4M43L

Crystal structure of anti-rabies glycoprotein fab 523-11
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
213
structure length
213
Chain Sequence
ELVMTQSPAILSVSPGERVSFSCRASQIIGTSIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLTINSVESDDIADYYCQQSNSWPVTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fragment antigen-binding 523-11 light chain
publication title Crystal structure of anti-rabies glycoprotein Fab 523-11
rcsb
total genus 46
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2013-08-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m43L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m43L01
1Z2KA 3T0DA 2R1WA 4M48L 3FONB 4DGIH 5I0DA 1YN6B 5KS9F 5BQ7B 4Z0BH 5AYQA 4AT6B 2AJVH 4X6EA 1WITA 2F19H 3CCHB 3GSRB 2Q1EA 5D71L 3SPVA 4OSUH 3IXAB 4R2GC 3N9GH 3U9UB 3P9LB 1BWMA 5CILH 2H32B 1SY6H 2DWEA 4JDTH 1MY7A 4F57L 1G7MB 3BD5A 3EO0B 4IRSC 3HN3A 4LLMA 3IDMA 4UV7H 1KCVL 4YHNB 4NYLB 3EUUA 3V6FA 1GGCL 1UWGH 3NOIA 3QUZA 1EERB 1NBVH 2ZCKH 4NM4L 3LSOB 1FFQA 4UV4L 3JZ7A 1I3GH 4ZO6A 5GGUB 4D9RE 5CJQH 1G7IB 1NCUA 2NY7H 2GUOA 3U0TA 4OZIA 3HAEH 4JN1H 3X12B 4XMLH 3LEYH 2E9WA 3OR7A 5J7CC 4NBZB 4PTTA 5I66A 1MJJB 3RHWF 1I8IA 3QEUA 5MP6H 1C12B 5GZNC 5TJWK 4R8WH 1FGVL 3OV6A 4LPYA 5E00A 5IKCB 5ELIA 3WXVH 1FZKB 3KAAA 4PJ7A 1FO0A 1HQ4A 3O3BA 2YD2A 3KPLB 3OF6A 2LABA 5KVFL 5EIVA 4POZD 1AXTL 1CICA 4K7FB 4P9HC 1ZGLP 4HKXA 2CO6B 1OHQA 5IR1A 4PJHA 4N5ED 5IM7B 4Y4KD 1LP9E 2VL4A 4HIXH 4DFIA 4F7PB 5CEXB 2X4TA 3AY4A 2BHZA 2F74B 5MEQA 1TMCB 2W65A 1S7SA 3RWJA 1P1ZA 3B9KC 5KS9E 1NCTA 4OGXL 3BN3B 1L9MA 1AIFA 3SKOB 1RK0B 1K5NB 3QULA 4WNQA 3U4EB 3WFEL 3C5ZC 4F9PC 2OZ4A 3T3PF 1AGBA 3HR5B 5EORL 3SOBL 1OTSC 4FQQA 2XRAH 3V5KA 3B83A 1HHIB 3ULVC 2Z31B 4DCQB 4MDIB 3HG1D 1NQBA 1J18A 2P44B 3EO9H 1WZ1H 2AW2A 5JW4R 5CBEB 2HRLA 3K2UH 4G5ZL 1RZKH 3DGGB 1ZLSL 3P4MA 1MHCA 5GGQL 1XGTA 3C09B 4QEGA 4U31A 4OZFA 4UINL 1EEYA 1NCCH 2DJ4A 3NN8B 1EX0A 4ODVL 2XXCB 3L5XH 5CS7A 1BJ1H 4UT7L 3R4DA 1XZ0B 1J11A 3BH8B 1M6OB 4NO0B 4MXQD 4P5KA 5E8OA 1RZFL 4I77H 1F6FB 3NIGF 1MCQA 3F6LA 5FUOL 4YNYA 3PHQA 2ZCLH 5I19L 4LEOB 4ODHH 3PV6A 1QFUL 2BOCA 1YY8B 3MGAA 2XWTB 3VH8B 2PTUA 5C0CB 5IVXB 1Z6JT 3RDTC 3K8LA 3WNMA 5BS0B 1TQCC 4X4XA 1LHZA 3HS0B 1BOGB 1F97A 1MHHA 2IAMC 3MMEA 3H3PL 2JIXD 5IFHH 4PREA 3BWAB 1MUJA 4NQSB 3T4YB 4OZHA 2GY7B 4QHNA 4ZQKA 3GBMH 3FT2A 3AROA 2B20A 5E1HB 5JR1L 3U4BL 3U0WL 1AC0A 2W59A 5TDNB 3T3PE 1EGJH 2WAHA 1KJ2L 2DQUH 4GRLC 1DBBH 3BKYL 5CJBA 2BVUA 4GKNB 3WHXA 3WBDA 1G7JB 3HPJB 3O8XB 1DDHA 2QADC 3MCLH 4KJQD 4X8JA 3PIQB 4K2UL 4D9LL 1A0QH 4OZ4B 1QKZL 3GJFH 3W9EB 4XHJD 2XKSA 3L9RB 4N0UB 5JOFA 4OCNC 1LD9A 4OZGB 4JREC 2WWKO 1T03H 1GL4B 5IB2A 3RWDA 3C2AH 1OTUD 1OP5H 3KS0J 5IT2L 2ZKHL 4LPVA 2AQ2A 2W60A 2WUCL 1KEGH 3TT1H 1G9NL 2HLAA 3QDMD 5HHQA 3IAPA 1CGVA 2DWDA 2O5XL 3MX0A 2DBLL 2VISB 4M1CD 2HWZH 4U6HA 2W0PA 1DLFL 2A74B 3O6KH 3H2WA 4X6BA 4LDOB 5T1KD 4X9HA 3ZL4L 5I1LB 4QWWC 4E42B 3KYMA 1CL7H 4M4PA 1ZA3A 1EZVX 5C07A 1BAFL 3LEXB 2FO1A 4ETQA 2VNCA 4X6CB 1AD0B 3BSZH 3U46A 3O6FA 1RUPH 5FECA 1MH5B 3RU8L 3AXLB 4KK6C 4HXAL 3RVUD 4IOIB 1ES0A 1QFPA 1RZ8A 1IAOA 3D69A 5L8KB 5K9JH 3KR3H 5BV7C 3C8KA 4CDGC 5DJZB 5LAXA 2IH1B 5MHSE 1GIGL 3PWPA 3THML 4XNUL 5IEHA 1AGEA 5DVNA 5I0ZA 5ENWA 4X83A 2XZAL 2I07B 1JJUA 3P0YH 4DGIL 4JPIA 3MLXL 1DQTA 1NUNB 2AJVL 5D7IE 3NIFF 3LQZB 4TTDC 4HG4J 4YJZL 5FYLH 3VG9B 3VGAC 3WIFA 3N9GL 1KACB 2PXYB 4ONOA 1SY6L 4OD3H 3MV7A 3R1GH 5GRWA 3WNNA 3G5VB 3RZCA 2YK1H 4DW2L 4UV7L 1ND0B 2DMKA 4WWKB 4ERSH 1UWGL 3PHOA 4KKCD 3CGTA 4O58H 2LVCA 3I9GL 5KZCB 3C60B 1R5IA 1F58L 1Q94B 5GS3A 2F54E 3SDCA 1T0MA 2VTFA 4RA0C 2HH0H 1I3GL 5F1IA 3QISA 5DD5H 4GKZA 5CJQL 2VITA 5FEBA 1T1YA 3FAWA 5DGRA 1IEBA 5BOPA 4FFWC 4BZ1L 3QUXC 1FG2B 2BERA 4UDUA 2EC9T 2OMBA 4TPRH 4Z8FL 5F1KC 2LU7A 4Y5VB 3V95A 1BGXH 4NGHH 4R8WL 5GGSY 3RWGA 5ACZA 2AV7A 3FQWA 4PV9B 3C08H 5T3XH 4XCFH 3VG0L 2EDKA 4FXKB 4H88L 4BSVB 1KN4L 5GXBB 3EDEA 4WI7A 2DQFA 3BE1L 3MGOB 1TNMA 3MJ7B 4L3ED 3QIWC 5GS0D 3BZFB 4PTUB 4X5WB 1GZPA 1PQZB 3ZDYF 3MREA 1U6AL 1P6AB 4E0RB 1D5IH 4IRSA 4KPHH 5IB1A 2BDNL 1PYWB 2BVYA 4RAUB 2AK4B 2AXFA 4V1DE 3AREB 4XZUA 5EU3A 6FABL 2Z31D 3CZFB 4YK4C 4P4KC 2HFEA 1BQLH 2EE9A 1AO7B 5IVZB 1XIWC 3OJ2C 3P0VH 3MLWL 4OV5A 4XPHH 4PJGB 3NPSB 4F2MA 4N8PA 1BJ8A 3PDOA 2OK0L 5BVPH 1I7RB 2DQGH 3MRRA 1Y0LA 5GSRB 1KSRA 2AKRA 4CU6A 2CR3A 5DT1L 5EH1A 4G6KH 2NTSP 4WIQA 4PV8B 2VZTA 1DP0A 4PRHD 1QBMH 3AMLA 2L7JA 4NT6A 5J12B 5A2IH 4GQ9L 5I76B 3EOTH 4ONHA 3VFMA 5IEKA 4W4OC 1RULH 1KF9B 1ZT4A 2WIMA 5FKAB 4NO0D 3K2UL 4R4BA 1S5IH 3MOAL 4KZEH 3O6LL 3I6GB 1ZHNA 4JDVB 3DYMA 2BVQA 1O5DT 2PETA 1PGRB 1F3JB 3ZYOA 1NCCL 3O8XC 5LG1A 1S9KC 4B7IA 1DUZA 4DOHE 4O2FA 2XV6B 5C0CD 4AEEA 4L3CA 5BS0D 1A8JH 3HC0A 4X9BA 3RHWK 2BRRL 2CKBL 5HY9B 3VXRE 1JYNA 3O0RL 1QNZH 2XA8L 2ZCLL 5TPWL 3V6ZA 5KSVB 3C5ZA 4ODHL 4PJBE 3A6BL 5D5MA 5BO1L 2BOBB 4AQ1B 3ZDYE 3S36L 4EUPA 1S3KL 1OTTC 2GTZB 3MV11 1P4BL 3KJ4B 1M1SA 2R4SH 4MJIB 5DFTA 5IFHL 1ZVYA 2LFGA 3DMMD 4XMKL 1D5ZA 2VLJB 3WE6B 5DJDB 5DHVB 5MENA 5C9JB 2V2WB 3GBML 1PEWA 3QPQD 5E2UL 5F9JB 3BVNA 1CFNB 1ZLWH 2HRPH 1KLGB 3RUGB 2GCYB 