4TUOA

Crystal structure of monoclonal antibody against neuroblastoma associated antigen.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
214
structure length
205
Chain Sequence
EVQLLQSGPELEKPGASVMISCKASGSSFTGYNMNWVRQNIGKSLEWIGAIDPYYGGTSYNQKFKGRATLTVDKSSSTAYMHLKSLTSEDSAVYYCVSGMEYWGQGTSVTVSSAKTTAPSVYPLAPVCSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTWPSQSITCNVAHPASSTKVDKKIEPRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Heavy chain of monoclonal antibody against neuroblastoma ass
publication title Structural Basis of GD2 Ganglioside and Mimetic Peptide Recognition by 14G2a Antibody.
pubmed doi rcsb
source organism Mus musculus
total genus 42
structure length 205
sequence length 214
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4tuoA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4tuoA02
3AB0B 1U8MB 3U6RB 2IH3A 3DV4B 4QY8A 2ATKA 3CX2A 3S37H 1CDBA 3CGTA 4NN7B 4ODHL 1TQBB 2HJKA 4XP6H 4KQ3L 3NIGE 4UMGA 4Q74A 3OKDA 1HH9B 2OTPA 2IADA 4P3CL 4Z76A 3CVHL 5JZ7C 1HKFA 3CXDL 4HUNB 4PG2A 2PYED 1QA9A 4KUZL 5KSAD 4K7FB 2D4DA 1IGYB 1RURL 5JMOC 4PLJD 1U3HC 4J3TA 4U3HA 4AM0B 5BVPH 5LXGH 1YN7B 1LK2B 5ITBL 5DD3L 2PXYB 3KJ6H 2YMXL 3HS0A 2BNRB 1UZ6F 4XB8A 4XNQB 3UTSB 5CD3A 3I75A 1HXMB 3TJHC 3ZT5A 4M93B 4I3GA 2JELH 3ROOB 2AJ3B 1MIEH 3WFDL 3QRFM 3QEGH 5KJRH 5I0DA 5C9KA 1ZLUH 5GGSY 5DD1H 1OGAD 1Q1JH 4PJCF 4X6EB 4XVUC 1ZHNB 4V1DD 5L2KA 2VH5H 3VFSB 4P5MA 2NY6B 4WTZG 2WP3O 4UIMB 2R1XA 3K81A 5DMIL 1UXWA 3IU4H 3HC4L 3BHBA 2M26A 3KDMB 1OY3B 4U7KA 2E9BA 3PGCB 4JO4L 4P4RB 2P24B 1B2WL 3A6BH 1NCCL 3BFOA 4YBHA 3BEVB 2DTSA 4DAGH 4K23H 4X4ZA 5IBUB 3ZKSD 2EH8L 4OFPA 3EOTL 4FQQB 4NZJA 1CGSL 4JG1H 2G75A 3QQ3B 3EHBC 2NW3A 1ZS8B 3H9SB 5C09A 2EEBA 5I1CL 3LKRB 4HUVB 3O3DB 4JDVB 1DBBH 4WI3A 1XEDA 5ENWA 4OCSL 2GJ6E 2I9TB 4JZOA 4E41D 3VXOB 3BQUC 1EVTC 3Q0HA 4O2CA 2DQGH 3C5ZC 1INQA 2UWEB 1BOGB 5F6HI 1CT8B 3MGTB 3IKKA 2ZUUA 4ODUB 2R1WA 4RIRA 1NAMA 4GW5A 1FYTD 3OKNB 1PBYA 5IF0A 1X44A 3ZO0A 1I9JH 2LAGB 1PYWB 3H42H 3SGEH 2AGJL 4NFDA 4F7TA 1F58L 1T89A 3EUUA 3EOAB 3VG9C 1WT5A 3B5GA 1C08B 1NFIB 2QADD 2P4AB 1DQLH 1ZT1B 3DTXB 3LVEA 5JIIA 2VLRB 3ZE0E 4LCUA 4HWEH 5DJDB 4HZLB 2VERN 5J3HC 3RDTA 3D3VA 1ACYL 2DF3A 3TO4D 3TN0D 1NDGB 3FRPG 3QFJB 5C0CD 4P0DA 4K3DL 3UYPA 5D6CB 4S2SA 3VGDA 3F65A 1AD0A 4TNVK 2KH2B 3S3JA 5K9OA 3HC3L 2F8OA 3D25A 3DYOA 3NTCL 3BP6B 1FBIH 3JTSA 2XN9B 1UWXK 1I8MB 4OV6F 1CICB 4OCYH 3HN3A 3UMTA 1T7ZA 4U7MA 1IBGH 1NCWL 5BJTB 1RUQL 3RTQC 1BQLL 2EDHA 4JFZL 2DIAA 4WFHE 1A64A 1CDJA 4MCYA 5J1SC 1TJGL 1U8QA 4IOSD 5MEPA 5HGHA 2IPKA 2NZ9D 3VGHA 3MRQB 3ZT6A 4N0YH 1FZOB 4JZJB 5L88L 1T1WB 3AS1A 1KCSH 1XF5B 3REVB 1DN2A 1CLYL 2OL3A 4JGMA 5IHLB 2DLHA 5J6HA 5F1KC 3O2WH 4JG0H 3N1MC 5J9PB 4M4PA 2B0SL 5SWSA 1A6UL 2Y06H 3TH4T 3RZCA 3IXAA 4U0RB 5TGBB 1YNKH 1CIUA 3VXSA 4G80A 3STLB 2OMNA 3T1FA 4FQPA 1KJMB 1Y6MR 4DZ8A 1IFHL 2B4CL 1HQ4A 3HUJA 3LQAL 2A9ML 1C5CL 5IKCA 1CD8A 1F3JA 4K07A 3V4VH 5F6IB 2I24N 4H20L 5H2BA 5HGDB 4LLYA 2APTA 3O6LL 2M8XA 1PG7L 4OD2A 4HH8A 1MRDL 5HHMB 5GPRA 3GGWA 2VDMH 4ZUWA 2ICWI 3IKCB 2IANE 5IEHB 2FX9L 3QZWA 4UILL 2V7HA 5IVZA 2IAMC 3BIBX 3EO1B 1MCIA 3AAZA 4NZUH 5C07E 1KT2A 1FGNL 1OAKL 3D1MC 3HI1B 3UTPE 3QEUA 3BWAA 4MNQD 1UH3A 1MCWM 1ZTXL 3NIGF 5B38G 5KAQF 4WUUD 1N59A 4WI5A 1JWSA 2YUZA 2AEPL 4Q9QL 1J05B 4QOKB 2VUOA 4WI4A 2DKMA 2IBZY 3RVWD 1SY6H 5DT1H 3GSRA 1MWAH 4R7DB 3MNWB 1U8MA 3U6RA 3KLHD 3DV4A 4X5XB 3RWFB 1ZT7B 1NQBA 4L3ED 4LQ1A 4K3HA 1NFKA 1ADQH 4P59L 1WGOA 3U4EB 5HHPA 3L3DA 4LARH 4OZHB 1QPXA 2FGWL 5GGVH 2VN4A 4XPGL 4IRJD 1CVSC 1UJ3B 4JVPA 1PY4A 3GHEH 3TO2B 1JF5A 4UB0L 1X4ZA 4P5KB 1T66D 1T7WA 5I1KH 5CJQL 2AJYL 1NAML 4LDOB 4OGYL 4LVNB 4K7FA 4M7LH 