4M43L

Crystal structure of anti-rabies glycoprotein fab 523-11
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
213
structure length
213
Chain Sequence
b'ELVMTQSPAILSVSPGERVSFSCRASQIIGTSIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLTINSVESDDIADYYCQQSNSWPVTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fragment antigen-binding 523-11 light chain
publication title Crystal structure of anti-rabies glycoprotein Fab 523-11
rcsb
molecule tags Immune system
total genus 46
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2013-08-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m43L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m43L01
1R3HB 5FECA 3GBLA 5KS9A 1IAII 5T1DL 4JE4B 1BQHA 3BP7A 4MA1C 4W6WB 2XQYG 4HXAH 3LEVL 5FGSA 1OD7A 3ZYZA 4FXGA 3IXAB 4F3FB 4BFEA 3T2QA 1DBKH 1PDKA 2DWDA 1UYWH 1EVUA 4KVCH 1LEGB 3CVIL 5DJCB 3PGCA 5C0GA 2F5BH 5JOEA 1IGML 3RIAK 4O02L 1JGDA 1A6AB 3C09C 3KG5A 5CHNA 1FL5B 3NFSL 4WNQB 4XAKD 4X4ZA 3MA7A 1SHMA 1NGZB 1ZK9A 1VDGA 1KFAL 1A1NA 2MJWA 4RFNC 1OT1A 1FO0A 3C2AH 4HUNB 1QRND 3VXUB 1I1RA 1S3KL 4JDVA 4PY8I 3UJIH 1D6EB 1BD2E 3LH2H 4BZ2L 4ZDHA 4ODUB 1KT2B 4U1KA 3C60A 3T4YB 1G84A 3T0WA 1INEH 2R1WA 3N85L 4PJ5D 4Y4FC 2Y36L 1DQQA 5GQBA 3SDAD 3OKLA 4NM4L 1CD1B 2E6JA 4ORGA 3KPTA 3D6GA 4HKBA 4BH7B 3DUSA 1QSFD 3BD5A 3OMZA 4YXHL 3FB8B 3K1DA 1T1XA 2OR7A 3ZHKA 3EZJB 3ZKXC 5BS0D 3ARFC 3S3PA 2Y5TB 3AREC 3U9UB 2XT1B 4YHKL 2OP4H 4LDLB 4V1DA 1OTTD 2VYRE 4N68A 3VXSB 4ENEC 3WSQL 3QDGB 5E6ZA 25C8L 2R0ZL 5HDBF 3STLA 5JLZA 1LNUA 2EO1A 2JK5B 2VXQL 3NGBB 4KKCC 2X4UB 4J1UB 4GRMB 1QFWM 1G6RH 4PRAB 5HGAB 2X1QA 2ICEA 2HTLC 4JFYB 1OLLA 5IBTH 4U49A 5CCKL 5I73B 3DGCR 1BGXL 4HMCA 5FYJD 2RFXA 2DJUA 2HLFC 5D6DA 1AY1H 3LKRA 3OKKB 1H15A 2JCCE 5A16B 3MLWH 3WFCL 4Y8AA 4O2CB 4XCCH 1P2CB 1BFTA 3D0LA 4IJ3B 3K4ZA 4LLWA 3GMOA 1YEGH 3CVHH 4XBGA 4LDEB 1EHNA 1IGJA 1IC4L 2YN5A 2VC2L 3UPCA 1J05A 1NCAL 4HX1B 2J12B 4RZCA 5BS0B 3LS5H 2PXYA 4K8RD 3BHBA 1QKZL 4FQHA 5ISZE 2DTML 4G8GD 4CW1B 3VGAB 1OSPH 3OR6A 2DB8A 1PZUB 4R0LB 5K33A 1J8HB 2V9TA 4IM8A 5D1QD 5GHWL 2YD8A 4DAGL 2XNAB 4HD9A 2IH1B 4LSPL 3CU1A 3SO3B 2I26N 4F7MB 1X4YA 5CZXD 4GBXA 4P9HL 4HPOL 3PP3K 4NN5B 3ZT5A 1HCFX 4L4JA 4AYFA 2Z92A 2GJZA 5ITBL 1S9XB 1EJOL 4K23L 5KG9B 2BHYA 3I2CL 1FH5L 1UM5H 3HG1B 4NQDA 4KDVA 2Q3ZA 2HFTA 4XBEL 2ITDB 4Y5XA 1EBAA 5HJ3A 3TEUA 2DM3A 5E9DA 5L88L 1VCAA 2WW8A 5H37G 5CD5D 2APFA 2CLZA 1MCOH 4M1DL 1JRHL 1IE5A 4RRPG 4GUPA 1Q9KA 4GXVL 2HVJB 2PW1A 4B7IA 2P42B 4HUUB 4AEIL 4K3EL 4YPGB 5GJSL 4RBPK 5EN2B 5FUZL 4NUJA 4PJHE 3VWKC 1HINL 4E42B 3D9AH 2QHRL 3SDDA 5C0FA 4ZOBA 2V5MA 4HZAA 5L2KA 5F9OH 1FV1B 3RWIA 2JCCF 5DVMA 5SV3A 3WDJA 3D39A 4M4RA 3NN8B 5EBLB 2UWEE 1N0LA 1R24A 5D7IA 4TUJB 4HG4K 1A9BA 5EZLA 4G8GB 4KQ4L 2CK0H 4APQA 1RZFL 4DZBA 1ROWA 1YY8B 3MX0A 4FS0A 5D1QB 1CLZL 3GM0A 2BVPA 5HI3C 3GGWA 4HH9A 3ARDC 1CIUA 4NBYB 4JFED 2AABH 5I6XB 4N8VB 2D2OA 4R4BB 4NQEA 2DMBA 2CJUH 1RJYB 2JKXA 1U8QB 3DIFA 3MRIA 4LU5L 4WHYG 2ORBL 2MNUA 4OZIE 4ETYA 2VXVH 3ZYIA 4KJQC 3UYOD 3W5MA 4LKXA 5HVGB 1F97A 2V7NB 4NWUL 3V5KB 4U2YA 4N9GA 2A74A 5C0IA 3F5WB 1KCVL 1SYVB 3T3PE 1HDMA 5E1AA 4X8JA 1I7ZA 1S7QB 5AYQA 1G0YR 1QBBA 3U4AA 3BKCL 2NXYB 2X4TB 3U4BH 3HPJB 1NBQA 4ISVB 4LGSB 3P11L 5D2LF 1JYXA 1NC2B 3PWNB 1GGYA 3QXAA 1ZAGA 2BNRE 4K9EL 1BX2B 1JWSA 4AY0A 4QOKE 2X89A 5C9KA 1A47A 4BZ1L 1KB5B 2W91A 4HS6B 3DXAE 3J7HA 5EU4B 3WDHA 1K8DA 4PJHF 4M8QA 3GO1H 4C4KO 5CFHA 1CFVH 1AD9B 3GUTA 4AQOA 3RIFK 1BFOB 4JFFE 5DRZA 5E8EA 4F58L 3CJJA 3FQNA 2UWEF 1TZGL 2DJ4A 1MHPH 1TQBB 3IFNL 3K2UL 3O3BB 5DFWH 3CCHA 2CMRL 5DJYB 4HKJA 3FCTA 2UVEA 1GPOH 4QEGA 4LCCB 3CX2A 3TV3L 1ZSDA 3GSNH 1CFQA 3O6LH 4V1DD 5JO5B 1AHWC 4M5YH 5FGRA 5KAQG 5KSBA 3OGCA 5J11C 4GSDH 1EAPA 1BIIA 2HLAB 1JTPA 3DOSA 2VDNH 4I77H 4QRUA 3C8DA 3VXNA 4LSUH 2QSTA 1F58H 2Z4QA 1DBKL 1DBJH 2LQRA 3HUJF 4PJDE 1UYWL 4KC3B 1K4CB 2FH8A 4KVCL 1RUML 4NBZB 3F7QA 3VXME 2X1WL 5D9SA 4N5EC 4OZIF 5KANI 1IBGH 4HIXH 3UPAA 5JDJA 2FEDC 1J0IA 3ARGA 1ND0B 4I18C 3C8KB 4HUKB 4P4KC 4O00A 4ZDHB 1IFHH 2VIRB 3B83A 3C2AL 3FZUD 2A6JB 5B39A 4S0SD 4LQ1A 2GITB 3UJIL 3KJ4C 3LH2L 4OLYH 3SQOH 3X11A 1INEL 4NN6C 5GS0D 3G5XB 3DRQA 3E6HA 1XGTA 3HMXA 3DXAA 4HKBB 1L4IA 3DUSB 4X6DE 3TBYB 5AG9A 4G43A 5EIIB 1TIUA 3ECBA 2W9DH 2PXYD 2FGWH 5C3TA 1UZ8B 3CMOH 2Z8WC 1Y18A 3CSGA 4OIBA 3CDYA 2OP4L 1QLRB 2FIKA 4RNRA 4L3EB 1K3ZA 4PJXB 4IIQC 3E2HC 4X6FB 4GBXD 2DQDH 4Z7VA 3PQYE 2VSCA 5DD0H 3W11C 4NKQB 1VFAA 3HE6A 2XZAH 1QSEA 3MR9B 5C71A 3LD8B 1DBAL 1G6RL 1B4RA 4NQDD 1MLBB 4G42B 3ZTJH 1CN4A 5GRVL 3RA7H 2VZ3A 4UZGA 5E9DD 3F7VA 1F45A 3ETBF 1AY1L 4EI5A 4WWID 1VA9A 5EIQA 3V7AG 4QXTB 1QACA 4LSTH 1V8HA 4R96A 4XCCL 2C5DC 4UB0H 4QYOA 3SE3A 3X3GL 3L5XH 3SGJA 2VOTA 5D93B 3SDDD 2EE2A 1YEGL 4P2YA 1J05B 2FGZA 3I3EA 5L2KD 1QHPA 1MHCA 1P7HL 4Y16A 2PYFA 2XPGA 1RZIA 2GTWA 3D39D 2F54E 4J3OC 4WO4C 5MI0C 3LMJH 2N7BA 1I7TA 4UDUB 4K71B 5E2UH 3VFUB 3VI4F 4ZSOB 1UWEH 3LS5L 4NYLA 3IGAA 3QQ4A 2E7HA 5IBLD 1X5JA 1OSPL 2ZPKH 1TZIA 4X6DF 4IRZH 1NAMA 1D5BA 2DM7A 5F9JB 4GBXB 5T5FH 4NHUA 1U8IA 3G5VB 2MKWA 3SKUD 3E8UH 2QBWA 4NQED 1XFPA 4G80A 5TE6H 1T2QH 3OJ2C 