4LLUB

Structure of pertuzumab fab with light chain clambda at 2.16a
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
210
structure length
210
Chain Sequence
b'DIQMTQSPSSLSASVGDRVTITCKASQDVSIGVAWYQQKPGKAPKLLIYSASYRYTGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYYIYPYTFGQGTKVEIKGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PERTUZUMAB FAB Heavy chain
publication title Generation of bispecific IgG antibodies by structure-based design of an orthogonal Fab interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 46
structure length 210
sequence length 210
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lluB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lluB01
3EZ8A 1CT8B 4LQFH 4QNPF 3O2VL 3L5IA 4CMHC 4RGNE 4HAFA 1MFAL 1GPOL 5JDSA 5AD0B 5IEKA 3W9DA 5DHYA 4KUCF 4UV4H 3QZWA 1YJDC 2VB5A 4Q9QL 3T04D 5MENA 5D1XC 4ZUTA 1MI5B 2I60H 1ZHNB 3TA3A 1LP9B 1K3IA 5GS0L 3LH2H 4FNLL 1EHLH 4GRLC 2IAND 3C08H 5EU6A 2AQ2A 3Q5TA 2GFBA 3AS2A 5EUKA 4DCQB 2LTQB 1I9IL 4TOYL 1FO0A 4PUBH 3SDYL 3VWKD 1N64H 4PGBB 4U1IA 2XXCB 1AGBA 2VWEC 4P9ML 2CXKA 1WCBB 1WQVT 3NCBB 4FP8H 2BVOA 2EIBA 1AFVH 4ZO8A 5BVJB 15C8L 4L3ED 4QWWC 4LSUH 4F8QA 4P59L 4MA1B 3DRTA 5FHBH 3BUTA 2WIIB 1R3HB 3ARPA 4F37F 4LHUA 4MD4B 3EOYG 4NT6A 1KG0A 3LAFA 5CILL 3C60A 3D69A 1RIUH 1NGYA 4PJXB 2ADFH 5J12C 4M61A 2CUMA 3LIZL 5DQ9A 1GZPA 4L5FL 5CFHA 2WBKA 4I0PD 3RL1A 3F6IA 4AG4H 2B1AH 2XA3A 4ZUWB 1CBVH 1OAXL 4PBXA 4PGCA 3I6LD 1DBBL 4X99B 1QFWH 2ZUTA 1AO7A 1S3KH 1MFBL 2P8PB 5C0BB 5IFJA 2G5BA 4R3SB 4U1NB 4DGVH 4IIQB 2CXGA 3V6OA 5HD8D 4NQEB 4QF1A 2HVJA 2MJWA 5C09B 2JIXA 3W0WA 3NACH 1CVSC 4XNQB 4G5ZL 4G6ML 4DKEL 2AQ1A 3IDYB 4Z76B 3PGCA 5J89A 3BYYA 3SGKC 4KROD 5FO9B 4H1LH 1NGWB 2RCSL 3SKJL 4EIZC 4Z77B 1PW3A 5DD0L 2GSGA 5ELIA 4KRNA 3BDYH 4Q97A 5CZVH 1D5MB 3BW9A 4X7FC 5GS0D 3O6LL 3UTTA 3SBWC 1F3JA 2ARJQ 3MLYH 4N8CH 2FX8H 4OV5B 2MHAA 1CIUA 3I50H 2YMXL 2YUWA 5HYEA 1MHCA 4OZ4B 2QBWA 2EXWD 3B2UC 4U1GB 2HJFB 4X8JA 1I1AA 5KSAB 3KYMA 3OL2A 3THML 4WUKH 3DX9A 3EO9L 4H1LA 2E3VA 5DUBB 2DL9A 4QHKI 1N6QL 2Q76B 1CXIA 3SJVB 1AD9B 1BD2E 4UQ2A 5GJTH 1DQQB 2EKJA 3HE6A 1DBMH 4NNPL 1U3HD 4Y4FC 1G7HA 1H3WM 4GUPB 5F7KC 3T0XA 2CRMA 5KTEL 1S9VA 5I76B 4PGEA 2AEQL 1KIPA 3AB0B 2R69H 2VUOA 1KJ2L 2NY3B 3MJ7B 2AJZB 1LGVA 3VFGL 4K94C 4F7PB 3W5MA 1AXTH 1OM3H 4HC1A 2AXFA 3PXHA 4Z95H 5D7SL 3MRGB 5E08H 3I2CL 4XI5C 1T7VA 1YN7B 4GBXC 4MNQE 5I30L 2AXGB 2QSCH 3D85A 4OD3H 4JPIB 1RUML 2VN4A 1QNZL 5T33L 3IDXH 4FFVD 3L7FB 1RFDH 2VXTL 4NKOB 1AR1C 4APQD 3QXWA 4YDJA 5DLMH 4F80A 2DQIL 2I26N 4Y8AA 1OPGH 3SE9H 5EU7E 1A6VH 2X9XA 3A0OA 4EIGB 3HG1B 3IDJA 3DUSA 4MX7A 4LAQH 4XAKD 5EORL 1JIBA 3QQ9D 4GW5A 3Q1SH 4HWBL 2DJ4A 2KZ1B 1FIGL 2DKUA 4HKXB 4LGSB 4ZQKB 4IS6A 3CFIC 4XX1E 1AGFA 4MLIA 5F7NC 2PCPA 1MRFL 3IXTB 3FFCE 5C07D 3PP4H 5LCVL 2QR0B 5I75C 1NCWL 3BJ91 3I3DA 3M8OL 2HKHL 3BPCA 2L4OA 4MA1C 5FCSH 3HE7A 1P6AB 5H2BA 3QHFL 2J8UA 3OXRB 4V2BA 1JTPA 5HDQH 5ITBH 2AJUH 1J11A 1QRNA 2HRPL 4Y16A 3LN9A 3DV6A 3QQ4A 4J1UA 3WLWC 3AREC 1AIFB 1S8DB 3TP4A 4TUOB 2W9LA 2MPAH 2BY2A 2DI7A 5HHNA 5L8LB 4K8RC 1RZIA 4HX1A 1JGUH 1X5IA 3WO3B 4I2XB 4P23C 2BNUA 3U7AA 4PRBB 1M7IB 3BD5A 5E94A 3E2HB 8FABA 3RPIB 3RVWD 1QSZA 5HTSA 5F7LB 5HHMB 3MV7E 3QUYA 4G6KL 1VERA 3R0NA 4IIQC 1MF2H 4IOSD 3L6FB 4G80B 5MENE 1OSPH 3L5XL 4IRJD 2Z8VC 5EOCH 1A1MB 2GUOB 4YNYB 4RRPA 4LEXH 2BXYA 1CFNA 3GSNB 3MUY1 5EU6E 4NDMA 2WBJA 2YPVH 4OI9A 5EULV 1Z3GL 5JUEL 5GPRA 3DI3B 4ZPVA 3MODL 4TSAL 5C9JA 1T21A 3VW3L 2EE6A 4C56B 3CFJB 1DBJH 4NM8L 1XAUA 1T7YA 3VH8G 1FVCB 4EUPB 4IDLA 2B1HH 4GLRI 5DS8A 1ZVSA 5FKAA 2ED7A 1GGIH 2W0KA 4OSUH 4UTBL 3GSQA 5ACLA 2OJEB 1BREA 1KPVA 3UZQA 3C2SA 2W07A 4QGYA 4AENA 1X4XA 4Y1AB 4RFNB 5L6YH 1FPTL 3FRUA 2FEDC 1BECA 2OTPA 1CICA 4YHPB 4YXLH 4PLKC 2R0ZH 3GMQA 2WM0A 4PV8A 2YXMA 3KDMA 5GGVL 5IFHH 2DQCH 4A6YH 2RJMA 2A6IB 2YK1H 4G43B 4ELMA 3P73B 4PJGF 4EBQL 2QKIA 1RAMA 3KLAA 1P4LA 3QDAA 3TM6A 2XN9B 4LSRL 2NMSA 2XTJB 3B9AA 1AO7E 1VGEH 2OI9B 1QUNA 3UBXA 3VXPB 1B4RA 1S9XB 4JRWA 1CDCA 2XG4A 2A9NH 1MCKA 5B39A 3E3QE 2AKRA 1T20A 3OG4B 1BQSA 1M05B 5B8CB 3FRPG 2YRPA 1FFRA 2V9RA 3W0WE 3RL2A 1S78C 5D7LA 1ZE3C 3K74B 4M6OH 5HHXL 1DBKL 3ARUA 3HMWL 3VGHA 1M7DA 1ZLVH 3AB0C 3WXWL 1TPXC 2NY3C 3NVQA 4X4XA 5JPMA 4YPGA 1XFPA 3MACL 1ZHLA 4FXGB 5E6ZA 3A6BL 4CVZA 1FFNB 4Q7DA 5HHQA 1QBAA 3ZHKA 2QADB 1A7RH 2WUBL 5E2VH 5CMAA 3G5XA 4HKBA 3UTTE 3ILQD 1A1NA 1IAIL 1NFIA 5FOBB 2R1YB 5MHSE 1OGTA 3J7HA 1MFDH 4I18A 4JZJC 4HFWA 4XP4H 2R0WL 4R0LA 1CI5A 4EI6B 2BMKB 3PHQB 3JV5A 1T3FB 4GAFB 4HGKC 2EZ0D 1S5IL 3SKMB 3PWNA 4DVRL 3UAJD 2AV7B 5B3NA 2WQRA 1LDPL 3LSOB 5E2TL 4OCNC 2WP3T 4DN4H 2AJYL 4OZFG 1VPOL 4HZLA 2B4CH 5DSCB 5AUMB 3VFNB 1KJMB 1U41A 3U0WL 3IVKB 4EQ3A 4HWZA 4EI5C 1JJUA 2C3HA 2NW2B 1S9KC 1UM4L 2X70A 5SV4A 5KVMC 5J11B 4OCSH 2OTUB 1S5HA 4PJAB 5FYJL 4X7TB 1EO8H 1ZHKB 3V6FA 3WO4B 4LP5A 4YC2B 2Z31A 4K7PY 1AQDB 3E2HC 3I6GB 3MNWB 4GRWB 4FQ2H 1HE7A 1JE6A 3O6FB 4M7KH 1CK0L 3UJJH 3GMOA 4OUOA 5BJTA 4HXBL 1KBGL 1A6UL 5B4MD 1BWMA 3B8SA 1JPSH 3TFKC 1I1YB 5KJRH 4RISH 1N0LA 2FD6H 1TVHB 3HFMH 3BQUC 5IROC 3WEXB 3LRGA 1JL8A 5JZ7C 