4XPAL

X-ray structure of drosophila dopamine transporter bound to 3,4dichlorophenethylamine
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
214
structure length
214
Chain Sequence
ENVLTQSPAIMSTSPGEKVTMTCRASSSVGSSYLHWYQQKSGASPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSVEAEDAATYYCQQFSGYPLTFGSGTKLEMKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transporter
publication title Neurotransmitter and psychostimulant recognition by the dopamine transporter.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transport protein/inhibitor
total genus 52
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2015-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xpaL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xpaL01
4O58H 5EO1A 2JCCE 3QHZL 4LLWA 3NMEA 2OK0L 4RNRB 4M1GH 1FV1A 3QULA 4UNUA 2PYEB 2Z31B 1JGVL 3WIHL 5GS0H 1VEOA 3W2DH 4XBEL 2EDQA 3AY4A 3L3DA 4NKDA 2Q76B 4U1GC 4LSVL 5C0BB 5CEZH 1EZVX 5KSUA 2UY6A 4PJAF 4KKCD 2C3HA 4WFFE 5ADPH 4EVNB 2F53E 2Y4SA 3LDBB 1P1ZB 2WUBH 3AVEA 2E27L 1T1ZA 4PBXA 4QWWC 5FUOH 5EOCL 1S5IL 2UUDH 2ARJQ 3BO8B 3X14A 1YN7B 3P9WB 3WDHA 5HXMA 3HZMA 5A2JH 4NC2B 1D9KD 3KS0J 3FHQA 4XPTH 1E28A 2IH1A 5TE7L 4NQVA 3WKMH 2XICA 4PJ9A 1QSFB 3DGGA 4HUNB 43C9B 3TA3A 4DZBB 1WISA 5HHPA 1QFWL 2H26B 4QRSB 3O3AA 1EO8H 4NUJA 1JHTA 3ARWA 1HCFX 3ZKMC 2VN7A 1U8KA 4HFUL 5I6XC 2FX9H 4LCYA 4PJCE 5D7LA 3LV3A 2A9ML 3OJ2C 4U1KA 3V5KA 4I3GA 1CL7H 2RGSA 4K3GA 4WO4D 3OAYH 5F7YC 1CXEA 3PV7A 3MOAH 4ODBD 4LSRL 2Y5EA 4M62H 2O93L 2CDGA 5C0AE 1D7FA 4NIKB 4JDZA 3WE6B 5I15H 1ZLUK 1OW0A 2YD5A 3UPAA 4X5XA 4K71B 3HC0A 4PFEA 4PRDB 3TO4D 4HGWB 1H3PL 2XWBB 4HX1B 3P73B 2I60L 1IM3B 3BXNB 1NAML 4JFZH 3NGBC 4N8VA 4OTXH 4ZUWA 4EUPB 3VDBA 3SDXE 3JTSA 3QSKB 1C8PA 2PCPB 3MNWB 4D9RE 1C16B 4KKBC 1AC0A 5D1QA 2HMID 4X6CE 3RVXC 1FHGA 5FHAL 4DQOH 1T0NB 3K3QA 2V7NA 3FB6A 5C0FA 2HT2C 3UTTD 2IEPA 4NKIH 5MEOB 3INUL 3QI9C 1HOCB 1JIBA 3MUGB 3O3BB 3MRIA 1P4IH 3PV6A 4R4ND 3KHOA 5I1HH 5EO9B 1A6ZA 4GBXA 5GIRA 2A73B 1XGUA 1R5VB 4NT6B 5DD1L 4QRPA 1PGRB 4WI6A 5I8OH 2DDQH 3OKMB 3MGTA 7CGTA 1EX0A 2EDDA 3IVKB 4RGNC 4H25B 3QQ3B 1BQLL 1ZV5A 3FZUC 3GM0A 2OJZH 3OKNB 5FUCE 3U30B 4OSUH 1A7RL 2MQ0A 5SWQA 3UTQB 1AGCB 5KAQF 1KSRA 1OP3K 4BSVB 3HN3A 1DL7L 4ACPA 3T0EC 5EU7E 1CFBA 5EZJA 1A1OB 1QEWB 3BGFB 4L4TD 4M6OH 4QKXB 3TN0A 3BMWA 3U9PL 2FECI 2NY0C 3ARBB 5GSRB 4PB0L 3NPZB 1MCLA 5ITFB 3GSNL 4ONGH 3GKWH 1EEYB 4ESKA 3KLSA 1JPSH 3KPLB 4XNQA 4XNUL 4Y5YB 4YEFA 3F7YB 1LO0L 3FRPA 1CTOA 4OJFL 3U9UA 3BD4A 3TO2B 3RWHA 1BJMA 1J87A 3RA7L 2AJ3B 3PHSA 3VWJA 3QHZH 2IQ9H 4R9HA 1ZA6B 5SWZE 4JJ5B 4IMLA 1L4IA 4YHZL 3VCLA 1MHCB 4XVJL 3RX7A 1I1AD 4G6AD 1AGBB 4MNGB 3CFDB 4RMUA 3HZYA 3P0YL 4F8QA 5J6GA 3ZT7A 3FKUS 3HPJB 1LEKB 4GG6B 5D7IF 4Q97A 3R06A 4GAFB 1AKJB 3BJ91 5D1ZC 5JNYA 3B2VL 1UQSB 5K9KA 3SQBA 4G80A 1F90H 3OV6A 2JK5A 2VITB 3F7QA 5IW6B 2JB5H 4M7JL 4H5SA 1JZ3A 3H9SA 1L6ZA 1EGJL 5TE7H 1MFEL 3SY0B 2D4DA 5MENB 4PGBA 1G9MH 2PUQT 2HVKB 2R2BB 4QXTA 1D5BB 1Z3GL 4WTXA 4WWKB 5DJ8B 4UILH 5HPOA 3C5SA 1NC4B 5MEPA 2XKSA 5EC2B 5A43C 2OLDA 4ODTL 3I6GA 3SGDH 2HTKD 3H9HB 5LXGL 3BOVA 2ICEA 4C58B 1QSVA 4L9LC 1NMCB 1DBML 1XGRB 1N59B 4LFHG 1SVZA 3T3MF 4WU7A 1FSKB 1X7QA 4LQFL 1HI6B 4H1LB 5ID1A 3QEQE 2HFFB 3EJJX 4NC1E 1G0XA 4PJDB 5JDJA 4GLRI 3VXUE 3TVMA 3ZE2E 2OR8A 4XC3L 2Q20A 3TM6A 2ID5A 2EZ0C 4M93C 2ZOLA 2APTA 4ZTPL 3LY6A 4LHUB 1INDH 4Y4HB 4F7MB 2P5WD 3QNZB 1T6WA 2E7BA 2FJHB 4TVPL 2YD1A 3K4ZA 4GMSL 5EU6B 4R2GC 4XAKD 3JUYA 1FIGH 4ZODA 1WFTA 3W39B 3VI3E 1HK6A 2JIXD 3GSOB 3WNMA 4KROB 2ZCKL 2XTJD 2YD6A 4JGJA 5C9JA 3QG6A 4B5EA 3I85A 4V1DA 5FKPB 4OGAC 1BREA 4X5WB 5AAMA 4EN3B 4X6DB 1GAFH 1T89C 2ZCHH 3OG6B 4HXBL 1HINL 1MRCH 4X7TA 2PYFB 5J0BA 1KLUA 1JYVA 3O41B 1U36A 3KPRA 4GMTL 1XH3B 4O5LH 3D2UD 4MXQD 1TLKA 3MQIA 3UDWA 5EOTA 12E8H 4F57L 2D0HA 1A7RH 3Q6GH 3LKPA 4X6DF 4QLRA 3EYUL 3VH8A 4NDMB 4OFPA 3HE6A 3WLWC 1IZKA 5I19L 3IRPX 4E41A 1XZ0A 3AGVA 3QUXA 4MQSB 1BPVA 4WDIB 2EH8H 4XPHL 4ORGA 4ZUUB 1N6QL 3ELAT 5EORL 5IM7B 3U9PH 4E0RA 2DLIA 1T22A 5GGSY 1D5XB 5IMLB 1X5AA 4PB0H 3IDMA 2EC9T 4NCC1 3GSNH 3FFCA 3MRMB 2E6PA 1S7WB 2VXVH 3HMWH 4QTHB 4XNUH 5K59E 1C12A 5F7UA 4YGVB 3RI5F 4F7CB 3FO9A 4FXGB 5FB8A 3DVGB 5J9PB 3LEYH 2XYCA 3MRKA 4HT1H 3FOMB 5EC1A 4XBPB 2F19L 1Q9LB 5D2LB 2IPTL 3IETA 4N90D 5CSGA 3CAFA 1C08B 2VXQL 4KXZH 4OBSA 2VXTL 4HXAH 1CT8A 1KCKA 3OJDA 5EBWA 3P0YH 3RPIB 1TTFA 1FZOB 1KCUL 3ZDZF 3BGMB 4JFHE 3ZKQD 3MLXL 3LRSA 4P4KD 1LO2L 2CIKA 3ZL4L 2ZUWA 3B2VH 2G5BB 4PGCA 5ACMA 5DEZA 2X70A 4P5KA 5BW7A 5D2LF 4JQXA 5CBEB 1ZA3A 1TFHA 4HKBB 1NFDA 3GSRB 1EGJH 4P2OA 1FNLA 3FMGH 4C83B 1N26A 4MCZB 1T83C 4G6JL 1ZLVH 4B7LA 1DQJB 5F7NC 1Z3GH 3DTXA 1DBJL 3RWDB 5JXED 1UACL 4ZNEE 5DJCA 5INCA 5EPMB 1CS6A 1CFVL 3FB8B 3FT3A 4JKPL 2CK0L 5GGUA 3MYJB 3VFVB 3UTTB 4M48H 1KB5A 2VJXA 1PQZA 2HKHL 2MHAA 2AEQL 3T1FA 4HLJA 1DBMH 3VFRA 4PJXB 4LGPB 3QXTA 3CPLA 2VSCA 3OJVC 3VXTA 5IQ9B 2ERJB 1U0QA 4QNPE 1C7SA 1S7UA 1HWHB 4U3XA 1CD1B 4YHLL 3DUUA 1FRGL 3ARFD 3MNZA 1M6OA 4LLDA 1U92B 5DEGA 1XT5A 2ED7A 1V05A 3IF1A 3O8XC 1RZFL 2EIZA 4E5XA 1U8QB 5HHME 5HI4C 4JRXA 4P99A 1CF8H 4PJXF 5EUKB 