4PGBB 1G1CA 2N1KA 4PY8J 1HOCB 4NQDB 3R06A 4LSSH 1WICA 3ARPA 1RIUH 2D03H 3JTSA 3O6MH 4Y2OA 1UM5L 1M1SA 5E6IB 3RVUC 2R2CA 4HC1L 1TCRB 4RAVA 2CLZB 5IVXE 1LO4L 1JPGB 3CZFA 3PF2A 3VH8G 5BW7A 4P2QE 1S7XB 4S2SB 4X9HA 4QF1A 4X9GA 2RAMA 5ALCL 1MCOL 1FAKT 1EERB 3UTQB 2BCKB 5D1XB 4X4YB 3IDJA 3SDDB 3MRFB 3C6LA 4EKXA 2NX5E 5GGRY 3T0VA 3FQWA 4ELME 1FNAA 3D9AL 1NDGB 2G60H 3I85A 4F33B 1JHLH 4AT6A 5HD8C 2UV3A 5FM4A 3BH8A 4JKLA 5F9OL 5IJKA 1RZKH 3EOAA 2X89D 2P5WB 5HI4D 2C3VA 4DQOH 4DZBB 4OCSL 1WEJL 3MO1A 4I4WA 1IAKA 2CK0L 5HGBB 4Z76A 3H9ZA 3BPNC 5HHME 3S5LA 1D6VH 3G04A 2DKUA 3LOWA 3O4LD 1I8MB 4IMLA 4P9HC 1CXEA 3GB7A 2AABL 2EYRB 4XCFH 5L7XH 5DQJB 5IIEB 5IFJB 2VKWA 3DROB 4ODVH 1G7HA 2B39A 1BLNA 43CAB 4GW1B 4YJZL 2WP3O 2JIXB 3BO8A 1KNOB 1NCCH 2NZIA 5DJ8A 5DMJB 4MJ6A 3VU2A 1JE6A 5FV2A 2VXVL 1HXMA 4X7TA 4X83A 1WWBX 4AZ8A 5JW4M 3B4NA 1A3RH 4PRPE 4F9PC 5JHLH 5E2JA 1BVKB 2DQFA 5J1AA 2AEPH 2XY1A 3UBXA 4Q9CA 1EEZA 3UXFA 3F65A 1XIWC 4PRNA 4XB7A 1EEYA 3M45A 3U4BL 1WC7A 3IFPA 2DKMA 2GAZA 2E9BA 4K8RH 3RWGA 3QXAB 4M61A 3TJEH 4BQ6A 2J6EH 4GQPH 2OTUA 1UJTA 5FO9B 2IBBA 2ICES 4UUJA 4QY8B 3HZYA 4CJ0A 5E99H 1BJ1J 1P4BH 5ESAB 2Z31A 1PEWA 4K3JL 4ELMF 4ZUSA 2XTJD 4XH2B 2VLRE 3O4LB 5E8EB 3PV6B 3GO1L 3OB8A 2CK2A 4WI4A 2BVUA 5CGTA 3KLHC 3T65A 1FNFA 1HH6A 3D69B 1MHPL 4MJIA 5I1HH 4R4NC 1LDPL 3O0RH 1IAIH 1EZVX 1GPOL 2APTA 1EAPB 4R9HA 3GSNL 3O6LL 1OAYH 4M5YL 5HGGS 5I16B 1WQVT 4RFEA 4GSDL 5MEOA 4C4KT 1HILB 2EDHA 3OKYA 1ZHBB 4I77L 5B8CC 4KAQH 4JO1H 1NFKA 4JFOA 3TN0B 1F58L 3UBXI 1DBJL 5CJOH 3TH2T 3EJZD 3MC0A 3GSOA 1QSED 4P5TB 1U8PA 2NTFB 2P24B 4YBQD 1IBGL 3EDEA 4HIXL 4K9EC 2GHWB 4JKMA 1KB5H 2FDBP 3O6KH 5DQ9A 5KVGH 3V6ZA 1X9QA 4EI5D 3BMWA 4HK3N 1AGFB 1IFHL 3T08A 1I75A 4WJ5B 3WL9B 2FO4B 2ZOKA 3KWWB 4HDIA 3SBWA 4URTB 2PYEB 2XTJB 4OLYL 3SQOL 3RTQC 4HHAA 1B9ZA 1LDSA 3VXOA 5I74B 1PKQB 5CKAA 4LEOB 4Y16D 1A6UH 5B22A 3VGHA 1UCTA 4U6XA 1FLRH 3BQUD 2Z9TA 4CN4A 1KTDB 2W9DL 3RKPA 1ACYH 2FGWL 3CSYA 1EVTC 5D1ZC 2ESVE 1MRFH 3V6FB 4NO5A 4OT1H 3CMOL 1UA6H 2DICA 2NY2C 1T22A 1CDJA 4S0TD 4Z7VB 4N9OB 1TMCB 5EU3B 1VFAB 4GG8B 1MVUB 1NCNA 2DQDL 1NLBH 2VZTA 5DD0L 4PRIA 4BSWA 3MV9A 5GJTH 4WI7A 2XZAL 1XEDA 2P49B 1QA9B 1U8JA 5E6YA 2COQA 3BZEA 1S7TB 1AR1C 5TH2B 2Y7QB 5DA0B 3RA7L 5TE4H 2QQNH 3MRJA 2OQJB 1F90H 4I2XE 4KKNA 3SGDI 4A6YB 4NDMA 3MRBA 1CL7I 1NKRA 4QYOB 2H41A 2C4FU 1U2HA 1QLEH 4OLUH 3Q5OA 4PBXA 3O41B 4LSTL 3C6LD 5E8NB 5HYSA 3X3FL 1F11B 4UB0L 5DD6B 1E27A 4WFED 2J4WH 4FQ2H 4YK4B 3U7YH 2NY4B 3U83A 4Y16B 3ZLQC 3AXLA 4QT5B 5IJVB 3EYSH 4ZQKA 5JMOC 1INDH 3BQUB 3L3KA 5DD1H 5JIKA 1WCBB 1CDCA 2B2XL 3OTTA 3L1OH 3LMJL 4XNXH 2YWYA 4NYLB 5E2UL 5EFIB 1UWEL 2KDGA 1TZIB 4FFVD 3OJDB 1U93B 5F1IA 3G08A 2ZPKL 2ESVA 1AGEA 4K94H 4IRZL 4PV8B 3L3JB 3BZDA 4WFFD 4XVSH 1BJ1H 4IEFB 2ZSVB 2GEEA 5T5FL 5F1NA 5C0NC 1BEYH 5EC2B 1YEEH 1IC5H 2E7MA 3E8UL 5TE6L 3VXUE 1T2QL 2MQCA 3QA3B 4OD3H 2QJDA 1B0RA 3IETB 4LSSL 4PY7B 4WW2F 4OQTA 2ENYA 1RIUL 2D03L 1LK2B 3O6ML 2CPCA 3FB6A 1MCQA 4X5XA 2C3XA 1EUTA 3IJYB 1TDQA 1OAZH 5DHVA 4X0KA 5J06A 1T04A 3SOBH 4OF8A 4FTVA 4KK5D 1B88A 4XWGH 3FOMA 3FQWB 1T20A 3MQIA 2ZWLT 3V6OA 3ARBC 2YA2A 3HMWH 2G60L 5EIVA 3QH3B 5C0DA 2WBKA 2DQCL 1JHLL 2FSEB 3BUTA 3VXSE 3WIFA 1WZ1H 5I17B 1RZKL 3GFUA 3QDGE 1C12B 4NM8H 5DRXB 3ZHDA 2CO6B 4DQOL 1CGYA 4PGEA 2VDPL 1RMFH 3S5LB 2Z31D 3TFKC 2Y6SD 1TTUA 2K3TA 3RDTC 3VCLA 2AVGA 5LAXB 3QQ9D 1D6VL 3MOBH 4MXQC 4YE4H 5DD5L 4MJID 1JWMB 1QSZA 2GJ6B 3NA9H 5KSUB 4XCFL 3P73A 5L7XL 1C1EH 1I9RL 4NO3B 3FTGA 1U36A 2AXFA 5FYJL 1U8LA 5DJ8B 4FQXB 3O3DA 3UAJD 1UACH 4OFPA 1HXMB 1TXKA 1F3JB 3V5HA 4X7TB 1NCCL 3GIVA 2VE6A 3FONB 1F3DJ 2Y25A 4Y8DC 3MODL 4DKEH 4LF3A 1NBYA 2OJEA 1MFDH 3VMPA 1MI5A 3RY4A 2DQFB 1Q0YH 3IFOB 1GAFH 4LSRH 3UBXB 2F9BT 1J9CT 3MV01 4UBDC 5IG7B 1A3RL 1YMME 2NPLX 4LVEA 2PO6B 3HCVA 1OD9A 2AEPL 5FGBC 5SWQA 3W0WB 3GBMH 3PHOB 4K8RL 1J8HE 4UUJB 3TJEL 4ODHH 3GM8A 4YHMH 2J6EL 2HP4A 1RUPH 1G7QB 5IHUH 3RAJH 5FHBH 5I8EB 1WWWX 5E99L 3EW3B 3CFCH 5JXED 5D7KD 5BJTB 4JREC 4KPHH 3KPLB 1N7ML 1P4BL 2P8MA 5C3LD 5EWIH 1G7JA 1BAFH 3HG1E 4KRLB 1SY6A 3VRJA 4C55A 1G1YA 3PHQA 5FAAA 1VACB 4YAQA 3TPUB 3PDOA 5I1HL 4BK5A 4I0PC 3NCBB 3O0RL 1IAIL 2EDEA 3VD7A 5GGVH 5K9KA 4YDVA 5MEOB 1W0VB 3U36A 4UOW0 1OAYL 4RMSA 4S1RH 1KN2H 2CXGA 1KIUA 3QIBB 1WCQA 5IQ9A 4KAQL 3W9DA 4JO1L 5DURB 3O9WA 3G6AB 1FVEB 5CJOL 4OF0A 1J87A 3EFFA 4NQSA 1I9JL 4ZS7H 4PRID 5I2IB 1WT5C 3L7EA 3MV9D 4M6NL 5AWNH 1IM9A 1IEBA 2YD7A 3HAEB 1T3FB 4RISH 4IRSA 4WI6A 3VE0A 5ICYA 4YIQA 3RWJB 3C6SA 5KVGL 1AQDB 1BVLB 4GW4B 2KZWA 1KIPB 1YC7A 3SDCB 1OVZA 4D9LH 5JZ7C 2W0LA 5CUSH 3RWFA 1M05A 1OAKL 2J5LC 4QHMA 1DQJB 3VXOB 1I7UA 1DN2A 1FCGA 3VW3H 3SJVA 2OTWB 1CLOH 1FAIH 3JV6A 5D5MB 3EHBC 5IESH 4HWUA 3G6JA 3TP4A 5FDWB 3TA3C 3MROA 4L8SA 4J3VA 1MCJA 1FLRL 4MD4B 1S9YB 3T2NH 4ONHA 2IAMD 2NY6B 5J13B 1ACYL 1H9VA 1JUFB 1MRFL 1MCSA 5D7JC 3OPZH 2YD5A 3QDAA 3PWLB 1U95B 3DURB 2V7HA 1JGVH 5C09E 4M5ZH 2XWJA 3VFGH 4WW2C 4IRJB 3TNMB 1T1YA 3KPSA 4CU7A 2VXTH 4BYHA 5F72S 1MCKA 3BD4A 2HT4D 1VEPA 5KSAC 5FV1L 5GJTL 1XGUB 4M00A 3QEQA 3BIAX 5EA0H 5J12C 3D2UA 1YPZB 1JZ5A 3D5OF 4NDMB 1MWAA 5TE4L 3HMXH 2QQNL 3PDDA 