4LLUB

Structure of pertuzumab fab with light chain clambda at 2.16a
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
210
structure length
210
Chain Sequence
DIQMTQSPSSLSASVGDRVTITCKASQDVSIGVAWYQQKPGKAPKLLIYSASYRYTGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYYIYPYTFGQGTKVEIKGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Generation of bispecific IgG antibodies by structure-based design of an orthogonal Fab interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords PERTUZUMAB FAB Heavy chain
total genus 46
structure length 210
sequence length 210
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lluB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lluB01
2PETA 1K8IA 3PE9A 4NO2A 2Z93A 1OAZH 1EUTA 4G9DA 3GHEL 4YWGH 3B2VL 3WHE1 4PS4H 5C0BA 5DUML 5D96C 1TNMA 5ETUB 1CLZL 4WFGD 5FYKH 3X12A 1FH5L 2WBJC 4CVXA 5GGUB 1HINH 5CZXD 3HNSH 4JJ5A 2VXQH 1U58B 4MWFB 3MLXH 3HCVA 2DM7A 1IAOB 1G9MH 4A6YL 3EOAA 4HBCH 3PL6A 4H8WH 2DLHA 4DZ8A 2EC9U 3ECBA 3OJDB 4U7KA 4YBHA 2R0ZL 4HF5H 2H2PD 4LRNL 3O8XB 1GGTA 2V2WB 3DUUA 3FO0H 2B20A 1AFVL 2DBJA 1SQ2N 5BV7H 3MXWH 3G6AB 4Z8FL 5E0QA 3LEXB 5HHXH 1YYMH 4AENA 2WANA 2YPLB 3B3IA 3HR6A 4N8VB 5D70L 2O61A 4K7PL 4ZQKA 4MGXA 5F7NC 4DN3H 2R2BA 3VD4A 3B3IB 1BVLB 5MI0C 5FECA 4YPGA 5GRVL 3WJLC 1RZKC 3QCUL 1FLRH 3FQRB 3HTLX 4HBQA 3BGMB 4HT1L 3MYZA 3KHOA 3MOAH 1H3VA 5J7CC 1J1XH 1NC4B 5CEZH 4G5ZL 2J3SA 2Q8AL 4HK0B 4M1CD 5D9SB 3H9YA 3CVHH 4PBWD 2FEDC 4DOHE 2P5EB 3C8KB 5B39A 1J8KA 2R0WL 5CZXC 4OQTH 3S9DB 3PHQA 3TZVC 2KZ1B 4LVNC 1UCBL 1CD8A 2EDBA 3BIAX 3IFLL 1HCFX 3RL2A 1PKQA 3WJJC 2DM2A 1DVFB 3C2AL 1FHGA 4KI5F 4HQQL 4YXKH 1WWBX 1G9NC 4WV1C 1TVDA 1U8OA 1I8MA 5I1IH 5EO0B 5IMLA 1M05B 3V5DA 2VDNL 3LB6D 3RIAF 3RL2B 5C6WH 3HC3H 2P7TB 3WFCH 1CGYA 3HUJA 3MUGA 2P8PA 4Y4HA 4KY1H 1MI5B 5DQDH 2BVOA 1EMTL 4JDTH 3FB6B 5CP3A 4MDIB 3NABL 1MJ8L 4N8VA 4E41E 2I26N 3AREC 3QZWG 1AP2B 5FB8A 4HGKC 3SPVA 3TA3B 2O5ZL 2BVOB 5AD0A 1LO4H 3ZO0A 1OGAE 2AEQL 2BHUA 3CPLB 1P2CB 4XC1H 4MA7H 1F97A 3HAEG 3HE6B 1RK0B 4YDJB 2P8LA 3MQIA 3P4MB 1JF1A 5E2UH 2BMKA 1JGUH 2RCSL 5HYQA 5J11C 5JMRA 4AT6B 5DEGA 4OIAA 2ATPB 5KVGL 4RAVB 4RWHA 2DQTL 3WIHL 1I1AB 3QEUB 3IT8D 4NUJB 1XH3A 2BSRA 3FONA 1KFAH 2EC9T 3HI5L 1I8KA 4KK8D 4QRQA 3RPKA 3HI5H 4XCCH 3EOBB 4XCYA 5AZEH 1KGCD 2VABA 2YD2A 4LRIA 1CDUA 2CUIA 3HMXA 3PNWA 4G42A 3UXFA 4FQ1L 3ULVD 3U6RA 2CIIA 4Z77A 2WLYA 1TDQA 5E95B 1K85A 3ILPA 3LSOA 3OHXA 2ILLA 3NIGE 5HHNB 4YHML 3U30B 3TM6A 5FA3B 2YZ1A 3RZWA 2B4CH 3BD5A 3RU8L 4Z0XB 5HYSB 5LXGL 1MHHA 1JTPA 5TDPA 4OZGF 1MQKL 4PRNA 1MJUL 4LVEA 4X6CE 1U3HB 1JPTL 5CGMA 4OD3L 1NCCL 4RCAA 3T4YB 3VXSB 5MERA 3MRPA 3L3JB 5E6IB 3IJHB 5EPMA 4CJ0A 5ISZA 3NIDF 4BQ6A 1FJ1A 4ELMF 1S7RB 1H3WM 2OI9B 2VDNH 3JZ7A 1DTUA 2FWOB 2Q7YB 1PEZA 5F9WC 3CU1A 4QRTB 2XRAL 4X80L 3PHSA 2F54B 3VMPA 3MLVL 5IHLB 2V5SA 1Q0XL 3KXFE 2XTJD 4NKIL 5CCKL 2EDOA 3GK8H 5AWNH 3UPCA 1ZTXL 2ZUTA 3QPQD 1CXEA 1LDSA 1SY6L 3RVTC 2MHAA 1OM3H 3ZTNH 4BZ2L 3WKMH 4WUKH 2OXHA 3N1MC 1QRNA 4X7TB 4FXKB 4OZHB 5KJRL 2QHRH 4U6YB 1CI5A 3MOAL 3PP3K 4KXZI 4J3VA 4PRBA 2EDWA 5CD3B 4DKDC 3ARTA 1RMFH 3E3QC 4OSUL 1FLRL 5BXFA 5I73C 4EN3D 2AJYH 1TQCB 3EHBD 2DI7A 4LU5H 1LE5A 3MLZH 4XZUA 5B3JF 3O11A 5KOVC 5IR1B 3TVMA 2NYYD 4TPRL 2L0DA 3DRQB 2A74B 5DJDB 4WIQA 1MH5B 1WEJL 4L29A 5FO8B 4FFYH 3WO4B 2G5BB 4W4OC 1KJ3L 1ZTXH 3OKYA 3TJEL 1VCAA 1Q72L 4XPGL 1K8DA 1KPRA 3KR3H 2YN5A 2DLTA 4ZDHB 3SO3B 4P5TC 1CFQB 3QXAA 4RZCB 5I76A 1RUQH 3VW3L 4HGMA 1T1YB 4GOSA 3P11H 1FNAA 3T0EE 1FFOA 4OZFG 2ZNWA 5EZLB 4LCWA 4PJ5B 4D9QD 4QXTA 2NLJB 3V79C 2X4PA 1HNGA 1HOCB 4I0PC 2X1QA 3L3KB 4PY8I 4X83A 5AYUH 3VRIA 1NQBA 5DRWB 2XKNB 3FQUA 1AGFB 3QWOB 1DQQA 5C07A 4LCWD 2HKFH 2AJYL 2VISB 4WUUE 1W72H 3WEXA 5KSVA 4I4WB 2J7LA 4WHYH 1GGBH 5EIIA 3L5XL 4MHHG 3G9AB 2E3VA 4RGOL 2DOCA 3DX9A 4WGVB 1MFAL 1JE6A 2QKIA 3X11B 2OTUA 1OM3L 3ZTNL 1Q72H 2R2EA 2ZSVB 4YEEA 4FQ2L 4QRSA 3R06A 3TJHD 1CDHA 3GMOB 4EZMA 5F7YC 5D6CB 1FFNB 2EZ0C 4RISH 2RQ8A 3B9EA 2DLFL 2Y07L 3KYAA 2V7NA 4V2CB 1EEYA 3G5VA 4PRPD 2X41A 2EYTA 1MAMH 1VFAB 3MLTA 4AL8L 4LU5L 1SYVA 2NNAB 4X7EC 3BN9C 3QJFA 5I17B 4O02H 4WWID 3H3PL 4F2MB 1NH6A 1DEDA 1MLCA 4IMKC 3SKMA 3ULVF 3B9VA 3BE1L 1ES0A 4PGEB 5IGXL 4HIEA 3ZTJH 1XCQB 1X5HA 2IFFH 1U8HB 2FL5B 5D1ZC 2A9NH 3RWHA 2BNRA 2BFVL 3OKEA 5HDQL 4MA7L 4ZTPL 4CMHC 3VXSD 3VD5A 5IK3B 1BF8A 2B8OT 3D5OF 3C5SA 4JY5H 5I1CH 1CL7I 4NKIH 1EEUA 3V52H 5HHOE 2BNRB 2NX5B 3CMOL 3N85L 1QSEE 3WNLA 4MD4A 2OK0L 1AO7B 1U8HA 1S9WA 3PDOA 2FATH 1T0MB 4IDJH 3U7WH 3DPBA 1BIIA 4WTZG 2ICWI 4K07A 1TFHA 4KI1A 2J8UB 4WI7A 35C8H 3QDMB 4QXUL 1NCCH 2MJWA 3RTQB 4N0FB 4AEFA 3T65A 2EYTB 4N8CL 1BJMA 2P46B 4HJJL 3K8MA 4N90E 3VRJA 3RU8H 5HYIA 2FECL 2D0HA 2R0WH 4PLJC 1S8DB 3X11A 5DR5H 1P4BH 2PW2A 3D39B 1CLOL 3W9EB 3V6OA 3RZCA 4TUKH 1KLUA 3SKOA 1ACYL 2FIKA 3LEVL 4ZPVA 2X4TA 3GBNH 2ESVA 1DCLA 4PGZA 3VCLA 5HGBA 3GSNL 5T33H 1G6RH 2P48B 3VA2C 1JF5A 1A6TA 2VH5L 4CADB 3UJIH 4NBYB 5F9AC 2XQYG 3HZVB 3TPKA 5DI8B 5EUOB 3W5NA 3QIUB 5J13C 4LSVH 4LSPH 3GKZA 4M7LL 2M1KA 3QUYA 4AIXA 2JTDA 3I3DA 3H9SE 1FVEB 1Z6JT 4YDIH 4PV8A 5D2LB 3CXHK 3HI1A 5IFHH 