4LLUB

Structure of pertuzumab fab with light chain clambda at 2.16a
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
210
structure length
210
Chain Sequence
DIQMTQSPSSLSASVGDRVTITCKASQDVSIGVAWYQQKPGKAPKLLIYSASYRYTGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYYIYPYTFGQGTKVEIKGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PERTUZUMAB FAB Heavy chain
publication title Generation of bispecific IgG antibodies by structure-based design of an orthogonal Fab interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 46
structure length 210
sequence length 210
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lluB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lluB01
3BN9C 1AD0B 4FTVA 4LSPL 1CICA 4MQXD 2FJFA 3VWKC 3C5ZD 1OP9A 5LVEA 3AU1A 5DJYA 4TOYH 5DJDA 2I5YL 4LF3A 2PO6D 1X5XA 3V7AE 1KCUH 4PRIE 4URTB 2X4PA 2G75A 5IJVB 1FH5L 5DHYB 1I1CA 2E8YA 3MLZL 4G8GD 4HD9A 4QCIA 5IGXH 5T33L 1T20A 3WO3B 4CU6A 4I2XA 1U8KA 1MJUH 4QT5A 1GAFH 3SPVA 5E9DE 4GKOA 3CXDH 3OKOA 1GGTA 4M48L 3PWLB 1Q9LB 5C09A 1DSFL 4I9WE 1CK0H 1GPOH 4MA3B 1V3KA 2FX9H 1CFVL 3HLAB 3MRIA 5LAXB 2EH7L 5I8OL 4U0RB 1MJ8H 3GSVA 4ZG1A 3SGDI 5FYJL 1WZ1H 3CPLB 2MFNA 3WFHA 3UTSB 3ZHLA 1QBML 3QULB 3O8XC 8CGTA 4KDTC 4K7PH 1CLZH 1JGEB 1NC4D 4OV5A 1EBAA 2X2YA 1ZLWK 2OQJB 4HMDA 1A7RL 1TJIH 1YPZA 2VLRD 4IJ3B 5CGTA 5DMKA 4JFPB 3QWOB 3FQUA 1S3KH 2VQTA 4XWGH 1J0HA 1DR9A 2OJZH 4C4KO 2VMFA 1REIA 4U1HB 3D2UD 4IRJC 3IB4A 3TH3T 3BZEB 1EUUA 2W9EH 1VCAA 1S9WB 5E2UH 3TNMA 4NN6B 3UTQA 5GJSL 1V3LA 3SE9H 1ZGLP 5CBEB 3T3PE 4HUNB 3T2QA 4DGYH 2W60A 2EO9A 2VSDA 2D4FA 4XCCH 3ZKMC 4JG0L 3TN0C 4HWEH 1TVHB 4M62L 2DYPD 5HY9A 1BQLH 3G6JA 1IAKB 1YNKL 5HYSG 3UROR 2DI7A 3MFFB 2P45B 1U93A 2F53A 3OR6B 3DSNA 4W6XB 5I1AA 1I9RH 4QXUL 2YKLL 5T3ZD 5DR5H 5IOPA 3RWGB 4JQVC 2APVA 5JOEA 3WLBB 2EYTB 4F7PB 1MVFA 3BX7C 4UQ2A 4X5LA 3OAUL 3VXSE 4NQUA 5D71H 4MAYC 3GMLA 3LN9A 4YNYA 1NCWL 3S4SA 4LCCC 1ZANL 3VXMA 3MLWL 3OGCA 2FGZA 3X14A 3HE7B 1QFWH 1L9MA 5T1LB 5DUPH 4JFDB 2FL5B 3BHBB 1QYGL 2B4CL 1F90L 1LQSR 1IGYB 4XC3H 4YHPB 3IDMB 4PJCE 3QIBB 3RBSA 1WJ3A 4P2QD 3U48A 5HGHB 4E9LA 3IVKA 2HTLC 1CG9B 3QJFA 4ZFOL 2J8HA 2YEZB 3CLFL 3MACH 3DGGB 1I9JH 3PQYB 5LQBH 3NH7H 5E1AA 1IC5H 5EU7E 4XP1H 4RA3A 4KRLB 2W65B 4QHLB 4LSQH 3UTSD 4K71C 4LPXA 1HHKA 1JZ8A 3CDCA 1IFHL 1BZQK 4NZTH 4BZYA 2E3VA 3CFDA 3KPQA 1UADC 4IMKC 1T83A 3MJ7B 3C6LC 1V05A 2XPGA 1KCVL 4HJJH 4YHYB 1WLHA 5ICYA 1ITBB 4X7TB 3OKDA 3DURA 4OZ4B 3VG0H 3HNSH 1L7TL 2IQAB 3RVVC 3HI1B 4QRPA 5I1KH 1AGFB 3VFRB 4JFQB 2BMKA 2CKBB 4O2EB 4QOKB 3O3BB 1OAKL 2XWBB 3MV8E 3F7RA 4PJHE 3HE6B 5T1DH 3DTXB 4ALAH 5F6IC 2PTUA 3I2CH 2XTJC 5I8CA 3BH9B 3W82A 5F9JA 5FUZH 4DVBA 3HCVB 2VWEE 3ALXA 1NBZA 2Z8SA 2I25N 1HHJA 1TCRB 2X89D 3TYFB 2HG5A 2NY4C 5FUOL 1OGTA 1YEEH 5EBLA 5F7YC 3T4YA 4KROB 3MV01 1FVEB 2JJTA 3FHQA 1MLCA 3S3PA 1FZOB 2WAHA 1KJ2A 1NCAH 3AY4A 5BO1L 3WYRA 3AB0C 3GM0A 1MFAH 5CINH 1RZFH 4U6VL 4LVNB 5ITFA 1K4CB 2W9DH 3SDCA 3C6SA 2H41A 3TT1L 4B53A 2P5WE 4FQ2H 2JLLA 3HZYA 4KKBC 1YN6B 4O2FA 4L8DA 3H9SE 4CVZB 4E5XB 2VSCA 3HE7D 5JIHA 3VFSA 3TEUA 1CD0A 4UDTA 4G7VL 5T1LD 5ANMB 4JFDD 1F4YL 2VH5H 5IK3A 3ZKQD 1CL7I 4LHUB 2R0WH 1CFBA 2FDBP 3QT2A 4OZFB 5IHLB 1G7JB 2Q7NA 5AZEL 3I6LD 1L6ZA 5C07B 3BSZH 4UMGA 5LGKA 3QIBD 2ZUSA 2R29L 1JGUH 1JHTA 3MLYH 3MRGB 2XQBL 1M71B 3RUGE 2YPVL 5CZXD 4HDIA 3WFZA 5A2KH 5L0QC 2GK0B 4DOHB 1WAAA 2CSPA 3SQOL 1ZEAL 4GKSB 1IQDA 3IDGA 3PJSA 3EOAA 5MEOA 4EBQL 3PQYD 3IAQA 4OB5H 3RWCA 1PD6A 3CCHB 4N1HB 1HDMB 4KVCL 1XIWD 3RHWF 4N9GA 1T21B 4PLKC 1BGXH 4J7RA 4P5TC 4G6FB 4OJFL 5F9WC 5TH2B 4NN5B 1WIUA 3WNKA 4KMTL 5LBSH 4OUOA 5D93C 3TZVA 2X4OB 3EO0B 4OD1L 4O58L 3ARVA 4Z7OF 5I75B 1FGNL 4PJXA 4MA8L 3BGMB 3KPNB 2GJZA 5HHXH 4HIXL 5D4QA 3NIDE 1JHLL 3DETC 1OM3H 3X3FH 2UUDH 1KJ2H 2NXYB 1QNZL 4X6CB 4QOKD 2OK0L 2CIKA 2VOTA 4HGMA 2UWEE 3HE6D 2VIRB 2APBA 5E94B 2NY0D 1KN2H 3BPOB 5FHBL 3T3ME 3FONB 4RGNC 1U3YA 4HV8A 1AGEA 5FOJA 5CEZD 3BKJH 2HT4D 4Y4HB 4WFHD 3GJFA 2D4DA 3QDMB 1KC5L 4GMTL 3EOBB 1FL6A 3TPUA 4HEPG 3QG7L 4PYGA 2DWDB 3CSYB 4KROD 3NFPA 1YYMH 4PIRF 2I9TA 1S5IH 5LG1A 1WUNT 1LVEA 1VFBA 3UO1L 1QO3B 4TUKL 4X6DF 2FCBA 5DJ6B 2F8XC 3IS1X 4MB3A 1X5AA 4RMWA 5C0AA 5JXED 1C16A 5DDHB 2MJWA 2WMPA 4Z78A 3S8WA 4M1DL 4UT7L 1TETH 1FN4A 3W9EB 2UYLB 2VZ1A 2XZCL 5D1ZA 4BQ6A 4PGEA 4P3WA 3CC5A 2GIYA 1A9BA 1HHIA 4BUGA 1KELL 2D03H 4HLJA 4P3DA 4XH2A 2ADGA 4YEFA 1PX3A 3W11D 5E1HB 5TDNA 4TSCH 2YD2A 4G6KL 1PG7W 3NPSC 3P11L 1OQXA 4LHUD 4DGIH 4F3FA 2EEAA 4MNHA 1P1ZA 4ZS6D 5C07D 1NFKA 3I50H 4JO1L 2B1AL 5D70H 5HD8D 2EE2A 4XNMA 1N3NB 4KKCD 4UV7H 3I6KB 5EBWA 1UWEH 3LQZA 4JO2H 2PR4H 2CK0L 3BWAA 2H6PA 3WNLA 1AKJB 2NW3A 5CLTA 1A7QH 5T1KA 2NX5B 5BMFH 2ZCHL 4KQ3L 1KIQB 2FATL 3EFFA 3VE0B 3LRSB 1GGBH 4G6FD 1ZHKA 4NRXB 4BFIB 1J8HB 4DUWA 1Y0LB 4LP5A 2GFBA 4HULB 3NCCB 1A3RH 1P4IH 1SQ2N 3RFZC 4I77H 2XI9A 3KPTA 5FGCE 1DVFA 4CW1A 1BF8A 2DM3A 4HFWA 4HIIA 3VMPA 3GJFH 3MLRH 4GG8A 5IIEA 2V2XB 1Z0MA 3QWQB 4CVWA 4G42B 2H2SD 1DL7L 1G9NC 2WWMC 2YK1H 5I74C 4JKMA 1JPGA 4U1MB 2ED9A 4IRSC 4PTTA 2NY5L 4DZ8A 3OF6A 3O4LB 3QEHA 4X0KB 5DMIH 2NXYD 2R2CA 4YXLL 5T1MA 