4M43L

Crystal structure of anti-rabies glycoprotein fab 523-11
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
213
structure length
213
Chain Sequence
ELVMTQSPAILSVSPGERVSFSCRASQIIGTSIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLTINSVESDDIADYYCQQSNSWPVTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fragment antigen-binding 523-11 light chain
publication title Crystal structure of anti-rabies glycoprotein Fab 523-11
rcsb
molecule tags Immune system
total genus 46
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2013-08-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m43L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m43L01
2ENYA 4CGTA 1BIIB 1LO3L 4C83A 4R0LB 4Y4FA 4JRYB 4F7EA 1CS6A 1U0QA 4P4KC 1HXMB 1EXUA 3BD4A 2VH5H 3C09C 4WFFE 1L7TL 5FGSA 2A74B 1RIUH 1O7SA 1T5XB 4LMQI 2CDGA 1ERNA 3BZFA 4LF3A 5AZEL 2A38A 1FFNA 4B5EA 3PWVA 3VU2A 3EYVB 1JWUB 4Q7DA 5E6IB 1S5HA 3C5JA 2HKFH 4UV7L 3V4PL 4JY4B 3CMGA 4WV1A 1EJ6A 4R0LC 5DFVC 2X4OB 2IH1A 4YDJA 5KVMC 2JK5B 5GGTH 3KPRE 4N9GB 3QUKB 1CWVA 1MHHB 2PW1A 1PFCA 3G6JE 4WU5B 5D2LE 5D72L 1JZ6A 2XTJE 3W0WB 2FCBA 2R2BB 1DEDA 3E3QC 4L3CA 4HK3N 4MAUL 5E6IC 1C08B 4PRBB 4ZODA 1F4YH 3F65A 4PLJD 3U7WL 1OARL 4NRXA 4Y19A 3QIBD 1G6RA 4XPGL 3BI9X 4TSBH 3ZYIA 5D7IA 1UWXH 3QIWB 3RNKA 3RVUD 1KUMA 2NW3A 5BXFB 5J56B 3MA9H 2OL3B 3PQYD 4JB9L 1UACL 3O3AB 1EJOL 4LPUA 1T2XA 1EBAA 3QHTC 1AQKL 5BRZE 4WCYH 4JO2L 3RBSA 1Z3GL 1SY6H 2IH3A 2NTSP 3ARSA 5SWZD 3CH8A 5BZDA 2WP3O 1BFTA 3QHZL 1WFOA 1XT5A 4P2OD 4WVRA 1ITBB 4PJAA 3R1GH 1LO4H 2VIRA 1QVOB 3AY4A 5IW6A 3QIWC 4OB5H 3X3GH 1YNTB 4GT7A 1FO0H 3CDCA 4N8VG 3SDDB 1G9NC 3O0RL 4K2UH 4QRSA 1QD0A 5KVGL 3QUXA 3GSRB 4OTXL 5B3JF 1MI5B 4Z0BH 3QNYA 4HS8H 1BD2E 4NO5A 5DGQA 5MEOB 2J4WH 3VD5A 1CG9A 2X1QA 3FB8B 5DUBB 5K93A 4M6OH 1MREL 3PWUB 4UOW0 3S97C 1VACB 3SE9L 2IMNA 2HFFA 2APVA 1JCKA 1TTFA 2ARJA 3ZL4H 3SDDC 4K94C 4MX7A 5E00B 5ADOL 4KKCC 1A6AA 5FGBA 4JHWL 5DZLA 4WIQA 5JOFA 3RJQB 1A9BA 3TBVB 4V1DB 1Q72H 4LQ1A 4DW2H 1H3TA 2RBLA 4UDTB 4QTHB 3U36A 1A6VH 3NN8A 3WFDH 4DGYL 2NXZB 5IFHH 1UM5H 2XWTB 4NQUA 1N8ZB 4KWUA 1TVDA 4KQ4H 4P5MB 1E4JA 1P7KB 4MNQB 1ZANH 5BS0D 5IQ9A 4LCWA 3FOLA 4ZXBD 4RSVA 2VQTA 5CGMA 3MCKA 4NRYB 5E2JA 1X5LA 4KK5D 1TJIL 3WJJA 2ADGB 2R0ZH 1T6VN 1JYWA 1TZHB 3AAZB 4QXTA 3D6GA 3MCG1 5TE6H 5BJTB 3N1PC 4ELKA 4LNVA 2DWDA 2NXZC 3V5HB 4G42A 3SDAA 1W72L 2EIZB 2DTML 2ZSWA 2BCKA 1AGDA 1BOYA 4CMHB 4K07A 4D0CA 3JBG7 4KTEH 4O02H 4OCSL 4FQJL 2HJKB 4YHYB 3LIZH 3WXVH 3QCVL 4YDKH 4DAGL 4ONGL 2F53D 3FO2A 1UENA 2A9NL 2XQBL 5DFWH 4M1GL 5F1IB 4YEFA 4P2RA 3FQTA 3WD5L 1MAJA 1PLGH 1MNUL 2ESVE 5DEGA 3O4OB 1L0QA 2BHYA 5BO1H 5B4MD 2GJ6B 4Z18A 1WQVT 1YJDH 4RFOH 1D6EB 4HW6A 1A14H 5EU5A 4CMHC 1JNNL 3EW3B 5SX5K 1I1YA 1BIHA 4YHYC 4WUKH 5E03A 3QFJD 4CJ0A 3UC0H 3CX5K 1G7JB 5FDYA 4LIQE 4F7CA 3O2WH 1Z2KA 4RMQA 3P3YA 3TBTB 1KBGL 2P7TB 4YFLF 1D5MB 2PO6D 4OQTL 5J13B 2CLVA 2BY1A 4P2CG 1V8HA 4NM4L 3MYZA 3O4OC 5SWSA 1IGCL 4YDIL 2A77L 1FC2D 1XGUB 3P11H 3LKOB 1I8KB 1XZ0B 4OFKA 3PHOA 3LPFA 5FUOL 3TO2B 1PJ9A 1UJ3B 3GSNL 4MJIB 2W0LA 1SQ2N 1CLZL 3QCTL 1NDMA 1MCBA 4JRYE 1RPQA 1R3JB 3F62A 1UZ6F 5J13C 4PRIA 3GMNA 1WAAE 1EEUA 5D9SA 1NUNB 1TVHB 3JXAA 3DROB 4AEEA 3RVXC 1OAKH 2F19H 4RMVA 3VD3A 3IJYA 1ZWIA 2DM4A 3E3QE 5DJDB 1UJ3C 2K1MA 1UXWA 3CX5J 3RFZC 5B39B 5I8CA 1FNAA 3S96A 2K7QA 2X4NA 4N0FA 3WN5B 2MHAB 4U1MB 1GGBH 3BZEA 2BMKA 3B8YA 3EOAB 1P69B 5F1OB 4JFED 3W0WE 4Q6IB 1NH6A 5F7DB 1Q1JH 2A6JB 7FABL 1GHFL 2BC4B 5BW7C 4X8JB 1LVEA 1DFBL 3ARTA 5ICZA 4X4ME 2OR8A 2AKRA 5BVPH 3EOBA 2XACC 3GRWA 4D8PA 1K5NA 5IB5A 3U82B 1OP5H 3BH9B 3QYCA 3WN5C 1JPTL 4HUUB 5A16B 3VG0H 4WNQB 2V2WB 3JV6B 4FQCL 1PG7X 5HGDA 2ORBH 2XFXB 5DD6B 3ULUH 5D71L 1MCLA 1U8IB 2QSCH 3LZFH 4Q6IC 5DQ9B 1OCWL 4NQDB 3HE6B 3IJSB 3UAJC 3QHFL 2ZUXA 3BDYH 1E28A 1H3XA 1KC5L 2IQAA 3FQNA 4K7PH 4UIKH 3TC9A 1S7WB 3KPPB 4NQCB 4WHCA 4ZOCA 3RWJB 3CDYA 4WO4B 3V6FA 1NDGB 2NPLX 3AUVA 1BM3H 3P73B 3D85A 2BZDA 3C5ZA 1T66C 2HH0L 2FYYA 5DRZB 1MI5E 2IBBA 3HE6C 2VJXA 4AH2A 1EO7A 5DVNA 1A6WL 2CDEA 3UPRB 4S1DD 1B0GA 1ZLSH 4XX1E 1M7IB 1QBLL 1VADA 1YEIL 2JELH 2AJ3A 5JDJA 5MHSD 4XGZB 1YNLH 4HD9A 5I30H 5MERA 3CFKA 3QNZB 1U58A 3O6MH 4V1DE 1XIWD 4APQA 3PV7A 2MQ3A 4XCCL 1XGTB 3GM0A 3VW3H 1EUUA 4ISVB 3DX6A 1MRCL 3IU4H 2W65B 3MUGB 4KKBD 1BVKB 2OTPA 3RHWK 2VXUH 5GRUL 2XN9D 4MNQE 5CWSA 3LN4A 3HZYB 4U6YA 1FYTA 4QY8A 3BGAA 1SJEB 1FZOB 4CAGA 4NBYB 3VH8B 1YQVL 4WFGE 4S11A 2DB8A 1KEGL 5FO8A 3ARXA 5I74B 1LE9A 5KANI 1YYML 4YBQC 1JWSA 3INUL 3RI5F 2ZUTA 4PYHA 5CIPA 5F9JB 5D6DA 1NGPL 2XZAL 2FZ3B 3PHQA 1QSZA 2JB6B 4GMTH 3EUUA 5IT2L 3MODL 1U8HA 3O6FD 4JFFA 5IHZA 3FO1A 5GGSY 4J1UA 1AXTH 3DXAA 1IGTA 4FFVC 4J23A 5I74C 5JQ6H 3O3EA 5JW4Q 3VJ6B 5DEZA 3GIVA 1I3GH 1WBYB 1E0OB 1E4WH 3E6HA 4JKWA 1C1EH 3PGCB 2GJ6E 2O5ZH 1FJ1A 2XXMB 5E99H 2A6KB 3T4YB 3T1WA 4MZ3A 2AGJH 3NAAH 1HIMH 1HSAA 1AKJB 3VXTB 3V2AR 1RUPL 2H41A 4P3CH 2HFEA 2X1OA 5ICYB 3KYNB 3TPUA 4Z6AT 1PKQB 1U3JA 4PJEA 4Y89A 1RZKL 2ZCKL 1K2DB 3O9WA 4LPCA 4KXZH 3QUYB 4PGCA 3RVTD 4OI8A 2VXSH 4GAJL 4JN2A 2Z8VC 1ZA6B 3G6DL 3JV4B 4N5UA 1P4LB 2VDPL 4RGNB 3ISWA 4MJ2A 4FFYL 