4L3CB 3DURB 1FYTA 3MR9B 5C0FB 5ESAA 3QDJB 3LKSB 4HIIA 3Q5YA 3OWEA 1T5XA 2RGSA 4XNZB 5CIPB 1KF9B 5CCKH 3SQOH 3MCKB 5T3XH 5DMYA 1ZGLP 3V52L 1XGTA 4FFVC 3EW3B 1ZSDA 2P7TA 3C6SB 2XNAA 3VGGA 1RMFL 4MSWA 4LLMB 2ICEA 4DZ8B 2CLRA 2Y36H 2O5ZL 2J8UE 1CDYA 3O45B 4NRZB 2IGFL 5DRZB 2PO6D 4RFNC 4PP1C 2N7BA 3IS0X 3CFKB 1QRNE 2Y5EA 5FUCE 4OKDA 1SYSA 5EIIB 1EUTA 1BLNA 5DD6B 3GMNA 3FQRB 3RZCD 3MCLL 1EXUB 1NAMB 2OL3B 1BQLL 4LU5L 2VAJA 1F4XL 2EH7H 3QIBD 2XTJC 3W9EB 2X4UB 1CL7H 3P9LB 2OI9C 4YXHH 1JBJA 4R26L 3SDDD 1PG7L 4FTVB 5FKPA 4MMZC 4XMKL 4P2OB 1DEDA 6CGTA 3VMPA 1OGAB 3NIFF 4JLRA 1YY9D 1QYGH 4HIHA 1P4IL 5FYJD 3KLDA 4LSQH 1J0ZA 1C08B 2VNCA 3RDTC 1R24B 4NFDA 4YHMH 3EKCA 5GGTH 4AT6A 3PG2A 3ZTJG 2ZG1A 4WU7B 4JR9L 3JWDC 4KAQH 4OM0H 4WIQA 1RJCA 3L95A 1NDGA 3QXUA 4AMKL 2F54B 3EYFB 4AH2B 3CX5J 3P4MB 3MFGB 5CSZA 3S97C 1WF5A 5K9JL 4Q74A 3O9WD 4P2QD 4UT6L 1LO2L 4I5BA 5HDBE 1H3PL 1TZGH 5T1KB 3DX6A 4U1SB 3UPRB 2DDQL 1IT9H 3BSZL 2PR4H 4PJXF 3WBDA 3FTGB 5ANMB 4XPAH 5ESVB 1T04A 3CFBA 4H5SA 5T1LA 5JOPE 4HT1L 1KTDB 4JJHA 5GGTA 1Z5LB 1RZFL 4P0DA 5J3HD 2HFFB 4QRUA 3HMXH 4HWUA 3T09A 3AU1A 2DIAA 1JPFA 1NEZB 4U7MA 2GW5A 1CGUA 4NQXA 4FQXD 1ZVYA 3BGAA 4X6EB 4ZMAT 4YDIL 1U8MB 1U6AH 4MDJB 3NCMA 5D7LE 2OMBA 4NJ9H 5IBUB 3QUXA 3W39B 3PWUA 5KANG 4ZFFB 3U4AA 4KHXL 4LFHD 3WS6A 3IFLH 4Z8FL 3VWJA 5I1KL 3WO4C 4TSBH 3OAYH 4LSVH 1WJ3A 4C57C 3MYZA 4B7LA 4HFUL 3G6DH 3DPBA 2BHUA 2DLEA 1L7TH 2KPNA 5FUZH 5I15H 2ZSVB 2IEPA 5A2LH 3VA2C 2G5RA 1NCDH 3BUYB 3HMXA 4ZAKC 3MRCA 1K4DB 3I02B 5BS0B 1U8QA 2LQRA 3O6ML 4GH7B 4CL7A 5EWIH 1UQSA 4I3SH 1HQ4B 5JMOC 4P5KA 2VZOA 4P9HH 4WU5B 5IHZB 3LQAC 2IG2H 1E27A 4M4PA 3C5ZB 5DZNA 4XNZC 1YNTB 1R3JB 4WHTB 1KPRB 1JUFB 1U8HA 1ZMYA 5D71L 3R8QA 1YPZA 2ZUSA 2ZCHL 1WFUA 4O5LH 4LEOB 2MMXA 2D0FA 4NFCA 1CU4L 2VLJB 3OJDA 4ZO9A 2CQVA 1IRAY 3DX8A 3EYUL 5GGSB 1IEAA 5DEGB 2BVQA 1F4YH 2CUHA 1EVUA 2ZPKH 3K7UA 2A38A 3U9PH 4HMDA 3G9AB 4JB9L 3BRGC 3V79C 4OD1H 2VZ1A 2HH0L 4TULH 3JZ7A 3O6KH 4HSQA 5A2KH 4XNUH 3ZYIA 4Y4HD 2ZG3A 1HK6A 1R3IL 2X5PA 5T3ZH 5DJCA 1C5DB 2ICES 4R4FH 3L3GB 5C0EA 5CP7A 1C5BL 3FZUD 3NCJH 4GMTL 1RUQL 4P2OC 3C2AH 4ZUSA 4G8IB 3WKML 1JP5A 3BP6A 3HI6H 2Q87A 4QNPE 4OLYH 5GISH 1IQWL 2VDKH 5EUOA 1KCUL 3N1PC 5LXGH 4OZHB 2DQGH 1FYTE 3OHXA 3W5NA 1EFXB 1HH9B 1M71B 2YPLD 3CVHH 1HILA 3MA7B 3F62A 2CDFA 4U0RC 3TWCL 4Z5RB 3OGCB 5DO2C 1BHGA 5I1GH 2D7NA 4BELD 4L4VE 4UZGA 2X4QA 4LL9A 5CLTA 1OTTD 3BPLB 1HIML 1TZIB 5IMLB 2JJTA 5IGXH 3R4DA 5L2JB 5C0JA 4QYOB 3GJEB 3K2MC 2YWYA 4O02L 3RFZC 3P77B 4NYLB 1C7TA 4L4TB 4PLJD 1TTGA 4NO5B 3TH2T 1NDMA 3K8MA 5J6HA 1HHGB 4YGVB 4HK0A 1J87A 3MJGX 5I1IL 2L7JA 5E9DB 3DSFH 4Z0BH 4LSTL 1WIPA 4HUVB 3HI1A 3BDBA 1TQCB 3FT3B 2XRAH 4LASL 4CU7A 2IADB 2ADIA 3REWB 4KMTL 4XC1L 5T3XE 1GGCH 2OCFD 4RAHA 4BZ1H 2JKXA 5GIRA 4HF5H 3BE1L 5F6HJ 4BH7A 1CDIA 4YK4B 4XVJH 4Q9RH 1IM3A 4LNRA 2P47B 2VDOL 4EXKA 3I75B 4DKFL 2CR3A 3WS3A 4U1MA 1UVQA 3QWOA 1KN2L 3SCMD 2ADGA 1HHIB 4ONFL 1A6PA 2YSSB 5CEXA 1P84K 5D1XA 3FOLB 3GIVA 4PJ8A 3RGVC 4G8GB 2XWJB 4BZ2H 1MPAL 4OCWH 4YFLI 1G7PA 3S4SA 3ZKSD 5D1ZB 4GW4A 1CF8L 1S7QB 5BRZB 1XGQB 4YH6A 4ZO6A 1FNEA 4U6VL 4CADA 2BSRB 2D31A 4S1SL 1QOKA 3PP3K 3BP4B 1FZMB 2NX5E 1HCFX 3BMVA 1AJ7H 4JY6B 3VH8B 2N1KA 3QHZL 1B0GB 1MCCA 2AJSH 3RUGB 5IQ9B 2VXQL 3A67L 5HGDB 2Y07H 1BPVA 4YHZH 3QNZB 3GHEH 2APFA 5JOFB 2H41A 1FZJA 1JVKA 4QOKD 1EGJH 4N1EA 1S7SB 5FF6A 5CZKA 4WENB 1GCFA 1YA5A 5AZEH 4Y8DC 2M8XA 5E56A 5IB1A 3UO1H 3X14A 3OKKB 4Y0GA 4JFZL 2VDLH 3GRWL 1JGVL 2AEIT 4ZFOL 2F5AH 1U3ZA 5E8NA 1N3NB 4WW1A 5IWLC 2UZYB 4PRID 5F7FA 5JR1L 4O2CA 2X1XR 4HPOL 5F96H 1PZUB 4ZSOB 3T3PE 4JVPA 4OGYH 4HEME 4XNMA 1CFSB 3GSRA 5IHUL 3CXHJ 4UINH 5GJSH 1DLHB 2YRZA 3T0ED 4FZ8H 4PJDB 2ICWJ 2D7MA 1XF4A 1PLGH 1PSKL 3QI9D 4RX4D 1LK3L 2WWKO 3EGSA 4LCUB 4ZUUA 5TE7H 1EGJA 4RMTA 4BJLA 4LCCB 2VDMH 1FCGA 4DOHE 4LLYA 4M1GH 4XMLL 2DMKA 4R2GB 1LE5A 3U7WH 4NQCD 2GKIA 3DXAB 2FZ3B 2NYYC 1MAJA 1WBZA 4OJFL 3NIGE 2VZVA 3FO1B 4MJ4A 4LDOB 4DAGL 3SBWA 6FABH 3M1BA 5F70A 1F90H 3BKML 3MFFA 3TBWB 4NRXB 1NBQA 5BZWB 4D0DB 1QLRB 3ALPA 1IZJA 3CDFA 1YPZE 4TNVF 2YWZA 3ME0A 1EEYB 4X9IA 5HYFA 5JIIA 4Q6IB 4F3FA 1B90A 4BK5A 3MLRL 1P7HL 5E5MA 1ZHBA 4OM1H 4UT9H 5I8EA 1G7LA 4ZXBC 4L29B 3DBXB 2NY7L 4MZ2A 2R4RH 3OX8A 5BV7L 2GJ6D 4JKLA 4QLRA 3RWJB 2NY4C 4G9FB 4ZD3L 5H35A 5CD5D 5L2KD 1KACB 1IC7H 4PJAF 3O3BA 1BVLB 1DQMH 1H15A 4J12A 3O3AB 1FZOA 3FB8A 2VDPH 1TQCC 5DFVD 4Y4FA 1ZT4B 2NY6D 4KK5D 1JYWA 2X89D 4J4PA 5DHVB 4GRWF 5FA4A 2J5LB 3QIWB 4QXUL 3WN5C 5LGKA 3SDAD 4H0GA 4JG0L 1VEMA 4Z7VA 4L9LC 2PW2A 4FZEH 5EZLA 5FB8A 5HJ3B 4XAWH 4OF0A 4YK4C 2GK0B 5CEYB 2ORBL 1CT8A 3RU8L 5EUOE 1OAZH 5AD0A 3O8XD 1PZ5B 4W4NA 1JRHL 1LEKB 1QSEA 4KMLB 2Q6WB 4Z7NF 1XR9B 1G0XA 4KJYB 3H0TB 5KANI 2I5YH 3L3JB 2PYFB 1MI5A 4TTDD 1ZHNA 2L0DA 1LP9A 4MQTB 3WNKA 3RNQA 4KFZC 1J0YA 2FECL 1MVUA 1R5VB 5D1ZC 3H9YA 4DCQA 5T3ZE 2Q7NA 2E7MA 5L88L 4WTZA 3PWPA 3FCTA 1LO0H 2BZDA 4DUWA 1WCBA 3RHWK 1LO5A 4NWUH 5DJ8B 4L8DA 2A6KB 1PKOA 1V3MA 5KS9B 2O61B 2A73B 2WIIA 3HNVL 5C9KA 3LDBB 1SVZA 1R3HA 4MD4A 1KULA 2YD9A 3CVIH 3E0GA 3VXOB 1KC5H 4HWEL 4JPVH 4JRXD 4KTEL 4PJXA 5C0RL 2BNQD 4JM4L 3QUZC 