3QRGH 1Q94A 1VADA 4HKXB 3FRPA 4PFEA 3DV6A 7FABL 1R3IL 1P6AB 4GLRI 3SE8H 3NTCL 4PB9H 5J06A 1A3LL 5I1LB 2RGSA 4Y4HD 1G0XA 3QDMD 4N8CL 4JZJA 3HFMH 1X3DA 5IBTH 4UDUB 3BH8B 4M61A 5KSAC 1A14L 1GGIH 4AENA 4X7FC 4P9MH 1IC4H 3L5WA 4RZCA 4MVBD 4XVUC 3QNXB 1BQUA 2OI9C 5EUKA 4U1JA 4X6FB 2DOCA 1A7NH 1P5UA 2X44D 4N9OB 4Y7MA 5HVHC 1MHHA 1Q0XL 4YDIL 4M6ML 5DXWA 5TE7L 3D3VB 2D7TL 1HIML 2XN9D 2FSEA 5IB3B 3E6FB 4HGWA 5IB1B 4NQXA 2XG5A 3UTPD 1N64H 5DO2D 2G2RB 4G5ZH 2O5XL 1N59B 3KVQA 4XPAH 5GRUH 5EB9A 4JPVL 1P7QD 1G7LA 3B3IB 4GW4A 5ID0B 5KJRH 1XCTA 3NIFE 1JF1B 1WCBB 4PJEB 3MUHL 2ZZUT 3SBWA 4KHXH 3FT4B 3KAAA 3BPLB 2X9YA 5B4MC 1JYVA 1UXSB 4PJDE 2R2EB 1M1SA 1AKJD 4Q2ZA 5D96C 1I8MB 1R0AL 2NX5D 4NHCH 3P9LA 4YBQD 3OX8B 1WC7A 3HKFA 4H25A 2Y5EA 3FB6B 3WMSA 5I16B 5KVFL 3IFNH 1J8HD 3Q6GL 3WLWD 3NCYS 3MYJA 3GIVB 4O02H 5DHXB 4OD3L 4MMZC 1KT2B 3SE3C 1FLRH 1J10A 4YE4H 1DQLL 3ZSSA 4L3EA 1A1OB 3QDJA 1BVLA 1WVZA 4LIQL 3QEQA 5K59F 2DQIL 3GMRB 4S1QL 4U1KA 2YRZA 4GW1A 4HMCA 5CILL 2DTSA 3PL6B 3S4SG 4TULH 4FQQB 3O4LD 1WEJH 1K6QL 4NDMB 5GJTL 2VABB 5IB2B 1OB1B 3NPZB 4HKZB 4Y88A 4BSVB 5K9KA 4HUXA 4KJYA 4LKCA 1AH1A 1Q0YL 5D2LB 1TNMA 2A9NH 3Q1SH 4Y5VB 5IFJB 2RJMA 3F7VB 4TVPL 1FZJB 3BE1L 4OFIA 1ZVYA 3VA2C 3NZHL 4LKXB 3EGSB 5I8EA 2GSIA 4YR6A 4CVXA 4QNPE 5T3XH 5EOCJ 4MJ6A 5FUCE 1FFNB 4OLEA 2BRRH 1MCDA 4G6AC 4JO4H 1WCQA 3AFLA 4F15B 1W0WB 5CD5D 4R96A 3TNNA 4FQXC 3S96B 4HAFA 4YEEA 5IBUG 2GUOA 2KUTA 4Q74A 1WWAX 3KJ6L 4QXTB 3D25B 4TN9A 1BQHA 3ARFA 3QAZB 1I7ZB 3ZDXF 1RIUL 4JR9L 3L95B 1QLRA 3V5HA 1U8QB 1DBKL 4LVHC 5JHLH 2C7UA 3D3VD 1Q8MA 3EYUL 2FLBT 3ECBA 1Z3GH 3WS3B 3R0NA 1VGEL 4APQB 3ULVE 1KTLB 3JSSA 1KCSH 1RHHA 1VGKA 2ZSVB 5HGDA 3RIAK 5FA3A 2HRPL 3WV0A 5GRJL 5DJAB 1K4DB 1A1MB 3QHFH 1I85A 4ODHH 3JTSB 3OPZL 4PJBF 3U0TB 3DO7A 2VZVA 5FYKL 1OGAA 5JORB 1L7IL 4U1GC 4XMLL 3DX6A 1S7UA 4RAVA 2X4SB 1BHGA 4JGUA 2FX7H 2ZUUA 5DMJB 1ZSDB 5FXCH 3VG9B 3OKNB 3IFLL 4WJ5A 5GRZA 3L7FA 3WE6A 1HH9A 4BZ1H 3BESR 4HIEA 2QHRH 5IESL 4L8BA 5AD0B 4OZHA 4YGVB 4MNGE 4P5KA 1CS6A 3FQTB 1QKZL 3QO1B 4ZQKB 5TDOB 1FGVL 1NDGB 1KCRL 4IRZL 3P0YH 1HEZA 3CH8A 5B38B 1EAPB 4YX2L 1R3HB 3KPLB 3KPSB 2NYYD 1QFOA 3PL6D 4U4BA 3WJJA 3JTTA 3EFDL 4PP2A 5EBMB 3D18A 5GS1C 4S11A 1MAKA 1X7QA 2GK2A 4PJAB 5EIQA 1AR1D 5DD3L 1QACA 3VWJA 4D9RD 2GKIA 2YUWA 3O0RH 3CLEL 3WNPA 1FO0A 3O11A 1I7RA 4QXGL 5GS3A 3ABZA 2EICA 3VD9A 1IJ9A 2BOCA 5KTEL 3MREA 5HHNA 1WFUA 5E24E 4BQ8A 2FZ3B 4ZS7L 3PNWB 5DA4A 1GJIA 1QSFB 2HWZH 4LSUL 2C4FT 5HI3C 2HT3C 1FVDB 1OAQL 2CJUL 3V5KB 2ZJSL 4OKVA 3AY4C 4NWUH 3C5ZA 1FAIH 5DYOA 4ZO7A 3S35L 4GRWH 3MOAL 3G6DH 2KKQA 1TNNA 2FYYB 5EPMB 5L88H 1PKQA 2PO6A 3ZHKA 4PJGF 1RZ8B 1QSEB 5IF0B 1MRFL 4YDVB 1OQOA 4AL8L 4APQD 4G8GA 5I66A 2CRMA 4GAJH 3Q48A 4OBSA 4G43B 3RY6A 2OTUA 2V5MA 1JUFB 5FKPA 2EYSB 4TTGA 1HSAB 5HYIA 2D7MA 5C0GA 3KYMB 2AK1L 1JTPA 1SVZA 3MCKA 2JB6A 3NACL 4XBPA 3QPXH 5FGSA 5KSUA 1P4LA 5DD6B 4RWYH 2ZUVA 2C5DC 4JVUA 5ITBH 1MNUH 1KJMB 3HAEA 4JZNB 1RU9L 4X8XA 4YHZH 5IKCB 4WWID 3SGJC 2HVKB 3L3DA 1XF4B 4ONOA 4CBPA 1LEIB 4XNYH 3DUHA 4HQQH 1RUAH 4FQ1L 2OJEA 2Z91B 4WUKL 2K7QA 4MAUL 3S5LA 1NC4A 4V2BA 1QP1A 4C58B 1FO0H 5F8RC 4JJ5A 1KB9J 4ZUVA 2VLRA 4X9HA 1NMAL 2MWCA 5I2IB 2J5LC 3WIFB 4JANA 1VACA 2HTKD 4XVJH 3SGKA 2VDPL 5C9JA 1F2QA 3D2UA 3KPSD 4N0FB 2FEEL 5DUBB 4FFYH 1NEZB 2FHBA 3B2VL 3PV6A 1INQB 3MRCA 5IMOB 1U3HC 3RI5F 1D6EB 4HC1L 4LEXH 4F7CB 5DJCB 2YUZA 4ZFFA 5L2JB 1XMWA 3QH3A 2VLKB 3AROA 5CMAA 1T3FB 2DYPA 4EOWL 3BUYA 1RULL 2MTPA 5B39B 5D7IA 3RVXC 1BAFH 4BFGA 5IMLA 4JHAH 5F21B 4ODUB 4PRBB 4KV5E 1PQZA 4GRMA 3UDWA 1S7VA 4OGXH 1QSFD 5C92A 1S5HA 5I6XB 1AD0A 3HG1E 5DVOA 2F58H 4LLMB 4Y4FB 2FBJL 1I8KB 1T7VA 1ZA3B 3GDBA 4UT6L 2O26U 3MPCA 3QUYC 5K9OB 4HJ0C 3HAEH 1QSED 1VEMA 4MWFB 4M03A 2WUCL 5D1ZC 1FIGH 3GJEB 5JIIA 1UCTA 5KBNC 5IJVA 5DHYA 2R39A 3O3EB 4Z76B 3WFDH 2QQLL 2ORBH 5CHNB 3EZ8A 2ZPKL 2GJ6B 5AYUL 5C2BL 1ZGLB 4Q0XL 3UPRB 2C3VB 5C70A 4P2QA 1DBAH 3FRPG 4NSKB 5E5RB 1OSZB 4DCQB 4WTZA 3PWLA 1Q9LA 5EO1B 3UZEA 4MA3A 3WCYA 1NCBH 5LAXA 1LP9B 3GSWB 3TBYB 4NQEB 2E9BA 5EC2B 3UTSA 3QULA 1LILA 3JV6B 3GMMB 1MFCL 1LWRA 2BFVH 2KH2B 2C4XA 2AEQH 3ILPB 2F19L 3VXRE 5E2WH 1FZMB 2A74B 2P48B 4JFPA 4GOSA 3UPAA 3QWOA 1ZMYA 3P73B 2AJXL 1ZHLB 4P3CL 2PKDA 4OGYH 4NYLB 4RGMC 5HHPB 2DM4A 1X5KA 1CXHA 4U1HA 4PV8B 4JN1L 4BQCA 3BZEA 3BKYL 2J88L 1GGUA 1S9WA 5T3ZH 3SGDH 2ZNWA 3F58H 3MNZB 4XVTH 3HS0B 1DZBA 2VLKD 4FQJH 2B1HL 5BS0B 3ARYA 4QHKI 4Q9RH 3VGGA 1SYSB 1IAKA 1V3JA 2ARJB 3L7EB 3QIUB 4ODVL 1DEEB 1ULVA 3R8QA 1INEH 3U79A 5B3NA 2X89A 2NY1B 2DN7A 4JFZL 3MFFA 1A6PA 1WICA 3OR6A 5GRXG 2AJYL 5BRZB 3BQUC 4P2RE 3O2VH 3RWGA 4R0LC 2DLFH 1XF2B 4ZFOB 2KZ1B 4FZ8L 3WLBA 4Y4FD 2EYTA 4PLNC 1Q38A 5D72L 4XB7A 3TO4C 3LMJL 2NY2C 3V4VH 2QSTA 4FFZL 2ZOLB 1CDCA 2RHEA 5FYJD 1D5IL 1NFDB 3HE7A 1XH3B 4JPKL 5T1LA 1UJ3B 4JFDA 2FL5A 3BHBA 3U7YL 1IGYA 1I1YB 2VZSA 1VFUA 2AABL 1S9YA 3TBVB 4YHPA 3C5SB 5IFHL 3GB7B 4L4TE 1JHKL 3IDMA 2GJ6D 3QIBA 5KSBF 5FGBC 3EOTH 5HGHA 2Q8AL 4JFOB 2VUOA 1CG9A 3UJJL 3TJHD 2YEZA 4M6NL 3DGGA 4L9LB 1FE8H 3PQYA 3MYZA 3QYCA 4ZUWB 3ILQD 4K3DL 1XIWA 4Y19B 2OYPA 3JV5A 2W65A 4NQED 5BQ7B 2OR9H 