1IGYA 1IKFH 1CU4L 5F7EH 2A2QT 4AM0A 4BK5A 1F13A 1LK2A 4QCIA 3VW3H 5ELIA 2PXYA 5JUEH 1NEZG 2BNRA 3UTSA 4FFVD 1GGCH 4XNQA 5C6PB 1F90L 1HXMA 1IGMH 2QTEA 3SDAD 5FGRA 5LCVH 1RV6X 4ETQB 2ITCA 2LV4A 2AJ3A 4JY6B 1MAMH 1KCRL 5GGSB 2C1PB 3HC0B 2HFEA 2WWMD 5CILL 4MXVE 4DKFL 1K4CA 4X6EA 1DUZA 4MB4A 2W9LA 1ZHNA 2CIIA 1C16B 1YEFL 5I71C 3VFSA 1N6QL 4LASL 5CBEB 4UIMA 5GIRB 1WAAF 2CUIA 1NCTA 1RZ8B 3KDMA 3E3QC 3PGCA 3I6LE 1F4XL 1YECL 3CLFH 1IM9B 3FZUC 2P24A 4MAUH 5DJ8B 3WLWD 3IDXL 4XHJC 3BEVA 5BRZD 4QRUB 4IOIB 4CRPA 3L9RB 4L4TE 1AD9A 4FQQA 4FQXD 2NXZC 3LEXB 3CH1B 3JVGA 3QQ3A 1B4RA 5MHSE 3VFGL 3H9SA 3LKRA 4HUVA 4JDVA 1ZHKA 1SJHB 3UROR 3ULUE 5C0EB 2I9TA 4E9LA 1EK3A 4DQOL 4A6YB 4ODHH 1PQZB 5D93B 2OL3L 5B8CC 5MENA 5KZCD 2UWEA 1F6AB 1BOGA 3WD5H 4R2GB 1CT8A 3MGTA 5A3IC 2EEAA 3L3OB 4KQ3H 4QRTA 1UT9A 4KXZI 4G6FB 2WP3T 1MHEB 4P5TD 3TC9A 2WBJD 3CVHH 1LILA 3QIBC 4UT7H 3B6SB 2EE2A 1RURH 2DLEA 4XPBL 4P4KB 5BO1H 5ITBH 1D5IL 1NFIA 2XTJB 3UTOA 5DD3H 1ZT1A 2YMXH 3DTXA 5I1AB 2VLRA 2DBLL 5DJDA 4LSVH 2IFGA 4Y16B 2YPLB 4I3RL 5T3ZE 4AIZB 3WFDH 5EOTB 1HQRB 1CWVA 1FFPA 3QFJA 3QIWD 3QEHB 2CLRB 2KZWA 5D6CA 4OUOA 4PRHE 3LH2L 3IU3B 2OMBA 3DRTB 1ITCA 1Q9LB 5GGRY 4WI2A 2AXHA 3BP6A 3CK0L 4OQTA 2XN9A 3HC4H 3CFBB 3WIIH 4K8RD 1CICA 5HHOE 2XTLA 4WWKC 1IARB 4XI5D 5BJTA 2DJUA 1FQ9C 4WFFD 5GRUL 2A6IB 1IL1A 4HGKC 3MRQA 1FZOA 1CGSH 1RIHL 2YPVL 4JZJA 5CMAB 1Q9OB 3OMZA 4ZO6A 4JFHE 5IJKA 5I1CH 4LKCB 2CKBB 4F57L 4U1JB 4OCSH 4WHYH 3MOAL 2X9YA 1J88A 5J9PA 3PF2A 1RZIB 3H7BB 2GIYA 4GRWB 3RPKA 3QUMH 3W0WE 1GGBH 1MCHA 5JQ6L 5TGBA 3TEUA 3STLA 3U82B 1IQWL 5IW3A 3ARBB 4Y4HD 3OKMB 1VGEL 2AGJH 5E95B 4W4NA 2FECI 3KHQA 1F58H 3CXHK 3EJYD 2RGSA 3MV9E 3SGDH 4CMHB 5D2NE 1YA5A 4B53A 4R26L 3GSQB 2AERT 5TFSL 5HGDA 1NUDA 1B6DA 3QCTL 4TTGA 4KKCC 5EUKB 3WMSA 3DMMD 3WXVL 2DKSA 4FMKA 4K3DH 3MLPA 4MAYC 3IKCA 4MNGA 1NCAH 1UM4L 3HC3H 4ZMAT 4DVBB 3NTCH 5J12C 2HA1A 4OCLC 3JV5A 3OQ3B 1DN0B 3N1PC 4L5FL 3N50A 1OSPL 2NY2B 1NCWH 3PWPE 4RFOH 4XMPL 1RUQH 1BQLH 4JFZH 3IVKB 4YDLC 2ZJSH 5M95B 2DYPD 1BD2E 4XH2B 3UBXI 4BQBA 4ZNEA 4UZGA 3NGBC 5L88H 4KRPB 2BSRA 4K7PX 4J4PA 5MEQB 3DGCR 3GKWH 1CLYH 4KK5D 3VG0L 3OAUL 4J3OC 2DQUH 4XVJL 4PJFB 4R7DA 3MNWA 3Q2CA 4TSBL 3TFKD 4X5XA 1NBZB 3U9UB 1OW0A 3RWFA 1MRCL 1ZT7A 4KZEL 5J56B 3PV6B 1II4E 5F1SA 1WFUA 3BRFA 1CDGA 3U4EA 1S78D 1A6UH 4OZHA 4NM4L 1KYOJ 5FAAA 2XXMB 3GSWA 4O58L 5E9DD 1KTDB 4EUPA 1S7VB 4PJ9C 1UJ3A 1NCDL 2FH6A 3G5VB 4MXVF 3FQTB 5CUSH 3TO2A 1A0QL 1U8PA 2VLME 2B4CH 4P5KA 5KSVB 3MLSL 1KCUL 5F7MC 5JHDE 5C0AB 5H37G 4XMKL 4P99A 3EO9L 5T5NG 2A9MH 1C5CH 4X7DC 4WO4C 3MACL 4CVXB 5T1LD 4KDTA 4NJAL 3UP1A 1J0ZA 5JMRA 4H20H 4W81A 3C09C 4AQOA 1UCBL 4I9WE 4RQQB 3SKMB 3EJZD 3O6LH 2ZKHH 4GT7A 4LLVA 3CMOL 4ETQA 1PG7H 1MRDH 2QL1A 3FOMB 3VWKA 4QGTA 2V5RA 3F62A 3IGAB 4JY6A 5GGSA 2W60B 2C1PA 4POUB 3HC0A 2H2PC 2VDNL 3T0BA 3S88L 2RAMA 1IGIL 4UILH 3MRGB 1INEH 2NY0D 3ULUF 5GIRA 2X9WA 4PJXE 5JW3L 2VXVH 2W0FB 1RZ8A 1FGNH 5D7JD 5I1DB 1UH2A 2X4UB 3FQUB 1IM9A 2GK2A 4Z0XB 5DJ8A 5D7LB 3MO1B 1ZTXH 4QRUA 2YK1H 4IOIA 3D18B 4R4ND 4ACPA 3L9RA 3VGAB 5TQ2H 1KCLA 3LEXA 3ARFB 4Q9QH 4CDGC 3CH1A 2HMIC 4Z8FL 4NGHH 4ZFFB 3DUUB 2CO7B 2DI8A 3NA9L 1F3DJ 5T33L 1SJHA 5C0EA 5CZXD 1UENA 4A6YA 3MRDB 4P59H 3DURB 3V7AE 2VITB 1F6AA 4PJEB 4WVRA 3L3OA 4XPGH 2SEBA 3ZT7A 1J1XL 4N0FB 2R4RL 2G9HB 2EXWD 1MHEA 5F9OH 4MDJB 4UB0H 4BZYA 5CJQH 2AJYH 1NAMH 3BRDA 4OGYH 1LO4H 3B6SA 4JO1L 1CL7I 1CU4H 5BZDB 1NGWB 2E7CA 4PGBB 4P4KA 4YHKH 4OZIE 1OP5K 5I1AA 4X5LA 4OLXH 4U1GB 1F90H 5FM5M 1U8IB 1S9KC 5I74C 4XCFL 1TXKA 3G6AA 2YPLA 4D8PA 4AIZA 5EOTA 3MLUL 2OI9C 1ZLWK 1HQRA 3T08A 1KCRH 1D6VL 4LCWE 5DMKB 3SCMC 2PTTB 3QEHA 2CLRA 4JFEB 5CILH 4DKFH 3ARDD 4WFHD 2XYCA 1T3FB 