4LLUB

Structure of pertuzumab fab with light chain clambda at 2.16a
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
210
structure length
210
Chain Sequence
DIQMTQSPSSLSASVGDRVTITCKASQDVSIGVAWYQQKPGKAPKLLIYSASYRYTGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYYIYPYTFGQGTKVEIKGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords PERTUZUMAB FAB Heavy chain
publication title Generation of bispecific IgG antibodies by structure-based design of an orthogonal Fab interface.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 210
sequence length 210
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lluB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lluB01
1SJHB 1TZIA 1CFTB 1CICA 2DMKA 1MPAH 2FRGP 5KSBF 1S7VA 3L3DB 2Q87A 3S5LA 4N9GB 3SE3A 3L5WB 5DQ9A 1WBXB 4ZOAA 2R1XB 1YN6B 2LU3A 1FFQA 1GGTA 3D2UB 4M93C 3V4UL 2AABL 4K3EH 3BQUA 5FYLL 5T3ZL 4NT6A 4DGVH 4MNGB 2D4DA 1TQBB 3CLFL 4WHYG 3DX8A 1BQSA 2EDEA 3MRCA 4CDGC 4P5TB 3ARGB 4JPIA 1BFSA 1XZ0A 4M03A 4Y4KB 5I71B 3TWCH 5IMLB 4F2MB 3P73B 2JJSA 3GSNH 4H0HB 1X5IA 3QI9D 3JSSA 1DFBH 4IMKA 1XAUA 5C2BL 4N0YL 4JFYB 3UO1L 3TN0D 1INDH 2PTVA 5JW4R 3MXWL 4MNQE 2VZ3A 3C6LC 1HQRA 1EHAA 2GITB 4HQQH 3BX7C 1TVHB 5IFJB 5I2IB 4OI8A 2VUOA 1MOEA 5C07B 3GSUB 4YH6A 1AGBB 2F58L 2HJLB 2D7QA 2CLRA 4H0GA 3CK0L 4TN9A 5GGUA 5EU4B 4XP4L 4ALAL 2AP2A 1S7WA 4HPYH 3VXRB 4QRRB 5DS8B 4H88H 2FEEI 1OSPH 1KN2H 4NYLB 4MCYB 5EO1B 2E9JA 3VCLA 1OT2A 1HILA 3QPXL 1J88A 1NCCL 5KVFH 1FO0A 3FQNB 3U4BL 1L7TH 1DBKL 5E1HB 4XPBH 4U05A 4WW2A 2Z93A 4NQDA 4IRJA 3MJ9H 1BIIA 3T3ME 3SDAD 3MLPA 4S2SA 2CXKA 2IAMB 3MRQB 4PJXA 3E3QE 2R15A 2VJXA 5ICXB 4GMSL 4OGAD 1GGIH 1FL3B 2JIXB 4AENB 4XI5C 4EDXB 1RIUH 5DJ6A 2J5LC 3ULVD 4KK8C 3MRDB 3LD8C 1T1XB 3VDCA 5JXAL 2NY1C 4GQ9H 3TFKC 2VZVA 3G6DH 4UDUB 3MRBA 1YN7A 5M95B 4XP9L 2VXVH 3MRRA 1NCAL 1MH5B 3DHJA 1IVLA 2Q76B 5HHOE 4HS8H 4MJ4A 4M5YL 1JF1A 2HH0H 3G04B 2FECL 4HK3J 1BJ1J 4HPOH 1QFPA 4AM0A 1JPGA 2QQKL 4MJ2A 5HYJA 2DD8H 5DDHB 2BRRH 3WFDH 3ET9F 1YEJL 2ORBL 4PGEB 2UYLA 4J2XA 1PY9A 2OXGA 3O3EA 1YMMD 2F5BL 3X17A 5IGXL 3F5WA 1FC1A 3ZL4L 5JPNA 4QHUA 3CFDB 1EGJH 3FFCE 4HWBL 3TJEL 3BEVB 2HJFA 4OGYH 3FB7A 2HT4D 3CSYB 4LK4A 4K71B 2HTKD 4LSRL 5IVZB 3DBXB 5L2KD 5ISZA 1G7MA 2GTZA 2BNUB 5D1QA 2BVOA 4HGWA 1U8KB 2GT9B 5EU6D 1YECL 4C56B 4I2XE 2YMXL 3MRHA 4JRYB 4JM2D 1XCQA 1CLZH 2DMBA 5KSUB 4R90H 3FONA 3QWRA 1N8ZB 3HG1B 4X6DF 4LLMB 5DK0B 4RISL 1C5DA 2GAZB 4O5LH 3OKNB 4X98A 2X4TB 3L3HB 5IW6A 3MLRH 4PV9A 3L3KB 3RL1A 5DF0A 4NKQB 2G75A 2EECA 1BVKA 5DJ8B 4PJCF 4LPUA 4QHMB 3CUPA 4JG0L 2NX5E 3SGDH 4YC2B 2AJ3A 4JFXB 1QLRB 4O2FB 2PO6B 4CW1B 3HE6A 4TQEH 1J05B 5B38A 5F9OH 3BZEB 1CT8A 1OARH 3W0WE 3PQYE 1DN0B 4ENEC 1JFQL 3QIWD 4KPHH 2VLLA 3AS2A 4UOJA 2EE6A 2F74A 4WUUD 2O93L 5CEZE 1TNNA 3MX0A 2YD4A 3CXDH 3KPMA 5IHUH 5D1XC 5DMIL 3KGRA 4LLDB 3N1QC 1HKLL 1VGKA 3WE6A 4J4PA 3O3AB 1CFSB 3FB5A 5DVLA 4H25A 2EXYC 3MNZB 4LVNB 3MTRA 3KJ4C 3DUUA 3QH3A 3FQRB 3JZ7A 1QBLL 4S1SL 2X4OA 4OZFH 4P46B 1WAAE 1AHWC 3AREB 1V3LA 4QNPF 1ZVSA 4P9HL 5CBAA 3LY6A 1N64H 3QA3A 3B9DA 5A2KH 2UZIL 4PRHE 4M6OL 3G6AB 5LQBL 3NA9H 1FE8H 3VWJA 4C83A 4Z7NF 1A5FH 1CLYH 3OKEA 4JO1H 3E1F1 1HDMA 1ZMYA 5BRZB 2DYPB 5J3HC 3FO9B 1I1FB 4LP4A 4WW1A 3ZKND 3DX7A 5CILH 3UC0L 2E6JA 2YN5A 2FATL 1KCLA 1UYWL 3LSOA 3L5HA 4MGXA 3DJ9A 5HPOA 3U82B 1M7XA 3FRPG 1RHFA 25C8H 4P5MB 4UOW0 2PUQT 5C0IB 3FB8A 4HIJB 5FXCH 2Z92B 4BZYA 1RZ7H 5CZVH 1H3TA 2XWBB 4LHUB 5LGHL 4QWWC 4EOWH 1UCBL 1I8KB 4PY7B 2P45B 2NR6C 3BSZL 4JZJB 1RK0A 4KZEH 4JY5H 3AU1B 4TUOA 1F45A 35C8H 1OPGH 2DL2A 1MEXL 3ZDZF 4HIXL 2AK4E 1OTTD 3WUWA 2YPVH 2DLEA 4Z7VB 2DQGL 4UIKH 3QXAA 4N0UE 2X4QB 3SGDI 3FHQA 1SYVA 1IQWH 2B5IB 3TV3L 1L7IL 1S7QA 4YPJA 4PJ5B 3K1DA 3IKCA 4WCYL 4AIOA 3QDMA 5HHMB 1JZ5A 4JDZA 1XH3B 5T3XD 3EOBA 3GI9H 5IT2H 1OD9A 3DETC 2GFBB 5C08D 1JV5B 2DKMA 1U2HA 2FJGA 1BIHA 1CE6B 3V6OE 4EDWH 1R24A 1KEGL 3NIDF 3TBYB 1YPZA 3HUJA 3AM8A 3I9GH 2KDGA 4ODTL 4FFYL 5L7XL 3SCMC 1YJDL 3LV3A 1I7RB 1JGEB 3UTSB 4NM4H 1A6VL 1EAJA 4U1GB 3RPIA 2YRLA 3BKYH 2XYCA 2NNAA 1XT5A 2N7AA 1CDBA 3ARRA 5E03A 4HUMB 3C5ZB 1U58A 2DWDA 1Y18B 2Z8VC 4PG9B 2DBLL 3P4MB 3ZTJH 3X12B 2LVCA 4KQ4L 4HH9A 1SYSA 2ED7A 5BZDA 5I0DA 4LLWA 1T2JA 1WUNT 3WEXB 5E24E 1I8LA 3I6GB 4FTVD 2LTQC 4OM0H 2VSCA 4X6EB 3ME0A 3WKMH 1UJ3A 3MUGA 3C60D 3QQ4B 4TVPD 1SBSL 4M7JH 3VGFA 1MHEB 4ELMA 3NTCL 1YA5A 2K3TA 3PXJA 5DYOB 5LKNA 2YD7A 5CJ8A 1MVUA 5F1OB 3IJHA 1YC8A 3C6SB 1EUTA 2R2EB 1B6DA 2HTLC 2FSEA 5E08L 2XQBL 2Y07H 3QNYA 1EXUA 1J1OL 5KSAA 5JZ7C 4TSBH 2HT3C 3KXFA 2DQEH 3EO1B 32C2B 1HCVA 3H9YA 5I8CB 3H9HB 5DRXB 5EFIA 1DQLH 2OSLB 5EOQH 5FF6B 5MEOA 3PP3K 3V5KB 4Q9RH 4U31A 4HKZA 1S9XA 3NFNB 3I3DA 2XN9A 5L8KB 2YD1A 3RNKA 3C09C 3R06A 4JDTH 3DO3A 1CCZA 2X4UB 3MMEA 1WLHA 3O11B 2DI8A 1VFAB 3VE0A 1WWBX 3IDMA 3SDXA 2H3NA 3QCVL 5IB3B 3LKQA 5GGSA 2R29L 2UZYB 4U3CA 5HI5C 3CX5K 3QXTA 4JVPA 1HIML 4ZUSB 1QA9A 3QFJE 2EYSB 1AGCA 4PLNC 4NCC1 1QQDA 3BP6A 1XR9B 4ZUWA 3SY0B 4JFPB 1P7KA 4HC1H 1ZHBA 3PP4L 1U8OA 2YKLH 2VDQH 4MJIE 3K4ZA 1KYOK 4LBEA 5E8PA 4TSAH 1U42A 3PIQA 2YZ8A 4KKBD 4ZO7A 5C71A 1CFNA 3MR9A 2QSQA 