3WFCH 5I8KL 3AS3A 4QO1A 2AV1B 4WEMB 4GMSH 2I26N 1A9BA 1MQKH 3TCLB 2J12B 4BKLB 3F58L 1JPTH 1QQDB 4L4JA 4CADB 5CSZA 3MRDB 4R0LB 5D72L 1JP5A 2UZYB 2ZKHH 4L4TB 1EUUA 3PQYE 1GGBH 3D6GA 4I3RL 3P11L 1MWAB 4AG4L 5I2IA 1FO0B 1NGQH 3ARGB 1QSZA 3DUSB 4J3OC 4FQLH 4G8GA 4RQQB 2VLRD 1FLTX 1QFUH 4HCRH 4QF1A 4JFEE 3BT2L 3IDJA 4GMTH 5IVNA 3DMMC 1OT2A 1H15A 3BZ4B 3IDGB 4M5ZL 2DWEA 5I1CL 1BBJA 3KJ4B 4NO2B 1MCEA 2UYLA 4FZEL 1CICA 5E8PA 5FIEA 2GSIB 3EYUH 5DK2B 4OKDA 1WBYB 3SKNA 5FV1L 1RU9L 1UWXH 1KGCD 1FH5H 2YD4A 5T3ZL 4XCCL 1EAPB 5IMKB 1KN2L 3VMOA 4WTWA 2VZVA 3T4AB 4R8WL 1MPAL 2FSEB 4XPHH 1RUKH 2QADD 5JQ6L 1M7XA 1RD6A 4Y4FC 1MCPL 1I7RB 5DT1L 4GKSB 4H8WL 1UB5B 4PYHA 2NY7H 4OQ1A 2AI0H 3VXRD 3HR5A 3H42L 1UZ6F 5I0ZA 2DL2A 4GKOA 1IEHA 3NFNB 1YDPA 1NCBL 2R1YB 1I1CA 4P23C 4ELKB 2IMNA 5L8KB 2E7LC 3IDNB 4HGMA 1T2QH 4HUWB 4X6EB 3CFIC 3BP6A 2NW3A 3BKJL 2BVPB 3LEVL 5GS2H 5C0JB 2HJLB 1X6LA 3G08B 1SMOA 5GS1C 2V2TA 1EHNA 1QR4A 2IPTH 1HZHL 1KN4L 1I3RB 4HUUA 2VXQH 4Z7NE 3GMOA 2VXTH 2EC8A 3TNNB 3K0WA 2GFBB 1KCUH 2IF7A 4JGUA 1ED3A 1U93A 1F6AA 3ZL4H 1X5KA 3O11B 4KTDL 5AEAA 1F00I 2JLLA 3BESR 3WO4B 1I75A 2A0LC 1DN0B 5JPMA 4NRYB 1WITA 1VKXB 4YPGA 4JQVA 5E08L 4KKAC 2YXFA 5IBTH 4GOSA 5E9DA 3FO1B 4Z7WB 4XH2A 3GNMH 1JVKA 2VIRB 3C8KB 5E6ZA 3S5LB 3WS3B 5IB2B 3ILPB 4FXKA 3PABA 4RGNE 1AE6L 1NCAH 3G5VA 5E99H 3RKDD 1IC7L 4OCSL 3JSSA 2EEAA 1QFWI 3VGGA 1CFVH 4YPJA 4JKPH 1BF8A 3VDAA 2VQUA 3G6JE 2JIXB 3GMMB 4Z7WF 3MRHB 2APBA 1A14L 2HKHH 3T0EE 2NR6C 2AEQH 5JW4Q 3TBYB 1NEZB 4BQ8A 5I1DA 3BH8B 1BLNB 4FQJL 2BCKB 4DVRL 5I1EH 1UH3A 4QRRD 1YMMA 2K9UA 1J11A 1AQKL 1V7MH 4IEFB 3SDCB 4YHLH 2AK1L 1N3NB 1KPRB 1OGTB 3RY6A 2DBJA 1P84J 3D2UB 3FB7A 1OP5H 1CFTA 5K9QG 4RBPH 5EDXA 3LEXB 1I9EA 3GSWB 5BQ7A 2UUDK 3CCHB 3L3IB 3EZ8A 5DXWA 3I3DA 2PNDA 3BPLC 2J6EA 3MJ8A 1AFVH 1JV5A 4UV7L 5J57B 4J1UB 1PD6A 5I17B 3F58H 4GRLC 1FYHB 4Y2DA 5DUPL 3CFKB 3D0LA 5D72H 4QOKD 4PJEA 4ENEC 3JTTA 2QSVA 1HCVA 5F9WC 4NO5A 1DBBL 2VZTA 3ZTNL 1ACYL 4AG4H 3QAZC 3BEVA 4BZ1L 3VWKB 4XWOD 1H3VA 4TQEL 4L3CB 4WNQA 1M7DB 4FQHB 4K3HA 4UTAH 4UIMB 3B2UC 3DO7A 5DGQA 3OAYK 2FGWL 1NKOA 5D5MA 5FDWB 2P42B 2I9TB 2D9QB 2Y7QB 1QD0A 3T2NL 3NOIA 5EU5B 5C0RL 3I75B 2VMFA 3Q48A 3BWAB 3PNWB 2A6DA 3GGWA 1RVFL 3DROA 3P0GB 4LSUH 4ERSL 1EAJA 4D0BA 4PRIA 2C5DC 2R4RL 5T3ZH 2DQJL 4XCCH 3VRLE 2Y72A 1KN2H 1X3DA 4ZOAA 3DBXB 4OV5A 4NN7B 1MPAH 1U95A 3MV9A 4P4KB 3RY5A 5DQJA 4MJ6B 5JZ7C 2W38A 5LJYH 3VXMA 1GGTA 5AYUH 2DB8A 2DTSA 1JF6A 3QNYA 4H8WH 3KLHC 1GXEA 5ICXA 3QFJD 4Z7VA 3HHRB 4P5TA 5I18L 2AK4D 3ROLA 4MA7H 5DGRA 1NCBH 4HKJA 5C7XL 3G9AB 4L3EE 3LRHA 4Q74A 3VFUB 2PR4H 4MXVE 2BXYA 3OZ9L 1D6VL 1FAIH 4H26B 2EYRA 4XXDA 2EDKA 4U6XA 3LEVH 1J12A 5F9JA 3RIFF 2UY7A 1FC2D 1K4CA 5EUOE 3S3JA 2CD0A 4KKLC 1HZHH 4W70A 1CE1L 3Q2CA 4JO2H 3RNQA 3E2HB 3TPUB 2A6IA 4JCMA 2MFNA 5B21A 3KPNB 2H2PD 3KS0H 5DURD 3T09A 1XGTB 3KPTA 5CJXC 4HJJH 2O61A 5EU4A 4OD3H 1EBPA 3C08L 5FM4A 1A7BA 2X89D 4I9WE 5E08H 3QXDB 3NN8B 5DUML 4I0KA 4EOWL 3EO9L 3U46B 4OZGE 2DI8A 3BGAA 4MYWB 3T8XA 2H32B 3ARFB 5KVDH 4ODXB 4IRJC 5SX4H 4XWGL 4P4RA 3MLTA 3TT1H 1DSFH 3RTQC 3BP5A 4YDKL 1K6QL 5DHVH 5T5FH 4Y4KA 4Y5VB 1WICA 1P4LB 3ARDD 3P4NA 1AE6H 4XVSH 2C4FT 3GB7B 1W0WA 2ZUYA 5EBLA 1ZHNA 1P4BL 1G9EA 3G9VA 4CKVX 1JUFA 2OTWB 4L29A 5JUEL 2DI7A 3K4DA 3RZWA 4RAVB 4YBLB 1J0YA 3TC9A 1P9MA 5SX5H 3QQ9C 4WJ5A 4JG1L 1EFQA 1I85C 3LB6D 1PVHA 4F3FA 5DFWH 3ES6B 4M7LH 1LO3L 1P2CB 2VLRB 3NGBB 4JPWH 3FRUB 5D7JD 1AC6A 4MJ5B 5HGBA 4FQ1L 1Q9WB 4G6ML 4LDLB 2OP4L 4P59L 5IGXL 3U2SB 3KPOB 1LO5B 1FNGA 2Y5TB 3RP1A 3CH8A 3BRFA 2ZUQC 5F93C 5I1IL 1WVZA 4KJPD 4OZIA 3ZHKA 3VXNB 4NQSB 5ITBH 4UV7H 5AG9A 5K9QI 4XCEB 3NIFF 5GRJL 5CJQH 2V9TA 2F5BL 4OZFB 4W4OC 4KMLB 4EZMA 1FE8H 2NY6C 5DUPH 4FABL 1IL1A 3ARPA 3MACH 2GK0B 2QADB 1DBBH 3B4NA 1ACYH 1FFOA 2YWZA 5HHXL 3SDAA 5DJZA 3RHWK 3G5YA 2IADA 1Y18A 3VXRB 1CVSC 5CEXA 4BZ1H 3AFLA 2DWDA 4ZFFB 2W60B 1HILB 2VRAA 2C1OA 2VL4A 4Z95L 2NY4B 2FGWH 2NY1C 1M7IA 3ZKXB 4NPYA 3MV7B 4X6BA 1KTDB 4JAMA 4KRPD 3CSYA 3V0VA 4C4KT 5C0RH 4LEOB 4KMQA 3LD8C 4ERSH 1JMZA 1MNUL 2WBJC 4O2EB 2NY0B 3O6ML 4X9HA 2BERA 2QV2A 5ISZD 1IGJA 1CCZA 4AT6B 2NY3C 3VFGH 3AU1A 3NFSH 2XN9E 2VZOA 5EZLB 4JFPA 1LQSR 4HJ0D 4WFGE 4WENB 4GRWH 4JFQA 2J3SA 4WV1A 1RJLA 1PX4A 1JNNH 3V6ZB 1NBZA 4Z5RB 2Y6SC 2VN4A 1D6VH 3A6OA 3NCJL 2DQEH 1L9NA 1DJSA 1QRNE 4MNHB 1MCWM 5E2UH 5DJDA 4KVNH 3KWWA 4RIRA 4R90L 1AGDB 1HSAB 2VDKH 2R56H 5CSBA 4CU6A 4RISL 3V0AC 2I9LA 1LK3L 2KQNA 5HPMA 3EO0B 2VB5A 3NPSC 4N0FB 4OUUA 1I8IB 1SJEA 5J3HD 3PGFL 1HE7A 3LSOB 4WY7H 5DUMH 4QRRB 5TQ0L 1JZ6A 3DURB 5DD6B 3EO9H 4JM2A 1KYOK 1K5NB 7FABL 1K2DB 4G9FA 3CNKA 1OPGL 4ZAKA 1RUPL 1ZEAL 4I18B 3GMQA 3BH9A 2IQAA 3K2MC 4AZ8A 5J1SC 4P2YA 4XMLL 1TQBB 2XXCB 1IC4H 3HTLX 1TJHH 3FQRB 4X7SH 1ONQA 4YXHH 2Y06L 5HYJE 2CO6B 1I3UA 1YYLL 1HYSC 2NY5H 3MBED 4U1LA 5GHWH 3TYGH 5E0QA 1OB1A 3RDTA 2A74B 2XTJC 3U6RA 4QOKB 5I74B 5JMOC 4NNXA 2DQCL 4YHNA 3ARUA 3SDDA 4HPOH 4JG1H 2E6QA 1B9ZA 1NLDH 2YMXH 3KPSD 1SM3L 4M61B 4NRZA 3GSQA 5DDHB 4TOYH 5F7MC 1YYML 1I3GL 4ODHL 4TPRL 4X83A 1BZ9B 5FAAA 3WFBL 2GJ6D 1UJ3B 3BP4A 4HHAB 4H1LH 3KXFD 2HFTA 4JO4L 2AABL 3EJYC 4P59H 4PJ5E 