3LPWA 1OD7A 2YRLA 3HE7A 4L5FL 4WUKH 3T77A 2G5BB 2IANE 4M6NL 3VD9A 2AEWA 1UCBL 3CUPB 4TYUA 5IHUH 4MA3A 3Q3GA 2BSTB 2HVJB 2OMNA 3OXRB 4YFLF 1G7LA 4JY6A 1Z0NA 2AXJA 5EU6E 4UILL 3EZ8A 3B8YA 3C2AL 3KPMB 4X7CC 2APVA 4RIRA 4YBQD 1UWEH 2GITB 4LSQL 5C0AD 2NR6C 1FJ1B 5F9WC 1KEGL 2R23A 1J05B 4LHUG 3VFRB 2QBWA 1HWGB 2PXYC 3GJFK 5B21A 5MEPA 1MWAA 4KUZL 5C0BE 3BRDA 1T04B 2IAMA 3QQ4A 4HKZA 5DQ9A 3SKMA 4U1IA 3N0PB 1MQKL 5D7SH 3NH7H 2Q76A 5ALBH 3ZT6A 3ZKXC 4I18B 4Z7WB 4LCYB 1A3LH 1OP5K 3C9NB 4HIJB 1A2YB 4TOYH 5C08E 2XQYG 1WEJL 3L95B 4Z95H 5IQ9B 2Q8AH 5HDLA 1F11B 4MXWL 2B1AL 3QO0B 1J5OH 2Q8BL 1UVQB 4P3CH 4GRLA 1CZ8H 3KLSA 5T1KA 3MFFB 1F13A 5IB3A 2CMRH 3BMWA 3VXUE 3HAEB 5F9AC 3R8QA 1B4RA 4BH8B 4KMTH 4XCCH 5CCKH 2ZUVA 4M7JH 2XZZA 1FL5A 4M7LH 3P0YL 4WWKD 2V17L 5K59F 4GKSB 4U7KA 1P4IL 4LLYA 32C2B 4HWNA 5KZCD 3IXAA 3C60D 3N06B 4BH7A 5KW9H 2BNQE 3U9UA 1L0XA 1T89C 5KS9B 3EO0A 1XEDA 4JB9L 4MS8D 5J6HA 5DEZA 5MERB 3WKMH 2W9LA 4YHNA 1LO4H 3VFNA 2ZNWA 4PJFF 3QEQA 5E9DB 3M1BA 3WUWA 1IGTB 3MSPA 1FL3B 1UG9A 3KPQB 1GC1L 3WO4C 2HH0L 5HD8D 1ORSB 4EIZC 1IT9L 3T2PA 1GGYA 3IDUA 3MJ6A 1NH6A 4HJ0C 4GXVH 3WIIH 2C1OA 2AJYL 4RMTA 3NZHH 4XPFH 2OL3H 4QYOA 4NGHL 1D5MA 1FZKA 2AK4D 5E2TH 3LKRB 3ARED 2UWEA 4M62H 4XCFL 1AO7D 3KPSE 2NX5A 4MA1C 2CRMA 2XNAB 1G0DA 5IM7A 2NY1C 5DRNB 4DGYL 3CX5J 1O7SA 4JG0H 1NDMA 1MCNA 5CEXA 1D5IL 3GNMH 2DLHA 3U30B 4L8CB 1FFRA 4CMMA 3C5SB 5E0QA 3TT3L 3FOLB 5K59E 1AD9A 4KHTL 4HFUL 1G6RH 2DDQH 4QXGH 3CC5B 1BD2A 1R0AH 4PPTA 4YIQB 3KYKL 1IBGL 2YPLE 5BVPL 4P3DB 4KHXL 3S5LA 1QA9A 5TGBB 3MXVH 4NNXB 1ORQB 3OB0K 3TO4C 3VXOB 1DFBH 1HHIA 4NKOB 4G6KL 4U3XA 4DCQA 2ZUQB 4PJFE 4OCYL 2RB8A 3OAYH 5CP7A 2VN7A 2HJFB 4JKMA 5FV1L 1S5IL 4LLWA 1CQKA 2AXGB 4OKDA 5ESVA 5AEAA 1CF8L 3JV0A 3BEVA 4LLVA 3MNZB 4JKLA 3QA3A 3IETA 4X98B 2VOTA 3T65A 5JHLH 5DD0H 1LO0H 3BH8A 1I3RA 2EYTB 1OQOA 4D8PA 4B7LA 4MJID 5GHWL 4JFFE 1GCFA 4LVOC 4P4KA 4JHWL 1A5FH 4J6RL 1YA5A 1TTUA 2BK8A 2VLJD 2D7PA 3IFPB 3ARVA 1WISA 1BVKB 1TPXC 4WV1C 5IVXA 1CE6A 4JLRA 4L8DA 4PJIB 3QWRA 1WFUA 1BOGA 1DVFB 1NKRA 4G43B 1JGDA 4XAWH 3BIBX 4BFBD 4CVXA 3DX8B 2PW1B 3BWAA 1KENH 4HS8H 4NQSA 5K9QG 1AKJA 1FNGA 2C5DC 2PTTB 1G7HB 4P57B 4W4OA 1EAPA 5DF0A 4OJFH 2NXZD 5TH2B 4X80L 4F3FB 1KJMB 4LNVA 5DRXA 5HHPB 1JGEA 5EU4A 5CSBA 2MJWA 2FNBA 1U8QA 3BGMB 1TENA 5HVHC 1RZJC 2VXSH 3O8XA 4NQXB 5DHXB 5T3ZH 1H3VA 4Q9BA 5E94B 5FCUL 2FRGP 5JHDE 3AM8C 4MD0B 2QSTA 3L9RA 4YFDB 2DIBA 5DA4A 1MFEL 2VUYA 3LS4L 1ZLWK 4Z78B 3DBXB 4OZGA 2RFXB 2RBLA 3SGEI 4D9RD 1UWEL 2JJSA 4WEBH 5ICXB 3TBVB 5FA3B 2X1WL 3SKNA 4YXHL 4GG8B 2XFXB 5AD0B 1A7OH 2VISA 4ZODA 1A47A 1CCZA 4ZFOB 3ISWA 3OKMA 1AQDB 5ICYB 4HS3B 5JA8B 5EU7C 2DM4A 5FO8A 3C2SA 3LEXA 3TNNA 2DQDH 4ONFH 4TOYL 4X6CA 4DFHA 5DJXB 3G6JF 5IWLC 3ALXA 3HNVH 1M4KA 5TF1L 1J5OL 2AQ1A 3AXLA 5CJ8A 3BD4A 3INUL 2XQYK 1EV2E 4BKLB 1R3JB 1INEH 4M7KL 1CZ8L 5GPRA 5GRVL 1JHTB 2XKNB 3G6AB 4XWOD 4JQIL 2CH8A 5I8KH 1YEIH 4XH2B 2FD6H 4HCRH 4CAGA 5DJZA 1FBIH 4FS0A 2V9TA 4HV8B 4IHOB 1FSKB 1CG9B 3TYFB 1A4JA 2I07A 4BZ2L 3CFIC 4BUGA 5GRVK 4M7LL 4XVTH 1YEGH 1QD0A 4F7CB 3RJDA 5F7MC 1M7IB 1RZKC 5E9DD 3LQZA 2ZP0T 2ILLA 4MWFB 3FQXB 3TH4T 4MA8L 5KW9L 3G04A 2PXYA 4MHHG 3RFZC 3CXDH 3CLEL 1HZHH 1DUYB 3IDXL 4ZAKC 3WKML 2FLRT 1PKQA 1ND0A 4OLVH 5JW3L 1ZVSA 1A6WL 1WZMA 4MQ7B 4OUUA 4ELKB 3FZUC 2VXQH 3RY6C 2N56A 4HXBH 4Y88A 5I17A 1MVFA 4QHMA 4NC1E 4FN0A 1VFMA 5SWZA 5FYKE 2VDNH 2ZPKL 1NMAH 3S37L 5H8DA 2VL5A 3GI8L 4XNZB 3F6IA 4XAKD 4X7FC 3VD5A 1BWWA 1WCQA 1NC2B 4YX2H 5C0FB 5SWSA 4HT1L 3PP4H 5GGVH 2YEZB 3U82B 4P23C 2IBZX 4XPFL 2OL3L 4S1QL 3RL2B 3G6JE 4PV9A 1BREA 3TIDA 2YKLL 1X5KA 3I3EA 1CR9L 2R4RL 4HJJL 2KUTA 4YC2B 3MJ7A 4WJ5A 4YDJB 4PB9H 4LGSB 4JM2F 4X5WA 1T89A 1PQZA 1S7QB 1CFQA 1ZMYA 3LB6C 4FMFA 4CNIB 2KH2B 2YD6A 1BEYL 1IGML 3D2UB 1PYWA 2AK4A 1P69B 4ONGH 1QSZA 3ZKND 3AREA 3AS1A 2EDJA 3CFDA 3MLYH 4GS7B 5HI5C 1AO7A 5TE6H 5MEOA 4IOFD 3ARWA 1OT1A 4YXKH 1UH3A 4QXGL 3FOMB 1JV5A 5IMMB 5JXED 3UYRL 4G8GB 3JWOH 1KXTB 1YNKH 5GSRA 1FFPA 2VXUH 1D5XB 3SDDC 4HAFA 4X7EC 1CXEA 1G84A 2KKQA 4RFEB 4R7NA 4PJCA 1EO5A 1Z5LA 3T8XB 3MODH 2BC4A 4FQCH 5EUOB 5JOEA 4DN3H 2AEQL 5B38G 3X3GL 4MNGA 2MCPL 3ULUH 2IANB 2ADIB 3IVKA 3I6GA 5D93C 1UM4L 3HLAA 1K6QL 5E6ZA 1F3JA 1KC5H 4F80A 1Q0YH 4PG2C 5E2JA 3OAYK 4PGDB 5J3HC 3DX7B 2NY2B 4NWTL 3TN0C 5HYJA 3KLHD 2IQ9H 4JFHE 1X5FA 3DVGA 3LQAL 1DVFD 5CD3B 3OKNA 3EYFB 2W38A 4Q2ZB 4XWGL 3GSWA 5HY9A 2XTJE 5KSVA 3SHSA 1FNEB 3IAGC 1BFOB 5C0BB 2H2PD 5CGMA 1YMMA 3UPRB 2YUXA 2R8SL 3D3VB 3UTSB 5ESQA 5T33H 4EDXB 1QR4A 3OJDB 3TO4A 5DI8A 4LEXL 4XBGA 3V0VB 3KPPB 4PIRF 3HMWH 1LK3H 1KENL 1T66C 3VXTB 5FGRA 3Q6FA 3QHFH 3LRSB 2NY6B 4WI6A 4Q9RH 1MI5B 2EDXA 4JFXB 5DHVA 3NGBC 5C9JA 3KXFB 4OJFL 2V2WA 1NL0L 1F3DJ 1CFNA 4XCNA 4OLWL 4RA3A 4YLQT 3SDAB 1KLGA 3BN9C 5IP4A 2C4FT 5D2NB 5DMKB 1SJHB 3OKYA 4Y19A 2MMXA 4A2LA 2G5BA 3ILPA 3G5XB 3CUPA 4OI9A 4RZCA 1MF2H 4MJ6A 3ZT7A 1OQXA 2HVJA 5E4EC 1Y6KR 3GBNH 3OXRA 4JO1H 5FYLD 1DEEB 5DUBA 3O2VL 3KDMA 2XIDA 4FQIH 1JZ2A 3BH9A 2GITA 4AG4H 1ZA6B 1FJ1A 2BJMH 2NY5H 3UTPD 3CVIL 2FBJH 4WV1A 3DVIA 3EOAB 3BEWB 2X40A 3HE6C 1QBBA 3HNTL 1S9WB 2ORBL 1RUKH 2ADJA 