3WFEL 1I8KA 3AU1A 4POZC 5JUEL 1DQQB 4FFVC 3F7PC 1JRHL 1TVHA 1H3PH 1SYSA 4CVXA 1X5LA 3CSYB 5D2NB 1FGNH 3X17A 4Z8FH 3BN3B 4WUUA 4YHNA 4OZIA 5ANME 2HMID 1ZS8A 4GO6B 5FYKU 3KLAA 1T83C 1ORSA 3P30H 5KSAA 4K8RH 4ODVL 1QFUL 1U58A 3VXUD 1TZHB 3EYVB 1A4KB 2X89D 4KTEH 1U36A 3U4AA 3TBYA 1L9MA 1JGEB 4G43A 3NBNA 1AH1A 4OZFA 1D5IL 3QUYD 1JHTA 1LO5A 2GW5A 3WLWC 1KNOB 4QRQB 3PGFH 2B5IB 3TA3D 4X99A 5DUML 1MLCA 5DD6B 3FB6A 2RBLA 4UNTA 3KVQA 1I8IB 4LLVB 1YA5A 1A6UH 3SGEI 1RUPL 5JW3H 5FOJA 3BISA 4YX2H 4HDIB 4PFEA 2X7LA 4HG4K 4XI5D 4PJBA 4NBXB 4FQXA 4DWHA 1F3JB 4LAJH 4MNHB 3TVMA 1RIHL 3UPRA 2EH7H 4N8PA 1K2DB 4YHKL 2R9HC 3OKLA 3U46A 5DRWB 3VFTB 3C2AL 2FJHB 3RGVA 5HYFA 3K80A 4Q6IC 2NY5H 4XP5L 3DPBA 2CDFB 2NY2B 4FQ2L 3VD5A 5C08E 4NWUL 2E9IA 2MHAB 4ODSL 1IT9L 4Z7WE 2OK0L 3FQXA 2OQJB 3R0MA 3TZVA 4BSWB 2VXVL 2FD6L 4NKMA 1KB5L 3QEGH 4U2YA 4EUPG 2ZCKL 1G1YA 3RX7A 3G6DL 1A6WH 2UV3A 1JZ5A 1M05A 4U33A 4XMLL 3BVNB 4K3JH 4K55A 3OB0K 5CJQL 3EGSA 5F7EH 3MV9E 2AJVL 2BHZA 1JYVA 4A2LA 1DDHB 2ENSA 1CD1A 3AREA 2NZ9D 4M3JA 2IH1A 1WZKA 5C1MB 3GIZH 4OLZL 4U1SA 1IL1A 3D25A 3ESUF 3OAYK 5C0FB 4NC1C 2BOCA 1JPGA 1AGBA 2A6IA 3WSQH 1A7QL 3MRJB 3P73A 4GAGH 1MUJB 3PGDB 3VWKC 1BFOA 4UV4H 2FO4B 5ISZB 2B1AL 4KRPB 4KMTL 2NXZB 4QF1B 4CMHB 5KSVB 3O3UN 4WTZA 4YGAB 3ARBB 1CVSC 4LRNL 3DBXA 5GJSH 4IMKA 4UT7H 1S9WA 3VMOA 5ADPL 5JA8B 2XQYG 3WS6C 3PF2A 1DE4B 3L6FB 4AEEA 5EU5B 1KLFA 1R3JB 4D0BA 1PEZA 4TTDC 3RVWD 1U8IA 1AGCA 3KAAA 1QSEA 1FZOA 3GSXB 5FO8A 2A9MH 1PZ5B 1DBAL 4LSVL 4WFED 3IDYC 1CICA 3VH8B 3CMOL 1QVOA 4IIQA 3UTZB 3SJVA 4MJIA 3F8UB 5EN2A 4Z7OF 3MRMB 3HPJB 5DWUH 4Y4KD 4P2QA 5F6HI 5F1IA 1OSPH 3BUYA 1FNGA 4NRZB 2VDOL 5GGVL 2WMPA 