2V2TB 4XMLL 1EDQA 2ERJC 4LRNH 1DBAH 4NUJA 4KAQH 3H7LA 1NPUA 3OWEA 1XF5A 2AV1B 5ACMA 3FHAA 5IHZB 2AEQH 1RIUL 2VDMH 2ZUXA 1A9BB 1GHFH 1KCSL 1T2XA 4XB7A 2A9NL 2GITB 5JIKA 2IMNA 3RGHA 5D6DA 3L7EA 5ANMB 1FIGH 1HSAB 3A6BL 4PR5A 3TH2T 4EI5C 2XWTB 4QXGL 4R97C 3PWVA 5IR1A 4YC2C 1XMWA 5IB4A 1QFWL 1CVSC 3MCG1 3WFDL 5ESVB 3VFWB 1OD9A 4WCYL 4R0LB 3MCKA 3QR2A 4RMUA 4NDMA 4HIJB 5GGRB 1FE8L 2HJLA 2DRUA 3I3EA 5HYSA 5HYSG 2YPKB 1HN1A 3HZYA 2DDQH 1S78C 1DE4B 3CJJA 1GGIH 3BFOA 3Q5OA 5LAXA 5CD5C 5JO5A 5CJOL 4OBRA 3EYFA 3VG0L 4EOWL 4IOFC 1CD9B 4JGJA 2HT2D 4FFVD 3IDXL 2R1XB 4IHOB 4ZYKB 5K9OA 1WC7A 4L4TB 4CBPA 2GIYA 1HHKA 4N9GB 3JXAA 2WNGA 3QQ9C 2W38A 4GSDH 4Z7VB 1MIML 2Z35A 3WLWD 4PLOB 2KBGA 1FO0A 3KS0H 5A2LH 1YY8B 3J7HA 4XP6L 4BH8B 1RZ7H 4ZO9A 3VDBA 4JRXB 3QCUH 3DI2B 1UM4L 3MRDA 3GMRA 3OKKB 4WFFD 2FO4B 1P4LB 4AQ1B 1RJZA 4LBEA 4G6KH 4XP5L 5DRXB 3INUL 5D93B 5DRZA 5IM7A 4GBXA 1JGLL 5DFWH 2QQQA 2GEEA 3N1FC 4X98A 4YBLB 5MEQB 4RA0C 5IM7B 2NW2B 4OLXL 5I1DA 1NAML 3MRCB 1KEMH 3B83A 3PWPA 4Z6AT 3GK8L 4P5KB 2FO4A 2J12B 5SWSD 4KROB 1XGUB 1M05A 4HIIB 2YPLA 1MWAB 2QV2A 3AS2A 1JL8A 3DXAE 4UQ3A 2WIIB 1BF2A 2O5XL 4EQ3A 1QKZH 4TSBL 2HT4C 4HUMB 4M1GH 5HHNA 3TJEH 5C08B 1BFSA 4LCYA 2P7TA 1PKQB 1IC7H 2GJ6E 3Q48A 5DK3A 5BS0A 4BSVA 1IC4H 3G6JA 4HK3J 1FYTD 3BT2H 1WFUA 3S35L 1EO8H 3I9GH 3MLZL 3ARZA 4I9WD 3D0LB 1HI6A 3AU1A 2VTFA 4LCIH 3C08H 5TE4L 1EEZB 3SDDA 4X8XA 3FFCB 4ZSOA 1Z3GH 1OLZA 1KTLB 3ETBF 3QEUA 43C9B 1HEZB 4ZFGL 2A0LD 4HXBL 2FJFA 1Q38A 2NYYC 3DURA 4KK5C 3SGEI 4K7FA 2DICA 2D4FA 2NY2B 4O51A 1FZJB 1I8IA 3JV5A 5F8QC 3DSNA 2A2QT 2XN9B 1P5VA 3MRBB 3GI9L 1H5BA 4NO5B 2HJFB 3RJQB 1H3UA 5JXED 3DLQR 3O81A 4GBXC 4U49A 1PEWA 3BN3B 3WE6B 3ROLA 1DR9A 3IRPX 2HT4D 1LK2B 4OZHE 5H37H 4JPWL 2I27N 4RA3A 2X40A 1JZ4A 3C5ZA 4AEHL 5ENWB 4BQ9A 1A7NL 3C60A 4WO4C 4DW2L 3V8OA 1U95B 4OLEA 4QTHB 4Y19E 5A3IC 2JB5H 4X5XA 1PX4A 3FB7B 4J7RA 4X6CA 4X8JB 4EI5B 1A4KB 1ZGLB 4OBSA 1H8NA 2PYEA 3VH8G 1LILA 2JK5B 1NKRA 1A6PA 3DV6A 2YXMA 1D5BB 3RL1B 1EV2E 1F11A 1CL7H 3HRPA 1J9CT 4AG4L 1KCRL 1WBZA 4NRZA 3JTSB 1UM5L 3FFCD 5I8CA 1OAYH 4KQ3H 2DWEB 3ZDZE 4LLVA 5KVFL 4D3CL 3KYOA 1BIIB 4E5XA 1KBGL 2WIIA 1UWXH 4HWBL 4JQXC 1ORSA 4P2CG 1TTFA 4L3ED 4LCUA 4U0QB 4WNQA 3EHBC 3MJ8A 4O2EB 4JN1L 4UOW1 1QP1A 3PWNB 3BGMA 2PW2B 4MVBC 2NY5C 2EIZA 4Y19A 1DBJL 3WS6C 4MD5A 3OKEB 1BLNA 3VXOB 1XF5B 1VFBB 3VMNA 4GG6E 3QDME 1F4AA 2VDQH 5DHYA 1MNUH 3HA0A 5IVOA 4FRWA 2XZQL 5K59F 3QDMA 4PB0L 2OYPA 4PR5B 2RCSH 3HS0B 4UAOB 3HE7B 5FYKE 4KJQD 1RZ8A 1EFXA 3QDGA 2ZOKB 1AGBA 2VLJD 4IIQB 1F4XH 3KPQB 3VFPA 1I3GH 1INQA 5JOFB 3DVGB 2DQUL 2A38A 5JZ7D 3MLWH 5CJBA 5IW1A 3EDFA 2VAAB 5ISZD 2G9HB 1JRHL 4S1RL 5C0IA 2DM4A 2VZSA 3M1BA 5JNYB 2Z8SA 3WXVH 4KY1L 1AY1L 4K71C 3RWJA 1KNOB 4L4TD 5E8EA 1MJJB 4FTVA 4OKDA 2NW3B 3CUPA 3VG9B 1A6AA 5IKCB 3PP3H 3KG5A 4HSQA 2G5RA 4MNHA 2IQAB 3S5LG 3U36B 2DDQL 1A1MA 3GMPB 2GT9B 5FDWA 1HQ4B 1ZLSH 4ODHL 1S78D 2GFBB 2JJUA 3WN5B 1S7SA 1RUKH 1JV5A 3D25B 4OZHF 3L7EB 4A6YH 1HOCA 3V0AC 3PP4L 4MXWL 5IT2L 3QHZH 4APQA 3U4BL 3ZKMC 3TBYA 2DQUH 4NSKA 4G6JH 4PJFB 5E2TH 4MDJA 4HWBH 2R56H 5DR5L 1CFQA 3QXAB 4RZCA 4P46A 5C9KA 3ZKND 4JVUA 4DEPB 3GMMA 4XI5C 1TZHA 3QG6A 2ZCKH 4KKCC 5CGYD 2YSSB 5C0CB 1EA9C 2NY6D 2DD8H 4ODXB 5M94B 2ZOKA 3O6KL 1R5WA 4LCCA 1X9QA 2Y6SC 3P77B 1AD0B 3PWJA 3HHRB 3NTCL 3NH7H 2APTA 4I2XA 1WGOA 3TA3C 3VFOA 2ED7A 3W5MA 2FGZA 5GJTL 3AS3A 3OKDA 4ONHA 3UJJH 3FOLB 3RJDA 1QQDB 1FNEB 2VE6A 3KLDA 5HI3C 3AMLA 4QHMA 1MHPH 3L3OA 2VLRA 3L3DA 1N59B 1I1YA 2IH3A 5I18L 3SE8L 1NCWH 3B9KC 1CQYA 1LHZA 3QJFB 2NW3A 3UJIL 3U7WL 4IMKA 2J4WH 3MRKB 3ZE2E 3BEWB 4C58B 3GIZH 1I9JL 4GMTL 5E2WH 4ZFOB 3TO2A 4NZRH 4WV1A 4MD5B 1H8SA 1I8LA 1WZ1H 5EU7C 2VNCA 1G1YA 5JQ6L 2CLVA 4QHLA 1DQMH 5I1CL 5IG7B 4FQJH 3FQTA 1HK6A 4V1DE 1DFBH 2ZCLH 4FZEL 1XCQA 4PBVC 2VZUA 4FFWC 4ELKA 3ZE1E 4HUVA 4KVCL 2DQJL 3QRGH 3R0NA 3OKNA 2BDNL 1QBLL 2YD6A 4LAJH 4P3WA 4IRJA 4DKAA 4LEXL 1FO0L 5BMFH 3ARWA 4FQIH 5IIEB 1MLCB 4HKXA 3BE1H 1KSRA 5L2JB 2BOBB 4F9PC 5T1LB 4W4OA 4Q6YA 3QXVA 1IARB 2APXA 3QWOA 2QTEA 1TZHB 3K81A 1S7VB 4P23A 5IW6B 3QPXL 1DBJH 4UAOC 3VXME 1QEWB 1FIEA 2AV7B 4GAYA 1CS6A 5I9QC 2BSED 3CDGA 1KB5A 2DQDH 3AC0A 1HH9A 4K8RD 2NTSP 3SJVD 3VXMA 2F9BT 5IW6A 2VQ1A 5EO1A 1U8QB 2BHYA 3PGDB 3DVGA 3MA9L 2CUMA 1U2HA 1UKSA 1DBKH 1A4JB 5HDQH 5GPRA 1FVCB 3IDJB 2DWEA 1I3RA 3SDYH 3MRLA 4LVHB 3EGSB 4XVUC 3REVA 1G7QA 3LV3A 5ERWA 3RWFB 4GW4B 4FQIL 3S3JA 4UMGA 4FTVB 3GGWA 5TDNA 3F6LA 4MQ7B 4NQEA 3HPJA 4J4PC 1Y0LA 3TESA 2FEDD 5J4MA 3IVKA 3G6DH 3TYFA 5HGAA 1YDPA 1HHGA 2I9TA 2XG5A 3N9GH 4WW2F 4HDIA 5F7UA 3BKJH 3QEHB 3MV7E 4WHTB 4F57L 2NXZB 1WZ1L 3C60B 1RIHL 2ADJB 4LKXA 4GMSH 3UYOD 5TF1L 5B38B 3KR3L 2CDFA 2J4WL 3WS6A 3ZYZA 2Q8BH 4PJ8A 3TEUA 3SDCA 4Z7WB 1NAMH 3OF6D 4OAWA 5HHMD 4P59H 1EAJA 1YMHA 4P48A 4JCLA 1PDKA 1PQZA 5DF0A 4LOUD 3VGGA 1XCTB 3TO4C 1MCPL 3U46A 1UC6A 3HC4L 4HEPG 4D9RD 5F9WB 4HXBH 3LN5A 3L5XH 4C56D 1MFDL 1ZT7A 2YR3A 4PJCF 1NL0H 2X7LA 2A77L 1AGCA 1E4WL 2W60B 1CE6B 1F2QA 1SEQH 3BHBB 2HKFL 2HKHH 5C0CA 4KDWA 3QIBB 4GBXB 5KVEL 4X4YB 2D4DA 4JM4L 5EC2A 1ZKAA 3IDMA 4PY8J 3RWIA 4IJ3B 4U1JB 3SDDD 3MTRA 1NCNA 