5IOPB 5BOPA 1F90L 3AFLA 4P23C 1F3DH 4FTVD 4QRPA 5CWSB 4P46A 3CGTA 2AGJH 4OLUL 1QLEL 5HVFB 1S78C 2KQNA 4XPGH 3VG0H 4YXKL 1WWCA 4ZQKB 2J4WL 2AKRB 3L3KB 4FQ2L 1GH7A 4LRNH 2J3SA 4CMHC 3TVMC 4LIQH 3EYSL 1I85A 1INDL 3KPNB 2IAMB 1P7QA 3BZFA 5JIIA 3L1OL 4QTHA 4XNXL 4HWEH 1G7IA 1ES0A 3O3EA 4YFDB 5F1IB 1KXQE 3G08B 3F7YB 4OFYA 4ORZC 5C2BH 5DJ2A 3FO2B 2QR0A 4PJAB 5DQDH 1VESA 5D72H 1GJIA 4U1IB 2APBA 2QTEA 4KRPD 4XVSL 3RVTC 3D0VA 1GXEA 5ADPH 3I84A 1BEYL 1VERA 1MCEA 4D3CL 2WANA 4OD3L 5C92A 4NT6B 4Z7UE 3GSWB 5B3NA 2NY1C 2HKHH 2H45A 3QDJA 1KB9J 3AS3A 4A6YH 2VWEE 1ONQB 2BNQA 2YPKB 3I9GH 1BECA 1IKNC 1MI5D 2WBJC 1JZ4A 3WN5B 3KR3H 3OKDB 4FTVB 2AJVH 4PTTB 1OAZL 4XCYB 3ES6B 4XCNB 4AEHH 3SOBL 3ULVD 3W39B 2IMMA 1QPPA 3CFBA 2Y4SA 2WIMA 4XWGL 2OL3B 5F9AC 4HMEA 4JAMA 3B5GA 5LCVL 5GZOC 3MGTA 1FP5A 4MX7B 3I6KB 4Y5YB 5DVOA 2NQCA 3HNTH 4KGJA 4L3EE 43C9B 4D0BB 3QPQD 4PJXE 5L8LB 1HZHH 1WZ1L 4P5MA 4PGEB 3L3DA 2YN3A 2AXGB 2YXFA 5FKAB 4NM8L 4X6CA 4HJ0D 5F88B 4ETQA 4Z0XA 1RMFL 1PQZB 1IGIH 2CXKA 1NCWH 4YHLH 2VR5A 4KRPB 2A6IB 3NGBC 2K7QA 4HIJB 4I0CC 4NZUH 4UDTA 1RJZB 2X41A 3MOBL 4YE4L 3FTGB 4YHYC 3D18B 3AS2A 4KHXL 3RU8H 3NA9L 3O3DB 5I73C 4WU7B 3BPOB 1C1EL 4NRXA 2VR4A 4OZFA 3C5ZA 4Z0BH 3V5HB 5F1KC 3IVKA 3PIQB 2EKSB 1EH9A 2H9GA 5IEHB 4GRLB 2VH5H 1MI5B 4Z7UA 1SBBA 3V52H 1FE8H 3NCEB 3SDAC 5DI8A 4IBLT 4DKEL 4POUB 3O9WD 4H26B 3HCVB 1Q0YL 3AAZA 4LAJH 1P4LB 4LSRL 3WE6B 5GISH 4NGHH 5I19H 1ZT1B 1IM9D 3QDMB 1LO0H 2CQVA 2FLRT 4IRSD 1P4IH 4G9DB 1YUHB 3GBML 3Q6GH 4EEEA 1DUYB 2IH3B 1RZKC 1VGKB 4U1JB 4JQXC 1JF5A 1WK0A 3VGAC 4YHML 1VFOA 4Y4KB 4W4OC 1OTTC 5MENA 4Y89A 1RUPL 3RAJL 4R0LC 4XPTH 4ZTOH 2L4OA 4LPUA 3CFCL 2EE3A 4KI5D 2VLKD 4L4TA 3SO3C 4RRPA 2C3WA 3SJVD 2OK0H 5EWIL 3U6RA 1GZQA 3E3QE 1EUUA 5DS8B 1J18A 3ZKSD 4RGMB 5DVNA 2CKBB 3MMEA 5CBEA 1BQUA 3ZDXE 3WBDA 1NKOA 3MJ7B 1IMHC 3PHSA 4LLVA 4XXCA 1JZ7A 1CFTB 3PL6B 1CD9B 5K9KB 5D71H 4G5ZH 5HHNA 3QFDB 4ODSH 2VJXA 1DQMH 2ATPB 1MCCA 1T66D 3IDMB 4S1RL 1BZ9B 2OSLA 1CGWA 2J8OA 4PRBA 5I71B 3KPSD 1JVKA 2P5WE 1ETZB 2EC9U 4JQVA 5DRWA 3CXDH 5AWNL 3EYFB 5FM5O 4K8RC 2VERN 3QEQD 2X1PA 3D2UD 4JJ5A 1S7WA 1T7YA 4MZ2A 3QEUB 3MUY1 1S7RA 5DO2D 2IWGA 3GJFA 3SKOB 5DF0A 1OPGH 5D1QC 2X1OA 2ZUWA 3IDXH 5GRWA 1ZS8A 2H1PL 3RWFB 2VL5A 2V5TA 4QRPD 2VLKB 4P9ML 4PTUA 4TRPL 5CZXC 5CUSL 3KNBA 1Z9OA 3X12B 1T1ZB 5EOTA 1JL8A 3VW3L 4HW6A 4D9QD 4XAWL 3G6JB 5J0BA 1CLOL 4NIKB 4L29A 4ZFOA 4Z5RB 5DRNA 1NBZB 5IESL 1P7QD 4CVZB 5GPRA 1A6ZB 3BIKA 3BEVA 3PXJA 3T2NL 4MSWB 4OFYD 3FO9A 3OXRA 3X13B 3S37H 2A9MH 3OPZL 3LSOB 3MFFB 1PY9A 3U46B 2P5EA 2JJVA 2P44B 1T4KB 2NXYC 5CD3A 3ZDXF 5HY9B 1T1YB 3KPSB 4M3KB 3MCLH 1JGVL 3LDBB 4M5ZL 3CU7A 3VFGL 3WS6C 4J2XA 1MY7A 2VXTL 4JZNA 1T2XA 2X1XR 3ARUA 3WJLA 2Z8VC 1FVCA 4FQLH 5BVJA 2BMKB 2OR9H 4EN3A 5I0ZA 3QDJD 3OKNA 4HLJA 4HV8B 3WUWG 2BNQD 12E8H 5EA0L 3SGDH 5A3ID 1CL7H 4YHOH 5D7IF 1WV7T 5I8OH 4AQ1B 4J8RB 2EDDA 3HMXL 1VFMA 4QRPB 5IKCB 1S7VA 4LLQA 4RIRA 3O3AB 1M4KA 4LBEB 4QTIH 4U6HA 2VMFA 2AGJL 4DK3A 1TQBC 4R26H 4XPGL 3VG0L 3KLAB 2W65A 5F9WC 1XR8B 4TNWF 1ZHLA 4LRNL 1FNHA 5IMOA 1QYGH 2X44D 4O51B 1NGXA 4QGTA 1YYLH 1S8DA 1JGUL 5DJ2B 1CLYH 4HWEL 3CUPB 4HS8H 5JIHA 3UTPD 1I1AD 3F6IA 4FP8L 1R3JB 5DQDL 5D72L 2FL5B 1NEZB 1O7SA 5CP7B 1U8NA 3DNKA 5ANMA 5FKPA 1PVHA 2VRAA 4M7KH 1X5GA 2A73B 3KGRA 4AENB 5ADPL 1Y6MR 5FYLE 1MCFA 1RUQH 3DO3A 5H94B 1CGUA 1IILE 4P2CG 3C5ZD 3OR7B 2PYEE 3JTTA 4W6XB 1IL1B 4Y1AA 4P2RA 2HKHL 3DV6A 3K4DA 2RIKA 1R3IH 4A6YL 3I9GL 1PKQE 1WZKA 1GZPA 5HYIA 3MNVA 4UNVA 3KR3L 2VWEC 2AJVL 1CWVA 4LIQE 3BN9D 4JAMB 4AEHL 5HYJB 5DK0A 4NQCA 1LEIA 2IAND 4KJWD 5DTFA 3TT1H 3HI5H 4M8VA 3AROA 4OFVA 4XRCB 2BVOA 5MEND 2X70B 4AMKH 4X6CB 3KPQA 4YZFE 4Z0XB 1DTUA 1WITA 1I1AB 4JPWH 1HWHB 3UEZA 4NO2B 5ICZA 4LSDA 5KSBF 4L4TD 4ZXBA 5I1CH 1IAOB 1JGEA 1IGIL 3H3KA 1NCWL 4YHLL 5ID0B 2CIIB 5FA4B 4NZUL 5F3BB 1BWMA 5SWSB 3TO4A 1VENA 4QHLB 3SKNA 3QI9A 4DKFH 1HHHB 4MCZB 1V3JA 4QWWD 5CZVH 5D6DC 1C5DA 2I07A 3F7PC 1L0YA 5IHZA 4RWYH 1IEHA 3FZUC 2NR6D 4F7CA 1RI8A 2CR3A 4KUCD 1KTLB 4POZD 3VD4A 1HH9A 5DI8B 3IS1X 4PJCA 1MFNA 2VH5L 5GS0C 1HI6B 3V52L 1G0XA 5SX5H 3NABH 3BP4A 3H42H 5HTSA 3FO0H 5D93C 5I18H 5CGYD 1IEAB 1T6WA 3QRGH 2OL3H 1Z5LA 5CKGA 1NC4B 5GISL 4NGHL 5I19L 2DLGA 9CGTA 2PXYC 4E41E 2IANB 3LB6D 1LO0L 2WQ8A 4XMKH 4K71C 2XN9B 1P4IL 4O2EB 3FOLB 3TBSA 5J6GA 5IFAH 3Q6GL 4M43H 4J12A 3WNPA 3PJSA 4LHUB 1YY9D 3T0ED 1G7MB 2PETA 3VH8A 5C9JA 4XPTL 5EU6E 4EUPG 2DM4A 4GBXC 1IQDA 4XP9H 4XNQA 3H9HA 5F8QC 2OK0L 5I1JH 4Z7VF 3O11B 1RK1A 5F89B 4H1LG 3PWJB 5TDNA 3FO1B 4LPWA 1NAKH 3D3VE 1NGWA 1NDMA 1P7KA 2BP3A 5SV4A 1AD0B 5JPMB 1HHKB 1NFDE 4KY1H 1L9NA 1MCPH 2A0LD 2Y5EA 4G5ZL 5D71L 2X2YA 2C7UA 1I9EA 1X4ZA 4HWZA 3HLAB 4ODSL 2P5ED 1OW0A 4PRBB 4M48H 5I30H 3ZT7A 1AXIB 3SDDC 4IMKA 1PGRB 4G6AD 4LAQH 4BFBD 3IF1A 5DGRA 5ERWA 5ACZB 1WBZA 3QULA 1U3JA 5KZCB 1UKQA 4XHJD 5A43C 3LHPH 3MRKA 3DVNA 5HPMA 1EZVY 4EN3D 3BW9A 3HZVB 3TBWA 5HGDB 1A0QH 5I0DA 1XF2B 5IBLC 2FYYA 3GJEA 4NQXB 2APXA 1LGVA 5DJDA 3T0EB 4AK1A 3H8NA 4W6YB 1UJ3B 4K55A 1DSFH 3BOVA 4F37K 3IDXL 2GJ6E 1H8NA 5E08H 1BBDL 3U0TB 4R6UA 3CPLB 3C5SB 2CKBH 5KTEH 5EU6A 1YNTB 2DQHH 4ZFOB 