4DN3H 3IU3A 3DRTA 1YEFH 4TUKL 1NL0L 1N6QH 3L5JA 2F8XC 4K9EH 1KTRL 3CFBA 3VE0B 3WXWL 3KPSA 4BUHA 2NZIA 4OF8A 3IDXH 3KPNB 4LFHD 4R7NB 4Y89A 3AS2A 4PLNC 1FZKA 5DC0A 4YDIL 5GZND 3ZKNC 1HSBB 4XXCA 5CMAA 1Q9OA 4KJQD 3W2DL 3O8XB 3NACL 1Z9LA 3VFGH 4PJDF 4LKCA 4KV5F 2CKBA 1ACZA 1K85A 3DHMA 4U1JA 2YZ1A 1G1CA 3QDJE 2BNQE 4DVRL 3RUGE 1ZHLA 3A6OA 4YPGB 2CLVA 2OL3H 1RZIA 2R2EB 4JKMA 4MJ5B 2BJML 4ZO9A 3HI6L 4RAUB 1OAUH 1BX2A 2L7UA 2VDLL 2FJFB 3S36L 3ARBA 3OKMA 1RULL 2B4CC 4IJ3B 3QQ9C 4RMQA 4XPBH 4IHOB 5HHVL 3LQAC 3B83A 1A6VL 3GSQA 2IAND 2DBLH 2EIEA 4HKJB 3TYGH 3P0VL 4ZFZB 2A38A 2VYRE 5EUKA 4MX7A 1S7SB 4I3RH 4N1EA 3MUJA 5C07D 3UTPD 4UT9H 5GS1B 4KZDL 4C57C 3KR3L 2GJ6B 4Z6AT 4DVBA 4XPFL 5I1GL 3CK0H 2V5TA 2JB6B 4R97B 1DN0A 3B8YA 5FV1L 1CDUA 4JKPL 2D03L 2VR5A 3VU2A 2Z31B 1FIGL 5I19L 3PUCA 4KRLB 3IVKA 3DSNA 1JGUL 4NRXA 5GRUH 4XH2A 1CXIA 4BH8B 5I75C 4IRSA 2XT1B 4YGAB 5MEQA 4Y2DB 3NCYP 2EE3A 1KB9K 4N0UB 3BN9D 4F57H 4Q97A 1X5XA 2YXMA 4NQSB 4PJIF 4TSCL 4PJFA 1NBZA 3U9UA 3LDBB 2V9RA 3VWJB 3DRQB 2I07A 5C9JA 3IDYC 2GSGB 1FDLL 3SKUD 5EH1A 4UOW0 4A6YL 1S7VA 1CGVA 3WL9A 1ZOXA 2LAAA 4HWBA 3G5VA 1S5HA 1TQCC 2DQJL 4JY5H 1SVCP 1UA6H 3FQTA 3NZHL 1VGEH 3RHWK 1E4XH 1LO0L 1T22A 4S11A 5KSVA 5HYJE 2OM5A 3L7FA 2DLFL 5C0AA 4RWYL 3KPQB 3IAQA 4TOYL 4ZUTA 2H2SD 1MAJA 2JIXD 4R4FH 2UZXB 1U91B 3QULB 2XV6B 4CVXA 4B7IA 4CU7A 2DD8L 1IRAY 2DLGA 4KJPC 4RQQA 5D1XA 3SKMA 2X1PA 5I8OL 5D9SB 1K4DB 3VFVB 1UB5B 3HLAB 3VMPA 3FOMA 4D9RD 4NFBA 3IGAA 5FXCH 3S37X 3I6LD 2W60A 3UTQB 5IROC 5DI8B 1K5NB 5JXEC 1A7NL 2XZAL 1KIQB 3T1WA 1UM4H 1KLUB 3MRGA 4DGIL 1CXKA 5T3XE 1NUFA 1A6PA 2BVQB 4Z7NE 5FYJH 4JRXE 3SQOL 3BYYA 4L5FH 3MYZA 5EZJB 3DUHA 3SGJA 1OSPH 3P73B 4XTRD 5MHSD 2K1MA 2X4UA 1U3ZA 2WUBH 3FQUA 4AH2A 4S1QL 3MO1A 3ULUD 3C9NB 3SE8L 1CE6B 3D18A 1CG9B 1KB5B 4AL8L 3F7QA 2QSCL 4HUUB 3GNML 3ARFA 3E0GA 3TNNB 1NAKL 5EIIA 4I0PB 4MA7H 4HSQA 4PJAB 2VL4A 1JFQL 3DUUA 3VG0H 3OAUH 5EOQL 1HZHL 3AC0A 4XVJH 5BS0B 5C0RL 4TSBH 4DTGH 5TJWK 4ZOEA 1MRCH 4KZEH 3MRDA 3DURA 2X70B 1QSFB 2VITA 3FMGH 2PKDA 4NM4H 4PJEA 4O58H 4DGYL 4JDZB 5C7XH 1PLGL 3RWIB 4N0FA 1E6OH 2P45B 3BO8B 2G9HA 1FFOB 1PD6A 1A0QH 2J8UE 4MDJA 3FKUS 5EUOE 3MLSH 3C2AH 5T3ZD 3TWCL 2G60H 3EO9H 3PHSA 1UWGL 3LB6C 5BZDA 1NGWA 4PGBA 5C0BE 6FABL 1TCRB 3OL2A 4NJAH 3ZHKA 1EXUA 3QRGH 5DRWB 4HCRL 4X83A 3RWCA 3FL7A 3RGVB 3QUYC 4PRNB 2OR9H 3ZKXC 2WUCL 3BP4B 5HHOD 4YFLI 4GRLA 4G8IB 1NANH 2PTTA 4WDIB 2VDNH 4JFEA 4C4KT 1JV5B 1T3FA 5GGRA 25C8L 2XKNB 4YQXL 5FUOL 4FFWC 3SPVB 4PRAA 4MD5B 5JW3H 1WFTA 3WUWA 4POYA 3MRIB 3MOQA 3VE0A 4JFHD 1JHLL 2XY1A 2APVA 4JR9L 3MC0A 4OQTH 4Y4KD 1AO7E 4R7NA 2V5MA 1KJ2A 5AAWA 1OM3H 5DO2D 3TPKA 3DBXB 4G9FE 3C2SA 2LU7A 1HSBA 3G5XB 5HVHC 5I1LA 3W0WD 1OP3H 3BGAA 4JFXA 1ED3B 3O8XA 3T65B 1EHLH 1YQVL 2KUTA 4JEGB 2HLFC 2YD1A 3NA9H 4Z95L 5GXBB 5T33H 2D0FA 1A4KB 1QSZA 4YPGA 5HXMA 1T6WA 3MV9D 4RGNE 2R2EA 2DQTL 3SBWA 3EDEA 1NGZB 2H26B 4RAUA 1PW3A 3C6LB 2R4RH 1TQBC 1JGVH 1U41A 2FJFA 4U49A 1JF1B 4LEXL 3GIVB 3PIQB 4XVSH 4HUMB 4JO1H 4XNYH 2BOCA 1A3QA 1IAIL 4IHOA 3O6FC 3OHXB 4EN3A 1OT2A 5SX4H 5MEOB 1BWWA 4XC1L 3RWGA 4UDUB 4X5WB 5D1QB 4RMVA 4L4TB 1QEWB 1TZGH 1C12A 4HIJA 1S7SA 1U8HA 3MLUH 1D6VH 3HE7C 1RU9L 1XIWA 1ZA6B 1UCTA 3U2SA 5GS1A 5EU3B 5C2BL 4HK0A 4NUJB 4J12A 5IJVB 3MGAA 1WTLA 4M93C 3IF1B 4YBQC 3VGGA 4TUKH 1NL0H 3WIHL 4NKQB 4UTBL 2JB6A 1TVDA 4ODTL 3WXWH 1MCCA 5IVXE 5ECJE 1JMXA 1JGDB 1LO3L 1VFUA 1G7JA 3L7EB 4JFFA 3NPSB 2Z31A 1RUAL 1SJVA 2NY6C 4LSPL 3RVTC 2NX5D 4YHYB 5C86A 2CUMA 2QQLH 4LPYA 4YBLC 4BH8A 2C4FU 4JANA 1JTPA 3ESVF 5I1JH 1FORH 3DVFA 3W2DH 2CUHA 3WHXB 1G84A 4Y2DA 4N0UA 1J8HE 1OARH 4BQCA 2ZOKA 1SVZA 4NQSA 4TTDC 1FV1B 2VLMD 4U3CA 2VE6B 3FQNB 5JHDD 4PLKC 5EORL 