4UDUA 1YEDB 4J3XA 3GSWB 1TVBB 4HIXH 5EIQA 1T1WB 4X99A 3FO0L 1BX2A 4IMKA 1MOEA 3LEXB 4JO4H 2B0SH 4GW1B 5EG6C 2AGJH 4XVTL 2A2QT 2P8PA 5C0BA 2MKWA 2BRQA 3DROA 4NIKB 4U1NA 2YD3A 4NNYB 4ZOCA 4PJHF 1IGYA 1YEJL 2XQBH 4NQEA 1JYNA 4KKLD 4DQOL 4QRPD 5C09A 1PD6A 1P69B 4R8WH 2OK0H 3FKUS 1E6OH 4H26B 4XNQA 1U8KB 2LV4A 3BDXA 5DURD 4XP1H 2WIMA 4Z76A 1C8PA 2PXYB 3VA6A 5KSVB 1KLGB 3JWOL 1DANU 4OT1L 2DD8H 3WLBB 2H26B 4HJ0C 4N0UE 1MHPL 4Z77A 1JGEB 4B7IA 4R2GC 3E6HB 1FNSL 2DRUA 4TSCH 5C71A 1XF2B 5JW4N 5BVPL 4NP4H 3K1DA 1TDQA 2HLAB 2OSLB 4PTUA 3D1MC 5J56B 5TQ0H 1KIQB 4NJAH 1FV1A 4JHAL 5KSBF 4QCIA 3HUJB 5H37G 1BFVH 1N7MH 5FYLL 3DRQB 4JN1H 4Q6IC 4K55A 3LKQB 1PG7X 3QG7H 3LKOB 3BKCH 1OWWA 4FFZL 5SWZE 2HJFA 1DQLH 2FX7H 1ZLUH 1U8LA 5TJWK 3ZKMD 3WFHB 1JNLH 3WNPA 5ACMA 5IW1A 5KSAA 3V8CA 1EIBA 2BFVH 4JKPH 3WL9A 4WW2C 5DUBA 5GZOD 3KAAA 5ECJE 2Q76A 3B9KB 3SJVA 2P5EB 4HJJH 1DQQA 1BZ9B 3R0MA 3C5JB 5DYOB 1HEZB 2ZNWA 2GHWB 4MJIB 3QDMA 4FQCL 3CCHB 4GUPA 4GSDH 2J5LC 1EDQA 5GRJL 2CKBB 3MJ7A 4U1KB 2AJZA 4F7PA 2D7TL 4IRSD 2VITB 3MRGA 3FT4A 1DQJB 5F3BA 3PL6B 1IFHH 5GHWL 1EJOH 4V1DA 3RIAF 3L7FA 5KVDL 4NKOA 1T66C 3TGXA 1QACA 4PYHA 3CSYA 4NQDB 4OTXH 3HG1A 3P30L 1L7IH 4LRNL 3VFMB 3FN0L 5E8OB 3QI9C 3B4NA 4Y7MA 2ESVD 4KUZL 4E42B 4HKXA 1KJ3H 4UILL 4MD5B 1V05A 3IXTA 4DKDC 1W8NA 4PJCB 1X5HA 2QR0A 4UQ3B 1F6AB 3CSGA 1UENA 3BXNB 1PG7W 4YUEL 3RVUC 4KI5E 5ADPH 2FX9L 3F7QA 3BGMA 3DV4B 2ENYA 3LDBC 3ZL4L 4NHCH 3OXRA 5FYLD 4PB9L 3MBXL 5FEBA 2R2CA 2NPLX 2B5IC 2DQEL 1VEPA 1MIEH 4NUGL 1FORL 2Z93B 1AIFA 2J3SA 4Z7VE 1S8DA 3U1SL 2X09A 1CN4A 4TUOA 1KOAA 1DP0A 1J0JA 2AABH 2W92A 4I2XA 3HC3H 4M48L 3E6FB 4P4KA 4PRBA 1M7IA 2H9GA 4XPTL 1A47A 3S98A 4RMQA 3H7BB 3RPIA 1QSEE 4WY7L 2YEZB 4WV1C 1U3JA 4OZHF 5D5ME 2X1OA 5FM5M 2R1XB 3HRZB 3WFEL 4IDJH 4G80A 4LHJB 1H5BB 4OBSA 5DFVC 3MTRA 3RGHA 1LP9E 2IAMB 3NPSB 3ARDB 3CDGB 4K07A 4QRRD 1A1MA 2GUOA 4YNYA 4JO2H 4MGXA 3VWKB 1YEKH 5IROA 4ZTPL 2PXYC 3DMMB 1IGJB 3W2DH 4ODHL 3X3FH 1RPQA 4X6CB 1I9EA 1T89C 3PWPE 1D9KB 4C56A 3CFJA 1J0IA 5JA9A 1NGPL 2V5SA 2MQ3A 4M7ZB 1W0VB 2RBLA 1EZVY 4EUPA 1FVCA 5F3HB 1RJLB 3MZGB 4G7YL 5DRNB 4EVNA 2F58H 2F8OA 1GC1H 1WICA 4HQQH 2XY2A 3BX7C 2Z4QB 4Y1AA 1EHAA 4M4RA 3ILPB 2RQ8A 3NOIA 3F58L 2W9DH 4PJXE 4YHPA 4F7MB 4YIQA 5EU4B 3C09C 1SBSH 4FFWC 1ZAGA 1CGSH 1FSKB 5BXFB 2A6IA 4G43A 4FFYH 3P73A 4LFHG 3G6JA 4N8VG 5A43C 1IGIH 4MA8L 2XN9A 3DLQR 3BESR 4KC3B 4LCIH 3RQ3A 5IT2H 4BA8A 3VXPA 1S9XA 3HB3D 4DVBB 4DWHA 1KELH 2ILLA 4WI7A 3CUPB 5K9KB 4JFQA 1FDLH 1M05A 5B8CA 1OAYH 5C09E 1G7IB 3GHBL 4PRPB 2X10A 4U1JB 3NGBB 5F6IB 2GIYA 1N4XH 3D39B 2WWMC 4KROB 3DI2B 4M8VA 5HGAA 3DVGB 2CKNA 3VMNA 1WZLA 4OLEA 2OS7A 4Y4KB 1J8KA 1G6RL 5IVXB 3SDCD 1X5GA 4X6BB 2DWDB 4LLUB 2D9QB 1CE1H 4FXGA 5E6IB 4YFEA 5I0ZA 1BF8A 1YEIL 2R4SL 2VLRA 4LCWE 1OLZA 4ODSH 4XP9H 1J8HE 4RFOH 3RTQB 2V9TA 1F5WA 4OF3A 5DRWB 1OAUL 4ODUA 4OFYD 4X9GA 3TCLB 3RUGF 4G3YL 2VXSH 5LGHL 4U1LA 5FOBA 2R1YA 1DLFL 5GSVA 5F8RC 3KJ4C 2JCCB 1ND0B 4EI6A 4PS4H 2BMKA 1T3FA 2VR4A 3KPLB 2CDEB 4PJFB 3SKMA 3ZMRA 4GRWH 3L3DA 4ZOEA 4OKVB 2AV7A 2OR9H 2DICA 4F33B 5GS1B 4EOWH 1J1XL 1FP5A 3ECBA 4QXWA 5ALCH 3VFWB 5EB9A 4YHNB 1N2RB 2AK1H 3MRDB 4L8CB 5JOEA 2KUTA 4JREB 4GLRH 1U3HB 4QRQB 5DSCA 3SJVE 3VFNA 5MEPB 3EYVA 1UA6H 2F19L 3P0VL 3QDME 1ES0B 5CUSH 4KKCD 4ZYKB 2K1MA 3X17A 4UUJB 3T0WA 5CIPH 3QUKB 4WFFD 4X7TA 4K23H 3ZKMC 1YMMD 4JAMB 1ZHKA 4LBEB 5FA3B 4YZFE 3RI5K 3VXQB 1AKJD 3K2UH 1GGBH 3LRHA 1AQDA 2X4OB 4I3RH 1B88A 2LAAA 3ALWA 1CGTA 3I6GA 3MNWA 2P42B 2E27H 3O6FA 4V1DE 3BKJH 1UWXH 3EBAA 4BKLB 2LU7A 4OGAD 2V9QA 4JFOB 4H8WH 2IAMC 3NPSC 3ARDC 3HG1E 3PQYB 3KPOB 4WDIB 1TVHA 3V7AE 1NAMH 3IFNH 3WEXA 2CK2A 2XKNB 3G08B 4L3CA 2NY2D 3MR9A 3DMMC 2VC2H 4K9EH 3QDJA 3W11D 3LKSA 5SWQB 1D9KC 1F11A 5I19L 5CIPA 4M5ZL 1Q0YH 1CFVH 3S8WA 3S5LG 2CPCA 4OQTL 2BC4B 1E6JH 3C6SA 4WW2F 5FIEA 2OZ4A 4LLMA 3HC4L 3ORJA 3QPQD 3SGJC 1G9NC 5T1MB 3O45A 4NRZA 5DRZA 1OAKH 1DEEB 4JFED 3CFKA 1EO5A 2D3VA 4PRNA 1C12B 1KN4L 1BQHG 5EIIA 4N90E 4KKAC 1MCQA 5DD6A 4AY0A 1FSKC 1U93B 3FQRA 4OLUL 1UWGL 1JFQH 1NAMA 2OL3A 3G6AB 1WZKA 1U3YA 1TFHA 4WO4D 2X4UA 3P9LA 5EC2B 1UM5H 2C7UA 3IU3B 4FTVA 4FRWA 5HHME 1MIMH 4UTAH 1KSRA 1QFPA 1LEGB 2EH8L 4P2OA 4I0CC 5GZNC 1SM3L 3U36B 3OSKA 4NOBA 5D70L 3F7VB 2IH3B 3HNSL 4P5TB 1HHJA 2AJ3B 1MH5A 3NGBC 5E2UL 5F6IC 1KLUB 3WE6B 1M6OB 3BEVB 5JQ6H 2EECA 1C08A 3ZE0F 4I13B 5A3ID 1R24A 4WI5A 1Q9WB 2XZQL 4LKXA 4GFTB 2BNRD 1E4WL 4PBVC 4Y4KC 4JGMA 5ISZB 1N0XH 1OTSD 4C56E 1YY8B 4JPWL 4WU7A 5E6IC 3WIFB 1V7NL 1HSAB 3MJ9L 2FGWH 4XBGB 3RTQC 2Z92A 2F54A 3ARBB 3EYFA 4AH2A 4TQEH 43CAB 5T5FL 2NY5C 3K0WA 4ONGL 4JRYD 5SWSE 3OJVC 5IB5B 5MP6L 1RHHA 1A6WH 1F4HA 5IESH 2FR4B 4Y1AE 5IMKB 3B9VA 5T1KA 3VXUB 5EO1B 1PAMA 1IAII 4U1SA 1OW0A 4R4NC 3CJJA 3ZE2F 4YDKH 1IC4L 1MFCH 5GRUH 4GKSB 1EEZB 3WDHA 1N6VA 5F1NA 3MRBB 3FTGA 4O00A 5ANMA 1ERNA 5ESVA 3DSNA 2GT9B 4AEFA 4RDQG 3C6LB 1AXSB 3G6JE 1KTDA 2XN9E 3O81A 4HBCL 5E8EA 4OCRH 2HFFA 3HR5B 4PBWD 1MAMH 4GAGL 1NEZA 4JREC 5CSBA 5ITFA 2W0LA 3TO4B 5HSFA 4KVNL 1UKQA 1BJ1H 2W59A 3HNTH 3ZT7A 1U8MA 1ZTXL 1IBGH 3CC5B 1HXYA 4MDJA 5F88B 1RURH 2Z8RA 1T6WA 4IRZL 3W39A 