2UZXB 4WCYL 4Z95H 3AM8A 1A22B 4LRNH 4HH8A 1FSKC 2PW1B 5EU5B 5B22A 3T1FB 3MJ7A 1NCCL 5ACLA 3KYAA 3QQ3B 1SJXA 2R69H 3HB3C 2YWZA 5IGXL 4X7TA 4XXDB 1RZJH 3Q0HA 1RIHL 1BQHG 3EDKA 3DPBA 3GIZL 5DWUH 2DKMA 3K8LA 4D94A 4QTIH 4M1CD 3MRFA 1MJUL 1GAFL 4B0MM 4QWWC 3LKRB 3HI1A 3P40A 3AVEA 1AGFA 3VFRA 4JFQA 1K5NA 1G9NL 2IH1B 4N8VB 4O2EA 3O3BA 2XWBA 3HE6A 3DTXA 1QRNE 3ARXA 5HHVL 4PY8J 4P5MB 2Z31C 3B9VA 3BH9A 2A73B 2FX9L 2VDKH 3H42H 1JMZA 2XKUA 5CS7A 5BS0D 4G6JH 2NY6D 4P4KB 3B9KB 1WZ1L 1TCRA 3QIUD 2EDWA 1KGCE 5J89A 3TYFA 2NY1D 4PRNB 4F2MB 4NQVB 4TUOB 1FVEA 1X4YA 2PYFB 2VLJE 1U2HA 3PIQB 2EXYD 1TLKA 1NANI 1ND0B 3T0EE 2IPTL 4NWTH 1S3KL 5JXEA 1JFQL 1FNGB 1K4CA 5DMGC 2VXVH 2MKWA 2R23B 5AZ2L 1YN6A 1QHOA 3CAFA 4CVZA 3FAXA 4KY1H 4E5XA 1VFAB 3LN5B 1U92B 3T2NH 4ONHB 5ANMA 5MI0C 3W39B 1BQLL 4LHUA 3DI2B 3P0VL 3WIHA 2BY0A 3I3EA 4PJFE 1TJHH 2DDQH 1V7NH 1A6TB 2XY2A 5C07A 5IVZB 4KRNA 3OSKA 4UT9H 3MRGA 3FMGH 1P2CB 2C3GA 3MLXL 3VRLE 1M71A 2VZ3A 2E6JA 2GK0A 3STBA 3FOLB 2OR7A 4NC2B 4GKSA 4UB0L 5CSBA 1MCJA 2J8UB 3CCHA 1HDMA 3DVNB 3QCUL 2QR0B 1T21A 4PLOB 4K9EC 5C9KA 4UOJA 3GMPB 2CKBH 1CD8A 1NMBH 4LARL 4WWKB 1A6VL 4OFVA 3RY5A 5TH2A 4P9HH 4D9LL 4LSVH 1HINH 1MJ7H 2BXYA 5L6YH 1FVCB 1I8LA 3LQMA 4KU1A 2ERJB 2X4OA 3EO0A 1GOGA 3H9ZA 4G7YH 4MHHG 2PTVA 2EDTA 5DEZA 4XC3L 3U1SH 5JDSB 1DE4A 3BGMA 1IMHC 2IFFH 3C8DA 4N90E 1ORQB 1FC1A 3PGFH 2JK5B 1OAXH 1OWRM 1FORH 5KN5B 3FZUC 1RUPH 4X6CA 2V5YA 2YBRB 3H7LA 1DTUA 4KI5E 3UC0H 2EO1A 4Z8FL 3MACL 2XIDA 5GS2D 5E94A 3JV0A 1I9JL 1UWXK 3FONA 3VWJC 2MQCA 1QBLH 3SE4A 4Y4HA 2QL1A 4P4KD 1J5OH 3B9KD 4ZUSB 3T3PF 3QDMA 1E6OH 2J2ZA 4LSQL 5DEGB 4AEIH 3EOBA 2X09A 2DWDA 4NZTL 5F9OH 1NCTA 1BOYA 5TJWK 5DD5H 2DQEL 4S1SH 3HAEG 3WIHH 5DJ6A 1XEDA 4F9PC 4KFZC 3GBML 4X7EC 3WFBH 3VG0L 2KBGA 4R26H 5DDHA 2EDHA 3HZMB 1UVQB 1U42A 4JLRB 4MQXC 5I1KL 3MRLB 3W9EA 2UYLA 1MIEH 2HLAB 5K9JL 4M8QB 2Y23A 3F7YB 3BPNB 2BCKB 4OBRA 5CJQL 1LO4H 4YC2C 4RFNB 1MCRA 2XN9A 3C8KB 3KG5A 2AJZA 4LLWB 1JI2A 2DTML 4LCWB 1YMMD 3BEVB 1YEFH 1QSZA 1PY9A 1OVZA 3GI9H 4OCWL 4J3SA 3UPCA 2I9LA 4PJ8B 1G7IA 1P7QA 4PGJA 1Z6JT 3HI6H 1YEEL 4XCFH 3RY6C 2DM2A 3QBTB 5EUOB 1B4JH 2OR8A 2JELL 1ZT1B 1TFHA 3I6KA 2GTZB 3E2HB 3ZT7A 4PD4J 1NCAL 4PJCF 1JNNH 4NNPL 2CR6A 4JY6A 1AKJA 5CINL 4Z6AT 1MH5B 2NX5A 1KIQA 3OB0K 2W9DL 3VE0A 3LRSA 3N50A 3U0PB 1FG2B 4WWKD 4NRXA 2Y6SD 3VJ6B 4BFIA 1J8HA 1Y0LA 1KULA 1AXTL 4Z7VB 3FB7B 3W81A 4LU5L 1H8SA 1HQ4B 4KVNL 1WWWX 1MY7A 1FNHA 3B4NA 2E9IA 2VH5L 2V2XA 4XWOC 5E6IB 1ZVSB 4FA8A 5GRYA 4G42A 5IFAL 5D5MB 4GRLC 4U1MA 3BSZL 1T03L 1IBGL 3MLYL 5JZ7D 3NAAH 1UJTA 3O4LA 5BZWB 5FV2A 4G3YH 1VENA 4HKXA 2DLHA 1DFBH 4PBWD 5IW1A 3C5JA 4OB5L 3KPPB 5I1LA 3ESUF 4PJHF 5A3ID 1G9EA 1NC2B 1Z0NA 25C8L 3R0MA 3OQ3B 1TXKA 1XGTB 3PWPB 3M45A 2XT1B 5KS9B 4GS7C 4UDUA 3BH8A 2PN5A 1BZ9B 4WTZG 5JHDB 4UTBL 1FG9C 1R3KB 1RFDL 3EYSL 1UM6H 4HXBH 2C9AA 1OLLA 1SY6L 2IBGA 3QNXA 2VXTH 3GNMH 3UDWC 4O4YL 1A6WH 4GLRH 5HHXL 5GRVL 3VGBA 4KTDH 3QJHB 2XNAB 1OM3L 3VFGH 4MDIB 3N1FC 1BIHA 3OAYH 2YA2A 1ZT7B 1QUNA 4ZFGH 3D3VA 1X5GA 4JPWH 4PP1D 4YHOL 4M9PA 1UT9A 1NMCC 4WW2B 4KWUA 3E6FA 5EU7C 4LCWD 4OUUB 2GCYB 5IB1A 2HMIC 3KYNB 2G2RA 2RR3A 1N59A 4EJ1C 3ALPA 2VRAA 2RFXB 5I1CL 4PJ8D 1W2KT 4YXHH 1WT5A 2R0KH 3B3IA 5C6TH 5ID0A 2CH8A 2DD8H 1JF1A 1WCBA 4LQ1A 4TVSa 4U33A 4PJEA 3T8XB 1A7PL 3QEUB 1SHMA 3HZVB 3RWIB 3FT4A 4KK9D 2R2EA 1I8MA 3D69B 3VDAA 1OD7A 5I8KL 5EU6E 3RUGF 3QR2A 2YPKB 3OX8A 2BJMH 3HC4H 3UTZB 2LVCA 2R4RH 4N8PA 4CGTA 3FB6A 4GQPH 5I16A 1RJLB 1CZ8H 4JFDE 1A6ZB 4UIKL 4U0RC 2X05A 5D8JH 3GIVA 4KXZH 1GOFA 1OP5K 3HN3A 2D03L 1KT2A 4X98B 1KG0B 4PRDB 3A6CL 2DQHH 1NGWB 3V6OA 4TNWK 3N1MC 5IB5B 1RUMH 2C3HA 1IRAY 5E6ID 3B2UD 1ZT4B 3BP7B 4IJ3C 3GMRA 3VXUB 4J12A 4ZNCD 3NN8B 2DB8A 4H1LG 3I50L 3PL6A 1LDSA 3TBTB 4FQQA 4LPVA 3D39B 4XXCA 2VABA 5IB2A 1OB1A 4UV7L 4X7CC 4HKZA 4BSVA 2X4QB 2C1PA 4HIJB 3PP3K 5D2LA 1RSFA 1UFUA 1F3DJ 4OLWH 3VWKB 3NIDF 4Y5VA 5IFJA 2IJ0C 3F7VA 5I1IH 1JZ2A 5ESAA 4R8WL 1FZJA 2EC9U 1NC2D 2UWEF 5F6HI 3BFOA 4LKXA 3EGSA 3AMLA 3EJZC 2J6EL 2WBWB 2MCPL 4DTGL 4KDWA 3T3MF 3CUPB 1FFNA 1JZ7A 1AO7E 4OQTA 4Z7NE 1RZJC 2CUMA 3KLAB 5JHDD 5ICZA 1R6VA 1W0WA 3ZYZA 3C8HA 3MLRL 3S96A 3GRWL 2A1WH 2AJ3B 4QOKE 2YK1L 4QXTA 3D25A 1XGUB 3L95A 4F57H 1JPST 4XPTL 1U8QA 1BJMA 2OP4L 5DMIL 1NKOA 3GHBH 1LEGA 3MRHB 3QRGL 3TESA 3RAJH 3EKCA 3QXDB 1FPTH 3CGTA 1OPGL 4XP6H 1U9KA 2AJVL 4APQA 1D7FA 4YPGB 1KTLA 3O6MH 3VGDA 4FQCH 3MXVH 3O8XB 2ZSVA 2NY3B 3O3UN 1EHLH 3QUML 1V3MA 5DJAA 1K4DA 1A1MA 3HFML 4TSAH 3S6CA 5IBTL 5E70A 5F88B 4Z0XB 4POZD 1XGPB 1ADQA 1GGIL 3BD5A 4OIIH 3MLSH 4P9ML 1IC4L 3JTSA 3KHOA 1X44A 3U0TA 4ODBD 2CGRL 4RRPA 1U8LB 3SDAD 4KJWC 3DSFH 2X4SA 5EOCL 4MMXC 2OSLB 3V6BR 5IEHA 1ZOXA 4IRJB 5J13C 3DROB 1ZSDA 3MRQB 2X4NB 3OKNA 1CCZA 5EZJA 4TVPD 3L1OL 2E27H 1XIWC 1U0QA 5D1QD 1S78C 5FM5O 5DA0B 3K74B 4N5ED 3TN0B 3EJYD 3FQTA 2VLME 3QO1A 3CU7A 1NDGA 1N64L 1JIBA 1NLDH 5SWZE 3SOBH 4EUPG 4XPAL 5GRUL 1ES0A 5FECB 3BT2H 5K93A 4OQTH 3SKOB 3VXUD 4DVRH 1R3HA 3KPLA 1BMGA 5CUSH 5D7JC 1AQKL 3KPSA 3QQ4B 3V0AC 5EBMA 3D39D 4KHXL 3BN9D 4PJAA 2R1YB 3VWKD 3U4AA 1OP3K 5CSZB 3OKKB 4LHUG 2Q3AA 2JF1A 4NHCL 