2APWA 3VWJA 3DRQA 2BOBB 4FNLH 2C7UB 2C4XA 2GSGA 3TZVD 5F7NC 3ZKQD 5IEKB 4ORGB 1OSZB 4PRHB 4KKAC 2DMCA 4HFUL 1LO5B 1XZ0B 2VDLH 4I9WD 4U6TA 2YS4A 3WBDA 1QZ1A 4GAGH 1QFWI 2YA1A 1L0XA 5HJ3B 2VXUL 1RULH 1A3LL 4ELMF 3MLWL 4EUPH 3U0TB 1WUNT 5DURB 3UJTL 3BPLC 3KPQA 1I9IH 5HHVH 4JHAH 3CPLB 1U91A 4TVPH 2EC9U 5E99L 3P0VH 2AJVH 5D9SA 1K4DA 5IMLB 2OTWB 3VFVA 1UB5A 2E5EA 3HLAA 1CFNB 1T7YA 4D2NA 2ZCLL 5EBWA 5IQ7L 3UTQA 1A14H 4KZDH 3KR3H 2R29L 5E0QA 1KIQA 4WV1B 1KLUA 4OJFH 4XPFH 1MI5E 2BVQA 4O02L 3D0LA 1F4WL 3OJMB 3N1FC 5EZJA 1A7PL 2D03H 4CGTA 3P73A 4PB9L 5CEYB 3E2HC 1FIGH 5I19H 3BPNB 3WFBH 1X5ZA 3P30H 2E8YA 3C9NA 3RL2B 3KYAA 1EFXB 3X3FH 1FNFA 1CE6A 1MCNA 3HMXA 4NZTH 4UNTA 1CICC 3N06B 5A16B 1CG9A 3SDCD 1KB5A 3I9GL 4HUUA 2J8UF 5EUOF 3TNNA 1JRHL 1KJ2L 3QEQA 5F9JB 4I0PA 5AG9A 4CVZB 2J5LB 5B4MC 4PJAA 4BM7A 2N7BA 3N9GH 3K2MC 4TSCH 5BS0A 4JZJC 5A2LH 4U4BA 3MLTB 2JJSC 4OAWB 2O5YL 3W5NA 4GBXC 4J6RH 3R0NA 5EU7C 1QSFA 1ORSB 1FDLH 5KVDL 1YNTB 1D6EB 5CSZB 1EIBA 3BIKB 5K9QI 4JDZA 4A6YH 1N8ZB 3OKEB 3DNKA 4FOMA 4FS0A 1GAFL 3RWIA 2RR3A 2DQJH 3BRGC 3MJ7A 3A0OA 1YJDL 3BO8A 4KK9D 2DQCL 1CLOL 1FL5B 1FFOA 2P43B 3IFNL 4ZODA 4RWYH 2VISB 1JZ6A 3IYLW 2B5IC 1J18A 4HIXL 2C3XA 1P84K 1TCRA 4GFTB 4FQCH 4NQVB 2ITDB 5DRWA 4LU5L 3WEXA 3ARRA 4PRNA 4XX1G 5BXFB 3MCKB 5EU5B 1UM5L 1AGBB 1BHGA 5DR5L 3M8OL 4G8IA 3BW9A 4WDIA 1BVZA 5HHQB 2DQFB 2E7MA 2DQDH 1JV5A 1LEGB 5JW4M 5DMJB 4OCWL 3RPIB 4HGWB 2XKNA 3DI2B 4DGIH 2NXYC 4PTUB 4WFEE 3SPVA 2K7PA 3SQOH 1UM6L 5MERA 2B7DT 4OGZA 1T20B 2B8OT 3NIDF 1NMBL 3QDJD 2BNQD 3V6OE 3QPQC 4ALAH 1YEJL 3DBXA 4P3DB 3KLSA 3GIZH 3GNMH 3G5XA 4G7VL 2NY4C 1NAKH 4HS6B 1ED3A 3T65A 1FH5H 4QHNB 1ITBB 4K94H 2FGZA 1WLHA 5EOQH 1HZHH 3QI9B 5C0RH 3DHJA 4TNWK 3TGXA 4DCQB 3QUZB 3T77B 5ID0B 4URTB 2NMSA 2CKBH 3LV3A 35C8H 2Z91B 2X5PA 5B22A 2DKUA 4DGYH 3U1SH 1KN2L 1HXYA 3C5SB 3MRKB 4EZMA 3JWOL 1NGZA 1PLGH 2H26A 3C6LA 2X1QA 2BVEA 2F5AL 4GRWH 4O2EB 1JF1A 1YNLL 2W59A 3PIQA 3CNKA 4D0DB 4PJXB 3OXSB 4M1CD 5KS9A 1UWGH 1UJ3C 4LLDA 5J13C 3MLRL 1A7OL 2OYPA 4U6YB 3OHXA 6FABH 5IVXF 4U1SB 1HWHB 4X5WA 3NN8B 1CFSB 1WCBB 1QEWA 3V52L 1DVFB 2WUCH 1FG9C 3H3PL 1T2XA 4PRPB 3T8XB 4KDTC 5GRJH 1MQKL 1AKJD 1ZA6A 4S1DC 5M94B 4OF0A 2KPNA 5EU3A 2OLDA 4NUJA 25C8H 5ESAA 2C4FT 3IF1A 3LOWA 3VWKC 4YQXH 1A9BB 1X5JA 4EI5D 4BSWB 1T5WB 2JK5B 4UOJA 5LQBL 3D69B 1KFAL 2DS4A 3GM8A 1JHLH 5GGUB 1JGDA 3L7EA 3HPJB 3I85A 4Y4FC 3LPFA 3PP4L 2DQIH 4IRZL 1MH5B 4LCYB 1JPSH 4HJ0C 3CVIL 3WHXA 1YQVH 4JFDE 4L8SB 3BYTA 3HMXL 1QBAA 3ECBA 3OB0H 1KB5L 1UFUA 3WNPA 1ORQA 2VSCA 3QIUD 3GMQB 5C0ND 1FV1A 3QXUA 2VE6A 3FQNA 4JZNB 5HYJD 2CKNA 1FO0B 2BOBA 2QSTA 4LCWB 3ME0A 2EC9T 2C7UA 3MZTA 1KTLB 2V7NA 2DQTH 8CGTA 5IEKA 4ORGA 1OSZA 2NW2B 3BJLA 1EZVY 1LO5A 1XZ0A 1LHZA 1LDPL 4LEXH 3D39E 2VDOL 2V2TB 5HJ3A 2MCPL 3U0TA 4DOHE 4NKMB 4HWBH 1JHKH 1IAIH 1XGTA 4QTIL 3CPLA 2PR4L 4O5LL 5D70L 4XC1H 4G6KH 5D7IE 1GSMA 4G8GB 1V8HA 5FYKL 4RMWA 4HHAB 5IMLA 2AQ3A 1N64L 2OTWA 4JRXD 1V5JA 1CFNA 1QSEA 2XTJC 5F9WC 4FFYL 4D0BB 1R0AL 2X4NB 3S4SB 3WN5B 4IEFB 5JW4Q 3QXWA 2I9LB 4KKLC 1CL7H 2Y6SC 2AJZB 5C2BH 2E7LA 3DX8B 1CDHA 3BX7C 4L8CB 1BEYL 4WV1A 5DUML 4Z77B 4F3FB 1FNGB 1L7IL 5HGAB 3RNQB 3TBYB 3L6FB 4ODTH 3IDGB 3OGOE 5LKNA 5EU6E 1I1YB 1KCVL 5CEYA 1RUAH 5L8KB 1E4JA 4LSPH 3B9VA 2Q87A 4ZOAA 2D31B 5IP4A 1EFXA 2PNDA 3B43A 5D1ZB 3D87B 2UY7A 5A16A 3MV8D 4KROD 1U6AL 5DFVC 3CD4A 5FV2A 3MXVL 3BPOB 4LP4A 1KPVB 5F9JA 1AXIB 3ZHLA 1ZAGA 5JORB 1A7BA 4GG6F 3KYNB 4XXCC 3MLTA 1HKLL 1DANU 4OAWA 5EORH 1NMAL 1FFNB 3C60B 2FIRT 3QG6B 5CJXA 3L5HA 3EFFA 4MNQB 5FYLL 1OWRM 4DEPC 1YNTA 1D6EA 3CXHJ 5CSZA 3BIKA 4PJ7E 1Z0MA 4ZFOB 4R0LC 1N8ZA 4HFUH 5D2LB 2NY1D 3B2UD 1FL5A 2UVEA 2VXUH 1OTSD 4OM0L 1A3LH 3ULVH 