2IJ0C 3ARGD 4JO1L 2VQ1B 1T0NB 4TUKH 2OTWB 4WI2A 4ZFFA 1B2WL 3F12B 3NH7H 4C54A 1MQKL 3OKMB 5E03A 5TFSL 1HDMA 2QV2A 5DUPH 3U30B 2MFNA 3LZFH 1P1ZA 4Z7OE 2VLRE 2AI0H 3B6SB 4UOW0 4M3KB 4U49A 3VFRB 1SEQL 3V5HB 4FQLH 2ZSVA 4MXVF 4LOUD 3BUYA 1IAIM 2MQ0A 2MWCA 3I02A 1F4WH 5BS0A 4J23A 2NR6D 2JK5B 3HUJF 4JY5H 1HQ4A 3B2VL 2ZCLH 4WU5A 5IHZA 4MS8C 3C5ZA 1A9EB 4LVOC 1YNTA 1R3JA 1JUFA 1KPRA 5I8KH 4M62L 3ARZA 2E7LC 1CDHA 1RK0B 3KXFA 4LEOA 1CFQB 1L4IA 3ULVH 1OTUC 5IR1B 2VLJA 4MA7L 2QQNH 2HMIC 5E7BA 3T8XB 4HUUB 4U4BA 5GGSA 3KR3H 5DEGA 3WFDH 4L1HA 1BD2D 2DLFL 3NZHH 4FHBD 1RZJL 1VACA 1LO3H 5EFIB 2D03L 3FN9A 1Q38A 4WCYL 3QJFB 5E2WH 5C2BL 2COQA 4ORZC 4DW2L 1NC4D 2FO1A 5IWLA 1NMAH 3S34H 1IL1B 2IQ9H 3CD4A 1RZ7L 4CGTA 5IKCB 2HAZA 4MAYD 1NLBL 4Z0XB 3IJYB 4D2NA 1C5DA 4GRWE 3L3GA 4XCEB 4WUUA 4CN1A 1FO0L 3O41A 2HYMA 4C59B 1I8IB 2VMFA 4G8IA 3RP1A 5AYUL 4WWID 4WNQA 5DR5H 3R1GH 2PKDA 4A2LA 1JHLH 3MLZL 5D7KD 3LB6C 3MGOB 1JHTB 4LQFL 1T7WA 1F58L 3TVMD 5HHPB 3CX5K 3B9DA 3O4LD 4UNTA 3QDJE 1QLEL 1HH9A 2YR3A 3T2OA 1M71A 3MA7A 4ZODA 5EDXA 1AE6L 5JW5B 3MYJB 4PJ5B 4Z5RA 3OGCA 2I60L 1NKRA 3LH2L 4HGMA 5JXEA 3WUWB 3FFCD 3ULUE 2XA8H 5L2JA 2AJVH 1I8LA 3QIUB 4QYOA 3GJEA 4PUBL 2EC9T 1N64L 1UYWH 4L4TA 1UJTA 3RZCB 1IM9D 4NO5A 3HI5L 2IBGA 3VI3E 5E70A 2DS4A 1HHGA 5IMMB 1GOGA 2CSPA 1AFVL 1ITBB 5E9DA 4LSUL 4NO0D 3BHBB 3C6LC 2QQQA 3WDIA 5DRXB 1NCCL 3OXSB 4KHTL 3FT3A 2IADA 3Q6GL 3C8DA 4FTVE 4PG2C 3RWHB 3GI9L 2ADFL 3EHBD 3TO4C 4X9BA 4K2UH 4NNXB 3QCVH 4G7VL 2HKFH 2B20A 2DQHH 1JI2A 3MLPA 4R7NB 3TA3D 1QFWL 3UYOD 4X5LA 1BFSA 1J0HA 1T2JA 3BVNB 3I75A 2VLKB 3MOAL 1HHIA 1NCNA 2YSSA 1NGQH 4X6CF 2NW3B 3FOLA 4KJWC 4DGVL 4G8GA 2XWJA 3DYOA 1U0QA 3X3GH 4TRPH 1FGVL 4GS7B 3O9WB 4RGNC 4MNQB 2NZ9C 1A02N 1YN6B 3TN0B 3MLXL 4OLWH 5D1ZA 2GITA 4PR5B 1S7QA 3QDGA 4FN0A 1XGQA 5BRZA 4F9LC 3QNXB 2Q86B 1QRKA 2BSRA 5BO1L 1CGVA 3BP4A 1FZMA 4UV7H 3T4AA 5CJBA 2CR6A 2DIJA 4JY6A 3VH8A 1G6VK 4LHUD 5HYJB 1GGTA 3PE9A 1B0GA 4O4YH 3BDYL 3PP3H 5IQ9A 5HGDA 4LVEA 1NUNB 5AZ2L 1ACZA 3QNZA 4YDLC 5DJ6B 2E8YA 4PLNC 1ED3B 4OF6A 5F6HI 2H1PL 4FQXB 5EC1B 3S37X 4X7SL 3MRRB 1YYML 3BP7B 3V6ZB 1S7SA 3NFNA 4HC1L 3EDDA 3WKNA 4M02A 1H3VA 2DQJH 2IALB 2JB6B 1GXEA 1NGXB 3OKKA 4N8VB 4Y5VC 2JIXD 4WUKL 3TZVB 1N3NA 1MY5A 2D0HA 3B3IA 1K6QH 3KPSD 1P9MA 3JV4B 1G7QB 1JK8B 1WLHA 4ZSOA 2DQDL 3FRPA 4U3HA 1CFSA 4JZNB 4ORGA 4XPBH 1DLHA 1WUNT 2IWGA 4QO1A 1ZA6B 4PJDA 3WJLC 4RMSA 3MV7B 2NXZD 5I66B 2R69L 3QZWB 4LCUA 5KVGH 2ZJSH 3UTPE 5MENB 4U1HB 4LCCA 1I85A 1AXTL 1OM3L 4Z95L 4OZFH 4YBHA 3UTTD 5C92A 1FJ1B 4K71C 2JCCF 2QSCL 3GKWH 4OD3L 2XZCL 4CU8A 3DXAA 2FZ3A 4P5MA 5L9DH 1FFQA 3IDXL 2AEPL 1KIRB 1NFDF 5DLML 1MCLA 5DHVH 1AXIB 3U4EB 4HCRA 1WIOA 4S1RH 3TBWA 4NRXA 4M6AA 5BZWA 1A6VL 1A1OB 4D0DA 4HXAH 1F8TH 1EEYA 4KJPD 3KXFE 5L8JB 4Q6IA 2FATH 4G6FD 5DJYB 4NZUL 5DJ0B 3Q1SL 3QIUC 2ID5A 3DBXA 4FQJH 5I16B 4IJ3B 4AEIL 1XCTB 3HE6D 4UB0H 4R90H 3RWJA 4G9FA 4MZ3A 1NGYB 3PP4L 4PFEA 3VXMD 4KKNA 1C7SA 3QYCA 2MKLC 3LPGA 4Y2DD 3O3AA 1KFAL 1A7QH 1BVZA 1F6FB 4IMLB 4W4OC 5HHOA 1ZT4A 5HDQL 3AVEA 2VN7A 4WUUE 1I1FA 2AJUL 1Z6JT 2HT3C 1SMAA 5DHVA 5E99H 2VE6A 1KB9K 4WWKB 3QIWA 1KXQE 3HR6A 1BBDH 4J3VA 4AL8H 2Y72A 3SN6N 4ISVA 1OP9A 3ULVE 2DB8A 3ZE1F 5CEYA 32C2B 4ELKB 1X6LA 4H20L 1A14H 5IFAL 3W0WB 3JTSB 1LEKA 1QBLH 2Q6WA 1UM6H 1XR9A 3RY4A 2HT2C 4KJYA 3H0TA 5GRZA 4JVWA 1T2QH 3PGCB 4PJEF 4F58H 3NZ8B 3L3JA 1MF2L 2PYFA 2H2SC 3MJ8B 4YO0B 4GS7C 3BI9X 3TN0C 1R5VA 4OB5H 4YBQC 4YHKL 1YEEH 2YPVL 5KVFH 3BW9B 5IUSA 4JO3L 4JHZA 5DMGC 1X6NA 1F3JB 3HE7D 5F7UA 4L4TE 1DBJL 5EU7C 5EZJB 2XWTB 2X4NB 3T0VA 2A6KA 1UEYA 4AEHH 1WZ1L 5DD1H 4Y16D 5KS9A 4HKZB 2O61A 2A73A 4CN4A 4XCYB 2IPUG 2Q20A 4JM2C 1ADQL 1I1AB 3VXOA 5L6YL 3KYMB 5IJVB 2EXYD 4S1QL 2GEEA 3DX9B 4P49A 3UJTH 3Q0HA 1IQDB 3MA9L 4YHYB 2CLVB 5IFHL 1YEDA 3QUYD 1WISA 5D7JC 3GSWA 1TVBA 2OP4H 2WLZA 2YK1L 1A3RH 4CW1A 3CXHK 4JCLA 3LEXA 4GW1A 2FBJH 4OCXH 1JTOA 1VGEL 3TZVC 1UB5B 4ZTOL 1JYVA 2H2PC 2DAVA 4MXQD 2DMBA 3QCUL 5TQ2H 3UZEA 2Z91B 4G8GE 1DDHB 1GIGH 4H26A 2YHGA 2V5YA 1U8KA 4PJ9B 3QDGE 2E6JA 2PXYA 5KSVA 1KLGA 4K7FB 1J1OL 3WLBA 2H26A 2X6MA 2I24N 4JQVA 4M7LL 3QSKB 3AXLB 4MWFB 4NN5C 3E6HA 3U0PB 5E2JA 3VRLF 2GY7B 1XF2A 3QPXH 4JDVB 1E0OB 2P4AB 4RWHA 2HLAA 2OSLA 2OQJA 2BVEA 3AMLA 1A6ZB 1I3GL 1KIQA 2MCPL 3WFCL 2IH1A 5EBWB 3QULB 2VOTA 2CKBH 4JHBA 1EK3A 4MQXD 3DRQA 4XP4L 4ZO7A 4IEFB 3KYKH 3LKQA 1MCSA 1FL6B 3LKOA 3TYFB 4I77H 4TVPL 4U6TA 3WFHA 1HYSD 4MXWH 3OKEB 4KXZI 4NQVA 2JTDA 1QRNB 3C60C 1ONQB 2DKMA 1IGFL 3JTTB 1IMHC 5D7LD 3B9KA 5JNYB 3QQ4B 4J1UB 3NA4A 1NCAH 2DYPB 1WVZA 2B4CL 3N0PB 5FB8B 1OAQH 1JGLH 3T0EB 1BZ9A 1I8KB 4KPHL 3C5JA 5DYOA 1HEZA 1JZ5A 4ZS6D 3LKNB 4MJIA 1RJYB 2FB4H 4XVUD 3CCHA 1MHHA 4WWKC 1W8OA 4P2RD 4PJDE 5K9QG 4OCSL 3H6JA 3UJIL 3E3QC 1A3LH 2CKBA 4U1KA 4HGWB 1JZ3A 4BFBD 3UTZA 4XH2B 1S9YA 2Q8AH 1DQJA 3MXWL 2K7PA 1MCFA 4ZS7L 1WWWX 3PL6A 5EU3B 4PRHB 1RZKC 1G0DA 3MRIB 3DXAE 4NDMB 4NBYB 3LQMA 3VG0L 2UY6A 5C0NC 1TJGH 1N5YH 2P1YA 1JRHI 2FIKA 3OKNB 4PGJA 1MFNA 1F00I 3JVGC 4OIBA 4GG6B 4NQDA 3U2SB 5AG8A 5KJRL 3QRGH 4RSVA 4RISL 3QUML 2FD6L 2HFGL 3DYPA 3HFML 5FKAB 2FECI 1D6VH 5C7XH 2DTML 