4XPAL

X-ray structure of drosophila dopamine transporter bound to 3,4dichlorophenethylamine
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
214
structure length
214
Chain Sequence
ENVLTQSPAIMSTSPGEKVTMTCRASSSVGSSYLHWYQQKSGASPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSVEAEDAATYYCQQFSGYPLTFGSGTKLEMKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transporter
publication title Neurotransmitter and psychostimulant recognition by the dopamine transporter.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transport protein/inhibitor
total genus 52
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2015-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xpaL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xpaL01
3OAYK 2CXGA 1KCRH 3T3MF 4UDUA 2A83B 1C7TA 5H94A 4PJDB 3WBDA 1CWVA 3H7BB 4MWFB 1J87A 3GIZL 5DUML 1TXKA 5EU6B 2D03H 1HKLH 1KJ3L 1G7LB 3NCBB 3NIDE 4Y5XC 3RAJH 3SCMC 1FL6A 3BD3A 3FQNB 5SWQB 4PJIE 4X4ME 3C5JB 5E2TL 2LVCA 4K9EC 1ED3B 1QSEA 1EGJH 4UOW1 5DJ6A 2CKBL 4WNQB 4O51A 1OARL 4HC1H 1T0NA 2HFTA 2W0LA 1LHZA 3RPIA 3KYNB 1TMCB 1QFWM 2AJZB 1YQVH 4K7FA 1K4CA 3V5HA 6FABL 4NRXB 1GL4B 4RFEA 2F8OA 3D69B 2GTWA 3KJ6L 1CGSH 1CL7I 4KH2A 3G04A 4QRRE 3TFKD 5E4IA 1AI1L 1MFEL 3QIWD 4NPYB 3OGOE 1ZMYA 1A6WH 3WL9B 1SJXA 2RB8A 4U0QB 4I0KA 5BS0D 3C6SB 4LGRB 4NCC2 2VO5A 4NKMB 2NXZB 3PWJA 4OCXL 2ID5A 5F9WB 1BD2E 2EE9A 2H1PH 4HXAL 5FEBA 3SGEH 4Y2DA 2X1PA 1U8IA 3LEYH 1X5KA 4JPVL 4RAHA 3F7QA 4HQQH 3FQXA 1DZBA 4RNRB 3MRJB 4NT6A 3MOQA 2Y7QB 3BPLB 3I6KA 1U8PA 4OCNC 1YY9D 3RA7L 2C7UA 5FECA 3G6JA 1QLRA 3K8LA 5CJQL 3EO0B 1CICA 2M26A 4XBPA 1F11A 4ODSH 3ZKMC 2CR6A 2LU7A 5DQJA 4M7KL 3LZFH 3TNNA 3BZ4B 1RJYB 4XVSL 4NNPL 1TQBB 1O5DT 3TZVA 3GNMH 5DMYA 2I5YL 2Q76B 1NFDE 1YJDC 2VLLB 4U1SB 1AXSA 1Q0YL 1G7PA 2OX5A 3VXRD 4YGAB 4XNQB 4HUMB 2F58L 4RMSA 1GAFH 1ACYH 3QWRD 4P5KB 4P4RA 1IAII 1NMCC 4UU9B 3LQMA 3QO1B 3DVGA 3MV7A 4XHJD 4OBRA 1A7RH 3TBYA 3ULVC 4LAJH 1EXUB 1UCTA 5E1AB 5J6HA 4H20H 3DX7A 4ZTOL 3RWEB 2AK4E 4F7CB 5EA0L 2P24A 4LVHB 1OAYH 2DS4A 1JI1A 1N0LA 4WU7A 2X70B 1JZ2A 3NIFF 3VCLA 3T0EC 3G5XA 4ZDHA 3GMQB 3EJZD 5GGVH 1BD2D 4G43B 4G8IA 2Z8VC 4WW2C 3TN0A 1J8HE 3Q3GA 4H88L 2D0FA 4PJIB 4HMEA 4Q74A 3TNMB 3OR6B 4JR9H 5CWSA 1CLYH 4L8DB 1B88A 2BNQA 1NLDH 4H8WH 3WXVH 5IHUL 2I9TB 2HKFL 3EOAB 1WSST 3FFCA 1AQKH 3MYZA 1M71A 4GW4B 3DX9B 3KWWA 3C5ZD 1T7VA 5C6TL 5F9AC 1MIML 3MRFA 1MH5A 3U46A 1BM3L 2A9NH 2CO7B 5T3XE 4NC1C 4U1KB 4ODUA 4FQQA 3QO0B 2Z4QB 2UWEF 4QRRB 3NVQA 3S37L 4Y5YC 2NY5L 1ZVYA 3RWJA 2HMIC 1BD2B 4DCQB 5E24E 3KPRE 1NEUA 5KSBA 3SDYL 2VXQH 1GC1C 3DBXB 5C08D 5HHNA 4F2MA 1RZKC 5TQ0L 4BFEA 3CDFA 3O45A 5ESAA 4GKSB 3QXUA 2GK0B 1MOEA 2QSTA 3BP5B 4FABL 4WCYL 2E7BA 1NCAL 1XGTA 5DI8B 1T89C 1OTTD 3TVMA 1QPPA 1I85C 5MI0B 5ISZA 2FX9H 2XPGA 4WEMB 4P9HL 1NMBH 2AK4D 3EOBA 1TVBA 5C9KA 4WJ5B 2HRPL 2MPAH 2J8UF 4KDTA 5I1IH 2DWEB 3L9RB 5C09B 1SM3H 1YMME 2OL3A 1CGXA 1OW0C 3TBWB 1JWSB 1FNAA 3F7RA 1LD9A 3VFVB 2Z35B 4UQ2B 5HGBA 1YPZF 1NANH 1J8HD 2FX8L 2D9QB 1RPQA 2EDLA 3UPAA 1ZHKA 2DQIL 3R1GH 1EHNA 1HHHB 2X6MA 2X10A 2WBWB 1TTUA 3JWNC 4O02L 3LHPL 4KRPD 2VDMH 3EDEA 3GSWA 1FO0H 1MLBB 4K71B 4YE4L 5JW4N 2EXYC 5IG7B 4LSDA 5D8JL 4E42B 1IKFH 2OMBA 4K3GA 2AK4B 4U1JB 2R2BB 2ARWA 1JNHA 4DKDC 1PG7H 1NGXA 1RUAH 1CFQB 2ZCHL 4HZAA 1P7HL 4Z7VE 3I9GH 4LCCB 4Z0XB 5EU3B 4KHXH 5FHBL 4GRMB 3BQUA 1J5OH 3GO1H 3K8KA 1KJ2L 4ORGB 1J7VR 5JUEH 3CFBA 5HGAA 3QXDB 4NN6B 1A47A 2A73B 1I3RB 4ZYKB 2BVTA 4CU6A 4OGAC 1BZ7A 2HWZL 2VL5B 3UZVB 4QHNB 5KW9L 3GGWA 5HI4D 4DGYL 4L4JA 1U58B 5CIPA 2CDFB 1V8HA 3FB6A 3DO7B 1R5IA 1HHJB 1Z0MA 1U3YA 1DLHB 4LLYB 4MX7A 3VFOB 3VGEA 4ZSOE 2BNUA 2KZWA 1V7MH 2CDEB 1NC4A 1IC7L 2C1OA 1AGBA 2D7PA 2BSSB 2C4FT 2WIIA 1RULL 3NA9H 1S9YB 2V17L 1YMMD 4NUJB 4CMHC 4TQEH 3PV6B 5F7EH 2R8SL 1X5GA 1YN7B 2B4CH 2G5BB 3QFDB 2B1AH 43C9A 3KPRB 3MCG1 1EEYB 4DKAA 1N26A 3MLPA 4RIRB 5CZVH 4XNMB 4QRPA 1KCLA 1VDGA 1HCFX 1XF2B 1MCRA 1UCBH 3FQWA 5EB9A 5C0DA 2LV4A 2A9ML 2NX5D 2VC2H 3P4NA 4QOKE 4XH2A 4Y2DC 4FQLL 2IG2L 2L7JA 2XTLA 4S11A 1P4LB 5DD3H 4PRIA 1UXWB 3KPPB 2CLVA 4UBDC 3IKCA 2VZTA 4HHAA 1IGTB 3JTTB 1YMMB 4YNYB 3HLAA 4XX1E 2AEQH 3LCYA 4W4OA 3IAPA 4JRXD 4MNGE 4HS3A 3BKYH 1CICC 1DR9A 1GZPA 3SE3A 3L3GA 3QEHB 2VRAA 3ZDXF 3S35L 3IFNH 3UJIL 5DGQA 3Q5OA 2XOTA 3BMWA 1NLBH 1PD6A 2BCKB 4NDMB 4NN5B 1A6PA 3SEPA 3TZVC 1QOKA 3E3QE 3H7BA 4YHKH 3JWDC 5E00B 3V6BR 3K4AA 4PB9L 4UINH 2HA1A 2AJUL 2DRUA 1RUQH 1MCLA 4P3DA 4OGYH 4RSVA 3GMLA 3PHQB 1ED3A 1T0MB 1R3LA 3QDHA 4KK6D 3MJ8B 1IQDA 4GBXA 4WNQA 2WUCH 4Z7VB 4JCLA 3GMNB 4PG2A 3KLHD 1A1OA 4PB0H 1WBYB 4CRPA 3MLWH 4M93B 1JZ5A 3GJFB 3LMJL 4J3OC 3PQYA 2VLKB 4OB5H 3OKEB 2EYTB 2K1MA 5F70A 5HI3D 1X5LA 2FBJH 2YZ8A 3FN0H 4NPYA 5KTEL 4NJAL 3B43A 4P23D 4UTBH 4ONHB 2DF3A 3DGCR 4KZEH 3TN0C 3C6SA 4NKMA 4QOKD 4ZSOB 4NJ9H 5K9KA 4TNVK 5ESQB 5FYLL 1JPFA 4LCYA 2V9RA 4JFQA 4YXHH 1W0VB 5IFAH 5IJVB 1T2XA 2YK1L 3KYOA 1WWBX 4KGLA 3MRJA 2OJZL 2NMSA 1F02I 4YPGA 1HIML 3ARBD 3GK8L 5EZJA 2XQYG 1C8PA 2NY7H 3W39B 5DRZB 1ZSDB 3MCKA 5DMKB 3MROB 3SDCB 5HPMB 1Z3GH 5KSVA 4LK4A 4XNZB 3OXSB 43CAB 3WDIA 2R0WL 4HCRA 1TZHB 5I1DB 