1UA6H 5D4QA 3WKML 1IEBA 3ZT6A 3SE9H 1JHLH 3RBGA 1IM3B 3V7MA 3BVNB 4L4VB 4LSSH 5INCB 3H9HB 2OR7A 3LPGA 1C7SA 4KV5F 32C2B 4XPBL 3OR7A 5D7KD 5DVNA 5IB2A 3DIFB 1EJOL 1S5IH 1H15B 4YNYA 1YEJL 4GG6B 2X89D 5HYJA 4H1LG 3VDAA 1FJ1B 4G80B 1T04A 3P40A 3TBWB 5KTEH 5F7HA 3AGVA 5L2KA 3BRDA 2AABH 4NP4L 4X7FC 2NY5H 3KYMB 4ZFZA 4NZTL 1FVDB 3O41B 4PJIE 9CGTA 2X89A 3LKPA 5IBUG 2OM5A 4FXKA 4LRIC 4M7JH 3OXRA 5DRXA 2O5YH 5FCSH 2VDOH 4JKKA 5L0QC 4KRPC 4HJGA 2AKRA 5DWUL 3ZL4L 5I1HL 1LWRA 1EXUB 1NJ9B 2BCKA 2QHRL 5C0AB 1M6OA 1VGEL 3NMEA 4ZS6C 2XFXA 4LHUD 5L8KB 2R0KL 1OTUC 4MJ5A 3FFDB 3ULUL 2XYCA 4MS8D 5DQ9B 4OGAD 5J9PB 1F11B 4WFED 4PJ5E 3VFRA 5BQ7A 3PV7A 1TETH 1EAPA 5E6YA 5J9PA 1NCBL 4L9DA 4UUJB 3DO7A 4KI5E 4U6HB 4Z7QF 3PGFL 4LPTA 4X7SH 5EOQL 5IMMA 5E08L 3ARVA 4RFNC 4KDTA 4QXUH 2OZ4A 4NWTL 3B9KA 3ZT5A 2BY2A 3CXDL 3PWPE 4LVNB 4YPGB 3BP4B 2DQIH 3WDHA 4MAYA 3UCRA 3BAEH 3MBXH 4JN1H 1VACB 4N5ED 3MRDB 1JF1B 5KS9A 2AJZA 2FATL 4OLWL 2YMXL 2DS4A 5E70A 5KSUA 3J8F7 3N85H 4ZFFA 4M6AA 2AJZB 2WWKT 2XN9A 4GS7C 3U6RB 5C09D 3RX8A 5KS9E 1GZPB 3QH3A 3MRMB 3O0RH 4HJJH 4M5ZH 3RY4A 1DLHA 3U4EA 1MCKA 1P84K 1N7ML 1EFXD 2AV1A 4JDTL 2R1YA 5ID0B 4NO0D 4XMLH 4XPAH 1K3ZA 4EJ1C 3BH9B 4GG6F 3FFCA 4ZSOB 1JF6A 3QDAA 4X4ZA 5EULV 3JTTB 1X5ZA 1KEGL 4LF3B 2YD4A 1OT1A 2DQIL 3GMRB 4QYOB 4LSPL 4M7LH 4MJIB 1T03L 1WK0A 2FYYA 2E7LA 2X7LB 2H9GA 1CWVA 3LN5B 1A0QH 3LEYL 4R0LA 2XT1B 1NLDL 2CD0A 2DLFH 4GT7A 3W11D 2DQTH 3UBXA 3LQAC 4J1UB 1KLGB 3IFLH 3O9WA 4OV5B 1BJ1J 4ZMAT 4L8SC 2EE9A 4DN4H 3ULUH 4R6UA 4IS6A 3SGJC 2CJUL 5C0DA 2HJKA 3FCTA 2CKBA 3HAEH 4RGOH 2KUTA 2SEBB 3BZEA 4Z9KB 2VOTA 4OQTA 1AIFB 1MCWM 1VFUA 2PO6D 3TA3D 2W9LA 2VLJA 5DQDL 1K5NB 5HY9B 3ARED 5AZ2H 5E9DD 1L7IH 4ZOCA 4YJZL 1V7NH 4GG6A 3QCVH 4CN6A 5KSAA 1MAML 4L3EE 3L9RB 1ED3B 1TVHA 4RX4A 2XWTA 1HYSD 2X1WL 3C5ZD 3QQNA 4GRMB 4JM2D 3QIBC 4Q58C 1NDGB 1NCUA 1AFVH 3QUXD 3BZFB 3IDIA 3MRQB 4R7NB 1OWWA 5B39B 1NFIA 5DURB 2BERA 4TN9A 2ZUQB 4HDIB 4LOUC 1AE6H 1MF2H 3OXSB 2EICA 1U8LA 5C9JB 1M1SA 2UZYB 2X1PA 3A67L 3QUXA 4UIKL 1JHTA 2VLRD 3MRCA 3OMZA 5D7LD 4CNIB 1E0OB 4NNYA 4AEEA 3MLSH 1WIOA 5HTSA 2R23B 4FFYL 2LE9A 2ZZUT 3IXAB 1I4FA 2QLVB 2PR4H 2VQ1B 3LMJH 1FN4A 5E9DA 1FZOA 1G0DA 3QI9D 4JPVH 3DWTA 4CRPA 5L9DH 1H3GA 1R3KA 4TQEL 2EDLA 4MYWB 4NPYA 5ESVA 1EGJL 5TE6H 2HKHL 4N0FA 4BH7A 4JZNB 4NKMA 2EIBA 3ZKNC 1BAFH 1S7XA 3VXQB 2DQFA 5J11B 2ERJB 5DRWA 3DGCR 1QFWM 3OR7B 5D70H 2IBZY 3VD3A 3W9EA 5C07E 3EO1A 4G6ML 4PTUA 4QF1B 5GRVK 4YUEH 4UTBH 5DD3H 3TBSA 2J88L 4YDKH 1H0DA 3QIBD 2C3GA 5L2JA 3QFDB 4TSCL 5A16B 2Z92A 1LGVA 4E9LA 2Q8BL 5GS0H 1S7QA 4YGVB 3LKRB 3TYFB 4CN4A 1TPXC 1D6EB 1FNSL 3UZVB 4MDJB 1ULVA 4FTVE 5DGQA 5J0BA 3WIHA 5EO9A 4Z7UB 4NSKB 3RKDD 3V7AG 1LDPL 3U9UA 3FMGH 5I1JH 2VXQL 1F3JB 2WLZA 4CU6A 4WUUA 5FUCC 1EGJH 1X44A 5C2BL 2A1WH 4KK9C 2W07A 4KHXH 5DD6B 3QEQB 2MOVA 1OP3K 3RNKB 1GPOL 3FT3B 3DI3B 4F2MA 1BX2A 2N7AA 2EDXA 4QGYA 3Q6FB 1AC0A 4BZ1L 3SHSA 4KH2A 2Y72A 4UIKH 5DD6A 1RIUH 1IAIL 4QHNA 3V6BR 4N0YL 3K4ZA 2V7NB 1J5OL 4I3RH 1Q0XH 4K94L 3GKWH 2IAMD 5GGVH 2BNRD 1I1YB 4X99A 4GRWH 1KJ3H 3O3AA 4NBZB 1I9EA 2BSSA 4B5EA 4GKZA 4X99B 2DL9A 5IVXF 3RNQB 4NKQB 2DTMH 3ULVH 4N68A 5EBLA 5DJDA 2WM0A 4U2YA 4R4FL 1BJ1H 5CWSB 1IL1B 3EGSA 5F8RC 1JPFA 1JNLL 3QFJD 1CFVL 4R2GC 2ITDA 4G8EA 3JVGC 4FQHA 1G6RL 4RIRA 1XGPA 2CLRA 3SE4A 2VERN 1Q1JH 2UUDK 3H42L 5ITBL 3LHPL 2XPGB 1AQKL 3FQNA 4FABL 1B0RA 5GSRA 2BX5A 2HFFB 3ABZA 2MCPH 4L3CB 3TN0B 3UZQA 1R5IB 2FSEB 2XZAH 1K2DB 4XVUD 4P2OD 5CINL 3TBVB 2WP3O 2OL3L 3TBYB 1ZANH 2ZCLL 1HZHL 1PD6A 5E9DB 5F9JB 5D1ZB 5HXMA 4LGRB 5IVZA 2YUZA 4HZAA 2XWJB 4N8CH 1E4KA 3BZ4B 1R5IA 5ACLA 5JDSB 2W65A 3S96A 3QDGB 5DDHA 4MQXD 4LDEB 4OZGE 3OV6A 4UT7H 4WEBL 2E6JA 3ARFD 3BW9B 3NA4A 5BV7B 3SQOL 5IB1B 3PNWB 2A74A 4XNXH 3B9AA 3O6LL 1SYVB 3TBSB 1UWEL 3GUTB 5IV2A 2GJZB 5CHNB 3O3BA 1CR9L 4PJ9D 5FYLL 1PY4A 1ZGLA 4AH2A 2E8YA 1MQ8A 5I6XC 4OD3H 3BXNA 3IKCA 4JZNA 3O3UN 4HQQH 3H9SA 1KT2B 1LE9A 2W9EL 2SEBA 4KK6C 3MA7B 4XWOD 4YIQA 3MV8B 3AXLA 1CF8H 1YQVL 5DO2C 5JW4M 4GUPB 4JG0L 4UB0L 5JHDA 2ESVE 1ZEAH 3I6LE 4I13B 3BEWA 1BVKA 4E42B 5HJ3A 2BMKB 4PJ7B 1VDGA 3IDNA 2A6JB 3BH8B 5E5RB 1UQSA 3LZFL 4ENED 3D69A 5HHME 3MREB 3PABA 4G8GB 2DMBA 4PV9B 1NEUA 2CO6B 3MR9B 1H5BB 1NC2A 1R3IL 5C0CE 4MXWH 4BFIB 3V5HA 1QR1B 3PQYE 5JW4R 1RK1B 3SGJA 1BVZA 4ODHH 4PJFF 4UT6H 5TPWH 3IAQA 3VWKB 3MOQA 1Q1JL 1X5FA 3UBXB 2VQTA 1JN6A 1KC5H 4LPCA 2MQ0A 3RAJH 3ULSA 3PQYA 4X6CB 4X8JA 2LVEA 4EI5A 4R96A 1FL3B 1ED3A 1TVHB 4ETQA 1ZXQA 2D3VA 1IFHH 1NDMA 3TO4B 4X0KA 2VDLH 4ZUTB 3VJ6A 3KPRE 2ZSVA 4LHJB 2R29H 1WVZA 3LIZL 3KJ6L 3BRGC 1R3LA 1LEIA 1X5JA 5GXBB 1CG9B 5MEOA 5DJ6A 2HP4A 3I02A 3BUYB 4LFHG 4H5SA 4MJ4A 2Y1VA 4QTHA 3K4AA 2O5ZH 1PZUB 1Z9MA 4H88L 2IANE 4M7LT 1XGTA 4BH7B 3BGFC 2AVGA 4OF0A 2EH7H 3IRZA 3QUZC 4CU8A 3V4UH 1BD2A 3ARDC 2HT3D 4N8PA 1MY7A 4IDLA 2I60L 4TVPL 3HC0A 1A3QA 4WWKA 1MLBB 3F62A 1A6VH 5I8KL 3MXWL 3GHEH 4YWGL 1OTUD 2BNQE 2FNBA 5F97E 3GRWA 2V7HA 4O4YH 4LBEB 4TNVF 1D5MB 2VLKD 4G6AC 1L0QA 3VXPB 1J10A 4PGBA 3F58H 4OCWH 5F1NA 1G9ML 1XF4B 4ODSL 4OKVA 4LF3A 3PWLB 3ILPB 1J0IA 4B53A 3BZFA 3IDIB 1U36A 4OQTL 2GSGA 1AH1A 