4OZFG 1OAUH 2NY0C 1WBYA 3LS5L 1J9CT 2WSKA 4OLUH 3IFNL 3MMEB 2HT4C 4K94H 2FZ3A 3RZWA 3PNWA 1QSFA 4RCAA 4X4ME 4YE4L 4JCMA 4YHNB 3S34L 3K0WA 4OAWB 5F7HA 1FVDA 3BXNA 3V5KA 4ZOEA 3HR6A 3GMOB 3VFUB 5MENB 5FYKD 2K3TA 4M7JH 5FDWA 2EDFA 5D2NE 4HG4K 2BNQB 1CGSH 1ADQH 2FYYA 5EPMA 3WDHA 4LPCA 4TSBH 4J2XA 5DFTA 1RZ8A 3PHOB 4OCSH 1QSEA 5EA0H 1JTOA 5IF0A 4YWGH 1KLFA 5CP3A 2QHLA 1RV6X 4YDVA 1TTGA 2Y07H 3KXFB 1VB9A 4O9HL 5DURB 4UU9B 4G43A 4NUJB 4OCRH 1B2WL 2YD9A 1JUFA 1KN4L 3O8XD 1RZ7H 2EYSA 1HSAA 2NY3D 3GSNL 5T3XL 4A2LA 2YUXA 3KYMA 2ZP0T 4JHWL 2BRRL 1VFOA 3FN0L 4HZAA 3C6LB 1TZGL 1RMFH 3MBXL 2FEDD 2OL3L 1KTDA 1OD9A 2XFXB 1KJMA 3LQAH 3NIFF 4JZNA 2DS4A 1F3JB 5IKCA 2ZG3A 5GGTA 5HYFA 1GGCH 1U6AH 2HVKA 1XF4A 4PJDF 1LEIA 1T6VN 3WSQH 1JP5A 3VGEA 5F6IB 2Z91A 5JHLL 2XTJB 1HKLL 3ZKMD 3TN0D 3ROLB 1AGCB 3UTTB 3HPLB 5DLMH 2YZ8A 2N1KA 4NZRH 5I2IA 1H3TA 5BXFB 2NY4B 1S9KC 1CVSC 3KLSA 3D1MC 1MIML 1TJGL 5I75C 1PX4A 3QHFL 4HXAH 4N0FA 5DUBA 1NEZA 3TA3C 1INQA 5IMOA 3MRDB 4G6ML 3AB0B 1SBBA 3B8YA 4P4RB 3AGVA 1D6EA 1WF5A 3FHAA 4ZPTB 3BKML 4F7CA 4NFDA 5DJCA 2NXYC 5L2JA 1JPSH 3QFJE 5IQ9B 3NFNA 3G5ZB 2VLKA 2CDGB 5HYJB 4AG4L 4O5LH 3MO1B 1NSNL 4AT6B 1T3FA 2FX7L 4FRWA 5B39A 2FEEI 2X1PA 4ZO6A 4ZPVB 4ODUA 5CP3H 3SE4C 1B4RA 3C2SA 3H3KA 4PRBA 2QHRL 2P49B 5C08E 4KUZH 2MOVA 4ELKB 2M2DA 3H3PH 2KQMA 4JEGB 1MF2H 4QNPF 3L3HB 4NKOB 3GI8L 1MUJB 5HGAB 3HR5B 4PJ5B 2LTQB 4Y4FA 1GIGL 2Q20A 5F8QC 4MVBC 5FAAA 1ZA3A 5MEND 4ODXB 5EZIL 4JRYE 1CFQB 1RJZA 2BNQD 2F8VA 3JWDH 3O3DB 3L3JB 1ROWA 5L0QB 5K9OA 3MLVH 4X4YB 4XAKE 3L5JA 4MWFA 4EI5C 5GGTH 1MRCH 4AEHH 2H26B 3WS6C 3ULUE 2DQGH 3QWRD 4KHTH 3KXFD 4ELME 3NCMA 4P5TB 5DURD 2A6DA 3O3EA 4Z76A 2QSCL 5F9WB 5CHNA 4CADB 2YUVA 5JIKA 1MPAL 1JWUB 4YBLC 4NJ9H 1HSBB 2BRQA 1MI5E 2GJ6A 3ULVF 5JW5B 1ZGLA 2A0LD 4MXWH 1U8PB 2C3VA 1UM5H 4AEFA 1KEMH 3C6LD 3OZ9L 4NSKA 2DQJL 2QQQA 1CDBA 3S37X 4I0PC 4WFGE 3CDGB 4DKDC 5DJZB 2HWZL 3KPMB 5EO1A 4I18B 3WIIH 2CK0H 3E8UH 1KXVC 4LSPH 4FFWD 1YQVL 4NWUL 1DN2A 3RVVD 3LOWA 4LSRL 4NFCA 5IROC 1LP9A 3GSWA 3TBYA 4D8PB 4NQEA 3G6DL 3QP3A 5EC2A 5SX5K 3JV6A 4YBQC 1MQKL 1NCDH 1T89A 2I5YH 3GMMA 5E8DL 3A6OA 1T1ZB 2XTJD 4K9EL 3QDAA 3T2PA 3WLWC 1MCLA 4RGNB 4M02A 3ILPA 3UTTD 3K4DA 1IGFL 1FZMA 2A74A 2WUBL 4M1GL 1QPXA 4NCC2 4GAJL 4L3CB 5FUCC 3P73A 4QO1A 1ZHLA 4Z7UE 4NYLA 5T33H 5DD0L 4HF5L 5HHPA 1P69B 1UGNA 4IOSD 3AS3A 2DMBA 2GTWB 4CMHC 4ZNEA 4QRRE 1QRKA 4BYHA 1NBVL 1G6RL 3HTLX 4RWYL 1MHPL 5ITBL 5DVMA 1MCPL 3HS0A 4YDJA 3K7UA 4YHZL 5HYJD 4CU8A 2HJLB 1U2CA 4F9LA 1H5BC 5H8DA 3ZKNC 4FXKB 5BS0A 3O6FC 5EC1B 5DC0A 3N06B 2EH7H 1SYSA 2ARJA 3L7EA 5GGSB 3QIUA 1DEEA 4JFFE 1NGQH 1CTOA 5FYJH 3IFOB 4HQQL 3EO9H 3L3IB 32C2B 3B5GA 4XCEB 2ZUTA 1NAML 1FO0L 5DFVD 5LXGL 1J1XL 1LO5B 3NPSB 4JZOB 1HI6B 1XR8A 4PJ5D 4XHJC 5I76A 1XF2A 1BLNB 4NO2B 4ZFOA 5CD5C 3G08A 1KIPB 2AXFB 4PGCB 3DXAB 3AS1A 4FFYL 2G60L 3FKUS 4H5SB 4BZ2H 2D7PA 5GS0C 2IADB 2OLDA 2ZOLA 2HFGL 5JPNB 4JDZB 3IAPA 4LEXL 3FFCE 5GJSH 1XH3A 4HIHB 1UJ3A 1BJ1H 2PNDA 4JRXB 5EO0B 3S36L 4JG0H 4P5TD 1I1YA 3TBVA 1HWGB 3IJHB 4M62H 5E2VL 2XWTA 4LOUD 4DKEL 3C5SA 3S35X 3GB7A 3HHRB 4KKLD 1OSPL 1YNKH 5MHSE 1WK0A 1KB5L 2RB8A 4JFOA 3TP4A 4D9QD 1WT5C 2ILLA 1ONQB 1SMOA 4AQ1B 3RP1A 2HFTA 2Y06H 4X6DB 2YKLH 4U1SA 5I74B 1IGML 4R97C 4ZUWA 3ZKXB 4IRSB 2DM7A 3DETD 3ME0A 4W4OC 5BQ7A 1FNSL 1IILE 5ILTL 1PLGL 3U82B 2NR6D 4CRPA 1MSPA 2PW1A 2Q86B 5EU5A 1FIGL 3T1FA 1KFAH 5LCVL 3QQ3A 4HX1B 4XXDA 3WFDL 4DFIA 4Y89A 4HK0B 3GSUB 2ORBL 4OM0H 5DI8B 4X7DC 1TIUA 1KXQE 2DF3A 5A2LH 3LKRA 3ARWA 4JAMA 3AAZB 3LEXB 2IH1A 4N8VA 3E3QE 3CZFB 2XKSA 2NYYC 4X9FA 2AXGB 2OI9B 4P5MA 3CLFH 5MERA 2A73A 4FFVC 2PYEB 1NCBL 1AR1C 5CAYB 1FYTB 2CQVA 4P4KA 3B9KA 4OQ1A 4YIQB 5GGQH 4PRNA 3SJVB 4X9IA 4M7ZB 4F2MA 4NQVA 4QF1B 2P8PA 4AQOA 4TUOA 1IFHH 2PYFA 4L1HA 3PIQA 4OF8A 4W81A 3EYVB 1N26A 3BW9B 4KV5F 4F15C 3WJLA 4OGYL 4JRWA 1FNGA 3NFSH 1T20B 3DWTA 1BJ1J 1ZLUH 2R23A 3DXAD 1L7TH 3SPVB 4P0DA 5T3ZL 5B8CC 2ADIB 1PW3A 2CRZA 2BNRE 1K3ZA 3F58L 4U1NB 1T0PB 1OAKH 1VFAA 2BY3A 3DX8B 3LN5A 1U92A 1YMMA 4ONHA 5C09B 4NUGL 4JRXD 4FQJL 2Z92B 1WFNA 3LCYA 1BREA 3W39A 5FDYA 5B38G 4Q9RL 1OHQA 4APQC 1INEL 1O0VA 2N56A 4Y2OA 5IVZA 3WFHB 1CDUA 4L4VE 1P2CA 5FUOH 5CJ5A 3SDXE 4LAQL 4Y4KC 3FOMB 3P9MB 1OOAA 3RU8L 5IQ7L 5KVDL 3JUYA 2WWMD 4MLIA 2J8UA 3DVNA 1BECA 3KPRB 4U6VH 2RCSH 1UB6A 2QR0A 1M6OB 3QQNA 4WI4A 2DMKA 3F12B 5FYLD 3GMPA 4XTRD 4WWKA 3QI9C 2XKNB 4NO3B 3TT1H 5GS2H 4BFBD 5A2FA 1FVCA 3PGCA 2YXFA 1DQDL 1OAYH 3DGCR 3O2WL 4G7VH 3SDDC 1F4YH 2DKUA 5JDSA 5HY9B 5J1TC 3QXVA 1ORQA 4JG1H 5AZEH 1QVOB 2W0KA 5KN5A 3EOTL 1JGVL 1A9EB 2R29H 1CXLA 2HTKC 2YBRA 4M6OH 4XVUD 4FQXB 5C0BB 5I1AB 2NY7L 3EDDA 2D2OA 1H8NA 2YPVH 4K3HA 5D9SB 1A64A 2ARWA 3B9AA 4LEOB 2ESVE 3SQOH 4HHAB 1ZEAH 2PYED 1HHGB 4EBQH 4EI6B 4FG6D 1FYTD 4HMEA 3CFEB 4CDHA 4ZUSA 4LVHB 1T4KB 4UQ2B 5DEGA 3TLRA 4Z95L 3SJVD 4OJFH 4LRNL 1N6QL 4C56B 2N7AA 1QHPA 4LSTL 4DN3H 5C1MB 5FFLA 2BERA 2R69L 4ORGB 3VI4E 4OIAA 5JR1H 4OD1H 4OI9A 4O58H 4ONFL 1RZJL 1BFOA 3QUXC 2EEDA 4QTIL 3HZMA 1UVQA 4MB4A 1MFEH 3MRLA 2HLAA 4S0TD 1JHLH 1F6LL 4M8QA 1MELA 5DUML 5B4MD 3F7YA 4LFHD 2BCKA 1A0QL 2OK0H 4U1GB 