2IH3A 2R8SL 2HVJA 3C5ZA 2CKBH 4LSQL 4UQ3B 3QCVH 5D7IE 3ARXA 3BUYA 3STLA 3JXAA 2CK2A 4EUPG 5I1IH 3WFHB 3RPKA 1FZKB 5ESVB 5FYLL 1RULH 4HBCH 1RJZA 5JIKA 5IWLA 4GAJL 4GW1B 4JR9L 4RX4A 2A83A 3ZDYF 1F4HA 4JLRA 5EIIA 2ICWB 5JO5A 4NSKA 3I02A 4IOFC 4BH8A 1ZLVK 5BOZG 1XGYL 2Z35A 3AY4C 5IMOA 4PJ7E 4ZOCA 1AO7A 3QFJB 1OWWA 4M6AA 4J4PA 1E4KC 4NQCA 5FECB 1ZTXL 4FMKA 5HI5D 2VAAB 4I3SH 5TGBB 4JM4L 5KAQG 3R0MA 4MLIA 1FO0L 3WFDL 3MOBH 2KDGA 2YXMA 5DHVA 3RIAK 4JFDE 2ICWJ 2CUHA 4LHJB 3GI8H 4AQ1B 5B39B 1BVLA 3IAQA 4MAYA 3RJQB 2BRRH 5EBGA 4PRHA 4FOMA 1CDUA 1LVEA 4UOJA 2X7LB 2E8ZA 4KU1A 1OOAA 1OAZL 3CH1B 5DZNA 4PJ9C 2BNRE 5T3XD 5E03A 4BM7A 1Q72L 5GRVL 3FB5A 4J3XA 1F3DH 2PTVA 4RFOL 5DURB 3TA3C 4NM8L 4ODUB 3VFPB 1VGKB 1R24B 2DYPD 3HS0A 5B8CB 2WWMC 3T77B 1KCVL 3DVIA 1KJ2H 5F6HJ 2XI9A 1L6XA 1IAIH 4P2RA 2NX5D 3HC3L 4I77L 1NL0L 4JHAH 1J5OL 2WW8A 4O4YL 3T1WA 3T0WA 4ZPVA 1ITCA 5HHNA 5T5NG 1S9YA 1PEZA 2VLKE 1UEYA 1QR1B 5IJVA 4IOIA 3JV5A 5FGBA 1PKQB 3ARDB 1OW0C 1H8SA 4EI6A 5H94B 4R90H 3SJVD 3H3PH 5DQDH 4PJGB 1JYXA 2ZP0T 3Q0HA 4RISH 5L2KD 2PKDA 3OAZH 2AQ2A 3CXDL 3GKZA 5HVFB 3V5DB 3CDGA 4UTBL 5HHQA 4A6YB 1KT2A 4LLYB 3GIZL 1NDGB 5F88B 5D1QC 1UWXK 5JHDD 4TNVF 1TTGA 1Q0YL 3EHBD 2FJFA 1R3JA 3D25B 5D7JB 4PJGF 4Y16A 1T1XB 1GGCL 3DYOA 1JGEB 1F4XL 4M1DH 1OPGH 4PJHB 4TN9A 1ZSDB 3ULUL 2IFGA 4XMLH 5GXBB 2VLLB 4GBXC 2FRGP 3O2VL 4X0KA 4UOW0 1QO3B 4J8RB 3FFDB 3WIFA 1YEDB 3HZVA 1OAXL 4LKXA 2BSRA 4PJBA 1YYLH 4CNIB 1B2WL 1PG7L 3VJ6A 4PD4J 4C56A 1AQDB 5KSVB 1FN4B 2BOCB 2YOCA 5IR1A 1SJXA 2W9DH 4HAGA 3F7PC 2E9WA 4Y89A 4F7TA 5DSCA 3QIWA 4N0UA 3MGOB 4RAUB 5FOBA 2IG2L 2X9WA 1I3GH 4LIQE 2XNAA 2DQIL 3DX8A 3EYOB 2VDQH 3L3OB 3P40A 2ITCB 4H1LG 4OZHE 3VW3L 3S6CA 2H8PA 4FG6C 4LCWD 3MJ9H 3TN0C 2R8SH 3CFEB 4LSQH 2P7TB 2Z93A 1A9EA 4I0PD 5DHYB 1RIUL 3PP3K 3MRBB 2CIIB 1F11B 4ZFZA 2Q6WB 5C6TH 4Y5XB 4ZXBA 1UWEH 5FYLH 2QQKL 4GJTB 3OX8A 3L1OL 3AS2A 3OBAA 3UCRA 4BFIB 3O4LE 4GAJH 4Z78B 1BX2A 1DVFC 3BQUD 3VWJC 4H88L 1T21A 3WHE1 3MA9L 4NQEA 1HSBA 5GGRA 5ISZB 1WFUA 1FZJB 3MUY1 2YEZB 2MOVA 1AY1L 1JGDB 4JFFA 2R29L 5CWSB 1XGYH 1HKFA 3LS4H 1NBYA 1BJ8A 4EXPX 3BZEB 1J88A 4UMGA 2VDLL 4YDLC 1A8JH 3HUJE 5BS0B 4ETYA 2WQRA 2GQHA 3L5HA 5FM5O 4JM4H 3U83A 1UJTA 3ZKND 5ERWA 1AR1D 1FO0H 4LLUA 1RJCA 2V17L 2R0LL 3KYKL 3C2AL 3NA4A 1OGAA 2ICCA 3F5WB 1PZUB 2R69H 5CBAA 2P44B 5EIQA 3UO1L 5FGCB 2XFXB 4MX7B 1WAAF 3MXWH 3ABZA 3P4OB 4JEGB 3SO3B 5HYQA 1HXYB 1VERA 5GZOD 3L3HB 1T5WB 1EHXA 4OCRL 4KDTA 1NCNA 4KUZH 5IB1A 5F1IB 1OP5K 4LP4A 4NM8H 2D4FA 4RBPK 4U6HA 4IDJL 2CRIA 4X8JA 1XF5B 3U1SL 4P23B 4ZUTA 1K4DB 4NQDD 1AIFA 3HC3H 3PF2A 1NL0H 2F74B 4O4YH 2NY2C 1LK2A 1VB9A 5JPNB 2MPAH 2W65B 4IRSD 1AJ7L 2RR3A 3FQUB 5I30H 4PJFB 4OD2A 4NUGH 4AENB 3GJFB 4I48B 2F53A 3TVMC 1FORL 2WZPD 3MBEB 2QHRL 4WHDA 2B2XL 5DJ6A 2BJML 3LS5H 5JORA 4Z7OF 2WBKA 2XZQL 5DR5L 1XCTB 3CXDH 1BIIB 3TNMA 4CVXA 4PJFF 3MJ7B 5H35B 3AAZB 1EO7A 2XY2A 3KPSB 5KANI 4J6RL 3QBTB 2DI9A 4EXKA 2EDFA 4MCYB 3O6FD 1MHPL 1S78D 4JANA 3SN6N 1Q0YH 4X6FA 4IJ3B 4NHCL 3PIQB 3SKMB 2GJ6B 2NLJB 1ZLSL 4M8QB 2FBJL 1GGCH 3KXFB 1XGPB 3N1FC 4H20L 1JPFB 4LSSH 1LILA 3GI9L 4YWGL 3ULUH 1P7KB 1ZT7B 2BX5A 4PJCA 3H7BA 3AREA 4IHOA 4PRPD 1J05A 2ADJA 2WBWB 2J8UF 1KJMB 1HHKA 3REWA 5LQBL 1A2YA 3BZFA 2EDXA 1QBAA 5KVGL 2KKQA 4EDXB 3LKQB 3MNVA 3UDWC 4J7RA 3V6FA 4K3JL 4LU5L 1J0JA 5JIIA 3QJFA 3HE6C 4XWOC 1KBGL 5ETUB 3SDXA 5FK9A 3VFMA 3CGTA 2DQIH 2ZSWB 2XQBH 3VW3H 3QUXC 3X3FL 3MCKB 5AYQA 2D3VA 4FTVD 5CGYC 2NZ9D 4HIJA 3DX9B 1QPXA 3OKKA 1VFAB 3D9AL 4Y1AD 3BRGC 5DQ9A 4Z0XB 3O6LL 1BFVL 2VABA 2QR0B 4I5BB 4F37F 2J8HA 2OQJB 3WO3B 5HYSA 3ARZA 3B9KA 3L1OH 2EYTA 4A2LA 2ADGA 5HHOE 5GGSB 2LU7A 1BMGA 2ZPKH 3QFDA 4DKAA 3VRJB 5DC0A 1R3HA 1YPZF 5I1LB 1JNJA 4M9OA 1X5GA 1FVEA 3MLWL 3DLQR 3NFPA 1DBKL 1KTKE 2VDLH 1Y0LA 5KOMC 1B6DA 1R3LA 2P8MB 1KTRL 5LGJB 2AJUH 5KS9B 2NX5B 3D39E 4P9MH 3S34L 3E6HA 4NZUH 5DJYA 2R0LH 3LMJL 2DQTH 5SX5K 4K8RD 3MLRH 3VFOA 5I76A 3FQNA 3UO1H 5BW7C 1PY4A 1M05B 3NCYP 3BAEL 4JQXC 2P5WE 1A4KB 1BGXL 5IT2L 3HE7D 4Q0XH 5KS9F 3NCEB 3NIGF 4P2OC 5CHNA 3U4EB 5I16A 3CFJA 2B4CL 4OCRH 4UAOC 3D18B 1N64H 4L8DB 5L2KB 1VFUA 4BYHA 1EUTA 3QEUA 3B8SA 5GISH 1ZHKB 3TV3L 2R0WL 1CYGA 3U7YH 4IDJH 4XPGL 1I7ZA 2XTJE 5A2LH 4XCNB 2M26A 4W4NA 3C6SB 3IU3A 2GT9A 5BZWA 5SWZA 1G6RA 3X13A 1T1WA 4M1CD 4LPCA 1C5BL 1F3RB 2IMMA 4LPTA 5JHDB 3LQZA 3MJ9A 4PTTB 1A4JA 1JWUB 4K3EL 4N5EC 4K7PX 1V3LA 1XCQA 4HZLA 5ENWA 1HHIA 2ZG2A 1AJ7H 1SBSL 4WW2A 3QPQD 4UINL 3LKSA 5F3BA 4AEIH 1GPOL 5IHLB 3KR3H 3MLUL 4JHWL 2Z9TA 5T1KD 2KZ1B 4S1RL 1D5ZB 3S36H 3S88L 2ESVE 1LE5A 4XMKH 1FNEB 3QCTL 4WUUD 2C1PA 4PREA 1I7TA 4GRMA 5DR5H 4HS6B 1G7IA 3HC4L 1RK1B 4KQ3L 2C3GA 2H1PH 3DJ9A 3GSVB 2YUVA 1E4WL 4L1HA 4MB5A 3M1BB 5DRXB 5KN5B 4JKMA 4QHKJ 1G6VK 4J6RH 4X98B 3I3BA 1AH1A 4OKVB 1RUQH 2C9AA 5C0CD 5L8JB 3C87A 4Q6IB 1DE4B 5DFTA 4IRJB 3G5ZA 1R3IH 1U8HA 4LCWB 4XGZB 1TZIB 4JRYD 4I0PB 3P4MB 3BIKA 1JGUH 3RUGB 5A2FA 4YWGH 2NCMA 3E6FA 4RDQF 1T5XA 3QA3A 3P0VL 5EBMA 2WV3A 4IRZL 2LVCA 3S5LG 5EU3B 1SJHB 1MFNA 4XAWL 2OSLA 3JV6B 3BQUB 5ACZA 3LZFL 3D85A 4KI5D 1BOGA 5KSAC 3QEQA 5IF0A 2E9IA 2G2RA 3VXPA 3MRPB 3VXUA 4XTRD 4BH7B 4RWYL 