1HKLH 4XPHH 5ELIA 3VXTA 3FHQA 3LKQA 4U6VH 4JFXA 2CDFB 3QEHA 4G6MH 1I1FA 1U0QA 3NPSB 1U8HB 2Q1EA 4JFDB 4NPYB 4FN0A 3BPCB 4YC2B 3S37L 2F53E 4P2OA 2IF7A 1R3LA 5L2JA 1NFDA 3W0WE 3HE7B 2A9ML 4RMTA 2EICA 2V2TA 1KEGH 2FB4H 3MCLL 4GAJH 5F7UA 4DKDC 3QFJA 3MLSH 1FVCB 5BVJB 3ISWA 3K3QA 3OBAA 4X4MA 5HI4C 1FL6B 4Y1AD 1T5XA 4P2RD 4ZUTB 2AQ1A 4YBLC 2OR9L 1KIQB 2IPUG 4HGKC 4G8FA 1XR9A 12E8L 3LKSA 3WYRA 2EEDA 1CL7L 4YHOL 5JHDB 1CVRA 5I8OL 4L9LA 1BP3B 4ZPTB 1UB6A 1IGYA 1RZ7H 5C0BD 4QTIL 3K2MC 2A2QT 2BOCA 2BSTA 4NQCD 3BESR 1NL0L 2IADA 4R26L 4YUEL 5EO9B 1MOEA 2O5XH 4YDKH 1Q8MA 4OFKA 3FKUS 1SVZA 3MLVH 3NIGF 4X80H 4TTGA 4WW1B 1S8DB 1LP9A 4PJGA 4IHOB 1Z2KA 1YJDC 4RGNE 1QYGL 1A6TB 5DYOA 1YYLL 4ODWA 5EOCJ 1CLYL 2CLRA 3PWVA 4CBPA 3D25B 4HS8L 4ZXBD 1F5WA 2I9LB 2M8XA 3BRDA 1YZZA 5AAMA 1JYWA 5FKPB 4PJEB 4BH8A 2HG5A 3VWJA 1J7VR 3WFDH 5GGSA 5J56B 2HN7B 4OKVB 3TO4D 1MCHA 4M7KL 4MQ7B 3VD9A 5DR5H 1MWAH 4MXWH 4X5WB 4HGMA 32C2A 3OAZK 4H0HB 3BPLB 3VXRA 4NRYA 3GMLA 5EDXA 3S6CA 1FDLH 3T1FB 3F12B 1INQA 3QSKB 3WS3A 4PUBH 4JLRB 2XTJC 1R3IL 3KYNA 5D5ME 3RWHA 4XP1L 5C0BB 3TWCH 3Q1SH 5I74C 3RGHA 3Q6FB 5MERA 3GNMH 4J7RA 5CGMA 4L3CB 3OJVC 4HK0A 5GGVY 3TESA 3TT1L 3HI5L 1MHEB 3QXDA 3OB0H 5IVZB 5BMFH 5C6WH 4UTAH 5MHSD 3LEXB 4WU5A 3ULUH 8FABB 1L7TH 3MLYH 3NTCH 2FD6H 3QYCA 2SEBB 5ILTL 3WHXA 2Z91A 4U31A 4OCYH 1QBMH 2VABA 2WIIB 3EJZC 5JR1H 1PLGH 3BJLA 2XQYK 5I1CL 5HXMA 1ZLWH 3U1SH 5JORB 1OCWH 5HHOB 4YBQC 1YPZE 4FQ1H 1C5DB 3RPIA 1J0HA 4OQTL 4Y19A 4LCWB 5EPMB 3EGSA 2NW3B 1MIEH 4XBPA 4NJAH 4C83A 5FYJU 3FRUB 4EI5C 3WFHA 4RWYL 4OLXH 5ICXA 1KJMA 4X6EA 1BBJA 1FL3A 3WNNA 3SE3C 3SGJC 1J1PH 1U3HD 4PJIA 3B9VA 4MA1B 5IT2H 1AIFB 3NABL 3H42L 4JY4B 3S8WA 1Z5LB 3OB0K 4YK4C 3FO0L 4PJFA 4WFHD 4EZMA 4Y16C 5I18L 1NCUA 2OL3L 4WEBH 2J2ZA 4H0GA 3B8SA 1NBVH 3I75B 3BQUC 1KJ2B 3SGKA 2E3VA 1X5AA 2AXHA 4XMKL 4GG6A 4PJAE 5F7DB 3MCKB 2AERT 4N0UA 5IFAL 4F2MA 4M43L 1P1ZB 4U05A 3IU4H 3RPKA 3ME0A 5DMYA 4GMSH 2BOBA 4HBQA 4X4XA 3FFCA 4ZPVA 4RFNB 5D4QA 4EXPX 4JRYA 3SPVB 2KL6A 5DJ6A 2DM2A 5AD0B 2PCPB 1LE5A 5E00B 4YHPA 5F93C 4P0DA 2NMSA 1LO5B 1DDHA 2DWEA 4XP9L 1U8MB 5HGHB 1TVBA 1T89A 1IM3A 3O4OC 1W72A 5I1JL 5F8RC 1TJIH 3ZE1F 1NGWB 3MOQA 4J3TA 2LVCA 1MJUH 1A7PH 4U6TA 5BW7C 1NAKL 2E8YA 2ZCHH 1IKFH 4UI2A 2Z8SA 3P4MA 4NKOB 4YX2H 4KY1L 2D7MA 2MQ0A 1OP5K 4I3RH 2H8PA 1V7MH 3ZKXB 1MCPL 1ORQA 1HHGB 1U3HB 3ARFB 5CMAB 4JG1H 3JWNC 5EOCH 1YPZF 2RBLA 5FF6A 2OZ4A 4M48L 3QJHA 4P3DB 4ODXB 3QFJD 4LAQL 5IJKC 1NFIB 2EDXA 1FFPB 5TF0A 2FHFA 5HPMB 2WV3A 3T77A 2DQIH 4F15C 4S1DD 3JV4A 4LPCA 3QG6B 3V6BR 5H37H 3ZDYF 2G75A 1JPST 5BRZA 4JRWA 3P77A 4U1GC 4UT7H 1DSFL 2WM0A 5JOPD 5FO7B 2ICCA 1SY6L 3SKMA 3RUGB 5E08L 1FGVH 2ERJB 4HJJH 4JFZH 1S5IH 5ESQB 3Q2CA 1DEEB 2OXHA 3N9GL 5KTEL 4LKCA 2DQHL 3MUJA 4MJ2A 4Q6IB 1HKLL 1YEJH 4PP2A 3REVB 4FQXC 4XPHL 2IBZX 3QCUH 2H2PD 1I1FB 5CEYA 4L8CA 3OXSA 4U6VL 4YGVA 3LKPB 2VUYA 3IU3A 4G6ML 3KPPA 2XKUA 3AB0B 3P2TA 4ZFZA 1XF4B 3QDME 3ZE2F 4X98A 5FB8A 4KK5C 2D7PA 4B53A 3T2OA 3VWJD 4MAYA 2FZ3B 4OCMC 2DQTH 1FRGL 1F42A 2GY7B 4NNXA 1FN4B 1U8KB 2YWZA 4U7KA 2APVA 3ARYA 2R2HB 4JPVL 5H35A 5JXAH 4WHYH 4FQCH 2CRMA 4GAJL 4NOBA 1XMWA 1KGCD 3MLSL 3GJFH 3OAYH 2HFEA 2XY2A 3RVVD 3VXRD 3EDDA 4OCRH 1NGQH 1XR9B 3QUXB 1OGAA 5EC1B 2Y6SC 5DJAB 5ID1B 1UG9A 3STZA 3NIDE 2BOCB 3OKOB 3QQ9C 1D5XA 1ZWIB 2DKSA 4NNYA 3W82A 4LASH 4FQQB 3GSQB 1RZ7L 3B6SB 1JN6B 1S7SB 5INDA 2DYPB 4I8DA 3S34H 1BZQK 3QWRA 4EDXA 1Q9WB 2VQ1A 2JF1A 3I6GA 1WWAX 4JHZA 3UAJC 3QIWD 2O5XL 4YDKL 1AQKL 3VWKB 1OGTA 3C08H 3MLVL 3UC0H 4X80L 2V17H 1T0NB 3UZQA 3ABZA 5E8PA 4Z9KB 1EXUB 2WINA 4UIMB 3LPWA 4M7LH 2J1KA 4LLMB 3GJFK 4BH8B 1U91A 2R2BA 3OAYK 2GY5A 4ZUUA 1IGTA 4PP1D 4XPAH 3CLEH 2Z0BA 4WWKA 3WFDL 3R0MA 4Y19D 4TQEH 3DARA 2I27N 3HFMH 4CVXA 3ARDB 4NUGH 4OB5L 1NUGA 1L9MA 1WFTA 1K2DB 1TETH 1HHJA 1MCWW 5GGUB 1YA5A 1MWAL 1ZGLA 4MXWL 3VFWA 1RIHL 2QADB 2FCBA 5JXEC 5DJ0A 2D7NA 5C0AB 1KF9B 4BQCA 3MV7B 5DEGB 1FDLL 5F70A 3RWHB 4PUBL 4Y5VA 1BFSA 4QRTB 5C08A 1EMTH 4OGYH 1JF1B 2R9HD 3K0WA 3TWCL 1Y6KR 3Q1SL 4GS7C 4ZG1A 1JHKL 3GNML 4PRHA 2YD1A 3QPXH 5DJXA 3QIWB 5DEFB 3A6BH 4UU9A 4WU5B 5GZND 5IR1B 5J13C 3WFZA 1ZVSA 5GGTA 4HUMB 3VFOA 5BMFL 2R4RH 4JGMA 2AQ2A 4LCUA 3FFCD 2NY7H 4LLYA 3WHXB 3ULUL 5FUCE 2CUMA 1L0QA 1JTTA 1LEKB 2Z91B 2AEIT 1L7TL 3KPMA 3MLYL 4JRYD 2CRYA 3NTCL 5EO0A 4BQ8A 3AM8C 4Z77B 2FD6L 3LRSB 4LEXH 5I1LA 4M6AA 4MD5B 3JUZA 4OLWH 5IFHH 4JKWA 3P9LA 4YR6B 2I60L 1QBML 3NAAH 5JR1L 2XRAH 3O2WH 3U1SL 2JB6A 4OCNC 1OCWL 2PTVA 3B3IB 3M8OH 4TN9A 3VI3E 1RZGB 4FQ1L 1KLUB 3QO0A 3VFPA 2XG4A 4LLUB 1UWGH 4IDJH 4OLZL 1C08A 1MIEL 1MFEH 4ODTH 5F96H 4E5XA 4ZD3H 4NJAL 1TVHB 4XPBH 1AE6H 1FL3B 4OLXL 4OZGE 2F8OA 4AIZB 1J1PL 2OLDA 1MCDA 2GSGB 5IT2L 4KTYA 3L3HB 4U6YA 4XC1H 5GS1A 1MHHA 3MOAH 4OF7A 4KI5F 4ZO6A 1JNHA 1Q0XH 3TIDB 4GMTL 5BO1H 4WEBL 4GG6B 1NMAH 1NBVL 2B1AH 3ULUE 4S10A 2IAMC 1RVFH 4F2MB 4Y2DD 1F4HA 4XHQA 2Q7YA 1G7PA 5BRZD 2EDYA 2Y07H 3G6JF 4HS3B 5EBWB 3WKNA 1SYSB 4FRWA 2X9WA 1DUZA 3U9PH 5T3XD 4ZPVB 3IU4L 3LKNA 3OHXA 4GMSL 1HSAA 3H3BC 4I18B 3LPGA 2G5RA 3KXFA 4YHPB 5JA8B 2R8SH 1ZA3A 1DQDH 1N5AA 2B7DT 4K3GA 4JG0H 2VDOH 3X14B 3KPRA 