5HHME 3FO2B 4MJ2A 3RA7L 4OLVH 3C8KA 4LLWA 3C60B 4LCWA 5C09D 3BEVA 5JNYA 5FHBH 1QOKA 4G6JL 4MGXA 1J87A 4PJ8A 3FTGB 4UV4L 1NEZG 1KC5H 3M8OH 4Z7QE 1HHKB 4GMTH 4MDJB 5EUOA 3PV7A 3R1GH 2DWEB 2GTZA 3LH2H 4KMQA 1CR9L 1SEBB 4TUKH 1MH5A 3QIWB 3KPRD 4G9FE 3CMOL 4WFFD 2W92A 4L1DA 4N0YH 1CGWA 4OZGE 5GS1B 3U0PA 1FG2A 1QR4A 1CXIA 3VJ6A 4M1DH 4UT7H 2FH8A 4G8IB 2XZCH 1DANT 1A6UL 4KY1L 4Z7VA 3FB7A 4P2OC 1J8KA 1HQ4A 2NMSA 3G6AB 3QA3B 1ZVSA 5E6IA 3LEVH 2VTFA 5D5MA 1NBZB 1KF9B 1UH4A 1HHJB 4RMUA 4L29B 5BZWA 3FMGL 3SN6N 2VITB 4U1LB 5EBLB 2B1AH 4FQXD 5C0BD 1MLCB 3JWNC 3C9NB 1DQJB 4PJBB 5E7FA 4MQSB 2YPLB 3KPPA 3MJGX 1NGPH 4JM2F 1NC2A 4WU7B 4E42B 3EDEA 2ZCHH 1NMBL 4KQ3H 2FATH 1XGTA 4M3KB 3TBWA 3RVWC 5KS9A 4LSVL 2PCPB 1HINL 4E41E 4C56D 5L6YL 1BZ9A 4ERSH 5JHDA 4KRPC 1R3KA 1UKSA 5CEZL 4LLVB 1NCNA 1JJUA 5FCUL 3L6FB 4G7YL 3WO4C 3ZT5A 3MROA 3MGTB 1EA9C 4I0KA 1QBAA 5ID1B 2D9QB 2VAJA 1DL7H 5IW3A 2XNAA 3GSRA 1UZ8B 1BD2B 1RUPL 4Y4FC 5LJYH 4GMSL 2NY5H 4XBEH 4K7PX 4LLYB 4JGMA 1UCBH 4WW2A 2N7BA 3C60D 1R3IH 4OUUA 2GCYA 4TQEH 1IQDB 1MCBA 3IDGB 4HPOL 3NTCH 1QBLL 1TDQA 2RFXA 1MCWW 1J5OL 3V4PL 1E6OL 3OB0H 4A6YL 5BRZE 4AEIL 2YR3A 3PABB 2EDYA 2B39A 2DQFB 3LB6C 4WRLA 1B90A 3T8XA 3QEUA 3HZVA 3RWIA 1A14H 4AIOA 4PJFF 4QKXB 3W5NA 1JGDB 3SDAA 1F4WL 3D69A 1ZHBB 2JJUA 3QIWD 4R26L 1RZKH 1U8NB 4JFEE 3UTZA 1NFDE 2LE9A 4JM2C 1RJLA 1U3HB 1CLYH 4PJGB 5D1QA 1PKOA 1P84K 4M6MH 5TE7H 3HUJE 1LE9B 4U1IB 4WI3A 4X98A 1BX2B 1KG0A 1T89C 4PRDA 5E8EB 2D7TH 3QFDB 5CJ8A 1NGWA 5IB5A 1VESA 3GI9L 4WUUB 1NH6A 1HYRC 2O5XH 3BP7A 1DJSA 1OARL 2JIXB 3VGFA 3HI6L 4JPVH 4XCFL 1I9IH 3TBTA 3D39A 5BV7C 4OGZA 4V1DE 4Y19E 5JW3L 2X4QA 4HIJA 2HT3D 2R1WB 4PJ7E 3VWKA 1JNNL 1YEKL 2YPLD 4X80H 2H1PH 3BO8B 4LSSL 3QUYB 1K2DB 4KI5F 2BSED 1R0AH 1UQSB 3DV4B 5C0AB 3W0WE 4Z78B 4F9LC 2EH8H 3CUPA 3WKMH 1BQSA 1C7TA 5KVFH 2NY6C 5MEQB 3Q6GH 2VDNH 4U3CA 3IU4H 3MX0A 3KLAA 3QUMB 1UB5B 3UTOA 3VFNB 3LRGA 1T04B 3RGVC 2AJ3A 4ZUTB 4QGYA 5CEYB 4HUMB 4LIQH 2DQIH 1M7DB 4S1QH 2AK4E 4RNRB 1BD2D 5CILH 3SQBA 3MRHA 5GJTH 1K6QH 3QXDA 1I7TA 3DX7B 4OI8A 4YQXL 3RQ3A 2BDNL 4ZTOH 1Q0YH 4FABH 2ZOKB 4MJ5B 4RGOH 5I1JH 5DJ8A 4YPGA 3RWDB 2NW3B 1MFDL 4TVPH 3BE1H 3VD5A 3K2MC 3O8XA 4FN0A 4OSUH 4N8VG 4M7LT 5F88A 4Z0XA 3F7QA 3MZGB 1XGPA 4HXBL 1OP5H 4RBPK 3ZL4L 1CT8B 4X4XB 2WQ8A 5EN2B 5L8KB 4ZSOE 1M05B 1U8LA 2VXTL 2H2PD 4RGMB 3MV9B 4N1EA 1EJOL 3D9AH 4F80A 1A6WL 1IGIL 2P5ED 2OSLA 4OT1L 4OF6A 3DROA 3L3KB 3MRQA 1TVBB 4KTDL 2X4NA 4KI5C 1RI8A 4PBVC 1RIUH 1U3HD 2X7LB 5IUSA 3QEHB 3WHXB 5E6ZA 1KYOJ 1DBKH 5T1MB 2B5IC 4JPWL 4PV9A 3TN0A 3I3DA 1OT2A 3PP3H 4L8CB 4NKDB 1MHCB 2PXYC 3TM6A 5JA8B 1VGEH 3RVXD 4WUUD 4CMMB 3RPIB 5FECA 2VXQH 2LV4A 3SKOA 2JIXD 4DAGL 3T08A 1CE6B 3QQ4A 5GRJH 4OTXH 3BQUB 3NMEA 3P30H 4M61B 1P9MC 4KUCF 4E0RB 4R0LB 4WTXA 4C54A 5CSZA 3OKKA 4X5WB 4XCNB 1NFIB 1B6UA 5FYKH 5J56B 2BVEA 2ZKHL 4MNQB 3QUYD 4XMLH 4R4NC 3TO4B 1CVRA 2NY2B 3QDGE 4KTEL 4HJ0D 4RISL 2DLGA 4WNQB 3MMEA 5I30H 2IG2H 6FABL 2VLLB 3IFLH 5D8JL 4P4KC 3DARA 5SWSD 3GSNB 1O7VA 4FZEH 4L8SC 4XC1L 4YHNA 2YD4A 5SWQB 1QKZH 1RIVH 1RUML 4NQXB 4OAWA 1FGVH 1CN4A 1KCRH 4IRZH 4BH7A 3LPWA 2V5RA 3GMOA 3VFUA 2OL3B 2ICES 5MENA 4LCIH 2R2HB 2IH3B 1UKTA 2YRPA 2BNQA 4D0BB 4YX2H 3WJLC 2FIKB 4XB8A 3EFDH 1A5FL 2Y72A 3PHOA 2IMMA 5TQ2L 2EKSA 1FNLA 5J8OA 4GG6B 4OLWL 5DD3H 2GW5A 5GS0L 4JY5L 3FQWB 4ZMAT 3QWRA 1INDH 2D31B 3KXFA 3OJMB 4KMLB 5I1IL 3CLEH 3K80A 4UU9A 4NUJA 4HS8L 3QCTH 1ETZB 3LVEA 4CKVX 4QXGH 4X6BA 3RZCC 4IMKA 5C0CB 3IS0X 5GGRA 3C6LA 5KTEH 4I4WB 1NUDA 2DICA 4QEGA 2AEPH 4PRPB 4ZS7H 2ADFL 1WZLA 3ROOB 3A0OA 1F3JA 3MV9D 3GMQB 2A1WL 2XQYG 3HNTH 3QO0A 4LSUH 4HC1A 2CJUH 2ZJSH 3DIFB 3U30B 4NRZB 1MCIA 3RAJL 4RDQG 2VDRL 4NQCE 2Z31B 4WWKC 5JUEH 4AK1A 3ROLA 4KJYB 1MRFH 3X13B 5INCB 3UTTA 5AAWA 4AL8H 3QHZL 3HPLA 1OP3H 3DUUB 5JOPE 4FQCL 3MXVL 5BXFA 2HFFB 4Y1AB 4HS6B 5KSBB 4MJIE 4U6TA 2AK1H 3BQUD 3MRDA 1NAKL 4NQDD 5CJXA 1C5CL 5JZ7C 4NM4L 4DJMA 3FO1B 3ZLQC 5IQ9A 3G5ZA 3TNNB 2CDGA 5HYJA 1HXYB 3DSFL 3MO1A 2Q8BL 3DRQB 2XV6B 4AT6A 4MNQD 3P9WB 3T0WA 3TO4D 1IKNC 3DHJA 1U41A 2NY2D 1Q72L 1HILB 2BVOB 4ZPVA 4JDTL 2E27L 3REVB 5A3IC 1O7SA 1QLRB 3V5HB 3WD5L 4FQ1H 1QG3A 4WUKH 4ELKA 4MAUH 1T66D 3L3HA 4NKOA 5HGAA 1NLDL 3HR5A 4PJ5A 1NLBH 4M7LH 3IAGC 4HFUH 1ZE3C 5SX4H 4Z7NF 1NMAH 2P44B 2COQA 3BD3A 4DVRL 4ODXA 4U6HB 1MRDL 3BZDA 1CFQA 3O3DA 2YC1B 4LVEA 3L3JA 2K1MA 1L4IA 4X4YA 1JK8B 5DD1H 4P46C 1TTFA 2H26A 1KJ3L 4W6WB 3PWPE 1EPFA 4HC1H 1MVUB 4ZTPL 5A16B 1Z9LA 4LMQE 5ISZE 2X4TB 1MREH 1OAUL 4PP1C 4YXKH 1JPTH 4P5TA 4RFNC 1KTRL 4Q58C 4RAVB 4XP5L 4J23A 3F6IA 4CADA 5D7KD 2EC8A 4EOWH 3CIQA 4HUUB 1JWUA 1RULH 4OLUL 1HSBA 2JJWA 5JW5A 5C0CD 1PJ9A 1KNOB 5DJ2B 4Z0BL 3HB3D 4L8BB 4PRPD 1JMXA 3S3SA 5DJZA 3KPMA 4I18A 1F58L 2YMXH 1BOGA 4QWWD 1G6RB 3X17A 1J0IA 4D8PA 2VYRE 4UT6H 4K23L 1T1ZA 4G8EB 4OCSL 3P2TA 2Z31D 1CFNB 4X5XB 2ZUQC 1SJEB 2XACC 4QHMA 3NCBB 2Y07L 3PP4H 4IMLA 3CH1B 4L3CA 4PRIB 2V6HA 1NAMB 1FO0B 1K85A 4LGSB 2DQUH 2QQLH 4HWZB 4Y1AD 5E6IC 5F44A 4LLQB 2GTWA 4PYHA 5AYUH 5C2BH 1JWMB 2BOCB 5ACMA 4Q0XH 1FFRA 5HDBE 2IANE 4HT1L 4HG4J 1RZKC 3O6LL 1OCWL 1BEYH 5E9DB 1WWCA 2HJLA 1GGCL 5DMGD 