2OX5A 4G7YL 1CICC 2YZ1A 5CD5D 4LU5H 3WIHA 5D6DA 3B6SB 2ZG3A 5J8OA 5I8CA 1NEZG 1MCNA 4KDWA 3QDMD 3QIBA 1CGVA 5IJKA 3VRIA 5C0EB 5ID0A 5KG9A 3D48R 4AY0A 4PRBA 4YFLF 5JA9A 5B3JE 3X3FH 1B0GA 4L4VE 1RK0A 5D7LE 1MVFA 4KRLB 1V8HA 1EEUA 4OLYL 5E8OB 5IVZB 4S1SL 1BFVH 3ARSA 2F58L 5EIVA 5TDNB 2NY6B 1KPUA 2XZZA 2V2WA 4LNRA 4P2QA 3W0WD 3PHOB 1CR9H 2X2YA 2BDNH 2OZ4A 3KGRA 4U1MA 1UKTA 1RSFA 5D1XA 4JFOA 4OCXH 4E42A 2BY1A 3MLWH 3RVTD 5IEKA 1KV3A 5HDOA 3KPMB 1U3JA 2DS4A 3AROA 4KFZC 5IEHA 5C08D 1JWSA 4JHBA 5C6WH 4NQDB 1NC2A 3W9DA 4BSWA 3S34H 3PL6D 4UBDD 5H8DA 5TDPB 1ES0A 3GO1L 3ECBB 1WFOA 4IRSB 3BUTA 1AD0B 4NO0D 4RZCA 2EYSA 2XT1B 3BHBB 4U7KA 5BVJB 2AGJL 3BAEH 3OKOB 3VXQA 4FP8H 1BGXH 1S7QB 1J10A 1N0XH 5J1AB 4M3JA 4P57B 1LD9B 4KK9D 4QRPE 2B4CH 2XZAH 1J0ZA 5IW3A 4C4KO 4JB9H 4KK6D 3TV3H 3EYFB 4XPGH 3MBXL 4LLAA 2F9BT 5BXFB 43CAA 5FA3B 4HLZG 2VE6A 1QSEE 5D71H 3O6FB 4TSBL 3BVNB 3FT2A 5D2NA 2EXWC 2YPLA 1MH5A 4F7PA 1S7VB 4XNMA 1D5IL 3DO3A 5HGHB 2A1WL 2N7AA 3C60A 1LP9A 1IGTA 2BNQA 4U1HA 4Q6YA 3KDMB 1A6UL 2FO4B 3AMKA 3WN5B 5KZCB 2EO1A 4CVUA 4HWZA 2XWJB 2P49B 4EIZC 4PRPB 2QEJA 5D6CA 3MREA 4HIIB 4YGAB 1TETL 1IGML 1XGQB 1U8LA 3RY6C 5CCKL 4LASH 1KGCE 5I1KL 1NGZA 3HC4H 3ZTJH 3EJZC 1JK8A 1UWGH 2X4UB 3EDFA 3MMEB 5CKGA 3S3SA 3UBXA 3QUYA 4OD1H 5DRWB 2H3NA 3MRFA 3QEHA 5LKNA 1AD9B 1DDHA 2GJZB 4HJGB 4PYGA 4RFEA 4XCYB 4Y2DC 1F4WL 4MJID 1Z5LA 4A6YL 3TBWB 3U7WL 2VERN 5DVLA 5BMFL 4PJ8D 4FTVB 5FO7A 3QWOA 4IS6A 1XIWD 1GOHA 1JPST 4Y1AB 5D96B 2IWGA 3HMXH 3L3KB 3EFFB 3LKOA 4YHIA 2JB6B 3PWUA 2HJKA 3FTGB 5GS0D 1JTOA 4O02H 5JR1H 2W9EL 1XR8A 4WFEE 3W9EA 1JHLL 3I6KA 5CEZD 1SMAA 3NZ8A 3QDJE 1LEIB 4EI5A 3LZFH 2R1WB 4M4RA 1UT9A 4UU9A 1KFAL 1KENL 1Z2KA 4BFGA 2J5LB 2AXHA 1ZAGA 2ENYA 1CTNA 2OL3H 1MVUA 2P5EA 1E27B 4KQ4L 1G7QB 3PWVB 4MD5B 3CDYA 3KG5A 2BP3A 3NAAH 1GZPB 2QKIB 4L9DA 4OCYL 3OAZK 1VFBB 2VQ1B 3D5OF 4LEXH 1S3KH 2X41A 2KZWA 4NKMA 1RZJC 5JTWA 1A3QA 2P4AB 1IMHC 4FQCH 4ZSOA 3O81A 1CG9A 4P5TC 4WW1A 3QRGH 2B5IC 4X8XA 3BWUC 3PP4L 3MROA 4TSCL 5FKAB 2XY1A 3PQYA 1FV1B 3QULB 3ZSSA 1RZ7L 3ORJA 3RGVA 1G7LA 1F2QA 3C9NB 1WWCA 3HKFA 4PLKD 3QUMB 3L3DB 4NKDB 3REVA 1X5XA 1IGCH 4WI3A 1J8HA 3S3PA 2HG5B 3CX5J 2EO9A 3M45A 1IBGL 3TZVA 4PGEA 5C09A 3F7VA 2K7QA 1Q94A 3C8HA 4ISVA 1G1CA 5FM5M 4ZOEA 1U3HD 4YK4C 3SHSA 1T1ZB 4B41A 3X12B 4YBQD 2UZIH 4LFHD 1N6VA 3UPCA 3OKEA 5E8DH 5ADOL 1CFQA 3QNXB 4P49A 1F8TH 1U42A 3WHE0 5H2BB 3QJHA 5MP6H 1YMHA 1FLRL 2Y9RT 4Y19A 1E28B 2W07A 2BSSB 4R96A 4NQVB 4YE4L 5ANMB 3IGAB 5HY9A 5T1KB 4CMHB 3DGGB 2B20A 2QSCH 3TA3B 1FL6A 2DM3A 4JO1L 2VOTA 1DQDL 5HHPB 4XC1L 3KNBB 4OCMC 1QUNA 4WI2A 5C8JB 5GJTL 2YUZA 4JQIL 1RUML 1RZKC 3I2CH 4NGHH 4NN5B 5JDSB 3KPRE 4Y4KC 1KEGL 3MBXH 2V2XA 4QXWA 1MCWW 2F8OA 1MI5D 4N9GA 2FATL 4J3SA 4PG9A 4TSBH 4KZEL 1LE9A 4JCLA 5C0GA 2YK1H 1D5IH 2A1WH 1MAKA 5HGAA 1P9MC 4E41E 1S9VB 2PW1B 3ZDYE 2R0KL 4JRYB 5E2VL 1U6AL 5DF0A 4NQXB 1NSNL 1YQVH 4QY8B 2ZJSL 4JN2A 1A64A 5C6PB 4N8VB 5F1NA 3T3PE 3FFCE 4LP5A 1XF2A 4U31A 3OGCA 3ZTJG 1ZANL 4MHHG 2GTWA 2V5TA 2JJWA 1JRHH 1MY5A 2BVQA 3SDYL 4UDTB 1A6AB 3FB6B 4I2XB 5C0FB 2AJXL 3ZE1F 4KAQL 1N7MH 1NGXA 3BX7C 1GIGH 3QDMB 1FYTA 4LDOB 3QHFL 5DI8A 3MRIB 2AK4E 3SPVA 5BMFH 3PV6B 1NGYB 4D2NA 5MI0B 4KI5F 1A6ZB 2AERT 5GIRB 4WHYH 3UAJC 3SDAC 1Q38A 3IJSB 3L3GB 2W0KA 1ZWIB 1XF4A 4WU5A 3W0WB 1IFHL 4XP9L 2WANA 3T0DA 1MCKA 1S7SA 1BM3H 5E5MA 2FEDD 1NFDE 1IM9D 1ADQH 1YY9D 4EQ3A 3GFUA 4D9LL 2QQLL 2XQYG 4Z7QF 2FB4H 4A2MA 1M71A 5HYIA 5C08B 2IAND 4JZJB 4APQD 1AR1C 3A6CL 3UTSD 5TH2A 3R1GL 1IAKA 4U6YA 3VGFA 4EJ1C 4WCYL 3W81A 1FC1A 5DD3H 2CDEB 4LVNC 1X5JA 4F9LA 3MODH 4WV1C 3VGAC 4Z6AT 2IPUG 3M07A 5CIPH 2X4SA 1J1OL 1TMCB 1RZ7H 2GUOA 4IMLB 3CDCA 5EFIB 4DEPB 4IIQA 1QA9A 5DJ2B 4OQTL 3V0WL 1LHZA 4XP6L 5HD8D 4POZC 4OZ4B 2HJFA 5E2WH 3OR7A 1FFPB 1IBGH 2YD9A 3EOBA 4AMKH 3UPRA 5T3XL 5DD0H 4GKNA 4JRXE 3GIVA 5IFJB 4UT7L 1JN6A 4MQTB 4Z7UB 4P48A 5JNYB 1P6FA 3ROOA 1CFSA 1O0VA 2Q8AL 2GITB 3U4BH 1V7NL 3VFSA 1BEYL 4OCNC 5C07A 2V5SA 1RUAH 1FLRH 3Q1SH 1P84K 4EDWH 3PWPA 3H9SB 4ONFH 4R6UA 4YE4H 1CXHA 3D3VA 3TESA 4L8CB 4YZFF 2VDMH 1D6EB 4JM2C 4HV8B 1A22B 4P5MB 4Z7UF 3QXUA 4AL8L 5CKAA 1QZ1A 1DQDH 5D9SA 5GJTH 4ZAKC 2ATKA 4L9LA 4LKCA 1GGIH 2VR4A 3DXAD 3C5SB 1KEGH 3O45A 5MEPB 4YHPA 3MV8D 1IGYA 1O7VA 2XPGA 4NWTL 5JW5A 2EDOA 3CZJA 2FATH 3RL1B 5ICZB 3GK8L 4KZEH 1KIPB 2MMXA 3QUKA 5E4IA 4MJIB 1ZE3C 3RDTC 2IBBA 2CLVA 4PJ8B 3NH7L 2VLJA 3SDDC 2BVUA 5C2UB 1MEXH 4DZ8A 1RIVH 3CMGA 4OIBA 5CD3B 4XPBL 2NW2B 2XACC 4PTUA 4CMMA 3HZKA 4B50A 3WCYA 1GC1C 3C5ZC 5D7SH 1AGEA 4LQ1A 1T89A 3HNVL 1G7JB 1VFMA 4YDJA 1MOEA 2HT4D 3SDYH 1UYWL 3GSXB 2OBGA 2WLYA 3HI5L 1E4JA 5IWLC 1MCOL 4KAQH 3BEWA 4JPKL 3B9VA 5C9JB 1WAAE 1F97A 3QG6B 5IVXA 4V1DB 4RA0C 3CVHL 4QHMB 2D0GA 2L7UA 3HG1D 3CLFH 4B7IA 5SWSD 3M8OL 4XMPL 1I9RH 4WHYG 3VGEA 4M43L 4YR6B 5E6IA 3P9MA 4UDUB 3TEUA 1NGWB 4J4PC 2CLZB 3HA0A 1IFHH 5EWIH 2XTLA 3IU4L 4NFBA 5DYOB 4GG8A 4OAWA 4LAJH 5E9DE 4DFHA 4HKZA 2X9XA 1JFQH 3VH8B 2DLEA 1I8LA 2GJJA 3HE6B 3RNKB 3GRWL 2DQGH 3MRRA 4D9LH 2QQLH 4HWBH 1HQRB 3K8KA 4PJAA 4WHTB 4L1DA 4K23L 1YC7A 3S37X 4PG2A 1U3HB 4ORGB 1T6VN 4E0RB 3CFBB 3VXSD 2PYEA 2Z31A 3IDMB 