2VZVA 1ADQH 3CFKA 5DMGC 2M1KA 4U1LA 4P3WA 1O7VA 3O4LB 5I6XB 4MMXC 4NC0B 4Z7WA 4B53A 1MREH 3BPNC 4LCYA 4YH6A 3UZVB 5TDPB 3FQRA 1A2YA 1CD9B 2DQDL 1C08B 2F9BT 5IQ9A 3IF1B 1JRHI 1JFQH 4KKLC 3QO0A 3WL9B 4KMLB 4XPBH 5DHYA 3IFLH 1OAKH 2R0WH 5H37G 4MSWA 2BNRA 1INEL 3AMKA 1K8IA 1FN4B 2AJZA 1T21B 2DQIH 3ETBF 2A6KB 4LLUB 2FD6L 4HBCH 4V1DD 4BH8A 1FBIL 1N2RB 1RIVL 3TCLA 4H1LH 4R7DB 3UPCA 1HHKA 3I50L 2MOVA 5BW7C 3R0MA 4EN3B 5D7LE 2C7UA 2OL3B 2LAAA 1YEGL 4GKSA 4Y1AB 1C16B 4GO6B 4HFWB 2I9TB 4PG9A 4WU5B 1RUAH 4H1LG 1IM9D 2WIIA 3MLVL 1V3LA 1HSAA 1AJ7H 2DL2A 2EDEA 1BZ7B 1XF3A 4E9LA 3WNLA 5C86A 2R1XB 5L88H 2X1QA 3SGEH 3BKCH 3D0LA 5MERA 5ALCH 3NFNB 1G1CA 5FYKL 2VWEE 3ES6B 1U0QA 4ELMB 4GS7C 2D7MA 2GEEA 1NFDA 2F58L 5E7BA 3RWFB 3TA3D 5FYJU 1PG7L 4HBQA 5JDJA 1FL3A 3QNYB 2VXQL 1MCWM 1GJIA 5KJRL 1NGYA 4QRSA 4FQ1L 4U1NB 4LSTL 1G6RB 5I1EL 4PJFB 2VDNL 2BFVH 5L2KE 3HI5H 1OGAB 4LF3B 2CDEB 5CGTA 3L7FB 5A2JH 1BVZA 1T1WB 5EOCJ 4KWUA 1S9YA 1UB5A 2V2XB 4M7ZC 2V2TB 1KT2B 4DAGH 5J11C 4OLYH 3D2UD 1QRNE 5KSUB 3MROB 3PG2A 4WW1B 2DOCA 1A6AA 3QDAA 4HK0B 4KAQL 3S88H 1YPZE 1LO5A 5LWYL 1P7HL 1J8KA 1EZVY 2BXZA 1JWSA 2LTQB 4G8GD 1OW0C 3CZJA 5EPMA 2C3GA 2GFBB 2IADB 1FRGL 1MCRA 4CL7A 4L8CA 2DQJH 2YD5A 4PJ8C 1EO7A 1MCJA 4L4TB 3RTQC 3WO3B 1UFUA 3U79A 2P5EB 4HWBH 3FOLA 5JIPA 5TE6L 3O9WB 1FV1B 1CN4A 1SBSL 2YS4A 3CH1B 1A22B 4NQCB 3TZVC 1TTFA 3B2VH 1LDSA 3RY6A 1NFKA 2IAND 3V6OA 1WJ3A 4P3DA 3STZA 5TGBA 3GHEH 1YNKL 15C8H 3FQTA 2FEDC 3VXOA 1UENA 2ZG1A 4KK9D 3EAKA 1ZLUH 5DEFB 4CVWA 5D7KD 3JWDH 3ROLB 1NMCC 3LHPH 4RNRA 1KELH 2NY6C 2NY2D 2HJFA 1A7RH 2VDOL 4JANA 1OSZB 4L8SB 4NQUA 3J8F7 4HWEH 8CGTA 3TFKC 2AXGA 4XVJH 5FA4B 3MGTB 3IFOB 3K1DA 3T0EB 5C0BD 1EGJA 4X98A 1GGTA 3ZTJH 3X3FL 2XT1B 4E41A 5FUCE 3D3VD 5HI4D 3UTSD 1JGLH 5EOQL 4LCCB 3WJLC 1PX3A 4EJ1C 3L3IB 3GJFA 5TQ0L 2AEPH 1CYGA 4OIAA 4ZSOA 1MI5D 4HK3N 1L0YA 4X4ZA 3IFPA 1FYHB 3KXFD 3UTTA 1BVKA 3QQ3B 3ARDB 4C57C 3PGFL 3TBTB 3QCVL 2GJ6A 5T33L 4PJIA 3SDAD 4NN7B 2NZIA 5AZ2H 4G43A 3PGCB 3SDDA 3IKCA 4X6DA 2HT2D 5I6XC 3HMWL 1LK3L 3S96A 3DJ9A 1X7QA 1FYTE 3CNKA 3L3GA 5IIEB 4G8EB 3CVHH 3K4ZA 1AH1A 1CFSB 1TJGH 1CT8B 4P2RE 4F7TA 5KTEH 1X5IA 2WZPD 1XAUA 4RAVB 4ZUSB 2JF1A 3BGMA 1FL6B 3MLSL 1F00I 3X13B 4ZS6C 1UT9A 1JWUB 1UZ6E 1MCIA 4PG2A 5L0QB 1T7ZA 2CLVA 2E6QA 3TN0A 4L4VE 1MF2L 5FHAH 2HT4D 1MIMH 4O9HH 2DRUA 2CRYA 4CN1A 4U0RB 1EJOH 1PY4A 2C3HA 2OI9C 1IMHC 4Z78A 3M8OH 2AERT 3OXSB 3O4LD 3BP6A 3KJ6H 1SEBB 4J8RB 2RFXA 4PY8I 3QDJB 4OCWL 4QRPB 5FA3A 4M3KB 5F97E 2NY5L 4HZLA 4GG8A 5DMYA 3DV4B 5AD0A 3RJQB 1XH3B 3TBWB 3QEGH 4ZFOA 1ADQL 5IHZA 2DD8H 1EMTH 5ICYA 4HS3A 3LZFL 1P6FA 4ZTOL 1IAIL 4D0DB 3O6ML 5CIPA 2V6HA 3EDKA 4F9LC 3AGVA 25C8L 1S7UB 2Y36L 4ZPTA 3BXNB 5IB5B 5HYFA 1HIMH 1KIPB 3PL6C 2WWMC 3CU7A 4EN3D 5H35B 4NZRH 2HT3C 2I60L 2JB6A 4BKLA 3S8WA 3NCBB 2HJKB 3V5HA 5IK3B 3DVFA 3FO1B 2DQIL 5BVJB 1FZOB 3KLDA 4XCYB 4NNPH 2VZOA 4TNVF 3SE8H 5E8NB 1HE7A 4TULH 5E08H 1NCWH 3TYFA 2C3VA 2XXMB 4Z77B 5SX4H 5SWQA 3QDHA 4PJDB 2A83B 3MZGB 1B2WH 1CLZH 4X9GA 3BRGC 4YHMH 2VE6B 4ZMAT 3GGWA 3C5JB 3HE6A 2VDQH 1F2QA 4K3DH 5B4MC 3QCTL 3PABA 4FHBD 1DUYA 4ZTPL 5JUEH 3BKCL 3ORJA 4NZTH 4QTIH 4I8DA 1OGAD 3QJHA 1UQSB 4NQEB 3D25A 3O4OB 2FH6A 1J0YA 1P7QA 2GIYA 4LMQI 3VWJB 1BFVH 2DLEA 1RHFA 1A02N 4G6JH 5L8LB 3VFOB 2G60H 5D6DC 1UM5L 2XPGB 4LIQE 2NYYD 3RVVC 4NFDA 2D0GA 4XB7A 3BDBA 2BFVL 3RP1A 2VDKL 2D9CA 4V2CB 1WCBB 1F42A 1JRHH 4PP1C 5J1AB 1NC2A 1RJLB 5C0FA 5CD5D 3SCMB 3IDNB 1KB5L 1AE6H 4RMSA 3E2HC 3PWVB 2NLJB 4OTXH 3DX9A 1BQHG 4KK5C 4RMQA 4XT1C 5BW7A 3H9SB 1Z9MA 3M17B 4HKJB 3EYSL 4QO1A 4DGVH 4L4TD 3RX8A 5L7XL 5A43C 2P5ED 1V7NL 4JFDE 4LOUC 1EIBA 4RDQF 3ROOB 4DVBA 3O9WD 3UEZA 1RY7B 3O2DH 1QFHA 4KI5E 4NQCD 3L3HB 4YDJA 5IOPA 1CDJA 3S88L 1YJDC 4S10A 4KQ4H 4K9EH 2ZZUT 2UVEA 4Y5YB 3BESR 4R96B 4ZOCA 3PDDA 4LCCC 1FVEB 3I6LD 3JV6A 2B5IC 1WLHA 2APBA 4IRJD 3RI5F 4JM2B 4QRRE 1NDGA 4KDWA 1DCLA 1Q0XH 4JAMA 1JP5A 4WDIA 3SDXF 2PYEB 3GBLA 4U1JB 2OSLB 2OTUB 1ED3B 4G8GA 2FX9H 4JGJA 3VFUB 3GHEL 4FZEH 5JHDD 1H3PH 5I1CH 4W68A 5I8EA 4YGVB 1X5YA 5ETUA 3U2SB 3HZVB 2B0SH 1A9EB 3ZHLA 1QHPA 1A7PL 4GG6A 3IJSB 4NUJB 3T8XA 1A6VL 5CJOL 5DDHB 3T0AA 1KELL 4D9QE 4R6UA 3FO0H 1A7RL 1UACL 3WLBB 3RL1B 2ADIA 3DMMC 3O41A 5DR5H 3F65A 3GMRB 5C70A 1ETZB 4WHTB 4HHAB 2P4AB 1ZLUK 3QPQC 4U1GC 1RV6X 3GDBA 2H3NB 5L0QC 1OWWA 4UU9B 1KCUH 4PGDA 2PO6C 1OW0A 2ZOLB 3ZTNH 4DKEL 5DS8B 3MO1A 3EYFA 3DSFH 4PJXE 4PJ8A 5JZ7C 1JHKH 3RTQA 1FZMA 3WFBH 3MBED 3TZVA 1FPTL 3FMGL 2EDTA 2YD9A 3GSNL 4XP4L 1VEPA 3RBSA 5IW1B 3B9EA 1S8DB 1TITA 2YRPA 5HDOA 4K3EH 5AAMA 5DJ2B 4EDXA 1ODAA 2K3TA 4BZYA 4NRYB 1CGXA 2VDLH 4ESKA 5AZ2L 4NN5C 1IAIM 4R4ND 4UB0H 4GW5B 3UBXB 2NNAA 3VXTA 4NO2B 1FFOA 4HH9B 3T0VA 4NZJA 1J0HA 4JFXA 4KRPD 2F5BL 3GKWH 1T1XB 5FGSA 1OAZL 5I8OH 3DROA 1JGUL 4L9DA 2ZNXA 5FM4A 4AEIL 2FR4B 5D2NA 4S0SD 5DMKA 4N0RA 4OCLC 2EDQA 1D6VH 3QDJD 3BPCB 4WUUE 4QRPD 1IFHL 2DIJA 3QP3A 2DTSA 2MSPA 1BM3H 4Y4HB 3MOQA 1MIML 2GI7A 2AVGA 4TUOB 4NKDA 4XX1E 1FE8L 1NGPH 3KPRE 3M8OL 4J3UA 5GGTL 1Q9KB 1T7XA 1OT2A 1TQBB 1A1MA 4H1LB 1S5HB 5CINL 4AYFA 3CFCL 4LSRH 1AFVL 4HJGB 1H3GA 2HTLC 2CIKB 4C59B 5KSAC 