3T2OA 1RK0A 2YPVL 1KEMH 4ODHL 4MXVF 5JA8B 1CL7I 4O2CA 3P9LB 1ZT7B 2OTUA 1LNUA 4MJIE 3PF2A 2RHEA 1TPXB 4PRHD 2J8UF 1RFDL 2YR3A 1HK6A 1BQLL 3CXHJ 5D70L 4L5FH 4UIMB 1CFTB 3QUYC 2AJVH 1NC2D 1DQQA 1YEHL 3DX7A 4XXCC 5C9KA 3VGFA 1W0WB 3LS5H 1VERA 3VGBA 4RGNC 4TRPH 5BZWA 3O41A 4OUUB 1VESA 1OQXA 4UOJA 3OR6A 1KTDB 4N0YL 5ELIA 3OX8A 5CP3A 4PJ5B 3TYGL 4GMSH 4X6DB 3OAZK 1J10A 1MIEH 1FNEB 4PB9H 4YFEA 1TPXC 4X98A 5HYJD 3SDCA 3RVVD 2DD8H 1S7QB 3IFNH 3AMKA 4GAGL 1DTUA 3DHJA 4PJGA 1U3HB 5DJ8A 3QO1B 5DUML 3BKCL 2JF1A 1Q0YH 2QJDA 1VEMA 1KIPA 4DEPC 3HC4H 4KJYA 3FQUA 5DHVH 3Q0HA 1GOFA 4XP4H 5FGCB 2MOVA 1SBBA 3ZKMC 4OZHB 4ZO8A 4JRXA 5GZND 1H3WM 4JDZB 4YHKL 4LRNH 1FDLH 4HX1B 3VFMB 4BQ6A 5DMKA 5K9QI 5DLMH 5EFIA 2EXYC 1U3HC 5SV3A 4RMSA 1U93A 2XZQH 2R56H 5E94B 2EEAA 1V3MA 2C3VA 1NAMH 5I73B 4U6HA 4KH2A 3VXUD 5E5UB 3CXDL 4CL7A 5I1EH 1VGEH 4WW2B 4DKEL 4GO6B 5HHVH 3S35H 3SDXB 3ZT5A 5CZVH 3U4BH 4NQCE 1CDIA 3ZHKA 2V17L 3GUTA 2R4SL 3QIUA 4XBEL 1I4FB 4NRZB 4L8DA 4OCNC 5H8DA 4NO2A 4NQSB 2DBLH 4I0PD 4RDQF 3ESVF 3LMJL 1MFDH 4UTBL 1MCRA 1G0DA 1WFTA 2DQUL 1U95A 1IZKA 3RZCD 3L3IB 5DD3L 4X80L 5I73C 4JG1H 3QXDA 4OM0L 5DT1H 1LEIB 4I48A 3I6KA 4GRLD 4WW2C 3RL1A 3T8XB 5T5NG 2I9TB 4LU5H 3OF6A 3NZHL 5C9JB 1P9MA 2QSQA 4L1DA 5I1GH 1YMMB 3WFBL 3CU7A 4ZG1A 3IDXL 5KSBA 3MRMA 2O26U 2HRLA 5F7EH 3GHBL 2FDBP 4PJ9D 4FQLH 1ZTXL 2ATKA 5KVDL 3TVMB 5GS2H 1TQCB 3SHSA 3HN3A 4XCFH 5EOCJ 3TCLB 2G60L 3I6GA 3BP5B 5EU6A 3O8XD 2JJVA 1JE6A 1RIHL 4OGZA 5CINL 5FF6B 2CJUH 2H2SD 3ARFD 2ZWLT 1EGJH 5KTEL 4Y2DB 5CGTA 4XPHL 1DBKH 2HT3D 1S7SA 3JTTA 3N0PB 4HV8A 3UTQA 1U8KA 1WIOA 3VXMD 4YHNB 1A7NH 1CIDA 3OKEB 4OFDA 5IWLC 1JGDA 4FFZL 4Q9RH 1J0ZA 1TZGH 1TCRA 3TVMC 4PJIB 4HC1A 1TQCC 1JF1A 3LKQA 4PGEB 2HRPL 5KS9B 4KJPD 1QYGL 3T0EC 3DV6B 4F33A 3MR9B 5TE4L 4PJ7F 1ADQA 4OBRA 3MJGX 5LAXA 4XXDB 3ESUF 4Y2DC 3WLWC 4M7LT 5J6HA 1NFDA 2OM5A 4YJZL 3FQRA 4FABL 1N2RB 5D7KD 3GJEB 4YX2L 5E4IA 1OTUC 3V0WL 5EO1B 2RR3A 4K7PY 3UZQA 3IDGB 4DVBA 1CT8A 1JGEA 2DM7A 5IQ7H 3D69A 4JFDB 2O61B 1X5YA 4HEME 3GMMB 5DWUH 5LCVH 2YA0A 1J8HB 4V2BA 1AXIB 5FOJA 4OLVH 4GG6B 3H7BB 1R5IB 3O6KH 4LRIA 1JBJA 5C2BL 5FM8A 1DQLL 1BZ7A 5ISZB 2FX8L 2KPNA 4IRSC 1CD1B 4K3GA 5EOTA 4IOSD 5ESAB 3KLHC 1MWAH 2EYSA 1PKQE 5DJZA 4ZAKD 1NGQL 3MNVB 2KDGA 1I7UB 2NX5D 4MCZA 4Z8FL 4TOYH 2GAZA 43CAB 3UBXI 1J1XH 3ARDA 2XTLA 1JNHB 5IR1B 4NBXB 3VI3E 4OCXL 5CKGA 1GGUA 1KOAA 3UEZA 2I25N 1T03L 4RGNE 2F58L 5E70A 1VEPA 3VFVA 5LGJB 1MOEA 3HI5L 3VMNA 4U0QB 3DGCR 3L3JB 2FB4H 1ACYH 5I1LA 3P0YH 2ZCLL 3PP4H 1RUAH 2X4UB 5IMOB 5DTFB 4BK4A 4X6CF 4FQXD 1IM9B 3E0GA 3ECBA 3U6RB 4WW1B 5E8EA 1D5BB 4X6EB 1YYLH 1HHIA 2PR4L 3AM8C 1ZLUH 3GSOA 4QYOB 4ODXB 3H42H 2Q86A 4EI5D 4PJ5E 3OQ3B 3FRUB 3VWJA 3WKML 4X6DE 4ZTPL 3CU1A 4MA7H 4XCEA 1QRNB 2NLJB 1IGML 2AV1B 2OR9L 4OLUL 1S8DA 4ZPVA 4MLSA 2R69L 3QT2A 1T89C 1QSFA 3FT4B 3I9GH 4FTVB 1HHHB 1FLTX 2OTWA 1YEJL 3VA6A 3OJMB 5FGCE 1ORSB 3P9WB 2A83B 2GFBB 4OZHE 3PL6B 1T22A 1RZ7L 1WJ3A 3CLFL 4PV8A 1AO7D 2FL5A 5I0ZA 2H26A 2BK8A 5HPMB 3IDMB 5CP7A 2JJSC 4Y2OA 3KLSA 3T0BA 3TA3A 3HUJF 1HKFA 1LK2B 4R3SA 4KUCD 3C5SA 5DD1H 2B4CL 2FX9H 4OM1L 4G8GA 1SEBA 1B88A 5JHLH 4Q9CA 2AXGA 1D6VH 4OV5A 1RJLA 2NMSA 3PL6C 5I1JL 3SDXE 4QLRA 3LEYL 4E0RA 3MBXH 4M4RA 2VL4A 2J8HA 2JJUA 4KGJA 4MMZC 1B2WH 4LCUA 5JR1H 2GUOA 2ZPKL 2MFNA 5DVOA 4HXBH 1U8NA 1YEKH 3THML 1VENA 2Y5TB 4NZRL 4PJ7A 4CADB 1TETL 1NL0H 2XRAL 4MD4B 4P46D 4F58H 1AY1H 2E9WA 1DE4A 1OAZL 5GISH 5I8KL 4OLWL 4X4YA 4J7RA 2KQNA 3WO3B 2X7LB 2IPTL 4P5TB 1X3DA 1TJHL 4WWID 2DMBA 4MHHI 1RUQH 4L8BA 4KVNL 4JM2B 1YMHB 1YMME 2EO9A 4NWTH 3I02A 4UINH 3VXSA 2HT2C 3GK8L 6FABL 4Y5YB 1CZ8H 2WIIB 4QGYA 1ND0B 5JPMB 3MV9D 4HUWB 3QPXH 5D2LF 1EFXB 1CTOA 3CZFA 2VDRH 4FZ8H 4XPBL 3T2NH 1IAOA 3T0EE 1FZJA 4WTWA 2IG2H 3W11D 5I1CL 2SEBB 3ULUF 2D4FA 3VRJB 5MENB 4O51B 4P5TC 5E0QA 5DR5L 2YOCA 1BZ9A 4WI4A 4JM2C 1CE1H 4YHLH 4QHMA 4Y5YC 1G9MC 2BDNH 3B6SB 4PJIE 1XGPA 2HKHH 5KS9E 2H2PD 2C7UB 1KN4L 5KVFH 3QAZB 4U1NA 2CKBA 1A2YA 2VAAB 3OKKB 1J0IA 3VXQB 3K74B 5FKAA 3U2SA 5CEXA 1RJCA 4M9PA 4GUPA 4X6CA 2WWKT 4KFZC 4G3YL 1F8TH 1HOCB 3ZE1E 2VDOL 1FBIH 4EEEA 4NJAH 2DDQH 2A1WL 2IBGA 3QAZC 3BW9B 3C60D 1RURH 4XVUC 4JFDE 2NY7H 3DVFA 4KUZL 2C26A 2NNAB 4P9MH 1ORQB 3BUYA 5ALCH 1J8HE 5I1KL 3SE3A 1JNJA 1DVFD 3VFTA 5GRJH 3P4OA 4GG6E 3CSPA 1FVEA 1CGWA 4HQQL 5EIIB 3ZDZF 1ADQL 3B9DA 2Q8AL 1BQHA 4HKXB 1CE6A 5ISZE 2BNUA 4IMLA 4ZQKB 4F7PA 1BJ8A 32C2A 4X0KA 4JDVB 5CS7A 5MEQA 2BVOA 4L9LB 1FZKB 4TULL 2VLKD 5HPOA 5DQJA 5GXBB 2IC2A 5J3HC 3GSQB 2K3TA 5B38A 3EO9L 1DJSA 1OTSC 1XGQB 3KYKL 3FMGL 3HUJA 4PJCB 1BFOA 4F7TA 4GXVH 4XVSL 2B1HL 3VFPA 2XA8H 5L0QB 1IKFL 3PWPD 3HS0A 1FFRA 5KVEH 2EE6A 4L9LC 3ZZ1A 3STLB 3QZWG 4EOWL 1CXFA 5HI3D 5IFJA 1T83C 4S1QL 4JANA 5C0BB 5DUPL 5D2NB 4POZD 3T0WA 5HD8C 2B0SH 5DJAA 3FFCD 1C12A 1SBSH 4M6MH 4CVWA 2G75B 4GW5A 4N0UB 1QRNE 5L0QC 2WBJB 2FNBA 4DK3A 5E2TL 1EMTH 4JPKL 3TYFB 4HLZG 1A6TB 3BMWA 3FFDA 4JR9H 3BQUA 4LSRH 4P4RA 1N4XH 1KJ2H 4K7FA 3KDMA 4UU9B 3KPLA 5SX5H 4FTVE 1T0NB 2EECA 5D2NC 5E2UL 5I18H 1UYWH 1DL7H 4NC2B 5JLZA 3PABB 3UYOD 4JPVH 1EAPA 1ZAGA 1AGBB 3KPRA 3GMOB 4RFEB 3QDMB 5E8DH 2WBJC 