3FN0H 1JGLL 5D70H 4XZUA 3KPLB 1UXSA 3B8SA 5EZIH 5D4QA 1XMWA 2R2HA 4UQ2A 5I8CA 2BSSA 3SE4C 4M3KB 2GITB 3MNWA 4LLQB 3N1MC 1I9IH 1HQRA 2EYTB 2DBLL 2YWZA 4GUPB 1QNZH 4RGOH 1QFWM 3T0DA 3CX5J 4P57A 4RRPA 4DGVH 3BD5A 1S7VA 1ACYL 5C9JA 4QRRA 1J8HB 4AENB 3VXUE 4UDTA 1F5WA 3IETA 1NGYA 4ETQA 1C5CH 4HGKC 4OUOA 3QFJA 2E8ZA 2DD8H 3GSVB 2KL6A 3HE6B 4ZO7A 1BQHB 4UBDC 2AEIT 2IPUK 4YDVA 4BFIA 5LQBL 1KYOK 3MBXL 4ZFZB 4QRPD 4WUUD 1GHFL 1BIIA 3VCLB 2MJWA 3T1FA 5E8DL 4Y5XA 5D2LF 4F7CA 3KPRD 3MUJA 4Z76A 4IHOB 3ZLQC 1CDBA 3GRWA 1H0DB 2ZOLB 1CFSA 5IHUL 1JPTH 1OGAD 3WKML 2A0LD 4ODXA 3ETBF 1OTTC 1U8LA 4L4JA 5C7XL 2EDLA 4ZUWB 3DV6A 5DC0A 5A3IC 1UJ3A 3L9RB 1F45A 1KCVL 1YN6A 4LASL 3IF1B 3OGOE 1TZGH 4ODTH 5GSVA 5GRYA 4KJWD 3C8DA 3BGFC 2OR9L 4ALAH 4Y4KC 1FYHB 1KXVC 4KKBC 2DQDH 4FQXD 4R97C 2WV3A 3OJVC 4TPRH 4IRSB 1KENH 1JPSH 3T77A 5B8CC 3BHBA 3KDMA 3S37X 1IM9A 4NQSB 4HK0A 1YPZF 1YUHB 1AD0B 4RAVB 1P4LB 2E7LA 4OLWL 1XIWC 3FB8A 4P4KC 3CDGB 5DO2D 4NT6B 1ZT1B 2IG2L 3TIDA 1MJ8L 3MX0A 1EJOH 3QBTB 1MHCA 3WIHH 1F6AA 3GMNA 3G5VA 2XICA 3ULVH 4KK6D 4OCYL 1QO3B 1MI5A 2NNAB 1MREH 2VUOA 2VUYA 5TQ0H 3H9SE 3O45A 4QOKB 4MJ5A 4PB0L 2V9TA 4U7MA 4DFHA 4JVUA 1IEBB 5E4EB 3VE0B 3ARED 4J3XA 4RGNB 4FZEH 5L2JA 4TSAH 4Z7NF 2J8OA 5SWQB 3QDJD 3SDXF 5DRZB 3D0VA 4HQQH 4HIXH 3FT3A 3TN0B 2A0LC 3KJ6L 3ZE0E 4HBCL 3FRUA 4F8TA 3W0WB 4BFBD 4XH2A 2GAZB 1T20A 2AQ3A 2D9QB 2R0KL 3DSFH 1QLRA 4M93C 3LQMA 5IJVA 5BV7L 2BDNH 5KSBE 2W65A 5E03A 4YXHL 2MPAL 2QQNL 5I1JL 4JGMA 4KJWC 4GKZB 1A7OL 1HZHL 1MFAH 4Q2ZB 1W8NA 1MHEB 4JZJB 1J05A 3QT2A 1F11B 1YEGH 1RU9H 1GGIL 5E6IB 5IB1A 4JG0L 5CIPB 3RUGB 4WU7B 3P0VH 5E00A 2Y5TB 5ICZB 3JSSA 1YEJH 1CICD 3K2MC 3O2DA 4N9GB 