3H9SD 3VFSA 2I9LB 3KYKH 3WJJA 2NY5H 1MCSA 5I15H 5EZJB 1D9KB 4ODHH 5EPMB 2UV3A 2L4OA 4PLKC 1CF8H 3GRWA 1A6ZB 5SWSD 5CEZL 4M62H 2X89A 4FABL 1CWVA 2OS7A 1HHHB 4PB9L 1KTDA 4JO4L 1WWWX 1P1ZA 1UEMA 2GHWB 2HFEB 3EOTH 3C8KA 4XVUD 4PJ9D 3RWIA 5F97E 5GGRB 3LKOA 1SEQL 4TSCL 3VFPA 3IDNA 5IHZA 3NIFF 5DQDH 5KVGL 1OP9A 1LO4L 2J6EL 2B39A 4G8EB 4GQPH 1NMCB 3B2VH 1NAMA 2KKQA 5CEYB 2EEBA 5DVNA 5HPMA 2XFXA 2MSPA 3MZGB 3OB8A 4M7ZC 4OQTH 2A83A 1AGEB 2XTJD 3QIBD 1V3KA 2PYFB 3N9GH 4JDVB 3Q1SL 1IKFL 4PJFE 2PXYA 3RZCC 5HYQA 1JK8B 1YY9C 2Q8AL 3GSRB 4WWKD 5ADOL 3MREB 5E56A 1ZHNA 1MCNA 4YZFE 3T04D 4JZOB 4U6YB 1D6EB 3PL6D 4AG4L 4NOBA 1QSEA 1WICA 3V4PL 3QDGD 1I9RH 2EDQA 3D2UD 3QHFL 5J12C 4OZGF 2H9GA 1YEDA 1TETL 2FO4A 4J3WA 4PGBA 1IGCL 2YUZA 3QUYA 3BEWA 4XVTL 4M48H 4X5WA 1XGRB 5I75B 3OR7B 1AE6L 3LH2H 4F9PC 4JN2B 4Z8FH 3MUJA 5ELIA 5DMJB 4PGZA 3RDTC 2KPNA 1LWRA 4TUJB 5EBMA 5D2NB 3TLRA 4PJAA 5K9JL 4ONGL 4KV5F 5I8OL 1Q9KA 3U36B 3ZYOA 5HGDA 2QKIB 2GI7A 1OAKH 5C70A 4EZMA 3HE7B 4O02H 1JYVA 1E28B 3PNWB 5CINH 2ICEB 1HSBA 4HFWA 2FX8L 4M43H 4DN3L 1NAKH 3TO2A 1YQVL 4UUJA 43C9B 1T20A 3MV9B 5C8JA 1UEYA 3MOAH 5C07D 3MRPA 5D5MB 5FHBH 2E27H 1MJ8L 4D9QD 4LVHB 1GZPA 4N1CA 5HVGB 1MJUH 2AI0L 3BDYL 1O7SA 5EZIH 1IQDB 1T04A 4GG6A 3HZMB 3VXSE 3HMXH 1UM6L 1WFUA 1XR8A 2MKWA 3D0LA 4PJEB 3RVVD 2Y36L 5HD8D 2AGJH 4KHTL 3B5HA 2YEZA 5IK3A 5CP3H 3GMNA 2FHBA 3DXAA 4CNIB 3TVMD 4PJHF 1L0XA 1FJ1B 1EBAA 4GKZA 4Q2ZA 5FIEA 4F7MB 2IJ0C 3JWDC 3WD5L 1N5YH 4G42B 5EC2A 2IAMD 4NFBA 4L8CA 1BPVA 1FAIH 4ORGA 4IRZH 1F11B 3B9KC 4X80H 3OR6A 3TCLB 3K4AA 1ZTXH 2X4NA 1FZJB 1U8MA 3IGAA 3VXMD 2GTWA 2CIIB 4UB0H 5D70L 5GS1B 1S9VA 3TBVA 2W65A 4F7PA 1K6QL 1IGFH 3OG6B 4DVBA 1E6OH 4LEOA 4M61B 5KJRL 3V4VH 1ULVA 3TT3L 5IMMB 1PKQB 3KPSB 4ONOA 4XNYH 1WFOA 1C08B 5F3BA 5EUOA 4L8SC 2WBJB 3GSWB 3HCVA 1D5IH 3QAZC 2XZAH 4PJ8C 4PRIA 4JG1L 5D1ZC 5IOPA 4HD9A 3GSQB 3FZUD 1B3JA 3WS6C 1NLDL 5DD5L 3O8XD 4QGTA 3VXQB 2CXGA 4XT1C 5GGTH 1NBVH 3ROLB 1QBMH 5D2LA 3CMGA 4RGOH 4ZUVA 4TNVK 3QXWA 1UXSA 3I85A 1XIWA 1K3ZA 3PWNA 4KRPB 1G1CA 2CMRH 1T2QL 3T65A 4CAGA 2VB5A 4KKCD 2EKSB 2F54E 5JIPA 4CMMA 3B9AA 3PGFH 4AQ1B 3X3FH 2M26A 1QNZL 2OR9H 3QJHA 1QRND 3QBTB 4GXUM 5HDQH 1LNUA 4M6ML 3I3EA 2PTTA 4L4VA 1CXFA 3QRGH 4LCWA 5GS0L 4C56D 1OM3H 4O4YL 2Z31B 3NCFB 4JRYD 1XF3A 3ROOA 3HA0A 2V17L 5FO7A 4DW2L 3KPPB 3L3DA 2IPKB 4N9GA 1FO0H 4G7YL 3MGTA 5LCVL 4HULB 4KDTA 3BH8A 1A0QL 4C4KT 3CMOH 4FN0A 3MOQA 1F2XK 3LHPL 2O61B 1BZQK 5DO2C 2HJKA 4ODXB 3ZTNH 1U6AH 4OBRA 4PP2A 3OV6A 2EDJA 1IGIL 1MREH 1FNHA 3GBMH 5KTEL 3MLZH 3PABB 3C9NA 1CZ8H 3BMVA 2HG5B 4F2MA 4OF3A 3TNNB 2IG2L 2X1XR 2ZNWA 1P69B 1A6WL 3SDCC 2Y1VA 3IFNL 4K3JH 3O4LE 3RWHB 1AR2A 3O2DA 4HXBL 1NJ9A 3PWJA 2DKSA 3AROA 4L8BB 5EORL 1NKRA 1F6FB 1FVCA 4MAYA 4YNYB 5J89A 4QHNB 1E4KA 4R4BA 5I1KL 5IB2A 1K8DA 1DDHB 2FJHA 4Q6IB 5E94B 1GPOH 3AAZA 4JO3L 5JHDE 4MNQB 3TO4C 1NGXA 5C0EB 3VFRA 1BM3L 3HRPA 1CDYA 3NMEA 4NZJA 4GKNB 4X6FA 4XPHH 3KYNB 1YYMH 2HT2C 1XF5B 1FGVH 3VXRA 1T83C 5T1KA 2ICWJ 5HYEA 4EBQH 3TZVC 4E41D 2BMKA 1QVOA 1RUMH 4MWFA 3UBXI 4P2QA 1XGTA 2FX9L 2P46B 3GJEB 5CCKH 4ONFL 1T1ZB 4QRPD 2NQCA 3G6JA 3SO3B 4YHOL 4QF1B 4XI5D 5B22A 5I1GH 4KK8D 2NY1D 3TFKD 5D7JB 4J6RH 4KUCD 2EO1A 3DO7A 4NSKA 4JHAH 4FQLL 2JIXA 5C3TA 4FQ1L 4AENA 3QG7H 1J0KA 3VFUB 4Z95H 2AXHA 1C16A 4HWUA 4K9EC 4J1UA 5J6HB 3UTPE 6FABH 3ARBC 2FEEL 2Y9RT 5EU3A 1T66C 4R0LC 2K1MA 4QOKE 1V5JA 3HLAB 1IC1A 1QFHA 4H8WH 3NCJH 1ZLVK 4PGCA 4CADB 3PHQB 1A9BB 3QXDA 1PSKL 4BKLB 1MQ8A 1W0YT 3Q2CA 3UJTL 2EZ0C 4MA1C 4WFGE 4XXCA 4LGSB 5FYJE 3WFCH 1LO5A 2GSIA 4GAJH 4N9OB 4XNXL 4LVOC 2UVFA 4Y1AB 4Y5YC 3MBXL 1QFWM 4OCMC 2FGZA 4YDJB 3STLA 5HHOB 1MRDH 2DQCL 5K9OB 1M1SA 5LXGL 3V6ZB 1OGAA 4HF5L 4WU5A 5IBTL 4WFED 2V7HB 1UENA 4PJ5D 2XZZA 1A4JB 5HHMD 2ED9A 1D7FA 3BEVA 3RUGA 1VB9A 1CLOL 4G6AC 5E9DE 3HNTL 3DURB 2DLIA 4RFEA 5IVZA 4X0KA 3BKCH 1MPAL 2VSDA 2YA2A 1OAQH 3PWPE 2BNRE 4D3CH 5EBWB 1XGUB 4Z7UE 1GRWA 1FPTH 3FFCB 3DTXB 1OVZA 1TNMA 1VEPA 4EI5C 1WF5A 4K3EL 2WIIA 1IFHL 4GRLB 3ILPA 1JF5A 4DGVL 1A9EB 3GNMH 4RA0C 1YDPB 3LKPB 4HUVB 1ACYH 3U4EA 2A38A 4BFGA 3GK8H 2XKNA 5JLZB 2WK2A 3IT8D 1ZSDB 3TWCL 3GSNL 4PTUB 3DNKA 1DFBL 2BVEA 4JFEA 2YS4A 4MHHI 4I2XB 4HW6A 2X4PB 3C5ZD 4QRUB 1PVHA 4LSPL 5F88B 4EUPG 1INDL 1UKQA 2PO6A 2VDMH 2H6PB 2NTFB 3GO1H 4CW1A 5E6IC 1G7IA 4HQQL 4BK5A 3G5VA 2EC9T 5J0BA 1XF4A 3GUTA 4PRDA 3IVKB 3LQAH 4P0DA 5EIIA 1RZ8A 3CDGA 4JCMA 4NKMB 2NX5B 4DTGH 3JVGC 1LK2B 3ULSB 1JZ2A 2MOVA 4JRXE 1RK1B 3QFDB 4NN5C 5BXFB 2EXYD 3W0WB 2JB6A 3PQYB 2APXA 4HPYL 3ZE2F 4H88L 3T1FA 1OSPL 3HMWH 1KN2L 3KJ6H 2WAHA 5MENE 1OHQA 1JPSH 3O3AA 2OP4H 5L6YH 5F71A 1KYOJ 1WT5C 3IAQA 5KVFL 3MV7E 4GAFB 1L7TL 3FQRA 4LLVB 4XPBL 3D87B 4NFDA 3MJ9L 5FCSH 5MP6H 4XC3L 3AREA 1T4KB 3O6FD 1CDUA 5DC9B 2D7OA 3UPCA 3S37X 5J3HD 1FL5A 3O0RH 2BFVH 4NKOA 1GGIL 2EO9A 5E2WH 4UTAH 3DROB 1RIUL 3TBSA 2DYPA 3RX7A 5F6HJ 3FO9A 1I1FA 1ZVHA 3CFEB 3ETBF 4GQ9L 3G6DL 4AT6A 4PRHB 1LP9E 2VXVL 4QWWD 1FZMB 4HS8L 4KROC 4K2UH 2VO5A 4G9DA 1W72L 2HH0L 2HKHH 1D5BA 5ESVB 4HPOL 2VDRH 4W68A 4IRSB 1KNOB 4PY7A 2BRRL 3EYSH 3BMWA 4LSUH 3MRMB 3MZTA 3N50A 3GJFA 4LPXA 1NC4B 2VR9A 