3ISWA 1ULVA 1H8OA 3VGDA 1CFVH 1A7BA 2GTZA 3DRQB 2E3VA 3MJ9H 4QHKI 5BV7H 3VI4F 3QI9D 2Q76A 3UYRH 1YJDL 4DUXA 3FCTA 1S7TB 5ADPH 4NKQB 3LN5B 1F58L 4IM8A 5L0QC 1GCFA 3M8OL 4XNQA 5GRVL 1L7TH 3TVMC 4P5KA 4MNGB 3ARBB 1A6ZB 3QXVA 1A0QL 3CMOL 3ZYOA 7CGTA 5BJTA 1D6EB 3P0VL 4RMTA 5IIEB 5KVEH 3RX7A 1NGZB 1WF5A 2PXYA 3BAEH 3FMGL 3ARTA 4X80L 1Q1JH 4KDTC 4E41D 4F57L 1QRKA 3V0WH 1E4JA 3DTXB 3MGTB 2BOCA 1Z9OA 3ALXA 3PP3H 3CH8A 3E6FA 2X70A 3HMWL 4ZO9A 4BSWB 4CNIB 3Q2CA 5F7DB 3X3FH 4JY6B 2B5IC 3TYGH 3FHAA 3U36B 2OSLB 2YMXL 1DQDL 3FZUD 4OFIA 1FZOB 2Z8RA 1KT2B 3TNMA 4X4MA 5FO8B 3GIZH 5DUMH 4MJIA 1VFUA 1MWAL 5I8CA 4YHPA 5D93C 1IJ9A 1KJ3H 1H5BB 4L8DA 4BFGA 4HGKC 1ZA6A 4YX2L 1K5NB 5E2TH 4PJ7F 3TBTB 2BVOA 4GW4A 5MERA 5B4MD 1OWRM 4GAFB 1IFHH 5F72S 2WSKA 5J7CC 4RWYL 4NYLA 4YC2B 2W60A 1JZ8A 2DI7A 4ZTPL 3QO0A 2Z4QA 3D25A 1HQRB 5IVXF 4DKFL 3GSOB 5A3ID 3QISA 3EYQC 4XPTH 3ZHDA 3BQUC 1D5ZA 3CX5K 5FYKU 6FABH 3MLUL 1M1SA 2VE6B 3KJ6H 2A77L 2A2QT 3WLBB 1AI1H 1AY1L 2VIRB 1S8DB 1G7HB 1HOCB 3A6BH 4HT1L 2AEPL 4OCXH 4KROD 1I7TA 4HXAH 4OQTL 3IS1X 2CK2A 1UENA 1IILE 2XZZA 4JPVH 5DI8A 1AR1C 1JGDA 3F7YB 3MREB 2A6DB 1XF1A 1A9EA 5HHME 5INCB 1UZ8B 1BFOB 4PGJA 4WJ5A 2DWEA 3QUXD 5CJQH 5C09A 1AGDA 2ESVB 4E9LA 2R0LL 2YUWA 1GGIL 3F6LA 3QNYA 3U2SB 3OB0H 3VXOB 3NABH 2F53B 3FRUA 1MCHA 4GT7A 1VFBA 4U6TA 4UQ2A 3VG0L 2VLJD 5BW7A 4M7KH 1UB6A 1GHFL 2FHBA 3BSZL 4XVSH 5CGTA 2VOTA 4DN3L 2I5YH 4TUOB 1JF6A 1HHKB 2G2RB 5HTSA 1HKFA 3O6LL 1P53A 3FB5B 1MLBA 4ZAKB 1JMZA 2F58H 2EDEA 3ZKNC 4E42A 2OTUA 1BVLB 3V0VA 3O3EB 4JFPA 4W4OC 4HV8A 1A4JB 3GI9L 1WVZA 3RIFF 4Y8AA 4WI3A 1NDMB 4ERSL 3ARZA 4Z0XA 5HYFA 4WUUE 5EU3A 2ARJQ 1I75A 3PDDA 3ARRA 3SE3C 2OCFD 4XXCA 4ZTOH 4D9RE 2BDNH 3ROOA 3PGDA 5C0FB 5JW4M 1WC7A 3N1QC 5EA0H 4AL8L 2MKLC 4MD0B 3ZE1E 1LK3L 3QXDA 4LVOC 4WHCA 4Q9QL 2B39A 2A73A 4JZOA 4NQCD 2XA8L 4XCYA 3HKFA 4M61A 3T1WA 1EZVY 4QHNA 4XRCB 5ID1B 4WFGE 1U58A 1Q9OB 5I76A 4PBXA 2CDFA 4ENEC 4KJQD 5EU4A 1HHJA 5EIIB 1MHPL 4D9QD 1MHEB 4M7ZB 2P46B 2YWZA 5IHUH 4JO3L 5MP6H 2NR6C 2Z31D 4GBXC 2BSSA 4XCNB 4XP5L 1DANU 5I1AB 1I1FA 4J3WA 3SDDB 2CMRL 1S9YA 3D0LB 4PG2C 3L7EB 1XGYH 1MIMH 2DBLL 1BM3H 5DD6A 1YN7A 2G5BA 3VFGH 3W9DA 4AEHH 4TNWK 4U7MA 1EEYA 2AS5M 3IGAB 4RIRA 1F2XK 4XNMA 3S37H 3DHMA 3WLWD 2NY5H 5SWZB 3FONB 1SVCP 1RI8A 2F15A 4WHYH 5FDYA 3SDYH 2CRIA 3TBVA 4YAQB 4D9LL 5F9WC 1JZ3A 4MJ5B 5TQ0H 1UJTA 1IEBB 4OFYD 5DO2C 4I77L 1X6NA 4LRNL 1O0VA 4HS8L 4XXDB 4JDZB 5HHMB 5E8OB 1FH5L 1P4LA 1BVZA 1URLA 3LSOA 1ZOXA 4PJAE 3W5MA 4FABH 1F4YH 1UXWA 4WCYH 1J05B 3DX8B 4XBGB 1PKQE 5F6IC 2AJXL 1P1ZB 3BPLC 4BA8A 2YRLA 4U05A 1OAZL 3H9SD 2XQBL 3QYCA 4WUUD 5GRUL 1QFWI 1KIRB 2ITCA 2WUBL 2Z93B 1KIPA 1RIVL 4HUKB 4Z78B 2HRPH 4ZQKB 3VXTB 1N6VA 1OP3H 4PV8B 3QEHA 5DRNA 3MUZ1 4OCMC 4Z18A 3R8QA 3IDGA 2ARJB 4Z6AT 1YNLL 2DMCA 5C07A 2YEZA 4WFGD 1AGEA 3MRKB 1TCMA 3CSGA 1I7ZB 3JWDL 5GSRB 5E00A 1EV2E 2PR4H 3IB4A 4J1UA 5D72L 1HH9B 3W2DL 1RV6X 3TV3L 3LHPH 4BQ9A 3EYSL 4KJPD 4XP9L 5KVMC 4YE4H 2DQTL 2KH2B 4WUUB 3UJTL 4FFVD 4M8VA 2PXYC 1KNOA 3VWJD 1WBYA 2ZCHH 4K7PX 3GJFA 4PBWD 1CLZL 2J1KA 1JRHI 4XNXL 4X7SL 5FHBH 4AZ8A 1WJ3A 1E6OL 2VLKA 4MQXD 3OKEA 1HQ4B 4LPYA 4U1HB 1KJ2H 4R4ND 1D9KD 4GKNA 2OP4H 4N5EC 1BREA 4PLNC 1KYOK 1RZ8A 5AYQA 2LU4A 4LSVL 5I18L 1LP9A 5KW9H 4Y19E 4JFHE 5AZEL 1S7VB 3IDIB 1G6VK 1RFDL 4TPRL 4GJTB 3QXAB 4C56B 1IC7H 1LE9B 1DFBL 3VE0B 3W39A 5DRZA 1GSMA 4X6CF 2X4QB 3RVXC 2V6HA 3MRRA 1INQB 1CD8A 5E8PA 2KUTA 3MROA 2V17H 3TYFA 4OSUH 5I30H 1JWMB 5TFSL 2FB4L 4BFIB 4J4PD 5KVGL 2R8SH 1R3KB 1XCQB 3W0WE 5F7NC 1GOFA 3T3PE 43CAA 4L3EE 3TCLA 5D2NE 3C6LD 1D9KB 3PV7A 2IAMA 3O2DA 3ULUL 4HUUB 3RJDA 3DRQA 1KSRA 3TGXA 4UB0L 1RZJC 2IBZY 3T3ME 3JUZA 1HSBA 5ACZA 1TZIB 1S7TA 4PJAB 2BX5A 1MCNA 1LO2L 3PE9A 2ERJC 3LN5A 5E1HB 5GGRY 5IW6B 1PKQB 2NY4D 2A9MH 3F12B 4HULB 3B8YA 3MSPA 5D70L 5E8NB 2K3TA 2OLDA 3ILPB 3K2MC 1U36A 1A6ZA 1P5VA 4X6DF 5JIIA 2Y5TA 5E2UL 5HYIA 4KY1H 3U0TA 2DQDL 3PIQB 1RY7B 2OL3L 1B6UA 5CFHA 4YDLB 4J12A 3ZO0A 1UG9A 4FA8A 4CGTA 3MGTA 1DQLL 1PG7W 3T0VA 4ODWA 3V52L 1C16A 3S35H 3EAKA 5IW1B 3UJIH 5EO9B 1FFNA 5BW7C 4O2CA 2WIMA 4CVZA 1UJ3A 1QBAA 3U36A 3HG1E 4PRNB 1FZOA 3MRQB 5AAMA 1UWGL 4IRSB 3DMMD 1N59B 5KOMC 4RFNB 2GT9B 4PB9H 4BZ2L 1H5BA 2AJUH 2BERA 4K71C 5GISL 2AW2A 2HVJA 2EE2A 1BF8A 4K9EH 2AEIT 3ARFD 2J7LA 1J0YA 3ZTJH 4FXKB 5B3JF 4NFBA 1JWUA 4RGMB 5FYKD 1YQ2A 1I9IL 1W8NA 5DF0A 4D8PA 1HXYA 5F7HA 5IOPA 4NBZB 3LN4A 4YFDB 1Y0LB 2YBRB 3SGDH 2F5AL 5H37H 1FFRA 4OZIF 1NCDL 5I1CL 3TIDB 4XXCC 1DP0A 1HQRA 3J8F7 2PW2B 1RQ5A 5JPMA 1YEJL 5GS2H 2GUOA 1D5XB 3LMJH 1LNUB 3D3VE 1RAMA 5D1QD 1CXFA 1QLFB 2VE6A 3LRSB 4Y19B 3JZ7A 1QRNE 1DQJB 1TETL 2VIRA 3C2AL 4KKNA 1S8DA 5KTEH 1MQ8A 4ZXBD 3LKPB 1DBAH 1JGUH 3H9YA 3RKDC 2PCPA 4C59B 2J6EA 4FQ1L 1KFAL 3C8KA 1UM4L 5FYLH 4FFYL 3FB7B 3HZVB 4IRJD 2HT2D 4MQTB 2XG4A 3F7YA 2NY1B 2C4XA 2YK1H 3BO8B 1C5CL 2A6DA 2OJZH 4S2SA 5KVDL 3ROLA 2AERT 3JVGA 2MMXA 1GGUA 3W0WB 3U7WL 1HIMH 3MCLH 4L3EB 5D2NB 2L4OA 2ESVA 4XZUB 3VFSA 3VXOA 1I8IA 4M43L 1E0OB 4M5YH 4PTTB 4I18B 3QUKB 2F53A 4B5EA 3NIFE 5BVPL 4CW1A 1FNLA 4Z77A 1SYSB 3I3DA 3BDBA 1HHKA 1YJDH 2G2RA 4K8RD 15C8L 1HNFA 1F58H 5I75C 