1I85C 2C3VB 2Z31C 2VXUH 1EVTC 1X5XA 5H37G 4ERSH 5FYLE 5LQBL 2XFXB 3LDBC 5EU6A 2ZCHH 3VXRB 4PJGA 5C08A 4QHKI 5ESAA 4X6CF 5I8EB 4HT1H 4UDUA 4WO4A 3U83A 5FAAA 2DJ4A 1OP9A 5BS0E 5DMGD 4Y4KC 4RGNB 3TC9A 5I1DB 3BWAB 2P8PB 4OI9A 1CGVA 1UADC 1KJVA 5IQ9A 1U95A 5IB3A 1IT9H 5IHUH 3T0XA 4FP8L 5I1GL 1VSCA 1BVLA 1BAFL 5ILTL 4NWUL 2YPLE 1QA9B 2VDKH 3T0WA 1MVUB 2F5BH 4KRNA 3B6SB 5JTWA 4FS0A 3EUUA 4ZOEA 4HK3N 3T3MF 4ODVL 3MCLH 1NMBH 1N5AB 1W0WB 5CEXA 1KG0A 1A8JH 1JYWA 3H8NA 1FYTE 2AJUH 1A7NH 4RMQA 4WWKB 3KYOB 1FVDA 3ZKXB 3U0PB 2AW2A 3ARGA 5D2NA 5CD5D 5A2JH 3MJ7A 1RAMA 4K71B 4KKBC 5C08D 1UJTA 5KG9B 3ZDZF 4HS8H 1PLGH 1ZT4A 2FJGB 5IHZA 1XIWB 4MX7B 2VWEE 1AXTL 2ARWA 3DIFA 4TVSa 5JW3H 1WBXB 2D7NA 2ZNXA 2KPNA 3HPLB 5F6HJ 1NGPH 1FPTL 4H0GA 1RV6X 2V5RA 1CICD 4KMTH 4UILH 1TZIB 1Z5LB 3QPQC 4X0KB 4ZUTA 1Q0YL 1HWHB 4PREB 3U9PL 1IGTB 1JFQL 4M02A 3W0WB 2F19H 3CZFA 1XR9A 3PHOB 4HIJA 4NN5B 4MD0A 4P9HL 3WNNA 4ZUSB 5HI5C 4PJAB 2EE3A 4GKNA 5IBUB 3WLWC 5KSUB 1S5HB 3MJ6A 1M6OB 5E24E 2YN3A 4IMLA 1F6FB 1DVFD 1IC4L 2AKRB 1IM9A 2F5AH 4AY0A 5T3XE 3W0WD 3VXRD 1IAKA 3E6HA 3RZCB 4FQLH 5BW7A 4M1GL 3UTTB 1S5HA 5CLWA 5HHQA 3TIEB 5J12B 5CEXB 4I77H 1YEHL 2W92A 4Q0XL 1FG9C 3IAPA 3GHBL 4M8QA 5DJ6B 5DS8A 1KFAL 5EORL 5GGRA 4M61A 4JB9H 3MV8A 4JRXA 3WIHH 3QDGD 4PJXB 3O4LE 5KZCB 3NACL 1F6AA 3ZDYE 1HWGB 4ZAKA 3O8XA 4NQXA 1T5WA 5DVLA 3HPLA 1LK3H 4MXVE 3P4MA 1RZJC 2ZUSA 4NOBA 5D2LA 3ZLQC 5BOZG 1MLBA 3T77A 3I6KA 2FHCA 2JF1A 1T22B 2NTFA 5JQ6H 4Z7UE 3VXPA 1N7MH 1QR1A 4XMPH 5DYOB 5E8OA 2C7UB 5C70A 5C07D 3GSWA 4OI7A 4I0KA 1QHPA 4OCYL 3O2VH 4BUHA 1MFEH 2D03H 2IPTH 5AG9A 4DKEL 4CVXB 3SKNA 1Q9LA 5TH2B 1FVEA 1MHPL 1NBVL 25C8L 3VXMB 3OKMA 4LQFL 3WO4C 2CR3A 1CG9A 4LK4A 5FYKU 2UVFA 2APWA 3MRGB 4U1IB 5MEPA 2OTPA 5DUBA 3U46B 2EKSB 3BYTA 5DMJB 3QUKB 3IS0X 3BWAA 2H6PB 2CXGA 2WV3A 5F7EL 4LGPB 1JYVA 4JFQB 5GGRY 1JJUA 3C8DA 1T04B 5CHNA 3ULVC 4WW1A 4RMTA 1TPXB 5EOCH 3FTGA 4S1DC 5FM4A 4UIMB 3MRNB 5CWSA 5CZVL 3QFJA 1NDMB 3WIFB 5J3HD 1B0WA 2VXTH 2JELH 5DD1L 4P2YA 2CMRL 4PJEE 2NXYD 4FZ8H 2XY1A 3PP4H 5FUZL 4Y2DB 3OKNB 1M7DB 4KRLB 4KUCD 2YPKA 1RULL 4TSAL 5EU7E 1ZS8A 4LLWB 5D96B 5IVXE 2H45A 5ERWB 5DI8A 3L3DB 5IK3A 1R6VA 3I2CH 1IGFH 4BKLB 1IGCL 2FEEL 4LNRB 3PABB 5LG1A 4HPOH 4HZLA 3KLHC 5K9JH 2VYRE 1EK3A 3BKCL 4U05A 2XOTA 3KPOA 3ULUC 4N1CA 3KPRD 4FQHB 4HZLB 4JREC 2CDFB 2MKWA 2C3WA 2MQ3A 3OZ9L 5GGSB 1LO3H 2ADJA 1XGTB 4LKXB 2J5LC 4OAWB 1MOEA 5C6TH 5F6IC 2WSKA 4U31A 4JFDA 5EH1A 4GXVH 1S3KH 1KCVH 1ZHLB 5IWLA 1QSED 2N4IA 3U2SA 1OSZA 3NCFB 3ZKXC 3KYKH 5JUEH 4KU1A 5F9OH 3MRFA 2P5WA 1J1PL 2DKUA 1YPZE 2WUBL 2GJZA 5IVXA 1XGRA 2Y36L 2CMRH 1LE9B 3WYRA 3WLBA 4XCEB 1E6OH 3EBAA 2F58L 3D18B 1SBSH 2IWGA 3HG1B 5DT1H 4DQOH 1I9IH 3WIFA 2W0LA 1U3HC 8CGTA 2I24N 4RNRA 3THML 1MRFH 5DZLA 3IDYB 3ZTJG 3U4AA 4MQ7A 3VI3F 4IIQC 3MRKA 4Y2OA 1JI2A 4OZ4A 4PJXE 1I7RA 4Y4KB 4K2UH 2IH3B 2ESVB 4HHAA 5F7LB 4P46D 4S1QL 3NCJL 4UBDD 4HAGA 3BISA 2CLVB 4QHLB 1HQ4A 4C59B 3TWCH 3BI9X 5I1KH 5EU3B 3UPRB 2VUOA 4LVOB 1BGXL 1JK8A 3NPSC 3VRIB 3CH1B 1J8HE 4PJ7A 4PJIB 4LNVA 4JREB 3FHQA 3WHXA 2FB4L 3CMOH 3QCTH 5HHOB 5HBBA 1KULA 1SYSA 1MIEH 4YHOH 4KKLD 1CICC 3TH4T 43CAA 2X70B 5KSVB 4ZTPH 5HDOA 3HB3D 4WJ5B 1KCRH 4YFLI 2E6PA 2ZSWB 1CL7L 4XGZB 5SWZD 4MAYC 1MJ7H 4XNZB 4E41B 2G9HA 3DUSB 4YDLC 3WUWB 2RFXA 1CE1H 4I2XB 5DEFA 1UEMA 2IFGA 4OF5A 5I17A 1NGXB 4Y89A 3FRPA 2DJUA 2HMID 2AK4E 1LE5B 5DHXB 4FA8A 3HE7A 1FAKT 1G7IA 3VGDA 1NGXA 3KVQA 1H8OA 1BX2B 2VAJA 3H3PH 3KPPB 2GAZA 1P9MC 3X17A 2Q20A 1QSZA 4K23L 4KMLB 4KKCD 4U1NA 5HPMA 5SX5H 3EYQD 1BWWA 5FYJE 4U6TA 3PGCB 4MA8H 4WV1B 2VITA 2P24A 5CP7A 3Q6FA 3QDJE 3TPUB 2B1HH 2XWBA 2FR4A 1U8PA 4P3DB 2XTLA 1Q9OA 2YA0A 1IGYA 4Q6IA 3RWJB 2CKBB 1KIRB 1ES0B 3UTSB 3OHXB 5I15H 1UJ3B 5CJ8A 3MJ9L 4LIQL 4XVJH 2G75B 1MSPA 1PBYA 4O2EA 3CFBA 1P7KA 2F54A 4UNTA 3KDMB 1A6AB 4FFWD 4KJQC 3MRJA 3FQWA 1V7NL 3LKOA 1WF5A 4MJ6B 5TE4H 5JHLL 4Z7VE 1G7PB 2CDEB 4LCIL 4RNRB 1V3JA 4M6NL 4S0TD 3FJTA 4Y5VB 5GZNC 4KMQA 3FO1B 2UWEF 1JMZA 2GCYA 3EDJA 1KYOJ 5E6IA 4CGTA 3T1FA 1IZJA 1LP9B 2FYYB 2VSDA 4QRSB 1I1AA 6CGTA 3HNTL 1WCQA 2XICA 2GTZB 1ZA6B 1I9RL 1ZAGA 1R3KB 1BQLL 2XKSA 3NFNB 4YGVA 4NO3A 4KKBD 2WP3T 4PJDF 1A1NB 4X5WA 4Q9RL 1J12A 4EUPB 4I9WE 5ENWA 2YWYA 4CDHA 3C5JA 2JCCB 4DJMA 3IFNL 1BZ9B 4K55A 3MNVB 3S37L 5IJKC 3CSYB 4YHNA 4XHQA 3VDCA 3GIZL 4RMSA 4J3SA 4Y4HB 3RI5K 3IU4L 1YNLH 2Q3AA 5DK2B 1MRCH 5L8JB 5GGQH 1IILE 1GVIA 3AREB 4L8SA 3B6SA 3ARYA 4LVHC 1FYHB 1ZS8B 1F90L 1A22B 2X4UB 3ROOB 1C5DA 1F8TH 3NTCH 1U42A 1A7PL 4RFOL 4NGHH 2DQCL 2QL1A 2YD8A 3ZMRA 3ZE2F 1CCZA 1XH3B 2BSRB 4CL7A 5JXEC 4WFFE 1AIFA 5F44A 3QCTL 4ODTL 3RHWF 2OR9L 4FNLH 2EH8H 5TQ2H 4J4PD 3FT4B 2RR3A 3OGOE 1FGVL 4HH9B 5IOPB 3MBXL 2OMBA 5E2JA 2EZ0D 4GG8A 3SE3A 2OJEA 3OZ9H 5D7LE 5ECJE 4G8GE 4F15C 1FYTA 4QCIA 4F8QA 3O4OC 4RAUB 2FGWL 2G60L 2OMNA 1MHHB 1U92A 3SJVA 1CLYH 1NCBH 3ARXA 4M43H 4DAGH 3QIWB 5FHBH 4EXKA 5CZKA 2OJEB 4HKJA 3W39B 4Y2DA 2GJ6A 3GNMH 3HC0B 1EGJA 1CBVL 1PYWB 1IAKB 2GJJA 5C08E 2XY2A 5DJXB 4LLMB 1ORSB 5JUEL 4IMLB 3S37X 1H15A 4H26B 5I1HH 3MLWL 2Z31B 2IPKA 2ADIB 5IB2B 1KTLA 1JPGA 4YDVA 1I8KB 1T5WB 4GFTB 4YLQT 2ATKA 