4MA7H 3QWQB 2KL6A 1D9KD 1EUUA 3H6JA 4QTHA 3ZKQD 3AFLA 3KDMA 4DZBA 5BV7H 1EGJL 1ETZB 3QO1B 4EN3C 4Z7VF 4OGYL 1SJVA 2IBGA 3VFMA 2XA8H 3DETD 4JQIH 4OI9A 1T5WA 2I25N 3ESUF 2CIKB 1J0YA 1FFPA 2BP3A 2AK4B 1AGFA 4PJGA 4X6BA 1R3KA 2GFBA 4OCNC 3HI5L 3PWUB 4FQHB 3BRGC 5ALCH 1YZZA 5IFHH 5I74C 5T1MA 1JV5A 2GJJA 4R90L 1XFPA 3SCMD 3QUZB 4K8RD 2R2HB 1U8IA 1L9NA 4O5LL 3QEQA 1JNLH 1YMHB 3MLRL 4NQEA 5F1IA 5F7UA 4LRNH 3IKKA 1JGEA 2D7MA 4GW5B 1EA9C 4FQQA 3EYOA 3CFJB 5E8NA 1GZQB 4PREA 5D71H 4Z7QF 2A1WH 4XMKH 2Q8BH 3WFEH 3JV0A 1KXVC 4NJ9H 3SBWA 4TQEL 4OCXH 2XWTB 5F9OL 43CAA 2VQTA 4LFHG 1CXKA 3OJDA 2JB5L 3BIKA 5TDNB 3RTQB 4HMEA 4NHUB 1NUFA 4KPHL 5F7KC 4BK4A 1CDCA 5EH1A 4APQA 3CXDL 4KKAC 4Q9QL 2NY0B 5IHUL 2W9EH 3DMMA 1UVQB 4YHNA 4NUJA 2ENSA 1OY3B 5FGRA 4ZPTB 1N6QH 3B8YA 4AIZA 1OTSC 2HT3D 1YEFH 3HE7D 2ATKB 5KOMC 5BS0E 1RUPH 5FYJL 1SVCP 4HK0B 3V52H 1FYTA 2DKUA 3THMH 1DVFC 3MRGB 4FQPA 2VQ1A 4WO4C 2MWCA 3GRWH 2OJEB 5DRXA 1N64L 1GH7A 2IQAA 1MCQA 4JLRB 4NQCA 3CX2A 5C6TH 3IB4A 3TH2T 3WL9B 3BZFA 2BERA 3NA9L 1FE8L 4F7CA 1S5HA 3M17A 1A5FL 1CLYL 4JO1L 1DQDH 5SX5K 5D6DA 4ODVH 5DJXA 4U1JB 5CILL 1OF2A 4WFFE 1NEUA 2JE8A 4U1IA 4IS6B 5CBEA 1FP5A 2CLVB 1WBZA 1HI6B 3EHBC 5J9PB 25C8L 5C9JA 3DX9A 2P5WE 5D7KD 2NPLX 3T0EC 2GJ6A 4X7CC 1N3NB 4GAGH 4YBQD 3QISA 4ZUSA 3GMLB 4EOWL 5F3HB 3ZE0E 5F72S 2D3VA 4KZEL 3ARWA 4JY5L 3JV4A 4BUGA 1MF2H 35C8L 4X7DC 1OPGL 3EDDA 4RGMC 3KPRA 2BVPB 4DUVA 4PRAB 3UTTB 3STBA 1MHCA 2CRZA 2XG4A 4PLKD 3QFJB 2YPVL 2ESVD 2DJSA 3RQ3A 1KLGB 3UROR 3JV5A 3MRFA 4Z7WE 5H94B 1IZJA 1L6XA 2I9LA 5GRXG 1IAIH 4Y19A 2ZUTA 1RUAH 3WNOA 5EZJA 2VZUA 1ZT7B 1IQWL 4OZ4A 2BRQA 2VDKL 2CLZA 1PZ5B 5EZLA 1VCAA 5ANME 1DCLA 3O6LH 3GI9L 5IT2L 1AP2B 5DMKA 4YHIB 4KZDH 4NQXB 2VISA 1D5MB 1YYLL 2RQ8A 1BD2A 4U33A 1WGOA 1UB5A 3KYMB 2XV6B 1T1YB 1J8HA 4YDVB 4D0CA 1P84K 1ES0B 3I9GL 1K5NB 2O26U 3LOWA 5HJ3A 5DVMA 2Z4QB 3UTQA 5E7BA 4RWHA 2Z91B 5GGQH 1YY9D 3GZKA 1LE5B 2AJYH 1R3HA 1RMFH 4LDLB 4NM4L 4RX4D 5BVJA 1D5ZA 1QFUH 3LKSA 4X9FA 3BKYL 4ZMAT 1QSFA 4JFDB 1J0HA 1KCSH 4P4RB 3NCMA 5GRWA 5LGKA 1H3PH 1E4WH 3QNXB 1JI1A 5I0ZA 4PJ7A 2X5PA 1JHTB 1HE7A 4I13B 2KQNA 5GZOC 4LPWA 1FFOA 4Q9BA 5DK3A 2YRPA 2YUWA 3QI9A 1JMXA 4OM0L 5T1DH 2YSSB 3I2CH 4MD5B 1EO7A 3OAZH 3WKML 3EDKA 3OR7A 4JN2A 3TN0A 3FRPA 4M7JL 1YNLH 5F6IC 5BVPH 1IKNC 4WI8A 5A2LH 4WJ5B 2Y07L 1JWUB 4WHDA 3VGHA 3S9DB 4TSBL 2W92A 5IEHA 1P5VA 1JNHB 4CUCA 2X05A 2DQEL 5DD6B 4GSDH 4BJLA 5T33L 4XCNA 1F4YH 2HYMA 3BN9C 4YFLF 2Z0BA 3NPSC 2ICEA 1DQLL 5EOQL 2BZDA 3OMZA 3B5GA 5F7MC 4F9LA 5J4MA 4Q9RL 3JTTA 3QEUB 3UP1A 4LSSH 2V9QA 5D5MF 2ZCHH 3NIGF 2R0LL 1DZBA 3NAAH 4Q6YA 4UI2A 3ZT5A 3RL2A 4OZFG 4DGIH 5GIRB 3WIHA 4W6XB 1JUFA 1F42A 4WV1A 3FN9A 2AQ2A 1NC2B 3A6BH 1U8PA 3F7YB 5IBUB 1A47A 1F97A 4MD4A 4JDTL 2IH3A 1L9MA 4PJEF 4OFYA 1UB6A 2HLAB 3SDAA 4UV4H 1K8IA 1EEQA 1GSMA 2XXMB 3B9KD 3OL2A 2LU7A 3S4SB 4PJXE 1IAMA 5EA0H 1K4DA 5GSRA 1NBZB 5IWLA 2EDFA 3VXSB 3NH7H 2AV7A 2B1AH 2CJUH 3P9MA 5HYSG 1NGZB 2BHYA 4HC1L 2YKLL 2VDQL 5I8EB 4TNWK 1GOHA 2K7PA 2Z35A 1P7QB 2MFNA 4WTXA 2CIIA 4YGAB 3FO2A 4HWZB 4TSAL 1S9WA 1TCMA 2A77H 2CH8A 1LO0H 5I15L 2NY5L 2QQLH 4PJ8D 3GSNB 3V6BR 3ARDC 1K4CB 3VD7A 1UQSA 1RUKH 2SEBB 5D1ZD 1TLKA 3QUKB 5IROA 4ODHL 5EO0B 5IIEB 2VLJE 1ZT1B 2XTLA 5DXWA 4HUXA 2COQA 1CF8L 5BZWA 2WBJA 2GK0B 4M62L 3TYFA 3RWDA 4YO0B 3GMRB 4TNWF 2B7DT 4PLJC 4P2OC 4RNRB 3MYZA 3EOTL 3V5DB 4PFEA 3O2DH 5SX4H 4Y1AD 2FYYA 1NQBA 3S35H 3PDOA 5ICYB 3BKMH 1UACH 1SMOA 1HN1A 1K2DA 1T22A 2ICWA 5DQDL 3I6KA 5L2KA 1A1OB 5J06A 1FLRH 3B2VL 2CUMA 2R2BB 1IEAB 4ZS7H 3L7EB 1V3MA 3MRNA 5ISZE 4OQTL 4WGWB 2BX5A 5E2TL 5EU6A 1KIQB 2C7UB 2QJDA 3NFSH 5CP7B 2E5EA 3N9GL 2QQQA 3L95A 4Y16B 3UEZA 4MZ3A 4D9RD 1Q0YH 2K7QA 4JM2A 3EFFA 2JLLA 1D6VH 4Z6AT 5CIPA 2I07A 4LCCA 4OF0A 2GKIA 2X2YA 3QUMA 1WZMA 4U1MB 4R4NC 1PYWB 3GGWB 3JUYA 3ZDYF 2OQJA 1I9RL 3E2HC 4I0PB 2F54B 1RZFH 2HWZH 3BPLB 3QUXC 3VD3A 2R39A 4F3FB 4BYHA 5GGVY 1CTNA 3CPLA 3O3DB 5GGSY 2AKRA 3DYOA 2OTWB 2H8PA 4JB9L 4M48L 4OF5A 4RZCA 1VERA 2F9BT 3BP5B 4NQVB 3V0WH 4GW1B 1CDGA 3WJLC 5B8CA 2O61A 1HXYB 3LH2L 1ZANH 4Z8FL 4G8GD 3QDAA 1EH9A 4ODXA 1DUZB 3SDCD 5E6YA 1NH6A 2CK0H 4NUGH 3DVFA 1F6LL 5CGYC 1OAKL 3P4NB 4X4XA 4ODUA 3FQUB 4CU8A 1C12B 5CUSH 4O02L 3FQTB 2NY6C 5F9WB 3SO5A 1MJJA 5CINL 1NAKL 1OSZA 3FTGA 4ZYKA 1VPOH 2Y5EA 2LQRA 3MOAL 5MERB 3LEXA 4L8BA 3T4AA 5FHBL 2E27L 3QO0B 1MJUL 1NFDE 1P5UA 1KJ3H 5HXMA 4QXUH 1G9NC 4HUUA 1KPVA 2ZJSH 5EZIL 4YHYC 4OGXH 4X9IA 3O4LB 4KMQA 2V2XB 4Z0BH 5DJ0A 3BE1H 1FZKA 2AGJL 3ZDXE 4YBLC 3SGKC 1JPTH 4FXKB 4ODSH 3QZWB 2YD2A 3RGVA 3KYNA 4WNQA 2X9YA 3SE8H 4U1NA 5EN2A 5MHSD 4WY7H 3DHMA 3N06B 1N5YL 5A16A 2OL3L 4X5XB 2YBRA 4LHQB 2LAAA 1FAIL 1VADA 5JHDB 3F7QA 1BQHB 1X5ZA 1XMWA 4X80L 3O4OC 5SX4I 3GJEA 1ZTXL 4QRTA 4JGUA 1WIOA 2HFFB 1EJ6A 1T1ZA 5CEXB 5BW7A 5D72H 4UB0L 2Q86B 1ORSB 2X44D 3FT4B 4OJFH 1NBYA 1KPRB 1I7ZB 1IGFL 1CD1B 1B9ZA 3ARBD 3V4VL 3CZFA 4XNYL 2PCPB 5F93C 4Y4HB 1BFVH 1MQKH 3CU1A 4XCCH 1D5IL 5J6HA 1GHFH 2XZAL 3U1SH 1WC7B 2ZWLT 1X5HA 2ADJA 3RX8A 3RWGA 4IRSD 4Y5VB 3WFBH 5C0AE 5GRZA 1LO3L 1KBGH 4JAMA 4ZXBB 1R0AH 3PHQA 2HRLA 2B2XH 4E5XB 1AO7B 5GGTL 1NBVL 