5FYKD 1HXYB 3PQYE 4X9FA 4PJ5E 4Q7DA 4XNXL 5INCB 1LO3H 3GMQB 1S9WA 3WS6C 2IG2H 5CMAB 4RGNE 3HRPA 3VDBA 2Y7QA 4Q6IC 1EMTL 2VIRB 2A77H 4G8IB 3BISA 3DVNB 3WXWH 5TDPA 5IBTL 5EZOH 4LCWA 3O4OC 2G5RA 3IF1A 4I48A 1RUQL 3AAZB 2EE2A 5EWIL 5LJYH 4I0CC 5L2KB 2CUMA 4Z7UA 1F90L 4I0PB 4P2OB 1VGKA 3EHBD 1WBXA 1FN4A 5J89A 5I1DB 1T21A 1QSFB 1JPGA 3VFWB 4IIQC 4C56E 3JWOC 2EXYC 2VLME 1AGCB 2CLRB 2UVFA 2F8VA 3GSUB 1IC7L 4HUUA 2ICWJ 1RIUH 1TCRB 2X7LB 3VD7A 1FHGA 1D6EB 4X4YA 4U6YA 4R7DA 5E08L 1NCWL 3E6FA 5KANG 1NGQL 3QFJE 1T6WA 1UA6L 4NQED 3LDBC 1CLZL 1XR9B 4Y1AA 4HG4K 3ULUC 2VLKE 3UZQA 4JR9L 1FIGH 1G0XA 5FUZL 4U1KA 3VWJD 1SJEB 2C9AA 3EGSB 5EG6C 3TC9A 1RHHA 4ZO8A 2DI9A 1PW3A 1CQYA 3RVXC 4JGMA 3NFNA 1AP2B 4LIQL 5I2IA 4ELMA 3ES6A 2FZ3B 1KCRH 4F9LA 1Q1JH 2CXGA 4U1MA 2D4FA 2LU3A 4LRIC 4OZIF 5DD3L 3PL6A 4OCXL 5I30H 2G60L 4PD4K 4X6FB 4PLJD 4U1NA 1G6RA 3B5GA 3BWUC 3GIVB 3WS3B 2X4QB 5DJ0A 3BP5A 4JFHD 3GIZL 2VDPH 2G9HB 5AUMA 1K3ZA 3BYYA 2V2TA 1XGQB 3L3DB 4PJ7F 2A73A 1KT2A 2VLRB 4PRNA 2O93L 5I1JL 1W0YT 3WDIA 2CRZA 1NC4B 2YPKB 4LP4A 1WBYB 1K4DB 4JO2L 2G75A 2QKIB 2B8OT 3CLFH 4PJHF 1UXWA 4JM2D 4W6XB 4HUWA 1I8KA 1N6UA 3K7UA 4NP4L 2EIEA 2ITDA 5C0JB 4O51B 5IJVB 3LY6A 4BFIB 1N64H 2PYED 2P24A 4YDIH 4JFZL 4OFYA 4K9EL 1EA9C 5DFVD 4YDLB 2GFBA 1R5VB 3S6CA 3BPLC 3HI1B 2J88L 2OQJB 3QXTA 5IBLD 4L4TA 4JZJC 2YC1B 3KYAA 1FV1A 3G5YA 4YHLL 4GRMB 5EC1B 2I26N 1Q0XL 5CZVH 5C0IB 2I5YH 5EBMB 3GSNB 4AM0B 1JI2A 5J1TC 2QLVB 1X4ZA 3TWCH 2AK1H 4M5ZH 5DRWA 4TSCH 4AEHL 4R3SB 1DQML 2R9HC 5A16A 4KJPC 1Q72H 4FQXC 4TVSa 1MQ8A 4JFOA 2ED8A 5IUSA 1F6AA 1N5YH 3FO0L 1OSZA 3DXAB 4L8SA 1EHAA 3NCJH 4NZDA 1S78C 2W0KA 4ZOEA 1WFTA 5M94B 5B39G 3MGTA 3BPOB 5HPOA 3WSQH 3T0EA 3JTSB 1J9CT 2ZSVA 1Q9WB 4QNPF 3EDFA 5JOPE 2XTLA 1KCUL 2QSCH 3NFSH 4LCCA 1JNLH 2B2XH 5F72S 1MJ7L 4ZUTB 1N7ML 4PJ7E 4WO4B 3L3IA 1JHKL 4YBLB 2OJEB 3H42H 5JMOC 3ARQA 4HIEA 4PJHE 4BQCA 3RWCA 5D1QC 1JNHB 4FZ8H 1XFPA 3CDFA 3RVTD 4PR5B 3ARDA 2DBJA 2N7BA 4LVHB 2EDDA 1RU9H 1XCQB 1DE4B 5C92A 2DM3A 1INQA 3EZJB 3MRGB 2D4DA 4FQJH 1R3LB 2A6IA 4OF8A 4OZHF 4XP1L 1OF2A 5DZLA 4X9IA 3L3KA 4PJ9B 1G9MH 3QIBC 1OARL 3VRIA 4Y4HD 3P11L 3W82A 5I16A 1H15B 4JVWA 1CFSA 1EFXB 1SQ2N 5D7LD 3DRQB 1N5AA 5H94A 1CXFA 4Z5RA 3H9HA 5I8OL 1A6ZB 3DHJA 3IU4H 4RAVA 3R06B 4BSWB 3MJ8B 3X13A 4OZFH 1D6VL 3VRLE 1A6TB 3FTGB 2ED9A 1JWUA 3NCCB 3ARGC 2Y9RT 3N1PC 2PO6A 2R29L 1MRDH 1EXUB 1X6NA 3HI6H 1W72H 5ITFB 2EKSB 4LKXA 4YHOL 4DEPB 2YD4A 4K07A 3BP7B 5DJCA 4XC1H 4HCRA 1C5CL 4QY8A 5EA0L 3JVGC 1MRCH 2IGFH 2OP4L 1SJXA 5GJSL 1JK8A 3VXSB 5D7JB 5L2KD 1XH3A 2A38A 3TBWA 1IGIL 4I0PD 5HHOB 4P2OD 1ZHKA 1A7NH 2IALA 1YYMH 5BRZB 1T5XB 2CK2A 3ULSB 1X5HA 4TNWK 1QSFD 1NMBL 1Q9OB 1NUGA 4UT6H 1IKNC 3WXWL 3QQ9C 1M05B 5DWUH 3QH3B 1QRND 1W8NA 1S7UA 5C0RH 4CU8A 5C6PB 2VH5L 2D31B 1TLKA 3BXNA 5IB5A 3OPZL 5HHNB 4D3CL 3H8NA 1MHPL 2AS5M 2NW3A 1OGTA 5H35A 1T2XA 2ZUUA 2HJKA 5DTFB 4WI5A 2XN9B 1JYXA 5DMIH 1B0GB 4R97B 4JVPA 5BVJA 1HILB 1QUNA 5EULV 4S1RH 4XTRC 4ZUWB 4LP5A 4C58B 3PXJA 3WEXB 3JWDC 3MNWA 4LDEB 4PJDA 5CEZH 5T1LA 2A83A 4LAQH 5JW5B 3KVQA 4EVNA 5E8PA 3L5WB 2VE6A 1L7IL 1W0WA 1LEGB 5KSAA 3F12A 4P59H 3WIHH 1DQLH 3IDYB 5F8QC 2J8UF 1SVZA 3WS6A 1AXIB 1BZ9B 1BBDH 1PEZA 4M93C 4LVNB 2X89A 4Z7QF 1AGFA 2Z8RA 2QQLH 4Q6IA 3D0VA 4QRRB 2MPAH 1S7XB 3RRQA 4WFGE 1GOHA 1J8HA 4NQEA 3BO8A 3ARBC 1PLGL 2QQKL 2VXTH 3RIFF 3TV3L 3VCLB 1CTOA 3LMJL 2VLRD 3MPCA 2Z4QA 3GSOB 4ZYKA 5HYSG 4R90H 4H5SB 5I30L 1A6UH 1KYOJ 1V7MH 2XPGA 4Y16B 1NC4D 1UGNA 2J6EL 1GAFH 2R2HB 5D6CA 1MCCA 1NGZA 3E3QE 4M6MH 4IIQA 5D1ZB 2YZ1A 5C07E 5HTSA 5HGGS 5JXEC 1SM3L 3JV4B 1RJLA 2VDPL 3NACH 3SCMA 4FRWA 1FH5H 1YUHB 3PWVA 1W2KT 5C09A 2EEAA 2YUVA 4HUVB 3EO1B 4X7SH 4S0TD 3S4SB 4ZXBB 1HQRB 1TVDA 3H9SA 2H2SC 4ODUB 4HKJA 3DO7A 3F7VB 3WFHB 2ZUWA 4X7TB 4NWUH 3RWIA 2FL5A 4WFFE 1QFWI 2Q86B 2XICA 3BZ4A 3O3AA 3PWPE 4O02H 3QRFM 2J4WH 4XBEL 1WC7A 1FVEA 4QRUB 1B88A 3BGFB 4M1DL 5KAQG 1EBAA 1YEJL 2ZJSL 3TIEA 3WN5C 3ZKMD 3OKLB 4H0HB 2A1WH 1M7DB 4K8RH 2I5YL 3DXAD 1T3FA 4U1JA 2OSLA 3MV7E 2I24N 2J8UE 4JQVA 5JPNB 2DLFH 4JM4L 1KV3A 2V5RA 4LVHC 3TWCL 4OBSA 1GGBL 4Z7QE 4LQ1A 4WI4A 4YGVA 5HJ3B 3HZVA 4Y4FB 1A9EA 3SGJC 3LN4A 2J8HA 3IJSA 4NUJA 4AIZA 2X4UB 3HB3C 3SDXB 3NAAL 3HZYA 4UUJA 5DDHA 5ANMB 1EVUA 4DVRH 5F93C 4QXWA 1HYRC 1KJ2A 4JN2A 2E9BA 5D8JH 4WO4D 2QR0B 5I1AA 1OSPH 4OGAC 1FO0L 3P9WB 5CWSB 2PW2B 4N8CL 4ZFZA 1KEMH 4F7MA 5E6IC 3KPRB 2X4NB 3HUJE 4UU9A 4PS4H 3QCUH 3CFEB 4FABL 5DUMH 2QSCL 1UXSB 4ODSH 2WQ8A 5DS8A 1JNLL 3UJIL 5EUKB 1CK0L 3MV8A 3QNXA 2AABH 2ARWA 2JELH 4JZJA 3UROR 4WW2C 3MCKB 4PJ9D 3VXNA 1YEKH 2A9ML 2MQCA 1FCGA 1OAYL 5D5MF 4FZ8L 2Q87A 1EFXD 2E9JA 1DANU 1CDBA 4OLZH 4DWHA 2OZ4L 3F58L 3ULVF 4CN6A 2A9NL 3MACL 5CJXA 1P84K 1TJIL 2NW2B 4CADB 4PFEA 4Y2DD 3C6LC 3MTRA 3VW3H 4FQXA 2EIZB 4L9LC 2N4IA 1KIUA 1I3UA 3L6FA 2O5YL 1SYVB 1GC1C 3LKNB 4GMTL 5IW6A 1AQKH 4YHYB 2GK0B 3QPXL 5IGXL 1LO2L 1WBZB 1D5BB 1F4YH 1CWVA 4I2XE 4P9HH 1E6JL 3REWA 4PRBB 1QRKA 2WMPA 3VXSD 1L6ZA 5A3ID 2CUIA 3MRQA 1P2CB 5D7JD 1AY1H 4YEEA 1NSNH 3QFJB 3IFNH 1KCSH 1QLFA 5HHOD 5BRZD 3HRZA 1MCSA 3SDYL 4BFEA 1H8OA 5KG9B 2XY1A 3VMNA 4H1LA 3G6DL 1VGEL 