1QUNA 3GMLA 4DTGH 3RWCA 4JM2C 2AQ1A 2XI9A 4LSVL 1U91B 4XWGH 1YNLL 1CGTA 4Y5XA 4YH6A 1NC4A 4P2QD 4POUB 1FGNL 5EIQA 4ORZC 4ODUB 5F7EH 4K9EH 3VGHA 4RQQA 2NW2A 3EYUH 4JEGB 1MNUL 2Z93B 1LO5B 1KB9J 2FH8A 2LVCA 3JWOL 5CIPB 1YC7A 4GG8B 3FCTB 4Q0XH 1KJ2B 5TGBB 3WFEL 4H0IA 3G5ZB 5DD0H 1RJZB 2EH8L 4XXDA 5TQ2L 2NCMA 5E8OB 1JGUL 3T3PF 1R3IH 1XCTA 4P9HC 5DD1H 3G5ZA 12E8L 1GH7A 1MCWW 4OFYA 3DURB 3O9WB 3SE9L 1FAIH 2B0SH 3LD8B 4OI8A 4NIKB 4OLUH 4NFBA 4JDVA 5CGTA 5BZDA 2VXVH 3EYOB 4MAYD 1RJYA 4ELMA 2DQEH 1TJHH 2R15A 1A7QL 3OB0K 4CVZA 5E03A 3CFCH 1IGTA 3BJLA 1INEH 3GBLA 4Y5YC 1L0XA 3BJ91 5DSCA 5IP4A 4NBXB 4CVZB 5DA0B 4M61B 4RRPG 2GW5A 5IMMB 4ELMB 2ADFL 1KN4H 3MGOA 1NCDL 5A2KH 2EDNA 1T5XB 4Q2ZB 3QXUA 3KLAB 3HPJB 5IB5A 1WC7B 2WBKA 2Z31A 4MA1C 1OP5H 1RIVL 2ORBL 4ZD3L 1YECL 2D7TH 1MAKA 25C8H 1PKOA 3KS0J 4HMDA 4JPKH 5J6HA 1J1OH 2DB8A 4UTAL 1U6AL 4M93B 2BFVH 4YHZH 2E8ZA 3PWLA 1UWGL 4GKSA 5T3ZE 1HIML 5C0AA 3MREA 2CKBH 1C5DB 3HAEA 2KQMA 3PDGA 5T1LD 4TYUA 2VKWA 4YXHH 2Q7NA 4PJFE 4X4MA 4JRXE 1GRWA 1P4LA 1X4ZA 3QUMH 1AGEB 1LK3L 1NGQL 1NLBL 2J5LB 3O2DH 4OD2B 1XIWD 3MACL 3RWCB 4YGAB 3AB0B 1F3RB 4GRWF 2IAMB 4PJBF 5D1QD 2V9RA 5E7FA 3MNVA 3S4SG 4NQDA 2X09A 4WI9A 3BHBA 5F93C 5ACZA 3C5JB 1RVFL 2AS5M 1GAFL 4XPHH 1EHLH 1MIEL 2YEZA 4NC0B 2NZ9C 4KRPB 1DANU 3MJ9H 3GSQA 3BP6A 3I02B 4XTRD 2UZIL 1C5BH 1AC6A 1NEZA 1AXTH 3IS1X 4WY7L 3QIBA 5I75B 3MXVH 2Y06H 4ORGB 4OLYH 4JO4L 3B8YA 3EYFB 3TPUA 2IQ9H 4X4YA 4N0YH 1KLFA 1IAIH 3D2UA 1YNKL 5IB4B 1KT2A 3DETD 3BN9D 4ZUWB 2F53E 3KPNB 1YEFL 1RK1A 2CLRB 4PJXF 2VLMD 2VDKL 3F7PC 5SWZA 4LMQE 1DBMH 5EBMA 4LL9A 5MHSE 5ESQB 1RU9L 4PJDA 3T8XA 1A2YA 1HKLL 4KHXL 1CDBA 1KF9B 3SO3C 2F53A 3VXNA 1UJ3C 3RWFA 3PV6B 5TE7L 1DFBL 2EIEA 2VLKB 3TF7C 4F7CA 3EOYG 4YHOL 3ET9F 4KJPC 2ED8A 4LCCB 3VI4F 2X70A 4XC3H 5I8OH 2XWJA 3MJGX 3EFFB 5KOMC 5GRUL 3RX7A 1OSZB 3UO1L 3FN0H 4NRYA 5K33A 4KZEL 4EBQL 3P73A 3CFEA 2VDLL 1P1ZB 3WFBL 3TWCL 1GJIA 2FECI 3TBTB 3DOSA 4JFEA 2R2EB 4I8DA 1IGCH 1JN6B 2FIRT 1GGUA 1QEWA 4JZJC 1KIUA 3CVIL 5AAWA 3ISWA 1U8QA 3PGDA 2VLRB 5GSVB 3NH7L 1Q9KB 3NFSL 1I8LC 2AQ2A 2PXYD 4ZOBA 5JW4Q 3MACH 1M7XA 5HSFA 3WV0A 5DT1L 4DQOL 5C71A 5HDBF 2FH6A 3GSVA 4ZG1A 3DHJA 3T2NL 4FZ8L 1MHEA 4PGDB 1T1YA 1QFPA 5KW9L 5AWNL 4H5SB 4LEOB 4ZUUA 4E42A 1JZ6A 3S6CA 4QXTB 2OLDA 1YEEH 1P6AB 2YA2A 1MFNA 2YKLL 3C6LC 4ZUVB 3BD4A 4KK8C 4OFKA 4ONFL 3TJHC 1ZLUK 1GZQA 5HHOD 5D5MB 1LP9A 1CGUA 3GJFK 5C6TL 4OIBA 3F7RA 4R7DB 4PJ9A 1WBYB 1YQVH 4YHIA 4JFEE 3P9MA 4CW1A 3EDDA 5C9JA 4OCWL 4WY7H 1HQRA 1CXLA 2NY3B 3DX8B 3IVKB 5CEZD 3RVUC 3L95A 5J1AB 1A2YB 4YHLL 4MJ6A 1YN6A 4PTUB 4QF1A 3BESR 2D0FA 1AGDA 5K59E 4R26L 3DX9B 3VFVA 5IFJB 2QJDA 4ELKB 8FABA 3KPNA 2J8UA 1CFSB 3LY6A 1INEL 3QNZB 5C07B 1GSMA 2MPAH 2WQ8A 1RULH 1I7UA 2EKJA 3WHXB 4P2RE 1G1CA 1BBJA 2C3XA 3F12A 4M7KL 3SE4C 3ARRA 1QNZL 1ACYH 2GK2A 5F6IB 4GH7B 4WFHE 5CINH 1FBIL 3DVFA 3BSZH 4YFEA 5IW1B 2LU7A 3VFTA 2AK1H 5JIHA 2HVKB 4AH2B 1NBQA 3N0PB 3P3YA 5D1XA 4OV5A 1UG9A 2BOBA 2DJSA 2A83B 2NY1C 1N2RB 4JFEB 3EYUL 3GFUA 1DUZB 1MFBH 3QZWA 4JR9L 4WUUB 4NQXB 1ZHBA 4LPUA 2GFBA 3VXSA 3MOBH 4CW1B 2D7OA 4F3FB 4FXGB 3FN3A 1QPXA 5IWLC 4C56A 4FMFA 2JKXA 2PYEB 4FQXB 1BFVH 4D0BA 3I84A 1AGEA 3MRGA 4U1IA 1F2XK 4Y16C 2DLEA 5C0GB 3SQOH 3QG6B 5C0BD 3AAZA 3BDXA 5JA8B 3P4NB 2X1OA 3OAZH 2HMIC 2HT2C 3GRWL 5F9JA 4P46B 5K93A 5KSAC 5FV2A 4C56E 4F33B 4NZUL 1DQDL 4FXLA 2OK0H 1F42A 3U4EB 3HZKA 2R23A 2YPVL 1BWMA 1I1AD 1BOYA 4LLQA 4WW1B 4JG0H 3SCMB 3QUXB 1YEKH 4PJ8C 2J8OA 1T2QH 3QQ3B 5GSVA 1ZANL 3I6GB 1QFHA 5DJCA 5D7LB 3MGAA 1XGPB 4YBLC 5FA3A 2X5PA 3QO1A 4N0UB 1ITBB 1BOGA 5T3XL 3WDJA 2M2DA 2IFFL 1MELA 3SDXF 3U9PH 4EN3C 1BD2D 4P9ML 4GKNB 4NUGL 1CD1B 3RBSA 3MOBL 1B9ZA 3OL2A 2AXGB 4PJHF 5CUSH 1D9KB 1N0XL 1FNHA 3P73B 5HYEA 2A1WL 1E28B 1ORQA 3EYQC 4P2OA 5TF0A 4BJLA 3BIBX 4L8BB 3C2AH 3UAJD 3GHBH 2BNQA 3TP4A 3E0GA 1IAMA 5FHAL 3IDUA 2QSQA 4PJCE 4X5XB 3MRPB 4PRPA 4UV7H 1XEDA 2ZUUA 4U6VH 1FBIH 3GIVB 1FC1A 3P9LA 1C8PA 1BLNB 1K8DB 2CK2A 1TETL 4NRXB 2Q87A 2FJGA 3KPQA 4ODTH 4OZIB 2IALA 5AD0B 2JB6B 3D0VA 2A6DB 3RFZC 1NMBL 3MCLL 3QJHB 5GS2H 3QUYD 4S1DD 4K94H 3SGKC 4P2RB 3ZE0F 1INDH 4EUPG 4YUEL 1PFCA 2DQFB 5EU6D 4JFZL 3FRUB 1U41A 3PXJA 1I3VA 4R90L 1NGYB 5KS9B 1FZKB 2DM3A 2V17L 3GNML 3PF2A 2J6EL 3U1SL 4X7TA 3QISA 1DDHA 5CEYB 3G5YA 4HS6A 5E8NB 5EZIH 1U8MA 3CUPB 3U7YL 5EO0A 4OJFH 4HFUL 5DJYB 4ODWB 4QHKJ 5D1XC 2GTWA 5L6YL 2C9AA 5J12C 4I48B 3KYMA 2EXWC 2HTLC 4JQVA 4S10A 4QRRD 3EYSL 1YEIL 3FZUD 3MRNA 1B6UA 3C6SA 4NO0B 3NGBC 5SX4I 2VZ1A 2X10A 3CH8A 3QQ4B 2MTPA 5D2NE 5IB5B 3MRRA 4LLMA 4XPBH 5GS0L 4YHPB 4NRZB 1FH5H 2FX7L 3G6JF 4HWZA 5L7XH 4TSCH 1S7XB 4JQIL 3IYLW 3MLPA 1OWRM 2B1AH 3RUGF 2DQHH 3H9SD 5J8OA 3ARDD 4MZ3A 2BNQD 1F8TL 3QCVL 5K9KB 3IJHA 3SDXB 1MWAH 4KI5D 3MUHL 5B8CA 5AZ2L 5LVEA 1DE4A 4HIHA 3WL9A 4C83A 2MWCA 3BZEB 4OLZL 4PJHA 3HAEB 1CXHA 4Y8DC 3DX6B 1B6DA 4Y4FA 2Y06L 3SPVB 3TA3A 4JPVL 3SDXA 1U3JA 3ARDB 2P5ED 1Z0NA 2C5DC 5BVJA 4G80A 4XVJL 5F72S 3F7VB 5GRUH 4ACPA 5D1QA 5I8OL 3JV4B 2DAVA 5C0FB 1U8IB 1JGDA 1U6AH 3HG1E 4MWFA 3IETB 1WISA 2YD1A 4XPHL 4ZAKB 1U8IA 1ADQL 1DLFH 1WAAE 5GRXG 3GSOB 1NJ9A 3RVUD 4XCFL 