4QHUB 2EDBA 3DX7B 5A2JH 4DCQA 2C1OA 2HT4C 3EBAA 5E56A 3OKMB 4TVPH 3QO1A 1ED3A 3LEYH 1TJIL 3W9EB 4OZHE 5DLML 2VL4A 1MJUL 1ORSB 3SCMA 4EIZC 1A7PL 1FBIH 3VXPB 3S4SB 1ZLUH 4GRWH 2IALB 2ZCKH 2ZCHL 1BREA 1IKFL 1ORQB 5CP3A 5HYJE 3DMMA 2EYSA 4YX2L 5B3JF 4I3RL 5JQHC 1V7ML 4CMMB 5CSZA 4MAYD 4JG1L 2H32A 2AV7B 3VI3F 2P8LB 3O2DA 4F8TA 2D31A 3PP4H 4PJ8D 3V6OC 3IB4A 4DFHA 1KJ2H 3X17A 4KTDH 3QR2A 2BY2A 2CO7B 1CBVH 3IRPX 3O8XA 3E2HB 3FT2B 4LCYB 3QNXA 4Y2DB 3TYFB 3BVNA 1UXWA 2X4OA 5LGJA 1E28A 5CIPA 1MH5A 4EDWH 1OGAD 4LMQI 1I4FA 2BSRA 3BX7C 3WJJA 3BJ91 1FZMB 2PUQT 4J3SA 1KJ3H 2EDNA 1FORL 4Q0XH 1ZA6A 4UT7L 5SWSE 1X5LA 1HSBA 2P7TB 4KRPC 5C07B 4ZO8A 3S88H 1I3RA 1FGVL 1TCMA 3ULUF 4PLJD 3OL2A 4HJJL 4JFZL 2NNAB 3QWRD 4XCEB 5AEAA 1ZT7A 2ZSWB 5IBUB 2D0FA 4PP2B 3BGMB 5F6IB 1H0DB 3QWOA 4CADA 1UM4H 1GC1L 2DI9A 3P0VL 1XF3B 1CDUA 4HUWB 1YEJL 4DW2H 5C0CD 1FZOA 4QCIB 3DETD 1CD8A 1ZVHA 3MLRH 2X42A 2JLLA 4OZHA 1PD6A 5MI0B 3CDFA 4X98B 5TE7H 4O58H 3ZZ1A 2NY0D 4UAOC 2EKJA 2XN9E 4PJ8B 2Q6WB 4WWKD 4G8IA 2DQTL 5DHXB 5DUPH 1PG7W 4CKVX 1BJ8A 1HNGA 5CBAA 5JXAL 4MA3B 4FQCL 1NMBL 2HFEB 3QPQC 2UZIH 4OI8A 2DQUH 3EO1B 3WHE0 1URLA 4CL7A 4HJ0C 1PX3A 4HKXA 1DN0B 2VDML 4OCRL 4JO4H 1RK0B 4CDGC 5IW6B 1WSST 1MPAH 4NNYB 4HKZA 1MJJA 2ZNWA 4N8PA 4X6CF 5INCB 3NMEA 3A67H 4RGMC 3ARXA 1QZ1A 2X5PA 4ZFOL 4HUXA 1HWGB 2HVKB 4PRHD 4EDXB 3AUVA 3S34L 1X5IA 3WFEH 4MNQA 2XWBB 2ICWA 3GSVA 4H5SA 1B90A 4JPIA 5C0CB 5TF1H 3PL6C 3CX5K 5E4EB 4Z7WA 4R7DB 3C08L 5IM7A 5JIPA 3UC0L 1R5WB 5E8PB 5LKNA 2V17L 5EBMB 4C56B 1XGRA 4NZJA 3DUUA 4R3SA 5JW5A 2B1HH 5ENWA 4M7LL 1QO3B 1IGTB 5I1DB 5IB2B 4WWKB 3M07A 4FFWD 4JRXB 1N3NA 2X4PB 5JDSA 4IRSC 5KOVC 3BPNB 3HR5B 4XPAL 3CLEL 1XGPA 4U1SB 3CH1A 1E4WH 1R5IB 1WBXB 5EUKA 1DFBH 4TQEL 4ZNEE 4IOIA 3HFML 4NUGL 3N06B 2YMXH 3QIUA 3FQRB 3RHWF 5DD3H 1QVOA 1TETL 2BJMH 3SKJL 2K7PA 5HYQB 3ARQA 4KI5C 1DVFA 1J0ZA 1I7RA 2A6KA 2CIKB 3B9KA 3HUJB 3NVQA 4Q58C 3MTRA 4KK8D 3WO4C 4U3XA 1XF5A 1EIBA 3DRTB 4ELKA 5DJZA 1EMTL 4OGYL 3QWQB 2VXUH 3LRGA 4PRHB 4L8SC 4D8PB 1RZJH 5JQ6H 3LN5B 1Q9LB 4JFDE 3QPXL 3V0WH 1EGJA 4TSCH 2FWOB 2YUWA 3A6BL 1YN7A 4JKPH 1XIWB 3ILPB 4F7TA 3WUWA 1TENA 2BVQA 4GW5B 1K85A 3ARTA 3KXFD 2UUDH 1T66C 3B9DA 2IEPA 3IDYC 4KKLD 3VGDA 4LEXL 1Q38A 3LDBC 5IFHL 3KPRD 4OLWL 1XCTB 3NAAL 1U92A 3U0WH 3H0TA 4U1HA 3RZWA 2YR3A 2HFGH 4UMGA 3B2UD 1ZEAH 2XRAL 1DL7H 3O2WL 5TDOB 3O3UN 3M8OL 2P45B 2VLJB 3UJJL 4OUUB 5JHDE 3SCMD 4NQUA 1C08B 4E5XB 3WEXA 2DJSA 1HQ4B 4JM2A 4MNGB 5DO2C 3MRLB 3RY6A 2VZ1A 1UWGL 4IDJL 3S35X 1MFEL 4ODTL 5F96L 3MJ8A 4ZD3L 3DMMD 4MLIA 4XPBL 1AE6L 2QEJA 4GKZA 5SWZA 3AGVA 5K59F 1HEZB 4Z7OE 1X3DA 3PNWB 4GAFB 1N59A 3VFTB 3WLBB 2CRZA 4XC1L 1DLHA 4OAWA 3MOAL 3O8XD 1H3PH 4FXLA 1U58A 5B8CB 4FQJH 4RMWA 2EYTA 1WFNA 1Q0XL 2F74A 5BO1L 1RULH 4QHNB 1NMAL 4CAGA 4NBXB 2B1AL 3DX6A 3B43A 5E5UB 1RVFL 4M1GH 3P4NA 1DUZB 5BVPL 4J6RL 3HZKA 4DTGH 2YUZA 3ULUC 3REWA 4HWBH 3G5ZA 4PJEE 1VSCA 3TIEB 1DBMH 2AAVA 4OGAD 5D7LE 3U9PL 4MJ5A 2O5ZH 2JJUA 1WVZA 3V0VA 2MHAB 2BY3A 2R8SL 1DQDL 1LVEA 4JG0L 4F8QA 1ED3B 1YEFH 4FQIH 4DJMA 1X4XA 3MV11 4ZYKA 3TO2B 2LU4A 3WO3B 1KLGB 1CICB 3LEYL 1NGYA 4G6JH 4KVNH 3VFNA 5A3IC 1CI5A 2JJTC 2DMCA 1K6QH 3DX8B 4YEEA 5C0BE 1FBIL 3HPLA 1PX4A 5C70A 2VLME 1KIRA 3TBVA 3EO0A 2ZCKL 4W4NA 5CSZB 5DDHB 2DLFH 5D1ZB 3AY4A 2BC4A 4HFWA 4M6OH 3FN0H 3LQZB 1FLTX 2NY2B 2ZJSH 1RZ8A 3RNKA 3O6FB 4PJBB 5BV7L 5H2BB 1KJ2L 4KTDL 3B8YA 3CFEA 5CLTA 1EV2E 1CBVL 3UTTB 1UXWB 1XH3B 3AMKA 4WCYH 4ODBD 3BH9A 1I4FB 2C26A 3CZJA 1BPVA 5D2NA 4ONOA 1OAQH 4EDWL 1I1AC 4Z78B 4G9FE 3FB7A 2IC2A 3DVGA 5AYUH 5HHOE 5C0EA 2R1YB 4A2LA 1KJ3L 4DZ8A 5IB3A 3DTXB 4Q0XL 3D85A 5MEPB 1W72H 4V2BA 4LCWE 5D7LA 4P4RB 1QFUH 4MD0A 4TVPE 1KN4H 3S88L 5DC9B 2XI9A 1WF5A 5CJBA 4MNQD 4GAGL 4PLKD 5AG8A 4UT6H 3C5ZC 2EDWA 1LILA 1UM4L 4DW2L 4H0IA 4NC1C 4E0RB 3T0DA 1MCIA 3LKOA 2J8UA 4N0FB 3IKCB 4L4VA 5FCSH 3MJ9H 3S3SA 3S35H 1ZLVK 3RI5K 3MRQA 4RGOH 4ZFFB 5D7SH 4O58L 4EUPA 2DQEH 4PJ7B 4XX1E 3IXTA 4KJWC 5DUPL 3LVEA 2YD9A 5TFSH 4PBVC 4H1LA 4MDIB 3QIUD 4LSQH 1CQKA 1A8JH 2UZIL 5T3XH 1Z0NA 4G8EA 4HJGB 5B21A 3QNYB 1TTGA 4B41A 2EDFA 2DQUL 4UTBH 1DVFD 3B9KD 4JO4L 1ZXQA 4N1HB 1MPAL 3NFPB 3CFKA 3JBG7 1AGDB 2AXJA 5JW4R 1AXSB 2Y36H 3A67L 1N64H 4H5SB 3KDMA 3LPFA 4QWWC 1GC1C 1SJEB 4XXCC 1NUFA 2B20A 3WFEL 1VFBB 2AJ3A 2NR6C 5IM7B 2VITB 2WWMD 1AO7A 5TF1L 4POZC 3ARBB 3FN3A 1YDPB 5K9QG 5HVHC 5KN5A 5A2IH 1EFXB 5JW5B 2ZZUT 4KZDH 2ZKHH 4PD4J 4MXVE 3A6CH 2B1HL 4PJCF 1BZ7B 4XNMB 2XYCA 4JQVC 3NFNB 4JY6A 5IROC 3ALWA 1RJLA 1XGPB 4GRWF 2IFGA 1GGBH 2AJSH 1ITBB 3LB6C 1UB5A 3RDTB 3B9AA 2VXQH 1C16A 3M17A 1AGCB 4H8WH 1C7TA 1E4WL 4JM2D 1DFBL 1QVOB 5IMKB 3IDGA 1YY9C 3HRZB 3T0EC 3DGGA 2FRGP 1KOAA 5FYKD 2YMXL 4PGDB 3RUGE 1JJUA 5DD3L 5CCKH 1K8IA 1LD9B 2BJML 5HSFA 2A83B 5SWZD 1MEXH 1MNUH 4HBCH 5EO1B 1XF5B 4ZS6D 1V3KA 1XF1A 5F7EH 2ZUQB 5T3ZH 1JNJA 1UWXK 2ADGB 1I8IA 4Y4FA 3QEGH 4PLNC 3BWAA 2FO1A 5F7KC 4PJ9B 2BHZA 2E8ZA 1Q9OB 1FVDB 1RZJL 5JPNA 1D5ZB 1WAAA 2D4DA 3V0WL 1DP0A 4TSCL 1IGCH 2BY0A 3HC3H 3FQTB 2GUOB 4JKPL 5J6HB 4OV6F 5JA9A 2A0LC 1KSRA 1QKZH 2AK1H 5I1AA 2CUHA 3ROLB 5JTWA 5BZDB 2CDEA 1GGCH 3AREA 3FFDB 3UYPA 