2Y4SA 3MLWH 4ZUUB 5KSBE 1DUYB 2VISA 3KYOA 3ZYOA 5HDQL 1GHFL 1F3RB 3C5JB 4Q2ZB 3ARBC 5JNYA 1J87A 4NQVA 3B2VL 4NHCL 1FJ1B 2ZG2A 3BD3A 4JPKH 1EJOL 5E99H 5L8JB 2K3TA 4LOUC 4N9OB 5BXFA 1DEDA 1VEMA 5HGBB 3MCKA 5EU5A 1AGBA 3O2DA 3TT3L 2ZCLH 3D2UD 5IQ7H 1CK0L 2QKIA 4TYUA 3B9KB 1AO7D 2DQFA 1GYAA 5E6ID 3PJSB 1LEGA 2H32B 2JJUA 1D9KD 2PYEA 5DGQA 3RPIA 5CD5D 2HT2C 4ZYKB 4G9FD 4PTUA 1YYLH 1E4KC 3IS0X 4DK3A 2DLIA 4U6VH 1F4WH 3H0TB 3QWQB 4KDWA 4PB9H 2JCCA 2FJHB 1BJ1J 1T20A 3QO1B 4N1HB 4OIIL 2FSEB 1JE6A 4P3DA 3UPRA 5JA8B 3I9GH 4RGND 4BKLB 3DXAE 5E2TL 3VRJB 2JLLA 1JRHH 1KJ2H 1TLKA 4HS6A 3VXUE 1BQHG 4LMQE 4QHNA 3ARYA 5DA4A 4RMUA 5INCB 4IRSC 3QI9A 2EDDA 2I60L 2O5YH 4DCQA 4CNIA 3MV7E 5ID0A 4MWFA 4G9DB 5BW7C 2Z91A 4KY1H 2BVTA 5ANME 1RZJH 2YUXA 2P5EB 1SHMA 3C5SA 3IFPB 3V4PH 3UJJL 1I7RA 1B0RB 1CLOH 2DQCH 2D7MA 2CLZB 1Y18B 4O2EA 2MQ3A 4D0DA 3OXSA 2FL5B 3ZSSA 4HIXH 4JHZA 4QHMB 4U6YA 4OZFB 4YHML 3MGOB 4U1SA 1MUJB 4WTWA 3GUTB 1JK8B 5EBMB 1T1XB 4C56E 3MJ8B 5FA3B 3VXME 1F8TL 1WCBA 4APQC 2I25N 5DJYA 1DVFA 2NLJB 1UM5H 1LO2H 4PRPA 3T8XA 3EYUL 5DR5H 3M8OH 5IESL 4N8PA 4IIQC 5D1XC 3ARGB 1UC6A 1I3GL 1D5MB 3F7RA 3QNXB 3DLQR 5HD8D 4MS8D 2R2CA 4A2LA 1A9BA 3OAYH 1J0HA 4BSWA 1T5WA 2JK5A 1EAJA 3D69A 1UM6H 1TVBA 4P46C 1KTKE 4KK6C 5GGUA 2VZTA 1MF2L 3MRCA 3HPJA 4F15C 3TN0A 1YEJH 5HI5C 4MSWB 3QIWB 5C0CA 5FK9B 1MH5A 3DVGB 4LCYA 4O51B 4G7VH 4PJBF 3SKNB 5L9DL 2PW1B 5C0BB 4L8SA 1BQSA 1TITA 2ILLA 3N1GC 3FT2B 2YZ8A 5DJ6B 3E1F1 1ODAA 3GMQA 3UTZB 1I1AD 3SO3C 4JZNA 5D7IF 1FO0A 1ZA3B 3QWOB 1CQYA 1J1PL 1KTLA 4X0KB 1OTTC 1KN2H 3JWOH 5SWQB 2ZUXA 1HINL 3WNLA 4BSJA 2F5AH 2PO6C 4OB5H 3NOIA 1T83C 1YNLH 5IR1A 1A5FH 4PGCB 1E4WL 3RZWA 4D0CB 1M05B 2GW5A 2XWBB 3MLRH 2XXCB 4QRSB 1A7OH 5EZIL 5HSFA 4NKIH 1WBZB 1LVEA 3L3JB 2WNGA 4MB3A 4G8GA 4WW2F 3INUL 3KXFB 4HHAA 3V52H 3NPZB 3BEWB 4QWWC 2DM4A 1U3HB 4JFQB 4D0BA 5DHVB 5F7KC 2XZCH 1MQKH 2P5WE 2X4NA 3S4SA 4J3VA 3WN5A 3TBTB 2P8MB 2EDNA 3TCLB 2I9LA 4UV4H 2AJZA 3DX8A 4L8CA 3KPRE 3HE6D 3O2DL 3O9WC 2BX5A 4Z77A 1P4LB 4KMTL 4UIKL 4F3FA 1TTUA 1J5OH 4GRLC 2I5YH 5HGAA 4F37K 4ZOCA 5LQBH 4QLRA 4LHUG 1MLCB 1KFAH 1U8NA 3IDGA 1BECA 3DSFL 2XRAH 1I1YA 2VL5B 4AIOA 4P9HH 1DANT 1FPTL 3ARED 4PJ7F 3WO4C 5FECB 2D31A 4C58B 3PP4H 4LQFL 5ID1B 5D1ZA 4FXGB 1QRND 1MCDA 3CVIH 1O5DT 1KPVA 5KSBF 2D4FA 3W11D 1H3XA 3WUWG 3HMXH 2BMKB 3VH8A 5AZ2H 4RGMC 1KB5H 3RY6A 5JORA 1WIPA 1WWBX 3KYNA 4N5ED 4HXBL 2Z0BA 1B90A 1CLZH 3O8XC 3KJ4C 1YMMD 1FFNA 3C60A 2VZSA 4NQUA 3QG6A 3WFEL 1LQSR 5IB4B 4WCYL 5SWZB 4MNQA 3MSPA 3RKDC 3T0ED 4ZAKC 4LSUL 4PJ8D 4WUUA 4ZFOA 2Q86B 5D2LA 2CDEB 3BQUB 1NUNB 3WLBA 1WBYB 3OGCB 3IFLL 1ZXQA 1YJDC 4UINL 1LDPH 5DZLA 3UAJD 2HG5B 3UJIL 3C5ZB 3HNVH 2MCPH 4ZUUA 1DUYA 3ZDYE 1KBGL 5IM7A 4OIAA 5L2KE 3C5JA 4Y5XC 1HYSC 5AWNL 4Q2ZA 4O5LH 5D70H 3OKKB 3Q5YA 4L3EA 4IJ3C 1F3DH 3MMEB 1O7SA 2YSSB 3AS3A 4N68A 4NQED 5KVFL 5FYKH 2ADGB 1WIOA 4WFED 1MVUB 3GSNB 1N64H 4HIHB 2A9NH 5E9DB 4EN3C 1EEUA 1R0AH 4FFYH 1H8NA 3EYOB 4RA3A 2JJVA 2EDXA 2DQHH 2VDPL 3PJSA 2HVKB 4RZCB 1BEYH 5DUMH 3HG1B 1BJMA 1XIWC 4ZYKA 5EOCL 2ADIB 5DZNA 5C09E 3O6MH 5LGJA 4OF3A 1CD1B 1H0DB 4JQXA 3H0TA 2AEIT 1KCVH 2FJHA 2ENYA 1SEBB 3QO1A 4FZ8H 3DIFB 1KB9J 2Q6WB 3L5IA 2FSEA 1U6AH 1P4BL 5F21B 1NBQA 4BKLA 4LGPB 3MXVH 4YNYB 3QUXD 3VRJA 3V6ZB 3RTQB 1MCFA 5INCA 4N0CC 4KHTH 4HEME 1HKLH 2HWZL 3DROB 2VMFA 1J0YA 2F5BL 2OCFD 4G9DA 1R24B 1BGXL 5FYLH 5BRZA 2CXGA 1OTUC 2P5EA 3IFPA 1MCWW 1NLBH 3D3VE 3JWOC 2ATPB 3QHTC 4LKXB 1V05A 1B0RA 1Y18A 1MI5B 2W1NA 3GEWB 5FHAL 1IEBB 4QRRB 5D8JL 1HHJB 1UWEH 3QBTB 2FL5A 3O4OC 5HDQH 2LVCA 1GHFH 3P11H 4P2OC 2FLBT 1X3DA 5L0QC 4ONOA 4OZFA 1MUJA 4R3SB 3LSOB 3GUTA 5EBMA 3TA3C 2EDLA 3MJ8A 1EJOH 3KGRA 5FA3A 3SDDD 1BIHA 4YHIB 