4H1LA 1UEMA 4MJ6B 4KK8C 3SJVD 1HOCB 3HNSH 4OFIA 4WTXA 4XPFH 3U36A 2FL5B 3B43A 3DVNA 4P2QD 2X2YA 1ROWA 5BOZG 5L8JB 1U3HB 4OF5A 1WWBX 4ZTPL 4K8RD 2AK1H 2Q7YB 3QO1A 1F4AA 5BV7B 4HMCA 1WIOA 3VFNA 1JGDA 2OSLB 3RTQB 2R0WL 4XC1L 1CGVA 2VAJA 5T5NF 4DAGH 3OB0H 1DSFH 1KIRA 4G80B 4QRPE 4WUUE 4PGEA 1OM3L 3MRDB 1XF2B 4R8WL 3KPRE 4YWGH 1FJ1B 2EDXA 3A6OA 3KYNA 5D8JH 5EOTA 1A7PL 1U3JA 4L8SC 1AKJA 3OAYH 1OGAE 1LE9A 3RDTB 3U0PA 1IAIM 2AJZB 5HYSG 4MSWB 1VA9A 5I8KL 3QFJD 1I7TA 3V8OA 1NMCB 3MJGX 4PLJC 5T1MA 3ZE1F 2DLEA 4HWBA 3BH9A 1TNMA 2NY4B 1NC4D 2APBA 3QA3A 4ZDHA 3UDWC 1KT2B 3SO3B 2EIBA 3L3DA 4QTHA 4R3SA 1SJEB 2R2BB 4G3YL 3ROLB 5A2FA 3FB5B 1MEXL 4G9FE 4RA0C 5IVXB 4EN3B 5D7JB 1PG7W 1MCWW 1Q9LB 1KC5H 2DQHL 3WFDH 1BFSA 1AXSA 2OS7A 2HKHH 3D87B 1T2JA 3THML 4X8XA 3QDGE 5DC4B 5EUKA 3RIFF 2BC4B 3TYFA 2FR4B 4DKEL 1WUNT 4KFZC 5ITBL 3CPLA 5DD0H 4K2UL 5CP7B 4X6CB 3NIDF 1PX3A 1A3LL 5E99H 4K07A 5I8OH 3LKNA 3KYKH 4TUOA 3HC0B 1CXEA 4K8RC 4YEFA 4X6FA 4Y1AB 3C6LB 5AZEL 2EIZA 4X9HA 5KAQF 4KC3B 4L3EA 5FDYA 1RUKH 1UXWB 3PGCA 3EJYD 4P99A 1FG9C 4PRHB 3VFSA 3UTSA 5D96C 1A7NL 2YA1A 1LE5B 4ZSOE 1HIMH 3DUSB 4PREA 3ELAT 4MA1C 4X5WA 4J8RB 1WAAA 4HC1L 4NSKB 2BY0A 5DLML 4WJ5A 4AM0B 5B39A 3I6KB 1B0RA 5EBMA 3FAWA 3QJHB 4JFZH 3GMOB 3QDJE 2O5YL 1MI5D 3QPXH 3DROA 1CDGA 3Q6FA 1B0GB 1HSBA 2GTZA 2P42B 2WBJB 1XF5B 4I48A 1E6JL 4PR5B 2H8PA 4L1DA 3HCVA 3UJTL 3QIUB 4PS4L 2PYFB 5J4MA 1BVLA 3D3VA 4TNWF 3EDKA 2D03L 5CMAA 3UTOA 5JZ7C 3CVHH 2UY7A 2NYYD 2Y7QB 3KPSB 3BKMH 2NY5C 4ZUVB 4I0PA 1I1YA 43C9A 1FGVL 2V5MA 4OKVB 3KPNB 4ORGB 4KK9C 1J88A 5BS0D 1EA9C 5ABDE 2ED7A 4NZTH 3M8OH 4ZPTA 3NTCH 3GSQA 3LD8B 5D93B 2VXUL 3JWDL 2DQCH 5IWLC 4I3RH 