1BFTA 3HR6A 5ECJE 4M6NH 1QBML 4XH2A 3ULUC 2BCKA 3HNVH 4RGOL 3P0GB 4ETQA 3JBG7 3EO0A 4GRWH 1N7MH 1X4XA 5GSVB 5J1SC 4QOKB 2CMRL 3BO8A 4IDLA 3VWKA 2IALB 3QDME 4G6AD 4ETYA 1WWCA 2Q3ZA 3PGFL 3KHQA 4P23B 3WHXB 3X3FL 5EWIH 2OR9L 5C6PB 4NN6B 4PD4K 5KN5B 1S78C 3MROA 1WBYA 4YUEH 3V7AE 5HDQL 4K23H 5CFHA 1N2RA 3QRGL 3GSVA 2VDOH 1OM3L 2CDFA 4UQ3A 2DB8A 2W0FA 4F80A 1Q1JH 2JF1A 1YPZE 3HUJE 3KLAB 3UPRB 1I1AC 2O5YH 5EBWA 3LDBC 1FO0L 3LQZA 3VU2A 2X09A 1SHMA 3CMOL 5ILTH 5DQJB 1OP3H 2WQ8A 5E9DB 2MCPH 1KG0B 3U0TB 2NCMA 1MIEH 1R3LB 4HUVA 5DSCA 1WCBA 1U6AL 1XCTA 3ZTNL 5KG9A 4IOFC 3W5MA 3QEHB 3PWPB 1MREL 2BNRB 3O9WC 3MLZL 4LRIC 4Z7UB 1XGPA 2DM2A 5DFVC 2EXWD 2G9HB 3QIUB 4R96A 4RIRB 1W0VA 2EDLA 1QLFB 3OAYH 4K3JL 2EH7L 5ID0B 3MCG1 3UTZA 4GLRI 5IESH 2CDEA 1UH2A 3U7AA 3C60A 5DFWH 4FQXC 4JANB 4XB8A 3S8WA 2NY0D 3DV6B 3HB3C 3IVKA 4JQXA 2HVKB 3ZKSD 4ELME 1DBMH 2ZG3A 2VERN 5J1TC 4WHYH 2W60A 4ESKA 1TTGA 2NX5A 2R2CA 3N1FC 1LK2A 3HRZB 1GPOL 3G9AB 1AIFA 1ZGLB 4ELKB 3MBEB 4LLUA 3TA3A 1RK1A 4I3SH 1SEBB 3KXFE 5MEPB 3GJFH 1LHZA 1EFXB 2W38A 4XPHL 2FHCA 3PQYA 3AC0A 1YYML 5IVXA 1RZJH 1FGVL 4HLJA 5I17A 3MO1A 1OGTB 4EBQL 1G7QB 3P40A 1TMCB 4OD3H 3VXOB 4JHZA 5D9SB 4FZ8H 3M45A 2WBKA 3PHOB 1AQDB 1RUML 1GXEA 4JRXB 3U9PH 1Z0MA 3OKKB 3TP4A 3V95A 2DOCA 2XN9E 5CCKL 4RGNC 3KPNB 4NZDA 5INCB 3ARFC 3U9UB 1ZAGA 5DHYB 1IAKA 4LLYB 3SDXE 3MV7B 4JHAL 1IE5A 4QXWA 3CSPA 5EU7C 4Z7OE 2M2DA 4DEPC 1KULA 2YC1B 3QG7L 1WAAF 3C5SA 4Z95L 2VLRD 2DQHH 4D94A 3PG2A 4KROD 3IFPB 6FABL 2YXMA 1NMAH 1DSFH 1P84J 1T21B 3MRJA 1T0NB 4NP4H 5FO8B 2V2WB 5IQ7H 5L2JA 3ZKMC 4WTWA 3BWUC 2BVUA 2ATPA 3NCJL 2OLDA 3IETA 3A67H 5L0QC 3WFHA 3UDWC 2EE2A 3SEPA 3RWCB 3RJDA 5F70A 5CD3B 3H9SA 5GXBB 3QXUA 3SPVA 3UTTD 3MJ7A 1LILA 3BVNA 1LP9B 3GMOA 4GAJL 2V6HA 3F12A 4I18C 4OBSA 1CL7H 3MRMA 1NCNA 1MRDL 4RAUB 5DGQA 2XKUA 3OPZH 3O3BB 3TH3T 3RWFA 1RULH 2FZ3B 1G6VK 3RIAK 1JVKA 2FCBA 1A7QH 4QHLB 3H0TB 1BVZA 3BKCL 1OAQL 3RZCB 4D3CL 1CLCA 3QG6A 5JIIA 1SJEB 1QD0A 1FPTL 3EKCA 5H2BA 2AK4A 3SJVD 3U7WH 1RZGA 1T5XA 1NGQH 3QIBA 4XHQA 3PWUA 4WI5A 3UZQA 3NFPB 4N0UA 1EFQA 3OTTA 4MXQC 1CXIA 5KW9H 3WLWC 4EEEA 3GNML 5EO9B 4WWKA 1DBAH 1ACYL 2XNAA 4NCDA 4AEEA 3RIAF 3B6SB 4NM8H 3GK8L 2ZSVA 4BH7B 3PL6A 1B90A 5JDSA 1YMHA 3QDGA 3GMPA 1GOGA 1GIGH 3FQXA 4JFDD 1J5OH 1QSEE 3O2VH 2J2ZA 3H7BB 3BWAB 3BIBX 2C26A 1FVEA 1W8OA 4UINH 3MV8E 2EIZB 2VDML 1MHHB 2W59A 1UWXK 1FNAA 3GSXA 4ZFFA 4GH7B 5DK2A 2BXZA 3LQAL 4D0DA 4NHUA 1F4HA 1VFOA 4PJAE 3Q3GB 4G8FB 4DTGL 3S88H 4PS4H 3C8HA 3BGAA 1VACA 4F15B 5DC4B 5IB5B 4TRPH 1H5BA 3BZDA 2KUTA 3OGCB 5A2IH 1S7SA 2AABH 4Y4FC 5FYLH 4YHKL 1KC5H 4NIKB 4KI5E 2QHRH 3HMWL 1INQA 4GJTB 1DVFD 3ZKXC 3KJ6L 5DJZA 2LAGB 3RHWF 1UM4H 4WO4D 4L9LA 1JPSL 3SE4C 1JGLH 2OP4L 4PJBA 4D0BA 5L6YL 3HZKB 5I66B 3I02A 5I76B 4NQTA 1QFWH 3FRUB 5JXEA 4IMLB 5MP6L 1CFQA 3LVEA 1ZT4B 3PJSA 2FEDD 3VMNA 5IW1A 1Y6NR 3RRQA 3TESA 5F7HA 2IC2A 1MLBA 5BS0B 2A6KA 3PHSA 3O0RL 2BFVL 5FKPB 1RJYA 2N1KA 4OCRL 5E2WL 3TVMA 4UTAL 1HOCB 3KPQA 5KS9A 5HDOA 4YEFA 4ZAKB 3EHBD 4PIRF 4GS7C 1F3DH 4L8DA 5DHVH 2OR8A 5AUMB 3T0ED 2P8MB 4LIQH 1AGDB 3CK0H 3DRQB 1TCRB 4JGMA 3GB7B 1DEEB 2IWGA 4NDMA 3VFGH 1VESA 3VXMA 2A73B 2XY1A 5KAQG 4K2UL 3AY4C 3EW3B 3V0VA 2HKHL 4F33B 2KZWA 3G5XB 2VDRL 3M1BA 1DANT 1FHGA 2EEDA 3EYSL 4LSUL 4PJIA 5L9DH 1VGEH 3WN5C 5CD5C 1MAJA 3RVWC 2VLKD 5EUOE 1UKSA 4MA7L 1G7JB 4KXZH 3QQNA 4RFNB 4PRIE 5BV7L 4IOIB 4PRAA 4EUPA 2V7NB 2NY4D 3O8XA 4JKKA 4G9FB 4HBCH 3U46A 3H9ZA 1U3JA 2XA8L 1AXTL 5DEFA 3VGDA 4JQIL 2R8SH 4FMFA 5IJKA 5D2LE 1WFNA 3QSKB 4IHOB 5IBLC 5FOJA 3TIEA 2PW2A 3W39A 4MJIA 3C2SA 3WHE1 1EEZB 3I50H 2VN4A 5C2UB 2XOTA 1A7OH 2Q3AA 5C0FB 2WQRA 5ALCL 4Z7WB 5IFHL 3MRIB 1KENH 1RZIB 2BSRB 3AB0C 1QRNA 4LQ1A 5EIQA 1WFTA 2UWEA 1KXQE 4YX2H 3BGFC 4ZQKA 1EAPA 2J8HA 2R0WH 3REWA 1U0QA 5ETUA 4Y5XB 4L4VE 1QUNA 1XGQA 1JNLL 4FQ2H 4LCWE 4GBXC 4E42A 4LRNL 1UWGH 3WIHH 3FAXA 1RI8A 3FMGH 5D71L 5HHQB 3P0YH 3TBTB 3ZL4H 2A1WL 3Q5YA 4XMKL 2Q8BL 5I8KH 3WFEL 2MTPA 3BD4A 3RY6C 4NJ9L 4MJ6A 5GZOD 4OCXL 4XAWH 2C1OA 1TZIB 5IB1A 3LPGA 4MLIA 4LDOB 4WFHD 1JGUL 1CICB 1JHTA 1JWSA 1S7VB 4KJPC 3S5LB 2FBJL 4PJFA 2ZZUT 5DQ9B 2ITDA 3ULVH 3C6LA 1Y0LB 4NNXA 3LN9A 2W9EL 2OZ4A 3SGEH 1EERB 3BQUB 4OLWH 2X6MA 1A14H 1N6QL 4PRPD 3CFIC 5GISH 1YEFL 4BQCA 3DX8B 3MRCB 1UM5H 4RISH 4JPIB 4U7KA 5JOFB 1RUPL 3BN9D 1XZ0B 1A6TA 2HA1A 3MCKA 1JE6A 5FECA 3DIFA 2DLGA 3THML 4ODWB 2RFXB 5DD6A 5K9QG 2DTMH 3GRWL 5FA4A 1QFOA 4JG0H 2EEAA 1SY6H 5CMAB 3HE6C 4MVBD 3T0WA 1HQRB 1BVLA 1U91A 2GY5A 4YHPA 5C6TL 1ONQA 1N6VA 1OCWH 4LEXH 4N5ED 1KIRA 4RFOH 4ZOBA 1DQDL 1T7ZA 4E41A 4IIQC 4ODVL 5GIRA 3KPTA 4I48A 5DI8A 1DP0A 1J11A 1IZKA 1L4IA 1T0MA 2CLRB 3V7AG 4P2QE 4QRPA 1F4XH 5CS7A 4CMHC 4BUHA 4DKDC 3V8CA 1T0PB 3G6JE 3TT1H 5J56B 5JORB 4GAGL 4JN1L 5H8DA 5CIPH 3L1OH 4FFVC 3VCLB 1HILB 3LMJH 5FO9A 5E7FA 4UMGA 3VXSA 4PD4J 3QUMH 1FO0B 1PX3A 2W9DH 4WW2B 2Z93B 3EJZC 4NQDB 3NGBC 2FECI 1BIIB 1MF2L 2ZOKA 3SDDC 4P2RE 2CDGA 4MQSB 5C0ND 4S2SB 4R3SA 4WHCA 2H26A 4PJXB 1I9EA 3GHBH 5C0GA 1T2XA 3OJ2C 4M6OH 2G2RA 1IAIL 1K4CA 1RUAL 2KQMA 4YGVA 5DJ6B 2DQFA 1KT2A 1CU4H 1I3RA 4FFWC 3IJYA 5HY9A 4Y8DC 1F90H 4NO0A 