3GO1H 4KRNA 1TFHA 3G6JA 5D2LA 3Q5YA 1WZKA 3HPJB 2RIKA 4MDIB 1S9WB 1BFVL 2DWEA 3QCUH 2HJFA 2UY7A 4JO4H 5CEZD 3HNVH 2R4RL 3QSKB 4J8RB 4IHOA 4IOIA 3L3HB 4LNRA 4R4ND 2FR4B 2RFXB 4X7SH 5EC1B 4L29A 4FP8H 4I77H 1G7QA 1QLFB 3MGTA 5TDNB 4M6NH 3O4LB 3CSBA 5D1XB 2VE6B 2ZG2A 3FT2B 1KLUB 1U8OB 4OZFB 3TWCH 2I60H 2KUTA 3R8QA 3HB3D 4JLRA 4LEXL 5AG8A 1FRGL 4JAMA 3P4MA 5HDQL 1HEZA 1XGYH 5BRZA 2B7DT 3HAEA 1U2HA 3EJZD 4X5XB 5LWYH 1XAUA 1WAAF 1R3KB 5EZLB 2CGRL 1BQHG 2VLJD 2VDLL 5F7WC 8FABA 1B90A 3D9AL 2UVEA 4DFIA 1MPAH 1KULA 4Z5RA 3GSVB 1NFIA 4HKJB 3WE6B 5T1KA 4H88H 1D5XB 5D1XC 4XVJL 4Z7WF 3EIFA 2FEDC 3EOTL 5GQBA 3OWEA 3NACL 1KPVB 1UVQA 4GRWH 3QWOB 4ODVL 4DKFH 3Q3GB 4FXKB 3RGHA 4RAVA 1PZ5A 1WICA 5JIPA 1IM3A 2YD6A 5F3HA 1ZHLB 4D2NA 2JJTA 1BD2A 2ERJB 3L3OA 1EDQA 3PJSB 1S3KL 4D0DB 3LEVL 3ROLA 1KF9B 1M1SA 4QOKE 4MJ6B 3LB6C 3KPTA 4PR5B 5I8OH 4U1LA 1UC6A 2ZJSL 5MENE 1KTRL 2QR0B 4WTZG 3D2UA 1CQKA 2OCFD 2R23B 5GSVB 5JZ7D 4LCCB 4O2EB 4CKVX 4H26A 1UCBL 5JXAL 5EZIH 4WI8A 4KI5F 2B39A 3QXAA 2ERJC 1A3QA 4RZCB 3CFEA 1E4KA 3LPWA 1A7RL 4XWGH 2OR7A 2CR3A 2Y6SC 2J12B 5ESVA 1GC1H 3PUCA 1N26A 4M5YL 4ZS6D 3AS3A 4LCCC 4MCYB 4PY8J 3QEGL 5TQ0L 2I26N 5HHMD 5T5FH 3FOMA 4P2RD 4L4VD 4FMKA 3IVKA 3RX5A 3V95A 3R06A 4BZ1H 4W68A 2VOTA 2O5XL 1AP2B 3BIKA 3WIHA 5DHYA 2WLYA 5J6GA 1B0RB 1MCIA 1EEZA 1DQML 4XHJC 1MHCB 2CKBL 2OP4L 1J0YA 1I8IA 1FGVL 5GS1B 4A6YB 4MNHA 3SKMA 3PWNA 4IRZH 4LCIH 1MLCB 2X4QA 2H32H 4MDJA 1YEDB 4U7SA 2ESVA 4M61B 3MLXL 1O5DT 4YH6A 2AJSH 3B9VA 4KK9D 4PLKD 3L5IA 4URTB 1KLFA 3NPSB 3QPQD 1CXKA 3HAEG 5C07D 1HQ4A 3MLRL 5IB3A 4KTDL 4HMEA 1NBYB 3DVGA 5GS1C 1ED3B 2KKQA 4RCAA 2R8SL 1WEJH 5C0JA 4P4KA 1SJXA 4OGYH 3H3PH 2KH2B 5TE7H 2P8MA 5DHXB 5BV7B 3K81A 1Q9WB 5C08B 4PRID 1OLLA 1DLFL 3UTSD 3ZKSD 3NPSC 4YDLB 4LPXA 4HFUL 1MIML 1RI8A 1KCUL 3EKCA 2XZZA 5E95B 3ARGB 1SEQH 3GJFK 1OAXH 1PSKL 1NBZB 4R0LA 2I9LA 5D2NE 4JRYA 4FQ1H 4JFQB 5LGKA 3QB7C 4OLEA 5DYOB 1HXMA 3CLEH 1FORH 1PX4A 1WAAA 5BV7C 4N0UE 4ELMB 3U0PB 1T5XA 2IGFL 1WFUA 1IC7L 2ZCHH 4YDLC 1NCAH 4X6FB 3EYVA 1JWUA 4TSCH 1I9IL 1A47A 5E6IA 3IXTB 3ARGC 3G5VB 2X4OA 3B9KD 4UNVA 3Q6FB 5ACMA 1OP9A 2V7HB 5DMIH 4CBPA 2I07A 5EBLB 2AV7B 3OZ9L 4UV4H 5FYKD 3KLAB 4N9GA 2A0LC 3QUKA 3TH3T 1D9KA 3QDME 4NCDA 1MHHA 4WU5A 1JI2A 3F58L 1MRFL 1YDPB 3SE4C 2EZ0D 3TN0B 3TBSA 4MS8C 3W0WA 4NC1C 1RY7B 3B5HA 2R2BA 3QDGB 3BKYL 4NWUH 3C08L 1C08A 1LDSA 4PRBA 3HRZA 1WCQA 3T77B 1O0VA 5SX4I 4X4MA 1FGNH 4Q2ZB 3K8LA 1BGXH 3QIWA 3O4LE 5BXFA 2CRMA 3BD5A 1V7NH 1GGCL 5J9PB 3RGVD 2OL3A 1AXSB 3SDYH 3O3AA 3NCMA 3AS1A 1EX0A 5C6TH 5ADPH 2BVPB 3TN0C 4HKZB 3O3BB 1NC4B 1T21A 3T2QA 4M48L 3K3QA 1DLHB 4XZUB 4X4XB 4NM8L 1QVOA 1NUDA 3C2AL 1L6XA 5DJYB 4JQVC 1YNTA 1MF2H 2WV3A 4ZUUB 1UQSA 5AYQA 3UPAA 4GKZB 3D39D 3ARVA 3SCMD 3GSRA 5DZNA 1F2QA 5F7MC 1MI5A 2I24N 3L3GB 1S9YA 4ZO6A 5IMKB 1KSRA 2F8XC 4AMKH 3DO7B 3FB8A 5DUBA 4BELD 4BFBD 1GRWA 3ZYJA 3PWUA 1FAIH 1VACA 4FA8A 4HWUA 1AC6A 3DHMA 2X10A 3WIIH 2ICEB 2EKSB 4LP5A 1X5GA 5E00A 3TBWA 4HBQA 1G9MH 1Z9MA 2M2DA 2GW5A 2VZSA 4C58B 3TBVA 4V1DA 5ITBL 3BE1H 1FPTH 3HMXH 4QTHA 4UDTA 4XRCB 2Y72A 1CCZA 5TQ2L 2OK0H 1BPVA 5IESL 5EOCH 2MQ0A 3QJFB 3STBA 5CLWA 2XWTA 4HEPG 3T08A 1N8ZA 4NQEB 1GJIA 4QXGL 2EDKA 4YR6B 5MP6H 4P5MA 1P7KA 4IBLT 1CICB 3KHOA 4YHPB 3NA4A 1MCPH 3P30L 1KTLB 2NY5C 4NRYA 3BZ4B 5HYIA 2VQ1A 3ME0A 1BREA 3MXVL 5DXWA 1TZHA 3AAZA 3C8KA 4A2LA 1OAQL 5BJTA 1D5ZB 4OIIL 5IBTH 2WIMA 1T1ZB 1A5FH 3MOAH 2EIZA 1C5BL 5LXGL 4ZNCD 5E8OB 3SJVB 5DA4A 1SJHB 4XWOD 2D7TL 3V8CA 4DZBB 2HJKA 2LQRA 1CICC 2DMCA 4HFWB 4LSSL 1CBVL 1GAFH 1OWWA 4FG6C 4Y1AD 5MEPB 5F1IA 5FYLD 3BHBA 5FUCC 5F8RC 2H8PB 1WUNT 4P23A 4UT6H 2GJ6A 4I9WD 4JFHD 3O9WD 4HWNA 4L3ED 2R2CA 4P3DB 1D6EA 3U0WL 4PJ8D 2E7BA 3G5ZB 1A6PA 3MJ7B 4HUVB 2RCSH 4WWKB 3WIHL 3TBTA 3HI6H 3U9PH 2P7TA 3RIAK 2JCCB 5A3IC 1N0XH 4Y4HB 1ROWA 2ZG3A 5C08E 1TIUA 2X1WL 3DTXB 3G9VA 1XGUA 2DI7A 3MLVL 3LKOA 1XZ0A 4YQXH 4HJ0D 5H37H 5FDWA 4UNUA 3TO2A 1UJ3A 4MJIA 3QDHA 4R2GD 4WWKC 2P49B 5DSCB 2OQJB 2BERA 4JCMA 2XPGA 3C6LA 3FB6B 4F80A 4XX1G 3EZ8A 2VSCA 4Y4HC 3UYRH 4H8WC 5JOPD 1OPGH 1N7MH 1NMAH 1W72B 4ELME 2P47B 4Z0XB 4HF5H 4AT6A 5JW3H 2H9GB 3O2DH 2J8OA 4RRPA 5DMGD 4NC1E 1C8PA 3MUJA 5D4QA 5DJDA 4XI5D 5BW7A 4TVPD 3L7FB 5FECB 2HTLC 1A7PL 4FZEL 3H9ZA 2P5WA 4GLRI 4M6AA 4UBDC 5B39A 1WIUA 3WFCL 1NBVH 5GSRB 3WN5A 2BVQA 3S5LB 2MHAA 4U1MA 3WBDA 2QQLH 1K6QH 3EOAA 2Y06H 3GI9H 1QNZL 4I0CC 4XMLH 4M62L 4Q6IA 5F7DA 1FL6B 2A6JA 3QDGE 4ZUTB 2DQJH 1XCQB 2BC4A 3PE9A 4J6RL 4X8JA 1P4BH 1JPGB 3VI3F 5E1AB 1HI6B 3TJEH 5DVMA 1D5IH 1LK3L 3PHSA 1UFUA 3BH9A 1OWRM 2D9QB 1RUKH 1ZT4B 4HKBA 4HUUA 5A16A 4MZ2A 4WNQA 3JV6A 3TV3H 1MAMH 4XNXL 2BVTA 3QDJD 2XFXA 1S9XB 2PUQT 5DD6A 1KIUA 1I75A 4LASH 5FUZL 5DQ9A 2LVEA 3EFFB 3HE6A 5IGXL 3GSNB 3IJSA 2DKSA 5GS0L 5I76B 3MOBL 3V52H 2D0GA 5J57B 2Y5EA 2ICWA 1P1ZB 1Z9SA 1S7WA 3KPPA 4NQCA 4NOBA 4IRJB 1NDGA 3FO9B 3GNMH 2GHWB 4ZO9A 3P73A 5HDOA 3SKJH 1MJUH 1LP9F 2MWCA 3IDYB 4X6DF 4WEBL 5HHPB 2UZIH 5HHOD 1K4CB 4K8RC 2P24A 2QQNH 1OT2A 3MBED 3V6BR 2IWGA 3UPRA 1N5YL 5C0RH 4ZS7L 3S88H 4ZFOB 4N1EA 1KG0B 3DSNA 3KGRA 4IRJC 2X1XR 4XGZA 1SMOA 3KR3H 1INEH 3VGGA 1RAMA 1N6VA 