4NM8L 1ZWIB 3M8OH 3KPSE 3N50A 5EOCJ 2EKSB 5BOPA 2E7LA 3O3EA 1SMAA 1WAAA 1A0QH 4NGHL 1T04B 1MCWW 2P4AB 1G1CA 4BUHA 3ULVH 4N0CD 1N6QH 3QEUB 4PUBL 1K2DB 3ARDA 4X80H 4F57H 3D3VD 3M45A 2UWEE 1V3JA 3HG1B 1B6DA 1RZIB 3OKDA 4MD0A 1ZT4B 1EFQA 2DLTA 3U0PB 4W4NA 2EO9A 1QFOA 2BVQA 1U8LA 4M00A 4S1RL 4NN5C 4GRLB 1WWCA 4NUGH 3O9WA 3RIFK 1CD1B 1O7VA 3RVWC 5A43C 5F9DC 2P5WE 2YMXH 1DQDH 3OQ3B 4OF8A 4I4WB 3H0TB 1U8HB 5EIIA 1MWAH 2XZQL 5ICXB 1FZMA 3CFEB 4HJGB 5CHNB 3JUYA 1LO5A 4JHAL 3VWKD 2IMMA 4YX2H 4OLEA 3X13B 4XCNA 1DSFL 2IAND 2J5LB 4JRWA 4KV5F 3P30H 5JIHA 4M3KB 1FLRH 1NGQL 1T0PB 4RWYH 2J8UE 4LFHG 5HYJE 1QEWB 1QRNB 4ZTPH 5D5MF 4FQIL 5E0QA 4Y4KD 2RJMA 4PP2A 4DKFH 3DIFB 3IGAA 4LNVA 4FP8L 3BUTA 4QCIA 3MLUH 5SWZA 5DMGD 1YPZE 3WFDL 2A77H 2EIZB 4FMFA 4J8RA 1JUFB 3PP3K 4YAQA 3VD4A 3HMXA 4A2LA 1AY1H 5FUCE 5DFWH 3D48R 1RZKH 4MJ5A 1NCCL 4HT1H 5I2IA 2AEPH 2ZSVB 3KPSD 4UNTA 4S1DC 3RVTC 4MCYA 3VWKB 1X5AA 4OQTH 1RUKL 3V6OE 1J05A 4I48A 3DX8A 1NPUA 4U0RC 4OZGA 4IOIB 4CMMA 3MO1A 1A4KB 4PP1D 5T5FL 2CJUL 1W72B 4HMDA 4MB3A 2ZNXA 3RNKA 4Z78A 3EYOA 2R69H 3NCMA 4ZQKA 4Y4KB 3FQRB 4R3SA 1BQLL 1Z2KA 5DZLA 4XNZC 4EUPB 2R0LH 1GGIH 5HHQA 5E5MA 2IFFH 1J9CT 2IAMC 4KK5C 5CEXB 4ELMF 3VG0H 2GI7A 5GSRA 1FLTX 3EFFB 4EN3A 1UH4A 3BSZH 4GUPA 3ZHLA 1HH9A 2W91A 3BP6B 3HI1A 4DN3H 3C87A 5T1LD 1QQDB 4NQDE 4PLKD 4R97B 5I73B 2CIKB 3O6LH 2F54E 4EBQL 5GGVY 1NGWB 4HW6A 1T03L 4Z7OF 4OV6F 1RK0A 2PN5A 4JFDE 3UTZA 2V5YA 2R56L 1E27B 2UWEB 5BZWA 4F80A 3C09B 1CDGA 3GI9H 3UO1L 4ERSH 2YN5A 2MHAA 4X9GA 5AUMB 3KPMA 5EZOL 2P5WB 3UCRA 1IGFL 4AL8H 3JWOC 5GJSL 1UJ3C 4XMKL 1KB9K 3DWTA 3HR5B 4Q9QH 1M7XA 1CGTA 3OB0K 2XA8H 1AXTL 4I3SL 3NA4A 2JIXD 2OQJB 5GSVA 1QSFD 1U8OA 3TO4D 5HDQH 5CS7A 3ETBF 4ZFZB 1H5BC 2YSSB 1MHPH 1ORSA 1M7DA 4QTHB 5D7SL 1OOAA 1ZT7B 1SMOA 1AQDB 5DVKA 4C56A 3VFPB 1MRDL 1CE6A 4NIKB 4OFKA 1DDHB 4Z95L 4KRMB 3U9UA 3ULVF 3OKYA 4JO3H 1IT9L 2J8UB 5HYJB 5D1ZA 3VXMA 3MLSL 3VH8G 1QA9A 3PL6D 4Y0GA 2CMRH 1JWMA 1FFOA 1U8MB 2C9AA 3LKSB 3WKML 5GS1A 1XCQA 4LKXB 3BIKB 1YPZB 4QY8B 4XNUL 4WW1B 1C08B 3ZDXE 2X89D 3BWAA 3CVIL 4H1LB 4HUUA 1T7YA 2V7HB 3T77A 5J12C 1RZJL 4I2XE 3HS0B 4LSPL 4FFZL 1AFVL 1XF5B 4S0SD 4HSQA 5K9OA 3TO4B 1A3QA 4D9LH 3V4VH 3W11D 3IAQA 1JE6A 5IW6A 4U2YA 1CDCA 5IB1B 2ICWJ 4N0YL 3NTCL 4I77H 3RGVB 3OPZL 4LRNH 4MDIB 4HS8H 4ZFFB 5C0BA 1A9BA 2PYEE 2VXTH 2ZPKL 1FH5H 3V5KB 4PJFA 4ZUTA 4POZD 3JBG7 2AJXH 3JVGC 1FN4A 2DTSA 3PL6B 5EOTB 3GHEL 2BVPB 3CSYB 3V8OA 4JAMA 1OAZH 3PIQA 2XQBH 4MCZA 5DHVA 5HVFB 3LOWA 4L9LA 3QFJA 2EECA 2WUBH 3CZFB 3EGSA 4R2GB 1BZQK 5HHPA 1S7WA 5EO9A 2O5XL 2RIKA 4MAYB 1YNLH 5CP7A 1IAKA 4L8CA 3ECBB 3FRPG 4NQDB 3PWVB 3B9KB 3IDYB 4IRSA 2F54B 3JWDH 3M1BB 3BZFB 1D5IL 2IH1A 5D72H 2ICEB 5IMOB 5C0RL 4JFDB 3W2DH 2Q7YB 3QH3B 3GIVB 1TPXB 5C0AA 1Q72L 3EYSH 2HT4D 3MRHA 4XP9H 4FXKA 2E7LC 2DQTH 4EOWL 5C71A 2YC1A 3FT3A 4U6VL 1Y0LA 5TDNB 1VSCA 5INDA 3VXNB 1DBKL 3OKMB 4PY7B 3ARDC 2DQFB 3DVNB 4PGDB 2OR9L 1D5XA 4L29A 1EHAA 5SWSD 1CLZH 3BH9A 5GGTA 3RDTD 4X7SH 3UJJL 2WANA 4LOUC 4IMLB 3F5WB 4MJ2A 4MVBC 4Y19A 1ZLSL 1CFNA 3O9WC 1OP3K 3BPOB 5IW3A 5F6HI 4QRTA 4MHHG 3VI4E 1VEOA 2PW1A 2AV7A 2NY3D 3PUCA 4LSVH 3ET9F 5I18H 1P84K 5AZEH 4M7ZC 5DURD 4OFVA 3FB7A 5CD3A 1Z5LA 2YN3A 3FTGB 1RFDH 4TPRH 1CQKA 4F7EB 2DOCA 5T3XL 3OGCB 3O8XA 3OF6A 3BO8A 1XT5A 4J6RL 1X5JA 1DFBH 1SEQL 5KN5B 3GSQB 1C1EL 4F15C 2GQHA 1U8JB 3KLAB 3OJDB 3TA3D 5KOVC 3S98A 2FB4H 4TUKH 1XF3B 4WTWA 5B39B 4I2XB 4N8PA 5GZOC 3V7AG 4I18A 2DKMA 3MRDB 4ISVA 3SKMA 2P8PA 3ULUH 1H0DB 3T8XB 3RZCD 2FEEI 5L2KA 2X4UB 4ODBD 3ZZ1A 1GOGA 4UB0H 4JZJB 5C0CA 4UTAH 5I6XB 5F1KC 3G5VB 1CIDA 2PYEB 5EO1A 3AMLA 1LO2H 4YH6A 1ZWIA 2FD6H 2QQLL 5C3LD 2XWTA 1REIA 4HDIA 3B3IA 2DL2A 2W1NA 5D70H 1FIGL 5F1SA 1S5HB 1S9VB 1HDMB 4PJ7E 4EI5D 1T04A 4RMUA 2CLZA 5E2UH 4O58L 1LO3L 3TA3B 1S7SA 3DXAE 3QEUA 4FG6D 1DBMH 2DQDH 2E6PA 2R2EA 4N0UE 5LAXB 2OL3H 2QV2A 5AYUL 1D5BB 5IVXE 2DTMH 1RZIA 3WNKA 3U0PA 1FV1A 3V52H 4GRLA 1Q94B 4JM4L 5BRZE 3U9PL 1ZT1B 1CD1A 4RZCA 4F9PA 4E5XB 2ICCA 4I4WA 4EN3C 3H0TA 3SGKA 4PJ8D 4LNRB 1UWGH 3W9EB 1OM3L 3LKRB 1ZVSB 2VR9A 4OLYL 2VABB 5FM5M 3CFEA 4HJGA 4R26L 1L9MA 4BZ2H 5GISH 3OX8A 5HSFA 3G6JF 4UOW0 5CJXA 1EVUA 1UA6L 2G75B 5FM4A 1RUPL 3VDCA 3FHQA 1G7JA 3NACH 4YEEA 4PFEA 2J88L 2F5AH 4JRYB 4L4TA 3VGHA 1JP5A 3BX7C 1QRNA 4Z9KB 5I1CH 5IQ9B 1NEZB 1ZGLA 1YEJH 1CD9B 4PLJD 4WHTB 4ELKB 1YEEL 3UPRB 4NKDB 4NO2B 4WI6A 1M7IA 2MSPA 4HFUL 1VGEH 2HTLC 2J8OA 3BUYB 3C2AH 1HH6A 1HSAA 1T1YB 3VXPB 1KF9B 4HFWB 2PO6D 4LL9A 4XB7A 4FQ1H 3X17A 4L3CB 1UM4H 4P2QE 4OUOA 1NQBA 4XCCL 5BCAA 1VCAA 5F3HB 4OCLC 4JN2B 4M7LT 5HD8C 5DJYB 1U8QB 1A4KA 4NSKA 4KXZH 4TOYL 3ZYZA 1C5CH 4N8CL 5D1ZC 3PABA 1MVFA 5HJ3A 3WN5B 5KVDH 3U7WH 1W72A 5FCUL 1GGYA 5GS1C 5E95B 3KHOA 3BRFA 4PJ9B 5EIQA 1G9MC 1H15A 2V5SA 2OI9C 3S6CA 4EUPA 5F97E 2I25N 5C8JB 5I17B 1WZMA 4YBQD 4M43H 5JTWA 1MLCB 4BSVA 1JPST 5BVPH 3RL1B 4EDXB 4HIXH 4PGBB 1XGUB 1T80A 2ICWA 3BP6A 2VQ1A 2XYCA 1T66C 1F8TL 2PO6B 2RFXA 5KBNC 2ZNWA 2GFBB 4CKVX 2X5PA 2DJ4A 2FEDD 1QQDA 4PJ7B 1H9VA 5DD1L 2CIKA 2DICA 3MYJA 1FG2B 5I9QC 4KGJA 2W65B 3WIFB 4UOJA 3NGBC 4JKLA 3DXAB 2X2YA 3RX8A 5CBEB 2OR7A 3UBXG 3D2UD 