2VRAA 4P2OD 1AO7D 3O6LL 2GK0A 4OCLC 4WTZG 3MRBB 1YN7B 5FDYA 4KZDL 1UYWH 4G6MH 3CXHK 3KS0H 3MRRB 1GGCH 4YO0A 2XWJA 2DLTA 1JRHH 3KVQA 1NKOA 5I73B 8CGTA 5KOVC 1IGYA 3V5DA 1JF1B 2E7LC 4OUOA 3SGEI 1JPGB 1MI5D 5CSGA 4AM0B 3RUGE 1KJMA 4QO1A 5CSZB 1NLBH 5GGQL 4ISVA 2UYLB 3K80A 2AJYL 1RMFL 3O3EB 1KOAA 5HGHA 4RBPH 3F5WB 1QFUL 4QRQA 5JPNB 4MXVE 4QHUB 3ARQA 3TBWA 4R4ND 2AJXH 4PGDB 3QUXD 1KCSL 2HJFB 4X9GA 2ITCA 1H3PL 3IXTA 4XNZC 3VDAA 1SBBA 12E8H 3GGWA 5ISZB 1G7MB 3CJJA 1L7IH 2NY2B 1U9KA 2DM7A 2GTZB 5DA0B 2NXYC 4PRNA 4KKLC 4HGWB 2ARJA 3IDIA 2H32A 2NZ9C 2HTKC 1BP3B 2OTWA 1I7UA 4JFEE 1A22B 5T1DL 3I2CL 3MRHB 5TE6H 1XCQB 3PP3H 2ICWI 2IPUK 3FONB 4XCYA 1UZ6E 1YNLL 3V5HB 4QTIL 5CGYD 4RDQF 1PD6A 3KYOA 1C5DB 5BVPL 1DQTA 2CRMA 5J11C 4XP6H 4X98B 4KAQH 4D8PA 5INDA 5IW6B 4GRWE 5DURB 4PV9B 4P4KC 3RL1B 5D1XA 4XNMA 1JF6A 3BPNB 4RGNE 1BVKB 2AQ1A 4GSDL 3FQUA 1DQJA 4J3SA 5TJWK 3FQTA 4YDKH 1F4YL 4Q7DA 3F7VA 2AJ3B 2X1PA 1R3JA 1W72A 1Q8MA 4J7RA 4NBXB 4LSSL 1FLTX 2D2OA 2BHUA 5B38B 2ZCHL 4HJGA 3NAAL 1I8IA 3L5XH 2FJFA 3R4DA 4X99A 4DGIL 1AHWA 4IBLT 3DGGA 2F74B 3A6BL 4LCIH 1PY4A 4MNHB 1JIBA 3K3QA 1X5AA 3KPMB 3FL7A 3QIWC 2YD6A 5T3XH 4LKXA 1NFDB 4Y89A 4HKXA 5E5RB 5EA0L 3WE6B 3B2UC 3FB5B 4YHLH 3LEVH 4H25B 2B4CH 1NCDL 3U30B 1JRHI 4X5XA 3DUUB 3NH7L 3QH3B 4L4TE 1KGCE 5JHDA 2C1PA 3QULA 5DHXB 2B1AL 2X4OB 2CJUL 1RAMA 3ZYZA 1ZVSB 5CBAB 2BHZA 5B21A 3QA3B 2YA1A 3FCTA 1Z3GH 4GKSA 2QL1A 4MQ7A 3DSNA 5C09E 1EO8L 2A77L 1LO0L 2IFFH 1R3IH 2QQLL 3VWJB 4C83B 2L7UA 2E9IA 1RUKL 3OKEB 4M4RA 4PR5A 4ZUUA 3IFLH 3JWOH 4RAVA 3DX7B 4NO5A 3VXPB 1G6RH 2DRUA 5C86A 3LSOB 2YOCA 4JFOA 5AAWA 3ZKNC 3FB8B 4C54A 3ARYA 3O2DL 4HH8A 5D7IA 5DMGC 1XF1A 3S35L 1A3RH 4L29A 2Y6SC 2YUVA 4TVPH 4N90E 1UACL 3BKML 4POYA 4YWGH 1FLRL 1RK0B 5GSVA 1S78D 4HLZG 4ZS7L 4TUOB 4WI7A 3CFCH 1MCIA 1BLNA 3NFSL 1L6ZA 1ZVYA 5FUCC 4WEBH 4A6YH 1Q0YL 4PJGE 4PV8B 3WUWB 4LKCA 1D6VL 2E9WA 5C0CD 1I1AD 3QXAB 3SCMA 5HYIA 3RKDD 1SYVB 3BAEH 3NCEB 4I3GA 1J0JA 1Q94B 1S7QB 3G08A 4GUPA 1OTTC 4OZFA 1RZFL 3QDMB 4JDZB 4PJDA 3J7HA 3EOBB 1YY8A 3EYFA 4U7MA 2DQTH 4IOFD 1U3HC 2GEEA 4ZNEA 3MFFA 3V0WL 3QHZH 1ZANL 1KG0A 5DD3H 4UAOB 2FJGB 2YPLD 5HVHB 5AYUH 3U0TA 5DFVD 3W11C 1R24B 3LZFH 4XRCA 4HV8A 5EC1A 3VG9B 1YPZB 3HUJB 1QBAA 5D96B 5KVGH 3HZYA 2CK0L 4Z7UF 4NUGL 2B4CC 3LV3B 2DQIH 2GQHA 5I6XB 4OLZH 1KJ2A 5FK9A 5CUSL 1M6OA 5EUKA 4Y2DD 3D48R 4FQXD 3JTSB 1QLFA 4CGTA 3RPIB 1JMZA 3T0VA 5HYSA 1IL1A 4U0RB 1VA9A 1E4XH 4Y0GA 2NNAB 1VPOL 2AEPH 4NO3A 3VFVA 1MWAH 3DSFH 3CC5A 1U58B 2DWDB 4OAWA 3DGCR 1T1WA 1UXWA 1KJ3L 4NNYB 2D31A 2ZG2A 4QXUL 4URTB 5F6HI 2ZJSL 2J8UA 3DLQR 4HH9B 1FG2B 1SYSB 4BFEA 4OGXL 5BZDB 4OF6A 4LLWB 3TNMA 4XMPH 5B39A 3FOMA 5F8QC 5BV7B 1K9TA 4Z0BL 1FYTE 3BE1L 5D6CA 4ZS6C 3MUHL 1I1YA 4NQSA 4U2ZA 3BJ91 1UJ3B 3MUGB 5HGAA 2P43B 4ODSL 5F7EH 3W9EA 4HX1A 4ELMB 3SE8L 2W91A 2HVJA 1G7QA 4K94C 4NQCE 4WY7L 3IJHB 2WUCH 2D7NA 2FSEB 3QNYB 1EXUB 1HK6A 3ALXA 5A2JH 3ARFD 5KSAB 5BS0D 3KXFB 2PN5A 4ZUTA 1IT9H 3KPLA 2VR4A 5D7LD 5EFIB 3L5IA 5D72L 4ZAKD 4QYOB 5MENA 2YA0A 4OJFL 2CGRH 1S9XB 1I75A 1MJ8H 4YDLC 1PAMA 4B0MM 2XN9B 2GJ6E 3ZKMD 3D3VD 3PUCA 5JOPE 1BFVL 1M71A 3U7YH 4RA3A 1MQKL 2XKSA 3RNKB 4XCCL 1X5YA 2NZIA 3R06B 1GHFL 3U1SL 1T0NA 3MMEB 4X6CA 4XBPA 4NBZB 2V2WA 3VE0B 3IDMB 2PW1A 4P49A 3WFBL 3SDXB 3LKQB 3KPRE 1KBGL 1R0AL 2VABA 2B2XL 5GRUH 2ESVA 4M6NL 1QR1A 5L8LB 1JN6B 3B4NA 5AZ2H 4ACPA 1GL4B 1AGCB 4MB3A 4R7DA 1QQDB 3BP6B 1N7ML 4ZUWB 1QR4A 4Y19E 1LP9A 2Q20A 3LS4H 1W0WA 1P7KB 4G9FD 1ZHBB 3FJTA 1U8OB 2JK5A 3D9AH 1J87A 1JCKA 2G5BA 1VFBA 4P3DA 3O3BA 4LBEB 3WDJA 3T0XA 5E8PB 5FUZL 4YUEL 3PIQB 1U8LA 4K23L 3HS0A 1CFNB 4LU5H 3MR9B 3VFSB 2NW3B 4O9HH 5BQ7A 1FL6A 2EICA 2ZUQC 3TT3H 1J8HE 1S9YA 3DV4A 2VDOL 3LB6D 3JUZA 2VZOA 1JHKH 4MYWB 3H0TA 1Q1JL 3R1GH 3RZCA 4YEEA 4KDWA 2O5YL 3MJ6A 3WLWD 1BF8A 3BYTA 1SJEA 4LIQE 3GMMA 1KTDB 3KWWA 5HHXH 3MGOA 4JPKH 4NN7B 5C0BD 1U8QB 5ILTL 5IVNA 1P1ZB 1NLDH 3K8LA 3OB0K 4M7LH 1MIEL 2ZSWA 3C8KB 4W70A 3MNVA 5F1NA 3RWIB 3LKOB 1B0GA 3VFPB 3IDNB 5IHZB 3G9VA 4WENB 3D18A 4S0TD 5HPMB 2XFXB 4F9PA 4XVUC 4PJ9C 2A83B 3GBLA 3RDTA 2MNUA 2OR7A 2PXYB 2ZNXA 5HYQB 3OXSA 1CICD 1Q38A 5IESL 1C7TA 4LL9A 2EIZA 1ZHNB 2XTJC 1RY7B 4EXPX 5I1HH 2JELH 1IEHA 3WIIH 3ZZ1A 1CIDA 1QSEB 3VD5A 1DBML 1H8OA 1YEDB 2FO4B 3SOBL 4DW2H 4PGBB 1IM9D 3Q3GA 1W8NA 3QUYB 3BEWB 5E1AA 3HPJA 1PW3A 3BZ4A 4I3SL 4X5WB 4XPTH 1Q9LA 2EYRA 1RZJL 1BAFH 1TQBC 2X4RA 3DUHA 5EBLB 3R8QA 5SV4A 5EBMB 5E5UB 4EUPH 4OD3L 3ARGC 4P5TC 3WKNA 2HAZA 4PJAB 4Y4KC 4FZ8L 5KTEH 3EDJA 1B0RA 2WANA 3HZKA 1Q9KB 4HXAH 5BMFH 3U9PL 3C2AH 5HGDB 4P5KA 4JEGB 3QP3A 5F7FA 1HSBB 1RJZA 3FHAA 3T1WA 4HFWB 3TO2B 3L3JA 1EMTH 4UUJB 1T20B 4RMWA 5C8JB 4CJ1A 4ODBD 3MRPB 2I60L 1HYSC 3B9KA 3DVGA 3GIVB 1IC7H 4TUKH 1GZPB 1ZEAH 1IEBA 5KVEH 4LCYA 1ZA6A 4W6WB 4AL8L 1T04B 4OQTA 2DQHL 2VNCA 4NC0B 1P9MC 4JJHA 3MV01 1BECA 3S3JA 4FZEH 4H0IA 4XPFH 1XR8B 1NMAL 1DSFL 3D0LB 4NP4L 3ULVE 5IQ7L 1G0YR 3GB7A 3RA7H 2H1PH 2YEZB 5IK3B 3A67L 1MFEH 1PKOA 1CBVH 3WIFA 2E8ZA 4NQDD 4WU7A 4IRJD 4ZPVA 2PYEA 4G80A 4GKZB 4L8SA 3O41B 4Q2ZB 3RVVC 3ZO0A 3RVWD 4XTRD 4F33A 1G9MC 1CGUA 1J9CT 2P4AB 1M05A 4PJ8A 