1U91B 3QNZA 3IDYC 4OZHF 2YD2A 3MXWH 2AS5M 2E3VA 4K94L 3NTCH 1A4KB 5J4MA 2Z9TA 1FFNB 2GI7A 1XGTA 4ISVA 3CVHL 1T0PB 5H35A 3MUGA 1EIBA 2COQA 3OPZH 4NQEE 1IAII 4GSDH 4LARH 3BAEL 3HZYA 1SJEA 1KT2B 1FZOA 2VABB 3I75B 4Q0XH 2FX7H 3CDFA 4RRPG 4WW2F 3SDXF 4M7KL 3I2CH 1H0DA 2PW1B 4NN6B 3VFOB 1ZHBB 1QBML 4GRWF 4FXLA 2Q7NA 3MRPA 5DDHA 1JFQH 3K4DA 5FUCE 4D0BB 1OY3B 1MCSA 5F9JA 2GY7B 5EB9A 3SQOL 4Y19B 2NY6D 4YXKL 1DBAL 3SJVE 3SGEI 5I1HH 5LVEA 5DD5L 4RQQA 4UT9L 12E8L 5TGBB 43C9B 1QEWB 3LVEA 3WJLA 4NN6C 4ZD3H 4HPYL 4POUB 1ZKAA 4QHKJ 5T1LB 2FBJH 3VJ6A 1JGVL 5KW9H 1DQDL 1WBYA 1UH4A 1S7RB 3PGCA 2A6KA 3T4YA 2QQKL 5F7UA 1CK0H 2WM0A 3VXTA 2EH7L 1JYXA 1FNLA 4HWBA 5FA3B 3VWKB 1DQTA 2V5SA 4U7KA 3VD9A 1T04B 1G1CA 2X70B 3KYNA 5FYKU 5IK3B 5ICYA 1FIGH 1PKQA 1YY9D 2YMXL 2GY5A 4LPWA 2NY0B 2JCCE 5JOEA 2EDEA 4DUVA 4CVUA 4LPVA 1CD0A 3QUYA 4XXCA 1VCAA 3GSWB 5CJQL 1H8SA 5JHDB 3UDWC 2NY3B 1ZA6A 5IOPA 1P4LA 2YUWA 3VWKC 1FFPB 1G7HB 3UMTA 2GQHA 5ICXB 3NIGF 3P9LA 3BP6B 1ZT7A 1P7QA 4MJ5B 4JHBA 1AI1H 4XBPB 5BV7H 2NY0C 4MD5B 1GGTA 3EFDH 2NY1D 4P5KB 4UIMA 1ZLWK 3W5NA 1OOAA 3EHBC 1NSNH 1XMWA 2EYRA 2NY3C 1W0WA 1JMXA 2YS4A 1A0QL 3UZVB 2EIDA 2ZKHH 1KTDA 1PQZB 4S2SB 5D7SL 4LCWB 1BQSA 2B1AL 2NY2B 3FOLB 4PJ5A 4QHLB 2N1KA 4X6DA 5DJ6B 3HC3H 3OMZA 1FNEA 4OD3H 3MLYL 4PGBB 3DVIA 1K9TA 3N06B 4PUBL 3MC0A 4MXQC 4D3CH 1S7QA 1U41A 2EDHA 2ZNWA 1U3HA 5LQBH 4D9LL 1N6QL 4G42B 5CLTA 3HCVB 1GPOH 2HTKD 3UP1A 1PY9A 1GOGA 1KELL 5CCKL 3X14B 5HI5D 3S37H 4OZHA 4YXLH 4X99B 5IBLD 4JY5H 5EG6C 3A6BL 3ARYA 2HJLB 4JDZA 2X09A 3WJJC 5KG9B 1JNLL 4HX1A 3VFMA 3LQAC 2KQMA 2CMRH 3A67H 1QA9B 5E94A 4OF3A 3UX9B 1IILE 4N8CH 3QIBB 1A7OH 4V2CB 4E9LA 4LSTL 3RUGB 2AJZB 4WW2A 3EYUL 3SDXA 3GSXB 3VRLF 2AQ2A 1GXEA 2VXQL 1A6UL 1I4FA 5EOQH 5EZJB 4UTAH 3QULB 4NRZA 4NQSA 4BFGA 2FIKA 4JQXC 5D7LA 3VE0A 4MNGB 4PLJC 4MMXC 4P2OB 1TCMA 3MRCB 1TXKA 1LO3H 3L3IA 4M5ZH 3QIBC 3MQIA 4FN0A 1LEIA 3QEQD 3RVUC 5DFTA 2DM2A 2Q76B 3PHOB 4LEOB 3UJJH 2C3WA 5JIHA 1CXEA 2I9TA 3LKPB 2CLZB 1AD0B 5C9JA 3FN9A 4OJFH 2X4RB 2Z93A 5AZEH 4XPAL 1YMMA 3FO0H 4QKXB 3B5TA 1DANU 2ITDB 1E27B 5BVJB 5L6YL 3L9RB 4UV7H 3V4PH 3EGSB 2ADFH 4P2OC 5IWLA 3L3DB 5DRXB 3TVMA 1FH5L 3IFLL 3T0EA 3ZTNH 4JFZL 3TCLA 1ZWIB 3BP5A 1IQWL 2NTFB 3LHPH 5FF6A 5J1AB 2PYFB 3IS1X 3BYTA 2NCMA 4JN1H 5D72H 3RWFB 5D7JD 4Y2DA 5AUMA 5I8CB 4WTXA 3UTZB 4HWZB 1BBJA 4P2QB 4MAUH 3RI5K 1Q9LB 4YHNA 3BZEB 3U7WH 2E9JA 1OARH 4S1SL 4PJIA 5TDOB 4XPGH 4PGEA 1KIRB 4FNLL 5KS9A 2Q20A 5BS0B 1B4RA 3MR9A 2JB5L 1A21A 4ZXBB 4JB9H 1EJOH 2AABH 4XXDA 1DBML 5KSAD 1AQKH 5TH2B 4CNIB 5C0EA 3QEHB 1E6JH 1JPSL 5IB5B 1FAKT 1Z3GH 1P84K 2EE2A 4EDXB 1N2RA 4IRSA 1FNGB 2X42A 2XQYK 3DGGB 3QHZH 3GJEA 5F21B 4NQVA 5EO1A 3IDGA 5D1ZD 5I15L 2MNUA 1A7QL 1J9CT 2F54D 2XZCL 4HZLA 4JFDA 4ZUWB 4ZXBC 3GMMA 4YGVB 1F4HA 1IGIH 2X41A 4KK5C 5GGSA 4TVPL 5IW3A 5KVGH 2LVCA 1S7VB 1UH3A 1K3ZA 3NCCB 2CK0H 3H7BA 4OTXH 1R5IA 4CW1B 4GG6A 4PTUA 5ISZA 4HDIA 3SGJC 5KZCB 1CD1A 2E27L 5ESAA 2Z35B 3JWDC 2J88L 4E41B 5F72S 1MREH 4U3HA 1XCTB 3MNVA 1I7UA 4W6WB 3T0XA 3H0TB 1JNHA 5IR1A 3QFJB 5ADOH 5JHDE 5SWQB 4JHWH 3AM8A 4D9QE 5LGJA 5AG9A 2VDNL 2PO6B 1CXLA 3R0NA 3L3JA 1X4XA 1U58B 3CSGA 3MMEB 4LOUD 3CZJA 2AXFB 4HWBL 5HGBB 5B4MC 3QUZB 1CF8L 3LCYA 3F7YB 2X4UA 5IMOA 5DTFA 1NANI 4IMKC 1IM9A 3U6RA 2PTVA 1FV1B 1MLBB 4WW1A 1D5BA 1RZ8B 2APBA 4X6EA 2WP3T 2AP2A 3S6CA 1V5JA 1T89A 5C09A 4HUXB 1JV5B 1TJIH 2DQGL 1E4XL 1CDGA 4QYOA 4ODXA 3QG7L 2YA2A 3ULVL 2PO6C 5FYJU 3DMMD 5I71B 5L2KB 4LCWE 3X3FL 3FRUA 4Y4KD 3BXNB 4MJ4A 1ZXQA 5CKAA 5JORB 2BVUA 3OKMB 3QUZC 1BJMA 2IQ9L 2YPKB 4XNUL 3RY6C 4AQOA 1QRNA 1W72H 2NLJA 3R0MA 2BFVL 2JJSA 2AV1A 2DTMH 2QHRL 2JKXA 1WCBB 1YC8A 4OCSH 4FQJH 2NYYC 4RDQG 3NOIA 2H1PH 3QCVH 1R0AH 4DAGH 4KRLB 4ONGH 3TZVA 1WITA 2XTJD 1KB5B 2XQBH 4KC3B 1AGCA 5EU3B 4FTVA 3ULUD 1HHHA 3WD5H 4KKAD 5I71C 1MNUH 1ORSA 4HMCA 2GFBA 4FHBD 3PL6A 5E08L 1A02N 3A6CL 1GIGH 2YKLL 4QF1B 5HPMA 5F9OL 4K3DL 3IDMA 5B8CB 4J1UB 1PEZA 4JFEB 1F6LL 3OR7B 3NFPB 2V5MA 4QRUB 5C6WH 4PJCF 1LK2A 3MLSL 3MREB 3B2UD 1JUFB 3U83A 4Y0GA 1BAFL 2OSLA 3IDIB 5KJRL 1HNFA 4C4KO 3RUGE 3GMPB 1KBGH 3KJ6L 4OQTH 3MUHL 5T3XH 1DBJH 1IGCH 4DGIL 4N5EC 3TIEB 5C7XL 3UYPA 5B8CC 4ZDHB 2A77H 2F74B 3AS2A 4UZGA 1Y18B 1IBGH 1MH5B 1HQRB 3ILQD 4OCRL 1OSZA 5AWNL 4MNGE 2Y5TA 5FUOH 4CADA 4MD4A 3QCTH 1CLZH 4JN2B 1RZJL 2AJUL 3GM8A 5T1DH 2FEEI 1W2KT 4UNTA 4B41A 3K1KC 3N9GL 1Q9KB 1RK0B 5DJCB 4P5TA 2X44D 4O2CB 5B3NA 2CUMA 1JP5A 4JM2A 5F6HJ 1YMHA 3CX2A 3I50H 3IXAB 1YPZB 3PGFL 3D2UD 5EWIH 1N3NA 4Y5YA 3BRFA 1UKSA 4KU1A 5I16B 1ND0A 5JPMA 4R4FL 3DX7B 4HK0B 4HUWA 3HMXA 1EFXA 3W9DB 5T33L 4M8VA 2EDXA 4QOKA 3DRTB 1QKZH 3L95B 5LBSL 1U3YA 3NIFE 2SEBA 5MENA 3EZJB 4O51A 3OX8B 3BGMB 5I6XB 4OF5A 3AVEA 4B53A 1EZVY 1F42A 4JPIA 1XIWB 2NY4D 2DJSA 1QSED 2XG5A 4P2QE 5L2JB 1GHFH 4X7DC 4S1DC 2UVFA 1DFBH 4G9DB 5IIEB 3BT2L 4EJ1C 1V05A 4OGAC 2YUVA 4HG4K 2C7UA 3E8UL 5BS0E 2VH5L 1T2QH 4M1DL 4XB7A 3RL2B 1JPTH 2VAAA 3OKKA 4ZFGL 3LKSB 5I6XC 4FQCH 3VXQA 2N4IA 5D71H 2FD6H 3WKNA 4G6FD 1XIWC 1OCWH 4N9OB 3QA3B 1XR8B 2X6MA 5E5MA 5EFIB 3QHFH 3ARPA 1U93B 1HOCA 1KC5H 4KKBC 2ZUUA 2W9LA 3MRIB 1IEHA 5I1DB 1F6FB 1G6RH 