2YPLB 1AI1H 3ESVF 2YD3A 1YMHB 4G6AC 1RU9L 1U92B 5DK2A 4U1NB 4KMTH 1JHTB 3VJ6A 4JFQA 4OJFH 3WJLC 1FGNH 2AV1B 3U0WL 2HFGL 4FZ8H 1A9EB 1ZEAL 4EN3C 1DL7L 3L3GB 1WISA 4RX4A 1X6NA 2X4RA 3VFMB 4O2FA 4WUUA 2ADJA 1IAMA 1FH5H 4MXVF 4GKZB 2CDGA 1WFUA 4I0PB 5GSVB 4MNHA 3T1WA 4R2GD 4HIEB 1GSMA 1ADQA 4FG6D 3DVFA 2VNCA 3KHQA 2O26U 2E7LC 3HI1B 4EIGB 3DYMA 1LO2H 5EU5A 5E2VL 1J8KA 1HNFA 1H3PL 3RUGF 4FQJL 1HINH 2XG5A 4MGXA 4HPYL 3LV3A 1RULL 1VPOH 4JFHE 5DFVD 3MRGA 5T1LB 5BZWB 3REWB 3G5ZB 4M1GL 35C8H 1CD0A 3TZVB 5EUOB 4DTGL 3OAUL 1CTNA 4HWBL 4AH2A 3S98A 1JMXA 4PB0L 1DBML 2IBGA 5IB1B 4LGRB 2O5ZL 4NKMA 1B0GB 1M7IA 4FFYH 2XZCH 4NCC2 2YBRA 2XKNA 5GSRA 3VFRA 2W0FB 3WFBH 3VMNA 4KI1A 4JDTH 2CUIA 4ZYKB 3S7GA 1IVLA 1KTRL 3ULSB 4FQIL 5C0AE 3MV7E 1OT2A 3V4PH 2YXMA 3BPLC 1FZJA 1IGFL 4ZUWA 1NANI 4U0RB 4G6JL 4L4VD 4KVNL 2ORBH 2CGRH 4WUKH 4PYGA 4PR5A 1EBPA 3M1BB 3P9MA 3WXVH 1FFNB 2DLFL 1YEKH 3WIIL 4XZUA 4M6OL 4XMPH 5E8OB 5B38B 2ED7A 3FN0L 3QUKA 4LSVH 2ITCB 1FQ9C 3RKDC 2ZJSL 4CNIA 3U2SB 4I13B 4BFIA 5CJQH 3ROOA 5IB5B 3MRMA 1BWWA 2GK2A 4WCYL 1E4KA 3JWDH 5TGBA 2XWTB 4WDIA 2X10A 3L6FA 1CVSC 2MCPH 5ETUB 4KU1A 4ZXBC 5KSAB 1OAQL 2LU7A 1LP9F 3V95A 3QHZH 4OFDA 5AYUL 4XPFH 5TQ2H 1FJ1A 4MD0B 3OJMB 3V5DB 4YWGL 1MELA 1W72L 4RWHA 3TO4C 1QFUL 4KDWA 3MRDB 1HXYB 4P23B 4OGZA 3SHSA 3DYOA 4UT6L 4S1QH 4F7PB 3MV8B 1AO7D 3K2UH 2DQJH 1A7BA 2J8UB 4OD2A 5DGQA 2CMRH 2YA0A 4L4VB 4PG9B 3HC0B 5HDBE 1WIPA 4CMHB 1BIHA 3BUYB 1QR1A 2OTPA 5IQ7H 1T5WA 3O2DH 4QRRE 3MJ9L 4EUPB 2XXCB 3S35L 4NO0A 4F80A 2FJGB 4RGOL 4PG2A 5D7SL 3PWPA 3GMQA 4JDZB 3I02B 2DQEL 2FR4A 5BV7C 2O61A 1KPUA 1RUMH 2ARWA 2IBZY 5KJRH 4DEPB 1D5MB 5TFSL 3G5YA 5J1TC 3THMH 4LSQL 2QKIB 5FXCH 1I3GH 3P9WB 1TNMA 5T3XL 1JIBA 3WKMH 4K7FA 4U3CA 1PYWA 4UTBL 2AJZA 2NXZD 2ZUUA 2NY1B 5CZKA 3R0NA 1CG9B 4Z7NF 4AM0B 2H3NB 3ZT6A 1FNGB 2D7OA 4LGPB 3B2VH 2WBJB 3F7RA 3I6LD 2YEZB 4C54A 4D0CA 3H9SB 1N64L 5CEZE 1E4XL 3E6FB 2VTFA 1QHOA 4OUOA 4X99B 2RB8A 3L3IB 3HZMB 2GFBB 4L8DA 4BQBA 1OW0C 3ARED 1U3HC 1T2JA 1AHWA 3BDYH 4Q9RH 4KZDL 3V0AC 2ZKHL 3SDXB 3A6CL 1Z9SA 4XGZA 3BXNA 4QRRA 1WBYA 4F57H 4TSAL 1DQLH 2NY3D 1GGBL 2A1WL 2AJSL 5T3XE 4RX4D 3GIZH 1UVQA 3QUMA 3OKEB 3U4EB 4H8WL 4LVHB 4WUUD 1X6LA 1DBAH 1K8IB 5C07E 3D1MC 5JOFB 4YHYB 1GGTA 4GG6F 5IW1A 1V05A 2R23A 4WTXA 3NCYS 3RI5F 1R5VA 1SM3H 2HLFD 5DMKB 1QRNB 3PP3H 4JHWH 4YNYA 4CVWA 1VADB 5L9DH 1MEXL 1I8IB 1MNUL 2ERJC 4HBCL 5CSGA 1U8OB 1G9EA 5F7EL 4EXKA 4PJ5B 5T3ZL 1QG3A 1NMCB 1P9MA 3VRIA 3X3GH 3MRPB 4M7JH 3SDAB 3QEGL 4Q6IC 5DSCA 1BD2A 4O5LH 7CGTA 5AZ2H 1N4XH 1OB1B 2Z93B 4Y88A 4GAYA 1F2QA 2P1YA 8CGTA 3QZWB 2I9TA 1W0WB 1DBBH 1S9VA 1QSFB 1FNEA 1IGCL 1G7LB 3HC3L 4YHZH 3AB0C 3EOBB 1CR9L 3IJHA 4OZFG 4U1LB 5GGRA 1TZHA 2AK1L 1Q72H 1OF2A 4RBPH 1Q94A 5K9OB 1HHIA 3QQ3B 1GGCL 4EVNA 1AI1L 2DLTA 3PGDB 4IIQA 4KMTL 4ZODA 3FQXA 4PRDB 4OJFL 5TPWH 1FGNL 4KKAC 1I8KB 1I1YA 3GMPB 2H26B 4NSKB 4S1DC 4FZ8L 2X4RB 2ATKA 1I9IL 4WUUB 1MFBH 3QUXC 2X4QB 3GHBH 3QNZB 4P5KB 3VXQA 4L9LC 4WFGD 5T3ZE 5DHYA 4HC1H 5J9PA 4DGVH 2X4NB 4GKSA 1X7QB 5D2LE 1LO4H 1YN6B 2J7LA 5ALCH 4OF5A 3CAFA 5EU5B 1P6FA 2JCCA 5DEZA 1LO2L 3LV3B 4C56E 1KV3A 2H2PC 1RZJC 3EJYD 1UH2A 3MBXH 1VPOL 2P46B 1Q1JH 2FX8H 4KGLA 4WO4A 1A1OB 4I9WD 5E5MB 4LLAA 1T21A 2HT2D 4JRXE 35C8L 4OCSH 1WEJH 3EYVA 4D9RD 5C0JB 3VWJC 3MRRB 1MVFA 3HB3C 1TITA 4FFYL 4DVBA 2XZCL 5ISZA 5HI3D 3V4UH 2G2RB 3WFBL 3AU1B 4JDTL 1S7UA 5FOBA 5GIRA 4XWOD 5FYKH 3RVVC 3C2SA 1OHQA 4M4PA 3HUJE 1DQTA 1CXLA 2QADC 3V4PL 3WV0A 4PR5B 3P0GB 5ITFB 3V4VH 3P9MB 2EDTA 4H25A 2CGRL 4WUKL 4NO0D 1K4DB 5LVEA 4U1MA 3DX9A 3GRWH 1UXSA 3PWPD 1YNKH 1AP2A 4OTXH 3WXVL 1R6VA 4U0QB 3ZHLA 3ZE0F 5CEXB 1R3KB 1NCTA 2BSED 1NLDH 2HYMA 1YEKL 1WTLA 5CILH 5IUSA 4BFIB 4XMPL 5IMMB 4HGWB 4WHTA 1FC1A 5IB4A 4HIHB 1PSKL 4LSVL 3QIWC 4LVNB 1ITCA 3MREB 1KBGH 1BM3H 5CJQL 2EIZB 3GMRA 1CFSA 2BNUA 2UYLA 3JWDL 1N6VA 1CT8A 4PJHA 4QRSA 2MCPL 2B4CH 2Q87A 4CUCA 2Y72A 3QHZL 3C60D 5AUMA 4XPFL 5TQ2L 3TF7C 2VLJE 4PP1C 5LG1A 2UWEA 1V7NH 4K3JH 3VMOA 3ZKMC 4MNGE 4D0DA 4JN2A 3VFVB 3EYOB 4JFEB 3FAXA 4EI6B 5F7HA 3KJ6L 1UH4A 3BP5A 4P57B 4RDQG 4OV5B 4WI2A 1SJHA 2LAGB 1OAXH 2X7LA 4S1QL 1DCLA 5GS2H 2W60A 2V5SA 2PF6A 4YO0A 2DQJL 1LDPH 2E7BA 1F4XH 5F9WB 5FECB 4LNRA 1SJXA 4EBQH 1C5CH 1O5DT 1OTSD 5KS9B 1BQHB 3BP7B 5IMLA 3HNSH 5IQ7L 4FXGB 2ADFH 3O2DL 4NFDA 3GSUA 2DWDB 1UC6A 2LTQB 2O61B 4OZIA 2R1XA 3SGKC 3PGCB 5C0GB 2VDRH 4LMQE 1Z0MA 1JGDB 5J8OA 4FXKA 4XC3H 5CHNB 5GZNC 4N5ED 1PAMA 5KJRL 1JWUA 3MA7B 5DUMH 3CFJA 3THML 1I8LA 1A1NB 1I3GL 1QEWA 1FO0B 3WKML 2C4XA 1KG0A 4JDVB 4U1KB 3FHAA 3C60B 3UROR 3UPRA 5C8JA 2R1WB 4UQ3A 1T89C 5F7YC 5JUEH 2BNRA 1DQQB 3VI4E 3OKLB 4QOKA 3GKZA 1BD2D 1KPRA 5I8CA 5IF0A 3B2VL 4U3HA 4ORGB 1FG2A 1ZLSL 1NSNH 5BCAA 3MLZH 2BSSA 1B4JH 1JZ8A 3OV6A 3UO1L 3DO7A 1T1XB 2IPKA 3FB5A 4JFFA 1REIA 4EUPH 4GLRI 2R4SL 2XXMB 4PJBE 1CFNA 1MQKH 3ARSA 4V1DB 2HFFA 5ESVA 1PBYA 4UOW1 3BDYL 4OIAA 4Q9RL 3UTTE 4XP5H 3BGAA 1SMOA 4H1LH 3STLB 3FJTA 1EO8L 5JLZB 2FJHA 1LNUB 4F57L 3KHOA 1DQLL 4LLDA 1GL4B 1QBLL 4Y2DC 4NQVA 3GIZL 3RWDA 2ICEB 3K8LA 4PJDA 4U2ZA 4KQ3H 1IJ9A 1BFVL 1ZANH 5IW1B 1KJVA 4TUKH 1S9WA 2BFVH 2RFXB 3VXMA 4XNUL 