3ULSA 4XPFL 1MRDL 5JMRA 4K8RC 2AJSL 3WDIA 1QLRA 4FNLL 5J12B 5CZXD 5C0BA 3BW9B 1RFDL 4DGIL 4DWHA 5I71C 1OY3B 5F7WC 1P1ZA 4Z0BL 1YMME 1QLEH 5TPWL 4XP6H 1CGUA 5IFAH 3MLZL 1CLCA 4ZQKB 3SCMD 1TCRB 3BO8A 3IETB 4EEEA 2VC2L 4H0HB 3KYMA 5D4QA 5FGBC 1K9TA 1CT8B 3OJDB 4DTGL 1MI5B 1A7OL 2BVTA 1QSFA 4N5UA 4ODVL 4JO3H 2ICWI 43C9A 4DZBA 5DFVD 2J8UE 1RI8A 1FCCA 4P5KB 4QRSA 4WI7A 3B5GA 2A77L 3WJLA 4PJIF 1F3JA 4PB9L 4KWUA 4X99B 3SKOB 1CLYL 1YEGL 2GIYA 1BIHA 2GK2A 5CILH 3FQWB 25C8L 2QSTA 2BMKB 3U36B 1CD0A 2AXGB 3DTXB 4KRNA 5DJCB 4B53A 4HULB 3UYPA 5F6HI 2Q1EA 2X10A 3ZE0E 4UT9L 1R3KA 3ULVC 4RMTA 3VDCA 4PRDA 5I1JL 4HGWA 4BSJA 2XWBA 2EE2A 3QCUH 1G0DA 1OSPH 5GGUB 4HX1A 3P73A 4DCQB 3UJJH 2KL6A 3GK8H 3U0WL 1IM3A 3BXNA 4EUPA 4HK0A 3O9WD 4QCIB 3T1FB 4PRIE 3WNOA 3NH7H 1VESA 4JRWA 1MF2H 3CPLB 3VXTB 1CDCA 4DK3A 1YPZE 1MCDA 4PLJD 5F97E 4LNVA 3MNWA 1C16A 3MV9E 1FBIL 2IGFH 2NXZC 3WFEL 3OSKA 3QIWC 4YC2C 4PV8A 1T0NA 4HW6A 3OXSA 4R26H 4Z7VE 5MEOA 3IF1B 3IFPA 5IHUH 1HOCA 2G60H 3VA2C 3MUGA 3MO1A 3LQAL 3O3BA 3QXAA 2YZ8A 3VGHA 1IM9B 5EO9A 1J9CT 3GBNL 3PDDA 4QRTB 1R5VA 4NT6A 3KPQB 1UYWH 4ZXBC 4LCCB 2B1AH 2HRLA 5CSZB 3HAEH 4XXCC 1BJ1J 4LLVB 1MCOH 1X4ZA 2IANB 4YQXL 1KIRA 2ZNWA 3IVKA 2X4RB 4APQB 2DQHL 3CVHH 5F9DC 1HYRC 3UTSB 3DMMA 2FL5A 3M8OH 3HR6A 3OKNA 5F7DB 4XMPH 3CZFB 4IDLA 5DVKA 1F13A 3UTQA 4M43H 1AGCA 4G8GB 4U3CA 3P9LA 4R7DB 1RURL 4QF1B 4BSVA 5GS2D 2NXYC 4GUPB 1A1OA 5DRZB 1QEWA 2DWEB 4TULL 4XHQA 3SE9L 3ARBA 5GSRA 5E8PB 3SJVE 4Y4FA 3QYCA 4G8FA 3RVTC 3C6LA 5ITFA 2BZDA 3BP7B 1DCLA 1WZ1H 4P3DA 4BQBA 1EEYA 3WFZA 1R5WB 2RCSL 3KPLA 4D9QE 2COQA 4Y5YA 4Z18A 3NIDE 4K23H 3TJHC 4UI2A 3W5MA 1VCAA 2AJ3A 2V5MA 1YZZA 4HWNA 2RHEA 1ZA6A 2E7LA 4XNYL 4PUBL 4G7VL 5D7IA 1KCRL 3RHWF 1BD2D 4JJ5A 4LSDA 4HQQL 3QRFM 1FPTH 1HKLL 1OAYL 4KDTC 4XPFH 4OCLC 1D5MB 3CD4A 1JWMB 3QIUD 1HQ4A 4WFHD 4TUKH 1KOAA 1PG7W 5JIHA 3VGDA 1SYSB 1G1YA 2HP4A 4MNGA 3CFDA 8FABA 4X80H 2GTZB 3HPJA 4X5LA 4FFZH 4CU7A 4MGXA 4Z0BH 1GRWA 5F6IC 1A0QL 1AKJA 4MAUH 3QWRA 5DA0B 5TPWH 3N9GL 2X5PA 2OR9L 1WT5A 2PO6C 3V4UL 2PETA 2VC2H 1EFXA 3WYRA 3GEWB 1EEZB 4KY1H 5IW6A 3QUML 4JFDA 4OZIE 4M6NH 5DD5L 3SY0A 2QLVB 5MENA 1MRFL 1F6AB 1YNTB 4ODVH 3QUZA 4MNQE 2FD6H 5JPMB 2HVKA 2FCBA 2I25N 4YPGB 4OLVL 4N1HB 3FCTB 2OTUB 5B4MD 3MLYL 4M7LT 4WWKA 1I4FB 2NTFB 1ZGLP 1NC4A 5EC2A 5LCVL 4QXUH 4K07A 4XH2B 3H9HA 5IKCB 1U8MA 1SEBA 4FXKB 4GS7C 3PABB 4R4BB 1CZ8L 3T2QA 1XGRA 1N59A 3ZO0A 3MRJB 4KVCH 3G5VB 1GCFA 1YNLL 1HI6A 3RWEB 3AREC 5CJOL 1L7TL 2CSPA 3BKYL 2YR3A 5GGTL 3U0WH 2IPUK 4HS8L 3V4VH 5HJ3B 4Q58C 4WI5A 5FYKL 3WD5L 4LHUA 1MHHB 2DKSA 2DQUH 4Y4HA 4F7MA 3HG1B 3BI9X 5SWSB 2BY3A 5C0ND 3QEGL 1XIWC 2FJHA 2EH7L 2IFFL 3O2DH 3VFTB 3PHQB 1IARB 1IKFH 4FN0A 3W39A 5DO2D 4G9FD 1CFNB 5C2BL 1DLHB 4MDJA 2NYYC 4K9EC 5TE6H 1QBBA 1CQKA 5FKPA 5T3ZD 1F2XK 3O4OC 4X6DA 3OG4B 1WWAX 3K8MA 3G6DH 3JV4B 1DLFL 2AJVH 5EULV 3RGHA 3UTZB 4KJWD 5FUZL 4XP4H 3B9KC 4RDQG 4KK8C 2PTUA 4PJEB 1XH3A 3JTTB 2XIDA 5E7FA 1GL4B 1U8JA 2IBGA 4NZRH 1MCIA 4NDMA 1LEGA 4WNQB 2MCPL 1EHLL 5T1LD 4OLUH 4XNZB 1PDKA 4UV4L 5FYJE 3P30H 2APWA 5D5MB 2EECA 4TULH 5IM7A 1G9NL 3SE9H 3IDXH 3BPOB 4FQXD 3QZWB 4G6KH 4PLKC 1D5XA 1FL5A 4ALAL 4P9HL 3CLEH 4GW4A 3RVVC 3LKRB 4XI5D 1X5HA 4J3TA 4PP1C 1WBZB 3SCMB 3RWIB 4WI4A 1S7WA 4QTHA 2D0FA 2PW2A 1D9KA 4GW5A 4RX4D 1WEJL 4OV5B 4U7MA 4YGVA 5KSBF 4F7CA 4YBQC 3BN9D 1NMBH 3VXMB 4FXGA 3Q5OA 4HQQH 1QBLL 3DVGA 1X9QA 4GQ9L 2FIRT 4KTEL 3SGKC 3UJTL 4YHOH 2B5IB 5D2LA 1BQHB 1UH4A 1HHJB 2YWYA 3ROLB 4RSVA 4K3DH 4U0RB 3RIAF 3CFCH 3NTCH 4U1IA 2VDNL 3RPIA 3NZHL 1J0HA 1FZOA 2G9HB 2XKUA 3OMZA 3H6JA 3DETD 1MELA 4BUGA 3BPNC 4WO4A 4MAYD 3TH3T 1MSPA 5HI3D 5HDLA 3QPXH 1CK0L 4WW2C 3V4UH 4LGSB 3EO1A 1KUMA 4AEFA 4PD4K 5CBEA 4MSWB 2J88L 5DC4B 2E6JA 3TO4A 4HKBA 2CJUH 2HFEA 4OIIL 1IGIH 1HN1A 1BAFL 1YEHH 1S9XB 1NDMB 1MRFH 4MCZA 2HLFD 2QL1A 4ELMF 1F02I 4OI8A 5IVOA 1MFBH 4OLVH 1FGVH 1DQJA 3RTQA 2CO7B 4ZD3H 5JW4M 3RWDA 4F7EB 2VO5A 4HAFA 3EOTL 1DZBA 2WINA 5EPMA 2R23A 3T8XB 4U1SA 2P8PB 3MYJA 3VFVA 3UTTA 1AO7E 1JYWA 3BP5B 3GMNB 3VD7A 4AYFA 5TQ2L 3H0TB 1PW3A 4PJXA 3NCMA 1QRKA 1YNLH 1JNHA 5IQ9A 2FHBA 4K7FB 1H8OA 1OARL 1JUFB 3RKPA 2CDFA 1K3ZA 1T3FA 3RAJL 4HS8H 1PLGL 3DNKA 4PRHE 3BE1L 5FYKH 4WJ5B 4HK3J 4Q9BA 2RBLA 3FN9A 1ZS8B 3KYAA 2EH7H 3KLAB 4CJ1A 2IFFH 2AV1A 3FL7A 1YEIH 3OR6A 5A2IH 4K2UL 3TCLA 4BKLA 2OTPA 1QPPA 1WCBA 2AEWA 4CADA 4O58L 4W4OA 3QIBC 4R0LA 5C2BH 5IJKC 3IS0X 5DMGC 3WNKA 4L4TA 4M1GL 1BF2A 3WUWA 4P2RE 2WUCL 1SY6A 5GS0L 1MWAA 3SGEH 1KACB 1ZT1B 3JVGC 1NGPH 3DUSA 4QHKI 4Z9KB 1DLFH 3WMSA 4RQQA 5ECJE 4YXLH 4HDIB 1DANU 4TUOB 3IYLW 1CDBA 2WUBL 3IDGA 2HN7A 3BZ4A 4QHNB 3V7AG 5D1XC 2XZCL 4UIKH 4RRPG 5CZVH 4YHMH 3G5YB 3QIUB 2GSIA 5CEXB 1H3XA 5DK2A 1I1AA 3MZTA 4MS8D 3KPPA 1WBYA 2KH2B 2Q7YB 3BIAX 4BELD 3BKML 5IMKA 3IJYA 3LPGA 1EK3A 3DHJA 3GHEH 3WKML 1M7IB 4QXGH 2F8XC 5AG8A 3SE8H 4X6BB 1ZLWH 3VE0B 1OTTD 3F12B 1ZVYA 5B38G 1ORSB 4GKSA 3ARVA 4JDTH 2H2SC 3K1KC 4WUUE 1KTLB 5M94B 1EO8L 1W0VA 1IT9L 4HUVA 2EDWA 4NQED 3NFNA 4HK3N 4ELKA 2EIDA 3IDNA 4HUWA 4Q2ZA 2VTFA 4YFLI 3DRQA 2FDBP 4X6EA 3IDYB 2F54D 1ORQA 1B90A 5C0CE 1CL7L 3GBMH 3O2DA 3TYFA 3IDUA 