4PRBB 3SO5A 1R3HB 1CK0H 4GW4A 4XB7A 5AD0B 1FHGA 3BI9X 3ARGA 2AJSL 4OZ4A 2GJJA 2X4OB 3RWJA 1G6VK 1D5MA 4PGJA 2CR3A 1BAFL 4U1HA 5ETUB 3QNXA 4KKNA 1T6VN 3UDWC 1T04B 2EXYC 1OD7A 4JFDD 4PD4J 4IDJL 4OKDA 1AGDB 2KBGA 5JIHA 4Y8DC 5DK3A 2IAMB 3SE9L 4OIIH 1YEIH 5SWSE 4JM2F 4MSWA 3QIWA 3VXSE 3TH2T 5B38B 5FK9A 2R1YB 3DVGA 5E2TH 3MBEC 4O51A 2C9AA 2J12B 2YKLL 3DETD 5ESQB 2PW1A 1X4XA 2BSSB 3HUJE 3D39D 3UTZA 2P47B 4ODSH 4ODBD 4HKZB 3UZEA 3IDNB 3BISA 3QWOA 5DD0L 5IGXL 4X0KA 2E6QA 1JWUA 2JJTC 5SWQA 3RGHA 3UJJH 1Q94B 3O4LB 1CGWA 3V5HA 3AM8C 5HYFA 1QR4A 5FM5O 3IDMB 4PGCA 3BH9B 1M05A 5CZVL 5IUSA 2XWBA 3QJFB 3O81A 3EYQD 4NUGL 4GAYB 1B0WA 1P1ZB 5KVEL 1WBZA 5IWLA 1SJEB 4N5UA 3L3JA 1LD9B 1F8TH 3FQRB 4ENEC 1JZ8A 1T0PB 3KXFA 5F7LB 4HXAH 1NEZB 1IE5A 3BEWA 2CDFB 4NN6C 4U1NB 3EYUH 4JFQA 4JGUA 5TE7L 5DHVA 5DRNB 3TBTA 2P8MA 1I3GH 1J7VR 5F3HB 3TCLA 5F9AC 3K4DA 4K2UL 3W9DB 3HZVB 1P4LA 5JOPE 1VFBB 4PP2B 1MLCA 1U9KA 3GDBA 4DK6A 4WTZA 4WWID 3OJDB 1MF2H 2VL5A 1FVDB 1UYWH 5ICXB 5I71B 1FFRA 5FECA 2ZCKH 1T03L 1KENL 2VIRB 1DLFH 4HQQL 1GL4B 3BKJH 1ULVA 5L9DH 5GZOC 4ZD3H 4JLRA 3ZDYF 1NKRA 1XCQB 3LY6A 3CFCL 3ORJA 2VC2L 5E8DL 1KXVC 4PGEB 1J10A 1CGXA 2NXZB 3MNVB 5IB4A 3IDIB 5SWZA 2BNRE 3UTSE 4XMLL 3OB8A 1NCNA 2XOTA 1TMCB 4MQTB 2N1KA 4KUCF 4LVHC 1HINH 2Q86A 3ZTNH 2CDEA 2IMMA 4P2RB 4XBEH 3BQUA 4BQ6A 1WBYA 2CMRL 3OGCA 1E28B 5IVOA 3KG5A 1BBJB 2P49B 2E9JA 2HG5A 5B8CB 3C5ZA 5FYJE 3SGEI 1E4WH 1YPZF 2R15A 2WIMA 2CH8A 3TVMD 4E5XB 1FE8L 3OKKA 5DJXA 3MMEA 2YSSA 1T21B 3QIBB 5DC9B 3INUH 2ADGA 2CO6B 4UQ2B 1MVUA 3GSNA 4HIHA 3D9AL 5E9DA 3WIFB 3K2UL 3NCCB 1X5YA 3V0VB 1HN1A 4I8DA 2YRLA 3EYOA 3FRPA 3PL6D 3GM0A 4ISVB 5H8DA 3O2DH 2Q3ZA 1IGJB 2HVKA 3TF7C 4RZCA 4KMTH 4UIKH 4FA8A 4X4YA 4YFEA 3DXAD 2ADIA 3H9SE 1CD1A 1SMOA 1WFOA 3DSFH 1XGYH 3V0WL 3VXUD 3QHFL 1IC5H 4HZAA 3ZDZE 3BVNB 1E27B 2EDRA 1SEBA 5MENE 2UWEE 3DIFA 2VLLB 2Q6WA 4LQFH 5CP7B 1DL7L 5E56A 3PWJB 4HK3N 2AK4B 4DOHB 1P4IH 4OTXL 4YNYA 4WWKB 3X14A 3VFNB 4HLZG 1YY9C 3AMLA 3V6ZA 3IJSB 3PHQB 1WZ1L 3GB7B 5FUCE 3N85L 3PABB 3QISA 3QXTA 5C71A 4FG6D 5F97E 2Z93B 3RX7A 3B8SA 3UTTB 3DROA 5DEFB 3GJEB 3MUGB 4OKVB 4RDQG 3EW3B 2AEQH 4WCYH 1R24A 2VLRE 2YUWA 1WAAA 5H35B 4LSUH 4K8RL 3GSVB 1GC1L 1I7ZB 4CW1B 2H3NB 2ATPA 5IB1B 1ZHBB 3JV0A 4LKXA 4JKWA 3IFLH 3SJVD 4UINH 3LAFA 4C56D 3QFJE 5L6YL 1VENA 3U30C 3UJIH 4ZXBC 4KJWD 3FFCD 1DFBL 3TLRA 2ADFL 4Y1AB 1JHTB 1IEBA 4QRRA 4H0IA 4X8JB 1HHJA 1KBGH 5EU6B 2L0DA 4YDKL 1U58B 5IMMB 5AWNH 1RAMA 2WZPD 2W0KA 2XN9E 4R3SA 3LSOA 4EXPX 3ZKMC 2X4SA 4P23D 3ETBF 4YHIA 3MCG1 4PRBA 4QNPF 4Z78B 3O45B 1R3HA 3LKPB 4MCZB 2QV2A 3U7WL 3JWNC 2PETA 3AMKA 1J0IA 4HJJL 2CK2A 5SV3A 2X4OA 2X10A 1VESA 3OV6A 2VDPH 4GJTB 5ETUA 5ALCH 2BXYA 4QEGA 4HFWB 4LF3A 4Q9CA 3U79A 1T04A 2JKXA 2E7LC 1WV7T 1JJUA 5EN2B 3VMNA 1G6RB 3KPMB 4L3CB 1DLHB 4MAYB 5IB2B 5H94B 1DBAL 4JVWA 1AGDA 2NNAB 5AG8A 2IAMA 5J12B 1RD6A 3T0AA 3P9MB 1NC2D 1HILB 5B38A 1OAXL 2R1YA 4FQ1L 1G7PB 4NKDB 5ESQA 4FABL 1QNZL 5FGSA 4YDLB 4OLEA 3E6FB 3CZFB 4JY4A 4JM2D 4HT1L 1I1FB 5J89A 4G8EB 4HKZA 3IDNA 1QSVA 3TESA 2MPAL 3QNYB 1SQ2N 4OUUB 2ESVB 2ZUVA 4OLZL 4W68A 4BZ2H 1AJ7L 1FO0H 1MFNA 4XVTH 1Q94A 5D7KE 3O4LA 5CJXC 1MREL 4Q6IC 5HHME 3RA7L 1M71B 4JRWA 5TQ0H 1P84J 1KF9B 5D8JH 1CVRA 3BH9A 4ZO7A 4PV8B 2P5WD 4MNGE 4PJ9B 1MFBH 4OT1L 1EA9C 4NNYA 4GAYA 4M6AA 1P1ZA 3KPRD 1SJEA 3B4NA 3F58H 5DUPL 4CVUA 4Y5VB 4PJDB 3FQRA 3JBG7 3Q1SL 1NEZA 2CDFA 4Y88A 4WO4B 1S7WB 4PJ5D 5DRNA 2AJSH 4ZQKB 4ZNEE 5F3HA 4Q7DA 4AEIL 1KN4L 3W9DA 3HZVA 4OCXL 1WZMA 5EO0B 1QBML 1PEZA 1VFBA 5I73C 1MAKA 4WNQB 4MZ2A 3OJDA 1CR9H 5KSAC 3QCUL 4HS8H 5I1EH 2IH1A 3W81A 3RI5F 4PLJC 1MHCB 2A1WH 1FVDA 3T2OA 3WCYA 5E8NB 2HP4A 5ICXA 1ES0B 3VCLB 4PS4L 2EYSB 4OZHE 