4L8CB 4OF8A 5D1ZA 3MRKA 3OR6B 2R4RH 5DRWA 3C08H 4ONFH 3WS6A 1CL7L 4DOHE 2X4NB 3LCYA 1FSKB 2ZPKH 5DJDA 2IAMC 1U8MB 2IQ9H 1G7JA 2P5WA 3IGAB 2FL5A 5DGRA 2GTWB 3OPZL 1P6AB 1S9VB 2O5ZH 1RULL 4DUXA 2CK2A 3TBVB 5FDWA 2W65B 2OZ4H 1YMME 4Z78A 3EJYC 1AC0A 1BF2A 2BVTA 2M1KA 4DVBB 2W1NA 2BC4A 1RVFH 4LLQA 1U93A 4G7VH 2F53A 2VDNH 4PY8J 2V5SA 5EUOB 5F3BB 3TC9A 1Q0XH 1ITCA 2EC9U 4PRIB 5L2KE 3F65A 3IYLW 5IOPB 1EEZA 3U7WL 5IF0A 5HYJD 1NGQL 5C0FA 3TH4T 4Z7WF 3Q6FB 3D39D 3LPFA 4ZD3H 4K3GA 5EU6E 1RZIA 4GBXD 5KW9L 2NXZB 1DBAL 3LKRB 5CJBA 2F8VA 3IDJB 5D2LB 1LEGA 1KB9J 4ZUVB 1LQSR 5ANMA 4XNUH 2KBGA 1UXSB 2IADA 1XIWB 3PWNB 4NWUL 3VMPA 3BH9A 5ESAA 1Q9WA 1GIGL 1KTLA 1J5OL 2YPKA 5DRNB 3RWJA 3T65B 3O2VL 1IILE 1HHJA 4YJZL 4CVXA 1X4ZA 4DKAA 4U6HA 4ORZC 5DLMH 4AH2A 3IS1X 4DVRH 5EB9A 3QJHB 2NY2D 3G5YA 4UINL 1J10A 1ZS8A 1A02N 4PRBA 2JJTC 4G8GA 5D1QD 4KKCC 1LNUB 1HHIA 2OL3A 2X4SA 4HZLA 4KH2A 3BYYA 2PTTB 4L4VB 4JREB 4K71C 4R2GB 4HKBA 4LCWB 5GJTH 4JFQA 3SDCA 1UT9A 1XF3B 3ROOB 3O45A 4L3EA 4JKLA 5FO7B 5JUEH 1YC7A 3WV0A 3S88L 1T80A 4PS4L 1BQLH 3MGTB 1ZHKB 3S97C 1Y0LA 3BH8B 3DYMA 4TRPL 5J1AA 2VDPH 3GMQA 3VGBA 4HAFA 5CKGA 1KC5L 1IFHH 2QHRL 1BOGB 2HJKB 4AYFA 1BZ9A 5KBNC 4PP2B 1UM4L 4MSWA 3LEYH 4BQ9A 1JGLL 1MRFH 5JOFA 5I1IH 3C9NB 3TO4A 1UA6L 4HS6A 1OD7A 2XQYK 4Z76A 3HE6D 3Q48A 1QFWL 4ODWA 1ZGLP 2RFXA 3LN5A 4YR6A 4KJQC 5IV2A 1T83A 3VRLE 4HEPG 4W4OC 4YC2C 4LSPH 1BX2A 5GGTA 3TZVA 4M1CC 5CMAA 1NJ9B 3PWJB 2VXQH 1L0YA 3V6FA 1FVCB 2A9MH 3FT3A 4MAYB 4U6XA 2NYYC 4R4BB 1I1CA 5HDBE 5IB2B 4N0CD 1AKJD 1K8DB 4U1SA 2Q7YB 2FJHB 3AAZB 4J4PD 1MCKA 4CU7A 4LIQL 3I75A 3UXFA 1NGXB 2ZCKH 3VFRB 4LPTA 4FFVD 3WNLA 3HHRB 2EDRA 3VFGL 4X6FB 3H7LA 1CD9B 3VFTA 2VZ1A 1A8JH 4KTEH 4ZDHA 5T1KB 1J86A 2R4SH 3EJZD 2AXGB 5JORA 3SDDD 2VH5H 2BMKB 2IEPA 3ARBA 1PZUB 4LVNC 4R0LA 3T77B 1CTOA 1QVOB 3N1MC 4MWFB 4P2QB 1XGTB 5TPWH 2MQCA 3UAJC 3WNPA 4WW2F 1CI5A 2V5RA 5L9DL 1VGEL 4HDIA 1IGTA 4P46C 4XC3H 4OGZA 4NNPH 3G6JB 5FUCE 1S8DA 2H32H 4PJXF 4TTDC 2WUBL 4WI2A 1DBBH 1LK3H 4FFWD 4LNRA 4NZRH 3DO7B 4HBCL 4NSKB 5GS3A 1V7MH 1KEMH 4UV7H 4Y5YA 1B6UA 2R8SL 5EOCJ 4P2RB 1C16B 1WVZA 4J1UB 3O81A 3P4OA 5EU3B 3VI4F 2RCSH 4F8TA 3I50L 4UU9A 5E2UH 1A7OL 5T3XE 3IJSB 1QO3B 4PGCB 1KENL 1FIGH 1CDIA 3REVA 2NW2B 5IG7A 3QXDB 3HAEG 3NVQA 4PP1D 1W72H 2VLJA 4YX2L 1N4XH 1VDGA 1NMBH 2R0WL 5CSZA 4JZJC 4FQ2L 1LO5B 2GSIB 2IAND 1UWGL 3WIHL 1RQ5A 4EI5A 5DUPH 3D85B 1DLHA 3STLB 5KVMC 2Y06H 3FMGL 4G6FD 3P0YL 4NC1E 1OGAB 4MD0A 4WU5B 6CGTA 5I8KL 3O9WB 4QY8A 4DUWA 4PGDA 3RUGB 1G7PA 2NXYD 1I4FA 4JVWA 4KKLD 4XAWL 3NBNA 2NZ9D 3ARXA 4J3UA 2VAJA 3GM8A 3L6FA 4RFEB 2B5IC 4X0KB 3IU3A 1S7TA 3CDYA 3PGCA 1KELH 2VKXA 1TITA 1EJOH 3T3PE 1VEOA 3L3IA 3ULVL 3UJJH 5E6IA 3HI5H 4V2BA 4V1DD 2HFTA 1MIMH 1EHLH 2FWOA 4KJWC 4OLWL 2WIIB 1VFMA 3ILPB 2A6JA 4P4KD 4FTVE 1A14L 3V5HA 5GISL 3L3GA 3U4EB 1MCDA 1S9KC 1UM5L 1TPXB 2FX7H 3JVGA 3VFWA 3LN4A 4KV5E 5SX5H 2XKNB 5IFAH 5GJSH 4TVPE 4YDIH 2J3SA 3NACH 2Y25A 4JFEB 5DVOA 3SKMA 4QRSA 1ED3B 2DTML 4LVEA 5J13B 4U1GC 1SY6L 4YXLH 4HG4K 3C5ZC 1WT5A 4XNQB 1G7IB 1MCFA 5EBGA 3G5VB 1OCWL 4GRWB 3GUTB 1XF4B 2JB5H 4LEXL 4PRDB 5IVXE 4KRLB 4RFOL 4RGNB 2E7HA 3ZHLA 4FFZH 1CFBA 5EIIB 3U2SA 1RZ8B 3CDGB 1RIVH 4E0RA 1NCUA 4MNHA 4Q9QH 3B2UD 2RIKA 3PWVA 3ALWA 3EZJB 1F4XL 1IC4H 1OP5K 2JB6B 1X4YA 4DEPB 3KPOA 1NFDA 3TT1L 3GSOA 3T1FB 1KLUA 1WISA 3E6HA 1GC1C 3L1OL 2P5ED 3HZVA 3LMJL 3IDXH 5FYJH 3OKOA 3QUML 4K8RH 2W9DL 4KK5D 4ZFZA 3IDGA 1HHKA 3UYRH 4Y8AA 1G0DA 2UUDK 5JQ6H 4XBGA 4U0QB 1F5WA 1IARB 3GHBL 2DLFH 4B5EA 5JNYA 1FL5B 1XF2A 3HI6H 5I16A 4NKOB 4L4TB 5M7QA 3BP7A 1HSAA 3OKYA 3O6FC 3TBSB 1CU4L 3H9SE 3QCUH 1F90L 4YPGA 4NCC2 3VXPA 5DMGD 3NN8A 2V5MA 4AT6B 4EN3A 4G6ML 3P9WB 1KJ2H 4JZNA 4QCIA 1GGCL 2Y6SD 5SWSE 4JKMA 3E6FB 1JRHL 4Z77A 4G9DB 2FB4H 2BOBA 1B4RA 1D5BB 2D9QB 3PDGA 5DR5H 1CR9H 2MKLC 4BFIA 2EIDA 3MLWH 3MYJA 2QADB 4YFDB 1TTUA 1NLBL 1EPFA 1U8NA 3GJFB 5C0AA 3W9DA 5ERWA 4BH8A 4OM1H 3SJVA 4QTHB 2AJXL 3KDMB 4DZBB 4PV8A 4UQ2A 3L5JA 2X89D 3VFMB 4YXKH 4DCQA 1MSPA 1D9KC 1R5VA 12E8L 1TFHA 2VDKH 1U3HD 1T5WB 1Q94A 4QT5A 4U1HA 4JFFD 5JA8B 3BJLA 1ACZA 4GAYA 1FFPB 4UIMB 1MFAH 4LPVA 3W11D 1AGFB 3QDGE 2OI9B 4PJGB 1YYLH 1R3KB 4X6BB 4PG2C 2LVEA 5F7NC 5T1MB 5TE6L 3X11A 1CGSH 2CO6B 2GYSA 2HKFH 2AXFA 5TE7H 1YPZF 3HUJF 1U8IB 3IRPX 4GXUN 4XP6L 1A7NH 2PXYD 4KAQL 3QEQB 2E7BA 1NMCC 2NY3B 2V5TA 3OX8B 1KTKE 4NQEB 4F37K 5F1IB 1TQCB 1QZ1A 5JDJA 1N59A 4FQQB 4K7PH 3EYOB 4K8RC 4Y4FB 5E8NB 4PREB 1C7SA 4FXGA 3MCLH 4YDKL 2RR3A 3ZKXB 3JTSA 1QSED 1DQMH 4L3AA 1T3FA 2DJUA 2VWEE 2VDLH 2D4FA 4Z5RA 3OKDA 1BWWA 4L4JA 4UDTA 4HIIA 43CAB 4I8DA 5IEKA 3OJDB 2BNQD 3BIKB 4QXTA 1DVFA 3AMKA 3WYRA 1FZOA 3L5XL 4NNYA 4WO4A 4ZS6D 4D9QE 1FG2A 3WDHA 2BY1A 3FB6A 4LCIL 4PJBE 4F37F 1URLA 4APQB 2YXFA 1ZGLM 4MZ2A 4OZIF 5FM4A 3HFMH 5HHVL 4WTZA 3DMMB 4P48A 5I75C 5T3XL 4YHNB 5LWYH 3B83A 4NUJB 4JY6A 5JMRA 4AIZB 4ELMF 2X70B 4YLQT 5D2NC 4YHLL 3LEVL 4F8QA 2B4CL 4KI5D 3FO1A 1FYTB 5KS9E 2QSCH 3FOLA 3HE7C 1VKXA 2VQ1B 4NO2A 1RJCA 5T33H 3T0EA 3QWOA 1DQQA 1T6WA 3F6IA 3FO0H 2IQAB 4HWNA 1Z3GL 4QYOA 4NQCB 2GSGA 3QQ9D 2MQ0A 4M00A 4YXHH 2GW5A 1U41A 4LVHC 2R0LH 