1KPVB 4E42A 3T2NH 2QL1A 4ENEC 1IGMH 1YZZA 4XP6L 1NC2B 4RA3A 4MD5A 3FL7A 3VXSE 2I9LB 3CLEH 4E41D 5CCKL 4PJCA 4QGTA 4G9FE 3BIAX 4UQ3A 4HDIB 1F6AA 4MVBC 4XBEL 1R6VA 4FXLA 3GMQB 3VFOB 2CGRL 1PQZA 2NY6B 5F71A 3ZKND 3L1OH 4UOW1 2Y36L 4XC3H 3RVTD 1FAIL 5HHOE 1I1AC 1IAKA 3TJEH 3L3IB 1IEHA 4ZFOB 4KTYA 4GQPH 4XVSH 4TVPD 3EDJA 3VXTB 2Z93A 1UXSB 1OP3K 4YHYC 5B39B 5FOJA 4HHAB 4W6WB 2FO4B 3HE6C 3VE0B 4MD0B 5TH2B 5EO9B 1CL7L 2NY1D 3S3SA 2H8PB 2YEZA 4Z7UE 4RAUA 1JPTL 3T08A 1GL4B 1CD1B 3HRZA 4KUCD 2IANA 2VL5B 1FYTD 1FBIL 1H5BA 5JPMB 4YPGB 2Z9TA 4S11A 2IAMA 3ARDA 3CDGA 3V0AC 4A6YB 1CDBA 4JQIL 3U7YH 3VWKA 2EDEA 1LO4L 4PJ9C 4ODVL 4P2CG 4HWNA 3H9HB 4YHML 4DUXA 4X6CA 5CMAB 4HKBB 3HA0A 5GGTL 1LQSR 3DX7A 2PW1B 1NFIB 2H32B 5C0CB 1FH5H 1W0VA 4JHWH 4J3UA 3VRJB 4KAQL 3L3KB 4GAJH 5F3HA 5CLWA 4OM0L 1RJLA 5JW4R 5DRNA 4M3JA 5KS9E 1LHZA 1MFAH 3D9AH 3P40A 3H7LA 4BM7A 2Z4QA 3RZWA 3SGJA 5LWYL 2BNQB 3N1FC 1TZGL 3ILPA 2J4WL 4I0PA 4N8PA 5EU4A 2RB8A 1A7OH 1IT9L 5D72H 2PR4L 4HZLB 1TJIH 3V5DB 5BXFA 3ZKXB 4UI2A 1BVKB 3NCEB 2NY5H 1DQDL 4TOYH 1MCJA 3QFJE 5FUCC 2JJUA 1ZLWK 3SDYH 4J6RL 4QRPB 4DVBA 5B38B 3MROB 3HMXL 2HG5B 1QFOA 5K9KA 3MLTA 1DTUA 3H8NA 5DURB 3EDEA 1G7IA 2E9BA 4PRPA 3FT2B 4U1JA 1U6AL 2PTVA 4P59H 1AR2A 2OM5A 3G5YB 4LVHB 2QQLL 3QUYC 4Y4KA 2F5BH 5IVXA 3IFLL 4X6BA 2RFXA 5CILH 1ZGLM 2DWDA 4LLUA 5DJZB 5E6IA 4KDTC 4NBZB 2XFXB 4LSVL 3LIZH 2ARWA 5D93B 5LBSL 3FQNA 5KBNC 3MREB 4L5FH 3ALXA 4EJ1C 3RTQA 2P45B 3G6DL 5T5NF 2WBJC 1U2HA 5DRWA 1L7TL 4OFPA 4FQHB 3EOTL 4OF8A 5FUZL 4CAGA 5I15L 3F7YB 3TCLA 5KOVC 5DQDH 1NCDL 4YPJA 4HIIB 1HYRC 3AROA 4PRDB 3WHE0 1GRWA 4JM2F 1U9KA 1J1PH 4QXTB 5T1LD 1ND0A 1MUJB 2W9EH 4L4VB 1AH1A 4I3SL 1GOFA 3KPLA 2CDEA 3M45A 4LNVA 4PJFA 1P7KB 4P9HL 1KYOJ 2AW2A 5HI5C 3MPCA 2CLRB 1UACH 4QTIH 5EPMB 4G6MH 4OKVA 5FDYA 1U8PA 4F33A 5GS1A 4JN2B 4U2ZA 3Q5OA 4H88L 2R2EB 3VFWA 4YHNA 1N2RA 4P3DA 1CICC 1WAAA 3MRDA 4GKOA 4BUHA 4L8CA 5KG9B 3SKJH 4XHJD 1U3HA 5J0BA 2Y4SA 3L5WB 4LSPL 1KEGL 1HNFA 5I9QB 2IF7A 3PNWB 4W6YB 1ES0A 2Y6SC 4ZFGH 3BGFC 1XH3B 4U6HB 1R0AH 1YECL 1CLYL 4ZYKA 4D9RD 3SE4A 2ZPKL 3O6LH 5FKPB 3N50A 5CGYD 3QUKA 2C4FT 1U42A 1WWBX 4TULL 3GBNH 4OFDA 1EFQA 4JAMA 3O6KL 3QQNA 3VD3A 2A0LD 3C87A 3GMLB 4LBEA 3VXQA 2YMXH 4APQA 2X4OA 4TPRH 2E9WA 3IDNB 4WFEE 3S88L 5T3ZL 4I9WE 1U8JB 3NCJL 3C2AL 4BKLA 4MA3B 3EO9H 1PDKA 3HI6L 4NQDE 3U46B 3OPZL 4JFOA 4QRSA 5D1QD 3M17B 1KENH 1IZKA 5GISL 3PQYA 1QD0A 3KPOA 4HPYH 4RZCB 4WDIA 3UC0H 1WIUA 3WNMA 4LDEB 1REIA 1NDGB 2XKNA 3P0GB 3F8UB 1X5ZA 2DQGL 4NNPH 2ZOLB 1PEZA 4AQ1B 5SWQA 4JFHE 3GB7B 4KY1H 1PKQB 5ENWA 2OR8A 2F9BT 3TT1H 2VIRB 2AEQH 2DQTH 5HI3D 1KJ2H 2NX5B 4OIAA 4PJCE 2PTTB 4R0LC 2BC4A 4KQ4L 5D2NB 1CR9L 5D7SH 3PWLA 1CZ8L 2Q3ZA 1FNFA 3MBED 3N1QC 4CBPA 5IGXL 5T1MA 2UZXB 1DEEA 2GTWA 1C12A 2FJGA 2DQIH 1FL5B 2RIKA 5MI0B 1YJDL 5CSGA 4KDWA 5GGVY 2DQFB 2UV3A 1U93A 4LSSH 1J5OL 3G6AA 4K3GA 1BIIA 2J8OA 1K4CB 3OAUL 4O2FB 4HV8B 4HWBH 5EC2A 1U91A 2BDNL 2GTZB 3PABB 4JFPB 2B8OT 3IU3A 4PLOB 4M1DL 4J2XA 2XRAL 3PWUB 4KJQD 2XTLA 1LEGA 4NM4L 3ZDXF 3AUVA 1KJ2A 2YD1A 1GGCL 2IANE 1MRFH 4AEEA 4BZ1L 3F7VA 5LCVH 2IH3A 4P5TA 3VJ6A 4F57L 2Z31C 2AJ3A 4TNWK 2CRYA 3WE6A 1KLUA 2HKHH 1M6OA 4Q9RL 2QHLA 1BBJB 5F89B 1Q9WA 2DJUA 2OJZH 4DGIH 3QHFH 1VKXB 1HINH 4LHUG 5ISZA 4X6CE 4YE4L 2HRPH 1YY8A 5T3ZD 5K9QI 3WIFA 4ODTH 1UJ3B 1T7XA 2B4CC 3EJZD 5LQBL 3OMZA 4X83A 1S7TB 1UQSB 3STBA 4DOHB 3ARBA 3DETD 43CAA 3S36L 4HWBA 5IB5A 4XPHH 2CRZA 2FR4A 2WV3A 5CJQL 3JV0A 3QWQB 1E27B 3BMWA 3VXUA 4JDTH 5EO1A 3T77A 2R2BB 4EN3D 2ZNXA 3E1F1 5HXMA 1AJ7L 1YPZB 1ETZB 3I6LE 1SYVA 3MRBA 5DMKB 2GT9A 2AJSL 3N9GL 3C6LA 1AXSA 4YHZL 5I18H 3ARTA 3T1WA 4OIIL 5FAAA 3ZSTA 1ZT1B 3BRFA 3G04A 3S9DB 3MODH 1R3LA 3HR5A 3KYNA 4PG2A 4TSAH 5KN5B 1MCIA 1FQ9C 4NM8H 2JJSA 1MELA 3T0BA 5I9QC 4PRPE 5F88A 1E4JA 5L8KB 3UO1L 5D1XD 2VLMD 2VQ1A 1T0NA 2OTWA 3D2UD 1JNJA 4GRLD 1FPTH 5IVXE 3OKMA 3OAZK 5F7WC 4M03A 5CP3H 5H37H 1MCNA 2J7LA 2EE3A 4OGYL 3B6SA 2AV1B 3G5VB 4UINL 5GJSL 3V5HA 3NCYS 5CHNA 3PJSB 4BUGA 4FZ8L 2EEAA 3MLUL 4QWWD 1HILB 2M2DA 4JFXB 4HS3A 5TE7L 2P5WD 5IB4B 3LS4L 1BQUA 2VDML 3VFVB 1EHNA 4M1GL 1UB6B 2VXUL 4PJFE 3LPFA 5GRYA 4OLVL 2XI9A 1A9EA 3QG6A 1B6DA 1QA9B 3HMWH 5KW9L 1P6FA 2J8UF 5FO7B 5IG7B 3WXWH 1CYGA 4N5UA 2X1PA 1WAAE 1RK0A 5CP3A 3U6RB 3KPRD 2FRGP 4HK0B 3B9EA 1RUPH 3AC0A 5E5UB 2DLTA 3T8XA 1NUGA 1WBYB 4HUUA 4UT9L 4WJ5B 4ZDHB 1OL0A 1YMMB 3X13B 4UAOB 3O2WL 3CVHB 5EFIA 5CGTA 5MI0C 1IAIH 2ADIB 2FHCA 4JEGB 2EYSB 5FCUH 2GSIB 2YD2A 2APBA 3C8KB 1IL1A 1CD8A 2WUCL 1IC7L 2A1WH 4H25A 5B3JE 2P49B 3W81A 4Z0XA 2A6DB 1EH9A 5F7HA 3IJYA 4UU9B 4YEFA 2VDPL 4PIRF 1S5IH 4XHJC 3QUXC 1L9MA 5IHLB 4DVRH 5BZDB 2ZKHH 3VWJC 3KPMA 1LDPH 4NN7C 1A3QA 2AJYH 3P4LA 3GIVB 1ZVHA 4OV6F 2PF6A 1VPOH 4WHCA 3L3HB 1TZHA 1V7MH 2R39A 3MGOA 1JHTA 3NAAH 5TE4L 4X4MA 5DEZA 1OAZL 3U0WH 3HN3A 3S4SB 4KMQA 5F93C 4OAWB 1L6XA 2AK4D 4HUWB 3BZFB 3WXVH 5JW5A 3MYJA 4PJ5A 3B2UD 4N0UB 5HDBF 2I5YL 4P46B 4KWUA 1CG9B 3ZDZE 2O5YH 4HG4J 2VYRE 3WUWA 5I8OL 4NO2A 4I0KA 4JKWA 3QIUA 4K8RL 5AG9A 5E1AA 3ZDYE 1S9WB 2LE9A 4OI7A 1LO0L 1AQKL 5E00B 3RZCA 4HXBH 1A8JH 1KBGH 3MMEB 1A2YB 4N1HB 4NWUL 3KLHC 