1GIGL 4WJ5A 5FCUL 3NIFF 4WEMB 2VIRA 5D72H 5DFWH 2YKLH 3BN3B 1REIA 4YXKL 2VXQL 3RFZC 1XCQA 1OPGL 2XZQH 2BRRL 4TVPE 1A2YB 2BXZA 3NVQA 3VD3A 3VXMB 1JNJA 5JPNB 3IJYB 4JO3L 4X6BA 5GRVK 4JHWL 4ZPTB 5FM8A 2VXTL 1ETZB 4HDIB 4ZTOL 3MNVA 3MRPA 4J3SA 2HRLA 3LKOB 3HB3D 5DD0H 3IXTA 3IDIA 5C8JB 1YEHH 2NX5B 5HY9B 1X7QB 3RP1A 4K7PY 4P2RA 4MGXA 5GGQL 2D2OA 4QXGL 4Z7VB 1BBJA 5B8CA 1I9RL 2NR6D 1N0LA 5GS0H 5C0GB 2A6JB 4KUCD 3ZTJG 5CZVH 4B41A 3PDDA 1LE5A 4NUGH 2JJWA 3DX9B 4HG4K 4LMQI 5KVEH 3UYOD 4LRNH 1T21A 3QIBA 4OF6A 4EQ2A 4UQ2A 1UG9A 2E6JA 2UWEF 5C09D 1ZEAH 4NOBA 5FDWB 3BGFB 2CQVA 4J3XA 3BAEL 1J12A 4F7EA 3WIFA 5TE7H 5HPMB 3ARSA 4G42A 4YAQB 3V0VA 1A6TA 4K2UH 3G6DL 4ISVA 4ODWB 5I74B 3DX7B 4KVCL 3AVEA 2B2XL 4M6OL 4IDLA 4LDEB 1IAMA 4NO5B 3QPXL 2P44B 3WDHA 5DGRA 1H5BB 3BSZL 3TIDB 1HNFA 2FJGB 2W0LA 3BVNA 1E27A 4G6JL 2Z4QB 1U8OA 3WJLA 2QADC 2VLLA 3V2AR 3GI8L 5CP7A 1T03H 3PWJA 2EDQA 1KENH 1SBSL 4QHUB 2AK4A 4YK4C 3MV01 4WWKA 4HW6A 2IFFL 3VFNA 4M5YL 5JDJA 3IJSA 3TO4C 3RDTD 3TN0C 3D3VD 3PHQA 1VGKB 3CFCH 4G43B 5D5MF 5LWYH 4N0RA 5EPMA 2W9EH 5E7FA 3GB7A 4YDJB 2VDKL 3PABA 4LGRB 5JO5B 4NBYB 5E8DH 2Z93A 5JXAL 2BDNL 3UTTA 5DEFA 2NPLX 3GJEA 3MUGA 4AZ8A 4CN4A 2XTJE 4Z7UB 3CFEB 3DPBA 4OD3L 5H35A 3MODL 3GSVA 4ZO8A 1I8IB 3LZFL 4AK1A 1JYWA 3QQ4B 4CW1A 2H3NA 3BE1H 2YPLE 1ZHBA 5IB1A 3IRPX 1UQSB 5EO9B 2CMRH 2DICA 5D7SL 4M00A 5E03A 1J8KA 4YHNB 4Y1AA 4X8JA 2NZ9C 2XA8L 1U58A 5IMMA 3SGDI 1ZANL 1AGCB 4KI5E 1FE8H 3OKLB 5GRXG 1V7ML 4ODXB 1JZ7A 2W38A 4HJGB 2HJKB 4OI9A 1JNNL 3KPSE 5LBSL 3D9AH 4Z78A 4WIQA 4OZFH 3UZVB 3K2UH 3O45A 5ILTH 3LKPA 1RZ7L 3PQYB 1NCUA 3MQIA 1T7XA 4XCEB 5I16B 3B9DA 2HTLD 2YN5A 3RZCD 4HFWA 3VXSD 3WN5C 3HS0B 5CD3B 1C1EH 1EBPA 2A6DB 3QHFH 5EN2A 1G6RA 2X1OA 3L3KA 3KPMA 3G6JF 4L3CA 1DLHA 4MAYA 5IB2A 1RIVH 5H94A 3WFCL 4GRWE 3O6KL 3VXQB 3DX6A 4I13B 1DL7H 3P9MA 1JZ3A 4NQCB 4DKEL 4OCRH 1L0QA 1HILA 4OTXH 2FZ3A 1F00I 4NKDA 3TBVA 4P5MB 1OAZH 3DVIA 1EEQA 1A4JB 3B5HA 3H7LA 5EFIB 1WZ1H 3N85H 5HYIA 5IBLD 5I75B 5JQHC 1I1FA 4G8EA 1HIML 5T1KB 3S3PA 5IIEB 3QNYA 4OUUA 1NEUA 2ESVA 4K8RH 1GC1H 2GFBB 3QAZC 1AR1D 2G75B 2BHUA 4MVBD 5L6YH 1M71A 2RQ8A 3FN0L 3KPLB 1DFBH 3IDYB 2ADFH 3RIAK 4PV8A 3ELAT 4JZOB 4PJ9A 2PN5A 5IQ9B 4NC0B 1TQCB 1D7FA 3NCFB 3QYCA 1CXEA 4Y5VA 3HZMB 5DEZA 3RVWC 4PJDA 4Z7QE 1CBVL 1W8OA 1O7VA 4X7CC 1D5ZB 1YEEL 4OZHF 4Y0GA 3KLHC 5HYSG 2FEEL 3QDMB 3U7WH 1NC4B 4WO4A 1S7WA 4HJJH 4ZQKA 1XFPA 3BMWA 4GO6B 5DHVH 3LIZH 3EJJX 3HRPA 4IRJC 1FRGL 2XY2A 5EO0A 3AXLB 4PGDB 4WNQA 1T66C 4PJFE 5FUZL 1DBAH 3UBXG 1MHCA 2H41A 5I1IL 5E8NA 4PR5B 3VCLA 1ES0A 3NCMA 4GLRH 4V2CB 5GJTH 3VA6A 5ACZB 3WKNA 4FFVC 4S2SB 2PXYD 3NAAH 4FQ1H 3WNOA 5HYQB 1I85C 4YZFE 2BNRD 3SDAC 3UTSD 5K9OB 1QNZH 3BD4A 4MHHI 1QPPA 1RMFH 3SOBL 1RUPH 4NKOB 5C0AE 4YX2L 4DN4L 1A2YA 4I4WB 2WWMC 4HT1H 1QFWL 2GYSA 5EZOL 5JPNA 3IJYA 5FYJD 3JZ7A 4ZPTA 1ETZA 4HDIA 4MCYB 3LKOA 4R4BB 1GGYA 3BP5B 5C8JA 2IPKB 2QQNL 3TNMB 2NX5A 5HY9A 4M5ZL 2D7OA 1MREH 1A22B 1GGIL 3PWUB 2B39A 3WLWC 4Z7VA 3ULUL 3E8UL 3EOYG 5C0GA 1JNLL 1TZHA 3BDBA 3EO0B 1QVOB 3QIUB 1OAQL 3OWEA 4FQXC 2P1YA 4KK8D 4OT1H 4Y5YC 3NCJH 5CLWA 3QXVA 1XGQB 1P7HL 3DX9A 1BPVA 4ODVL 1BZ9A 5DUPH 5SWSB 5KVGL 3KNBA 1NKOA 5DK2B 4HUXA 3Q1SH 4F58H 4G80B 3H9SD 3RAJL 5FDWA 4N90E 4PJIA 1TETL 1ZGLP 4YEEA 5HPMA 5IHUL 3UPAA 5CJ8A 2BZDA 2XICA 4B0MM 3GSNH 3B9EA 1MFCL 3QUYB 1J1OL 4BUGA 1KN4H 3DX7A 3ZKXB 4HPOL 4R90H 2YEZB 3OBAA 4GMSH 4FQLL 4TRPL 1TJIL 4P5TC 1A6WL 4NO5A 1MOEA 2DL9A 2WBJC 2KKQA 2M2DA 1H5BA 3TIDA 4K71C 3QCUH 3UEZA 3NCYS 1C7TA 2Z4QA 2MCG1 4PS4H 3GGWB 1KEGL 1F2QA 1MCOH 4PJEE 2Q8AL 5FCUH 1G6RL 3ULVE 4QHUA 3CH8A 4OGAD 3V5DB 2VRAA 2VLRD 4RX4A 3RVUD 2X89D 3S35L 4CU6A 4YXKH 5JHLH 1OPGH 1VADB 2BRRH 1VGKA 4G43A 