3RWFB 2VXUH 4FXKA 5EC1A 4DKAA 2IWGA 3VH8G 5GGSA 4L3AA 4JGJA 2CKNA 3IYLW 2D7OA 3DNKA 5EIVA 3LN4B 3WSQL 3IFOA 2YA1A 1H9VA 5CBAA 4YC2B 3L3IA 1PGRB 1MCSA 32C2A 1MFCH 4XCEA 2DL9A 1LO5A 3VXUE 1FL5B 2JCCE 1XGQB 4JZOA 2F19H 5ICXB 1KB5B 1HI6A 5E5MB 1N0XH 1RPQA 4NZRL 1BLNA 2A6KB 4NO2A 3Q2CA 1KIPA 2AXFA 5I66B 2AJXH 3T0AA 3DBXB 4P3CH 3FQNB 4BH8B 4PGCA 3DXAA 2FWOB 2D7QA 2B0SL 4H5SA 4AIZB 4JN1H 2IADA 3MV7E 3BKYH 2J88H 4XBPB 5JPNA 1B0GB 5TFSL 4JDZA 4LK4A 5F7LB 4EEEA 3MRBB 5DJXA 4JRXA 4O5LL 2KZWA 5F3HA 4DEPB 1MJJB 5BVJB 1CE1H 1UZ6E 1J12A 2RAMA 5JW4R 4NCDA 4ODVH 1G7MB 4WI6A 5SX5H 2XOTA 2I60L 1HXMB 3H3PL 4UQ3B 1ONQA 1CD1B 1A4KB 2AJYH 2PF6A 3OWEA 4X6DA 2FBOJ 3MUZ1 4ZUVB 4OFPA 3I6GB 1CDHA 2EDXA 4GRLB 3PF2A 3VI3E 1A7OH 5TE6L 3FZUD 3SDAC 1BIIB 5D72H 3LMJH 5ELIA 3V8OA 2Q86A 4PJIA 1MRCL 5T5NG 4AEHL 3VXSB 1CDJA 1D5IH 5D1QC 5FB8B 2VN4A 2DQGL 4HX1A 5HHOE 1X5HA 4PRID 2P42B 4HK0A 3GSUA 5DI8A 3BUYB 2CLVB 4NJ9L 2AABH 3G5VB 5IFHH 4MXWL 1JHKH 3G5YB 4WVRA 1KEML 3LEXA 2Y36L 3CFJB 3CZFA 4GKZB 2Q8AH 4WY7H 2AXGA 4PJCB 4XBGB 4OFKA 4M6NH 5E9DD 2PYEA 5D2NC 5TF0A 5D7LE 5IHZB 1FYTA 4K3DH 4YIQA 3O81A 4I9WD 2W0LA 3QEGH 3SJVA 3K46A 1NCDL 4Z7WE 4QF1A 4WCYH 1NMCB 1JVKA 1YEDB 5A40E 5F3BB 4D0DB 1MAMH 3OKEB 4FMFA 3IXTB 3E1F1 3EYVA 1M7XA 1NCCH 3BW9A 5CJBA 2OTWB 3J8F7 1JN6B 1N5YH 1D9KD 1RIHH 2M26A 2J7LA 2YD6A 3GIZH 4PUBL 3MGAA 1K8IB 2ADIA 4HWBA 3PHQB 4P2QB 3JUZA 4U1NA 2JE8A 1G9NH 1NEUA 3K2UL 5E8PB 2Y4SA 3DX8A 5HHVH 5HI4C 2FO4B 5FYLH 2Z92A 2GHWB 2MPAL 4PJHB 2CLZB 5I19H 1NGQL 3U2SB 1CGXA 3ULUF 5EDXA 2M8XA 1A4JB 4ELMF 3EO9L 1WZMA 5DTFB 3SE3A 1J0JA 2NY3C 3FOMA 3KPOB 3P9MA 3T2OA 4XWOD 3P4MB 1KCKA 1WFTA 1EGJA 1BM3L 4GRLD 2FEDC 3KPRA 1M6OA 2IPTH 5GSRB 3F12A 5C0EB 1JFQH 4OIBA 4PY8I 1D5BB 4AMKH 2XKNA 4BZ2L 4NO3A 1YDPB 2DQDH 3PWVB 4PGZA 4DKFH 3ZE2E 1CDGA 5AZ2H 4EKXA 2EYRB 2FB4H 3VXSD 3L3OB 2P5WB 4XNUL 3WUWG 2D3VA 1LGVA 1DBML 1JGLL 1RK1B 2X4RB 5SV3A 3H9SB 4K8RD 3P0VH 4NQTA 4F7EB 1YJDC 1N8ZB 2WNGA 1QVOA 4XZUB 3MGOB 1ZTXL 1A9EA 5B3JE 3WFCH 4Z7UF 1F8TL 4EIZC 4FQXA 3OR7B 5C0BA 3MLXH 2Y06L 1CI5A 3CFCH 5D9SA 3CDFA 4LEOA 4FS0A 1HNGA 2L7UA 5BV7L 4HHAA 3RUGB 1HHGA 4UB0H 4EI6A 4MXVE 3CFEA 3QCUH 4HWBH 1T4KA 3IFPB 1OAZL 4PRHE 5DSCB 4LARH 3VD3A 3CNKA 2EE6A 1A6VH 4C56A 1CTNA 3CFKB 4D9LH 2HMID 1KFAL 3RTQC 3RY4A 1JBJA 4ORGA 2BZDA 5CP7B 4YPJA 5I15H 4DW2L 4OM0L 4KZDL 5I1HL 4HLZH 1S9YB 2E6QA 3OXRB 1DLFL 2WBJB 4XPGH 3ARQA 3Q3GB 4GAGH 2RQ8A 4EXPX 4JFYA 4WU5B 4ZYKB 3MSPA 1EGJH 3FO2A 4JN2B 1DDHA 4Z8FH 1FFPB 3C60A 3LKNB 5J13B 1KTKE 5DK0B 5F1OB 2ADJB 4KK5C 3MV8D 4IBLT 2UWEB 3BRDA 3NOIA 1XIWB 1G84A 4U2ZA 3VXPB 1QBBA 3FTGA 4HPYH 5GGQL 2AP2A 4QGTA 4MDJA 1CQKA 5KVGH 2NZIA 2BVUA 1AHWC 2DWEA 2O61B 2A0LC 1SEBA 3EZJB 3FN3A 4KKNA 2DQEH 4I1NB 1E4KC 5HVFB 1OF2B 4EDWL 3QIWA 3GBMH 5D7JB 3NFSL 3W2DL 1MCHA 5GS1A 4J3OC 3QNZB 1QR1B 4NZJA 4UINH 2NTFB 3MRFB 4FFWC 1Z9SA 4PD4K 1E0OB 4G8IA 5K9JH 2JB5H 1K5NB 3MLUL 5CKGA 1WIPA 3WDIA 1UYWL 2A83B 5CJQH 5ALBH 1AXSB 1RD6A 2P5WD 2NY0B 5E7BA 4XPFL 2DTMH 1ZA6B 3G6AA 3QA3A 1G0DA 3EJZD 3H9SD 4OCWH 4H0GA 2F15A 1SY6A 4MA1C 2E7CA 4EQ3A 4L29A 5IR1B 2VITA 4U1LA 4JY4B 1Q9KB 4FQHB 2F5BH 4FP8H 5C6PB 2JELH 4WDIB 3C9NA 1AP2B 1DQJA 4OGAC 2V5TA 4LPWA 1C08A 4PJBA 2YPLA 4NNPH 5CJXC 5L2KE 3AXLB 2RCSL 4WU7A 4E42A 5IBLC 3V0WL 4RGNE 3N1QC 1GH7A 3CX2A 3L9RB 2PCPA 4A6YB 3MJ8B 3ORJA 2QQKL 4LLVA 4YDLB 1OAYL 1AXTH 4LU5H 3L6FA 5IWLA 4CL7A 4KVNH 5DFVC 1PEWA 1EMTH 1PEZA 3MGTA 2Z8RA 5FGCB 4JG1L 5ID1A 5J0BA 5IFAH 5DJ0B 2LTQC 3MOBL 2WBJD 1UZ8A 1BD2A 1T03H 5KVMC 3S3JA 1IBGH 4M6OL 4LLYA 2V2TB 2YZ1A 2ICWJ 3MXWL 4KJWD 3F62A 4W68A 5L8LB 3SGJA 5FO9B 2WIIB 3FB8B 2WM0A 4ESKA 2Y5TB 4ZDHB 4NGHH 25C8H 1S78D 1HWHB 4KJQD 1RZIB 3PABA 3WDJA 3BMVA 2DQFA 5AYQA 4Z7OE 4LOUC 1YN7B 1OW0A 3TH2T 4JFHE 4KKLC 4DN3L 4UTBH 1JGDA 3EYSH 1RFDH 5C0DB 5JR1L 2F54E 3VDCA 1ZHBA 3ZDYE 3QQ9C 1SY6H 2DJ4A 3SDXF 2P5EA 5D7JD 1KJVB 4O4YH 1U8NA 5GZNC 4I18C 1DE4B 1QZ1A 1U58B 3TA3B 1MFEL 2UV3A 3RIFK 1EFQA 1U3HA 2LQRA 4XNXL 3N85H 3VD4A 2VZTA 2AEIT 4PJGA 3FL7A 1FP5A 2BVQB 1KIRB 3BAEH 3IF1A 5F7NC 1LE9A 2J6EA 4U1IA 1KCLA 5H37H 4OLVL 1BX2A 5E8EA 3QFDA 4YHOH 2NR6C 1B88A 1XGYH 2ZSWB 5CIPB 4LBEB 4WUUA 3QB7C 3MRPB 4UTAH 4OZIE 2P24B 2G5RA 3SHSA 4MS8D 3IJYB 2JIXA 3MA9H 5I1CH 1RUQH 3GRWA 4N0UA 1YA5A 3M8OL 2J1KA 2D0HA 2Q6WB 3R1GL 4LCYA 2YD3A 3PDOB 2BSTB 3LH2L 1A7PH 2R1WA 3WXVH 1PYWB 3BYTA 3BO8A 5HYEA 1J1OL 3QUYA 1K2DA 4GAYB 1F6AB 1UQSA 3DV4A 5I8KH 3QRFM 2YD5A 4N0YL 4PJDB 1A02N 2G5BB 35C8L 4EI5B 4YHML 5MEQA 4LSDA 3O6KH 4EXKA 2DL2A 4UIKH 2AV1B 5SWSA 3QUMA 1UB5A 4PJIF 4DK6A 3GK8H 3VFNA 1F97A 1HYSC 2XN9B 2AJZB 3A6CH 1T04A 5IVXE 3LEVL 4YBLB 3ETBF 4QHNB 5IT2H 4NM8L 1U8JB 4ZUTA 5CEYA 3UYRH 3GO1L 4Q7DA 2I9LB 1G7IB 1EEQA 1M7DA 1P7QB 4UNTA 5FO7B 3RVUC 4RNRA 4GO6B 1NUGA 3VI4F 4I0PB 4FTVE 3KS0H 3SKMB 3DX7A 1M7IB 1J05B 2HRLA 2ZOKA 4MJ5A 4ONGH 1MLBB 4JY6B 2QQNH 3RWDA 1NGPL 1VFMA 2I27N 4FQIL 5EOQL 4R8WH 1J11A 4OCMC 1ED3B 3WUZA 4R7NB 2J6EH 2MCPH 4DTGH 3B6SB 4NO5B 4I3RL 2EDNA 4ERSL 2Q7YA 1Q1JL 1ORSA 1CT8A 4X4XA 4I2XE 5EN2A 5AWNL 5C7XH 3W5MA 3ZE1E 1M05A 3MV9A 3GRWH 3D85B 3OTTA 3L3KA 1TVBA 3K8KA 2O5YH 3TA3D 