4N0UB 2X4PB 4NP4L 4NGHH 4PRBA 5IVXB 4S1SL 1JV5B 1Y6KR 1WK0A 4L9LC 3D18A 4YDLC 5SV4A 4PUBH 1DLFL 3MLXL 5BRZB 3V4PL 1B4JH 1EIBA 2FL5A 3OJVC 2P5WA 4ZG1A 2Y6SC 3N0PB 3RU8H 3DETC 4NZTL 4QNPF 3HR5A 3S97C 2OQJA 1Z9SA 1UACL 4IRSC 4WUKH 2VAJA 3I6LE 1PVHA 4G6ML 4ZFZA 1F2QA 2XZQH 3EZ8A 1JL8A 5I16B 3E2HB 4BH8B 5KS9E 1DDHA 1X4XA 4Y1AD 2HTKD 4PJGA 4JPWH 2IC2A 2CDGA 1DSFH 5HYJA 4NQSB 1SY6A 1CVSC 3BDYH 5HHOE 2CK0L 4OD3L 2FNBA 5GRVK 1IM3B 2G60L 4K23H 4G9DB 5CMAA 2FJFB 3ZDZE 1D6VL 1NGQH 1YPZA 3INUL 5HGHB 4FQIH 4L3AA 1UKTA 3VXRA 4XCEB 4H1LA 2HJLA 2FX7H 5CILH 2DQCL 2V7HA 3QDME 4FP8H 2L7UA 3MUGA 2XKSA 1FC2D 5FB8B 3K46A 4P2QB 2J6EL 1UVQB 3OL2A 5IB1A 1NCCH 1ZHLB 5DR5L 1S7RA 2N4IA 4YIQA 5E5RB 5J56B 3P73A 1EEQA 1D5MB 1U0QA 3QQ9C 3QJFB 3O6FA 4F9LA 5DUPL 1RUKH 3O8XC 5DFVC 3TYGL 1TCRA 1MCOH 2EH7H 1MCDA 2AVGA 4KJWC 2WBJB 3AMKA 5T5FH 2E6JA 1CD0A 2BFVL 3SJVD 5BV7B 2CJUH 3MTRA 5KJRL 2DM7A 5KZCD 2WINB 5A40E 1FZKB 1KENL 1VFMA 1BQLH 3EDKA 4HCRH 4I18C 3MLYH 1KJVA 5ACMA 1F90L 3WYRA 1Y18A 2YA0A 4P46D 3I6LD 4X4XB 1UWEL 3S4SA 4NQDA 1PW3A 2ADIA 5EUOB 3MXWH 1RJLA 2C3VA 1I3GH 1YNKL 4HJ0D 4IHOA 4CN4A 1FFPA 3UDWA 2NZ9C 5J11B 3GIVA 4M6NH 2E8YA 4X8JB 2EDNA 2VSCA 3VG9B 5FHAL 4EBQH 4ZS7L 3DUUB 3MV11 5C6WH 1BFVL 1ZK9A 3GFUA 2V7NB 1MNUH 4WDIB 5EH1A 2WWMD 4X6CE 3OKMA 5C08A 3WJLA 1W8OA 1DUZA 2YD7A 1KPRB 4M9PA 5IFJB 3DVNA 4PGDA 3UTPE 1AHWB 3UO1H 5JXAH 2F74A 3QXWA 4H25B 3K80A 4UUJA 3QHTC 4YK4C 3FO2A 1U95B 2BNRE 3DI3B 4GRLC 1WWAX 1G6RA 5GJSH 4XMKH 4F9PC 2Q8BL 4YEFA 3PXHA 2VR5A 1AXTH 3KJ4B 2HN7A 3SGKC 4I3SH 4IMKA 4PJ5D 3KYMB 2EZ0D 1QTYT 5I1KL 3QT2A 1I7RA 2VLRD 2QHRH 3DUSB 4HK3J 1QR4A 3HE6B 2BSED 2PTUA 1X5ZA 3FTGA 3O4LD 4H26B 4F7EA 4N1EA 5HHOB 3QULB 4HIHA 4FQHA 1MCBA 1MRDH 4K7PL 4X6DE 4K3DL 2J5LC 4Z95H 5CJXC 1RIHL 1IT9H 5IHBA 5KN5A 2AP2A 3GSQA 2PTTB 3KXFB 3MLSH 4XAWL 3KLAA 4F7PB 5CCKL 4WFFE 5BXFA 5JNYB 3WKMH 3CFJA 2X44D 3QDMB 4JFXA 4EQ3A 3IDXL 2E9BA 3B9EA 4I2XA 3MBED 4OZFG 4WIQA 3WUZA 5B8CA 4XNUH 3V4UL 3BKCH 4FXGA 2CIIA 5DUBB 3S4SG 1JPTL 2EDQA 4YDJB 4URTB 4DVBB 1I1AB 3CVIH 3WS6A 2X4UA 2Q1EA 1RZJH 1C5DA 4JZJA 4LSPH 3WE6A 4FFZH 1AFVH 3TESA 3G5VA 4U1IB 2ZUYA 2HG5B 5SX4H 3EYFB 4LHJB 5CINL 1CZ8H 4OI7A 4G6AD 3NTCH 1IL1B 3OPZH 5L7XL 4ZUUB 2ZPKH 2JF1A 1A3LL 3FO1B 4GFTB 2BVEA 5B3JE 3QRFM 3P9LB 3GHEH 1R3IL 5FFLA 5E70A 4GG8B 4OZIE 3L5HA 5DS8A 1LEIB 2XY1A 3MBEB 4KKAD 4AIZB 1MCFA 4OCRL 4LSUL 1EAPB 2QADC 4X5WB 3A6CL 5IB5B 5L8JB 4OLWL 4FFWC 4PJBE 2O5XH 4PJXF 1ZT1A 2D7MA 4LQFL 3P11L 1P7KA 1TJIL 3D39E 3HZKB 3HC3L 3X12A 1LE5B 2I26N 4NKIL 5GXBB 3QWOA 1NDGB 2EYSB 3W9EA 1CFSA 1K9TA 1ZVSA 5D7LD 1BBDH 1RJZA 2DYPD 4OUUB 5I73C 5C0RH 3CIQA 3BZEB 4NCDA 5GRZA 2BSRA 3UTTD 4X6CB 2YD9A 4GKZB 3IDJB 3MLZL 4HIIB 2A6IB 3JV0A 4JFYB 4JJ5A 2BJML 4YXKL 5ICZB 2DQUL 4PRHE 2Q8AL 1MRCL 4HGWB 4EOWH 5E8EB 3TFKC 4WFFD 3K81A 3C09C 3FT4A 1DVFD 4U6VH 4JRYA 4P5TA 1RHFA 2FZ3B 1WCBA 4CL7A 2BNRB 4DK6A 1BZ9A 5C0JB 3U4EB 32C2B 3SO5A 1NEZA 4L8BA 2OR9H 1X7QB 1UEMA 2NX5A 3BPCB 2NY0D 2Y4SA 2A0LD 1A2YB 4QRSB 4FTVB 1E4XI 3LQAC 5F1OB 1QD0A 3OR7B 4JKKA 3BVNA 1ZLSH 3AS0A 3GDBA 1MHHA 3KDMB 3VA6A 3P3YA 3BUYA 5LXGH 3T0DA 4YGVA 4G9FB 5D6DA 1V05A 4O4YL 4HFWA 3MACL 5FOBA 2DYPB 4LF3A 5HDBF 4JRXA 4B7LA 4X6DB 4AH2B 4A6YB 5EPMB 3I3BA 5T3XH 5A2LH 4JN2A 3MNWA 5DXWA 5BZDB 4JDVA 5DJYA 1U8QA 5EFIB 2VDRH 4J6RH 4Q9RH 3WN5A 1OF2A 5GJTL 3HPLB 4GLRH 8CGTA 3NCFB 1SEQH 5C0IA 1G7MB 3CU1A 1C1EH 2FHFA 4N9GA 4PJEA 3BT2L 1G9ML 4R4FL 4CUCA 3X11B 5EO0B 3MJ6A 1MCPL 1H3XA 5I17A 3MXVL 1OQOA 5FUCC 1DN0A 5FM8A 4X99B 2BC4B 4LSQL 1MLCA 1W0WB 2EEBA 1CG9A 2E9WA 4EDXA 4F7TA 1MJ8H 5C0GA 4Z7UA 1MFCH 3MJ7B 1GPOH 1M05B 1GOHA 2ADGB 1B0GA 2DIAA 2EC9U 2GFBA 5BVJB 4D0DA 3OG6B 1CFTB 1PYWB 1EDQA 3O6FC 4AT6B 1G0YR 5TH2A 4F9LC 4DZBA 2QQLH 2QEJA 1EEUA 1Q9LB 5E99L 3DXAA 5J1SC 5IHZB 1UQSB 1FIGH 4KTDH 1II4E 1NAMB 1WFTA 3CU7A 4OZIB 2X4PA 3QUZA 4LPXA 4U6YA 5FDWA 5IVXA 4KV5E 4LMQI 1IZKA 5FV1L 3EJZC 3JV4B 4O58H 2X1OA 1J12A 4P23A 4LHQB 2ED9A 1OT1A 1PQZB 4MXVF 4R2GC 5BRZA 2XN9A 5DGRA 5DJ2A 3TPUA 4I0PD 5D5ME 3CJJA 1A3RL 5AYUH 4HAFA 3D39B 2FGZA 3MLTB 2VZOA 2X1WL 1NC2D 2ZCKL 4JM4H 2B1HL 4XI5D 1QLEL 1BAFL 2IQ9H 3WCYA 3PJSB 4YHNB 4OGXL 5E2WL 3KVQA 3J7HA 1CDUA 1KLUB 3UDWC 1OM3H 5H2BA 2HFEB 5EOCL 5FCSH 4OLYH 4R26H 1TPXC 1IAOB 3BH8A 4RQQA 4PRHB 3RFZC 4GW1A 1BIIB 4MD5B 1F42A 4X6FA 2VUYA 4NQSA 4B53A 4MNQE 1YZZA 1YYML 1IM3A 3WJLC 1RUPH 5T1KB 1OLZA 2J88H 4I0PB 1ZGLM 3N1FC 1OGAA 3GJFH 5T1MB 5HGHA 3AS3A 3T2NL 2DQEL 2WM0A 3UTSD 1T7XA 1XGQB 3RTQD 3L7FA 4XCEA 3HN3A 1YEEH 4ELME 5GGUA 1OTTC 4PPTA 4NQVA 2D7OA 1U3JA 4HFUH 2E7MA 4IMKC 3FL7A 5F93C 5GZND 3CK0L 3QAZB 2YD6A 5BQ7A 3MRMA 1Q9WA 2A6KB 2GEEA 1ETZA 5EBLB 4BJLA 5ILTL 4F37F 1D5MA 2R9HD 3QJFA 3CXHJ 1AGCB 4X7CC 4Z7OE 1BP3B 2ZJSL 5AD0B 4RFOL 5I71B 4G8FA 4LPTA 4Q6IB 4TOYH 4N8CH 5IBUG 5ENWA 3NFNA 1IE5A 3BGMB 5HHVH 1Z6JT 5FCUH 1XIWD 4YWGL 4WO4D 1EBAA 2WINA 3RTQB 5EULV 5B8CC 2COQA 4KRPC 2XNAB 1GGTA 3S96A 3WFBL 1YMHA 4UAOB 3RVVC 3WS6C 3OJ2C 4DN4L 4X4XA 1RMFL 1N8ZB 4JZJC 2UY6A 5I6XC 5EUOA 5EBMB 5FO9A 3OTTA 3LS5L 1DBJH 1F8TH 3VXUA 4LVNC 2VYRE 4XMLL 2UYLB 1XR9B 4X8JA 1LWRA 4I5BA 5ID0B 1VPOL 5DD1H 3RWFB 4HZLA 