4YE4H 3BZFB 3VXME 2IFFL 4YK4B 1R3IL 3BPOB 4F7CB 1S5HB 1WEJH 3M17B 2D03H 4LSTH 4QGYA 5DJXB 5TDOA 3IFLL 3JWOL 3T4YA 1N0XL 3DXAD 1OF2B 3OBAA 3EYUH 1G6RL 4U1IB 3OJMB 5CBEB 5T5NF 4PJIE 2VLMD 1CS6A 1WBZB 2VLKA 4POZC 4UILL 3T8XA 5C9JB 3SDXF 3KAAA 3DX9B 4BSWA 2APTA 4Z7OF 2VAAA 3VFNA 2GJ6B 4IJ3B 1A3RL 4ZOEA 1JN6A 3J8F7 4TVPL 4YWGL 3U48A 3ALPA 3JV4B 4YBQC 3KPRB 3CFCL 5ENWA 3U79A 2DM4A 5GS1C 1MHCB 2L0DA 3BGFB 4WEBL 4A6YL 2ZUSA 4NKDA 5ACZA 2MHAA 1DUYA 3MRFB 1NBQA 4PRID 2NW3A 1MNUH 5DMYA 2R56H 4Y19B 2OMNA 1QRNE 1IRAY 4OZ4B 2UWEE 3BAEL 2CLZB 1H3XA 2DN7A 2X42A 5EZLB 3T2QA 5DMKB 5TF0A 2VISB 3VI3E 5DUMH 2DQTL 1LDPH 1V8HA 1BD2B 1UB5B 5DJCA 1U8QA 1MFCL 1XIWD 3QHZL 1UWEH 5TQ2H 1NEZA 5DD3L 1J8HB 3EYQD 5FM5O 5AYUL 4D0CB 3JWDH 1B2WH 3LZFL 5HJ3B 3UTQB 5DHVB 2AEQH 3ARPA 3OSKA 4RCAA 5JIKA 2DQIL 4OLZL 3HN3A 5D8JH 1R3HB 5BVJB 1D5ZB 4R2GD 4LCWD 5E2TH 3LKSB 5EU5A 4MB4A 4OKDA 4NPYA 1QSFB 1E4XL 5MEQA 1IKNA 2AEPL 1MWAL 3DSFL 4WHTA 4F7EA 1KCVL 4PRPA 2DIJA 3L9RA 2DICA 4PJ7B 2Z31C 1OQOA 5HYFA 1FFOB 4P9HC 3QI9B 4XMPL 4Z0XA 5B3JF 4GRMB 2I27N 1ZK9A 3MV8A 4JB9H 4P5TD 3ARGD 1I7TA 4Y4KD 3TN0B 4RMVA 5F7EL 2BY3A 4O2CA 4IIQB 4JQVC 3Q6GH 2AJSH 3K8KA 5EBLA 2APVA 4PJAF 3AVEA 2WUCL 4HUKB 3HR5A 4XWOC 2MJWA 2EDBA 5IEHB 4OB5H 4E41E 1HKFA 2A6DA 1HYSD 1IT9L 4XCNB 1Z0NA 1DLFH 1UKTA 4KI5F 4JHWH 5E8OA 2H2SC 1FH5H 3IU4H 3JTTB 2ZG1A 3MXVH 4QRPE 2CGRL 2D7PA 3GIVA 1ZLUH 5C7XH 3RL2B 4P57A 5IMOA 3CH8A 1JUFB 4WV1B 3GFUA 4ERSH 4GG6F 3MA7A 3U7YL 5ACLA 1U8PB 3VXRD 4QRRD 4Q6IC 4MD4B 2IH3B 1UB6B 3KLDA 3QCTH 3SDAB 1K8IB 5K59E 3ARDA 2V5YA 3TJHC 4M7KH 1F3DJ 2XXCB 4KC3B 2YHGA 5GRUL 1K4DB 5GSRB 2N7BA 1TTFA 3O41A 4P3WA 5AZ2L 2C4FT 4NBYB 2OL3H 3VGAB 5B4MC 2AV7B 5IUSA 3EJYD 2Y7QA 3LS4L 3P9MB 1CDJA 1H15A 4P2OA 4C59B 1I85C 3SO3C 1DBJH 3D9AL 1RJLA 2JIXD 3HPLA 2APWA 2Z35B 4XZUA 4G43A 4NZUH 3FO2B 2OYPA 1F3RB 1S9WB 3D25A 5D7JC 4LU5L 3RJQB 3BI9X 5I1AA 1ZA3A 3P30L 4O9HL 4WFEE 1LO2H 2IFGA 1UQSB 1PG7H 4HCRL 1MI5A 4FOMA 4DOHB 1JHKL 4BQ8A 2R1WA 4HUXB 5EUOF 1CG9A 5BZWB 3R1GL 1EIBA 3RGHA 3E3QC 3TYFB 4EKXA 3GHEH 1NFKA 3RWDB 1RHHA 5HHXL 1G7LA 1IC5H 4JPKL 5ITBH 3U6RA 5H37H 5IKCB 2I5YH 3Q6FA 2BSED 4R26L 1LO3H 2VC2H 4I9WD 3DRTB 4Q0XH 2C4XA 4M7LL 1JZ7A 2FYYB 3QUXA 4NWTH 3LKRA 4U6TA 4N8VG 4HBQA 5D2LF 3PDOB 3IDJA 1IGJB 1OGAD 1J1PH 1T22B 2ICWB 1K2DB 3MJGX 2WV3A 3TPUA 3K8MA 3R0NA 3I6KB 4OKVA 4OLUH 5L2KB 5I1DA 1CD0A 3WJLA 3MRNB 2KH2B 5DRNA 4C58B 5EU6B 1N26A 4JFHD 2O5XH 3L95B 3BPCA 2E6QA 2Y23A 3ZT6A 1KLFA 3ELAT 3EFFB 3PGDB 4JM2B 5CIPB 2I07B 4CVUA 4LCCB 1OL0A 3QUMB 5I1HL 2JELL 3WIIL 2OQJB 4HIEA 4K9EH 5JMOC 4OCYH 3CPLB 3IDYB 4ZFOA 3SKNA 4Y7MA 2AKRB 3HG1D 3LKNA 2H8PB 1ZHKA 2Z8WC 4RZCB 2V9RA 4XPTL 2GJZA 5B8CB 5E8EA 4GRLC 1FNEA 4JY4A 1BAFL 2EE3A 1BOGA 2BSSA 4RMTA 4KJQD 8FABA 1M7IA 2E7MA 4HXAL 1EX0A 5BMFL 2PO6D 3C2AL 4M1CD 4CU6A 4X4XB 4ODUB 4YIQA 3B3IA 3SGKA 3O6KH 4OZHA 2DL9A 2X1WL 5ABDE 2CKBA 5BJTA 1MJJB 2EH7H 1GOFA 2NYYD 4C55A 5KVDH 1OSZB 1EMTL 3FTGB 4ZYKB 1JNNH 3ESVF 1HYRC 3MLXH 2FDBP 3LEXB 2BJMH 1P2CA 1LEIA 3T4AB 4XC1H 5IR1A 1IC7L 4TUKL 1ZEAL 2HRPH 3RP1A 3X3GH 5KVEL 1TJIH 4HUUB 1KPVB 3WDIA 4FG6D 3UZVB 1H0DA 4CVWA 2A6IA 5DTFA 4NGHH 4A2MA 2Q7YA 4FZEL 4XPFL 5DJ0B 1FRGL 1FZKB 1RPQA 3WLBB 2DLHA 2ZOLA 5FB8B 3RA7L 2H1PL 2AEIT 1MFEL 3RGVB 1CBVL 1A6AB 3GEWB 4WNQB 3NZ8A 3UAJD 5AG9A 4U1NB 2AXGA 4P46D 5EN2B 3ARED 4TTGA 5A16B 1CK0H 5TF1H 3QDJA 4ZSOA 5FGCE 2YBRB 4I77H 1VADB 2YWZA 3T77A 4TTDD 2R4RL 3WXWH 1F02I 1TZGH 1N0LA 3C08L 4QRTB 5D93B 2L7JA 2X40A 2ZPKL 3G6JF 5LAXA 2IQ9L 5EIVA 5BRZD 2DYPD 2K9UA 2O5ZL 3FT2A 3ARUA 1NBYB 2OZ4L 1WTLA 5SWQA 3CZFB 3B43A 1RVFL 5D7IE 4G7VL 5ACMA 2VDNL 4P2RA 4X9HA 1MCPH 1Q0XL 2J12B 5F1KC 2ADJB 4M02A 4LHUD 3RWGB 3IJSA 5CLWA 1QO3A 4WDIB 4R97B 4ZD3L 4JAMB 3EJJX 2CQVA 1UWXH 5HI3C 2NW2A 1KPUA 4XH2B 5C0CA 3UCRA 1I1AA 2BCKB 1A1MA 4IRSC 4ETQB 3GM0A 3KS0J 1A4KB 4XNUL 1PGRB 3EO0B 2J4WH 1Z9OA 3OG4B 2R23A 3BO8B 4N90D 3DVNA 2VN7A 3D85A 3VGEA 3VWKB 4GW4A 3UYOD 3CFBA 4PJDE 5E4EB 3ZE1F 1JPST 5DLML 4DVRL 3BRDA 3MROB 1WBYB 3EBAA 3O9WA 4FXLA 3RUGF 4LPCA 4LRIA 4ZNEE 2JJVA 3FQWA 2YPLA 1DTUA 1N2RB 4XBEH 5GJTL 3GSVB 4XVJH 4U1LA 1A1NA 2CDFB 1UH3A 4UQ3B 2W0FB 3TEUA 3NA4A 1E0OB 4KJWD 4MXVF 5JUEL 4HAGA 3LQZB 1AXSA 1NUNB 1BQLL 2FR4A 1U8HA 2XY2A 2VDPL 5C1MB 5DUBA 4FQXA 3QEQD 4KTYA 4NQED 2EDNA 2A0LD 1FN4A 3QUZC 3UTSD 2DIBA 5DSCB 1WCBB 1XCTB 5DJYB 5KG9B 2WNGA 5I9QB 3LEYL 4PBXA 1MRFL 4YQXH 5I1IL 5JA9A 1BBJA 1XGPB 4MAUH 2J8UE 4S0SD 4WI4A 4R96B 1ED3A 1W0VB 4FTVB 1UZ6F 5CWSA 3WSQL 5CAYB 3V6OC 1DANU 3UTZB 3UYPA 4IOSD 1MAMH 5DRZA 5EG6C 3NIGE 2VXQL 2CDEB 3C60B 2EXWC 4XNQA 4APQD 4GRWF 4LGRB 2EKJA 1FVDB 4PB0H 2A9ML 3RTQC 1QKZH 3PV7A 2W60B 2P7TA 3ARFA 2YK1H 4G6KH 1OP3K 3CX5J 5TH2B 1C5CH 1AIFB 1BMGA 4A6YB 1UFUA 2NY0C 4LLUB 5T1LA 3TA3B 2ZCKL 1AR1D 4JJ5A 1BFOA 1H8NA 1T89C 4YHKH 5IVXB 4KTEL 5I17B 3MO1B 2R4SL 1BZ7A 2DS4A 3L7FA 3R8BB 2VH5L 3PV6A 4E9LA 4O51A 2X1OA 3P77A 5D7KE 1LEKB 4KDVA 5TPWL 3D3VA 1MELA 2WLYA 5FV2A 5FA3A 3UDWA 4NNPL 4D2NA 3SGJC 3RWEA 2P24A 1QEWA 4G3YL 2NLJA 3RY5A 4HWEH 4X6CE 1IAKB 4HUWA 1DBBL 1LK3L 1TZHA 4NZRL 3RVUD 4OCRH 4L4TA 4I18A 3VRJB 1JWMB 1WZKA 