3C2SA 3LH2H 5HYFA 3MOAL 2HJLA 4JFPB 3G08A 5CMAB 4M62L 4C56E 1IC5L 5E8NB 5BRZE 5I15L 4TTDD 4EQ2A 4P46D 3TNNA 2GFBA 2VUOA 2NPLX 2BC4B 5D2NC 3OB0H 4FFYH 4JFZL 4N0UE 4JJHA 3ZE1E 3C60C 4ZOBA 2G5RA 4DK6A 1DN0A 4WVRA 4YHYC 1VKXA 4FA8A 1CDJA 4XCFH 3ALPA 3GDBA 4O2FB 3KWWB 2WIIB 3AB0B 3QDHA 3T04D 4AM0B 6FABH 3UTPD 1YEKH 4OIIH 3FO1A 4Y0GA 4Z7WA 5DLMH 5MERB 2VIRA 3C8KA 4I2XE 4NKIL 4XHJC 3WS3A 4G8IB 4KMTL 2D7OA 3KAAA 3ILPA 5IB2A 3RBSA 3T0AA 3MRCB 2P5WA 3HNSH 1SJEB 3N1MC 3FHAA 4GAGH 2HLAB 5I1HL 1FFNA 1NMAL 1SYVB 4TYUA 2PXYD 3RZCD 5I8OL 4JFFE 3N1QC 3DI3B 4G9FB 5I9QC 5E8EA 4N0CD 3GMMA 4JREB 1Q9OB 5CP3A 4WFFD 1N5YH 1VACA 3PG2A 2F53D 3BH8A 5SV4A 4O00A 2BCKA 2OJZL 2P45B 2K3TA 3VI4F 5EU6D 1S8DA 4U1LB 3LVEA 2R2CA 3RVUD 4MD0A 2P47B 3RAJH 1GH7A 4KC3B 4PLNC 5E1AB 4NNXB 2DM4A 4YHNB 3D2UA 4M6OL 3LEXA 3GSWA 5F96H 3PGCA 3CCHA 4EN3D 3L3IA 4NRZB 1LDPH 3LN5B 1EVTC 4NWUL 1INQB 5I0DA 4ONGL 2ESVA 4J1UA 1JPSL 2M8XA 2IAMD 4MA1C 4OCWH 4GXUN 5I17A 4TRPH 5T1LB 2HTLC 1B4JH 3CFKA 4ZUSB 1MHEA 2IQ9L 2V5RA 1PAMA 3IXTB 2WUCH 4DGYH 4FQXB 4N8VG 4R7NB 3B5HA 4NBXB 5JA8B 3VD3A 1AHWB 2OI9C 1ZHBA 4X7CC 4S2SB 1E4KA 2CR3A 1EMTH 1KPVB 1M7DA 4FQHA 5C0AD 5EIIB 3W11D 5D93C 1WZMA 1AXTL 2XG5A 2YSSB 4UIMA 3I02B 4UT6L 3RGVC 4BH8B 3ETBF 4YZFE 5FDWA 2F5AL 2XZCH 2UWEB 2Y7QA 3JV0A 3F6LA 5EU5A 3I75A 3BWAA 4NQCB 3TZVC 1F90L 1NCTA 4S1QH 4LF3B 2BNUA 2JB5L 3BKMH 3QH3B 2QSQA 5DHVB 4YLQT 4P4KA 1MIMH 1BVLB 1CE6A 4MAYB 2UWEF 1G9ML 1A1MB 2KBGA 4NQTA 5C9KA 1IT9H 4UILL 3CUPB 1EZVY 3E3QC 4U05A 4L4VA 1KC5H 4CJ0A 3VFUA 4XVUC 3B9AA 4XNXH 5J13C 1HHHA 3F62A 1IC5H 5JXEA 3RRQA 2GCYA 4PGJA 5AZ2H 3TPUA 3BMVA 2FX7L 4NN6B 5FO8A 4G9DA 4KK5C 5HHNB 1KLFA 5HVGB 4YIQA 3FRPG 3KPNA 4G5ZH 1J0KA 1XGTA 2YHGA 2WK2A 3ZT5A 4MLSA 3IXAB 1INDL 1I7UB 4D3CH 5TF1L 2AXFA 4FFVC 5CEZE 4U1JA 2DM7A 4DW2H 5IV2A 3QXDA 3N0PB 1GJIA 2VDOH 2NNAB 3U46A 4OB5H 3U7AA 1FIGL 2HAZA 1FG9C 2H32A 4ODXA 3HRZB 1T20A 4KMTH 1P7QA 4L8SA 3MFFB 4Y5VA 1P4LA 3FAXA 4WEUD 3JWDC 1GAFL 3GB7A 3KYNB 5IW1A 2ZCHL 1NMAH 1WFNA 1Z9OA 2XA8H 2ZZUT 4DOHE 2PF6A 1MRCL 2FJFB 4Y16B 5F1OB 5FYLD 1FDLL 4O5LL 5T33L 12E8L 4RMRA 1QSEA 3Q6GL 1DEDA 5L8LB 4M6MH 3ES6A 4PJBB 3WSQH 2EXYD 5J11B 2ADFH 3FRUA 3VJ6B 1ND0B 4MJ5A 1CBVH 1TVHB 1Q9WA 4GFTB 3KPOA 2EH8L 1LO5A 4LSPL 3H3BC 4GRWB 3GMPB 1TQCC 5DSCB 3QIWB 1KB5H 5FOBB 4NWUH 3ARGD 4NQSA 3UZQA 3VFNB 3MRQA 2VXVL 4XCEA 3HMWL 4HUXB 5GZNC 4OZFA 4DN4H 1DVFA 5K9JH 1A9EB 1MFCH 1U91A 2HT3D 2GK0A 3EOAA 1BJ1H 4GRWF 4D0DB 1KEML 3LEYL 4ZFZB 1YQ2A 4ZXBB 3HI1B 4HT1L 3OX8B 3VXRA 3X11B 4LSTH 4AIZA 4BFEA 4PJIE 5T5NF 1BX2B 15C8H 4LARH 2W60A 3CXHJ 4F9LC 4HXAL 1HILA 4NQEB 2D9CA 4ZS6D 2J6EL 3QEQD 1AXTH 1HSBB 1ITBB 1NFKA 1MI5E 4UT6H 2F54B 3LRGA 1FJ1B 1JI1A 1U41A 3OKDB 4IIQC 3G04B 1NBYB 2F5AH 2FWOB 5CP7B 4ZFGL 4UUJB 1KTDA 1BFOB 4LEOA 3BYTA 2NXYB 3M17B 1KCSL 1ZT4A 3OQ3B 1H5BB 1ZKAA 3QDJA 3WS6A 5ERWB 1ZHLB 4ONHB 4YFEA 4P46B 4O2EA 1JCKA 2D03H 1DQTA 2R9HC 2XA3A 1QBMH 3FMGL 4GG6F 1OGAB 3SBWA 1A6PA 4JHZA 4AT6A 1JPGB 3GJEB 3R4DA 2VDRH 5D70L 3V79C 4MD4B 2JJVA 3VH8G 3V6ZA 4GT7A 3QO0B 5IB1B 4M5YL 4M48L 5IMMA 1NUDA 3O3UN 4WEBL 2V7HA 2GY5A 2JCCB 1OTUD 4MNHA 1CLOL 1N8ZB 32C2B 2YPKB 1T04B 1DN2A 1AIFB 2PXYB 4QHUA 4CUCA 2YA2A 3RZCB 2CKBB 1MQ8A 2LTQC 2FX7H 1HSAA 1KXTB 3ULUD 3EAKA 2LU3A 1TNNA 4MQXC 3L5WB 1V5JA 4OD2B 3EO0A 3IJHB 4XX1G 5A3IC 5TF1H 1S7TB 2F53B 1YEEL 2JCCF 4N0FA 1RPQA 1I8IA 1I8KB 1CF8L 3WFCL 1OLLA 3LSOA 4QRRA 5IBLD 3DURA 5DD6A 1NLBH 1MQKL 4PJDF 1QFWM 1ACZA 3IT8D 5E94A 5K9OB 5T1MB 1JPTL 4FMFA 1K5NA 1K2DA 1KIQB 3V7MA 1HH9B 1CGSL 2VUYA 4XPAL 4URTB 4CVXB 4P2QE 2ZKHL 4I18A 1Q8MA 1GGBL 2E9BA 4LVHB 3BISA 1NGQL 3MRGA 1MY7A 4FQLL 4NRXB 5DEFB 1DUYB 2LQRA 1QFUL 2IAMB 4KDVA 3EDKA 3SDCD 4HCRL 3CC5A 4IMKA 5JXAH 3LIZH 5IESH 5FYKU 4YNYB 4LMQI 3EYQD 1FGNL 2A74A 2E9JA 3VG9C 1FDLH 2WM0A 4QOKA 5FO9B 2A38A 1PKOA 2YBRB 1Z6JT 5T33H 2C3XA 5C70A 4PJCB 4JFHD 5AUMB 4F33A 3STZB 1U58B 3AS1A 4M61A 1PEWA 4KH2A 5E6IC 1BZ9A 5JW4R 1HHKB 4R97B 1FH5L 3CX5K 5C0AB 4QRQB 1UJ3A 4MVBD 1MAJA 1T0MA 3OPZH 5F71A 5B22A 3S98A 1T66C 1KJ2B 4S1DC 1U8OB 3HB3C 4UQ3A 1R5IA 3FT4A 3QO1B 4LSPH 3BD3A 1RUKL 3FN0L 2HRPH 4G6FD 4K7PL 1I8LC 2NY7L 5IB4A 1FZKA 1TPXB 5ESVA 3WFHA 3TFKD 3L7EB 2AI0L 5FK9B 4NFDA 4HMEA 2X4QB 3VWKD 4AEHL 2H6PB 1UC6A 1F3DJ 4GW1A 4PG2C 4LCIL 2ICWA 5ELIA 1AGFB 1T2QL 4HIJB 1HNGA 2Z31C 3S8WA 5DQ9B 4X6CB 3TH4T 3VFWA 1CXFA 1KEMH 5D2NE 2YPLE 4X7FC 4RFNB 3QFJA 5HYSB 1LP9E 3B9KB 5L9DH 4HS3A 4U6VL 2BNQE 3TCXA 2VAAA 4LHQB 1Q9KA 5TGBA 2AK4A 5IUSA 5HDQH 4R3SB 3DXAE 1TITA 2J6EH 3LDBC 3MV8E 3BN9C 1R3HB 3FOLA 2X4NB 1FVEB 3NFPB 4X6CF 2FIKA 4YDIL 5B39A 4ZFGH 1O7SA 3WDJA 1S7XB 1R3LB 2ED9A 4XP5H 3ME0A 1KCSH 3BJLA 1A6WH 5IBTL 5HHMD 2G75A 2FX8H 5AD0B 4UQ2A 3DETC 2Y36L 2VL5A 3VFOB 3GNML 3VFPA 5I76B 1VGKA 1R24A 2HA1A 4UB0H 5D70H 3WJLC 3BPCB 3TWCL 3PQYD 1NCAL 5E99L 5HVHB 5CHNB 4I13B 2Z8RA 4J12A 2R0ZH 2CR6A 1Z9MA 4AH2B 5JOEA 4LPXA 4M5YH 2IBZX 1G7MB 2RJMA 4JFED 2CUMA 4WEBH 2X4PB 1CLOH 3ARDA 5BZWB 5SWZB 3TBSA 3X13B 1T1WB 1CL7I 5I1EL 5DS8A 3SGJA 4ODSL 2GHWB 1RZJH 5H94A 3I6LE 1V7ML 1A4JB 3B9DA 4PJGA 5AWNH 1F45A 1J18A 5ENWB 2XXMB 2YD8A 2LU4A 4IBLT 5F3BB 3U4AA 2P5EE 