3VFWB 1QHOA 2GSGB 3DUUA 3MRLA 4MMZC 4GXUN 2LU3A 3ULVE 2V7NA 4JG0L 5GS2D 1FAIL 1JTOA 4JFEE 2EDOA 5D5MB 1KPRA 4S1SH 4U3XA 1QVOA 3OJMB 2ZG3A 3S7GA 3FB8B 4JQVA 1KCVH 2XXMB 1DLFH 4KKBC 2F8XC 3T0EE 3V4PH 3IJYB 4AEIH 1KB5B 3E6HB 2IPUG 4U1LB 3SCMB 4OAWB 1WTLA 4Y5XB 4BZYA 4NZTH 1ZLUH 5FYLD 3IJSB 3EW3B 2Z91B 3CDGB 3ELAT 1BBJB 5C7XH 4K8RL 1UACH 3ARUA 3ULSA 5E9DE 3AXLA 4G6MH 3RWIB 1W2KT 3QUXA 4MNQB 1JYWA 4X98B 5FA3B 5E56A 3JV6B 1JN6B 3MFFB 3SBWA 4NC1E 4UNUA 2VLJA 1W0YT 4HK3N 3KXFA 2CK0H 3AM8A 4OD3H 3FJTA 4P5TC 3ES6B 2ZUVA 1TNNA 2VDPL 1HZHH 3CFKA 1D6VH 4ELMB 1AO7B 3HNTL 3WFHB 2FIKB 3D6GA 4YDJA 1I1AA 2DQCH 2EYRB 4PREA 2YD4A 5D6DC 2J6EH 2HG5A 3LKOB 3GMOB 5E6IB 3LV3B 1J0JA 5DR5H 1IL1A 5DZOA 3ULVD 4ZUUA 5CP3H 5DUPH 3S88L 4P3CL 5L2JB 3BP7B 3REVB 4DJMA 3MLVL 3PWPD 4FZEL 3WN5C 1MFBL 1T83A 5J1AA 4XMPL 1W72L 5CSBA 4EQ2A 1WCQA 1QYGH 3UX9B 4GG8A 2DKUA 4ZFOB 1LDSA 5KJRH 2FSEB 4QHUB 3QEGL 4X5WA 1KENH 4FQXD 5FUOH 5CJOL 1ITBB 5JHDE 1N0XL 2Z92B 5EORL 1IGYB 5DQDL 1LP9F 1F90H 4LCUB 3V8CA 3D87B 5E9DD 3FKUS 1NCNA 3VD9A 5LQBL 1UWEH 1K8IA 3BEVB 2EYSA 1NMCB 4JN1H 3HFML 3MOBL 4S10A 3KLHC 5GGSY 4IRZL 1YNKH 2EICA 1YY8B 2H3NB 3QDJA 4EDWL 1MCJA 3KPNB 3O3BA 1OGTB 3VFMB 3MRIA 1SBBA 2WLZA 4JFEB 2C1PA 2H9GA 5J6GB 4Y4HB 1FL3A 1J1PL 4GKZA 4HIIA 5ICZA 1IGML 3MFGB 2GK2A 2FGWL 4G6JH 1G7IA 1GXEA 4WWID 3QUZC 5HI3C 1KN2H 1OSZA 3R06B 5E8EA 1HK6A 3LPFA 2X4NA 3T0EB 4P23C 4BK5A 5C2UB 5JW5B 5E94B 2HMID 4AJ0A 3ZKQD 3NCJL 1CL7L 3EOYG 2D03L 5ACLA 25C8L 3O2WL 3G5YB 5J06A 3BPCA 1CQYA 5DMIH 4FTVA 3UPCA 5CLWA 3OR7A 4M5ZH 3M17B 5J3HD 5E9DB 1HNGA 4HH9A 2R1YA 2Q8BH 1T3FB 3DX6A 4LLAA 5FIEA 2X42A 4G9FA 1JK8A 3H9SA 4HC1L 4ETYA 4MAUL 3QZWA 4PRAB 4GAJL 5I1KH 3HNSH 4L5FH 1INDL 1QR1A 1CVRA 3KYAA 3RHWF 1QSEE 3E2HC 4HBQA 4CVUA 5EPMA 3PNWB 5KAQG 2LAAA 4KUCF 5EFIA 3IXAA 1EEZB 1U8KB 1SY6L 4K7PH 3RWCB 4K3DH 4Y5YB 3EYVB 1FGVL 1RIHH 4MJ6B 5LVEA 4Y4FA 1A6WL 3QEQE 3G6AA 4G7VH 4XAWH 2QTEA 4WFHD 1FP5A 1KBGL 5CCKH 5J13C 4J3UA 1A6TA 2ADJB 3IDXH 1EA9C 3HZMB 2BC4A 3V4UH 1W0WA 4OD2B 1JPTH 3HA0A 1UYWL 4X0KA 5EC2B 4ZS6D 4HS6B 3GJEB 3A0OA 3RWDB 3QXTA 2EXYD 5GS0L 5C2BL 1CT8A 2ADGA 3IDNA 5BMFL 3VWJA 4IEFB 3SE8L 3MUJA 1IAIL 5IWLA 5H35B 4ODSL 5CINH 1U91A 3O3AB 4PGCB 5L7XH 4NWTH 2V9TA 1WBZA 1A3LH 3G6JE 5LGHH 2QBWA 1UXSB 3VMOA 3JV4A 3SE9L 3FZUC 1ADQL 2AKRB 2WNGA 3ZKXC 3GNML 1KGCD 1R3IH 1PAMA 4HWZA 4GG6A 5JHDB 5JXEA 2NTFA 2JLLA 3OKNB 3LEXB 2H6PA 4OGAD 4Q9BA 4OCRH 1AKJB 3D39A 4LSUH 1S7UB 4LP4A 2DM3A 2HP4A 3ARSA 4OLWH 4ALAL 5IMLB 4NQTA 3QZWG 5SV3A 4LQFH 3P11H 1TJIH 3B8SA 3HC3H 2ITDB 4NKIH 3VRIA 3RIAK 2HFEA 1FQ9C 4LHUD 5J11C 4PRHA 4BH7A 1J18A 2FHCA 5A3IC 4I9WE 1BIIA 4MD5A 3QA3B 4YXKH 3MLZH 4XPFL 4HXBL 1F6AB 1QUNA 4EEEA 5EN2A 2LVEA 2DQUH 5EZLA 2Q8AH 1MRCH 2O93L 5T1KA 2XWBA 1NGYA 4CDGC 4JQVC 5H94B 5T1MA 3HI6L 4KROC 3DOSA 1XGQA 2J4WL 2KL6A 1S5IL 5DHXB 2NXYC 1F5WA 4AQOA 1FL6B 4Y2DD 1NJ9A 3QR2A 3ZHKA 4AY0A 1QSEB 1CU4L 5DJ6B 2BNQE 1GGCL 4UBDD 2A6KA 5E08L 3MACH 5EBLA 2O5YL 3FFCE 3QWQB 1T0NB 1ACZA 2JKXA 3QUXC 4CMHB 4ZO7A 2E5EA 3RPIB 1WAAF 1U2CA 2YD8A 1G84A 5JW4Q 5AD0A 3QCUL 3QEQB 1I1CA 1K4CB 4FQ2L 3SBWC 2ZCLL 4RFEB 4EVNB 2VTFA 3AM8C 5GJTH 1MHCA 4F37K 1CN4A 2C5DC 4R4FH 3BT2H 1G9MH 2Z8WC 4HK0B 3TZVD 3DMMA 3PWJB 1JVKA 1MCPH 4LDOB 4XVTL 5KSBE 2CQVA 2XNAA 3MXVH 1I1AC 3QHFH 1U93B 5E7BA 1JYNA 3RY6A 3EOTH 2VDLL 1HXMB 5FO7B 1KACB 3LIZH 4NT6B 2IQAB 1XR9A 3MV7D 4XWOD 5FECB 3G6JB 1N2RA 3H3KA 5ID0A 2XXCB 1CICB 4K3EL 3S3SA 2APXA 1FHGA 4XBPB 5ISZE 1JHTB 2GSGA 1ZAGA 1CI5A 1HCVA 5E99H 1K3ZA 3S36X 1EFXD 1T83C 5DQJB 2D3VA 3TNNB 5ERWB 5DHVH 3DVIA 3R1GL 3LVEA 5A1AA 3TZVB 1S9XB 3L6FA 2EXWC 5CSZA 5I1HL 3MUY1 2KQMA 3TN0D 3U4AA 1A3RH 1KB5A 4GXUM 4U1LA 1QO3A 3OB8A 4WI7A 1I3VA 2FO4B 3IJSA 2BHYA 4MHHI 1V5JA 2XTJB 2ZCKH 3H42L 2BNQD 3GEWB 2B1HH 2XRAH 1P4BH 1FNSL 1QLEH 1XGRA 1BAFH 4MDJB 2AXGB 4P4RB 3STLA 3TEUA 1ND0A 4JHWL 2V2XB 2VKWA 3DVGB 5GGRA 1MJUH 4OZGF 5EOCH 5J6HB 5ITFA 4MNQA 1T2JA 4NFDA 3JV6A 5I1GL 5ICYB 1J5OL 1S3KL 3VXSE 4WU7B 5ANMA 1ZKAA 4PTUB 1J10A 3VCLB 4X4YA 3G5XB 4PG9A 5K9QG 1YYMH 4ZDHB 3ES6A 2RGSA 1YEIL 3ULUD 4PLOB 4G8IB 3WNMA 1AO7A 3WFHA 3Q3GB 1RURL 5D7JB 3L3OB 3T2NH 2DQEH 5EDXA 4JG1L 1OL0A 3DECA 4JPKH 4TULL 1H3WM 3KPLB 3FFCB 1WITA 3AREB 1M71B 3TVMD 3KWWB 1FNHA 3I3EA 3JV5A 5ISZD 3MRFB 3U46B 1P4IL 5ALBL 5E6IA 2VITA 1JGVL 3LV3A 2V5MA 4HLJA 1YEDB 5ILTH 4IOFC 4ODUB 1X6LA 4BK4A 5L2JA 4E0RA 2ZJSH 2V2WB 4Y16D 2XZAL 1X4YA 5MEPA 3RWJB 4Y4FC 2Y5EA 4Y8DC 3OG4B 4H5SA 4ZFOA 4F2MB 2J12B 3V6FA 2VC2L 5ESAB 4AG4L 1KEML 2O26U 1CYGA 5D7KD 4U4BA 3DPBA 4AEEA 1IGYA 5L0QB 4LCUA 3GJFK 2P5EA 3MBXL 3HC0A 1XGTB 1EVTC 4DN4H 2IALB 2M8XA 5HY9B 1XCTA 2IANA 4CJ1A 3B5HA 4FFVC 3BEVA 2I60L 4R0LA 5ISZB 2XPGB 1KTLA 3V6ZA 4PRIE 3LS5H 3VWJC 1YY8A 5IWLC 2YXFA 4YDVA 4C55A 4XMLH 1KYOJ 1T20A 2H2PC 1SVZA 5J6GA 4Y4HA 1VPOH 2MQCA 3IFNL 3IFPB 3QNXA 1J0KA 1FVDA 3R06A 3D85A 5I8EA 1QBML 3BQUD 1FAIH 5HGBB 2AJ3A 2B5IB 1ZHKB 4GOSA 5MHSE 3PHOA 3LB6C 4LPWA 5JXEC 4WI5A 1X5HA 5D9SA 1S7QA 3P4LA 3SY0B 4UINL 3I2CL 4PR5A 5D93B 2W9EL 5DT1L 3GSWB 1XR8A 3P9MB 3SO3C 2EH8L 1T3FA 4P9ML 1LEKB 1NC4D 1AR1D 3TJHC 3VFRB 2JELL 2G9HA 3UEZA 4PJFF 