5E6YA 2APWA 5IMMA 4CKVX 4Y4FD 1C16B 3QIBA 2MNUA 5A16B 5FF6B 5F9JB 5HYQB 3BHBA 4AM0A 1RK1B 5E0QA 1EJ6A 1QHOA 1C1EH 5SWZB 3SE3A 3MNZB 5DRXA 3PXJA 3OXSA 4ODWB 3INUH 2C3WA 4NC2B 1CFTB 5KAQG 1Q9LB 2EKSB 5KZCD 2CJUH 1KC5L 3ES6B 3RWHA 1G9EA 4XI5D 1UEMA 5TE6H 1GHFL 2VISB 4IM8A 1IGTB 2BNRB 1AR1D 1F3DJ 1MLCB 4P9HC 3GSRB 1RUKL 4R7NA 1MI5D 3D0VB 4JO4L 2B0SL 3BVNA 2AGJL 5HGBB 4WEUD 2VLKA 3MUZ1 3MRPB 3EFDH 5F9AC 2NW3A 4WTXA 4NZJA 1CXFA 4FQ1L 2DQUH 5IHBA 1AI1H 4LLQA 3O9WA 1I3RB 4MNQA 2OK0L 3IKCA 3MCLH 1E6OL 3TN0A 4LLYB 1BQLH 1SJVA 4OFVA 4YX2H 1GYAA 1YEFH 2Q86A 3QNXA 3E8UL 4NQSB 3VXUE 2DD8L 3U4BL 4N0CC 3BZEB 4RGOH 5HYJA 4OBRA 1QO3B 1I7ZB 3QQ3B 1Z0NA 2P43B 2Y5TB 1P4IH 2JJTC 5SX4I 2EDXA 5D6CB 4XXDB 1TITA 1ZS8B 5DJ6A 3WLWD 3BZDA 3ARED 5I8EB 1ED3A 4GRMA 4NHUA 3DYMA 4FQXA 5JW4Q 5DMIL 2YBRB 4NJAL 4K8RD 4JPKL 5EC1A 4P23D 4BSVA 2B2XH 4GQ9H 3MRKB 3MRRA 3BP7A 3V6ZA 1BFVL 1N7ML 4JR9H 4JN1L 5IMOB 4JFFD 2J88H 5C0BD 3CU7A 3ARXA 3BKCL 1DQLL 2JB6A 1NGXA 4AZ8A 4N8VA 4NQED 3FB8B 5FDWB 1CGXA 5FV2A 5C09D 4UT6H 1LO2H 5I1HH 1H3PH 2BFVL 4JKPL 2E7CA 3QISA 4JJ5B 3JV4A 1G7QA 1JK8A 3BSZH 4X6FB 4HJJL 1DSFH 4JZNA 3QAZB 4C55A 5LG1A 1ZA6A 1QSEB 3MV7A 3TJHD 4J3WA 5D5MB 5CJOL 5I66A 1SY6H 1W0YT 4XWOC 4U1HA 4PJ8C 5ICZB 1BP3B 3LN5A 3TV3H 1FJ1A 3RNQB 1MVUB 2Q8BL 2FEDD 4WI8A 4I8DA 1EJOL 5DVKA 3TT3H 4PLKD 2XPGB 4ONHB 1KIRA 3GBML 1NPUA 3MUGB 1FVDB 3PWPB 4KKBC 3FCTB 4NGHH 3U4EA 4KHXH 4P4RB 2X4RB 4P46C 1A1OA 4Z8FH 1LO5B 4L8DB 5I1JL 1L7IL 3PDDA 5DJYA 3RWDA 5DJ0A 2X05A 3Q3GA 1RZKH 4OZIE 1KCVH 4M9PA 1KJ3L 4Z7WB 5I16A 3CMOH 4DN3L 1SY6A 3BPNB 1XCTA 4X8XA 4HS6B 3EYOA 1S78D 1MWAL 4MAYB 3O6MH 3LS5H 3P4NA 2BVPB 3O0RH 3ARFB 4UDUB 5ADPL 4RGMC 4FA8A 2NY3D 4IMLA 5DZLA 3GSNL 4NHCL 5ACZA 3CLFL 5J7CC 1CCZA 1BX2B 4B5EA 4LCYB 1YNLL 4WWKA 1ZANH 1MCEA 1Y6NR 2ICCA 1VDGA 2R0KH 5DJXB 4Y19D 1M4KA 3DROB 2QHRL 5D71H 3WHE1 1YUHB 2E8ZA 5F72S 1IGYB 2ZCHH 32C2A 4ELKA 3O4LB 4PREB 2AABL 1CLOL 4X4ME 1T1YA 1CU4H 4NKIL 1JPGB 3JTSA 2P8LB 3EYUH 4ERSH 5JIHA 1CXLA 1VFBB 1QFWI 3IDIB 3NZ8A 3JVGA 4IDJL 1DR9A 4JB9H 4PJ5E 2WZPD 3MJ8A 4YO0A 4JKKA 4U6YA 4XTRD 4LCWB 2R9HC 1J8HB 1YEKL 3LN4B 3W2DL 4QHUB 1IAOB 3KWWB 1EAPB 5IJKA 1V3KA 1G7MB 1C5BH 1B3JA 4PTUB 4LLVB 4GMTH 1RUQH 5EZJA 5J1SC 2XWTA 2KDGA 1FV1B 2X4NA 1KCLA 4JKMA 4QCIB 3S5LA 1Q9OB 1XZ0B 4EI5D 12E8H 4KU1A 5CEZL 3MV9B 4HKZA 3GMPB 4U31A 1KCUH 2EYRB 4XCYA 1U8LB 4HMCA 4HQQL 4OD2B 5IW1B 5IJVA 4YBLB 3TBSA 2VXVH 1Q8MA 3RWGB 3WL9B 1OF2B 1BQHA 1IQDA 5EA0H 3TWCH 5C86A 1FG9C 2CLVA 4KI5C 3JWDL 3BPOB 1XF1A 4FFYL 1HIMH 3RA7L 3QDMB 4RIRB 3T3PF 4LCIL 3TFKD 3MLWH 4J4PC 1UB5A 5IT2L 3HKFA 5HDOA 4B53A 3BQUD 2LVEA 2VLKE 5JZ7D 5E7FA 2Z91A 1UCBH 2SEBB 3KS0J 1FDLL 1DDHA 4XCNB 3FT4B 5EOTB 5F3BB 4PJBE 1XF3A 4PJ9A 4CU6A 3TLRA 3RIFF 4V1DB 3CH1B 1VFOA 3VI4E 3ELAT 4K7FA 1XIWB 3NIGF 4XC1H 3CSYB 1CE1L 3AXLA 4MWFA 3OKLA 2B7DT 4NPYA 4Y1AD 1MRDH 4PP1D 4ODBD 2JE8A 5HYJE 3U0PA 1BM3L 4ODSL 4XP9L 1YPZF 4JDVA 2LTQC 2K3TA 1A6ZA 1UFUA 1IGCH 2GCYA 5EBWA 3QULA 1GAFL 3LRSB 2XTJD 4PY7A 4PS4L 4XMPL 1FL6A 3TYFA 3BGMB 3D6GA 1MSPA 2V5MA 4N0YH 4QHKJ 1Y6MR 1NAKH 3OKEA 3BPNC 5CEZD 4IBLT 1BOYA 3IJSB 1ONQA 2YN5A 3HTLX 3JTTA 4S1SH 5ALCL 5D2LB 2AK1L 5JNYA 4XNXL 3RDTD 4GXUN 2DLGA 3ARFC 2DYPA 3ET9F 3SOBL 3PWVB 3TNMB 3T0EA 1I8KA 3MGAA 3QHZH 1JWUB 3LKNA 1UA6L 1RJYA 4XCFH 4P4KB 1FFOB 5CUSL 2H9GB 3A67H 3UMTA 5EUOF 4IMKC 3LQAL 1MNUL 1FN4A 4O51B 1FFPB 3HPJB 4PJ7B 4HGWA 3S36X 5JIPA 4XH2A 3UTQA 3HZMA 3MRJA 3O3DB 4KDTA 2UY7A 4NKMB 5EU3A 4I3RL 4PRHA 2JB5L 5I1CH 2OZ4L 1EMTL 3MRIA 5MEQB 3CPLA 1KB5B 3IDYC 2FGZA 2MQCA 3UX9B 2VQUA 3FQXB 1Z9LA 3RBGA 3GRWH 1X7QA 3OKNA 5C08B 4LARH 4GG6A 4J8RB 1DUZA 3U2SA 3UYRH 2HTLC 5GRWA 3MV11 4KRPB 2LFGA 3TJHC 5JR1H 4HPOH 1NAML 2IPKB 2OL3L 5EH1A 1U8OA 3UTOA 3IFNL 4EVNB 4LPCA 3SO3B 5IHUH 2VC2L 4K9EL 4LRIC 3MRNA 4E0RB 5SWSB 3VXMB 5L2KA 1NC2A 4RCAA 2EDTA 2I9LA 2FEEI 4Y2DB 4NQUA 4H0IA 1LK3H 4HDIA 4X9HA 4YIQB 5TPWH 5DXWA 3VFOA 3GSUA 4DFHA 3MX0A 1AC6A 2X89A 4M7LT 4U1GC 3BFOA 4XMLH 2ZG2A 1IKNC 3GM8A 3SDAA 2RHEA 3G6JB 5KSAC 1OAKL 3GRWA 4JANA 4YBLC 1YDPB 4OGXH 3L3IA 4ZFOA 1F45A 4X80H 4DAGH 3VXTA 4XCCH 5FYKL 1UXSA 1T03H 2H32H 4HHAA 2R29L 3RKPA 1HH6B 3BPOC 1KTRL 3QWRD 4JFQB 2FO4A 5K93A 2CLZB 5TDOA 3VE0A 4MD0A 5TH2A 4B50A 1CQYA 1X4YA 2OX5A 5EO9A 4ZAKD 1OP3H 3HPLB 1ZWIA 5ILTH 1UM5L 2H8PA 5A1AA 4KXZH 3QXAB 3OF6A 3ZDXE 5HGAB 2Q7YB 3LEVL 1MCBA 4UTAL 1CD1A 3S6CA 2YS4A 2VL5A 1YEGH 5BV7H 5ALBH 1E4XL 1NUFA 3HRPA 1EERB 2CK0L 1UH3A 4KTDL 4ZD3H 1JYXA 1X5JA 2CO6B 2Y06H 4A6YA 5I1EL 4XB7A 5HVGB 1BJMA 2VLRB 4BQCA 1X5XA 1RQ5A 4QHLB 3H9HA 4ODUB 1B6UA 2W38A 4K3DH 1XIWC 4LF3B 4U1LB 5C6TH 3CFDA 2PW1A 3ESVF 3NFSL 2H32A 5C0CA 2X44D 5DC4B 3VRJA 5GSVB 3L3KA 4JG0H 1A7NL 3NA9L 2FGWL 1Z2KA 3OTTA 4U3CA 2ORBH 4NUJA 3RU8H 2W91A 2FBOJ 3QEHB 4NC1E 3V0VB 3WMSA 5TF1L 3FN3A 4XTRC 5IESL 4XGZB 1INDL 3L3DB 2BNQA 1JRHH 3QRFM 1GGUA 2EO1A 5I0DA 5HI4C 3ECBB 4YDKL 2Z35B 1MFCL 1UZ8B 5GRUL 4YWGL 4FTVD 3V5DA 4Z7QE 3SHSA 2A9MH 3EYVB 3IXAB 4P2OD 1BVKA 1OGAD 2BRRH 5L88H 4OCRL 3C8HA 1S7VB 4QRPA 5B38A 3MROA 5LAXB 2DKSA 1MAML 2HLFC 4D0CB 2HG5A 4LK4A 4X4YB 1QP1A 2CMRH 3V5KB 2PYED 3FT2A 