3VDCA 4YWGL 5D1QA 1JGVH 1CDGA 3MJ9L 1DLHB 2EDLA 3AFLA 4Y8AA 1HXYA 4QOKB 3T2OA 4HW6A 3RIAF 5INCA 3U48A 1QLEL 3SGDI 1T0PB 3BW9B 3OG4B 3B6SB 1U3HB 4EUPH 4IS6A 1JN6B 3D9AH 4IJ3C 1NAKH 4HGWA 4G8IA 3QIBA 2XN9D 4GW4A 5GJTL 2GTWB 3WMSA 5FO9B 2HFGH 4KDTA 4DZBA 3KNBB 5AYUL 5BJTB 4JZNA 4MXVF 1GH7A 1YEFH 2H26B 3JV5A 3AAZA 5D5ME 4ENEC 4XPAH 3LN9A 5J6GA 5DJ6B 5BMFH 3ULVE 1A4KB 1OOAA 1E4WL 1HK6A 1KCLA 1UKQA 2UYLA 2ENYA 3ARGA 3FB6B 3BUTA 4MD4A 3VFWA 1BOYA 4QHLB 1X6LA 5DMIL 1AGCA 1CFTB 2CLRA 2DI7A 4XXCC 5MENE 4AMKL 1LP9A 4F8QA 2K1MA 5IFAL 2R0KL 4K71B 5DD6B 1TCRA 5D70H 4A6YH 1D6EA 3QXAA 2EO9A 1TVHA 4QRRD 3RAJH 3FFCB 3OGCA 5CEZL 4LAQL 5EO9A 1NBYA 3ZDXF 1IM3A 3V4VL 5CKAA 1DL7L 1QFOA 2R1WB 1BQUA 4P59L 5I18L 1R3IL 1DQLL 3EGSA 1MIEH 4X6EB 2FECI 2P7TA 4M4RA 1MLBB 4Y16D 3SKUD 4JFEA 2R0ZL 4N0YL 5FDWB 3BKMH 5D1ZD 3ZHKA 2DWEB 1F4XL 5EOCH 2EYRB 3MBXH 5JIKA 3GUTA 1YNTA 4YO0B 4KFZC 4LSSL 1KPRB 2FJFA 4KU1A 3IDMB 4YUEH 4HWBA 3V6FB 3VFGL 4R90L 1X44A 4ZXBD 3MA7A 4EBQL 4OB5H 2IWGA 5ESAB 5TQ2H 4Z9KB 3WS3A 3OR6A 1R3HA 5IMKA 4M6ML 1MVUA 4XB8A 3GRWH 4UTAH 5JMRA 2XQBL 4HH8A 3KPOA 2X70B 3S7GA 3U0TB 4KRNA 4OZIB 1XGQA 3L3DA 3W11C 1FH5L 4QRTB 3OR7B 1YZZA 2UWEF 4KK9C 5DUPH 1MELA 1A7QL 3QYCA 3P9MA 2NXYB 5I66B 1DQDH 1WBYA 1K4DA 1I8IB 3QEUB 4Y5XC 4IDJH 5C0JA 1WZLA 4PJ7B 1FO0B 1HQ4B 3O3BB 1HKLH 2NZ9D 4Z7NF 2EKJA 4O02L 1CICB 1V3KA 2MTPA 4C55A 4HKXB 1R5VA 2XG5A 2ARJA 3HI1A 2XWJA 5IR1B 5F9OH 4PJHB 4N0CC 2IPUG 2OQJA 3ARBA 4F58H 4PGEA 4Y4FD 1IGFL 2YC1A 5IBUB 2HTKD 4P5TD 3ZDZE 3OKEB 1HCVA 4YHZL 2X4TB 4GBXC 2HMID 1J88A 5EC1A 2YMXL 5MEQB 2W65B 4K8RL 3LV3A 1I3VA 1S7SB 3RWJB 2J5LC 3A0OA 2YSSA 1BJMA 3FT4B 1AIFB 1P7KB 3QWQB 4L4JA 2AJ3B 3ALPA 3QIUD 1OB1B 4R3SA 2ZCHL 4ZNCD 4G8FA 1AGBB 3QEQE 4MQXD 1DJSA 2AXHA 3TGXA 5LXGH 4FQQB 4P2CG 5BV7H 3KPRD 5FF6A 3V5KB 4QTHA 2UZIH 1KIQA 2F8OA 4DVRL 2E9IA 2HT2C 3DXAA 4NQDB 3FCTA 4S1DD 3RIFK 5I1IL 2NY4C 3CVHA 3GMPA 1OSPL 4E5XB 3ZT5A 2BCKB 2AI0L 4KROB 3O3DB 2FB4L 3EOYG 3P4MB 4U4BA 4GLRI 4X5XA 1MHCB 1Q9WA 4ODXA 4OZFB 4NHCL 2X2YA 5DUML 1PFCA 1EEYB 1V05A 1AI1L 4ZUTA 1WFNA 3B2UD 3KPNA 3VI4F 1QPXA 5JORB 3QUML 1QFWH 1U8JB 1W72B 2IQAB 4ZPVB 1I7UA 2JELL 1ACYL 3STLA 3I2CH 3U83A 4KKBC 3SQOH 5JLZA 1GHFH 1YEKL 5E8OB 5IVXF 3S3SA 1JNHA 4JPVH 3TJEL 5ITBH 4P9MH 4YNYB 3V7AE 1RVFH 4WCYH 4KTEH 4TSAH 3MZTA 2VLMD 3PV6B 4FMKA 3FB8A 4NZUL 5HYQB 3N50A 4F15C 3SGJA 3DWTA 4KTDL 3QFJD 4RX4D 1MHHB 4Z7VA 1EFXA 1CE1H 1N6QL 1MUJB 2VLKD 1DBMH 3V5DA 4OZHB 4P0DA 2HLFC 3X17A 4QHNB 1HH6B 4ZQKB 4BSWA 1T7WA 3REVB 1F4YL 5D7IA 3ARXA 5F9DC 5E6IA 4P9HL 1A6TA 5E8DL 1FLRL 5TFSH 1FP5A 2W9DH 4QOKD 3IJHB 4NJAH 3C6SB 4OZGF 1NSNL 1DBJL 1JNNH 1MCEA 4R26L 3WHXB 2EKSA 2MFNA 4S1SH 5IMOA 2F15A 5L9DH 4LSVH 4GW1A 4K71C 2H1PH 1UYWH 3BP7A 1DDHB 1U3HD 4F8TA 5T5FH 4X8JB 4WW2A 3W0WB 5SV3A 1ZS8A 2EO1A 5JOFB 3GSVA 1FDLH 4MB4A 1JGVL 3B8SA 1SEQH 2NY3D 4PRPA 3RWDB 2F54A 2MQ0A 1GPOL 5MI0B 1HHHB 4FQLL 2A2QT 2P5WA 1FGNL 4JCMA 4UZGA 3C6LA 2B1HL 3OSKA 4MVBC 2DWDB 1Q9OA 2EDOA 4XP6H 3VI4E 1XR8A 3OZ9H 4X6CF 3ULVL 4U6HB 4HUKB 1YDPA 2YWZA 3WNKA 4QXUL 5C0CE 1JTPA 5IVXE 5F3BB 3MCG1 4H26B 5BS0E 2OR7A 4G80B 5KOVC 3FFCD 1NLDL 1N4XL 2B7DT 4UQ3A 5BMFL 4ETQB 1YQ2A 4N8VG 3U46B 5DTFA 4J4PC 1HILA 1K4CB 5ILTH 1RZ8B 4XNYH 4K23H 2WM0A 3D69B 1RI8A 2FX8H 3WEXA 3C8KB 3RAJL 2VDRL 5EZJB 1NEUA 3K81A 3KHQA 5GGSA 4MNQA 1H9VA 5LAXB 4O4YH 3QT2A 3TF7C 5IEHB 1TTGA 3PWPB 1AGEB 1VEMA 5ENWB 5LCVL 3SO3C 3CSGA 4GSDL 1MAKA 4M43L 5FKPA 1QLRA 4N0UE 2W0FA 3O2DA 4HAGA 4YE4H 1BFTA 4KK8D 4OZGE 3Q5YA 1MHEA 3EYVB 1KBGH 1N8ZB 1MWAL 3WIFB 3BKML 1R5WA 3VFPB 1MCPL 3VCLA 1TZHA 3MV7B 1YECL 3QI9B 3SGDH 4HUNB 3ZSTA 2JCCA 1CDHA 3RZCB 3GSOA 4CMHB 1LGVA 4H5SA 3PHOB 5GIRA 4NHUB 4NCC2 3TJHC 3D85B 1R5IB 1RPQA 2AJXL 2X4SA 4UTAL 4XXCA 5F1IB 1H0DA 4X6CE 4JFQB 2VITB 2NCMA 3OF6D 3P3YA 1IEBB 1YUHA 4RCAA 1CICD 1CS6A 4UAOB 4EOWL 3EYQD 1CDCA 2WP3T 3EO1A 2AJSL 1G9MC 3O2WH 4UDUB 4ODUA 3VRJB 3F7VA 3VXRA 4FOMA 4CUCA 3H7BA 1OPGH 3N85H 2ADFL 2BMKA 3HMXH 1PZ5B 3T1WA 5ACZB 2Q86A 5CAYB 4PJBA 3BKJH 1TZGH 3BDYL 4U6VH 1YNLH 2R2CA 2VZ3A 1LILA 3D39A 2DQFB 4GJTB 2FJGA 4R2GB 2BSRB 4QRUA 2KBGA 1MCOL 3RVWC 1GZPB 3MREB 4U2ZA 2APFA 3MRLB 5F7DB 5E5MA 3WD5H 1Z3GH 2EC9U 4IRSB 5IB1B 1I1AB 3VD3A 4N9GA 3UC0H 4XZUB 3IYLW 3QNZA 2HFEB 3EJZC 3I02B 2EE3A 5JPNA 3T0XA 1H8SA 1EDQA 1KN2L 5AWNL 4PJCF 3ZE0F 3BUYB 4QRQA 5HJ3A 1PKQE 4F2MB 4KROD 2CJUH 1VCAA 4MCYA 3PDOB 2DQCL 3U7YL 2E8ZA 2X4UA 3MRRB 1T22A 5BV7L 1Y0LB 2PYFB 5CLTA 1ZHBA 1U2CA 2AKRB 1J1PH 1BLNA 2Z35B 4NKIH 1EHLL 1FG9C 3NA9L 5T1MB 4Y5XA 3CX2A 3FFDA 4ONHB 1MRFL 5EU6A 3VFMB 5IEKB 4N1HB 4M7LT 1ZT4B 2AGJH 5CWSA 1RQ5A 4GH7B 2CK0L 2PW2A 4R4BB 3VWKC 4HQQL 4APQC 4PLKD 2GJZB 3IDIA 4WEMB 3MOBL 4MQTB 1ZHNB 4BSJA 1UXSA 2BVQB 1I9RL 2YA0A 5FM5O 3UCRA 5I15H 1DUZB 4OM1L 4HDIB 3HC4H 2HN7A 5A2LH 1JWMB 4L3CB 4I9WE 4Q58C 3NTCH 1FCCA 2QQNL 3HC0B 5C08A 2OXGA 5CBAB 4P9ML 4LASL 1A3RL 2O26U 3B9KB 1HI6A 4OLUH 1NUFA 3IXTB 4JJHA 3V6ZB 3KLAB 5GS0L 2H8PB 2OJZH 3VFVA 2NW2A 4NJ9H 4CADA 1M71B 2AK4E 4OD1H 1GGIL 3C5ZB 3UYOD 1I8MA 4UT9H 4RFOL 2IF7A 2UY7A 1AO7E 4YQXL 5I75C 1N6VA 2VO5A 3CMGA 4ZOBA 4LPWA 2DM2A 4EUPB 1U91A 