2V2WA 5M95B 4J3XA 4CMHB 1GHFL 3ZKXC 5C09E 1RQ5A 2X7LA 4NKIL 4XBEL 4XPTH 3WHXA 2OP4H 4XTRC 3G04B 4KZEH 3AMKA 4OZGF 3VFOB 1LO0H 1UCBL 4XX1G 1TMCB 1H5BB 4L8CA 5IW1B 1OPGH 3CXHK 4NKDA 1MHCA 3O6FB 2AJVH 4TQEL 3C5JB 2VZOA 2W0PA 2DBLH 3GSQB 3U4BL 4CMMA 3RPIA 1EFXD 3LHPH 2X70B 4EN3D 3LAFA 3MCLL 5I1DB 5EWIL 1CE6A 3QUMH 2UUDK 1YPZE 4LFHG 5J6GB 2L7JA 3BQUA 3NCJL 3BKCL 4NO0B 4B41A 4NPYB 3JZ7A 4NQDA 4E0RA 5JQ6L 4R0LA 5ADOH 1W72L 3T65B 4X5WA 4XCNA 1E27B 1NFIA 2CGRH 1U8OA 2BY1A 3T77B 4RMTA 4MNQA 1RZKL 4Y8AA 3TO4A 5EOCH 1VHPA 1ZWIB 4YUEL 1V7MH 4WNQA 3ZT6A 4AJ0A 4HLZG 1GZQB 1CLYL 4FG6C 3FO9B 3FCTB 2VLLA 3L1OH 3BIAX 4CNIB 4EI5D 1C1EL 1UA6L 4OLZL 3GSNA 2IBZY 4M7ZC 3I02B 3KS0J 2W1NA 4RAUB 3G6JE 5SWQA 4QTHB 4MA7H 4R9HA 2X42A 2F53E 2OL3A 5FGBA 2R2HA 1I3UA 2IH3A 1I9IL 2ZUWA 4D0BA 4KXZI 1CLOL 4I0PD 4ZO9A 5MEPB 1AQKH 2FIKA 1NBYB 4ZAKC 3SCMB 5DRNB 2LFGA 4Q97A 4GG6A 4R97B 4D3CL 3NZ8B 3M07A 1RJYA 3PWNB 3FQWA 1T5XB 2Z0BA 2D31A 4X80L 2FR4B 2H1PL 1P84J 1YNLL 4W70A 3VXME 1ETZA 3DX9B 3TWCH 2ITCB 3LS5H 5C0NC 2EH8L 3WKML 4PG9B 4XRCB 4QY8B 5C0CA 2VDNL 1QD0A 3IU4L 2XWJB 4I4WA 2QBWA 3CSBA 3BZ4B 4PRPA 3GKWL 3ROOA 1CFSB 3GMQA 1MCNA 3S34H 3FO0H 2VERN 3D85D 4JQXA 3DIFA 1S7RB 4MZ2A 4NRZA 3F65A 2EDJA 2Z31A 1N2RB 5KW9L 5IJKA 3MJ9L 2X9XA 3X13A 2C1PB 3ARTA 4FABL 5INCA 4RGOL 4WHTB 3ZKND 3GJFK 1IAMA 2J4WH 3BDYH 3O6FD 5I1JL 3HNVL 2MMXA 3DUUA 1IL1B 5ESAB 3I75B 3HUJF 2AQ3A 4O9HH 1B2WH 1UXWB 2HFFA 4Y1AA 1H3PL 1KN4H 2DIBA 1N7MH 4OSUL 4HS6A 3GSNH 3ULVD 5KSBA 4XI5C 4JHWH 3SO3C 2WANA 3FN0H 4NO0D 3QG6A 3G9VA 4XHJD 1TZGH 2J8OA 5ICZB 2X1OA 4J3WA 1JWSB 3GBLA 3MBXH 4NZUL 3FO1A 2OL3H 4DWHA 5CCKL 1HXYA 1PFCA 3D9AL 3DRQA 4QRPE 3RX7A 5IMKA 4PJ7F 5B8CB 5GS0D 2A6JB 1HILA 2BVOA 3REVA 5T5FL 4JVWA 1LEGB 4EZMA 1EVTC 1HKLH 4K2UL 4ZOAA 1IAIH 2XA3A 5IB4B 4JKKA 4NC1C 5DS8B 2VXQL 4Y8DC 1UM4L 3INUL 1I8IB 4U6HA 5DZOA 5EIIB 2YC1A 4Y4KB 3E6HA 1MIMH 1TJGH 4OTXL 1GL4B 4NBXB 3P30L 4OF3A 3SCMD 1JK8A 2MQ3A 3DO3A 4G6MH 2IEPA 1FQ9C 4NHUB 3BP6B 3BGFC 5F1NB 1MVUA 3BKMH 5A16A 3GFUA 2X4TA 4AG4H 3QI9B 1NSNH 5J1AA 4HCRA 3C60C 5IEHB 4HUUA 2AW2A 1DN0B 2HH0H 5EZJB 5I30L 2IG2L 2UZIL 2VDLL 5DK3A 4Z9KB 5L7XL 1GC1C 5EO9B 1KNOA 3P4NB 5DJ2A 5CEXA 5GXBB 3OJ2C 4FZEL 4H0HB 3SDDB 4S1DD 5GQBA 5H37G 1RIVL 5EZOL 2MKLC 3GI8H 5BZDA 5GISH 4U05A 1G6RA 1ES0B 4LCIL 5ALCH 1GIGH 4JCLA 1E28B 2EDBA 3QIWC 5EZIH 4I3GA 1WAAE 3HG1B 4GBXB 1ITCA 4P99A 3S97C 4G8EA 3PWJB 1CFNA 4X5XA 3OXSB 1SJEA 4FFVD 4ZFZB 1CFTB 5J1SC 1INDL 2XZQL 4NQSA 3CH1A 4PRIA 4Z77A 2YD8A 2XG4A 1NAMA 3QCTL 3SEPA 1IC7L 1U8MB 1WBYB 2JTDA 2QSCH 4HWZA 5J57B 4WHCA 5F7MC 2R9HC 5I9QC 1MPAH 2YD7A 4LLQA 3U7AA 4ETQB 1H3GA 1ODAA 3SKJL 1JWMA 2I24N 4I8DA 1YJDL 3OZ9H 2AEPL 4PJXE 2DQJH 4F9PA 3QUXB 5F9DC 5TF1L 2QEJA 5E9DA 2EDLA 3QZWB 3MCG1 3HNTL 2XYCA 1EH9A 3S9DB 1JNLL 3BXNB 4KQ4H 3RWFA 4O51B 1YQVH 3QDHA 1EVUA 1SBSL 4LSRH 2ZWLT 5IHBA 1U3JA 4LDEB 3LN4A 5FDWB 1EO7A 5JMRA 1IKFL 1T7ZA 3ES6B 2P47B 1MQKH 4HH9B 5E8DH 5F6HJ 5JUEL 4K9EH 5EU4B 3NBNA 2W38A 1FL5A 1XGQA 4FXGB 4HCRH 5ICXA 3IRZA 1KB5A 4R3SB 1IGFH 2ITDB 5E5MA 2A6KA 4CDGC 2WUBH 4M1GH 1D9KA 2D0FA 3DBXA 5IWLC 3FQNA 4BH8A 5I73C 3VXRB 3KLHC 4LL9A 5DD0H 4HF5H 2FWOA 5JOFB 1IARB 4Y4KD 2VXSH 4BUHA 4AIZA 4O00A 4WEMB 5IW6B 3UYPA 3UJIL 1B0GA 5C0AE 3OJVC 4PGBA 3FFDB 3O45B 1EERB 1NBVH 5EU3B 1G6RH 1KTDB 3MRBA 3VMNA 1MHPH 5L9DL 2NW2B 1MCPH 1UWGH 2IAMB 1MJJA 3PDGA 3QI9D 5BVJA 3U4EB 4RQQB 3CSGA 1G7MA 1QPPA 2FHFA 4P2OB 1HXMA 4UQ3A 4RAHA 4IOIB 3PDDA 5IVNA 1CD1A 1A4KA 5TPWL 3SDDD 1NAMH 4YAQB 5LXGH 1J1XH 1JZ4A 1OW0C 1NLBL 4M7LL 3I6GA 1BFSA 4HFUL 4GRLA 3U6RB 1F4AA 4YK4C 1PVHA 3QUKA 2H2PC 1BIIA 4P2RB 1T22B 3HG1D 4GBXD 4JO3H 1JYWA 3ULSB 2G60H 3MLTB 4JKLA 5DD1L 4ZODA 3V7MA 2HFGH 3VXSA 3NA9H 5FB8A 1I4FA 3RX5A 3QXTA 3NFNB 1MREL 2C1OB 4YXKL 1JPTL 3TT3L 3TF7C 3THML 3TV3L 3S36H 1R3JB 2W59A 1BBJB 2NLJA 2CLVA 3G5VA 3GSOB 4IOFC 1WWBX 2CR3A 5E2VH 4DKEH 3G5YA 4KRPB 2APFA 1OSPH 3KJ4C 3OJDB 4OD2A 3CFJA 1KB5H 4GKZA 1RUKH 1EEYB 1P7HL 4L4TB 4OCLC 3WO4B 3QUXD 4PJCA 4XBGA 3ZHDA 3TIDB 2YMXL 4TNVK 2DAVA 2Z4QB 1IGMH 5IHZA 2KDGA 3FB5B 4KKAD 1KV3A 3VFTB 1MFNA 2C3WA 3GGWB 2BY2A 1RJZB 1FNSH 5INDB 4GKNB 5ILTH 1PLGH 1YEDA 4F7MB 1T1XB 4KAQL 1F2XK 5F3BA 2WBKA 4D0DA 1JE6A 4YFEA 3OKEA 3PP4L 5GZOD 3MRKB 2BVPB 3IXTA 4OM1L 3VD7A 4X8JB 5LCVH 2OTWA 5TE4H 3U0WL 1JN6A 2A6DB 2DQUL 3KYKL 3LY6A 3VXRD 1W0VB 1LK3L 4AZ8A 1MOEA 1K8IA 1CU4L 3PHQA 4RMVA 5E8PA 1N0LA 4M6AA 1BEYL 1SMAA 2FO4A 4M00A 2IAMD 2VXUL 3MV8A 4PJHA 1CXKA 4QRUB 4JM2B 1QRNB 2FHCA 2CLZA 5T3XE 4F8QA 4OLXL 1IZKA 3O41B 3U2SA 1K3IA 1A4JA 2EXWC 4UUJB 5DTFA 4P2OD 3VFVB 1HH6B 2QTEA 2E6PA 4NFBA 3UZQA 3KPOA 3DMMC 3P4MA 1VKXB 4K8RH 2NZ9C 1N0XL 4UOW1 4YJZL 4WFEE 3BP5A 4GSDH 2VLJB 2AGJL 5GSRA 1IT9H 5C0EA 4IDJL 4P2RD 4F33B 1D5BA 5BV7B 4ORZC 1YDPA 4U3HA 3T0EB 1K8DB 3PWVA 5DRXA 2EYRA 4BSJA 1E4JA 3HRZB 4GG6F 3L3OA 3U7WL 2P5WA 1VPOL 4HK3J 5HPMB 4YDJB 4NUGH 1CE1L 1RK1A 2X4RA 3H9SA 2DIJA 3RVWD 3MRRB 2NY6B 1Y6MR 4BSWB 4F7EA 4Q9QL 1H3WM 1N8ZA 1SEQH 2YS4A 4XZUA 4I0CC 1WGOA 3MGOA 4KRPD 4L3EE 1WBXB 4IS6B 3QDJE 4WENB 2H9GB 3OR7A 2VISB 1PZUB 4LAQH 4PJFB 4L4TD 5F7EH 1FAKT 3RGVB 3QEQE 4ODWB 