2NNAA 1ORQA 4ESKA 1IC5L 1NEUA 3U1SH 3SGDH 4HXAL 3LN5A 3K8MA 3V8OA 5EIIA 3FB7B 4OFYD 5HSFA 1A6WH 1DANT 4NO2B 3H9YA 3PGDB 3D18B 4MAYD 4E41E 4TSBL 1FSKB 1QBLH 4JDVA 1YEIH 3MRLB 4P4KD 2HN7B 2V5TA 3LH2H 3RAJH 4Z95L 4HG4J 2Z8RA 3QXDB 1FZKA 3GDBA 3QWQB 1NAKH 3QFJE 4WI3A 1P5VA 1T83A 4M43L 3LY6A 4WUUD 1R3IL 1GGIL 1XGQA 4MQXC 1KACB 5I75B 3R1GL 1LO4L 1IRAY 4RAHA 1T2JA 2WZPD 1MRCH 3ZO0A 5KSBB 1FSKC 2ZOLB 1EH9A 3JWOH 4OB5L 1HINH 2C4FU 2MJWA 5GRUH 3SOBH 4OFVA 5TJWK 1S5IL 2VQUA 3RWEB 3STLA 3WMSA 3HG1D 4PJHF 5TF1L 1J1OL 5C0CD 1M71A 2FO4B 3IKCB 1P9MC 3KXFD 5D2NA 2IBZX 5L2KE 4ETQB 3CFIC 2J4WL 4LVOB 3WDHA 1YYMH 4J3TA 3JTTB 3INUH 5I75C 4KAQL 5E2VL 3MZGB 1J5OL 1NC2B 3WHE0 3RVTC 5C86A 5KAQG 2G75A 4XNMB 2WBJA 1JPFB 1NGPH 4IEFB 2XZAH 4KZEH 1A6TA 1HWHB 2W38A 2VLRB 2P5EA 1JL8A 5IT2H 4UU9A 4Q58C 1T0NA 3FQWB 4G9FD 1KFAL 5HYJB 2HFTA 5J6HB 2X4TB 3PABA 4U1IA 3NCFB 5DEFB 1IQDB 5L7XH 4BQCA 1AGBA 5IFHL 1BECA 1ZK9A 3DO3A 3GMOA 4RFEA 2FWOB 3QDMA 3WIFB 1A4JB 4JFEE 3HPJA 4KI5D 3EJYD 4MDIA 3DBXB 1S9WA 2V9RA 1RUPH 1NCDH 1TZIB 2FGWL 5KANG 1HZHL 5F88B 3SO3B 1HILB 4AM0B 2A73A 1KCRL 4J8RA 3U0TB 3OGCB 3EYSL 3L3HA 2RFXA 4MA8H 5EC1A 5TE6L 4Z7UB 1QLFA 1RZKH 4FQIH 2ZCKH 1DN2A 2IAND 3O4LA 5D1XA 2VE6A 1YEFH 3FT2A 1KLUA 1U8OA 4OZFA 1RU9L 5HGAA 4YDVB 4GAJH 5HYEA 1IGFL 5DK0B 2VDPH 4NKIH 3REWB 1JI1A 3SDDD 3VXUB 4FFYH 4OLYL 4AIXA 2YPVH 4X5XA 4ODHH 3SO3C 4JZNB 1R3KA 5EZLA 4ELMF 4AL8L 3BJLA 1HH9B 1I9JL 1P6AB 5GZNC 2CO6B 3CUPB 3QI9B 4HKJA 3VFVB 3WE6A 1QSVA 1BQLH 3STZB 4DUWA 1D5XA 1WT5C 2MTPA 4I0PB 5K9OA 5JDSB 1KPVA 3QWOA 3MLZL 1YEHH 4BKLB 3Q3GA 4FXKA 2M1KA 1KJVB 1YPZE 5CD3B 5F9DC 4DWHA 4HSQA 3UC0L 1X5HA 2RQ8A 1ZHLA 3ECBB 4JO3L 4N0YH 5CBAB 1IMHC 3TYGH 4GRLB 5F8QC 3PJSA 5F96H 4D0DA 1I8LC 3QI9C 4TTDD 4XAWH 3VGAC 3GSOB 4GAGH 4PR5A 3UTPD 2Q86B 2NXZD 4I0PC 4TNVF 3UZEA 2QR0A 2A2QT 5H2BB 3BKCH 3CIQA 4DN4L 1Y6NR 1MCJA 4MNQD 5GSVA 2BSSB 4LCCA 2VZOA 4O2EA 5A2IH 3WLBB 1NBQA 3BFOA 5DK3A 1KB9K 4FQ2L 4ZPVB 3O8XB 4GRLC 3OJVC 3ABZA 3ARFB 4RZCA 2EDWA 1JHTB 3LDBB 3QXWA 3VMPA 3DJ9A 1R6VA 3S8WA 4O4YH 3VXRD 4Z7VB 3ZDXE 3L5WB 1OAKL 5GGUB 5IF0B 4OGXL 2LAAA 5GRYA 2YD3A 4K3JL 3DX9B 3CXDH 5E8PB 3BVNB 4MCYA 3O8XC 2H2SC 3ARFC 3RTQA 4YEEA 4KK8D 3LDBC 2V17H 4XBEH 4U49A 1SEBB 2HT3C 1AP2A 5IHLB 5FYKH 5GJSL 3GRWH 3LMJH 3G08A 1YN7B 4UTBH 1B0RA 2KBGA 4Q9QH 1MHCA 2DQEH 4X80H 1RHFA 4WFHD 1G7IA 1OHQA 4KJPC 4A6YA 4M00A 5GS1A 5HVFB 4OM0H 1RHHB 4QRRB 1MLCA 3KLDA 4JGUA 1CDCA 5BVPL 1YEDA 4M61A 3RPKA 3T09A 1KB9J 2OXGA 3TP4A 3NZHH 4OZFG 4HHAB 1FYHB 1FVCB 2R1WB 4GKSB 4IIQB 3VG0L 3V9FA 3IB4A 3NFNB 1WLHA 5DQDL 1EVTC 1RMFL 3TJHD 3HR6A 3LZFL 3GHBH 1NBYA 1ZTXH 3MRHB 1ED3A 4WJ5B 3QZWB 2NX5B 3BDYL 4I18C 3VXSB 1SMAA 2G60H 4K7PL 2G9HB 1RIHH 5CINH 4ENED 3FHQA 5KSBE 3GBML 4QT5B 1Q9WA 5C08A 2BRRH 4K9EH 4XPHH 4IIQC 3RWDB 2YRLA 3WEXA 4ODUA 3PWLB 1OAUL 2D2OA 3ARGA 2MCPL 4G80B 1NBZA 2HRPH 1QYGH 4JFQA 5T3ZL 3TT1L 2HWZH 5DYOA 5TE4H 4H1LB 2QADB 4HIJB 3BEVB 2QBWA 2XWBB 3SE4A 1S7XB 1QFPA 3GKZA 2VLRE 1QR4A 4EI5B 4FABH 1A2YB 3OKDB 3IXTA 5DI8B 1KXTB 3V0WH 1CL7L 3VFUB 1U36A 1CGUA 5HYJE 1JGLL 1Z0NA 2GT9B 3Q6FA 3M07A 5ITFB 3U2SB 4FQXC 5EBLA 1IVLA 2AV7A 1H3PL 3ALPA 3KLAA 2CO7B 2QADC 3CC5B 2D4DA 1YDPA 5CIPH 3TN0A 3F7PC 2JCCF 1T66D 4AY0A 1DQLH 3QDGA 4EI5C 2FX8H 3BISA 4ZFZB 1U8PB 2VDQL 3PG2A 5I8EB 1XF1A 4NQDD 3ARED 1AO7B 4Q2ZA 4XP1L 1NGQH 3LAFA 4Z7UE 4Z8FH 4OZGB 4JQVA 5J9PA 5GGRB 4U6XB 4OCXH 3PXHA 1AXSA 5E8NB 2FHCA 3BOVA 4QTIH 4WO4D 5JUEH 4DQOH 2QSVA 3M17B 2BVPA 1RZGB 1ZLWH 4HKZA 2VO5A 3O3BA 3VXUE 1NC4A 4D9RD 4X83A 5KN5B 1C16A 5CILL 2GSIB 5EDXA 3L1OH 3DURB 5IEKB 1DLHA 1F4XL 2BHUA 9CGTA 4X4XA 5FHBL 5E24E 4LLUB 1UG9A 5FYLH 4EKXA 4ZMAT 1E4WL 4IOFD 2ZOKA 4HIHA 1VPOL 1I7RB 4ZUUA 2AGJL 2L0DA 2ICCA 2PR4H 3NAAL 5BCAA 1HIML 4GKZA 4ZTOH 3MGOB 3NABH 5JXED 4M02A 3KYOB 1GZQB 2W0FB 4YHZL 5DC0A 3L3GA 3NVQA 4P3CL 4KPHH 3UBXG 3WKMH 5IMKA 2VRAA 3DO7A 1NEZB 2VUOA 4ZTPH 2EDOA 4JANB 2AERT 1I7ZB 2ZUQB 4HCRA 3MV11 4G8EA 1IGMH 3P77B 3VGDA 1MFAH 3IDUA 3MRQB 2OR9H 2P46B 2ICEA 2EKSA 4OLUH 2GSGB 4PJXF 1P53A 5C0AD 2R69H 5F44A 2Y9RT 4DCQB 3MV9B 4HT1L 1GOHA 5I2IB 4YFLI 1IFHL 2VZ3A 4XRCA 1MRDH 4LFHD 3WUWG 3IAQA 4Z7OE 5DMJB 3QJFA 2LU3A 2ZUQC 3BKJL 5CP3H 1JZ2A 4NQEA 5I17B 4YR6A 3VDBA 4Z7VE 3ULSA 1EAPB 3MZTA 1CICA 3VXME 4YHPA 3LS5L 4B50A 4C55A 1KTLA 3RKPA 4TRPL 3BZ4A 2B4CH 3O2VL 2WUBH 4OM1H 4LLWB 1JVKA 3OHXB 2MQCA 4GKNB 3KPSD 5EIVA 3NCJH 2BNQD 3W11C 2HJFB 3MSPA 5I1JH 1PD6A 2X4PB 1D5ZA 4JFPB 3LEYH 1T1ZA 4IOIB 1WZLA 1IKNC 2WINB 2XV6B 3SJVA 1SJHA 2UV3A 2YD5A 4L29B 4DZBA 3DARA 3PIQB 5D7KE 4HFWA 4NZRH 1AKJD 1TETH 3GI8L 4OUOA 5MEPA 3F8UB 3U46B 2H2PC 2YBRA 3MTRA 1OAZH 5I8KH 3F5WB 4QRRE 5CZKA 1J05B 4OLWH 3GMQA 4GW4A 2H8PA 2IPUG 3BO8B 3U30B 4KVNH 5CGYD 2GTWB 5DLML 4P3DA 3QUYD 4H20L 3GK8H 6FABH 2D7MA 4LLAA 3WNPA 3MJ7A 4HUVA 4WWKA 4BQ8A 4KK6D 2NX5E 4XPBH 3VXSE 4K3EH 1JRHI 4XP5L 4Y4HA 5HHVL 5I1CH 2ZG1A 2VLKB 5AYUH 4A6YL 1VFOA 5DR5H 4WFEE 2LTQB 3U30C 4POYA 3DTXA 4JVUA 5FYJH 3QUMB 5HGGS 3LOWA 1MFDL 2H6PA 3AB0B 2VXTL 2E6PA 3OAUH 5BOZG 4MHHG 5DSCA 1V7MH 5DT1L 4PLNC 1KN4H 2OQJA 1T5WB 4H26B 1T1XA 4MWFB 3FB6A 3PWPB 3CSYB 3B4NA 3IFPB 