2BVYA 1RUKH 3LKRB 1H15B 1SM3L 4BK4A 1RY7B 3MACH 2Q76A 3CXHJ 4JHWL 5L9DL 4WTZG 1M6OA 3D0LB 3DV4A 5IVOA 1BD2B 4J3UA 4LLWB 3GMOB 1UFUA 5F6IC 3X3FH 4XBGB 3RTQA 1JK8A 4KDTA 4M7JL 5DVLA 1IGJB 3RIAF 1TPXB 2A9NL 2NW2A 4O5LL 5AZ2L 1N4XL 4JZOA 1P53A 4RZCB 4WO4D 1DBBL 3MA9L 2B2XH 2FX7H 2PXYB 3BHBB 4X6DA 4FQHB 4BUHA 4JVPA 2UZXB 4YHZL 4PJ7E 3KYMA 1IQWH 1JPFA 4MAYC 3OR6B 2YZ8A 4APQD 4FOMA 1Q72L 4PJ8C 1A2YA 5ISZD 4YDLC 1RQ5A 5E95B 3AMLA 2G9HA 3TYGH 2BK8A 3PWUA 5ACLA 3B9EA 2WSKA 4WI5A 2D7QA 5TPWL 1MCRA 2QLVB 3RL1A 2Z92B 4H8WC 2GJZB 2YC1A 3S96A 2HMID 4PJBF 1MFBL 3RRQA 3PQYA 3BZ4A 2DS4A 3PGFH 3GHBL 4Y5XB 4HWNA 5E2WL 1M7DA 1YEIH 3RZCA 5HJ3B 2KUTA 5E9DB 4DGVL 5FM5M 2DL2A 4PLJC 2UZYB 1XZ0A 3RNQA 4MHHG 4GUPB 1Q9KB 2NZ9D 2PW1B 3SEPA 4NUJB 5C0FB 3UTZA 2OX5A 3H3PH 2XV6B 2PKDA 3DETC 4MMXC 5E4EC 5L2KB 3RWIB 4B7LA 5I76A 4JFPA 2X40A 3BEWA 3D39B 2DQCH 3MBXL 3QJFA 1R24B 5D7IB 5F3HA 1Q1JL 2FX8L 3MNWA 1A9BB 4G6FD 4MCYA 5EZLB 4F9LA 4APQB 4GKNA 2W0KA 1AGBA 2F54A 2VDPH 3WNKA 3V8CA 4WWKC 2WMPA 2G5BA 2BVPB 1ZGLP 3GGWB 4HH9B 1FYTE 5TDPA 3GSXA 3V4UL 2RCSL 1QSVA 3T4AA 4NQEB 5DD5H 1NANH 2ENSA 4PJ7F 3DIFB 1A4KA 5FYKL 3MRIB 1I9RH 4LK4A 1G6RA 3EDJA 4W81A 4WV1A 3UCRA 5FYJH 4H25B 5FGCB 4Y5VC 5DWUH 4KK6D 3V4VL 1ADQH 3EFDH 3LCYA 4LKXB 3C8HA 4N9GB 2A74B 5C0IB 3MODH 3L3OA 2IPUK 3GRWL 4OTXL 2IMNA 1YNKL 4NRZA 1HDMB 2YRZA 5E1AB 4C59B 4X8JB 1JNLH 2BHUA 1I7ZB 1KPVA 2ED9A 1NLDL 5CILL 5IVXA 4P2QA 1IARB 3CVHA 1FFOA 1FCCA 5JW4N 1KBGL 1BM3L 2YPLE 1CT8B 1CXIA 3N1QC 3ARGD 4LOUD 1JWSB 2XFXA 3P4OA 2NX5A 3EKCA 4Z7WF 1YNLH 3SGEI 4ELMA 4R90H 2B4CL 1MAJA 4YBLB 2BNRD 1K8DB 2DAVA 4FFWC 4M8QB 4JQIL 4QOKD 4Y4HA 1OSZA 1N7MH 3KPOA 1QR4A 1V7NL 5F7FA 3WNLA 3ZTNH 3GUTB 3DXAD 2X4SA 5DRZB 3FQNB 3MYZA 5J89A 2NLJA 3MBEA 3KLHD 2APWA 3FQUA 3CCHB 4HKJB 4JFFD 3FCTB 1OAXL 4HUVA 3J8F7 2VQTA 4QXUH 4FHBD 1CE6A 3RP1A 1F4XL 2WLYA 2PTTA 1ZSDB 1CFQB 4EBQL 5KSBB 2QL1A 1C5CL 4Q2ZA 5L8JB 3OGCB 5FK9A 3IDIA 1EEQA 3HNSL 4KK8C 5GS1C 1BIIB 4QRUB 5T1KA 2B0SH 2ADFL 4JZJA 1EFQA 4L8BA 3VXNB 2Z4QB 3GMMA 4PIRF 5IV2A 1B2WH 3IJSA 5FEBA 1CGSH 1LMKA 2FHBA 5IEKA 2FBOJ 2VDRL 5D9SB 1I9JH 3HE6D 4M6NH 4XC3L 5FGBA 3CFIC 4PRPA 3PABA 3ARGB 5DUML 3JWDC 3VXMD 1P69B 4RQQA 2AK4E 1KG0B 3CXHK 3GSRA 4TUOA 3TNNA 3EDFA 2OYPA 4KKLC 4YQXH 3C9NA 5B39B 4HCRA 4X6BA 2VLLA 3X11B 1MY5A 3QDHA 5A1AA 4PV9A 2XQBH 3B2UC 5JUEL 1OAKH 3DRQB 4MB5A 3E6HB 1XGTB 3RTQD 4L9DA 3DXAB 2R29H 5MEQA 3MNZA 2HTKD 4G43B 3SCMC 1MFAH 3RGVA 1CICC 3U0PA 3DHMA 1NSNL 5KSVA 3ECBB 3MLZL 4XVUC 4ZMAT 1SEQH 2MSPA 2VLRA 1B4JL 2WK2A 5HI5D 3DMMC 3QUZA 4HIIA 4JM2F 4JM4H 2IQAA 1A14H 1N6UA 1Y18B 1P84K 1MQKL 2DI7A 2FIKB 4RNRB 2HH0H 3O8XC 2ARJA 4XP5L 3O6FC 1N0XH 3RIFF 2ZG2A 5J7CC 2YD6A 2A6DA 4PJDB 3HE6B 1QSEB 1OP3H 4BSVA 1MUJA 5BQ7A 3WJJC 3PQYD 3Q3GA 1FO0H 4KQ3L 1HQRA 1KELH 1YEDA 3UTSE 1ZANL 2HJFA 4TUKL 3LS4L 4OGAC 3RZCD 4I5BA 1H5BA 2BFVL 2E9WA 3F7VB 2L0DA 1BOGA 1H3UA 1RUKL 4EI5B 2AK4A 5KVMC 3MACL 5EUOF 1JMZA 3MV8E 2V9QA 4R96B 2ADIA 5FO8A 2DMKA 4YXKH 1FHGA 3HAEG 4CDHA 1MLCA 1MHCB 1J1XL 2PYFB 2XPGB 1RZIB 2GTWB 3GI8L 4LPYA 1I7TB 2VAJA 2EECA 2V2XA 1MAMH 3TA3A 3DJ9A 1SEBA 2FX7L 2GKIA 3IGAB 3QQ4B 2F54D 1GVIA 1IQWL 3GSNA 2AEQH 4N1CA 5CJ5A 1OP3K 2P8PA 1NAMB 5D7JA 1D5BB 5I1IH 3QUMH 5LBSH 4KJYA 1U8IB 4NHUB 3TYGL 1PG7H 2N7AA 4G80B 1DANU 2YSSA 2EDKA 4WW2A 1FZKA 5F7MC 2L7JA 4D3CH 1XGQA 3BZ4B 3R06B 2ZOLA 5JNYA 3U30B 3O4OB 1M7DB 3JTSB 1JPTH 3PGFL 5HHQA 4Q97A 2H6PA 3ZL4H 4BELD 4RAVB 5IK3A 1YEIL 3CZFB 3UTSA 1S5HA 3H9SE 3GMNA 4KUZL 4QF1B 5GS0H 4AIXA 1TTFA 5HPOA 1QRKA 1AC0A 3NBNA 3IDJB 3OG6B 4P2QD 5FUOL 3C6LB 1M71A 4I2XA 3OF6A 4JCLA 1RHHA 5I76B 5HDLA 3H3PL 4FFZH 5LCVH 4AT6B 3BH8B 3MNWB 5D96C 5EZJA 1ZOXA 4MCYB 2NX5D 3SDXE 1R3HA 1AFVH 3EOAB 2C3VB 3CH8A 4RA3A 5HDQH 3MO1B 4I4WB 1PZ5A 5L0QC 4F15B 4LQFL 3IDUA 1IAKB 2J8UF 4QO1A 3IXAA 4F3FA 1X5FA 4Z76B 4PREA 4Y4HD 5KVEH 4XAKE 1LEGA 4U1GB 4G6KH 5DJCA 3G04B 5F97E 4IMLB 4YLQT 1IC7H 4MZ3A 3GB7B 3QIUC 3IAQA 3MBED 4MXQD 2JB5H 1A6AA 5HHMD 5C2UB 1FL5A 4WNQA 2N4IA 2VDKH 4KHXH 1QRNE 4WV1B 1G7HB 2IG2H 3DWTA 1ZMYA 1BLNB 1NGZA 1DVFC 3B9KC 5K9QI 2EDOA 4PJ5E 4NKIH 3BO8B 2CLVA 3VRLE 4MJ6B 2QHLA 5DWUL 2DD8H 3VXUA 5JMRA 4WY7H 4HFUH 5T1KD 2HT3D 1ADQL 1D6EA 3EFDL 2ZUQC 4ODUA 1KT2A 3T4YA 4NRZB 4NC2B 4LHQB 4G7VH 1QSFE 4PJ9C 5J1AB 1CD1A 1JNLL 1EEZB 1FIGH 3SE8H 4PRNB 1BF8A 5BS0E 1EEYB 2XOTA 3IAGC 2WWMC 1LQSR 2D4FA 1WC7B 3IFPB 4PRPD 2GAZB 2OXGA 3RWGB 4M61B 2WWKT 1UKSA 2XFXB 2NX5B 3FB8A 4N90D 2OTUB 4MMZC 3BRFA 2X9XA 1J86A 2W92A 3HZYB 3U9UA 1J1OH 1YNLL 4RMRA 2KPNA 5L8KB 4R90L 4Y4HB 1RD6A 3VXSA 2Z31B 2D9CA 2HKFH 4ZUSB 3NPZB 3QDGA 5CSBA 5DMIH 2NLJB 3V7MA 4OI9A 3RGVD 2JK5A 4JM2C 1Z9LA 3ZTNL 5HHMB 3SDXF 2X4UA 5GXBB 5FYJE 4J1UA 3S97C 5K9JH 4GRMA 3RY6C 3T65B 3I3DA 1HH6B 4PRAA 5HGAA 2VLRD 4MJIB 4JFYA 3QUZD 2Q7NA 4QXUL 4CVUA 1KCLA 4ZS6C 5T1KB 3O45A 3OKKA 3GMMB 4RFEB 4L1HA 4O2CA 4MYWB 2B0SL 3N1MC 1P2CA 4JFOB 1G6VK 1ZV5A 3MRNA 1B2WL 2B5IB 4ZOEA 2PNDA 1CGSL 3GSOB 1CFBA 2EO9A 1U8PB 3N1GC 3VRLF 4HX1A 4G8GE 3GKWL 2MWCA 1YMMA 3NZHL 3TZVC 5BS0A 1WAAF 4IOFD 5DQ9B 3C9NB 3V6ZB 4M93C 3NCFB 4CW1A 2B4CC 2HAZA 3S3JA 4W4OA 3G9AB 2ZOKB 1NGPL 1U2CA 