1KJ2H 4YPJA 4PREA 3BGAA 3EOBA 4XCYB 1T21B 1J0JA 4Q7DA 3BKML 1MI5E 5JMOC 2OS7A 1QLEH 3EJJX 4NNPL 3ZDXF 3IDMB 3IKKA 4OIIL 2YPLD 4U3XA 4ZO7A 2OCFD 3S7GA 1QVOA 2AJXH 2LTQB 3W0WE 4M6OL 2V2TA 3QULB 4CVUA 2R1YB 4PRHA 4KI5C 4U1HB 3C9NB 3PHQB 1NUFA 1J05A 3VXRA 1A7QH 5BS0D 4LP5A 1TENA 3GZKA 1FIGL 2B5IB 4N8VG 2VXVL 1NMAH 4P5KA 3MLSL 2C3HA 3GEWB 1KB5H 2GK0B 4LCYB 4GJTB 4NZUH 4UTAH 4Z78B 1XF4A 4OKVB 1S9VB 4HD9A 2IBGA 3UP1A 5CKGA 4OFDA 1YECH 1HDMB 1FZJA 3BVNA 1F3DJ 2O61B 3P30H 4NNXA 1T0NB 5GS1B 4FQ1H 1OF2A 1IEHA 2D0GA 4PGCB 1KIQB 1Z5LA 4KHTL 4N1EA 1P69B 1MFBL 1TQCC 1K4CB 1KCUH 4QYOA 1BBDH 2OJZH 4DK6A 1NCAH 2HWZL 3LRGA 3FO1A 4PRDB 1IM9D 2DIBA 5E1AB 3ULSB 2HH0H 4F8TA 2C26A 3PGFH 1RUPL 1YY9C 5HYJB 4RGMB 2L7UA 3MNZA 1ZT4B 3BO8A 3GSNH 3E6FA 4YXLH 4QRRB 1I1AC 1Z9OA 5DQ9A 1KCLA 4HK0A 1VEMA 3G5YB 4YXHL 5DK2A 3D2UD 4L4TA 3CFDB 1FVCA 4LKCB 4HXAL 3DX7B 3EYVA 3B2UD 3F7VA 3QIWA 4UQ3B 2JJSA 4YHKL 4P3DA 3H42H 4JPKL 4UOJA 5ITBH 4Z7QE 1HH9B 4G7YL 4GXVL 1YJDH 3NAAH 3CDGB 1K4DA 2D7TL 4H20H 4K3EH 3LEXA 3TH3T 4OFIA 3UBXG 1E4JA 3VMOA 2BNUA 5HPMB 1L9NA 1MPAH 3IKCB 4R26H 1NCDH 3BKYL 4PRPB 1IAII 1NCWL 4RFEB 2GAZB 3VWKC 3A6OA 3MCKB 5BO1H 1V3KA 1W72B 2ZOLB 4XB8A 4GRWB 1ZK9A 2CPCA 4JHBA 1EAPB 4FN0A 2IALB 1N26A 3OKDB 1IEAB 3T4AB 5I1IL 4JQXA 1UQSB 2GCYB 5I71C 1VKXA 5BOPA 1G7QB 5T5NG 3OKOB 1X5IA 3DROB 3QO0B 4JFED 4NN6B 5KVDH 5C86A 4L9LC 5FEBA 4J3OC 2G2RB 4G3YH 2P45B 4PYHA 2F74A 3CCHB 4P57A 3QEHA 5H2BA 1G7MB 1V7MH 3FOMA 4JFPB 3UPAA 4HC1A 4UV4H 1CIUA 1CT8A 1D9KA 4XRCB 2NX5A 4OLWH 2V7HB 4Y5VA 4B7LA 3WFEH 1CLYL 4HJ0D 1VGEH 1TVBB 1SM3H 3WHE0 2YZ8A 2AQ3A 3MSPA 1S3KL 1GL4B 1Q94A 5SWZE 1D5XB 2K7QA 1F90H 3QUYB 2GSIA 2EXWD 4M1CC 4BM7A 4JFOB 4M3JA 4AQOA 1KLUB 2A77H 3GSUA 3VFWA 2HN7A 3T65B 5IROA 4Y5YA 1LDPH 2YUVA 2EE6A 3S96B 1IGJA 4QOKD 3IJSB 4MNQA 1A1OB 3TT3L 2HAZA 4FNLL 4JCMA 4J8RA 3X13A 2P5WE 4XC3L 2A83A 1S9YB 1P5UA 4OQ1A 4GKZB 1Z2KA 1A9BA 3LPFA 1YEDA 3LRSA 3PWUA 4MNQE 3D6GA 1NKOA 1D6EA 5FYJU 4H8WL 1CVRA 5BCAA 3WUWG 5CBEA 4IOIA 4HUNB 5EC2B 1WICA 3MLXL 5EUKA 1RJLA 2D31B 4BZ1H 1YN7B 4ZPTB 4JO3H 1G7JB 1N8ZA 4JANA 2J8UE 3WFZA 3ZKQD 2VDOL 1JNHA 2GQHA 4G8IB 2FX9L 1UACH 1LP9E 1QFWI 3EJYD 3AY4A 4YXLL 4W68A 4U1GB 3U7AA 5GGQL 4N0CD 2P5EE 3MRJB 5HHMB 2ZPKL 5L9DL 5CJ5A 5J6GB 1X7QA 5GS0C 3FT3A 3O4LB 4X6DE 4IJ3C 1UM6H 3W9DA 4HCRL 1OAZL 1MREH 2D7PA 3D69B 1FL6B 4KPHL 5EORH 5F7MC 5EO1B 3QQ3A 3D9AH 4X6DF 4KTYA 1C08B 5HVHC 2F54D 5GISH 4L5FL 3MGTA 1IMHC 1I4FB 4OZGA 4J12A 5EZLA 2OR9H 3PGCA 5D7JA 4LSSL 3QNZA 3B8SA 3EDEA 1HSBB 1UEYA 5C0EB 1FFNA 5FDYA 2F8XC 5T5FH 4XPFL 2CR6A 4R8WL 3EJZC 2CSPA 3K2UH 3HNTH 3W81A 3R06B 4NC2B 4O2CB 4PB9L 5IVXB 1FNEA 5F7FA 5GZOD 4QKXB 4OUUB 4X9BA 4LLVB 1Q8MA 2QR0B 4RBPH 1S9XA 4JFHD 2GI7A 1UM5H 4J8RB 2AGJH 2GUOA 3M8OH 4AM0B 4AG4H 2LAGB 4JG1H 4AIZA 4YX2H 4W6XB 3UTTD 2E5EA 5D1ZD 4M6OH 5EG6C 4BSWB 4KJWD 3WIIH 1Q0YH 4EQ2A 1MFDH 1JWMA 4PJ5D 3SOBH 4MNHB 5L88L 3SN6N 5BJTB 4P4RB 5HPOA 1GGCH 2OL3A 5DHVA 3STLB 4PRID 4ZUUB 4ZUWA 1DN2A 5HVFB 3CH1A 4YHZL 2NR6C 3MNWA 4JO1L 5J13B 2X4NA 1FFOB 1SVZA 1VENA 2XACC 3BPCB 3LCYA 2XXCB 5C0IB 3DMMD 5FV1L 3K8KA 4ESKA 5I76B 2C7UA 3HE7D 3D25A 1QPPA 3CGTA 5MP6L 1S7VA 3S36H 2ICCA 3WBDA 3S97C 4RIRB 2R4RH 2UVEA 2LU3A 1N64L 2J1KA 3N1QC 3SE8H 1JCKA 1AGBB 1T03H 3P4OB 1NEZB 3VXTB 3VFUB 3KYNB 1JPST 3QPXH 3HUJF 5T3ZL 4XNZC 3QQ9D 1P84J 4H1LA 5ITFA 2F19L 1JMXA 1FAIL 1JIBA 1ZLUH 3QHFL 5FKPA 3O45B 2FZ3B 1N6QH 3MA9H 4CVWA 3D39E 2ZCKL 1BD2E 3HKFA 5JOFA 15C8H 4U6YA 5GS1A 4NFDA 3V95A 5MEPB 4DGYH 3PJSA 1P7QB 3KPTA 4BSVB 4JFXA 5H35B 3GM0A 1S7SB 1H3PL 3ALXA 3T3PE 5BVPL 4XZUB 5TFSL 1AP2A 4H8WC 3ARPA 5EOQH 5F1IB 4P5TB 3FQUB 2NY2C 3D1MC 2XKNA 1HH6A 3O2DA 3DV6B 2V6HA 4K8RC 1AI1H 1QYGL 5D7IA 1SBSL 3T0DA 4QRQB 2BOCA 1JHTB 2MMXA 3SKJH 4CNIA 1CZ8H 1MEXH 4M1DH 1UM4H 2R0KH 4JRYA 1JGVL 1DQLL 5TQ0H 1PSKH 1WCBA 2VXTL 3PG2A 4L3EB 4ZFOL 5BZDB 5I1LA 2NXYC 5DJZB 3QDGE 1JVKA 2NY4C 1NGZA 3LOWA 4NKMB 4NN7C 1YEGL 4ZXBA 3U4BH 3VFMA 4JHAH 2FBJH 5DMKA 4A6YA 3PWPB 1MVUA 2I9LB 1T4KA 4TUOA 1OGTB 3HUJB 1QOKA 2VUYA 4OFPA 2H2PC 4Z95H 1KNOA 1MRFL 1MCCA 1NC4D 4JRYE 4JRYD 3VD9A 1KYOK 1RURH 3OBAA 2DD8L 3S3PA 1YA5A 2HLAA 4P2QB 2DF3A 4WU7A 4WTXA 1ND0A 3LKNA 4PJHE 2ARJQ 1A7BA 3BP7B 3MBEA 3M07A 4F7EB 3MRBA 3EOTH 3TZVD 5H8DA 5CZVH 4E0RB 3C2SA 3OKOA 3KWWA 4Z7OE 1XAUA 3CMGA 2BC4A 4DGVL 5C0FA 3W0WA 4U1KB 3GJEB 5DTFA 5FOBB 5LBSH 2IADA 1YMMD 1G6RB 2E7HA 4OTXL 3V4PL 4PRDA 3MC0A 3QA3A 3CX2A 3BH9A 4HPOL 4LHUA 2WWMD 2Z8VC 4Z8FH 2BVQB 3GSNA 3BEVB 3CDCA 4R2GB 4PTTB 1CQKA 5BV7L 1ZT1A 4JB9L 3WS3B 2K3TA 4XNXL 4ALAL 4LCWE 2VR9A 1UGNA 2PW1A 3SDAD 3ARUA 1U3YA 5DJAA 2Z0BA 4EVNA 4U7SA 4NO2B 1T66D 1I8MB 1NGWB 3KNBB 2AK1L 1IKFH 2VH5H 1JRHH 4S1RH 5IQ7L 3EYVB 5LGHL 1BQHG 3DUUB 4XMPL 1A7RL 4XWOC 3VE0B 2NY0C 3KNBA 5GZND 3QI9C 1MUJB 3DUHA 2A9MH 1WAAA 1YPZF 2XKUA 1UXWB 1E4XL 1EFQA 1WCBB 3I85A 1N4XL 1PG7W 1MI5A 4F58L 4HJ0C 2P49B 2UYLB 2UY6A 5C0RH 3ARQA 1T6VN 1MCIA 1U91A 1YUHA 4HLJA 5E99H 3MBEC 4Z5RB 1SMOA 3STZA 3VRJB 1VADA 3FONB 5C2UB 2VSCA 4GLRH 1Q9WB 5I74C 1CK0H 4JM2F 1CTNA 1CFVH 1XIWA 2OBGA 2E7MA 3NZHH 1KELH 1VHPA 3OJMB 3V5HB 35C8L 3MV9D 1GOHA 