4LU5L 1A22B 3MUY1 4LBEB 2LTQC 5M94B 3T3ME 5CJ8A 2H9GA 1QLRB 4UT7H 2AEQL 2A6IA 1U3ZA 4FQLL 4G3YH 3AB0C 3L7FA 5FECA 4JDTL 4WI9A 1AR2A 4PJAF 4LAJH 2VDOH 2K7PA 3GFUA 2A1WH 4HIEB 1ONQA 5GSRA 4HC1H 3D3VD 3S5LA 4KUZH 5I1KH 1C7TA 5K33A 3FOMB 3RQ3A 3L5JA 1DBKL 5IV2B 2DLHA 4LSUL 4JKLA 4HQQH 4LQFL 3F7RA 1ADQH 2Q8AH 4ZUTA 1XCQA 4Q9RL 1TZGL 1AGFB 1JPGA 5DHYB 2GITB 5E1AA 4RWYL 4KV5E 1CFQA 1AO7E 4O9HL 1EEZB 1AD9A 4A2MA 2YSSA 2DN7A 1G0XA 4OIAA 4OZGE 2FO1A 4M03A 5T1MA 2F15A 1ZT4A 4TULH 1JZ5A 3RIFK 1K8DA 1T7YA 1JZ8A 3HZVA 1NCWL 3EO9H 3EFFA 3KYKH 3FMGH 2XT1B 3GSNA 5IMMB 5I76A 4OCYL 4XVSH 1MQKL 1HKLL 2B1HH 2DLGA 4EUPA 1P1ZA 1IKFH 2R9HD 4IRJA 4UB0H 3MROB 1P2CB 2PETA 3G6AA 5JMRA 5LCVL 4EOWH 2VLJB 4S1QH 3RWHB 2E8YA 1K4CA 4I3SH 1MCEA 1MFBL 4KKLD 5DUPH 1Z9LA 2UYLB 2LE9A 4LHUA 4PREA 3RDTD 4EZMA 5F3BB 2Q3AA 3RIAF 4LSPL 1MWAL 1A6ZB 3HB3C 4ZFOA 3FT3B 1KG0A 2I9LB 4JPKH 5EZOL 3JVGC 3EJZC 4DTGL 1J87A 1BFSA 2FRGP 1XF2B 1JK8B 1U91A 1X44A 4Y2DD 3MV9E 5E2UH 1A4KA 2FB4L 5LGHH 4KMTL 4LHJB 3PP4L 5EUOB 4F8QA 5JNYB 4YC2B 2MKLC 2FSEB 4YNYB 1Z5LB 3RUGF 1MCWM 2F5AL 1KJ3H 5IVZB 1BFVH 2I07B 1KT2A 2VABA 3I75A 3VFRB 4HCRL 4NN7B 3RRQA 1B6UA 2DJUA 1D9KB 4Z78B 2Z31D 3VFOA 1ZHBA 3D0VB 2QSTA 4KMLB 2NY5L 3TBSB 3UTTD 2DLTA 1RD6A 3CD4A 4D0BA 5C70A 4MA7L 5CJXC 4W4OC 1TJGH 3HRZB 4YC2C 3VFWB 3S5LG 1BEYL 4LEXH 1YECL 4LFHG 5JZ7C 1FRGH 5J11B 4JFDD 5HDQH 3M8OL 1F58L 2D9CA 1FL5B 3HKFA 3K2UL 1BF2A 1J8HD 3HNSL 4X6BB 5DA0B 4NN7C 1U8QB 7CGTA 2CGRH 1F5WA 5TGBA 43C9A 5HHMB 1D9KC 3I9GL 1QEWA 3ORJA 4L4VB 5EO9B 4KDTC 5J89A 3V6ZB 5GS0C 4G8IA 4G6AD 1V3JA 5T1LA 4XVJH 1T21B 4OF8A 1EEYB 3NACH 4ODVH 1S7RA 4O2FA 1NKOA 2DQCH 4ZS6C 1BOGB 3UDWA 5J11C 5CD5D 1DSFL 4PG2C 4PJBB 1HHKB 5FA3A 3VWKA 3ZKND 3R8BB 1IEAB 4JHAH 1UQSB 4IJ3B 1T04A 2X70A 1S3KH 5IK3A 3LEVH 2XKNB 1WISA 3GSUB 4WDIB 4AG4L 2Q6WB 3CVHB 1BBDL 1L0YA 4QRQB 4EUPG 3C2SA 3WS6C 2VLKE 2ZJSH 1S9YB 5HYSB 3C8DA 1F11B 3JTSB 5F6HI 3GSWA 2KZWA 4I4WB 5JHDA 4MA3B 5JR1L 5AAMA 3BN9D 1UCBH 3N1MC 4HBCL 1FFPA 1G7HA 1XF4B 1LO2L 3K8KA 5FV1L 5JXAH 4LP4A 5ICXA 3K80A 1AY1L 3JWNC 4LHUG 4IJ3C 4NQTA 2WQ8A 5GGVY 3BP6A 3KHQA 1TNNA 4KK9C 3TBWB 4MJ5A 4PLKC 4B7LA 4XBPA 3UTSB 4MD5A 3PWPE 2WBWB 1U92B 2BP3A 3QPQC 4CU7A 5F7NC 3OV6A 4P5KA 2LAGB 3MV8B 4M5YH 2Y36H 5IEHA 3B83A 2VITB 3H7LA 4H8WL 4JPWL 1KCVL 4ZPTB 3MRRB 1MCKA 1M6OB 3AXLB 4HLZH 2AXJA 3TCXA 3FFCE 2EXWD 1PQZA 3QEGH 4S2SA 4QHLA 5TQ0H 2BJML 5K59E 5DJ6A 2CIIA 1UCTA 2X9WA 3T2NL 2VQ1B 3MLUL 4PGBA 2IG2L 3S3JA 4FFWD 1EO8H 2VUYA 2O5XH 3DLQR 1OT1A 3C8KB 2DKUA 3RA7L 1NUFA 1NFKA 2J5LB 2AI0L 1DQMH 2CKBH 2OP4H 2YRZA 3HCVA 3B9KB 1FGVH 4U1HB 1QHPA 2HYMA 1V3LA 2QTEA 3IT8D 2VXVH 3X14A 2O5YL 2EE3A 2HKHL 3MLXH 1W0VA 2NZ9D 4X99A 5KVFL 2G2RA 2HG5B 3E1F1 4P59L 2E5EA 2HJLA 5HHNB 5FO9B 1LGVA 2EC9U 5KG9A 4HZAA 5IMLB 3BHBB 4NKOB 4JQXA 5EN2B 5CEZE 1QA9A 2EIEA 2J5LC 3MLRH 4P23B 2G5BB 3BZDA 3QIBA 3B9KC 3E6FB 3QWRA 3NA9L 3RUGA 2R8SH 2Q1EA 1F8TL 2AJZA 1MY5A 5GIRB 4NO0B 2CKNA 3RGVB 4B7IA 1R5VB 4NJAL 1FE8H 1N0LA 2DDQL 3GSXA 1BQUA 5IG7A 5DJ0B 2NY7L 2EZ0C 5DC9B 2BY2A 5EZJA 4HFUH 4ONFL 1MIMH 3QULA 1NPUA 5SWZA 2VLJE 4MNGA 4P23C 4P2OA 5HDBE 3MRCA 1IGJA 3D1MC 1CQYA 1PSKH 2BXYA 5A2FA 4P9HL 25C8H 2EIBA 2Q76A 4LEOA 3RGVC 3O81A 4K8RL 5FDWB 1QZ1A 4XTRD 3LKPA 1CVRA 2CLZA 1AD0A 3D39B 2IGFH 2BSTB 3SCMB 1IC7H 1R24B 2X4RA 3FRPA 1E6OH 2XPGB 3C6LB 2BY3A 3PNWA 1I9IH 2ITDA 1E27A 5BVJA 3L9RA 3EGSA 1QRKA 3L3DA 5DRXA 4AT6B 5IVNA 1ETZB 5FB8B 3SO5A 3OZ9H 3K4AA 5EUOE 2NTFA 5J1AA 2PYFA 2XA8L 3HC0B 1UKQA 4WI5A 3KAAA 3BN3B 4NUGH 3HFMH 3F58H 1MRFH 3SCMC 3RWFA 2P5WB 1PW3A 3UTZA 3C6LC 3PWJB 3BESR 1YUHB 4ZFOL 3BKYH 4HWZA 4P2QA 4Z76A 3C08H 2BVQB 5I19L 1Q9LA 2DF3A 3H3BC 5TF0A 5TDOA 4PJFB 2B0SL 1KIRA 5C6PB 4PJEF 5BS0A 5T5NF 1LEKB 1UWEH 4ZXBA 3HMWH 1EMTL 1NCTA 2MCG1 5TH2A 4LSRL 4CNIA 3QEHA 3L5HA 4R7DB 4EDXA 4M48H 3QXTA 4HKBB 1FNGA 2AEPL 3DGGA 5LG1A 5HHME 3SGJA 3TO4B 4TUJB 3MCLH 4L4VE 1AFVL 5I18L 1VB9A 2EYTB 4I3GA 5GGQL 4NM8H 2D03H 2OZ4A 5KSUB 5AZ2L 1YPZF 4KZDH 2VZVA 5EULV 4ZUWA 4IM8A 5ALBL 4HGMA 1DZBA 4ODTL 4RMUA 4YGVA 1CFVL 2ICWB 4PJBE 4Y1AB 1S7VA 4JO4L 4MSWB 4CW1A 2D31B 5HHQB 4NP4L 4J4PD 3TO4C 4BQ9A 1VGKB 3HAEH 1T80A 2Z35A 4LHQB 5GHWL 4E41A 1XCTA 2C1OB 4L3EB 4IMKA 3TNNB 4ALAL 2ED9A 2P24B 3TWCL 4PJ8B 2DQDH 3H0TA 4PJGF 1TLKA 1EBPA 1MEXH 3QFJA 2C4XA 4ACPA 1N5AB 5SWQA 1XGYL 5GZOD 3JUZA 5ITBH 2DYPD 5CFHA 2X9XA 1NGYB 2GCYB 3AS0A 5L88L 3VI4F 2PO6A 1NGWA 1CDYA 3NCBB 4YPGB 5IESH 3ZDXF 4U1KB 2RJMA 3MMEA 5C0BD 4ODBD 2AXFA 5HGBA 3QUZA 3MRKB 1UM6L 3F7YA 3RY6A 3UTSE 1FCCA 4QXGH 3RPIB 4PJ8C 5A2LH 1FV1A 1MLBA 3FRPG 3RWCA 1RZ8A 2ZUVA 2Q8BL 3MV8E 1UEYA 4M1CD 3P30H 5M95B 5H35B 4X5WA 2EE9A 4HUXA 1QBAA 1JV5A 3MXVH 4RGMB 2Z4QB 5L2KA 3DWTA 2V2TA 5K9JL 4YHML 2YZ8A 3BXNA 2VDKL 4OIIH 5JORA 5B3JE 3OKMA 2YPKA 1H0DB 5LXGH 2YPLD 4NUJB 2EDJA 3MRPB 1WCBA 5DDHB 1OP3K 4HJ0C 3ZE0E 3QDMD 4G5ZL 4LKXB 2DQTL 1CBVH 1KB5A 2CD0A 5EU3A 4RGMC 1ZMYA 2H3NB 1PKOA 4MB3A 3EO0B 4RQQB 3WL9B 1UM4H 3F7VB 1CLYL 5EU7C 4ERSL 2RB8A 4QF1A 1NCNA 5CJOL 5D1XD 1X4ZA 5B8CA 4NSKB 4JFEA 5DMGC 3U0WH 3OR7A 4S0TD 3NFPA 1G7LB 5FO7B 4XI5C 4QRUA 1R3HB 2HT4C 4MLIA 2Y25A 3MREA 