1V7ML 1KEML 4UV7L 4X8JA 2QSVA 2ESVE 1DEDA 3C5SB 4QEGA 3GJFK 2GJ6D 4F7TA 3MRJB 2RCSL 5E2UL 5L2JB 1MWAB 4X7SH 5C09A 2ATPB 3IETB 3E6FA 5FKAA 3WFHB 1FIGL 5GS0C 4MS8C 4OD2A 1N4XL 3H9SB 1I8MB 5FYLD 1NMBL 5T3ZD 3VDBA 1X5FA 3SPVB 1KXTB 3MJ7B 4OLXH 3JV6A 3BVNB 3GMOB 4GG8A 3F12B 2WINA 5JIHA 5DUPL 3S96A 2YR3A 2Y06L 4AIXA 1GCFA 2JCCA 2VTFA 3WBDA 5F9JA 2VZSA 5C0BA 3RWFB 4CN1A 5IB4A 2PF6A 1I3GH 2EDKA 1V7NH 5L88H 4WI9A 1HWGB 1AXTH 2B1HH 1BD2D 1KSRA 1GVIA 2QR0A 1ZLWK 4AZ8A 4X7TA 1KELL 4MQXC 4LLAA 3QG6B 4UIMA 1EJOL 3I6LE 1AD0A 1KF9B 1JTTA 4PJGF 5H2BB 3UJJL 1RZGB 1T5XB 5FM8A 2G60H 4OCWH 3KLHC 3QIBB 1MIML 1EHLL 4GT7A 4N0UB 3QYCA 4NRZA 5DJ2A 5TFSH 1INEH 4WWKB 5KSBA 2XNAB 4H1LA 4RAHA 1OAYH 4FMKA 5MI0B 2FX7L 2ZSVB 5IFAL 3PL6B 5GJSL 5FAAA 5JDSB 1O0VA 1M4KA 4K7PX 4P9MH 4YDIL 3QDGB 5K9QI 1QSFD 3GMPB 3OX8A 5K9KA 3NACL 3FQXB 2IH1B 4Y4FA 1GJIA 4LHUG 1IM9A 4LSVH 1FV1A 1MCJA 3D1MC 4M8VA 1FVEB 15C8H 1II4E 3SE4A 1NFIA 4YXLL 2AJZA 4FQCH 1U95A 3GSXB 4ZFFB 4U1KB 1MCRA 1G7HB 4Y2OA 3QQ3A 4FFZL 5DK2B 4D0DB 1JGUH 3UBXA 2H2PD 4BQ6A 2ERJB 2FBJH 1RIVL 2GUOA 4HK3N 3CCHB 3RPKA 2C3VA 1VACB 4LAQL 1H5BB 2C3HA 3CU7A 4MDIA 2UY7A 1IC4L 3OAUH 2P8LA 1S7SB 4YHZH 3B9VA 1F4WH 2J88H 1INQB 4EI6A 2X70A 5DJZB 3BW9A 1JTOA 1L0QA 4L9LB 5E5MA 3HAEA 2CR3A 4D0BB 4PJBB 5SWZA 1X7QA 4EVNA 3IDXL 4L5FL 3MJ8A 3CIQA 3I02B 3DX6A 3BN3B 4XB7A 5C0JA 4K8RL 4M3JA 3MV9D 4J23A 2VE6A 1CFQB 4XWGH 4UNTA 3UYRL 3AY4A 3PJSB 3QR2A 4YAQA 5IW1B 1RZKH 5JQ6L 3BXNA 2DLFL 1MLBB 2A6KB 3HI6L 1RJYB 3TVMB 2FEDC 3KPQB 5KS9B 3QB7C 3WN5A 5I1LB 4OFYD 3QEGH 4POZD 2J8OA 2PYEE 2WLZA 1O5DT 4L8DB 3QCUL 3EFDH 1HH6A 3O6MH 1P4IH 1KJ2L 5F21B 5HGBB 4NDMB 4C57C 5F7DB 3VXMB 4R7NA 4YFEA 4X83A 1YEIH 3WS3A 4J8RA 2FB4L 3V0VB 3V9FA 4JM4H 4JN1H 5DR5L 1CR9L 3M1BB 3VXUA 4HIHA 3TYGH 3MLWL 3HC4H 4Y1AE 2BOCB 4PJIB 2J1KA 3K1KC 2F53E 5BOZG 4LAJH 2HN7A 4UOW1 5HHNA 4OM1L 4U3XA 3KPSD 5JW4M 4KGLA 1V05A 5E4IA 3EGSA 3D39A 4EUPB 4I4WA 2WBJD 3O8XB 1S7UA 4GBXA 3U46B 2VOTA 4YXKL 5DEFB 4D9RE 3VW3H 2DQUH 2NY4C 2BDNH 3TIEB 2PW2B 3W39B 3OF6D 1MFAL 4MJIB 4UNVA 5JW3H 4QHKI 3RY6A 3I84A 1KB5A 4Q9CA 4HLZH 2QQNL 2CSPA 1CGSL 4KRPD 5HBBA 1QRNB 2HKFL 2UWEB 2ARJQ 5TE7L 1EEYA 2H45A 4Q74A 5F1SA 4MA3A 4BSVA 4ZQKB 1EAPB 4G8GE 3REWB 4LP5A 1A7NL 5DHVA 2G5RA 5ETUB 1XGQB 1MY7A 2VXUH 4E42B 4MX7A 4M93B 2CRIA 2A74A 4K7PL 4GXVH 1OW0C 3T0AA 4L3EE 1JGVH 3MCLL 4Y16C 3D6GA 4X6DA 1DQML 5I1JL 1ZWIA 1QG3A 2VDLL 2Z31D 4OLVH 1RZKC 4MJ6B 1PJ9A 4XCEA 2P48B 2C1OB 5IB1B 2YUXA 4OV5A 4PJ7F 4PJCA 4LQFH 4WUKH 3BGMA 4I0PC 3HC0A 1RD6A 3BPLC 1JWSB 4KMTH 5GRYA 4XGZA 5E6ZA 1TJHH 4MXWH 4PJFB 2OX5A 4TOYH 2ITDB 3C6LB 4GRMA 4NNXB 3BD3A 5E70A 2DQJL 3CSBA 5GHWH 3HFML 3P2TA 2MQ3A 3CFKA 5LWYL 2FGWH 3M8OL 1IAIM 1U36A 4XWOD 4IIQA 3WO4C 4DZ8A 4QTIH 5T5FH 3BUTA 4U6VH 1A6TB 3CLEH 2VL5A 3MCKB 2H2SD 2Q6WA 3VFOA 5FECB 4IM8A 2PNDA 1A6PA 3DIFB 3HI1A 2QSCL 3VG0H 5MHSE 2DMCA 3PWLA 1AKJA 4OLEA 5F9WC 5FA4B 1WZ1H 4MA8H 2AV1A 1R5WA 5JW5B 3FO0L 4I5BA 3T08A 1FFRA 1BVLB 1U91B 4YHPB 4YXHL 4OCSH 1ONQB 3MUY1 4YE4L 5CZKA 3CNKA 4MNQD 1KIRB 1WEJL 4XVSH 4PY8I 3SDDA 3MLVL 3P0VH 3MACH 2BSTA 2D03L 4LSTL 1ZHLA 4E41B 4ZG1A 4H26A 4MVBC 4I48B 4S1RH 5DI8B 3ARSA 5KANG 3NCYP 3RGVD 5TGBB 2EDYA 3BP4A 3I3BA 3TJHD 1T0MB 1EDQA 4N0FA 5FCUH 3EYUL 4HKJB 4N5EC 1U8JA 1IAII 1RFDH 4G6JH 4Z18A 4QRPB 3SKOA 3V8OA 1FYHB 3S37H 4BZ1H 1G9EA 1QYGH 4HJJH 5B4MD 3RNQA 3BDXA 2J5LB 1AD9A 3MUZ1 3LD8B 2P49B 4G8IA 2NY1B 5A2FA 5ITFA 2GCYA 5FO9B 1NCDH 1QACA 2CPCA 3ULVF 2ZOKB 4JFZH 2CDGB 5D7JD 5F7WC 2OMBA 4R3SB 3SHSA 2E7LA 3GKZA 5EOCH 2H26B 1YEGL 5C0GB 3U0PA 3MLTA 3TIDB 2G2RB 1PG7X 3ECBB 1EO8H 4D9LH 5C0NC 1MNUL 1G9NH 2X7LB 2R56L 1SM3H 5AD0A 2BY0A 4YGVB 1FDLH 2DQFB 4Y4HC 1KT2B 3STZA 1I3RB 5B39G 3IJYB 5ESQA 5HY9B 4NO0B 3S36H 3UPAA 5A3ID 2IANA 1CGYA 5DD0L 1SY6A 5IMKA 5DUML 1LDPL 4Y5VC 1YMMA 2XWJB 1Z5LA 5IKCA 1UWEL 2CKBH 2AXJA 4I3RH 4RMQA 4TULH 4ZXBC 5TQ2L 3MPCA 1IGYB 3DRTA 3CVHA 3JWDL 1B2WL 3VWKD 2WZPD 3VJ6A 3MODH 5HHOD 5ADPH 4OIAA 2VXTH 1IGJA 1KJMB 5A40E 4J3VA 5E00A 2AEQL 2YD9A 4ISVB 1FBIL 1Z6JT 5D8JL 2HMIC 5HGHB 4QRQB 4HS3A 3TBWB 1MCOH 4P23C 4NN6C 4V1DA 3OJVC 1MHPH 4JM2F 1U92A 3PGDA 1PLGH 1T7XA 2ITCB 4P4KA 2E9BA 4ZNCD 3IXTB 1U3ZA 1ROWA 4LDEB 1A3QA 3FFCD 1CXHA 4OV6F 4DN4H 3MNWA 4PGJA 5I18H 3HTLX 1S7XA 4NFCA 4PTTA 4GRLD 4PRNB 1WIPA 2ARJB 3IDIB 2H32B 3B5TA 5H35A 3T09A 1I7UB 1M7DA 2V2TB 4KQ3H 4XCYB 3VA6A 1CDHA 3ULUH 1KFAH 3Q6GL 2AJSL 1UJTA 3D5OF 3KYOB 4ZTOH 1F3JA 4L1HA 4OZIA 4RBPK 4D8PB 5INDB 5D1XB 3IRZA 4XNMB 3QIWA 4OB5L 4WUUA 1DQJB 4N1HB 2VIRA 3QIUC 4P59H 1LVEA 1DLFL 1Q9OA 3F7VB 4JHWL 4DQOH 1MLCB 2CD0A 5CZXC 5KSVB 1CXLA 1R3JB 1W72B 3LRGA 1FH5L 3IU4L 4V2CB 4WIQA 2LV4A 1RU9H 3KJ4B 3MXVL 2NX5D 1S7RA 3GDBA 3MFGB 4HJGB 1Z9MA 1I8IB 4XAKE 2EYTB 5C7XL 2ZCLL 5C3LD 3TA3D 2FJFB 4X99B 1E27A 1AHWB 2P5EA 4ERSL 4NKIH 1Q72H 3DGGB 4PBVC 3VRLF 3PQYD 4O00A 3W0WD 5FUOH 2MPAH 5FGBC 3MBEC 5HVFB 1NDMA 2VLRE 5IP4A 3QCTL 2DQDH 5CEZD 3WLBA 4OFVA 5FB8A 4LKXB 2XRAH 4NHCH 4K55A 3O6FB 3OKMB 4HKXB 1A6AA 4M7KL 1OAZH 4J12A 5HDBF 2D0HA 1V3JA 1LE9B 1A21A 3QJFA 2W07A 2C1PB 3QULB 3LIZH 2UVEA 1X5LA 1DBJL 1H3GA 4M8QA 3UTTE 1T7YA 3WNNA