3EFDH 3RA7L 4PJGE 1R3KA 1YY9D 5ERWB 5HGDA 1JTTA 1X9QA 1SYVA 3LKNA 1OAQH 3GZKA 3CPLA 2QHRH 2E7MA 1T80A 1D5ZB 1DBML 3QHTC 5HHXH 5T5NF 4RSVA 2ADGB 2DF3A 5MENB 4XX1G 1HHJA 5GS1C 5J1SC 2R69L 5C1MB 3ZE0E 3BVNB 3UTZB 4DTGL 5CEZD 3BAEH 5D4QA 5TFSL 3DRTA 4K3GA 4GRWH 2W9DL 4NJAL 4WFGD 4MNGE 1JNNL 4S1SL 5HDBE 4OM0L 2H1PL 4PY7A 1KFAL 4S2SA 3CMOH 3MJGX 1NLBH 5KG9A 1TETL 3LS5H 3Q1SH 3Q3GB 4GLRH 3SY0B 3VA2C 4TUKL 2HKHL 4QOKA 4LFHD 1IAMA 4XP9H 1UWXH 2LAGB 4L29B 3X14A 4RIRB 3TVMC 4LPUA 5E1AA 3HPLA 1H3WM 3B6SA 4HWZA 4Z7WF 1C1EH 4WTXA 2R23B 3EKCA 4K7PY 4PRIB 5IQ7L 5J8OA 1MPAH 3O6FD 3RDTB 1TQCB 4XP6L 3DARA 4G6ML 5MEPB 1BECA 4RISL 1MWAB 2W9EL 4PRAB 2IAMB 3QQ4B 4HKZB 5DQ9B 3SKMB 4U1IB 4MJ2A 2H26A 2R15A 2Q76B 2NQCA 1SJVA 1YQVH 4XMPH 2EICA 5DJ6A 1ZWIB 3OHXA 5I1HL 3DURA 4JKPL 4JY5H 3PWPD 4Q9QH 5L8JB 4QHUA 1N0XH 3KPSA 3QHZH 1E4XI 3NCYS 2VLJE 2WNGA 4ORGA 3V4UH 1YEHH 1CFTA 5IW3A 1MAML 4GRLB 4CVUA 4NBXB 1OM3H 5ILTL 4DKFL 4QGTA 1I4FB 3TYGL 3P30H 2QADB 2CUHA 2EECA 3RUGE 2APXA 4JVUA 4K3JH 3A67H 4ZDHA 4IMKC 2FBOJ 3UTOA 1IC5L 2GHWB 4FFZH 1PJ9A 3V0WH 2XTJC 3MV7D 2E7BA 4JREB 3V7MA 3QI9D 4I4WB 2ICCA 4X99A 4K94H 5LQBH 3U6RA 3RZCD 1FL5B 1U95B 3GMNA 1BF8A 3ZYJA 4UOW0 2X4RB 3T2NL 2YPLA 1MLBA 4G3YH 4LLYB 4K8RD 3D1MC 5FDWA 1KBGL 5GISH 2XZCL 3F7RA 4XXDA 4BH7B 5IHBA 3SDCD 1NFDF 2Y1VA 4AENA 2EYRA 5D2LB 4YO0A 3WNPA 5J6HB 1KPRA 5FIEA 1I1AC 4KV5F 5I74C 1AGDB 1U58B 3ILQD 5HVGB 3VFNB 4HGMA 3FAXA 3QEQB 4YEFA 1I7ZA 4KY1H 2DTML 1VACB 3M1BB 5ESAA 3WUWB 3MLUH 1RFDL 4Z7WE 1UJ3C 1RZJH 1FNHA 5D72H 12E8L 4J4PA 4XVUC 4KQ3H 1JHLL 2X70A 2APTA 3DUUA 1CFVL 1XF4A 4WWID 4QRTA 5K33A 4DZ8A 5I8CA 5B39A 4R2GD 5BV7B 4JPKL 1CLOL 2FO4B 4WHCA 2IFFH 4FQPA 4XPTH 2C1OB 1OPGL 3I6KA 3N85L 4IRSD 4QYOB 1D5MB 5FOBA 4GAFB 5LBSH 2UWEB 2E7CA 4C4KO 4AL8H 1JL8A 1QG3A 1KXQE 2PKDA 2NX5B 3GI9H 5C0DA 3VGAB 2I9LA 3FRUB 5DSCA 1JPTL 1L7TL 1TZIB 3MRNA 3AB0C 1NDMB 3I85A 4Q97A 3OKEA 5ID1B 3T09A 2FX7H 1QOKA 2EDNA 2VR9A 3AVEA 4CMMB 4WTZG 1DBAL 2PF6A 3FT4A 5GZND 1P7KA 1AD9B 1B0RB 4HPOH 4LNRA 2AJ3A 1OB1A 4M9PA 2CJUL 2FGWH 1BD2B 1IC4H 5E9DE 1NFDE 3S5LB 1QA9B 1WT5C 1ZANH 2DQEH 3MUGA 4JO3H 3PV7A 4BJLA 3QUXB 4LCIH 2IPKB 4NQDA 1J1PL 4IRZL 3QG6B 2GKIA 3I75A 2D03H 2X1PA 3MLZL 5CP7B 2K7PA 4E5XA 2R56H 2BCKA 4YAQA 3O3DA 4PB0H 3WLWC 3V4PH 2JB5H 4LLWB 5ESVB 4MMZC 3U1SH 5LGHL 3QIWB 3BEVB 4LLVB 5K9OA 4XNQA 3QA3B 3C5ZD 3OAUH 4OF7A 3IETB 5I15L 1C5DA 5HGBA 5JORA 2IQAA 1U8JA 1W72A 3T65B 4ZPVA 3MA9H 1OTSD 4UTBH 1I3RB 4CGTA 4XAKE 1VSCA 2ATKA 1RIHL 5HDQL 1BQSA 2MHAA 2VWEC 1QSVA 4D8PB 1KTDA 5DC0A 4PJIF 3ULVD 4JQXA 4YK4B 1NCBH 4P4KB 5DLML 4XBPA 4OCRL 4X6DF 1XIWB 2B39A 5B3JF 1MFBH 5MEND 5HYQA 4NM8L 1VKXA 5F7FA 5IFJA 5DD1L 1MNUH 1CE6B 4JLRB 4L8DB 2EXWC 2A0LC 4LSUH 2EYSB 3HCVA 3HE7D 1XGRA 1JGDB 1NGXA 4CVXB 4KZDH 3H7LA 3V6OE 1OAQL 2HKFH 1AKJB 1FNGB 3EDDA 3MRKB 2Y07L 2QHRL 2E27L 5DK3A 1PD6A 1EAPB 5EBWA 4JY4A 5ADPH 1HH6A 3REVA 3VWKA 4APQA 1J1XH 1ZT1A 3RGVC 1BIIA 3VFSB 4G7YL 5DRXB 4W6WB 3A6CL 1JGEB 5EU4B 8FABB 3IJHA 3C6SA 2Y6SC 1U8QB 1MFNA 4LGPB 4F33B 2NY0D 4P4RB 3BRFA 3QDGA 1NLBL 3RDTD 3W0WA 5GZOC 3FB7A 3ARUA 1Q9LB 3W2DL 2IAMD 4E41E 3RY5A 5ADOH 4NDMA 4YPGA 1HHHA 4XP9L 4BYHA 4U33A 1ROWA 3WIHA 3SKNB 1S7TB 3GMOA 3K1KC 3UDWC 1MJUL 5DO2C 5E2VH 3QUYB 5M95B 4ZSOE 4GRLD 3MRMB 3OKMB 5F89B 5HYSA 4M8QA 1CXIA 4K7PL 5F3BA 4N68A 2GJ6E 2QADD 4M5YL 3NIGE 4H26A 1UWXK 3U7AA 2JKXA 4G80A 4PJIE 4C54A 3QRGH 5FO8B 4OCMC 2GAZA 3QZWB 3TNNB 3UJTH 5GS1A 4Z6AT 3U0PA 2DYPA 4NUGH 2RCSH 3P73A 3HC3H 4PUBL 3UMTA 4UBDC 3CK0H 4TN9A 3SJVB 1YEHL 1HEZB 3P4LA 1K4CA 3V52H 3MUHL 2WINA 5HHME 4TVPH 1KJVA 2WUBL 5FUCC 4JPWH 1CGSL 2VDML 3P30L 1EVTC 2Z8WC 3A67L 3FQUA 5EZJA 4ZUVB 4JO4H 2DQHH 3LIZH 1FNFA 4LARH 3V0WL 4XGZB 5IHLB 1MCFA 1A4JB 5DC4B 4QWWD 4OT1H 5LQBL 2ERJC 2DLTA 5BZWA 3TVMA 4YHIA 1AR1C 4Z0BL 5EZLA 5AZEH 3PJSA 4TUJB 3QEQD 4QT5B 5F9WB 1QSEA 2F19L 3EYVA 1N8ZA 4OSUL 3ZSSA 2B4CH 3G04B 4ZUUA 1I85A 5CILL 3VFPA 4KK6D 3JTTA 4OQTH 4JDTL 3FKUS 2IH3B 1CXLA 3QI9A 5E5UB 1AXSA 5CIPH 3ZKXB 3NVQA 1JPFA 4PP2A 1PAMA 1PKQB 1ZVSB 4NHUA 1ULVA 5FYLE 4XI5D 4OUUB 1MEXH 1NBVL 2JK5A 2ZCKL 1S9XB 4XP5H 3D85A 2AAVA 1NCAH 1EAJA 5I73C 3OX8A 3LVEA 4X4ME 4I3RH 1RZJL 5D72L 5EO1A 2WWKT 4KQ3L 5I17B 4QHMB 4JFQA 3UTPE 4LPCA 2NY7L 5SWZB 1A64A 4HEPG 4TTDD 1F45A 4JN1L 4XMLL 3HNSH 3DETC 3LEYL 2VL5B 2NX5D 5D1XC 4IMKA 5SWSB 3VRJA 5C8JB 5MP6L 4BQBA 1PZ5A 2CDGA 4N0FA 4BK5A 2Q7YA 4JRWA 3WXVL 1MFCH 3TIDB 4AZ8A 4Z7OF 3FN9A 3NPZB 3K8MA 4OLXH 1YYLH 4FTVA 4AL8L 4PJAA 2Z93B 2BSRA 4WJ5B 1HSBA 4R0LC 1CFQB 1BD2D 4OIBA 1SMAA 4IBLT 3ZLQC 3MRLA 5F7DA 4HIXL 4KKAD 4FG6C 1I1AA 3UO1H 5K9QI 4FFWD 5DJ8A 3GMMB 2FX7L 3CFDB 4U49A 1GGUA 3I02A 2DAVA 5MEOB 1LDPH 5F7EH 1UJ3A 3NIFE 4RQQA 3BUYA 4GG6F 1CBVH 1JV5B 3WO4B 2EZ0C 5EUOF 1IC4L 2X5PA 2CGRH 2PYFA 2XRAL 1FFPB 2Z35A 4LCIL 3ESVF 3HZMB 4R7NB 4PJCB 1Z5LB 2C3XA 3QFDB 5T1MA 1NBZA 3SBWC 2BC4B 3BP4A 4AK1A 3EO9L 5IF0B 1WZ1L 4GAYB 4MNGB 1RZKL 4NFBA 2ZUYA 3IVKB 3V4PL 2GJZA 2JB5L 4P4KD 3HLAB 4OGZA 3TH2T 1XIWD 4MA1B 3WFCH 4GRWB 4JEGB 5CGYC 2NY1B 1RURH 4HX1B 2ENSA 4HDIA 3L5XL 1JWMA 5HYJB 4UTBL 3KWWA 4NN6C 2LQRA 3DVGB 3QWRD 2AQ3A 3GM0A 