3EDFA 5C0GB 5KSBF 1JUFA 3LQAL 1EHLH 3IDIA 3WIHH 3GMPA 1MVFA 3P0VL 4PGJA 1P7HL 3LS4H 4XMKL 3WXWL 4XCYB 4NN5B 2UY6A 3TIEA 3WJLC 4ZDHA 2F74A 1I9EA 3TF7C 1Y18A 2FH6A 2VN7A 1MH5A 1HQRA 1G7PA 1BJ1H 1ZS8B 3NBNA 4NHUB 2AK1H 3H2WA 3MV7B 2ZZUT 5IOPB 2EH8L 1K3IA 3N1FC 1KXQE 1OD7A 4Y7MA 1Q9KA 1ZVSA 4F3FB 1RK1B 4LIQH 2AJSL 5EO0A 3MUZ1 5DJCA 4R26L 1YZZA 5EC2B 4NN5C 2Z0BA 3D39E 5D93B 1QFUL 1P7QB 5HHOB 5ID1B 4OBSA 3LQMA 1NFDF 1BX2B 3IXAA 1CGSL 1YPZA 3MBEB 2MKWA 3KPMB 4MA1B 5I16A 5DJ2B 1QFWH 4JY6B 3ULVC 4FZEH 4HK0A 5HVGB 2EYRB 4MD0B 3W9DA 4DEPB 3MJ9A 1DQJB 4W6XB 3WFCH 1QBBA 3DRTA 3H3PL 1GGYA 3L95A 3AU1B 3BGMA 3WDIA 3FN3A 5D93C 2P5WE 1H8NA 3DUHA 3WFEH 4M62H 1XIWA 2EC9T 1CLCA 3MBEC 5L2JA 4MA1C 3LKRB 1DEEB 4J6RH 5IFAL 1F90L 4G9DA 4NCC1 4JRWA 2R1XA 2AEWA 5IIEA 2XWJB 4PJFE 1FL3B 2LABA 4FQ1L 4OCMC 4QXUH 1LK3H 3I6LD 4HPOL 4C57C 2R29L 4JM4L 4KRMB 2XN9A 3CLEL 5F1NA 4K71B 3RL2A 3LKSA 4XP9L 1LDPH 1CDBA 1NLBH 2J8UB 3KYMB 5D6CB 1UZ6E 2L4OA 4TSCL 5FUZH 2BOCA 3QA3A 1XR8A 4QRTB 4XC3H 1FP5A 3WHXB 5GS0H 3MOBH 4KKNA 5E4EB 5F71A 1PDKA 4L3AA 1F3DJ 4UV4L 1T7ZA 3MRIA 5I1DA 4K71C 5I1IH 2F8OA 3RWGB 5IHUL 3FQXA 3QP3A 4WEBH 5ESQA 3O6FA 4NPYB 4Y1AE 4KXZI 2VISB 2OL3H 3FB7A 3MFFA 1Q94B 1G9NH 2CRYA 1RZJC 3PGDA 2FIKB 3D18A 1HHGB 5E4EC 2Q87A 1WF5A 5D7LB 3VE0B 2GYSA 4ZS7H 1EERB 4I9WE 4JFHE 1BGXL 2CPCA 4L3EE 4Y16D 2NY6C 3MRLA 2HN7A 3D48R 3JWDL 5F1SA 5BOPA 1RULL 3QNXB 2OZ4L 3VG9C 4UOW1 4HUMB 4Z7OF 4WU7B 1I3VA 1F02I 4JGJA 4K94H 1QFWI 2Z93B 4Z7VF 2JIXD 4Z7QF 2ZOLA 2WMPA 3CK0H 5HYQB 4PBVC 2OXHA 3CFJB 4LL9A 4U6VH 5H37G 2WAHA 3BAEH 4MQSB 3MNWB 3RWEA 3T0EB 3MYJB 4AEHL 1HNGA 3F12B 4M7KH 4M7JL 4QRPD 2FO4A 3IKCA 2YZ1A 1YY9C 1QBMH 5AUMB 1HN1A 4ETQA 1ZHNB 4YLQT 1BBJB 1KPUB 5EU7E 2P4AB 5F7HA 4I0KA 3U7YL 1NC2A 3N1GC 1FAIL 2CUHA 4MXWH 1CIUA 4XNMA 3SQOH 1F4WH 5CUSH 1DBAH 1JPFA 1JJUA 4GRMB 5DD5H 5IHBA 1FZMB 2VLRA 3NGBB 3OKOA 4TVPE 4EDWL 4UT9H 12E8H 2HFGL 4E42B 3RU8H 3K0WA 3FQWA 5HDLA 1FPTL 2IAMB 2HAZA 4HPYH 5HYJA 1YEGH 3P2TA 2X4TA 4Q9BA 5C0EB 2OK0L 5DEFA 2NY1C 1IQDA 1JGVH 2PCPB 5GRVK 4L8CB 4YUEL 1DQDH 4IRSB 3VXPB 3IETB 2FWOA 4NQVB 2IFFL 2QQKH 4WHYG 1A4JA 3WIFA 3QQ3B 1YNKH 1I9RH 2EH7H 3DBXA 4NFDA 4XVTL 3NGBC 1TZIA 4PS4L 4HZLB 4U2ZA 5F88A 1HILA 1ZT1B 4AM0A 3TNMA 3U0TA 3OGCA 3V7AE 4M93B 5CBEB 3VFNB 2YMXH 2IAMC 1CFNA 5GGSB 3L7EB 4TPRL 1YA5A 1OGAD 4Z7UA 4PTUB 5EA0L 1ULVA 1KB5L 4LLMA 5IBTL 1MFNA 1WT5A 2R39A 4HDIB 1OAYL 4LVNB 1FO0B 5IP4A 1T4KB 4OLXH 4R8WH 4YDVA 3KG5A 2ZSVA 5DK0A 2DMKA 2HTKC 2BNRD 3REWA 3MNZB 3VXUA 1D3CA 1I1AD 2AK4D 4M8QB 4JZNA 1EHNA 1LILA 3AC0A 5HI5C 1SJVA 1U6AL 3ULVE 4M93C 1HH9A 3MJ6A 3MV7E 5IBLC 1I8LA 4PP2A 3T3MF 3CUPA 3QI9A 4LPYA 4N90E 3STZA 2VMFA 3Q6GL 3ZE2F 4I0PA 5JDSA 4LVNC 3BRDA 4BKLA 2FLBT 5HHOE 1A0QH 1KJVA 1M7DB 3HZMB 5E7FA 5CD3A 2ID5A 4YWGH 1FC1A 2E9IA 3QEQB 5CBAA 2LU4A 5D7SH 2B1AH 3EO1B 4GRLA 3IDNB 1OSPL 5GRWA 4N0CD 3MLYH 3BPOB 5C09B 3MO1A 3MRDB 4JO1L 2GIYA 5FCUL 4PLOB 5H2BA 2X89D 4NQED 4G43A 4LMQE 4EBQH 4D9LH 2D0FA 4QXWA 4PJ9A 5C3LD 1NCBL 2BSSA 4CN4A 1CICD 1JHLH 2JTDA 5C0DB 3WLBA 4G6KL 4OZGF 4G8FB 1KELH 3N1QC 5E7BA 4TNWF 5CCKH 4XPFH 1RVFL 3O8XA 2E6JA 2R0WH 1C5DB 3ARFA 5KOMC 1Y0LB 3TZVB 4J2XA 1CFSB 1JHTA 3A6BH 3BPOC 4JKPL 3UYRL 2HP4A 3ARBD 1AGCB 1JNLH 4LSVH 4MXVE 4FMFA 4OCWL 1QO3B 4ONHB 2GK0A 4YZFF 3U48A 4Z7VA 1WV7T 3OAYK 5D1QD 4H0HB 3L5WA 3MJ9L 4X5LA 1SM3L 5FHAL 3VXMA 3FKUS 5GGUA 5IF0A 1RSFA 2J8UE 4PV9B 2P42B 3T04D 4G7YL 3WS3B 2VC2L 4LSTH 3DX9A 2YEZB 2BOBB 5E8PA 3U79A 3BVNA 1PYWB 3AGVA 2UWEB 3C8HA 4G7VL 3TZVC 1S7TB 5A3ID 2OSLB 5D7JC 2VXQH 1A6UH 1I1FB 3SE8L 1IAIL 4I3RL 2OS7A 3UJIL 1YN7A 4XMLL 1ZVYA 1ZA3B 2QHLA 4OKVB 5JW5A 2DQJL 1UH2A 4BZ2L 5D1ZB 1RHHA 4I18A 4QRRA 1ZOXA 3FB5B 5TPWH 4EIGB 1OSZB 5D7LE 1Y6MR 1IAIM 1DUZB 4Y88A 3OKLB 1QPXA 1HYSC 2IJ0C 3TFKD 5KSAC 1IL1B 4HHAA 2WBKA 1FVCA 2R1WA 4GKSA 4IIQA 4X9BA 1GZPB 1YJDC 1ZHKB 4FXGB 3NFNA 1I85C 5F1KC 5I0DA 4K23H 5L8KB 4ZAKA 1VFAB 2FBOJ 3MRHA 5D1ZC 4WJ5A 3QZWA 2NX5A 3IFLH 3V52L 4JFZH 1IQWH 2G9HA 3VXOB 1N3NB 4P49A 2DI9A 4W81A 3FN0H 4K7PX 4QT5A 3G6JF 4KVCH 4KJQD 4KRPB 3RWDA 4QOKB 1QLEH 1XR9B 5IW1B 2B2XH 4RMTA 3MLWL 3PWLA 4S1SH 4HK3J 3VFSB 1N64L 1PX3A 4G80A 1G84A 1IEBB 1Q0XL 4FNLH 1OB1B 4JPIB 1FIEA 4PD4K 4FQXA 1RQ5A 3B43A 3S88L 2JB5H 4KHTL 3CH1A 4H1LA 4LK4A 3P4NB 1MCWW 4HIJA 5F89B 3BEVA 4NYLB 4OF7A 1DBMH 2XWBA 3KR3L 1INEL 2W9EH 4KRPC 5FM5M 1S7XA 2QEJA 1J88A 1FLRH 3MXWL 1PG7H 3G5XA 4EI5A 3OKDA 3W81A 4NQXB 4Y4KB 5DI8A 4LOUC 3NTCL 3VFUA 3ZDYE 1SVCP 2DQHL 2GT9A 4EN3B 1UZ8B 5I15H 5ITFA 5F97E 3RY5A 1A7QH 4BM7A 5IUSA 3X12B 2XZCH 5E5MB 1QOKA 3CC5A 4LAQL 2DLFL 5T3XD 4GSDL 4LARL 3ARZA 1MCHA 4XMPL 1AIFB 4LPTA 4F9LA 2ZP0T 2FIRT 4DK6A 4Y4KC 4ZFZA 1U8PA 2E27H 2EDTA 5I8EA 2J88H 1AO7A 2PTTB 3LN5B 3QQ9C 1S78D 4EN3C 4O58L 1JFQL 4DN3H 3RJDA 1RZIA 4OZGA 4R96B 4XC1H 2PXYB 1FVDA 5GPRA 5GGRA 4PD4J 4U6XA 4FS0A 5E8NA 4EXPX 4CDGC 1L7IL 3M17A 1U2CA 1RZGA 1IAKB 3ULUC 4G6ML 1IZJA 2VDNH 5KN5A 2GSIA 2NW2B 3RVWD 4HWBH 3ZSTA 1KXVC 3DURA 5IEKA 1CF8H 1GVIA 2EDFA 3MGAA 4LLUA 3WYRA 5KW9L 3VGEA 3T0VA 2PXYC 2QLVB 4ZYKB 4BSVB 4GKOA 1I7RA 3B2UC 4WHTB 4Y4FD 3OXSB 3MGOA 3WNKA 1EV2E 2ARWA 3KYOA 