2DJSA 3VXSB 3MLWL 1JNHB 4RRPG 1NGXB 3PNWA 1PX4A 2JCCF 5JQHC 4P5MA 4HIEB 1EEZA 1IARB 1WZ1L 2MCG1 3KNBA 4TSCL 3CFBB 5HGAB 1JF1A 4QRPD 3PQYE 3DSFH 2Q6WB 3RBSA 3EDJA 5CIPB 1EGJA 3HNTH 3HZMA 3FB6B 5T1LA 3MZTA 4LLWB 4MX7B 1F3JB 4FMKA 3DRTA 2BY2A 2BNUB 4PJXE 4YHML 3GM8A 1F6LL 3OSKA 3V5DB 2BP3A 3GJEA 4N9OB 4PRID 3GBNL 2C1OB 1AGBB 4G6KH 2NY7L 4W6YB 3ZKND 1KCSL 4QT5A 1ZLUK 4C57C 1VKXB 1ZA3A 1MCKA 4ZOBA 3S3PA 4UT7L 4R6UA 4K94C 3WIIL 2UVFA 2EO1A 43C9B 4OCYH 3UBXI 3VFNA 3S88H 4P3CH 1UXSA 2JE8A 1UWXH 3MLVH 4FZEH 5BV7L 5F7FA 1W72H 4JE4B 2AKRA 4DKEL 5JMOC 5JHDA 1QSFA 3UYRL 2AXJA 1CXKA 5IESL 5DTFA 3FQWB 4HJJL 1Q0XL 3DMMC 4R96B 4EUPH 5C0DB 5E5UB 5TGBB 1S7UA 3QEGH 3P4NB 2K7QA 4XH2B 1L7TL 3RY6C 1N0XH 5EORH 4PRIB 5DQDH 1L6XA 1EJOL 3GB7B 5IB4A 4HHAB 5LQBH 2AGJL 2UUDH 3HLAB 3HFMH 2R39A 4ZUVB 1X5FA 1JPGA 1TQCB 4QYOB 4C58B 4XNYH 4NFCA 1GZPB 2YPLA 1MCQA 4WV1A 3L3GB 2CRZA 1J1PH 4RAVA 5CEYB 2A6JB 3T2PA 1IGMH 2FGWH 4M7LL 1XF4B 3RVUD 3PQYD 4WTZA 3RNQB 4G5ZL 4LVOB 4RDQG 4MJ4A 3EKCA 3VGBA 4IDJL 1Y6NR 3IU4H 3NCJH 1CL7H 25C8H 2VISB 3NN8A 3O2WH 2NXZD 4DFHA 3W81A 2ICWI 2HT2C 3WIHL 4P3DB 3LQAH 4LBEA 3GMLB 1JPSL 2VLMD 4MJIE 1R3LB 1DUYA 4BM7A 2DLGA 2X41A 1IQDB 1IFHL 4GBXB 5T33L 1P7QB 5I1LA 5IK3B 4CU7A 1A14L 5F89A 4MAUH 4GAJH 4MD4A 1A1OB 1INDH 4OZ4A 3B5GA 4XPTL 1GYAA 4ZOAA 4O2EA 3QEQA 3CDYA 1WTGT 1VEPA 3PQYB 4EVNA 1MCCA 4NRYA 1FDLH 1SY6H 1RZFL 2XIDA 1SYVA 1FGVH 3GKWL 1TZGH 3A6BL 4U6XA 1MEXL 5D1XB 4HK0A 4MXVE 4PJXB 5ESVB 1KBGH 4OI8A 5K9KB 5CJBA 4K07A 1JPFB 2AABL 4LCYB 4H1LH 3MMEB 4JFQB 1U93A 4WWKA 4N0RA 1CK0L 3AS2A 4JGJA 2VDQH 3BIAX 4FNLL 1HXMA 3KYOB 5FO7A 1UYWH 4QXTA 5F6IB 4OCSL 4YPGB 4EJ1C 5EZJB 5CAYB 2IQAA 4N0CC 5GS0H 5C2BH 5E6IC 3MCKB 5BMFH 3SE8H 1IAIH 4M48H 3LDBC 2PXYD 1JHTA 5GIRA 4WTZG 4Y88A 5HVGB 2Q20A 5KSVB 4HH8A 4J3SA 3NABL 4M1DL 3O4OB 3TP4A 5C09E 5ERWA 3R4DA 2GTZB 3SE9H 1ADQH 3MV8B 4LPVA 1S9XA 2OZ4L 2C4FU 1GGBH 3FCTB 4X6BA 4MXQD 3HCVA 3PP4L 1Z9LA 4OM1L 3LEVH 1B0RA 2FO4A 1T21B 2Y07L 4ALAH 2DB8A 4MDJA 2AXGA 4YPJA 5M7QA 4R0LC 3IDMA 3QQ4B 2V2XA 5BJTB 2D4DA 1BWWA 2PXYB 1TDQA 4Y2OA 2PETA 4V2CB 3O3DA 4QXWA 4Y4HC 4LLDB 2BDNL 4UT9L 5ICYA 2AXFA 2BOCB 1FYHB 4QRRD 3S34L 4YDIL 3E6FB 4XPFH 4HXBH 5DMGC 4PTUA 2JJTA 3RZCA 3SGJA 3CC5A 4PRDA 2D7QA 1K85A 1F3DJ 5D7JA 3L3OA 5ECJE 3HI6H 3BN9C 4MJIB 5I8CB 1IEAB 3IXTA 4YHPB 2J4WH 1EO7A 2FH8A 1S5IH 1IKNA 1G6RH 1ZA6B 1LDPH 1E4WL 4UV4H 5IFHH 3KPLA 5MP6L 3QDGA 4KC3B 1DEEB 3AREA 2BVOB 4LLQA 2RQ8A 4QEGA 5MERB 1ONQA 3U0WH 1CU4H 1XGYL 1T1XA 1KULA 1GGCH 4A6YL 2MKWA 2WWKO 5IV2A 5E08H 2O5YH 1YEDA 2FH6A 4NYLB 3VFGL 4AEHL 5IP4A 2W60B 3D25B 5C09D 4ONOA 5KSAB 1T7WA 2VDOH 2V2WA 3QCUH 1D5ZB 4FQ2H 4JM2A 4J3TA 2ZCLH 2QLVB 1RHHA 5IMMA 3MGOA 4OLZL 4U6HA 5CLTA 4PJ8A 3DARA 5ITBL 1I7TB 2J8HA 2ERJB 4R7NA 5DEZA 5DVOA 3VXQA 4XVTH 5DJAB 1DEDA 1SJEB 1F4YL 3UP1A 1PEZA 3PWLA 5LGJA 2AQ1A 2IALA 1JGDB 2P1YA 5HY9A 3R8BB 2VDLH 1FAKT 1VADA 3QCVH 2EDDA 1A9EB 4LDEB 1I9RL 1MI5E 1KB9J 2AQ2A 1FSKB 5HYSG 4KI5C 4PJGF 1OD9A 1PJ9A 1P2CB 1AGDB 4K3EH 1KIUA 1NAML 5FV2A 3IFPA 3QNYB 4DOHB 4MLSA 3H3BC 2EEAA 1YN6A 4PYGA 2Q87A 3FRUB 1JRHL 1VFBB 5E8DL 1FL5B 1UB6B 3BGAA 2PR4L 4XPGL 2DIBA 3SY0A 5C07E 4GH7B 5I1HH 1NL0H 1XAUA 4RAUB 3RKDD 4EI6A 2JJVA 4WGVB 3P9MA 3CCHB 4N68A 1VB9A 3OKLB 3ARGA 1CXHA 3H42H 1OP9A 1LEKA 2NNAA 3QUYB 1FNSH 5T3XD 2OTUB 2R29H 4NQEA 3V0VB 3VFRA 4JFPB 4KZDL 4HV8B 3ZT5A 1PY9A 4JHWH 4DGIH 3VXSA 3O2VH 1MQKL 4XP4L 2DJUA 1LK2B 3HNVL 3DVFA 1J0HA 1OAUL 3FQTA 4WV1C 4HIEA 2P8LB 2FECL 3ROOB 3PGDB 3SPVB 5I1GH 3KPRD 1WC7B 2K9UA 1S3KH 1OP5H 1PZUB 2H26A 2OP4L 3SDXF 4JZOB 4UMGA 4XCYB 4M61B 2VLKE 3NZHL 4XVJH 2Q6WA 1YEIH 2JK5B 1ZS8B 3BDXA 3ARPA 4Z8FL 5I76B 1RURH 5EU4B 2YOCA 4LLWA 1F3JA 2OTWA 1M6OA 5JZ7C 2R23A 1LP9E 2VH5H 4JG1H 3V5DA 2IH3A 4HUVA 4TULH 4MB5A 5EU5A 2C26A 3D2UA 1G7QB 1I1FB 2NTSP 1VKXA 4OSUL 4U31A 5DD0L 3UMTA 4JFZL 4C4KT 3L5WB 5I30L 1P4IH 5ALBH 4I0CC 1JGVH 4K94L 5DD6B 2X4OA 3QUMA 3W9DB 4DEPC 3WFCL 4Z76B 4OCWL 1NFDF 3S37X 1SBSL 3NH7L 3H3PH 1AIFA 2XZAH 2OBGA 3BD5A 5EBGA 5L9DL 1X44A 3VGFA 3KPOA 3TBVB 1JBJA 3ZL4L 4R96A 4P2YA 4S1QL 3RVWD 5TGBA 1BOGB 2OXGA 3QIUB 4JZNB 4AG4H 1KEMH 2APVA 4WWKC 2VZSA 5I75B 1MI5B 3LSOB 2HT4C 3MBXH 3GB7A 4Y1AA 3OMZA 1MY7A 4KY1L 4J3XA 2I60H 4OQ1A 5AEAA 4ZUVA 3ZYJA 2FCBA 5H8DA 2WV3A 2ITCB 3MJ9A 4F58L 1KIPB 4PJCA 1YEKL 4QYOA 3WNNA 3BESR 3SQOL 5DRNB 4HG4J 5CEYA 2A6JA 1P84J 3H7LA 1TLKA 5DEFB 1XF4A 3IDGB 3IDUA 3C8DA 2VLKD 3RNQA 4TN9A 1A7OH 1QBMH 5C07B 2YEZB 1AGEB 1OTSD 5DK0B 2IADA 4J1UB 1KB5L 2VISA 4P49A 1JZ7A 3K1DA 3I2CH 2W9EH 5DT1H 2XTJC 4K9EL 3RVTD 4OT1L 3TC9A 2EH8H 1KXQE 4P9MH 1P7QA 1QFUL 5IK3A 2ED8A 3SJVA 2JELH 3JSSA 1KNOB 4KTYA 3P9WB 1N5YH 3WS3A 3O41B 5IB3A 3SDCD 3VA2C 4R4BA 1YDPA 3B6SA 3NCYP 5DQ9B 3NFSH 1WZ1H 2F19H 2P47B 2JJTC 3RZCC 4TSCH 4GKNB 2IAMD 3VRLF 3SGJC 1DBAL 1JGUL 2BOBB 1RZ8B 5D1XA 1XZ0B 5D7JC 4PJXA 5ESVA 2W9DH 1LP9B 1OAKL 2IBGA 1P5UA 4XC1L 5DEGA 5FK9A 2CKBA 3MMEA 1IKNC 3DURA 3BP4B 3GBMH 5FGCE 3U30C 2XV6B 4YHMH 1PY4A 1B2WL 2G5RA 3AREC 4U0RB 5EUKB 2DM4A 3GBNH 2QL1A 4P2OA 4JKPL 4M3JA 5JW3L 3MCLL 2XFXA 1ORQA 2BRQA 1KCSH 3MRRB 4FG6C 3WFEL 5E8PB 1JTTA 3H9HB 3TYFB 2D7NA 