4FXLA 1RSFA 4I77L 4JG1H 3OKNB 3CAFA 5ISZB 5I1GH 1UEMA 2GK2A 5CBAA 3GSWB 3B9KA 4J1UA 4ZS7H 3IXTA 5IVOA 3KLAA 1BMGA 2H8PA 1AKJD 2WBJC 4Z18A 1YEEH 2YWYA 3CFJB 3ZYIA 2W1NA 1M71A 4F9PA 1YMMB 2EDYA 1TJHH 1OAXH 4G42B 5ESQB 4HF5H 1WT5A 1T1ZB 3QUYC 4U05A 3TO4B 5DI8B 5C0NC 4XBGB 5ERWA 3O8XD 4G8GE 3K2MC 3Q6FB 4EI5C 2ADGA 5F8RC 5ADPL 4NCC1 1JE6A 2DL9A 4YHKH 2VR5A 1HINH 4GG6E 4XCNB 4H8WH 3UTZA 1B3JA 2DKSA 1EGJL 3HZKA 4KI5C 5DK0B 5EUOE 1J87A 2DQUL 4WRLA 4Y19B 1DBBL 4MAYB 3TCXA 1ZE3C 5HXMA 3ILPB 4MHHI 5H2BA 2CKNA 1SMOA 4Y8DC 3MCLL 4PGZA 4RZCB 5LGJA 2UZXB 1FNSH 4MJ6B 2D2OA 3SY0A 1A0QL 5DYOA 4LCUA 4A6YA 4FQHB 5JXAH 1OTTD 3CDGA 1F8TH 5D7KE 5DUBB 4LVOB 1ITCA 1T03L 3KDMB 3BH9B 4L29A 2P42B 2BSSA 2DJUA 3TM6A 3S34H 4PRIA 1X5AA 1TPXB 3TT1L 4WV1B 3RDTA 2X4PA 2VRAA 5E2VL 4ZO9A 3SJVD 2HWZL 2ADJB 3CFKB 4PRAA 1LEKA 3O6KL 2VUOA 4U1LB 4Z7UF 4H20H 3W5MA 4L8BA 1U8OB 5E95B 3D3VE 3UTSE 1B4JH 4EEEA 3DI3B 4KJWC 1CL7L 3FQRB 3B9DA 3I84A 3IRZA 1ZWIA 5TDOB 2EDFA 3IU3A 3BSZL 2P46B 1RJYA 2KPNA 4NUGL 3RGVA 1RUPL 3HC3L 3S3PA 4LQFH 5DHYB 1MI5E 2QHLA 1YPZA 3VGEA 3KXFE 4MSWB 5HVHB 2BNRB 3HFMH 4TVPL 1K8IB 3BHBA 1I4FA 3GRWA 2AJZB 5CP3H 4JPWL 4YDVB 2VSDA 1RZGA 3LKSB 5K9JL 1PVHA 3KR3L 5D2NE 2PXYD 5KSBA 1UZ8B 1EBPA 5DK2A 3Q5TA 5TF0A 3LIZL 3TCLB 2DKMA 1NEZG 4HIIA 4I4WA 1QYGH 1HHKB 3SE9H 1U95A 4OT1L 4D0CA 2C7UB 4M61A 1RMFH 3RWEA 2DMCA 2X4RA 4MNHB 4PG9B 1BPVA 2WIIB 3MRJA 3UDWA 4ELMF 1RK1A 4ZFOL 1HSAB 5FYLL 3MUZ1 5JQ6H 2GSGA 3E6HA 3OTTA 5J13C 1XF3B 4OD3L 5D2LA 3R1GL 4O00A 1VFAB 1K2DA 5GSVA 4Z76B 5SWZD 7FABH 5HSFA 3D0LB 1U92A 1AGDA 1U58A 2YK1L 3SGKC 5HI3C 3JWNC 1KYOK 4UIKH 4ERSL 1HYSD 3MXWH 4O58L 1VACA 1NFDB 5SWSD 3O4LE 3V79C 5DJYA 5KVDH 1NGYB 4L3AA 4QRSB 1J0KA 1KTLA 5DD5L 1U8NB 7CGTA 1H3XA 4Z7UE 3HNSL 3EOBA 4I9WD 4Q0XH 2YD3A 2FO4A 4F37K 2F53A 1S9VA 1VEOA 4P5MA 3E8UH 4HC1H 1S9YB 1UB5B 4TPRL 1ZAGA 4JHAH 5DVKA 1BGXL 2VABA 5ACMA 5FDYA 1JNJA 1JTOA 3C08L 3MUJA 5T3XL 1A6AB 4ZFFA 4DQOH 3FRUA 4IOSD 1VFOA 4HMEA 4RGNC 1LO5B 1VERA 3QXUA 3RKDC 1J12A 1TZIA 1JWSB 5C2BH 4Y1AE 4G6AC 1L0QA 5EPMB 3V8CA 4ZAKB 1H5BC 4KPHL 5ID1A 3UO1L 1KJ3H 4OGYH 1CFBA 2MKWA 4HJ0D 4P2RA 4L1DA 1BQLL 2NTFA 3ZYZA 4IMLA 1B0RA 2ESVA 3GFUA 1LDPL 3P0VL 5F7EL 4XPHL 3JUYA 2XZQH 1X4YA 3DUSA 5C6WH 4ELME 3EYUH 3K80A 3STZB 2DQGL 4L4VA 3FQTB 2JJTC 4P46C 3QUXA 4I1NB 3VXMA 5JPMA 35C8H 2IPKA 1U8MB 2CLZA 5D1XA 3QG6A 2R1YB 2NY1D 1QBML 2ZUXA 4RNRB 3EOTL 4P23B 5HYJD 1OGAE 4UDTA 4JANB 1RULL 3LD8C 5TE7H 5C6TH 5ISZD 4KZEL 3VGFA 2BHYA 4NNYB 4UOW1 5CLWA 2UY6A 4WI3A 1IGJA 1WWBX 2ZOKA 3QIWA 1DZBA 3F5WA 4MAYC 3V7AG 3UTQB 4JRYB 4R0LA 1YMMD 4KUCF 5F71A 5FYJH 5T1DH 4E41B 1D9KC 1MFAH 4L1HA 2AP2A 1I7TB 3QXDB 3TO4D 4OFKA 4NKQB 3VGGA 3GJFB 9CGTA 1QNZL 3GO1H 1XIWA 4WFHD 3N1MC 4I3SH 4ZSOB 3U36A 3IJYA 3TPUA 4K94C 3UTTB 4O2CB 1TJHL 4L4TE 2PCPA 4LRNH 4UNUA 2P5EE 2GJ6B 4HF5L 3OBAA 2DQTH 2RJMA 4NQCE 2EYSA 5B8CC 3ARFC 3SDDB 3IKCB 4X6DB 1FC1A 4Y19D 2R4SL 5FM8A 3MRFB 3S96B 4LDLB 2VZUA 1X7QB 3MRKA 4N8VA 3L3GB 1JYVA 5HVWA 3I6LE 4U1HB 2VC2H 5HHMB 3MNVB 1XGYH 5JW4N 4FQ2H 4F7TB 3SQBA 3VFSA 5D93B 3DSNA 1YJDH 2YD1A 1IKFH 2HRPL 8FABA 2Y25A 4NQVA 3AC0A 4WUKL 1QQDA 3RPIA 4F33A 4JE4B 2OXHA 3KYNA 4P4RA 2D7TH 2CLVB 1XGPB 5IHUL 3TN0B 1FNSL 1Q9LA 2W0LA 3OL2A 3T0EE 1SBBA 3FT3A 1T4KB 5HHVH 5JXAL 1P4LB 2FGZA 1F8TL 1N3NA 3BP6B 3DECA 2WBJA 4GAGH 5T3ZE 1LE9A 3VH8G 5IG7B 5EO0A 4XC3H 4TRPH 1FFNA 1S7TA 4HZLB 2LV4A 2BY3A 3QUYA 2ZSWA 3QUZC 3MRMA 5F89A 5IHZB 2BNRD 2VMFA 4JRXB 5D7SL 3NH7L 5ALBL 1B4JL 5FGCB 5GRYA 3ZMRA 4EI5A 1A3LL 2G2RB 3QZWA 3NGBB 3UAJC 5CIPB 4FFVC 4Z95L 4PGCA 4ZPTB 2Q8AL 5EBGA 4JFDA 2ATPA 4GMSH 2EIDA 3H0TA 1HXMA 3SJVA 5DQJB 2AV1A 1HEZA 4P3CL 2JB6B 3HTLX 3V5HB 4PJDF 2VZ1A 4M48H 1UCTA 2CMRL 2YOCA 1N0LA 4ZUVA 1JMXA 5E4EB 1VA9A 5D71H 3WV0A 1G0YR 4XGZA 5HYIA 4KMTL 4XCCL 5CCKL 1EEQA 2C3VB 3BQUB 4M7JL 5SWQB 3MR9B 3D48R 3SE9L 1HDMB 3I3BA 2IMMA 4F57H 3HMXA 4TUJA 4QT5A 4YXLH 3GGWB 4RMVA 1U9KA 3HE6B 3HHRB 4YDKH 5I9QC 1GGCH 5JQ6L 3QDJE 3PABB 4QRPE 2IH3A 4NM4H 3DNKA 3L5JA 4UV4H 4D94A 3BPNB 3QJHB 1LO4L 2Y5TA 3VU2A 3QAZC 4UIKL 3D25B 1S9XA 1P7QB 3C8DA 4DUXA 4NRXA 5F7KC 2Z92A 1DBKH 5CZXC 5J56B 4RRPG 4EXKA 2CSPA 1FGVH 2VAAA 1CLCA 5GGVY 5K9KA 1EO8H 1T83C 2P8PA 4Q0XL 4PJXA 3ULUF 4YPJA 1ZV5A 3B9AA 4QF1A 1BBJA 1V3MA 1AXTH 3L3JA 5C8JA 3E8UL 4GXVL 3WIIL 1LNUA 3MRHB 3NZHL 3DX9B 3KGRA 3QBTB 5GRUH 5E2TL 5IV2B 3R0NA 4M62L 3FZUD 4X8XA 4DVBB 2Z93A 4WU7A 5IOPB 4PLKC 5F70A 1VFUA 4PJDE 4OGXH 3MLPA 4JG0L 5F1NA 3BDXA 3JV6B 2JE8A 3GNML 3GMMA 3SGKA 2Q6WB 5EORH 3QJFA 3SOBH 3L1OH 1MCKA 3NCEB 1QO3B 1VB9A 3FQNA 2JJWA 1NDGB 4JAMB 4P23D 2WLZA 4WDIB 1G6RL 1J8HE 2DDQL 4MAUH 4NQEE 4WUUA 2XZQL 1R0AL 4PLOB 4AEFA 4I13B 2D3VA 3MXVL 5I8EB 5CJ5A 1DFBL 1ZLSH 5ETUB 2D0HA 4CU7A 2ZWLT 1DANT 3HZMA 1MSPA 4FA8A 3QFDA 4GG6B 1EFQA 1I9IH 4M7ZB 4E41D 4EI6A 3LB6D 5IF0A 5J11B 4ODVH 4GAYA 5TE7L 3HG1B 3TBYA 4ISVA 4UT7H 3O41B 5HI5D 2VXVH 3PQYA 1IZJA 1HWHB 1RZFH 2D7QA 3CFBA 2ED7A 4KJYB 3H9SE 5FUOH 3UTTD 5GGRA 5I19H 4HX1A 5FYJL 5T1DL 2EEBA 5JHLL 3MYJB 3ULUE 2GJ6D 5DD0L 1LO0L 1H5BA 4MDJB 3MO1B 1QFUH 5ISZA 3SDDD 4PJ8B 5I71C 1P5UA 3RTQB 1FZMB 3VE0A 1A5FL 3EYOA 4LHUB 