2DQGH 1E4XH 4QGTA 5FOBA 1GZQA 2CQVA 2W0FA 3ULVH 3QEQE 3MLTA 4WTZA 4TNVK 1FIGL 1HHJB 1YN6B 1NEZA 4DUXA 5C09E 4XNUH 4K55A 1I7ZA 4HS6B 1M71B 4JFOB 5LKNA 5FV2A 2BFVH 2MPAL 3P77A 1S9KC 3MRQA 2QHRH 4YHOL 1NUGA 2PNDA 3ILQC 2GSGA 3DIFB 2ADIA 4IDJL 4R7NB 4DCQA 3MV9A 2YUXA 2WUCH 3OKNB 5I2IA 2R1YB 2X2YA 4BFIB 4LKCB 15C8L 4GXUN 5ENWA 1WZ1L 2P5EB 5E08H 1AI1L 3A6CH 3UO1L 1BWMA 2YKLH 2P1YA 5F9OH 4K3DH 4H1LG 3EFDL 1P5UA 1IKNA 5I17A 1G6VK 3F7QA 1QSEB 4C56B 4U1IB 5K9KB 3MLSH 4Y19D 3N50A 2GTZB 1BAFH 1DDHB 5KJRH 4LLWA 2NR6D 3I3BA 3OHXA 3G9AB 3BUTA 4GKNA 4UILH 1UWGL 4EVNB 1X5KA 4YPJA 3X13B 4DOHB 4XPTL 2UWEE 4DGIH 2X4PA 2A73B 4JFPA 4M7LH 1NMCB 2B5IB 5HDBF 5C7XH 3QXVA 3BDXA 2WINA 1JTOA 2EDRA 4F2MB 3PIQA 5AWNH 4LLYB 3EOYG 1J18A 2CR6A 1GPOL 3MLPA 5HGAB 1U8JB 1RZJH 5ETUB 3U46A 2AJUH 3NMEA 3CFCL 5C3TA 3F5WA 3S37L 1J05A 4OQ1A 3V4VL 2F54E 2YUZA 1FNSL 4H25B 3IFOB 2Y4SA 2EDNA 3QUXD 1NMCC 3BO8A 2B5IC 2WK2A 2GTWA 4GS7B 2CMRL 2X40A 1P4IL 3QFDA 1PY4A 5JHDD 5EUOF 1L9MA 4DVRH 5DJXB 4MAYB 3SKOB 1A7OL 4D9QD 4KHXL 4R4FH 2DM3A 3FJTA 2CH8A 2J6EA 5T33H 3DRQB 4KI1A 2VZUA 2VLKA 2BHZA 3S35X 3ZYOA 1J12A 3W2DH 1WVZA 1CU4H 2ATPB 3QUMA 4GS7C 4WUUB 5ILTL 4C4KT 4KJWD 4Y8AA 3VFGH 4M5ZL 4MAYC 1TENA 3BT2H 1ZV5A 2Y23A 4U31A 3E8UH 4MQ7B 5DD0L 1T5WA 4MWFA 1NEZG 2XXCB 2NY2D 4LCWD 3RNQB 2ENSA 3PWPA 3UJJL 3CSYA 4M1DH 3IFPA 4GBXB 3V4UH 4NGHH 5M7QA 4ZFGH 4LBEA 2OI9B 4OJFL 3HG1B 5C0CB 3FO0L 2WW8A 1QACA 1QLRA 3KXFB 4Z7WB 1I1RA 4FQPA 5DHVB 1NGZB 2ADFL 3FFCA 3SDAD 1WBXB 3O6LL 2PN5A 4YK4B 4PJBF 4RMRA 3ZTNL 4HIEA 3LHPL 1KENL 1QQDB 4CN1A 4GBXC 4JN1L 3GIZL 2OI9C 1IC5H 3GBNL 4LSQL 4I2XB 4HXAH 1I7TB 1RIVH 3RTQB 5IV2A 4G9FB 1X4YA 3ULUE 4NZTH 1NAMB 2O93L 1LWRA 1PAMA 5DVKA 1EK3A 4JG0L 1AGFA 2GITA 3G08B 3QWRD 1PVHA 3NH7L 1CD9B 4YK4C 1G7IB 4Z95H 3ROOB 3P4LA 1XF3B 1LO0H 3NCYP 3MRFB 2AABL 2DQFB 2DKMA 4WI7A 4M43H 4U2YA 3RTQC 1E6JL 1J1PL 1R3IH 4TSAH 1GGIH 5SWSD 1T7WA 5I66B 2IANB 5IMMA 4QHNB 5T3ZE 1D7FA 2UUDK 2YN3A 2CXKA 4TUKL 1S5IH 4KI5C 3UBXB 2PTUA 3EJYC 1P2CA 3MROA 3QG6A 4WY7L 3JVGA 1CLOL 1IGIL 1FG9C 1MJ8H 3BH8B 4PRPB 2VLJA 5TF1H 1J1OH 2CK0L 3RWHA 1MCDA 1RJYB 1MELA 2ITCB 1OP3H 1DUYA 2UYLA 1L4IA 4QEGA 5F3BA 4KAQH 3ZE0F 5E2VH 2NXYB 3WEXB 1I3RB 4ODUB 4CUCA 1J5OH 1A6ZA 3ZDZE 1JZ7A 3FT3A 3LD8B 4P0DA 3WUWB 3KPNB 1XF2A 1JK8A 2UZXB 4CVZB 4M4PA 1KFAH 4P2QD 4GG8B 1U8LB 3ZLQC 2FEEL 2P5EE 4QCIB 3CFBB 2NXYC 5EUOA 5CJXA 2AJYH 4W4OA 5JNYA 2EDYA 3EYQD 2FSEA 4YNYA 3LD8C 2D3VA 1Z5LA 1M7XA 1QSEE 5IVZA 4C56E 1MFEL 2W60A 2FGWH 1HZHH 3VFRA 3LRSB 1J86A 5GJTL 1KCRH 4J12A 2EKJA 2R0KL 3EYSH 4Z78A 1CGTA 1OW0C 4KDTA 4TTDC 4LLDB 4X4ZA 3D0VA 3TEUA 1MCOL 2V9TA 2Z91B 3VXRB 3EYFB 3S98A 4DOHE 5FAAA 1RU9H 3VFWA 3ILPB 1IGFH 2D7QA 3K1DA 4Y8DC 3WFHA 4PG2A 3CJJA 1IT9L 1VDGA 2H1PL 3MFGB 1N6UA 4OLYH 1R0AL 1FL5A 4X6BA 4DKDC 1U8QA 3BP4B 1WFNA 1F3RB 4AL8H 1DR9A 3I85A 1I9JH 4L4VA 5EO9A 1CXIA 1XGRB 4ETYA 1NLDL 1J0HA 3V6ZA 1A3LL 1T7XA 2C3XA 1AR1C 1MWAB 3B2VH 4PPTA 3D85D 5KZCD 4KDWA 3ZSSA 5JIIA 3HE7B 3C5ZD 1IGYB 3ARQA 1M05B 1F3DH 1TDQA 3WS6A 4E41D 1H3UA 1C16B 1GIGL 1EEYA 3MLZH 4S1RL 1BOGA 3RIFF 5A43C 1YC7A 4NKDB 5CEYB 4PJBA 4PRAB 2YC1A 1HHKA 2VLMD 3BYYA 4DGVL 5E9DB 1IEAA 4JO3H 2ZOKB 4HIHB 4QNPE 2XKNA 3ZKQD 3QRGL 4KK8C 3GSUA 4WDIA 2EICA 3CVHA 4O5LL 5T3XL 2Q6WA 3HE7C 2HVJB 4QRQA 1DBJL 3RBGA 3UXFA 4OT1L 3QUZD 5HYSA 3MRJB 3IAPA 4W70A 1OLZA 1F11A 3FL7A 3JTSA 5C07A 4APQD 4DN4H 4I4WA 4MA3A 4PJFF 3CMOL 1FFOB 4R4BA 4S0SD 4TQEL 2HLFD 4I5BB 4WUUE 1IBGL 2NYYD 4G8EB 4AQ1B 1XF4A 3J7HA 4UQ3B 4FQ2H 2J7LA 1SYVB 4D94A 3GGWB 2FJGB 5T1DL 2Y07H 1TNMA 5L2KD 1FYTD 3UTSA 1T3FA 1U92A 2J6EL 2YD7A 4RAUB 3MV8A 3HG1E 3TJHC 3EYOB 2CXGA 4OGXH 5C0CE 4DFHA 1DCLA 3I50L 2VITA 1ZEAL 3ES6B 1N59B 4ZPTA 4K3JH 3S34L 3KXFE 4HWEL 4Z7WE 3MRRA 5EWIL 3ZT7A 1M6OA 3AXLA 3LV3B 5K9OB 4RMWA 3ULSB 3KNBB 3QUML 4F7MB 4ENEC 1AGEB 2EDQA 2C3GA 3OJDB 1QKZL 1URLA 3QH3B 5GJSH 4JFFD 4BH7B 4N5ED 1TITA 4Z77B 5CMAB 3DXAD 4I2XE 5IKCB 4G9FE 4AZ8A 1J11A 3B9KA 4U1HA 4FQQB 1F6AA 4IS6B 2AXHA 2RGSA 4H5SB 5L8JB 4AEIL 3KPQB 2AJXL 4NO3B 2HG5A 4YBHA 5ID0B 5FO9A 1T2QL 3NFSL 5HHNA 4PY7B 4KI5E 5IMLA 2YBRB 1EAJA 5HI4D 5ECJE 5CJBA 2AEIT 3GMQB 4GW4B 4NKOA 5DQDH 5E6ZA 5EN2A 1RMFH 3IGAB 2FD6L 3AREB 2J3SA 2G5BA 5ERWB 3F6LA 1IC4L 3E6FA 5DRNB 3BJ91 1AQDB 2IANE 4R90L 5GIRA 4NO0A 3RGVA 3GBMH 5IVXB 1R5VA 3CAFA 4XNQB 1IJ9A 5JQHC 1VFBB 1Z6JT 5DJ0A 4BYHA 1G6RL 3SKNB 4LVEA 3U1SL 3WFZA 4PRPE 5DK2B 1OAUH 2DL9A 2IEPA 2MCPH 3AREC 2FATL 3QJHB 3HTLX 5CEZL 1MJ7L 3KWWA 1CTNA 2A9ML 5T3ZH 3TT1H 1TVBB 2H6PB 4OGAD 1J8KA 4OLZH 4I13B 4HIXL 3RWIB 4WO4C 3LH2L 3RAJL 3D39A 1UB6A 2BSTA 3SCMA 1R24A 5HYSG 4LGRB 4AEFA 1NAKL 5H94B 1ODAA 1T1XB 1KCSH 3A6OA 3SDCD 4XHQA 1VEOA 1CL7H 2JLLA 1ZLVH 3DUSB 1JGLH 1ETZA 4C54A 3UTPE 5FB8A 4IOFC 3HZKB 1H3PH 1MCFA 3ALXA 2A6IB 3HC0A 1T0MB 3JWOL 5C0AB 3IU3B 1HINL 4OSUL 3SOBL 2DIAA 5JXEC 2OJZH 3WNMA 5ABDE 3PDOB 3PWJA 1ONQB 1YUHA 2P43B 4JRXD 2VDQH 5EU4B 5TFSL 4AENB 1R5WB 4PJFA 4XP1H 5C0IB 3S36L 3IKKA 3VXRE 2E9BA 1WIPA 1LEKA 3FHAA 4I8DA 4OZ4B 4OD1L 3ULVF 5L9DH 1CFQB 5KSVB 3FAXA 4KZEL 3G04A 4KROB 3BPLB 1AD9B 5CSZB 2FECI 2YSSB 4U05A 3KPSB 5T1MB 2BNQB 4R7DA