3WIFB 4ZUUB 1RZJH 2XZCL 4MNQD 2HAZA 3SKOA 2QSCL 2PXYB 3B9KC 1YEFH 4XC3H 4JKWA 1I8LC 2F5AL 5FYJU 1MFBL 3GJFA 1WIPA 4MWFB 5AEAA 3ZKMD 4M1DH 4OCSH 5F70A 4GRLA 3TO4A 4OLEA 4Z7QF 4TVPL 4LHUB 2W9EL 3G04B 2RJMA 3HMXH 4KAQH 4CVUA 1DFBL 3U7YH 4LSUH 1PLGL 4G6AD 2ICWA 1KFAL 1PDKA 3HNVH 1BM3H 3G5ZB 5MERA 3MJ7A 3SGDI 3LS4L 4LHJB 1QKZH 5J0BA 2VZTA 1ZHLB 4HJGA 1RIVH 2NW2A 3AMLA 5JPMA 4L3CB 1RY7B 2JJSC 4Q74A 4PJXF 3FT2B 3HZKA 3CUPA 1FZMA 3REVB 1N7MH 2FBJH 3QFJE 2DYPB 4MA7H 2CUIA 2EE3A 1P7KB 2HFEA 2A83B 3MRRA 1AR2A 4U6HB 5IUSA 4OZGF 2L7JA 4Y4HA 3WJJC 1I1AA 4F57H 4XAWL 1HN1A 5IKCA 2V9QA 4OB5L 3B5TA 4ZOEA 2IADA 4G8GE 2H3NB 4GG8B 1TVBB 1MJUL 1U42A 1AKJD 4NKOB 3A6BH 4WWKB 1BVKA 4Z7UB 4JY6B 3LPGA 2GUOA 3QNXB 2NYYC 4D0CA 4KQ4H 4XCYB 1M7IA 4C56D 2HT3D 1AQKH 3ARDA 3GNMH 4OQTA 4PGBB 4UU9A 1Q8MA 3BEWB 3ZYJA 3BIKB 3QYCA 2ATPA 1XF3B 1AI1H 3UJIL 2ESVE 5L6YL 4KRMB 3QI9B 5JHLL 4LLYB 3PDOB 4XCNB 3MBEB 3OWEA 1QR4A 5JLZA 5C0DB 5EA0H 1WWAX 3AMKA 3CLEL 3M17B 3F7VB 5IFJA 6FABH 4OGYL 1NSNL 3ULVD 1XGUB 4L9LA 1JV5A 2IAMD 2B20A 3CK0L 4OAWB 5DDHA 4FS0A 3BDBA 5CKGA 3PWVB 4DVBA 3K46A 3MRLA 3V7MA 3MFFB 2PW2B 1J12A 3JWNC 5CJXC 4PJDE 3FONA 1EGJL 1ZMYA 1SY6H 1YEIL 1TVDA 2KZ1B 4WY7H 5FO9A 1QLEL 2DTSA 2WK2A 5HDOA 4QXTA 3PDDA 1NANI 3SDAC 3W5MA 3H6JA 1DLHA 4JY5L 5JW4Q 3JTSA 3TNMB 3V0VB 1F3DJ 3PHQA 2JIXA 4Y16C 1DBBL 2OMBA 3DETC 4Z7WF 5EU6D 3QR2A 5FYKL 4M6OH 1DR9A 4CN4A 2AVGA 5D7LD 3K2UH 4IS6A 3UTSD 4LSSL 2A1WH 3T65B 2AEPL 2A6DA 4JFDA 3ZKNC 4I1NB 4OGXL 2BJML 1YNTB 3I6GA 4OIAA 1IAOB 3L3HB 4P2CG 3LV3B 3EJZC 2XY1A 1U8OB 3AS0A 3RPIA 3QH3B 1F42A 1JGUH 4FNLH 3TT3H 5BS0E 4JCLA 8FABA 3EOBB 4P9HH 2D7TL 4YXLH 5M94B 3BWUC 3VGDA 5C0EB 