3RU8H 5IQ7H 3PUCA 5KVDH 2YN3A 1XR8B 3RUGA 5I76B 5HDBF 3RDTD 4BK4A 1A7OL 1I1AC 4WHDA 1IQWL 4PJ9C 3G08B 3KLDA 2VDQH 4KGJA 1FV1B 2F8OA 3IFPA 5KAQG 5DSCA 1O5DT 3DVGB 2NTSP 3CFKA 1GVIA 1UH2A 4HS3B 3LKPB 5CZVH 5CGMA 1DQDH 1EK3A 5CP7A 3V6FB 4MYWB 5C6WH 2DLTA 1T66C 3O2WH 1C12B 3KR3H 2D9CA 3LB6D 2AAVA 3OXRA 2JCCF 1GYAA 2XWTB 5F1KC 4KPHH 2WBJA 3Q3GA 4I3SH 3VFPB 5LGJB 4PGDB 4ZYKA 1WSST 4NCC1 4WU5A 1JGVH 2H32B 4WY7L 3CVIH 4QLRA 4JN2A 3GBNL 1YEHL 1FFPA 2NY7H 1ZLWH 4YGAB 3LKNA 4U1SB 5DK0A 1ZAGA 2ADJA 4JM2D 2UWEA 2CUHA 1QRND 3DOSA 3VXPA 4XMPL 4ZTOL 3HMWL 3QEGL 5JXAL 3B8SA 1HHHB 2B5IB 3GZKA 2QSQA 1X5YA 5H94B 4UILH 1N6QH 2PXYB 1UZ6F 3CVHL 3ZYJA 2O61A 1MAML 3H0TB 1ZV5A 1KGCD 4LSTH 4CN4A 4AIXA 5AAMA 1D5XB 1OF2A 2Q76B 3I9GL 1N5YL 3GHEL 4ONFH 3EO1B 5D7JA 4RMQA 2VLJD 4GRWE 1FRGH 3QNZA 1QR1A 4RFEB 2NTFA 5E99L 1CIUA 3T0ED 4JPIB 1QLEH 4JAMB 1OGAE 4JQXC 3VI3F 2Q1EA 4M5YL 5DUMH 3U30C 2NCMA 4OKDA 2A83A 1P7KB 1A0QH 1FNEB 1AXSA 1NQBA 3RA7H 5L8JB 1SYVB 5FYLL 1ZA6A 5E00A 1D5ZB 5IJKC 5MERB 2E9WA 4G8FB 5LGHL 1YYLL 4Q9CA 5I19L 4WI5A 3IDJA 4OZHE 3IDYC 4UV4H 5IR1A 3TCLB 1PG7H 1WQVT 4JY4A 4L8SB 2P8PB 4U3XA 1Q9KA 3EYFA 4FQHA 3TH4T 4WDIA 3X11B 4LLDB 1BVZA 3D0VB 3RGVD 1AP2A 2VL5B 1CR9H 4IHOB 2FGWL 3D87B 2GQHA 1FCCA 3AXLA 4M7KH 2FX8H 3QUZC 3CMOH 2WZPD 4AMKL 4GW5B 2DQDL 1WITA 4DKFL 1T80A 3LV3B 3L9RA 2R0ZH 2AI0L 4A6YA 2DKSA 2FB4L 4TTDC 2UY6A 3C2AH 3TJEL 3MJ8A 4C4KT 1A6UH 4IIQC 4Z7WF 3WBDA 1YMMB 1IAIM 5DT1H 5C3TA 3RZCB 2OS7A 3HI5H 4YO0B 3STLB 5DJ0A 3MUY1 5GGVL 1E6JH 3WFCL 1XF3B 2V2TA 5HYQB 3A6BH 3CFCL 4N90D 2YN5A 3V7AG 5FO9A 4NOFA 2WIIA 1BFVL 3FB8A 1PKQE 2Y5TA 4KI5D 4AYFA 4ZDHA 4HWBL 1UB6B 2CIIB 1RZIA 4N0CD 1AJ7L 4K55A 3O3AB 1EHAA 4XP9L 1YN7A 4G8GE 3GSXB 2PXYD 4LCUB 3BN3B 3PGCB 5CEZH 5C0DA 3PWUB 5KVEH 4WW1A 5FCUH 5I15L 3LSOB 5CSGA 1KJVA 1FFOB 4POUB 3O2DA 3AUVA 1FDLL 3TA3A 1U58A 1H0DB 4MSWB 1HZHH 2P7TB 4XPGL 1AGBB 3RL1B 3I3BA 2SEBB 4GAGL 3ZE0E 2BVQA 4GMSH 1KIRA 5EBGA 1EGJL 5D6DC 1NCUA 1MWAB 4R4ND 5CIPA 2ZSWA 4WV1C 3LZFH 1UH3A 4LBEA 3ZE2F 3IDXH 3MRPA 2P24A 4HPOH 3BJ91 1EFXA 3S7GA 3IJYA 4HPYL 4EN3A 1AIFB 1IEBA 4PRAB 3V4PH 5F7KC 4A6YH 1IAOA 2VLRE 5KVGL 2R4SL 2Q6WA 3DI3B 3PDOA 4NKMB 2BSTA 1JZ5A 4YHKL 2XA8H 3B9DA 1PYWA 4B50A 1JTTA 3CMGA 5B3JF 1TZHB 4MCYB 1F4WH 1BFOB 4GAYA 1F6AA 2E5EA 4OF5A 4UINL 4PJDA 4OLYL 2G5BA 4R4BB 3VFWB 4H1LB 4P46B 4EI5A 3JXAA 5EU6B 3S5LG 3V52L 3U46B 3WS6A 2JB5L 2HKFL 2AV1A 2HP4A 4MXVF 5ADPL 4RIRB 4FQLL 5ALBL 4C55A 5D7IE 2A9ML 4CU7A 5JNYB 4QHNA 3RZCD 2EECA 1U8JA 4D0CB 1OARH 1XT5A 1RY7B 2OZ4L 5FO7A 5SV4A 4O2CB 5T3ZE 4I0PA 3RKDD 1D9KC 3RWHB 2F5BL 4FP8L 3SKMA 4KUCD 4YFLF 3MNWB 5E5UB 1M7IA 5JW3H 1J05A 3TVMB 1CF8L 3RWEB 3O2DH 3VA6A 5IROA 1MLBA 1F3RB 2NXZB 5DF0A 1YEKH 1J7VR 4LSSH 3IU3B 43CAB 1ED3A 4X7SL 4DEPC 4R7NA 4KGLA 3MRMB 3MRJB 2ZUQB 3ARBB 3B6SA 4NO5A 4FQPA 43C9B 2V9QA 5CIPH 3OKMB 4Y16C 1PAMA 1UC6A 4I48B 3NCEB 3OMZA 1SM3L 1GC1L 1AO7B 3SO5A 1EMTL 4DQOL 3OAZK 3D85A 4P2QE 3SDYL 4DGVL 1FCGA 2WP3T 1G9MH 1W72B 3ZZ1A 4M5ZH 2CDEB 4F8TA 4B7IA 4JB9L 1D3CA 2E9JA 1Z2KA 2DI9A 5D1XB 3G04A 5F1SA 3VFOA 3WNNA 1H5BA 4YQXH 3O6FA 3LDBC 2BDNH 3UTSE 1I3RB 2AERT 5E8OB 3GSQA 2E7HA 3MODL 4NGHL 4HAGA 1MFDH 2X1XR 2PW2B 2X70A 1KYOK 5I1DA 4N1CA 3TBWB 5J6GA 2OXGA 4K8RC 2DQCL 1F3DH 4NO0A 4UAOB 4NPYA 5JTWA 3KNBB 3BISA 1OTTC 2R0LH 4MCZB 3ZL4H 3T65A 1E27A 5FF6B 3T77A 4UBDD 1NKRA 3MROB 2C26A 1EJOH 4EUPB 1IGIH 1ZWIA 4OT1H 3AS0A 3SY0B 2BVYA 3KGRA 1F00I 3V8CA 1GZQA 3GSRB 3N85L 4P46D 4ZXBC 3FCTA 3ELAT 3FO9A 2BC4B 5EU6D 4CNIA 2N4IA 3BAEL 4XHQA 2WP3O 1KEGL 3MBEC 3I02A 4RAUA 1XGYL 4QTHA 3MRNB 3CX5K 4UTAL 3QPQD 3DUSB 4ZUUB 2GITA 4MNGA 3MA9L 1RUQL 1NL0L 5SWZB 4DAGH 5MEPA 3FRUB 3C08H 5DEFB 1NBYA 4LASL 3SCMA 5FA4A 3EJJX 5DRNA 2HJKB 3O4OC 3WXVL 3NZ8A 3TVMD 3PWNA 4KK6D 1P53A 1T5XA 1N5AB 3EBAA 2FR4A 3K81A 2YSSB 4W4OA 3MUGB 2NXZD 3O9WC 3SDAB 5JLZB 5KANI 1E4WH 2ZKHH 2JJSA 3DX9A 2ITCA 1LDPL 5ACZA 4KTEH 4RISH 4PG9A 4XRCA 4K7FB 4QY8A 3ARBD 3O6KL 3UJTH 2XWJA 6FABH 5D1QB 1YQ2A 1L6XA 3SKNB 3VFMB 3BZ4A 3GK8L 3EYQD 1AGDB 2EDQA 3I6LE 2QADC 2VWEC 4XC1H 1CFSA 3EYOA 1AO7D 3IETB 4KJPC 1ZLSL 4Y5XC 5IT2L 3ULVH 1QA9B 3UYRL 1MCFA 1S7RA 3ZDYF 3QCVL 1FC2D 3PQYE 5D1XD 4NT6A 1N2RA 3V79C 1XR9B 1A5FH 5F71A 5TQ2H 3KDMA 5D2NB 3ARUA 5K9QG 1E4XL 3CD4A 1RURL 4WHTA 3MNVB 4X4ZA 4ONGL 2QQNL 3TO2B 5GS0H 3TGXA 4JY5H 2LU4A 2ZUXA 1IL1A 3I75A 3AS2A 3ARDC 4HS8H 1UXWA 3WKNA 3FQXB 1HN1A 2X1WL 4OZIF 3GMNB 3R8BB 1F4XL 5C7XL 1JWSA 2A6IB 4GXVH 2ADFH 4YLQT 3TIEB 1JNHB 4NP4H 5F72S 1NGXA 2P43B 1N4XH 1JZ6A 2O5YL 5B8CA 3IRPX 1ZS8B 2A6JA 4GT7A 5I1GH 1IM3B 4JQIL 3UP1A 4R90L 2ICEB 4KZEL 3RBGA 2VDRH 1LO0L 5CEZE 3SKUD 1I7TB 4WFHE 5IB4A 5DJ8B 2DBLL 3QHZH 4H88L 5DS8A 5BJTB 3U9PL 1NGZB 3LHPL 1I8IA 2VLMD 5EIIA 3OAYK 4Y4KA 5B21A 5SWZD 5IVXF 2GI7A 4FNLL 5GRWA 4X99A 4HUVB 3OB8A 1U91B 2GAZB 5E2TL 1NAKH 1QFUH 1X5FA 2WBJC 5ADOL 4NHUA 1C5CH 3BP6A 5F1NA 1ZKAA 4NM4H 2P8MB 2HN7B 3QI9A 2Q8BH 2DJUA 3CXHJ 3H9YA 1V7ML 1DN0A 3QFJB 1Q72H 3FJTA 4JDTH 5ANME 5F7DB 5EO9A 5JO5B 4KJQC 3P4NA 1FBIL 3WD5H 2R8SL 4PV9B 4C83B 5C0RH 3SDDA 3IJSB 3BRFA 4MA7L 1TCMA 2HYMA 3PXHA 5C07E 2BSSB 2Z35B 5C08B 4AH2B