4KRMB 4HDIB 1F6LL 4R0LA 3NCYP 4PV9B 1J8HA 5F1OB 4YQXL 2H1PH 4ZUVA 2XNAA 4Z6AT 4P9MH 4HHAB 2IH1A 4TRPH 1D9KA 2Y06H 3CSPA 2XQBL 4F7MA 4ZOAA 3NCJH 2R29L 2K9UA 4XAWH 4ACPA 1MFAL 2VLRB 3D48R 3EHBD 4U0RC 1S9XA 2OMBA 4GS7B 5KG9A 4U6XB 4GLRH 3HG1A 3TA3D 1SEQL 3CSYB 5DZNA 2ITDA 3MRCA 3AY4C 3DSNA 4JM4L 2OBGA 1A14L 4NO5B 4R2GC 1YJDH 4UIKH 1T22B 5D7JD 4FG6C 2ESVD 2FJFA 1UGNA 2HH0L 4CU6A 3I3BA 2HVJA 1CDBA 4HUUA 1N0XL 3PV7A 2PN5A 4YPGA 5EN2A 4NN7C 1JFQH 4Y0GA 5DFVC 3RJDA 4PRIB 2Q20A 4BSWB 3MV9B 5C7XH 1FV1A 1A7NH 2XACC 1U8JB 4HEME 5EBLA 3NN8A 1FO0L 1KELL 2DBLH 3BZEB 2C3HA 2J6EA 4G8GA 3ILQD 3MRJB 2VXSL 3UMTA 4JFEE 5FHAH 1YY8A 2GCYA 1A6PA 3MRBB 5D1QA 1RIVH 1E0OB 3GZKA 3EAKA 2EC8A 2F8XC 4WEUD 5HYSB 5HHXH 2I5YH 1MF2L 1E27B 3OF6D 4N8VA 5KS9E 3AXLB 1RJYA 1U8QA 4XT1C 3RWEA 1MAML 1JGUH 2YPVH 2V7NA 3V5KA 4M9OA 3ELAT 15C8L 4LP5A 2ESVB 3F5WA 4KJYB 1AGEB 2AEQL 1SYVA 4FP8H 4U4BA 1TQCB 5SX4I 5I1IL 1S7QA 2C4FT 3K8KA 3QUML 1B0WA 5LBSL 5F1NB 1FZKB 4DEPC 1PG7L 1J11A 3HPJA 1IT9H 4ISVA 4PYHA 4X7CC 3WS6A 1B0RB 2ZG1A 1EO7A 1NC2A 3PWNA 5C09A 1BX2A 4ZTPH 3VXUD 1JPTL 1RPQA 3FB6B 1TNNA 4X5XB 1KB5A 3ZL4L 2DIBA 4CJ1A 4HS6A 4U7MA 5EU4A 2NY5H 5DHVB 4X0KB 3DSFH 1T04B 5GS0L 4I2XB 1AD9A 5T5NG 5GRXG 1BFOA 3FOMB 1T20B 3RX7A 4OBRA 4V1DE 3O3BA 2W9LA 3EDKA 5C0DB 5DJYA 4FFZL 4NFCA 4LCCA 3WIFB 1PZ5B 5LJYH 1G0DA 2HJKA 1AFVL 5JO5A 1PEZA 4PREB 5DZOA 3T2PA 1NAMH 5HDQL 2HLAA 2LV4A 3VXSD 5KS9F 3QDGD 3VCLB 4POYA 1EDQA 2EIEA 5KVEL 1K4CA 3KYKH 1GGIH 3HRPA 4G6KL 2FNBA 1IC7L 4LVHC 2JB5L 3P73B 4P99A 2VDKL 3HTLX 2AXFB 1U8LB 2CLVB 3V9FA 2IG2L 1ND0A 3C8KA 2OJZH 1MSPA 2NXZC 4NKIL 5HHVH 2VIRA 3C87A 1LO3H 2VE6B 3GIVB 3S37X 4TOYH 2A6JA 2DD8L 4WY7L 4HFUL 2GITA 4LF3B 1NBYB 2OJEB 4FA8A 1L6XA 1NMCC 3MZTA 1RV6X 3G5XA 1NEZG 4UAOB 4G7VL 3TBYA 1JYVA 5EIIA 1FIGL 4ZSOE 3SE8L 5SWQB 1YMMD 4IDLA 4WHCA 3ZDZE 3UZVB 5C6PB 1UZ8A 1J10A 5EB9A 3SGEH 5LGHL 3F58L 1J8HD 3EO9H 3SE4A 4ZO9A 1J1OL 1QLRA 4L3EA 1D9KD 4PJXA 2P8MB 2NY3C 1G7JB 1WUNT 4X6FA 4XVJH 2HKFL 4JB9H 4NQDE 1E6OH 1OP9A 3VRJB 5DMIL 1EJ6A 5EBGA 3PHQB 3T09A 4YAQB 3MR9A 5E9DE 5K9JL 3K7UA 3HG1D 3PDOB 1PY4A 1MLBA 4G42A 3LIZH 3O45B 4YDVB 1FNSH 3U36B 3KVQA 5D8JH 5C1MB 1WTGT 3MRNB 4QXTA 1OLZA 3CMGA 5L2KE 5IQ9B 4NNPH 3W9DB 3O9WB 3D39E 4OKDA 4OSUH 4NC0B 3EFFB 4OFIA 5D7IE 4NQSB 1JGLH 3L7EB 1IM9B 1IEBB 1B3JA 1YMMB 3T0BA 4IRSB 1QFWI 2EE9A 4UDUA 3P30H 3VE0B 3VFUA 3ARVA 2DRUA 4ZSOA 4RAHA 5ICYB 4YIQB 4RFOH 3C6SB 1JZ3A 1RFDH 4ZUVB 5CLWA 1QD0A 1RURH 4NQEE 1D9KB 1BBDH 1M05B 5EZIH 5GRVK 4QHMB 5F9JA 4HQQH 1RSFA 4P46D 1I7UB 2P47B 3G5VA 5HHPA 2Y06L 5FGCE 3SJVB 3ZDZF 4DUWA 3QT2A 3WO4B 4PGBA 3NCJL 3JV6B 1HOCA 2OI9B 4PFEA 4R97B 1OARL 1N5YH 3MRCB 3MROB 4L8SB 4LHUG 5E6IA 4ONHB 5DMGD 1TCRA 1P5VA 3U7WH 1JPGA 5CD5C 4S2SA 1S7XA 1YJDL 2FJFB 4UIKL 3BMVA 3UTQA 2BCKA 2V7HB 3MRHA 5D1XA 4X4YA 2NXYD 2XWJB 4LVNC 3MRFA 3IDYB 1E4KC 3EJYC 1NC2D 1JFQL 1NDGA 2VUOA 3UZEA 5C09D 4F33A 5C7XL 1L0XA 4JPKH 2GK0A 1A7NL 2HT2C 3QEQB 2DI8A 4HCRH 2P5WA 5CJ8A 2DBLL 3D2UB 2GCYB 1P5UA 3TGXA 1MWAB 5C0RH 3O4LE 5LXGH 1DZBA 2PTUA 5HGBA 5FHAL 1GOFA 4K3DH 1OWWA 1CU4H 2XKSA 3RQ3A 4JKKA 1RIVL 1CK0H 4P46B 4XWOC 1I8MA 1VKXA 1JI1A 4RA0C 3MGAA 1JV5A 5HHXL 2I5YL 4TYUA 2EYRA 5T33H 1NL0H 4H88H 5KSBE 4YUEH 5DQJA 3AVEA 5IIEA 5IFJA 2W1NA 3DROA 4LRIA 43CAA 3RWEB 1X5ZA 4GW1A 4XB8A 1A3LH 1P7QB 1KTKE 2JIXA 3BZFB 1KNOA 4QTHB 1G7IB 1ES0B 3O3EB 4PG2C 4KV5E 4MVBD 4UILH 2LTQC 4K7PX 1CCZA 2GT9A 2YPVL 2XICA 2QR0B 3VGFA 4HLZG 4TPRL 1UZ6E 1T83A 1BVKA 3D0VB 2QQLH 3L9RA 4KTEH 2OR8A 1F4WH 5C09B 1N26A 1IT9L 4JO2H 3QHFH 4LNVA 5FO9A 1CGVA 2YS4A 3EZ8A 4QY8A 3QDJB 4ZTPL 2ZCLH 2XTJE 3C60C 2BNQB 1F8TH 1UM6H 5ESAA 3Q0HA 5B4MD 2NY5L 4XH2A 3O4LA 4XP1H 3DSFL 3PV6A 1U42A 3CFBB 3EOTH 3QRFM 2MPAH 3D69A 1JPSH 3MGTB 4JGUA 1CS6A 3TJHD 1OTSC 2FBJH 2HJKB 4M62H 1A7QH 4P5MB 3VD3A 3L3DB 4HXAL 4Z7VE 3STBA 4TSBH 5KVFH 5I16A 4L3ED 2CH8A 4QHKI 4ETQB 1NAML 3KS0J 3QAZC 4LPVA 5ILTH 1HILA 1QSEE 1ZHBA 4WTZA 1TJHH 3TN0A 4NZRH 2F5BL 4UDTB 3KYKL 1GGIL 4OCLC 1A02N 4P5TA 2NTFA 2P24A 2OMNA 4KV5F 4OQTH 4NRXB 1IC1A 5FYKU 3LQAH 3T3PF 4OZFB 3C5ZB 3IVKB 1A21A 3LQMA 2OJZL 1UZ6F 2DLIA 2H9GB 5KVDH 1T1WA 2QSQA 5HHVL 1AGFA 5DHVH 4WJ5A 1ULVA 4Z7UB 2FO4A 2WAHA 3WL9A 1LO3L 1P9MC 4TOYL 3KWWA 2PYEA 3BRGC 4GKOA 3AAZB 2J88H 1TPXC 2MKLC 1PKQA 4LEOA 4CGTA 3PDGA 2LABA 3RL2A 1J88A 1MQ8A 1GCFA 1KTDA 4X5LA 2UY6A 3QXWA 3QHTC 3QUYA 3V6FA 5MENB 3DLQR 2V5RA 3DHJA 4HF5H 1HKFA 4NJ9H 4YH6A 3TM6A 1MCBA 3EO9L 1X44A 4K7PH 2YUVA 4L4TB 4JR9H 4Q74A 5EU3A 4GG8A 4XVJL 1MVUA 3U6RB 1GZQB 2VR9A 4JB9L 1E6OL 3MMEB 3Q48A 5CBEB 4HSQA 3UYRH 4K3HA 5IBTL 1QA9A 4LLVB 5E6ID 4Y5XC 2A77H 4PJDF 1S7TA 5TH2A 3LIZL 1LWRA 2Y7QA 4S1SH 5HHNB 2OQJA 3MLWL 4WFEE 1FNSL 4A6YA 5HVHB 5D8JL 4XI5D 3BIBX 5D1XD 2OSLB 3O41A 5E8NA 3ULVH 4NNPL 1F11A 3CVHL 5DD6A 4OSUL 1JGLL 5DRWB 4QT5A 1Z3GH 5IJVA 3BQUA 1WCBA 4N0RA 2P5WD 2YK1H 1RUAH 5GRJH 4JJ5B 1S7WB 3P30L 5EFIA 4APQC 1S7RB 2VN7A 3GJFB 4WFFE 4E41A 4Z8FH 2IFFH 3OJDA 1U93A 1ZS8B 4RFOL 2AJUH 1RFDL 2VL5B 5CJXA 4MHHI 1RURL 3NIGE 4PTUB 5HHPB 4PV8A 3L3JA 1SY6H 3KNBB 5EZIL 4YFLI 3VGGA 2ZSVA 4KKBD 3UDWA 4HQQL 2M2DA 5EOTB 4RMUA 5EC2A 2ZUTA