1VPOH 4MA3A 2FWOA 4HK3N 4MD5A 5DQ9B 4I9WD 5HHOA 3FZUC 5D7IB 1P4IL 3QDMB 3D3VD 5CEZH 1A3RH 1R5VA 5KVGH 1UJTA 2CQVA 5DVLA 4F58H 3MLZL 4YHPB 5DT1L 4MNQE 4NJAL 3HRZB 1DQMH 5F7DB 4L4TD 4XB7A 1N59B 3MUGB 3BPOC 1G7LB 4KK5C 2CK0H 4JEGB 4X7EC 3WIIH 2ZCHL 4GRWE 4MD0A 1VKXA 1HINL 5DD3L 3ULVC 4K71C 1JWUB 4J23A 4LLMA 4WHTA 4WW2F 1UM4H 4BH8A 4M7JH 1BQSA 4PP1D 4FP8L 4M1CC 2J8UB 5BVJA 1NGXA 4XVJH 3UBXA 2BSTB 3F7RA 4EI5B 1IBGL 4OKDA 5EORH 5B22A 3HZMB 4RIRA 3RZWA 3D85B 4XCEB 2PO6C 2AJUL 2W38A 2VDRH 5DUPH 5DMGC 4X5LA 1I9RL 3VG0H 4LVHB 1CK0L 1Z3GH 1T04B 3OXRB 3LEVH 5EUOA 4RFEA 3LRHA 4LFHD 4PP2A 5HY9B 2YWYA 4KZDL 2QQLH 35C8H 1ERNA 4HT1L 4I77L 1IEAB 5T5FH 1AD9B 5J1SC 5LGHH 4E41A 4PY7B 1QRNA 1FSKB 1LO0H 5DJDA 5DXWA 5EIQA 4N8CH 4NKDA 4P9ML 4JRXE 1EHLL 5LKNA 3NCYP 2HVJA 4GBXD 2AV1A 4LDLB 3O2VH 5EO1A 3V0WH 2NX5A 4C56E 4PRDB 2KPNA 4V1DA 1HEZB 3VXSE 4Y4HD 5CILH 4P46B 5D1QA 4KQ3L 4PJ8C 2OR7A 1NCTA 4C57C 3RWHB 2H1PL 3DX9A 3QRFM 2XTJD 1E0OB 1RUAL 1MCNA 1L7TL 2Q3AA 2JJTA 1P6AB 4ZD3H 4NJ9L 2YD1A 4RDQG 5ELIA 1T2QL 2HJKA 3PL6C 3CLFH 1J1OH 3ULVE 1NFDB 2VR5A 5F9WC 3UTTE 3NN8A 1EHNA 4OCXL 1XH3A 3ARDD 2VXSL 1Y6MR 4NNXB 3HC3H 3WN5B 1MCRA 5FGCE 1NDMB 1RIUH 2OZ4H 2VH5L 5FUOH 1UWEH 5F3HB 1TJIL 4MXWH 1FNSH 4PJ9D 4OZHF 1A6VL 5DK3A 2IQ9L 4QHMA 5JQ6H 1NH6A 2VXQL 2YPLB 5DD1H 1E4XH 2FSEA 4JO4H 1F4HA 1ED3B 5D5MB 4DK6A 1TTUA 5FO7B 2HKFH 4Z5RB 3V4VH 1U8QA 4XP9H 3T4AA 4R90H 2CRMA 2R29H 3SDDA 5A40E 1D5MA 4G6FD 5EU6E 3MV8B 1OP3K 4I18C 4XB8A 5D7LE 5E9DD 1U3YA 3DX6A 5F89B 2VAAB 3AS2A 3MGTB 1CG9B 3FCTB 2R56H 2CIIA 5E70A 3X3FL 2NY0B 4NWTH 3FB7A 4XP4H 1EAPB 3V4PL 4R0LC 5DJ0A 1FFOA 5IMMA 3MRBA 3V7AG 4AEHL 2X4NB 2JIXD 4GBXC 1T2XA 3NZ8B