4N9GA 3KYNA 5C0AE 4NQDE 4B50A 5GGVY 4ZFFB 4OF8A 2K9UA 2GJ6B 4NQCB 1MFEL 2D03L 1JBJA 3V0WL 3DJ9A 5F7DB 2D7QA 4Z7WA 3X3FH 4X6DB 3HNVH 5ANMA 3ECBB 3OJDA 1QKZL 4TSBH 3MV7B 4MMXC 3MODH 4RAUA 4X9FA 3KGRA 5FGRA 4GAYB 1V8HA 4XP4L 2ZG1A 4OT1L 3G6AA 4KTDH 5IB3B 1WZLA 3IJYB 1W8OA 2Q6WA 1JPSH 5DRZB 5FKPB 3S98A 3TV3H 1ZVSB 5GRYA 3TGXA 4UOW0 5IBLD 4UILL 2EEBA 3D0LA 3INUH 3LHPH 1CE1L 5TJWK 5DD5H 2C4XA 3ZHKA 1YYLH 2C1OB 4L1DA 5C2BH 2FLBT 3N06B 1U8KA 2UWEB 1IGML 1DBKL 2ED9A 3QXDA 1N2RA 5EC1A 1FLTX 4XNMB 4JFYA 2X2YA 2H2SC 2FB4H 5EU5A 1YNTA 3UTTE 3HNVL 4PB9H 3LQZB 1T80A 3ES6A 2X4TB 3ALWA 2B39A 4HS3B 4XPFH 3FRPG 2BVYA 1V3LA 3MYJA 4EI6B 1HHGB 3RIAK 2F5AL 3B9KD 4NHCH 3BPLC 4PYGA 1BFTA 4QOKA 4YZFF 1LQSR 5D7IB 3S34H 2AV7A 3MGTB 4AZ8A 3RWHB 2QSVA 1C12B 2XPGA 5HJ3B 1OD7A 3NZHL 3QDMD 4NQVA 1FL5B 1GGBL 4Z7WF 1CGWA 2XTJE 1MVFA 3THMH 1DL7H 4OLXH 4XVSH 4D8PA 5DQJA 1FZKA 4RDQG 1FE8H 3RTQA 4M5YH 1NGZB 1Y18A 2ZKHH 3NIFF 5JA9A 3JV6A 5DVOA 4XP5H 1RUMH 2H3NB 2P8MB 2BZDA 3B5HA 2DQJH 1LP9F 1LO0L 3QRGL 4ERSL 1WTGT 2FX9H 1X3DA 2EO9A 2IBZX 4FFZH 3G5VB 2EDRA 4Z7NE 3QI9A 4ETYA 5J56B 3GB7A 4ZDHA 2R0LH 4UT9L 3MV11 1RD6A 2G75A 2O5XH 2JLLA 4M00A 2WAHA 3CSBA 1C5BL 4JN2B 2C4FU 1ZLSL 3TO2B 3F6IA 3OGCA 5I1EL 1MCOL 4PP1D 1J86A 1EHXA 4KDVA 2BXYA 1RUAL 1GAFH 4UNUA 4GW4A 2DMCA 4M93C 1N59A 3TT3H 2P24B 4G6MH 4XBPB 4KTEH 5J57B 2FSEA 2YD5A 1IGJB 4G6KL 4FOMA 3EDKA 4DVRL 3JBG7 3G04A 3VCLB 3O6FD 4WDIB 4LASH 1R24A 3F65A 2Y5TB 2H26B 3CC5B 3DRTB 1CXKA 1CDCA 4YIQB 1IC5H 1A9EA 4WHTA 2RFXB 3Q2CA 2WWKO 4F9PA 3P9MB 3FL7A 3UTQB 1BREA 4FQXD 5EUOF 5MHSD 3QHZL 3EFFA 3KPMB 2PXYA 2GTZA 3WNMA 1J1OL 1HNFA 4LCCC 4PV8B 1A3LL 3H7BB 2ITCB 5HI3D 3ARBA 1OT2A 2CQVA 1KC5L 2A6KB 2AJ3A 3PV6A 3HUJE 3NIDE 2FX8L 1A6VL 3UC0H 3V7AE 5I8KH 1QTYT 4WEMB 1VFOA 3RI5F 4WCYH 4APQD 1Q9KA 1QFWH 3WFDH 5JPNA 3O6FB 5FUOL 1BIHA 1HHIB 3CFCL 5D6CA 4LPWA 1M7IB 4R3SB 5MEND 3L3HB 4G8FA 2YS4A 4Q74A 1G0XA 4UB0H 1NAMB 3MJ8B 4GW1B 3H0TB 4YHKH 1QG3A 2CUHA 3VXUD 3WJLA 1PG7H 5KN5B 4I5BB 1AHWA 1CZ8L 4W81A 3QP3A 2W0FA 3H6JA 4UZGA 5DRNB 3L7FA 4EI5D 2G5BA 1DSFH 4PJBA 3O3DB 3ZE1F 1AGFA 1WBZB 1ZHBB 1EHAA 5J6GA 4QRTA 1AXSB 1JHKH 1R3JA 1F3JA 5D7JD 3LEYH 3T2PA 1WJ3A 4P46C 5KSAB 1I1FB 2HTKC 3HE6D 4O02L 1AKJA 4DW2H 1FGNH 5D72H 4PJBE 5DHYB 4O58H 1X4YA 3FZUC 2AEPL 3CX5K 3WUWA 1AJ7L 1UH2A 3GMOA 3OX8B 1I85A 1OGAA 5D7JB 3T04D 4OZHA 2KDGA 4K7PY 4JY6A 1P4BL 4PJCA 5FGBC 1RZ8B 2NY2D 3ILQD 4ZXBC 1IBGL 1S7TA 4Z0XA 4LEOA 5HVHB 4M5ZL 2RHEA 2OTWA 1CGXA 1MFAH 3GMNB 3K0WA 7FABH 4KUCF 4RMVA 1LO4L 3ULUF 5IJVB 2NY6B 2DTSA 3E3QE 4G6FD 3SGEH 2R2HA 5IKCA 1I7RB 4HKBB 4P2OC 4JFFE 1ZA3A 3UROR 1CR9H 3LKQB 5FYLH 1YNTB 3VGAC 3ULUE 3P0VH 5DFVD 43C9A 1TZGL 1XR8A 1U0QA 1EEYB 2K1MA 1Q9WA 4ODBD 3BPNC 2H8PA 1IJ9A 4NWTH 2BVPB 4PD4K 4NNPH 3UZEA 4LCUB 1N64H 3L9RA 5JDJA 5KTEL 1C1EL 4PP2B 4HS8L 3FMGL 3VXUA 1BEYL 1NC2D 3S36L 4U2ZA 4XCFH 3GKWL 3UJTH 3CVHA 4YC2B 4NNXB 5CSZA 2BVTA 1FNSH 3QWRA 3S88L 1CDYA 1SEBA 4PFEA 1LK2A 3FT2A 1UCBH 2AJUL 5I75C 5EN2A 4PRAA 3NVQA 5L0QB 1N6UA 5GGSA 2MCPL 4G9FD 4JZOB 5B38G 2VISA 5CIPH 1CXIA 2BVEA 1RZFL 5FYKD 5DMYA 5JHDD 5IHUL 4Y4FD 5F7DA 3FB7A 4PIRF 4G42B 4B41A 1CYGA 1X5GA 1D5XA 3IJYA 4POYA 1MJJA 5MEQA 3BEVA 4OFVA 3KLAA 4XH2A 3LKSB 3HI6H 4PRNB 4AL8H 5E6ZA 4KKAD 1XR9B 4BFBD 2J6EA 4ORGA 3O3EA 2VXUL 4U7MA 2KQNA 4X7CC 1F4HA 4LSUH 4ZS7L 5DVMA 1DVFC 1I7ZA 3TIDA 1ZV5A 5EC1B 4K3DH 4KDTC 2IH1A 3SDCC 3FO2A 3Q0HA 4GBXD 1MCEA 1U93B 5CJOH 4NHUB 3VG0H 2UWEA 3S88H 2FO1A 2QSCH 4GMSL 3GO1H 5AG8A 4UDTB 2UYLA 2Q7YA 3ALPA 4V1DD 3CFIC 3EYSH 2LU4A 3UAJC 1JTOA 2PN5A 1NAKL 1VESA 5FB8B 1MREL 4V1DB 4Y4HD 2AJVH 4O2FB 1IC1A 3NCBB 2UWEE 1QLRA 4J6RH 4M8QB 4U1LB 5TDOB 5ICXB 3M17B 2I60H 3LKPB 1TZGH 1PX3A 2XZCH 3QWQB 1JGEB 2P47B 4M6NH 1VACA 2ADGB 2X4SA 2ATPA 1JP5A 1EHNA 3CDYA 4PS4L 4ZQKB 1H5BC 3VFSB 1GXEA 4C4KT 3MUY1 3SDYL 1Q9LB 5TH2A 3WNPA 1D7FA 1AD9A 5IQ9B 3T0ED 1QLFB 2EDJA 4LAQL 3O2WH 4JFZH 4RRPA 5KSBA 3ELAT 2VLRE 3KJ4B 5A2IH 1MCLA 1MCBA 4XP1L 4MAUL 4WRLA 5I15L 1S7UB 1P7HL 5DYOA 2Y23A 4R4ND 2PW1B 5DJ0A 2APVA 2IADB 3AMKA 3DHMA 4X98B 3BX7C 2VLME 5DJ0B 4NQDB 1AJ7H 4JJ5B 1SJHA 2R1WB 4Q2ZA 4UV7L 1A0QL 2NXYB 1A4KA 3MJ7B 3PL6C 4I48A 3RX5A 4N5EC 1YUHB 5J1SC 4M4RA 4FQCH 4NN5C 1NLBH 1NGQH 3QUML 4TQEH 2A0LC 1I1RA 3H3KA 4YR6B 3RWDA 1QA9A 3AREA 4L8SB 3SBWC 1HHKB 5F1OB 1DUYA 5KSBE 4J3XA 2I5YL 4XXCC 4GRLC 3TNMA 5DMGC 1J8HD 5ICXA 3MRHB 4A2LA 4KTDL 5IMKA 2VWEC 1ND0B 1QLRB 5BVJB 5CCKH 4PJ8B 1CLCA 3SCMA 4TUJB 2OQJA 2PYED 2F8OA 4JLRB 5IMKB 5LAXB 3MV9A 3HZKB 5J89A 2BJML 4MA1B 3WL9B 5EN2B 5E4EB 5ANME 3GRWH 3T08A 4R4BB 2AERT 4GAGL 1ONQB 1SEBB 5HGAB 5FUCE 5FOJA 4TULL 3SE3C 3RY6C 1O5DT 5HD8D 5AZEL 2CLZA 5I8EA 1YMMB 1D6VH 1T7ZA 3P0VL 1TZIA 1KELL 5ETUA 1D5MA 4OB5L 4Y1AB 1YY8A 3N1GC 5HDBE 2PUQT 2PNDA 4MJ5B 3IETA 4YXKL 4XH2B 3AY4C 1RK0A 4YDJA 2ADIA 3LD8C 3RP1A 3GBNL 4JY5L 3PUCA 1J88A 1EEQA 3I75A 3QO1B 4MHHI 2B4CL 4N0UA 1E6OL 12E8H 2OL3H 4Z7NF 3K1DA 5E8PB 3ARDA 1QBAA 4NFCA 1ROWA 4MDIA 1PYWA 1PG7L 2ZP0T 2XNAB 3ARGB 4NQSB 5D2NB 2COQA 5DC9B 4FABH 2VZVA 3FQRA 5ADPL 3ZSTA 1QNZH 5FECB 4Q9BA 2VLLA 2IAND 5SWQB 3NABH 2I9LA 4LASL 4Z0BL 1SJVA 1RUKL 