3QEQD 1AGEA 1IBGL 5FYKD 1ZLWH 4MCZA 4P4KC 1RURL 5CZXC 1UWEL 3HNVH 3G5YA 5DO2D 1A6TB 4HAGA 4TUKL 3PDOA 3NH7L 1FGNL 1G84A 2F54D 3X12B 4HWEH 2BSSB 1I7RB 5DJZA 2X4PB 5AEAA 5DUPL 5C0RH 4QT5A 2XFXA 3LZFL 4JM4H 3MREA 1DFBL 5T1KD 1INEH 5CJXA 5GS2D 5BCAA 4FQHA 3F7YA 4YEEA 5EZOL 4FOMA 3TC9A 2X4SA 3ISWA 4S0TD 1A4JA 1F11B 4PRDA 4XVTH 4PB0H 1I8MB 1F4WL 3IRPX 1UT9A 1OT2A 4QXTA 2KQMA 3FOMB 1JNHB 1MUJA 4KRPC 4L4VA 5F9DC 3GI8H 3WNNA 5C0AB 5IM7B 4DQOH 4JY5L 4YFDB 1ZLVK 1KV3A 3SO3C 1EAJA 4D94A 1P7KA 1B4JH 4OI8A 4KI5F 4FABL 1TETL 5EPMA 3HZYB 3WHXB 4JN2A 2R2EA 2WMPA 3JWOH 5I8KL 3K80A 4PRNB 4Z78B 3T0DA 5KG9A 1MHPH 5B21A 3L5WA 4YAQA 2ZUYA 3T0EE 4P2RB 4Z7VF 1FNSH 3PNWA 1U2CA 5DT1H 1XH3A 4RNRB 5DMJB 4U6HA 3WFDL 5D96B 3RGVD 3AAZB 1X5LA 3NZHL 2C7UB 1LO3L 1P7QD 4R97B 1JWSA 3T65A 5HGGS 2PNDA 2IBBA 1WFNA 5D5MF 3GMLA 4NQCE 2CRIA 1NMAL 3S34L 2IQ9L 5B8CC 1NKOA 2O5XL 2BVYA 5FYLH 1GC1C 1ITCA 1HHJB 3IDNA 1MH5B 2EDHA 4PRHE 1LP9F 4MNHA 5BS0D 4FFZH 1T5WB 5DHXB 4LKXB 2YZ1A 1U8JA 4MJ2A 4MA3A 4GG6E 3U46A 1F02I 5DR5L 3M17A 2ESVA 2G9HB 3I3EA 4RZCA 5C0DB 2Z92B 2QADC 4POZC 5GGRY 4U2YA 2GJ6E 1AP2B 2ZOLA 4K7PH 4OCYH 4C4KO 1RHHB 3GB7A 5L2KE 1PKQA 2VLJD 2J12B 2VIRA 1WCQA 1ORQA 5GRJH 2F74A 2NX5A 2PTTA 5D2NA 3OR6B 2R15A 4GKZB 5F1NB 2DM4A 1W0WB 2AJVL 3NCYP 4HMEA 1NH6A 4X6DB 1OSZB 5E8EB 4R4BA 1UYWL 5F1KC 4HH9B 1O7SA 1ODAA 1F2XK 1FL5A 1OLLA 4F37K 5FGRA 1Q72H 2DQFA 2V17L 5F9OL 4P3WA 5ITFB 3SDXE 3P30H 4M1CC 2P44B 2NY1B 3D5OF 3FN0H 1T83C 1K4CA 4EZMA 1RZ8B 1JV5B 5EN2B 4UNVA 4O2FA 1HXYB 4HV8A 1N6UA 5IW6A 2GTZA 3PABA 4JFPA 4AIZB 5DA0B 4KUZH 2VZ3A 2KH2B 3BKYL 4UILH 1KPUB 5FGCE 4WTZG 4WEMB 5J11C 4CMMB 3BH8B 4ZOAA 1DJSA 4PGZA 2NYYD 1EFXD 1HDMB 2AERT 4YC2C 3QCVL 1P1ZB 4V2CB 1S7RB 3P11H 3OJ2C 2DQHL 3V4VH 1BBJA 5F89A 2J8HA 3ZL4H 3O6FC 1VKXA 3GNML 1OCWL 1PJ9A 2O26U 4PB9H 1EO7A 3DGGB 3BAEL 2DQEH 5BMFL 3F65A 4TTGA 1WZMA 5E1HB 1UJ3A 5C0CE 3GIZL 1FORH 1MVFA 4ZXBD 4D3CL 2G75A 4TRPL 1S7TA 3U1SH 1UKTA 3BT2L 1FZKB 1UZ6E 1KYOK 4KZEL 2NY4D 3B43A 2V7NB 5ESQA 2BNQE 5E9DD 4WY7H 4UV7L 3KPPB 2R2BA 4NSKA 5L7XH 3BN9C 3WFEH 4NBXB 1ETZA 3KXFB 1QBMH 5EU5B 5DMKA 3ULUC 4O4YL 1HZHL 4PY8J 4FXKB 5DD3H 5ETUB 2N4IA 2UVEA 2FLRT 1W72B 1ZT1A 3MRFB 1HOCB 4ODHH 1VACB 4L3AA 1FRGL 5KN5A 4QRPE 5IB2B 4H8WC 1NGPH 5LGJB 4WVRA 4BFEA 3OB8A 4YGAB 1J7VR 5A2FA 3BIBX 2NZIA 4YZFF 1WTGT 4K9EC 2DQJL 3V4PH 1WC7B 2YPKB 4LIQH 3D3VD 5D96C 4G8GD 4WUUB 2GJZA 1HKLL 3O41B 1I9RH 3P4OA 5D1ZD 3LVEA 4HCRL 4WNQB 5BRZD 1B0RB 3VXRD 4OFYA 1MQ8A 3FMGL 2YD7A 2XWBB 2AV1A 3G5VA 3DUUB 4EQ2A 4OZGE 3FQWB 2BHZA 1CLZL 3PJSA 1QR1A 1A5FL 4MA8H 4Q2ZA 1AHWB 2APTA 1H3TA 4JFXA 1YQ2A 1QKZL 2IQAB 1KXVC 1G1YA 3QBTB 5IB4A 3TBYB 3VG9B 2NXYB 2R56H 3VFVA 4HLZG 1ZT7B 1UB6A 3DTXB 3O4OB 2UYLA 4JE4B 3VGBA 4LAJH 5L9DL 3F7RA 2VO5A 2W0PA 1QA9A 1BGXL 3QUZD 5J57B 3W82A 1T7ZA 5FO7A 5IG7A 2A6JB 1OW0C 4KV5E 4S1RL 4HXAL 3U6RA 1F8TL 3LCYA 2IPTH 2FATL 4DTGL 2C9AA 1D5IL 3WNOA 1WBYA 4WJ5A 4YHLH 4ZDHA 1YMMA 5T1DH 3X13A 5C70A 4FQJL 4EDWL 3CVHA 1FC2D 4G3YH 4UB0L 1F42A 1LD9B 2EYSA 3FFDB 1QFHA 4CNIB 2GSIA 4PP2B 5HHVL 3C8KA 5IVOA 1BF2A 4KVCL 4HBQA 4LGPB 2FH6A 2A6DA 1A7QL 4UU9A 4HJ0D 4G6JL 5EOQL 2C1PA 1I1RA 2Y1VA 3V0WL 3QH3B 3IT8D 5BZDA 2XXMB 1KB9J 4R2GD 1KGCD 1BBDL 1J1XH 1TNNA 5DTFA 2ESVE 3L3HA 2HP4A 1G9MC 1FNHA 5ID0B 1F6LL 1T4KB 1R3KA 3NIDE 2WWKT 4OAWA 5DDHA 2GITB 3QDGB 2R23B 4HUWA 1OP5K 3BZFA 5C2UB 3MGTB 1NCBH 1PKQE 1T2QL 3PGFL 4F58L 4CUCA 3T4AB 4N0UA 4TVSa 2F8VA 4P46A 1J9CT 1D5ZB 1CG9A 4DEPB 2NTFB 5D2NE 5JDJA 5FYLE 4E5XB 4FQIL 2BP3A 2V5TA 4OB5L 5DFTA 1YEEL 5KVFL 2D2OA 1S9WA 3C5ZC 4CDGC 3OB0K 5E00A 3G6JF 3MMEA 1A2YA 2QSVA 2CH8A 4ZNCD 1N59A 4WO4A 1C16A 3OZ9L 3LEYH 5A16A 2N7AA 4AEHL 4R7DB 3NFNB 5F9JA 5HYQA 3QIWD 5DD1L 1RK1A 4L8SB 2EDYA 1WGOA 2V2XB 5SWZA 2EDRA 3MNZA 4ODWA 3K4ZA 3IF1A 1CFTA 2XKUA 3IFPB 1Q9LA 2EKSA 3ES6A 1PBYA 5I2IB 5HYSG 1EUUA 4M5ZH 3B3IB 3QNYB 4EUPG 3OQ3B 2VISA 3T4YB 1IGTA 4OQTH 3U83A 2BNRA 1MLCA 1T66D 2OP4L 3LKPB 2EICA 3BEWB 1A3RL 4ORGB 4Z7OF 3D0VA 2V6HA 1J10A 5HGBA 2HJLB 1I9JH 1FL3B 2XACC 5DGQA 1IVLA 2W65A 1K5NB 5TQ2L 2R0LL 3MRPA 1RHFA 3ULVC 1IEBB 3QR2A 4JRYA 4HW6A 3UYPA 1I3RA 4MLSA 2HTKC 1GIGL 4OLUH 4HK3J 3MLSH 1OHQA 4P5MB 1AHWC 4ZPTB 1XF5B 3EAKA 2QQKH 3RVUD 4NQSA 1RULL 2FL5B 3BZEA 2EH8H 1SM3H 3VG9C 2NXYC 4B0MM 2AJXH 1QO3A 3KHQA 1CLCA 5JXEC 1I7ZA 3BPLC 3O4OC 4HIEA 3QQ3A 5HPOA 2Y5TA 2R8SL 2EYTA 4XXDA 5D6CA 5DC0A 1VGKB 1ZS8A 1I8LC 5E2UH 3TPKA 2XZQH 1X3DA 1E4WH 4MAUL 3VXSB 2YBRA 1BIHA 3MRKA 2CKBL 4JPWH 2W60B 5IMOA 1V7NH 2D0GA 4OZFB 3KYKL 3ARGA 2P46B 3MJ9H 4YHIB 5IV2B 3D2UB 4TUJB 2GAZB 4GRLB 4I77L 4UBDC 1FC1A 4ONGH 5HHOB 5FDWA 3TO2B 1I1FB 4C58B 2ZSWB 2VE6B 4G6AC 4GXVL 4UT7L 4F7TA 1C5CL 1WT5A 2ITDB 4ISVB 4JJ5A 5SX5K 2PXYD 4X6FA 2CIIB 3STZB 4F8TA 3RVXD 4R9HA 2FB4L 4I48B 3LMJL 4HUXA 1Y18A 2P5WB 4Z7UB 3VD4A 5D5MA 2ITCB 3N1MC 5TDNB 1D7FA 3EYSL 1I3UA 5ICZA 3QCTL 2Q8AL 3MJ9A 4HG4K 4JFYA 3DIFA 2FJHB 4RMVA 3EYQC 4LIQE 1WV7T 4KK8C 3ZTNL 4FFWD 2XPGA 4IRZH 3UEZA 4ONHA 3ULUF 7CGTA 1Z0MA 4JO1H 2X1WL 3KPRB 3MUGA 1FVDA 4IOIB 3MLVH 5D7IE 5IIEB 1B2WH 2WAHA 1QVOA 2X4RA 3GBLA 4P4RA 2X9YA 1JF6A 1MJJB 4QEGA 1FCCA 2BERA 