4UT7H 4B41A 4KUCD 1JNLL 1NBYA 4M5YL 3WIIH 5HGGS 3TCLB 5IVOA 4JM2C 4Z5RA 2IAMB 2ESVE 3AY4A 3LRHA 1CXIA 2ZUTA 4GRWF 3VGGA 4ZFOL 2ZWLT 3MV8A 4DKEH 4PJ8C 1HSBB 2F53E 5ACZB 5IESH 4HJJH 1Q0XH 4Q97A 2VLRA 2FYYB 4PJHA 1WWWX 5AG8A 1CGVA 4CADB 3I50L 4YHOL 3MRPB 3O4LA 1OLLA 5TF1L 1T21A 4RGNC 2AQ3A 5I19L 1E4KA 2E7CA 1I8KA 2B4CC 3IKKA 1EJOH 1E6JL 3QQ4A 1BQHG 2Y5TB 3ULVL 4M8QB 1A22B 2AGJH 3U0TB 2EDBA 1A7QH 1N6QL 4NNYA 3L1OL 1T1WA 4JY5H 4NNXA 1WAAE 4LLDA 3I75A 3S35X 4ODWB 3GRWL 4NUGL 1C16B 4PJEF 4OZHB 4M7LH 1KTDA 1FFNB 4O2CB 4CVZB 1UJ3B 4G5ZH 3HTLX 5JQ6L 1UWXK 3G08B 5IMKA 4IDJH 2EDTA 4K7PY 5I1EH 3MV01 1IEAA 3B83A 4Y5VA 3HE7A 4KKCD 1R0AL 3OAZH 3O81A 4Z7UF 4ZUSB 3GSVA 3WIHH 1FNFA 3BEWA 2HVJB 3ARGC 2N56A 1DEEA 1JPSH 4U1GC 4OV5A 1JWUB 3HHRB 3P30L 4D8PB 1HXYB 3SKUD 5IOPB 5T33H 3LN4B 5F88B 1V3MA 1FLRL 1A14H 3N06B 1BLNA 1Q8MA 2NY6C 3NPSC 2DDQL 2UUDK 1DCLA 2P8MA 5JPMB 2ESVD 5KSAA 2GUOB 3OKKA 4QXGL 4GMSL 4JFFE 2ENSA 1RZFH 4KRNA 1GC1L 2F53D 1S78D 4HPYL 5J12B 3GKWH 4U3HA 4MLIA 1RZKL 1U3HB 1AP2A 5L88L 1MEXH 5FGCB 2CH8A 5D7LA 2PCPB 5SWZE 4APQA 4F7MB 3C8KB 5DJAA 1SJEA 2AABH 5KANI 1WISA 3UTTA 3NPZB 4JY4A 4OKVB 3WFZA 1CK0H 4BZ1L 4FNLH 2DLFL 4ZAKD 2R15A 4S2SB 3ROLB 3TBSA 4OCSH 4YO0A 4W6WB 5C0NC 2X4SA 2JB6A 2R69L 4OZGE 3X14A 2YKLL 5F9JA 1P2CA 2V9QA 1OTUD 1C7SA 4N8VG 3WNLA 3VFSB 2IFFL 1I8IB 1SEBA 1IZJA 4M1DH 5KSUB 4CW1B 1FL5A 1JJUA 4Z77B 3STZB 1T5WA 5DDHA 2OZ4H 2WBKA 1CGWA 2H45A 4KK8C 5CEZL 2GY5A 4LP5A 5JDSB 4RAUA 4CAGA 3ABZA 3PP4H 2X4RA 3CCHA 4OM1H 3C9NA 5D2LA 4P4KA 1GH7A 3OKLA 2Y07H 5M94B 1QKZL 3QUYA 3FAXA 4EKXA 3S36L 1O7SA 3OKOA 4KU1A 2C3XA 2FWOA 3SDDD 2ED7A 1TQCC 5I1JL 1QFHA 5D7IA 3ARDB 1PGRB 1LK2A 4YHZH 1MFDL 5CUSH 3FO0L 2P8LA 3SPVA 4UT9H 5DJ0A 1DL7L 2E9JA 3OKDB 3B5TA 3S34H 4W6XB 4YDIH 2OYPA 3WJJA 4F8TA 2BVQB 1U8LB 4ZPVA 5JORA 3O9WB 3VD5A 1HN1A 1D7FA 5SWZD 2JK5A 2Y72A 1ZS8A 3TWCL 1KV3A 5HDQL 1L0QA 1QG3A 3EJYD 3S3JA 2N7BA 5IGXL 5FKAA 1FZMB 4KKLC 5EUOF 1WZLA 1LO5B 3OBAA 5HHMD 1E4WH 1ZV5A 5SX5H 5FA4A 1G7QA 3C60A 4RBPH 4BUGA 4WHYG 3U83A 4NO0A 4C56E 5FGRA 3L5WA 4A6YH 4F15B 4PIRF 2R2CA 1VFOA 4LCWB 4JFFB 1MPAL 3VXME 2CD0A 4Z76A 4PP2B 1QFWH 4TVPL 3TH4T 4OTXH 2EIEA 4QCIB 1NC2A 1F45A 1FYTE 1WFUA 1EHXA 4J8RB 5JOFA 4OLZH 2RHEA 4AENA 5D1XC 3V4VL 3T2OA 2HT3D 1BOGA 2LQRA 3QIUA 1HHGA 4JZNA 1RZGA 2W38A 5I2IB 5ITBH 4M1CD 4MCYB 4CN6A 5AAWA 3RL2B 2VXTL 3HRZA 1MI5A 5DC0A 4I48B 4OZGB 4XTRD 4CMMB 4P2OC 3MO1B 3QG6A 5C0BE 5GGQH 4GMTL 1I9RH 2APFA 4PJFE 4D9RD 3RNKB 2RR3A 3EYOB 2MQ0A 4R3SB 3VH8B 3UTSA 1NAMH 5DEFA 5HHQB 3O4OC 3MC0A 4ONGH 5E5MB 3QFJE 5K93A 3AY4C 3QPQD 5CD5D 1JRHH 5DK0A 3V79C 5E8DH 1T6VN 4Q2ZB 2EZ0C 4N1CA 2HTLD 4EN3B 4GUPB 4XPGH 3WXWL 2Q3ZA 3KPQB 1I9JL 3HI1B 4KVNL 4PD4K 3V7AE 3VU2A 5T3ZE 1E4KC 2IMNA 2Z0BA 1RK0B 4C56D 1S7XA 2X4TB 4NWUL 1N7MH 2GJ6B 3UTZB 3WNOA 2FR4A 5C0AE 5HD8D 1FJ1A 2D7TH 3T0XA 4KZDH 5BZWB 4X6EB 4L4VB 5D1ZD 2YXMA 2EEDA 4WO4A 1KEGL 5F8QC 3O41A 4XGZA 1MQKH 4XP4H 4FQCH 5KAQF 1FCCA 2MHAB 3HNVH 1OAUH 3KPMB 5DQ9A 5B38A 4LLVA 2VJXA 3IRZA 1CF8L 1CBVL 1MCWM 5MENA 1ITCA 1FVCB 2BOBA 4R7DA 4D0CA 1XZ0A 3NZHH 1L9NA 5GSVB 4ZO8A 1IQWH 4OF3A 4Z8FH 1U8OB 2W92A 4Y5VC 3HE7C 4JREB 1A5FL 1T2QL 5DRXA 4G6AC 2ZOLA 1I1YA 1ORSB 2DQJL 1M7DB 5IBLD 3BP4A 3MOAL 4P2RA 1CE6B 5C0BD 3U9UB 4QRQA 5EUKA 3RUGA 4OFPA 4YR6A 3ZKSD 5EIVA 5D1ZB 3VXMB 5A2IH 4AM0A 1QA9B 4DZ8A 3EHBD 3AS1A 3H9HA 4LEOA 4MA1C 5DD0H 1FFOB 4JFZH 5ABDE 5GS1B 4TUKL 2OS7A 3RJQB 5EU7C 5GQBA 4K94H 3ZE0F 1FYTB 5DK2B 5CGMA 2OI9B 5KSAC 4YHIB 3GSNB 3QPXH 2APBA 1MFAH 3MA9H 3WFCH 4OCWH 4KDWA 1SBSH 3BWAB 2GCYB 9CGTA 1T22B 1VERA 1UM6L 2ZOKB 3NH7H 4HLZH 3T77B 4AEFA 3LY6A 5L9DH 3DETD 3LN9A 4UTAL 4ODXB 5K9OB 1OP5K 2MWCA 1I7UA 3ZL4H 4S1QH 2FYYA 4APQC 1TVHA 4IRSD 4CADA 3L3KB 4QRUB 3MRPA 5L2KE 2FD6L 3QNZA 3SN6N 2DQGL 2SEBA 5C0CE 1GVIA 2P43B 5F8RC 4KPHL 5C0BB 1A9BB 4ZNEA 5I9QB 3LAFA 4O2FB 3A6OA 3NGBB 4PJFB 4ZUTB 3BGFB 5B22A 3BRDA 3MA7A 4V1DB 1FN4B 4M8QA 2JCCB 1FSKC 4NO5B 3S5LA 4K3JL 1DBML 4JAMB 4MCZB 5DHVB 3CD4A 1Z9MA 2DBJA 5B38G 5IF0A 4L9LB 1G1YA 3QFJB 1L0XA 4F58H 1YEKH 2H8PA 3L3JA 2DTML 3EGSB 3KS0H 4YLQT 2APTA 2IWGA 3KHQA 3SQOH 5HHPB 1S7WB 1RJCA 4OZHA 2W59A 4NHUA 5CP7B 1IAKB 3RI5F 3ZTJG 5K9QI 4L8CB 2EDYA 4LASH 4Y19D 4JFHD 4Q0XL 1LILA 4G6FB 3G08A 2B0SH 1QNZL 2KQNA 5H37G 1KTKE 1VENA 2IH1B 4G8GA 3MRCA 1KB5H 4WI2A 5JDJA 2E27L 4P9HC 4ZUSA 1RZ7L 3T1FA 3IETB 1WIUA 1BQUA 5C0AB 1WV7T 4P4KC 2DL9A 1NBVL 2WQ8A 2ZUWA 3MRHB 3PWPA 2NY1D 3QUYC 4OT1H 1YNTA 3OF6D 2YC1B 3NACL 3FT3B 5F88A 2KPNA 3W0WD 1QFUH 5F7YC 5INDB 1ODAA 4ZOEA 3Q6FA 4L3ED 4I1NB 1BJ1H 4L29B 3NMEA 3BH9B 1MIEL 1OHQA 4OF7A 4L4TE 3WJJC 4GG6F 4G8EB 1CFNB 2VL4A 5IR1A 1VGEL 2VN4A 4QF1A 1CDHA 1DQTA 4QRTB 4M4RA 2PW1B 2AV7B 1U3HA 4B0MM 3RX5A 5L2KD 3RZWA 3BHBA 4YUEL 4F7MA 2K7PA 1OAKH 5C0CD 3HR6A 4XC1H 5EWIL 4Q9CA 5DJXB 1JHLL 5CD3B 1CIUA 1TJGL 1Z5LB 3O6ML 1IGJA 2NZ9D 2V5TA 4OKVA 5LBSL 2R1XA 3VMNA 3S5LG 2ZUQC 3O8XB 2HKHL 2XT1B 3KYKL 3C60C 1B2WH 2VXVL 2BY1A 1I3UA 2BVUA 2BVYA 4YJZL 4G42B 3ZE2F 5HVHC 4JKPH 5JW3H 1R5WA 3TF7C 2P44B 3QQNA 3WFEH 4JDTL 2HVKA 1JNLH 2VNCA 3PG2A 4Z0BL 3SHSA 3HG1D 3I84A 5KSUA 4TYUA 4ISVB 4XI5C 3SKMB 2P8PB 