5HTSA 5I75B 3V5DA 1RJYB 1YEEH 3ZKMD 3S4SB 4LLYA 3MA7B 1I9IH 1CGTA 4OGYH 1NDGA 1OF2B 5F88A 2ZCLH 1AFVL 2ARJA 5CGTA 5D7JA 3NVQA 4GRMB 4TNWK 1T1XA 5ALBH 1G7IB 3LKNB 4ZSOE 1CGSH 1JGEA 4XPAH 1EO5A 1ZLWK 1ZSDA 2Q86B 1JTTA 1EDQA 3VXSE 1DBAH 3HI6H 4U2YA 2VLLA 5J56B 4J8RA 3FFDA 1YEDA 1E4XH 1J8HE 5FYJL 2Z8WC 5FHBH 2WQ8A 1U8HB 3HFML 3PGDB 1I1YB 4UTAL 1FGNH 5C09E 1AQDA 5C1MB 5KSBE 3BIKB 1FN4A 2Q7NA 5KSAA 3E6FB 2YC1B 1T5XB 3QA3B 2O5ZH 3U30C 2W0FB 5EBMB 1F6LL 1FZMB 4KKBD 3Q5TA 5KW9H 3RVXD 4LOUC 3MGOA 4OFYD 4RAUA 1RZKH 4I4WB 4XP1H 4LSUL 2OSLB 2HT2D 2DRUA 3EYOA 3L3OA 2ITCA 1IEAA 3QI9D 3D85B 4KV5E 4Y19E 1BOGB 1N5AB 4WHCA 4QGTA 3QEQB 5IF0B 4S0TD 3OB0K 3BGFC 2MTPA 3VXUB 3CFEA 2P7TA 3E3QE 1LO4L 1FNAA 2GAZB 3ARBC 2Z8SA 3MRBA 1KB9K 2CIIA 3FN0H 1F11A 4K7PH 3C6LC 5AYUL 2Y07L 5DZLA 2AS5M 5I8CB 3U82B 1K8DA 4Y5YC 5A1AA 3QP3A 4AEHH 5I1AB 5ID0B 4BFIA 4Z78A 4PRBB 4MA7L 1EA9C 4RGND 1B0GB 4LCIH 3A6BL 1IEBB 2OMBA 3A67H 3FZUD 3ESVF 1GYAA 5AZEH 5ISZA 2PR4L 1FZJA 1FAIL 2YEZA 2NY4D 2NZIA 4NQUA 5CWSA 3ZDXF 4TVPE 5DUBB 3RVWC 3MV7D 4ELME 1X44A 4X4XB 3T0ED 1WAAA 1BZ7A 4U6VH 4JO2L 4JFXB 4KJQC 4MA3A 3HCVA 2OJEA 5E00A 1PYWA 3MCLH 2NY0D 2FZ3A 4OF7A 1OTSC 1Z9LA 4M7ZB 2BOBA 4OFVA 1N6UA 5DVOA 3F5WA 4YDIH 2O5YH 4HJJL 1WT5C 3N06B 3VI3F 4OD3L 3WNLA 2XFXA 5IEHB 3IDIB 4TTGA 4TTDC 4KJYB 4FQ2H 4BSWB 2SEBB 5JOPE 3ARTA 2Y36H 5F9OL 1ZVSB 3QUZC 5KVDL 4CVZB 1KXQE 4RZCB 2IPKA 5A16B 3TT1L 3SKJH 1DSFL 4BFBD 1FYTE 1XF5A 5T5FL 9CGTA 1PG7X 4WWKC 3TWCH 4XVSL 3QZWG 1K4DA 1KELH 3E0GA 4JVUA 1DEEB 1F58H 5D1ZD 3ULUF 5LVEA 5JPNA 4PRNB 2V9QA 5IB5B 5IBUG 2BHZA 2YA1A 3FQUA 4PJFA 1NMCC 5GSVB 1FNHA 3GJFA 3SGDI 1QHOA 2DN7A 1IILE 4I48A 1FSKC 4PS4H 43CAB 1T7YA 4M7LL 4ODSH 4XNMB 4JPWL 3CMOL 3MBEA 1BQHG 1FVDB 4RGMC 1IGTB 1IAMA 1IE5A 2D31A 2ADIB 5CJ5A 1XCTA 4Y4HC 3N50A 2AV7A 1BBDH 1KJVA 3MJ7A 5H35A 3AAZA 5F7EH 3KPSA 4UZGA 4DKDC 5EO0A 5I73B 1DQQA 5ITBL 4MCYA 1CD9B 2J8UA 3EDEA 5CJQL 4HMDA 3PIQA 4U6TA 3SKMA 2GJ6A 1FE8L 2NLJA 4BQ9A 3L5XH 1NGZB 3KXFA 4KROC 4M8QA 1XGPA 1OCWL 1YN6A 1JK8B 2QHLA 1JPFA 3MACL 3QDGE 4EN3C 1P7KA 4L3ED 1BD2E 1MJ7H 4G6FB 1ZT7A 5IQ7L 2YA0A 1AP2A 3UBXB 3QUYB 2H3NB 2EZ0D 3JWNC 4GQPH 4WFHE 2AEIT 4RFEB 4GXUM 5FYJH 4M3KB 1Z5LB 3GUTA 3HFMH 5IFHL 5DMIH 4ZFOB 4IS6B 3LKQA 4PY7B 3ZHLA 4YHIB 4NZJA 3WL9B 3PWUB 2FECL 4NJ9L 4R2GD 1BECA 2M2DA 5KVEL 4KKCC 4I9WD 5C07E 3ULVL 3CVIH 2ZSWA 4EI5B 3EIFA 1W2KT 5C92A 4OGAD 3OXRB 3PWPE 1YPZA 4LLQB 4OBRA 1GZQA 3D3VE 1OHQA 3DX9A 1LO4H 4XZUA 4Z0XA 2AJYL 4YO0B 3VFGL 5KBNC 1HHGB 2Y07H 3NFSL 4I5BA 4OQTA 1JBJA 1MVUB 2OQJA 3V2AR 1D9KC 5HHMB 5IHZB 5GGSA 1JNNL 4E9LA 1T7VA 2MWCA 3A6BH 1B3JA 3VRJA 5D8JH 2ZOKB 5KJRH 4M00A 5I1LA 4NYLB 2DQEL 3V5HB 2DYPA 2R4SH 4U1GB 4WW1B 3DECA 2UVEA 1GC1H 3MROB 5E2UL 3PQYB 2P8MA 4B0MM 5LGJA 5KS9A 3RGVB 2VLJE 4KVNL 4KZDH 2NX5A 4ZNCD 1I1FA 2VDKL 2R56L 1T4KB 2EIEA 4WO4C 4KXZI 1HEZB 3UJIL 3RX8A 4MXWL 4OM1L 4JFEB 1N4XL 4PGZA 4ZYKB 1JF5A 1ZVHA 4ISVB 3GHBL 3TT3H 1M05A 1A4KA 4DKEH 4WY7L 1MFAH 3TO4C 1YEFH 3WEXA 2VDPH 3SJVA 3VI4E 2CGRH 1RZGA 3L3JA 4NO3B 3D18A 3HPLB 4L8DA 5F9OH 5L2KA 3VG0L 1T03L 3QJHB 1ZHKA 1YMHB 4XB8A 1KJ3L 4L8BB 4XCNA 5IVXE 4R96B 1IAOB 1IC4L 5I6XB 5T3ZE 1TJHL 2AKRA 4X7SL 4JPIA 4YXHL 2HMIC 5JHDA 4YX2H 2NY5L 2Z4QA 1WLHA 2C7UB 5GHWL 3TYGL 4JG0L 5J13B 2N1KA 2V2XB 3CDFA 2JELH 4HPOL 2Q3AA 4R4NC 1NLDL 4K8RH 3UC0H 2YMXL 2ERJC 2P24B 1OM3L 5DA4A 5HHVH 1D5ZA 4TOYL 5E2JA 1FNEA 3CMOH 5HGAB 5F3HB 1Z0MA 2YRZA 3VMPA 4PJAE 4HS6A 3RY4A 1HXMB 1QFOA 2CKBL 3QCVL 3RFZC 3GSVA 5DRXA 2AXJA 2KQMA 2GSGB 2J1KA 2PYEE 4JN2B 4F15C 4LDEB 3HRPA 5F1NB 4OKVA 1RULL 3PDGA 4HBCL 4MNQA 1XF2B 1DANT 4Q6IA 1DE4A 3AS0A 2XN9D 5C0BE 3QI9B 5J4MA 4WWID 4WFGD 4R0LC 1F5WA 1S7RB 4LCWA 1MCFA 4XGZA 1OCWH 1PSKH 4Z7NF 2AQ1A 4I0PA 3P4MA 1WCQA 2C3VB 2L4OA 1ERNA 5IQ7H 3ARGC 3P77B 3EYVA 5EU3A 1WC7B 5M95B 1SJHA 1QRND 1MJUL 2H9GA 4O2CB 4I3SL 1XEDA 1NCDH 3GRWA 1N2RA 3JV6A 3BQUA 4RGNB 4QEGA 3SPVB 1A1NA 5IFHH 3O8XD 3MOBL 3P4LA 5HI4D 1MLCB 3DARA 3KJ4C 3GI8L 3MRPA 4BH7A 3D69B 1UCBH 2R2EA 2DQDH 1QSFE 3G6JB 1U8NA 4NJ9H 1ZGLB 2BRRL 1I1AC 1XF4B 3B6SA 4G6AC 3T0EB 4F2MB 4MQ7B 5KVEH 5E5MB 4JN1L 3ULVH 4ZS6C 3MTRA 5C0EA 4DN3H 3O3EB 5E8OA 4NJAH 2QJDA 3HNTH 2AJYH 3G6JF 3IKCB 4XBGB 5TDNA 2DLFH 3O2WL 1KJ2L 4LPVA 5BS0D 3LN4B 1IAIL 3RQ3A 2N56A 2N4IA 2NQCA 3DMMD 4O51B 1VDGA 4JHAL 5F9AC 1A02N 4U6YB 5HYJD 3OWEA 5F8QC 3TIDB 5CAYB 1XR9B 5DRNB 4NM4L 1CI5A 4QYOB 4L5FL 1A7PH 4NQDA 3P2TA 2HTKC 3H3PL 1MLBB 5DQDL 2VXUL 5D1ZB 2R2HB 3TBVB 1L0YA 1A6TB 3OR7B 4IRSA 4X7DC 5D7KD 1L7IL 3L7FB 3WO4C 3UJIH 3IFLH 4MXWH 4OM1H 1N4XH 1HH6B 3BHBA 5BVJA 4PJ5D 3GHBH 5BJTB 1OT1A 4GKNB 5L88H 5FF6A 3OKOA 4P23D 2JE8A 1EXUB 3BSZL 1LD9A 2HFGL 1UZ8B 1BFSA 3UYOD 1H3UA 2AJZB 4W6WB 3VFSB 2D7NA 5E4EC 3VG0H 1A21A 4TSAL 4M1DL 1T03H 4N68A 4QTIH 1VEMA 5I66A 1AXSB 5HGDB 1KJ3H 5INDB 5BXFA 5FA3A 3B8YA 5HGHA 3V6OA 4DAGH 1UM6L 5L7XH 5CJBA 4ORZC 2A0LD 4JG0H 4L9LB 2OL3B 3C5JA 4KKAD 2VISA 4FQIL 3VRLF 3KDMA 2FO4A 2W9DL 3WN5A 5MHSE 4L3EB 4JFDD 1DQLH 1OM3H 4PRPA 3ALXA 4M93B 3SDCC 1TENA 3WXVH 4NZTH 5EUOB 4D0CA 2VDQL 1XGQA 5DVNA 4DVBB 1W8OA 1QFHA 1G6RL 4MXQC 3MJ9L 4G3YL 2ZG1A 2BNRD 2VSDA 4ETQB 2GYSA 