3CFJA 3TZVB 1JPSH 3H3PH 2EDWA 5HHMD 5EU5A 4G42A 3NBNA 2FSEA 3E3QC 4MA7H 3LPFA 1NGWA 3LKPB 4C56A 1T1ZA 4Y7MA 2JJTA 1GRWA 2B4CC 5JR1H 3U4BH 3U0WH 2PYEE 4XAWL 3O6FC 1P9MC 4W6YB 4QLRA 1NMCB 4OI8A 2NNAB 4HS8L 1KJ2H 3DYPA 1FFOB 4TVPD 5J3HD 1WUNT 1KG0A 3BKYH 4K55A 3TN0D 4PRDA 1T0NA 4O2EB 2FIKA 2Y06H 2F5AH 4XCEB 1EJ6A 4K2UH 3DROB 3QXVA 4D9LH 1Y18A 1QKZH 1YJDL 1AC6A 5DK0A 5FOJA 3MFGB 5HPMB 3PWJA 4MAYA 4D0BA 2VXSL 5T3ZL 2OLDA 1TVBA 2BXYA 3RQ3A 4H25B 3MRIB 5IT2H 2X10A 2ZKHH 3DI2B 3RNKB 5IMLA 4FQHA 1G9NH 4NKDB 2AJUH 4NIKB 2O5XH 4R9HA 4JRXD 2DBLH 4P99A 3BQUC 5E7FA 1T66D 3EDJA 1A1MB 4LLAA 4AIOA 4WEBL 1U8IB 1KLUA 4OKVB 1A7OL 1UB6A 3BN9D 5B8CA 3ARFA 1ZEAH 5E2WH 3W9DB 1XGUA 2FWOA 2Y7QB 1U8OA 1N59A 3DV6A 3RU8H 4HXAH 3VXQB 5H37H 1CD8A 4LCWB 3BFOA 4ONFL 4I48B 3OAZH 5TDOA 1I9JH 3D87B 3HNVL 1LP9F 4Z7UB 1ZKAA 4GMSL 2YHGA 2ZG2A 2OX5A 1VGKB 1GIGH 4KGJA 1WBXB 4XNUH 3THMH 1JPGB 4YDVA 2XZAH 2YXFA 2E7LC 4GXUM 3LKSA 2E8YA 5F96H 4HIHA 4WHYH 5T3XD 3HE6D 5I8KL 1YEIL 3AM8A 1BHGA 4F7EB 3MLXH 3LKOA 1UZ8A 2V9RA 4HCRL 4HUUB 3DTXA 5DMGD 2OI9B 4X4YB 4U6YB 3E6FB 4WHYG 2PUQT 2VQ1A 3VJ6A 2CDFA 4XVTL 4UQ2B 4MNHA 3FB5A 4YXLL 3RKPA 4KKLD 4DW2H 1P7QD 4U1KB 4YDKL 3CXDL 1J10A 4POZC 1RHHB 3I9GH 3KYOA 1HZHL 4Z76A 1VFAA 1F58H 1FVCB 3GSQB 4WTZA 4HPYH 4NKMA 4N5EC 4Y4KC 4URTB 5I2IB 4OLVL 2VZSA 1NC2D 1UKTA 5IWLA 5TE4H 4BZ1H 4ZOAA 2FHFA 4U1MB 1KCKA 1WWCA 3PL6B 3OKOA 4HXBL 4Z8FH 1DBKL 1U8NA 3TBSA 2DMBA 3HAEG 3BI9X 1NMAL 3GSXB 5DJ0B 4HUXA 3BP5B 1EO8L 2JJUA 4OFPA 4RGOH 5FM5M 1HOCA 3VG0H 4H88H 1KN4H 5AUMB 1FVDA 4YX2L 3UXFA 4B5EA 5A2KH 1QSFE 3BE1H 3PP4L 5GGVL 2A73B 4PRNB 1A1OB 4NBYB 2EIBA 3PHSA 1U6AH 4CJ0A 5GRUL 1OAUH 4CKVX 2FIRT 4GOSA 2G75B 1UXWB 2BDNH 43C9A 4HUWB 1I8KB 2LE9A 4H8WC 2ITDB 6FABH 4PB9L 2DN7A 3Q48A 3T4AA 4WENB 4OF3A 2P24B 2C1PA 1OLZA 1GXEA 3MLWH 4L3EB 4ZAKA 3HKFA 3RBGA 2X42A 1TXKA 1BZQK 4H0GA 4ONGL 2PN5A 2OK0H 2P8MB 3MLYL 3L1OL 3UP1A 2FEEI 4JFEE 4RGMC 4MXQC 3G5YB 4CVZA 1EPFA 5DT1H 4YXKL 4MAUL 3ZZ1A 3Q0HA 4ZNEE 4GQ9H 1H8NA 3JWOL 4CJ1A 5EC2A 3NZ8A 5DRWB 1JYWA 3MOAH 1T83A 2VXUL 1J0JA 3ESUF 1U8MA 4MZ3A 4TSBH 5A16B 5IROC 3O6LH 3FO9A 2R1YA 1I9IL 3W81A 3E2HB 3MODL 4JFOB 1RAMA 4FQCL 4P23A 3HE7C 3VFTA 1WTLA 1F6AB 4DN3L 2SEBB 5DRZA 1TNNA 4PRHB 3ULUL 1E28A 4OAWB 4PJ8D 1FNAA 3FJTA 4OF5A 4NNYA 3RTQD 1NAMA 2VXVL 2VLRE 5C3TA 4LHUD 2P48B 3TZVD 2BRRH 2CKBH 4HS6A 5FCSH 3UTQA 1KC5L 4JRYA 1X4XA 2VQTA 3O0RH 2ZSVB 1Q0YL 2XA8H 5TPWH 3MJ9A 1LMKA 1I7TA 2IQ9L 5IB4A 2FEDD 2B5IB 3QXDA 5FV2A 2R0LH 2NY0C 4RFNC 3A6BH 4KJQC 1MFDH 5BO1H 1HNFA 2OBGA 1KB9K 2VB5A 3S36H 5JNYA 1S3KH 4XHJC 4HIEB 1P4BH 2NY6D 5EFIA 1JPSL 3RWCB 5F7NC 4O2CA 2WQRA 4XMKH 3TFKD 4MA7L 4P2QA 4Z7VF 1OTUC 4HULB 1IGCH 4GKOA 3ARSA 1WICA 1INQB 5E2UH 2A6IB 3MRFA 1OF2B 3L3KB 4A2MA 4M1CC 5D7IF 3QHFL 3VRIB 1UKSA 3N1GC 4L5FH 1OLLA 4U1HA 5I16B 4Q9RL 2HJLA 3T08A 4M6NH 5KANI 3MNVA 1UCBH 1N5AB 3DMMB 2Y06L 2F5AL 5H94B 4G9FA 4RMRA 4Z5RB 3H9HB 4YFLI 1DEDA 3DGCR 1A14H 1AR2A 3DXAE 3KS0H 3SKJH 3P40A 2FJHA 4C83B 4U1GB 1IVLA 4WW2F 5DJAA 5D9SB 3EW3B 4KMQA 4AH2A 3O81A 2PO6B 1XGPA 4UILH 3RVUC 5DZOA 4LSQH 5DMJB 4LKXB 1T4KA 4LBEA 1P4LA 1XF2A 1ZT7A 3GBNL 3NCYP 4JO1L 2AJUL 5DJCB 4PJEA 1B9ZA 4QY8B 3MRBB 5DEGB 3BX7C 4FQIL 4KUZH 2BVPB 3P77B 5LGKA 5IG7A 4AG4L 4LCWD 1MQKH 3GEWB 2BJML 1JK8B 3BZEB 2FBJL 5E24E 3B3IB 2W91A 4JJ5B 4LVEA 5C0AB 3U7WH 1RUKL 1WEJH 4NN5B 1DN0B 1ZEAL 5E2WL 3IDJB 1ZHKB 2IALB 4MXWH 2B1AH 4JRXA 1HHGA 5FK9A 1P9MA 4OQTA 4ZS6D 2Q8BH 1RZIA 1MREL 1R24A 2G2RA 2Z9TA 1I9JL 1JFQL 5ABDE 4XPBL 2FHBA 3IFLL 4KKCC 5DQJA 1OAKL 2AEIT 4XI5C 2NW3B 1OGTB 2R0WL 4Z7VE 4Y1AD 3CXHK 2WANA 5F96L 4AIXA 2YA2A 2V17H 5E8EA 4HBCL 1HN1A 3OAZK 1P4IH 1T5WA 1J0ZA 4WVRA 3K3QA 3MNWB 3BQUA 3JSSA 3MR9A 1HDMA 5FHBH 5T1LB 1T2JA 4EVNB 1JZ7A 4JB9H 2J8UA 5E8PB 1W0WB 4OUOA 2VLLA 2RGSA 3N1QC 5KSAB 1RUAL 3F12B 2GT9A 2OR8A 1WAAA 1QVOA 3PL6D 1AJ7L 1CLYH 2WWMD 2KZWA 2HFTA 2JCCF 2HT3D 1AGFB 4S11A 4B0MM 4Q6IB 3VXSE 5L88L 3D0VB 1IJ9A 4IM8A 4PRPE 5GS0C 4HPYL 4EQ3A 5ALCL 1GC1H 1J8HB 4POUB 4NOBA 1M7XA 3BO8B 2P5WE 4KKAC 4PD4J 5HHOE 2HFFA 3W39B 5BRZE 2D9QB 2MNUA 1IT9H 1QPPA 1GOFA 5J4MA 5TE4L 2Z4QB 4ZYKB 2Z31C 1Q8MA 2UUDH 3F62A 3MLTB 3HUJA 2AJYH 5D6CB 3IS1X 1NGZB 2E7LA 2R2BA 4IIQB 3HI5L 5B3NA 4JDZA 4RGOL 5B4MD 5B38B 1LK2A 3C09C 3ARPA 4OFYD 3OKKA 4PJBF 2DKUA 3MRHA 5C09B 2XN9E 4DAGL 3T0WA 4OLYL 5FYJD 4WEUD 4DGYH 1X3DA 4UMGA 3LDBB 3DO7B 5IV2A 1OAUL 1C8PA 4JZOA 2H41A 3QUMA 4KXZI 2FL5B 3OB0H 3RWIB 5DVOA 4MNQE 3TT3H 1PX4A 4M9OA 3BZ4B 3O3AB 1W8OA 3ARZA 2CIIA 3RVVD 1WC7B 4KHTH 4HFUH 4ORZC 4Y4KA 4LL9A 2Q6WA 3KYKH 1IBGH 2DQJL 4PP1D 4KHXH 3TIEB 4J3SA 1QO3A 2HVKA 3FO2B 1CXHA 4HWBL 4X0KA 3L7EA 3FN0H 1KPVB 3B2VL 4KK5D 4I2XA 1T3FB 3QWOA 4PGBA 4OCYH 5KVGH 15C8L 3MV9B 1QACA 2JCCE 2Z91A 4LOUD 1XCTA 1AHWB 3K8KA 3T0ED 3IGAA 4M6AA 4TSBL 3RNQA 5HGHB 4MCZA 3LN4B 4AIZB 3JWDL 3LHPL 3HZYB 4UUJB 3X11A 1CF8H 2H9GA 5T3ZD 1KJ2B 1A9BA 3HG1A 1FZJB 4HWEL 3EFFB 4JN2B 4WI9A 2MKLC 5I1AB 4XVJL 4J7RA 2F8XC 4KUCD 1J0IA 3WHE1 4KJYA 3D18A 4ZFZB 5GHWH 4F7MB 1HH9A 4JHWH 4J6RH 1NUDA 3ARDD 4HEME 4TNWF 3MYJA 1JGLL 4MDJA 3BPLB 1IL1A 2JJSC 1S7WA 1U2HA 2R0LL 4FNLH 3MV8B