4HIXL 2VR4A 3BZDA 4GRLD 2VXUL 4UT6L 4X5LA 3STZA 5L2KB 5IM7A 5C0CB 4MMXC 2CR3A 3O3UN 1I9EA 3QIUC 5EO1B 3KG5A 5JDSA 4G3YL 2VXSH 3I50H 4YHOH 3MZGB 5TF1H 2XWTB 3PGCA 4HDIB 3B3IB 5I19H 4M1GL 3JTSB 2VQUA 1E6JH 3WDHA 4Z7WA 2CLZB 3VFTA 1S7SB 1K6QL 4KFZC 2IPUK 4JO2L 1KOAA 1AJ7H 1X3DA 3VW3L 3BE1L 3L1OH 2R2EB 5F3BA 2RAMA 1B4JL 1BVKA 4F8QA 1QRND 3RU8L 1TJHH 4YK4B 1FV1B 3GRWH 2DN7A 4M62L 5DVMA 3HC4H 2GITB 3MV9A 1MCIA 4WUKL 4RZCB 1HEZA 1YC7A 4WRLA 5JQ6H 3PGFH 1MELA 2M2DA 4PRPA 2R9HC 3UAJC 3EJJX 1R0AH 4DTGH 3VGAC 3E0GA 3CVHB 3OX8B 4JPWL 3FOLB 2VUOA 3BDYL 3O0RL 2XA3A 4K23L 3HUJA 3AFLA 1G7JB 3V7MA 4WO4C 4PJGE 3UBXB 4L4TB 5M95B 3TLRA 5MEOA 1VFAA 4LCWA 4JFFA 3V9FA 2DDQH 2HFFA 4ETQA 4NO3A 2YPKA 1ZGLB 2FX7L 5CILL 2P7TA 1FZJB 4QXGH 2QADD 1LVEA 1AD9A 1A6AB 4GMSH 2YUXA 1WT5A 4FFWD 3WO4C 1KC5H 1M7IB 3BI9X 1GC1H 3C5SB 4K3HA 4HPYH 2X9WA 3VXRE 2PUQT 1HH6B 2HAZA 1HSAB 5L88H 4CDHA 1TTFA 1A7PL 1EH9A 4LHUA 3H6JA 3RL2A 3WUWA 5IT2L 1AD0A 1JNJA 2W0KA 2XI9A 3P77A 1MCOL 4HF5L 2EH7L 3OAZK 4YBLC 4BZ1H 2DLFH 4NSKB 4TNVF 3PABB 5HJ3B 3SDAA 2A74B 1EPFA 2I9LA 2ATPB 4I3RL 4LPUA 5F1NB 1BPVA 2YKLH 1H15B 4K55A 3VH8A 4HD9A 4HCRL 3MLYL 5LJYH 5DK3A 2LTQC 2QADB 1K4DA 1S9WA 3OV6A 2XG5A 5DJCA 3T65A 4HWEL 2P5WD 3FO9A 3IAGC 3F6IA 3SDXE 4BSVB 1CDIA 4X7TB 1V7NL 5JR1H 2GYSA 4Q2ZA 2WMPA 2VERN 1VESA 2ZP0T 3MXWL 1FGNL 1I3GL 4POUB 3IU3A 3S9DB 2ICWB 2VQ1B 2RFXB 3KPQA 1DQML 5CEZH 4JQXA 4M6NL 1A8JH 3MYJB 3TIEB 3P4OA 1HILA 2X4TA 4Z7QF 1MNUL 1QKZH 3MPCA 1PX3A 1UKSA 2GJ6A 4YHLH 4PRBB 4ZOCA 1J1XL 3S36H 4X6EA 5HYJD 4L4VA 5K9JL 3QIWB 3LKQA 3D18B 5JXAL 5I1JH 2DMBA 1T5XA 3SGEI 5BS0B 1I8LA 2HJKA 3DROA 4NBXB 1MFDH 1NGPL 5C08E 2FL5B 3FO0H 4HUWA 5JPNA 1DL7H 2AAVA 4LIQE 4IIQC 2B2XL 1FVCA 4LHUG 1FNEA 2Z8SA 5J1TC 3WUWG 1IM9A 1EHLL 4BELD 3TWCH 3U1SL 2QHRL 3CZJA 4XWGL 3FRPA 3GMPA 5IGXH 5GS0D 3L95A 1T1ZB 2R0KH 5I74C 1SQ2N 3RGVD 4EIZC 1WEJL 2V5RA 2BXZA 3O6FD 1EFXA 1KELL 1MJJA 4PJGB 3THML 3LKNB 2YWYA 3FQUA 2CDGB 3BKJH 5F7KC 3KGRA 4RISL 2V2TA 5DFTA 1YEGL 2ZSWB 2BHZA 4LKCB 4ZNCD 5CMAB 4F33B 1FYTA 5DK2A 4LRIA 4YHIA 3GSNA 3BKCL 1MPAH 2IGFL 4FQXC 4R2GD 4U1MA 4TVPH 2GCYA 1T22A 2PYFA 5DMJB 3VXRB 2ZOKA 2HJLB 3MUGB 4MAYD 3VMPA 4U1NA 1U3HC 4ODXA 1AGFA 2QJDA 4NQDD 3LH2L 4HKXA 3HAEA 3B9KD 1R3JA 2F54D 3L3KA 3E1F1 4QRUA 3UYPA 1CZ8L 3G6DL 1S7RB 4YIQB 4LQ1A 3P73B 5FYJU 4BQ8A 3B4NA 3MNVA 4JFDD 3O6FB 4NHCH 4XPAH 3K4DA 4O2FA 4HX1A 3DV6A 1TCRB 1J1OH 1OVZA 1KPUB 2X9XA 3WHXA 4V1DA 2JCCA 4NO5A 4GMTH 3T4YA 1RUML 5SX5K 3P2TA 2IBBA 4RBPK 3BOVA 4PV9B 4EXKA 3SDXB 4MQ7A 4O00A 4XC3H 2FLRT 4LLUB 2VZ1A 5IQ7L 1KJVB 5J3HC 3PF2A 1NBZB 4RDQF 1Y18B 3GSXA 3VRLE 4OZFB 3QJHA 3S4SB 1E4XL 4JPIA 3C5ZB 2ADIB 1RJLB 2CPCA 1BBDL 2C3VB 2FJHB 3WXWH 2YRZA 1T4KA 4IHOB 1FFPB 2N7AA 1I9JH 4P99A 5C0EB 1PDKA 4KVNH 3IETA 3OZ9H 3RI5K 2PKDA 2W9LA 4MQSB 3GSUA 5FAAA 4Y16A 2MCPH 4KI5F 4NWUH 4OJFH 4ZPTA 4RA3A 5TF0A 3GMMA 4B7IA 5C08B 3SKOA 1NFDB 5EBWA 1J0ZA 1DUZB 1ZGLP 1KEGH 3CXHK 2F74B 1U6AL 4I8DA 4UUJB 4JRYE 1MCSA 3D5OF 5C86A 1R24A 4ZUWA 3FO2B 3LS4L 4G8EA 3VRJA 5B3NA 2F5BH 5ETUB 3HAEG 1G6RB 4ZS6C 1CF8H 1CBVH 2NX5E 5LXGL 4GRWE 3RVVD 5DD5L 5MEQB 1FCGA 2WZPD 2GJJA 2HN7B 4LCIH 5CZXD 1K3IA 4TSBH 2PYED 1I7RB 1RK1A 3IFOB 5DJXA 3L3IA 1A5FH 1T2QH 4BQ6A 2DQJH 4WFEE 2FRGP 2NY2C 3MOAH 4HIHB 4FQHB 1NCUA 2VDRL 4JRXE 4Q9RL 1NANI 4QHMB 3PWUA 4CBPA 3DLQR 3HPJA 4G42A 1MRFH 3BXNA 4BQCA 3DHJA 1J8HB 2QKIA 5BXFB 3CFJB 1Q38A 3P0GB 2WP3O 4JFXB 5DLML 5B8CB 4KRPB 4FXGB 2CIIB 3L3HA 4KKBD 5HGDB 2DQHL 4PJEE 1WT5C 1UM5L 1UM6H 5I8OL 1FRGL 4NKOB 1MJ8L 1MFCL 3CH1A 1C5DB 2HJFA 4TNWF 2XKUA 1GPOL 3WE6B 2H2SC 2WW8A 2ILLA 2DI9A 1I8MA 5C9JA 4NN7B 3QIBA 3G5ZB 2OJEB 1OAXH 1C12A 4LVNB 4DW2L 3B2UC 4Z7UE 4BKLA 5DYOA 2DQGH 3EO9L 3TO2B 1N5AA 2O61A 1J8KA 1OD7A 4KPHH 4KTDL 5E6ZA 3UTQB 4ODHL 3JTSA 3AU1B 1S9KC 3SDAC 4R8WL 4HMCA 4KVCL 1KXVC 3TH2T 4K3JH 5KG9A 1P9MA 1TITA 5LCVL 5DS8B 4JRYD 2EDKA 4P5TD 3LQZA 1CE1H 5HYQA 2D31A 1A1MB 4UIMA 5JW4R 4HBCH 2XN9E 1YYLL 4C83A 3HB3D 2C3HA 2GITA 2IQ9L 4ONFL 2VSDA 3AC0A 3RPKA 1MUJA 1P7KB 5BO1H 4Q0XH 3X12B 5DJDA 3QWOB 1QNZH 2XWJB 5JIKA 1CFSB 3DI2B 4WFED 4JQXC 2B8OT 1RJZB 3MRNA 3WHE1 1FIEA 2E27H 1RZ7H 2NCMA 1H8NA 1BX2A 2BSRB 3CVHA 3ME0A 3PDGA 4KMQA 4YHYB 4ORZC 3FOLA 4JJ5B 1NBVH 4HWBA 5FKPB 2EDWA 3KAAA 2QQQA 4OBSA 3FT4B 4P5TB 3UBXA 1WCBB 1BZ9B 2A83A 1I8LC 4PJDA 3BYYA 4PJ9D 4HPOH 4MWFA 3UROR 4L8BB 5EU6A 2NX5B 4GRWB 3MJGX 1FZJA 1MIEH 1G7LA 3WV0A 1FORL 1A6AA 1OGAE 3BVNB 3FQNA 2DD8L 3C5SA 5SWQA 1MHHB 1OPGL 3C5JA 1QSZA 4CVXB 1TENA 5CIPH 4YGVB 5D6CB 4JREC 5FOBB 4YUEH 4LF3B 4XWOC 2I24N 1ZXQA 4JRXB 7FABL 3LD8B 4WTXA 1GZQB 2QQNL 5EWIH 5D96C 1JHLH 3KYNA 1TJGH 3O6MH 4TSAL 5LBSH 2AJZA 5E2VH 3MNWB 2HKHH 3KYKH 4JDVB 1B4RA 4E41E 3DXAD 4D2NA 2X1QA 4NRXA 3B9AA 2VXVH 1OF2B 3CDCA 2A74A 3D69A 3QUZD 2ATPA 5HHVL 5C0IB 4JFOB 5F1NA 4N9GB 4JDTH 4PJEB 5C6PB 2HFGL 1WBXB 3QUMH 3WL9A 4LRIC 1ZLWH 4M9OA 3O2DL 2XN9D 4Z0BH 5BRZD 1Q9KB 1DN0B 3A67L 3RRQA 1BF2A 5AWNL 4X7TA 1CG9B 3LRGA 4G7YL 5FYJE 2GSIB 3ZSSA 2VXUH 4UT6H 4F7TB 5C0GB 4Z7UB 4RNRA 2YA1A 3ILQC 1DBJL 2Y7QA 1B0GB 4NOBA 4D0DB 3TIEA 3EO0A 4G3YH 5EUOE 5TH2B 3CAFA 3HRPA 4DZBB 3BGFC 2APWA 3VXUE