3SE8H 3QRGL 3VI3F 3TH3T 1HCVA 1ZA3B 4PYGA 5JHLL 3KPQA 4WGVB 4WFFE 4WHDA 3BZ4B 4Z7WA 1IGML 1NC4A 2P5ED 3UZVB 1YMME 4IOFC 4W81A 2WK2A 3GO1L 2F8XC 3CLEL 4MJID 4HS6A 1QQDB 4MAYA 5M7QA 2WWMD 2BVPA 3ARFA 3MRQB 4L8SC 3SKNB 1DVFB 4C83B 5F1IB 5SX4H 3MOBL 4CW1B 4XC3L 5ICYB 1EX0A 1YYLH 5BW7C 1D5BB 4M6ML 3TJEL 4LCYA 4WI4A 3QFJB 1TNMA 4WFED 5TGBA 5DJXA 4XVSL 4YJZL 1D6EB 1YUHA 4M62H 3TVMA 1P9MC 4S1DC 4XNYH 1BEYH 4NC0B 3O4LA 4PREA 1D5XB 2AK4B 4LPUA 4XRCB 1FE8H 2MSPA 1JPGA 2ZP0T 3H9SB 1V8HA 5DQJB 5ID1A 2P8LA 5CINH 1RU9L 5AAMA 3IGAB 1G9NL 1VFBA 3IDIA 1WEJH 1RZJH 5FECB 4XWGL 1JNNL 2YD5A 4WCYH 2X41A 3GK8L 4LCCC 4AJ0A 1I85C 1BAFL 4DW2H 1JHKL 4JFHD 3MOQA 1P53A 4LCWA 1ZXQA 1IKFL 3K8KA 1J8HA 4JFEE 1RZ7H 4PGDB 3LN4A 3TPUB 3F5WB 1IM9A 2XG5A 4L8BB 4QHUA 1IAOA 3KWWA 1EAPA 4LRIA 2OQJB 3UP1A 1G7MA 5F9WB 2J1KA 2YN3A 1YMHB 4LLVA 3G9VA 4WFGD 2IH1B 1Q9OA 4GMSH 1XZ0A 1OY3B 1SEBB 3MLZH 3MV9A 3ARRA 3GMPA 4JFDD 5KZCB 5BOZG 2EYRA 1F58H 3JSSA 4GBXB 3D9AL 3SKOA 2NY0B 1EV2E 1IKNA 3T3ME 4OD2A 4FG6C 4Z18A 4PG9B 4NQVB 1QLEH 4HKJB 3RWGA 35C8L 1OF2A 3RPKA 2ED9A 1AE6H 1A7OL 3CGTA 5D72L 5AWNH 2CIKA 1TJIL 2BNRE 3Q6FB 3CZFB 1CQKA 4PJIA 3MRLB 4RIRA 4ZUVB 1Q1JL 2NY5L 3MV8D 1MHHB 2IAMD 1IE5A 3ARDD 1KLFA 1QHPA 3QIWC 4WEBH 5HYIA 1YC8A 3DMMD 3HI5H 3UTZB 3FJTA 2SEBA 1S9YB 2VSCA 3JUYA 4XCNA 4JRYE 3V7MA 2Z8SA 2XIDA 4OF7A 5DVNA 5EOTA 1D9KD 3ULSB 5I75B 3EOBB 4MCYA 2FCBA 3CK0L 3QXVA 1BFOB 3A6OA 4G8FB 1YQVH 5F1OB 3UTSD 3H42H 3CH1A 5A2JH 1NCCH 2DI8A 4KHTH 2I9TA 3D25B 1XIWA 4NWTL 5FXCH 1U95A 2FIKB 2F5BL 3Q6GH 5FFLA 2QLVB 5J06A 4FQPA 3GI9H 5C0GB 1NEZG 1ZOXA 3AREB 4G7VH 5IBLC 3CIQA 4KKAD 4P23B 5IBUG 4R96B 5DQDL 25C8L 1BZ7B 4JFFB 3MOAH 1J1PL 2EEDA 2W9EL 3LRSA 3RKDC 1P4BH 3ETBF 1PQZB 2F53B 1FGVH 5E8DL 5GZND 3MLXH 1UACL 1KB5H 4QTIL 4OGZA 1NL0L 3KPSA 1IAKB 4Z9KB 3IJSA 1RV6X 5IVZB 4PRPD 3PWJB 5BO1H 5D2LA 2PETA 3D39D 1GSMA 3LD8B 3GDBA 4O9HL 3RX5A 1VB9A 3TNMA 3PWVA 1UCTA 3FB6B 3TYGH 1DVFC 4Y4KD 1JWUA 1E4KA 4XB8A 4BSJA 3ULVF 1FFOA 1M1SA 3S37L 1QSFD 4ZFGL 5E6ID 5AZ2H 5I1AA 1R0AL 1ZEAH 4O51A 3EO1A 4GJTB 1FLTX 1J12A 1FFPA 5DI8B 3HPJA 4PJ7A 4RAUB 3RTQD 2H1PH 1H9VA 4F7EA 1ZLUK 2IANB 4ETQB 3GBNL 2EDNA 4DK3A 3O3DA 4FMKA 4X7SH 1YYMH 4NKMA 4BZYA 4HC1H 4TPRL 4ODXA 4OLZL 4BQ8A 1F2QA 5MEQA 5B22A 4R4ND 1KB5A 3LV3A 1HWGB 3V4UL 3FQXA 2OXHA 5GRVL 4YXKL 4BFIA 5C08A 3GUTB 1HHHB 4MMXC 3RVXC 4J8RA 4JQVC 3VMOA 5KVEH 4L3EB 3MXVL 3DX7B 5HVWA 1J88A 1KENL 4HPYL 3UC0L 2IPKA 3SGEI 4KK9C 2DQDH 2UUDK 1MJ8L 4E0RA 5SWSA 5F9WC 3HCVB 3KYOB 3VXMA 4Z7WE 4RBPK 1AD0A 5GSRB 4KY1L 4D0BA 4DGYL 5MERB 4I0PB 4Y2DA 3TT1L 1U58B 2DQTL 1TVDA 1TPXB 5DEFB 2FSEA 5C6PB 4GG8B 4XPFL 1INQA 2BOCA 2GY5A 2D7QA 1VFMA 4NZTH 4CN6A 2C1OB 2NY0C 2XZCH 4Y19B 2LU4A 4GKNB 1YDPA 2AEPH 3SY0B 1XCQB 5D7KE 3B9KC 5GRXG 5LVEA 1HH6A 1WBXB 5E24E 4LSSL 3MLTB 2V7HB 3WD5L 4JZJB 2CLZA 3O4LE 3WIIH 4NZUH 3MRHB 3OKDB 3AS3A 3HPLA 1MCRA 4XHQA 3T2QA 3PQYD 3QXAA 2Q7YA 1MJ7H 4AEIH 4YR6B 2YA2A 2RFXB 4MS8D 1T1ZB 1EEUA 3S3JA 2EDBA 3FQNB 3PL6C 5DK2B 4D8PB 2DMCA 2H3NB 3H3KA 4BQ6A 1NFKA 4QHLA 1KFAH 1S7XA 2OJZL 3FHQA 1FNLA 3K4AA 1MCOH 4DGIL 5JHDD 4MB3A 1HINL 1TTUA 4LF3A 4EI5B 5EZIH 1XR8B 4K3EH 4YLQT 1OTUD 2CDGB 4N5EC 4YHOL 2HMID 4ODTL 4AK1A 1JTTA 1P2CB 4S2SB 3BOVA 5KSUB 3VFTB 1LWRA 3MV9E 4XP5H 3QEHA 4H20H 5IFAH 3V0VA 1TLKA 5DUML 2CD0A 3O2DH 4XPHL 4XGZA 1G0YR 5IF0A 4U3XA 1U8PB 3WJJC 4JDTL 5BOPA 3GMMB 4P3DB 2Z35A 1UZ8A 1MWAB 5INCA 1Q0XH 5IBTL 5HPMB 1IC1A 2EDKA 2JELH 2YKLL 4BSWB 4X98B 3IXAA 1U8IB 2IC2A 1T83A 3DWTA 4PJIE 4QHMB 2DBLL 1IILE 4YHKH 2E9JA 3BQUB 5I18L 4P5TD 3DHJA 5INDB 4JO3H 4OCMC 1S7VA 3LB6D 5LAXA 4LMQI 4D0CA 3LD8C 4PJDF 3AM8C 5HYSB 3BP5B 4NZRL 4RQQB 4X4YA 3V5KA 3I9GH 5ISZD 2PUQT 1WZ1H 4APQB 2DJSA 2FHBA 3ULUH 4KQ3H 3O2DA 4WFHD 2X4TB 1A6TA 3AY4C 1ADQH 3O11B 3ARBD 3X12A 2E7BA 4HS8H 2BSSA 4S1QH 1I7RA 2X4PA 1H5BC 1H8SA 2FYYB 4QRSB 3MA9H 2V2TB 4LPXA 5FGBC 1EA9C 4IHOB 3VXUD 1HXMB 3VWKC 4RAVA 5F7EH 1YNKL 1G7JA 4S0SD 4PD4J 5C07B 2J6EH 1NMCB 1CXEA 1NMBH 3FONB 5ENWB 4ZTOH 1I8MA 1QSVA 4M7ZC 3J8F7 3C6LD 3FOMA 1JNHA 3QCUH 4KZDH 5C0AA 3V6OE 5IM7A 3PWLB 4UIKH 3WSQL 4TNVK 4O58L 4WI6A 3TO4D 3HZYA 3WHXA 1U36A 1ADQA 3RDTB 3CXDH 3KPSE 2XYCA 4I0PC 2GTWB 5D2LE 4Z78A 1J1OH 1JGDA 2FJGB 5F7MC 3ZLQC 4M7LH 1HWHB 2NLJB 3WIHH 3VU2A 4P2RA 1RUPL 3RX7A 1BIIB 2APXA 4YFLF 1II4E 4RNRA 2J6EA 4KJWD 1U91B 5E95B 3AAZA 5HD8C 3GGWB 1I3GH 5DVOA 4RGND 4PJ7E 2NZ9D 4URTB 1WFTA 4IRJB 3U48A 2MCPH 4M8QB 4Z7UF 5FCUL 3WFCH 1KJ2B 4G8EB 3VFUA 2A1WL 3VJ6B 3I85A 5I74B 2YD8A 1NANI 4KROC 1T5WA 4TVPH 1NLDH 5DWUH 4F9PC 4M7JL 1F3RB 3S96B 3HZVA 2ZWLT 5C08E 2ZKHL 2D7OA 4D9LH 1IGFH 2G9HA 1E4XI 3WIHA 5GS0C 1KEMH 1V7ML 3NAAL 5C0DA 3KJ6L 1SMOA 3U82B 4KPHH 4M6NH 4E41A 1AP2A 1RY7B 4JGJA 5KS9F 4PV9B 3VXME 2IBZX 2VL4A 3WXVL 5J13B 2EXWC 3T77B 3UJIH 1AGCB 3FO9B 1R5WB 2NCMA 3OR6A 4P3CH 2O5YL 4GKZA 4CJ0A 1UWXK 1SYVB 3MXWH 1W0WA 4ZS7H 3SQBA 2R1WB 2UWEB 1G9MH 1NQBA 2WLYA 4X6DA 3VXNB 1OSZA 3VG0H 5GS1C 4M43L 1FVEB 4HH9A 3G04B 3H3PH 4XZUB 1R3LB 1H8NA 3KYNB 2GYSA 4ZAKB 1U3HC 1RVFL 2A74B 5JXAL 3TH4T 3QUMH 4M5YL 2X2YA 3ZYOA 1RZ8A 5JW4M 1JV5A 2HFGH 1MCDA 1J05B 3I6KA 1C1EL 5EN2A