3O3DA 4DZ8B 4R2GB 3MMEA 5C6TL 4PR5B 5CGMA 1UWEL 2MJWA 4LAQH 5DRWA 1AD9A 2GJZA 4HJGA 4CMMB 5LGKA 4XCYA 2CRMA 2NR6D 1X4YA 3OF6D 3TBWA 4MNGE 1RIHL 1AGEB 4FTVA 1TJIL 4P3CH 4OZGB 4Y1AA 1NCCH 2X1WL 3PWNB 3V8OA 4GG6E 1RV6X 3L3KA 2VLKD 3EFFA 5EZIH 3LS4L 2JB6A 1H8NA 4YUEH 3FTGA 3VWKC 1SHMA 1E0OB 4JY6B 2ICES 1MJUH 3NABH 4PV9B 2VXSH 5ESAB 4RWHA 1A7QH 2OR7A 4OZGF 4HWUA 1MCQA 1IQWH 2R69L 5MENE 4Q9RH 4JKLA 2LAGB 2UZXB 3MUHL 3TJEL 4GRLD 3OAUH 3DV4A 1CGYA 3WJJA 2FYYB 3MXWL 3T3ME 8CGTA 5DZOA 4JN1H 4OAWB 3G5XB 1G7QA 3PWVA 4NN7C 4HKZB 1GZPA 2QKIA 4P4KC 4NNYB 2CMRH 3EW3B 1VFBA 4KUZL 1B0RB 1TJGH 2VQ1A 4S11A 4S10A 4N8PA 2AP2A 3S96A 3O6KH 3O2WH 2JF1A 1U2CA 2CLRB 3RX5A 3RL2B 3HLAB 5FKAA 3HE7A 1H3WM 3R0NA 1T80A 2DF3A 3B2UD 4PJDE 3ULSB 4YEEA 3C9NA 3IFOA 1QLRB 2C3WA 1QFPA 2WSKA 2MPAL 3QUMA 4HC1H 4N0RA 2HG5A 1IRAY 5I30L 1DUZA 4K9EH 1FNFA 2D7TH 4NUGL 4FFWD 1WUNT 3FQTA 4NM4H 5JXEC 1OAQL 3E2HC 4L5FH 3X12A 5JZ7D 5DMKB 5EU6E 2VXUH 3QNXA 5DWUL 4LK4A 1N0LA 3LS5L 3STBA 2OZ4L 4H0GA 3KLHD 1L7IH 3KYMB 5DHXB 4NOBA 2C26A 5H2BA 1JGLH 3QG7H 3AC0A 2AEPL 2BSSA 3DRTB 5ANMA 3IGAA 5T1KA 4X6DE 5J7CC 4OLEA 3BSZH 2HFGH 3ARFC 4WUUA 3KNBA 3WIIH 3VD9A 1IAIM 3C09C 5C8JA 2WAHA 4TSAH 3O4LD 5GGTA 4KKLD 1F3JB 5JDSA 2H41A 4L8SC 4LSSL 4Y5VC 5C3TA 2JTDA 5DJAB 1TXKA 5GRUL 4YHKH 5F21B 3KYOB 4QHLB 5SX4I 1B88A 3VD5A 5C0CA 3MV01 2DAVA 4FHBD 2XN9B 2B0SH 4YBLC 1UM6H 3S37H 2ITDB 1IVLA 4EBQH 4ZUVA 4NP4L 5J1TC 1S9VA 2PW1A 3G6AA 4KHTH 5BRZA 4OLWL 4JRYA 4WTZA 5IB3B 2PTTA 5FA4B 4PJHF 4FQIH 1R3KB 4BZ2L 2P8LB 4NQXA 5I1GH 4QY8A 2XWTB 1UM5L 4HK0B 4NOFA 1QRNB 2A6KA 3U0TB 1BZQK 4G8EB 4IRJD 1XF3A 2XQBL 3RTQD 3O8XB 1G6RH 5JHLH 4HKXA 3GSUA 3MSPA 1W72A 1YUHB 4ODWA 4G3YH 1OAKH 4JY4A 3ZDZE 4CL7A 4NHUA 4NKQB 4LLMB 5CIPB 1MAML 1I8MA 2GEEA 1A6AA 4PV8B 4UDTA 1HIMH 4I2XA 5FYJU 1A47A 5CZKA 2HH0H 3OXSB 4XXCA 1OL0A 3IFPB 3RWCB 3QDMA 5D2LE 1VADA 3MO1B 4TUJB 3QQ9D 3QXAB 2ZPKL 3LAFA 3AXLA 2X4TB 1NGYA 1RIHH 1P5UA 1TJIH 1UVQB 2QADC 1OSZB 2DBLH 3IJSA 3DHMA 3ET9F 3L3GA 3NACH 2EDLA 1ZWIA 3IRZA 1KIRB 1K3IA 5E6YA 3W0WA 1G7HA 2AJUL 4O9HL 3DMMB 1R0AL 1OWRM 2FL5B 4P9ML 3Q3GB 3I3EA 5FGSA 4NZUL 2DIBA 2NY4C 5HYJB 2DQTL 2XRAH 4JFYB 3ZKXC 4MA8L 3P9LB 3MLRL 1CU4H 2B4CC 3TJEH 4W81A 3DSNA 4ZFOL 3E8UH 2NY6D 3MRLB 1PFCA 5C08A 4P3WA 3WS6C 1BFTA 2DTMH 4JZJA 4ZPTB 3LPWA 4Q0XL 4Z8FL 5DK0B 3PL6A 2EDEA 4Y4FB 4LRIC 4G8FB 3C6LB 1N64L 4WRLA 3SBWC 4P3DB 5FXCH 5GISL 1RHHB 3U7YL 4NO0A 3UTTE 1FFRA 3CK0L 3V4PL 5TDOB 2CDEA 4PJ5B 5GPRA 2XKNA 1UXSB 2OK0H 5D7IB 4PJXE 1YY8B 1JGVH 3WIHH 4G42B 2NY1D 5EFIA 2RFXA 5DJ2A 4XBEH 1HQ4B 3FO2B 1W8NA 4OZ4A 2X40A 3FO0L 5GS1B 1IC1A 4LSVH 1FFPA 2PO6A 5FYLE 1SEQL 3B3IA 8FABB 4AEIL 3RKDC 1OAQH 2WBJD 3KR3L 5IFJA 2E27H 2EIBA 4YAQB 5ICYB 5IG7B 4Z7UA 4PJ7B 3PDOA 3S36L 5HYSG 1NQBA 4XMKL 2X4OA 1S9WB 2NY3D 5EOCH 3TBTB 5DWUH 1S5IH 2OZ4H 2GITA 4YDVB 1EFXB 1VHPA 2H1PL 4L4TE 4JFDB 4BK4A 2AEPH 3OKLA 3DX6A 5DMYA 1K8IA 3AUVA 4L8CA 1RUQL 3UMTA 2Y6SD 3QUZB 1D6EA 4HV8A 4P5MA 4PJ7F 1R3IL 3B9EA 1QFWH 5HHOD 4I18C 3RU8L 1EJOL 1JGUL 4MZ3A 5KZCD 2E7CA 3MRNA 2BNRB 1TQBC 4HFUH 4PLOB 5GRUH 2AQ3A 2A9MH 3RL1A 5ICZA 1U8MB 4IMKC 1SEBB 5KTEL 1UZ6E 1KIPA 4JZOB 4MJIA 4LSRH 4NP4H 4PJ8A 5I74C 3D39D 4OLWH 1XIWA 4BZ2H 1VA9A 4HIHA 2MQCA 4HIEB 3J8F7 2VLKB 1H3PH 3ZDXE 4K94C 4C59B 2I60H 4RGMB 1NAMH 2CRZA 4OM0L 1UM5H 5CD3A 2NW2A 4HC1A 1UJ3C 3ZYZA 1NJ9B 3PE9A 3OHXB 1ODAA 4HF5L 2ZSVA 1ROWA 3BPLB 1ETZA 1G7JA 1MAMH 2Z8VC 4WGVB 3GSXA 5FHAH 3OTTA 4GRLB 1HYSD 4MDJB 3WXWL 3INUH 1CR9L 2BDNL 2WNGA 3S4SG 1KULA 3RWGB 1L9MA 1AR2A 4QHMA 1JZ2A 4PBVC 4QRUA 5F9WB 4PP2B 4CW1B 1MJJB 5E24E 3QAZB 4OCXL 5DD1H 4YR6A 4Z76B 2Z91B 3U79A 5TE4L 4UDUA 2E8YA 1NGWA 5EG6C 3JWDL 2CLZA 4ZDHA 5IOPA 2D7MA 3EJYD 2DIJA 4O9HH 1CGXA 5DYOA 1R0AH 1BQLH 1U8JB 4U1NB 5DK3A 2LFGA 1VPOL 5DTFA 1UGNA 3ULUE 2ESVD 4MA8H 3RNKA 1B4RA 4Z7WE 1LEGB 3K2UL 4F9PA 1DL7H 4WHTA 1HQRA 2EDNA 4Y8AA 1U3HA 4FP8L 4Z8FH 1N0XL 3CFBA 4IOFD 2Y25A 5EN2B 1DP0A 1FL5B 4HG4K 4GW4B 2H2PC 4XAKE 5F7FA 2O26U 2XZAL 5GRZA 1U3YA 4JB9L 5CINL 4OZHB 3SGKA 2PW2B 3BW9A 1D9KB 5B8CC 1LO0H 4GW5B 3CK0H 4MWFB 4OJFH 1UA6L 3V4PH 3ALWA 3RA7H 5DJXA 5D71L 3RWFB 4YHZH 4HH9A 3FO0H 1IAII 4XVJH 5JOFB 4ZQKA 4PJIA 3O4LB 1TCRA 3DOSA 4OZHF 2APXA 1SEQH 3ARDC 4U1IB 1TZHB 1WBXB 1MI5A 2BY2A 3SGJC 5C86A 1CDYA 4PJ9D 2EDJA 1FVCA 2DQFB 3TA3D 4WO4B 5MEQA 3QQ4B 4JZNB 3T65A 2ARWA 3VXOA 3HUJB 4LASL 2WWMD 1ZK9A 3EO1B 1VSCA 3HAEB 2XG4A 3L5IA 1VFOA 3CSPA 1UWGL 3TO4B 3DWTA 4M7JH 4X99A 2HFEB 3LB6C 4L4VD 5FYKD 3SKOA 3CVHB 3DVNB 3L6FA 1MFEH 3AMLA 5D7LD 4XRCA 3AM8C 1NBVL 4OD1L 3FQWA 3GMLB 5FEBA 5D7JC 5EH1A 2BMKA 4TVSa 3RTQB 3U36A 2AXGA 3HUJF 1YC8A 5IK3B 1NUFA 3RU8H 4K7PY 5BO1L 1EJOH 1RZIB 2WINB 4L3AA 1P7HL 4KJPC 5F8RC 4X4YA 2R23B 3HMXL 4ODTH 4U1SB 2FH8A 4DCQA 4O02L 1U8PA 1J1XL 5JR1L 5LXGH 5KTEH 3QXVA 1BWWA 4QCIA 2K1MA 4N90E 2VLMD 1MFDL 1U8IB 1B6UA 3PWLA 3CXHK 4LQFH 1JNHB 1M4KA 3THML 3CX2A 1VGEL 4OF8A 2H45A 2WP3T 3RUGF 3KJ6L 1T7WA 5D1QD 1QVOB 2CDFB 4XC3H 3DIFA 1T3FB 2OL3L 1CDIA 4OM0H 4PIRF 4PRAB 2MSPA 4ZTPH 1P7QD 2OM5A 2ZUQB 3J7HA 3NAAL 4D8PB 4TVPH 1IM9A 4F15B 1UB6B 4HF5H 4GBXD 4HUMB 3OR6B 3WHXB 3F6IA 4LEXL 4QRPD 4QRTA