3QIUA 4NQEE 4L9LA 3Q1SH 4MB3A 1XF2B 5JXEA 1OAXH 2IGFH 4GKOA 1D6VL 1JNJA 4X9IA 1UENA 4P2RD 1YJDC 5TDOA 3ESVF 5HGBB 2I9TB 1KV3A 2Z35B 3QIUD 3QNYA 2XTJC 4KHTH 4HH9A 4O2FA 5JR1H 3H9HA 4R9HA 5KVGH 5HGHA 2DIJA 2C1PA 3KPSA 5DGRA 1YN6B 3V5KB 3VWKA 4Y1AE 5DEFB 3BPOB 5GJSH 4LAQH 1FL3A 4ONFH 4UU9B 5I30L 5FF6B 4XXCA 1YEEL 5DJ8A 3KJ4C 1OQXA 1LO0H 4KJYB 1ZMYA 1VB9A 4LP4A 3DVIA 1V5JA 3RY5A 3H9ZA 2AXGA 1TCRB 2DWDA 1TJGH 4HEME 1KB5B 3NCEB 5GS1C 4D0CA 3UPRA 3L3HA 2NY5L 1SEQL 4FQCL 4JY4B 4JFHE 1OTSC 4H1LH 4TRPH 5K9QI 2GHWB 4X7SL 1I1CA 2NZ9D 1TXKA 3TLRA 1YEJH 4HWBA 1FRGL 3V4VL 1ADQH 1PW3A 1FGVH 2A6DA 4ONGH 3V0VB 5B3JE 2LV4A 4XPGH 4GUPA 1JPFB 4OM1L 5M7QA 2X4NB 3FO0L 3O4OB 4K3DL 1G7JA 4ZO6A 4D9LH 3HN3A 2AXHA 4Z7OF 2R0ZH 1AO7D 3EO0B 2IANA 5F6HI 4J3UA 4R7DA 1VEOA 4MAUH 4YHIB 5BZWB 3O2VL 4EDXA 3LB6C 4RGNC 5CSZB 4PD4J 2LFGA 1LMKA 4GRLB 4JDZB 1RIHH 4TTDC 4Y7MA 5L2KE 1NMCB 4F57H 1TIUA 1XF1A 4C56B 3LN9A 3P0YL 3RVVC 1HINL 4PJIA 4NJAH 1ZHLA 2CK0L 5GGTL 5T1MB 3WN5A 2EDYA 4G8GD 4N1HB 5A40E 3VXNB 1EH9A 1HCVA 1MEXL 4PRIA 1MRCL 2YC1B 3MLYH 3VXTA 5EZJB 5CJXC 3TN0A 5IEKB 5T3XD 5I1AA 1CLZH 1VPOL 3GBML 2AABL 4MCYB 4NP4H 4BZ2H 4IEFB 1CXFA 4DKFL 3CSYA 2DQHL 5D1ZA 2Y9RT 3RNKA 2P5WD 2VDQL 1HSBA 3L5WB 3DNKA 5DLMH 4OF3A 2FX7H 4A2MA 4HKZA 3OKLA 4O00A 4ONOA 3G5XB 2HFTA 4JHWH 3PWJB 4I3SL 1T3FB 3MLUH 1BQLH 5JHDB 2EEAA 1ZVYA 3DSFL 2VIRB 4EEEA 3UTPD 3MLRH 4JANB 3ULUD 1UA6L 2QQLL 3FOLA 4N9OB 4D3CH 3RKPA 5EB9A 4XNQA 4GQ9L 1OAKH 1RUML 1BQSA 3T4AA 4ZS6D 3RNQA 4CUCA 4I3GA 3O3BB 3HMWH 4LCWB 3O6FC 3IFPA 4U1MA 3FQWB 2J6EH 3U1SH 4PPTA 3FFCE 4S11A 4HUVB 1ZOXA 3QHTC 3KDMA 1RZGA 3FQTB 3P2TA 4RAHA 3IB4A 5D1XD 3OB8A 5FO9A 4F7MB 3RWEB 1JPSL 1R3HB 5DUBB 1SY6H 4TVPE 5DQJB 4F58H 1U8JB 5HVWA 4S1SH 3REWB 3TYGL 3EJYC 4MQXC 4QGTA 1HILB 3S36X 2BRQA 3FB8B 4L3AA 4RFNB 3MLRL 4S0SD 2A73A 1LEKA 4H25B 5D8JL 4JPWH 5EO9B 3RQ3A 1HIMH 3SO5A 5E2WL 5D2LF 1ZLWK 3QEGH 1HYSC 4XCCL 4WI8A 2HN7B 4LLYB 2CIIB 4Z77B 2M26A 1P6FA 2BHZA 4Z7UF 1QO3B 3VFOB 2V9TA 4QRRA 1D5BA 3RL1A 1INQB 1X4XA 2CXKA 3JV0A 1XGQB 1VGKA 3NCCB 1N0XH 5J1TC 4K3JL 1EFXB 1CGSL 4XNYL 1G6VK 3MLTB 4APQC 5FK9B 1FO0H 4XPAL 5BMFL 4NYLA 5MI0B 1U8KB 5F3BB 1IT9L 5MERB 3MLYL 4X6FA 2H6PA 4WEUD 4M62H 5GS3A 4OTXH 2EDQA 1D5IH 2KH2B 1KACB 4PLKC 4JGMA 5LBSL 1K6QL 2YHGA 1BMGA 2FLRT 2DI9A 1DJSA 2X4OA 5HGGS 3S35H 4EDWH 2BY3A 3HE6A 3NPSB 2DQDL 5JLZA 3GJFA 4Y19B 3GSVB 1B4JH 4HIXL 4PJDB 2XA8L 3OAUH 2XNAA 2AXJA 3FQXA 4CKVX 1OW0A 5GRWA 4I3SH 5EBMB 1JZ2A 3O6ML 5H94B 3PQYD 3C09C 2AEPH 1ZHNA 4WGWB 1KJ2A 5TGBA 4D94A 5E6IC 3ILQC 3KXFD 4ZXBD 2O93L 3D2UB 1ETZB 3PXHA 4NQCE 4I1NB 5E9DE 4GRMA 3QXWA 1A6ZB 4X4ME 5TDPB 3CFEB 3V5DB 5EDXA 3OXSA 3FOMB 5F88B 5IFAL 4TVPH 3GI8L 3KXFA 1RHHA 5EU4A 4BFEA 5HYJD 4M4PA 1J1PH 4LKCA 1U3HD 2VN4A 3G6JB 5E1AA 4NCDA 1FSKC 1UXSB 3QAZB 1S7WA 4HGWA 3GB7B 4FQJL 4XP6H 3WSQL 1DQML 2EXYD 4L29B 5FO8A 2QQNL 5IBTL 1ZLVK 4DFHA 5ADOL 1FNGB 2JJVA 3BPLB 3BO8B 5CGYC 1I3GL 3W2DH 1DQLH 3DYOA 3SY0B 4W6WB 3AFLA 3V0VA 1MWAA 5JPMB 4BQ8A 1HXMB 5J06A 5FUOH 1KB9K 1T1XB 5AAMA 5FYJL 5T1DH 3Q3GA 2E9WA 3TNMB 2MNUA 5FHBL 1UT9A 4W70A 1JUFB 4ONGL 1CN4A 1OL0A 1OHQA 4HV8B 5GGSY 5LCVL 4UBDC 3S5LA 4KKLC 1ZWIA 2HJKB 5DHVH 4YR6A 4AT6A 4YHLH 1LNUA 1XF3B 1KCKA 3KPRB 4JFFB 1RY7B 5BW7C 1A3LH 2ZJSL 2BVQA 3GSNB 4NQCD 5FF6A 1QFUL 4YAQB 5ADOH 1H3PH 1ZSDB 2WQRA 4KXZH 3WSQH 2I25N 1L6ZA 4M6MH 5J6HB 1CLOH 1T21A 2HFEA 3BPOC 1QSFE 4K7FB 3G08A 4U1KA 4RGNE 5FYKL 1GHFL 4JLRA 1Y6NR 4MJIA 1NUNB 2H1PL 4WENB 1HXYA 2R4SL 2ZKHL 4Y1AD 4M5YL 3ZHDA 3ZDXE 4P23C 4J3TA 2W9EH 4Y16A 2DQCH 3K74B 4DOHB 3QUKA 5F1NB 2CLZB 1U8NA 3CVIH 4IRZH 1U92B 1MCPH 3SCMD 1G0YR 1CGSH 4XNYH 1DN0B 3O6LH 3TZVA 5T1DL 1A14L 2NY4D 2Z8RA 2XA8H 3IXTB 4Y4HC 4Z78A 2HVJA 3CDFA 3ARGC 5D2NC 1AR2A 2R0LL 1N3NB 3W2DL 4PG2A 1X6LA 1H3XA 3QJHA 3TBWA 3NAAL 1NFDE 4DZ8B 2QQNH 5IBTH 3QDJD 1T22A 2NTFB 3LEVH 1J05B 2DQGH 1PSKL 1FCGA 4PJ9C 3T0EB 2RGSA 2Z8WC 3DETC 1IGMH 3QDJB 1PG7X 4NCC2 3L5HA 3L1OH 4I0PB 5FCUH 1XZ0A 4L4VD 3VFNB 2X4OB 3MO1A 4PJAE 4NKDA 1G6RA 2XZQH 4PGBB 2CIKB 3T2OA 2X9YA 1MCRA 1OARL 1X5YA 4YX2L 1F13A 1DVFA 5EUOA 1YNKH 3VFNA 3M8OL 3EYOA 4E0RA 4OCRL 1YEHH 5ID0A 1WSST 4LLDA 3QQ4A 1LVEA 4MNGB 2YBRA 4HUKB 5DMIH 1BBDL 2OJZL 4HAFA 4OLYL 2Y07H 1LEGA 3AROA 2H32A 1U8MB 2QQLH 1QO3A 2NR6D 1UB5A 2WINA 3E6HB 4BFIA 4P2QA 2YOCA 4XXDB 1A6UH 2QBWA 1LEGB 3GI9H 3MX0A 4WFEE 5JW4N 5EWIH 4EUPA 4EKXA 5CBAB 3EFDH 1DUYB 2X9WA 5IESL 3IDNB 5B8CB 3D9AL 4MD0B 1UXSA 4NC1E 4ISVB 1I7ZB 3TIDB 4X7DC 1MCHA 1T7XA 3CFKA 4QCIB 4N0CC 3RZCC 3TO4A 2WIMA 3HMWL 3Q5TA 3CD4A 1W0VA 2M8XA 4RWYH 4F7MA 3C08L 3ORJA 2V2XB 4JFFD 3ME0A 2AAVA 5E99L 1T0PB 1CFNA 4HWZB 2H8PB 2JB5L 2QADD 3C6LB 1HXMA 5JIIA 4I0PA 3SGKA 1IAIM 2VZTA 3IFPB 2P43B 3V6FA 4OT1H 5C0BE 3QDJA 4L8BA 3QUXC 4HMCA 3ARFC 2KZWA 4P2QE 1R3JB 3UBXI 2ICWB 2OSLB 3DSFH 2BC4B 3GSRA 4G9FB 1HH6B 4KROC 4OF7A 1MCDA 4JHWL 5HGDA 1IKFL 3BMWA 3I6LD 4GMTH 2ID5A 4L8DA 4QWWD 5FA4B 5LGKA 5IF0B 1V05A 2PCPB 1RHHB 5DLML 3AS1A 5IVZB 1G84A 4OLVL 2J88H 4YDKL 4ZODA 3IDYC 1DN0A 1HILA 1RIVH 2ORBH 5CP7B 4QXWA 5LGJA 5FXCH 2E9BA 3TBVA 3O2WL 4G9DB 2Q76A 4IOFD 1VPOH 2ADFH 2AEIT 2QSTA 3GBMH