2FATH 3QIWC 3HAEG 3QFJD 4YDJA 2QQKH 5JO5A 4KI5F 3CX5K 4NO0B 4JO3H 5HVHB 3MLXL 4JHWH 2OSLB 3NA4A 4ZTOH 5HHXL 4WUKL 4Z7UA 2IJ0C 4X9HA 4OD1L 2WQ8A 3MCLL 3CFEA 2MQCA 3GSUB 5CEZD 3UCRA 1RZKL 3FO1A 4K8RC 2XN9D 1I8IA 4LSTL 3MV8B 1BJ1H 3QQ4A 1FNAA 5GGQH 5EO9A 1UQSA 4XI5C 1KCKA 3MOBL 4QXGH 5C6TL 1QBBA 4HBCH 1I9RH 4XCCL 4JFEE 5CJOL 3DWTA 4YHNA 5KN5B 4IM8A 2APFA 4PJHF 3AGVA 1AGCA 2MMXA 4CUCA 3OKLA 5JR1L 4ODXA 5HHPB 2QLVB 3L3DB 4XWGH 2QJDA 4HJGA 1DQQB 2HN7B 1EFQA 3F7PC 4GRWF 1FGVL 1HSAA 3BAEH 4YUEH 3DO7A 4XC3L 4U1IB 1TTGA 3O6FB 5IWLC 5FKAB 3UXFA 4ZPVB 3PQYA 3MLYL 4L1DA 4N9GB 3TV3H 4XCEA 5I16A 3G6DH 1T1ZB 2BCKB 3WDJA 4KVCH 1OLLA 4MA1B 5J8OA 2B2XH 2XG4A 4KAQL 4M6OH 4QCIB 4MLIA 1VEOA 1BWMA 3ZDXF 4JO2L 3HE7B 4Y4HC 3QPXH 15C8L 1Y6NR 3BSZH 4XP1L 2A6DA 3EJYC 4U31A 4OLYL 1A7QH 4POZD 5CWSA 3T0DA 1JBJA 2ITCB 4MZ3A 2LE9A 3JWDL 4G6JH 3VGBA 1CE1L 3CFIC 4H88L 3VXQA 3GI8H 2HFEB 5KOVC 4NQCA 1SBSH 2AP2A 2ZPKL 1K4CB 1DUZB 4FHBD 1H9VA 2CIIB 1ZMYA 2IFFH 4M5YH 5D6DC 5E6IB 4HBQA 3DMMC 1T1YB 4LBEB 5DTFA 3RU8H 5D7KD 1A4JA 5EFIA 5ICYB 5HHMD 2EKJA 3QB7C 2QSQA 2VDKH 1T2QL 4QRPB 4YBLB 5JXAH 1IZJA 4B50A 3DV6B 4Z7QF 5T1KA 2Z8RA 5IIEA 1AXTH 2YA0A 5CGYD 4OD3H 2VLKB 3SQBA 3MODH 3Q3GB 1AD9B 3LZFH 2GFBA 3EZ8A 3PGFH 5F7DA 1OQOA 5IFHH 1L6XA 3KPLA 5D7SH 1MY7A 2A6KB 3MA9L 1E4XI 1ZHKB 1MPAL 2XA8H 3V5KB 1ZANH 4DJMA 3T4AB 1A7RL 5IQ9A 1WVZA 1EUUA 4NBXB 3GI9L 4L4VB 1V7MH 4PJFF 5MENB 2AQ1A 2D0HA 4J4PD 4QOKD 4KK5C 3HZMA 1JNNH 1RK1A 3F8UB 2HRPL 3AY4A 5LBSH 1WZLA 3BPLB 4QRTB 4NWTL 1IVLA 1D5ZA 4NNPL 4PRIB 5BMFL 3TFKC 3FQXB 2C3GA 4YXHH 1A21A 3T0XA 4EBQL 1PG7W 1RZ7H 3QDMA 1NC4A 5KAQG 4JQVC 4YPJA 1S78C 4LAQL 3MRHB 5F8QC 4NWUL 4WY7H 5J6GA 4N0UE 2VXSL 1RJLA 3AXLA 3ARQA 4PGDA 3OXRB 1OP5H 2EH7H 2CRZA 3I2CL 5IROA 5JXEA 2X1WL 2IPTL 4FQHA 4TVPD 4G6AD 2WK2A 5T1DL 1FFPB 3O6KH 1ZLWH 3R1GL 4PR5A 5E5RB 4DKEH 2VR4A 4ESKA 2R56H 5ACZA 1KLGB 4D9QE 4P2YA 3EJZC 5HYQA 1F97A 3E2HB 2O26U 2FO4B 2RB8A 1ZT4B 2Y25A 4MDIB 4XNUL 4J8RB 4F9LA 4S10A 4MD0A 4NKOA 3PXJA 1GOGA 1UH4A 4I18B 4I4WA 5FYJU 4IOFD 3MRJB 1RFDH 5BV7L 2HT4D 4PPTA 4IS6A 1HIMH 2FEDD 1A3RH 2ED9A 2BY2A 4HUKB 2NY0C 4R4BA 3BP5A 1JP5A 3EFDL 1IL1B 5DA0B 3TNMA 3M45A 5F1OB 4W70A 4H5SB 5D7JC 3C08H 1DQML 2UV3A 3GFUA 3VI3E 3PWUA 3VXRB 3FN0H 4GBXB 4LCIH 2AABH 1IM9D 4Z7WB 1VEPA 4U6XB 5JW5A 1KPUB 1TPXB 1JGLH 1LK3L 3OX8B 1GOFA 5J11C 4R4NC 2VLJB 4CDHA 3EO0A 1QVOA 1UADC 3QIUA 4QRQB 1XGQA 4NC1E 4PP1D 2X05A 4G8FB 1N5AB 3ZL4L 5DK2A 1CBVH 1JPFB 3ALXA 1UJTA 2ADJB 2LQRA 1IMHC 4PJEF 1SEQL 1TJHH 5CZXC 4X9BA 1AY1H 2B5IB 3ULVF 1DBJL 5EC1B 1VFMA 2Y23A 3MA7B 1NANI 4C83B 3NABL 2QHRL 3QUYA 4R2GD 3TH3T 2G5RA 3QEQE 1I8KB 2YEZA 3BDYL 3BD5A 1KACB 4PJAE 4DUXA 2Y07H 4KJYB 2EXWC 4YDVB 2O5ZL 5BS0E 2F58L 1PKQB 4H0GA 4ELMA 5FUZH 4Z5RB 4XP5L 3CSBA 4BSVB 2YRPA 1TCMA 5I1IH 4OLVL 2NXYB 1QSFE 3THML 5KBNC 4H25B 4P4KD 5ISZB 2J8HA 3V5DA 3V4UL 4Q9RL 2F19L 4MNGB 3HPLA 2J1KA 2OX5A 2E8ZA 4Y16D 3SOBH 1VADA 2H6PB 3KPOB 1OF2A 4DN4H 1R3LB 4LNRB 4EXKA 4YX2H 5FYKE 3ARDC 5EZOH 4NO0A 5IV2B 2YD9A 2NY4B 2OSLA 2FO1A 1L9MA 4H1LG 2QQNH 4P57B 3GSUA 2R2BB 3SY0B 1L9NA 4KI5D 3CFJA 4M5ZH 4UV7L 1XF2B 2BSRB 3MV8A 2EZ0D 1GGIH 2C3WA 5FDYA 4BZ1L 1LP9B 1NLDH 5KN5A 5E1AA 1JNLH 5GZNC 3ILQD 2X9XA 1X5IA 2Q8BH 3BZFB 4LFHG 5E7BA 4KJQC 1O0VA 5KVGH 1YMMB 5SX4I 1YEKH 1DQQA 2HN7A 3GSWB 4ZTPL 5HI3D 4EUPB 3RAJH 1TETH 5J13B 4LDLB 4U1IA 4NNXB 3T3ME 1ZE3C 1KV3A 1W72B 3O6FA 5A2KH 5FKAA 4FFZL 1U8PB 3U7YL 5JTWA 4ZPVA 3BKYL 4XNZC 4N9GA 2F15A 3HKFA 5LGHH 1T1ZA 1MFCH 1J1OH 1F2XK 1Y6KR 2OP4L 1XGUB 2BCKA 1VHPA 4FQLH 4TRPH 3CSYB 2GQHA 3V0AC 1TJIH 4IMKC 1A6WH 3HE7A 4PYHA 5FYLE 1NBYA 3X3GL 3S34L 2VWEE 5C0DB 5SX5K 1JNHB 3JV6A 4LLVB 2N56A 3VWKB 1HH6B 1EGJL 1KEGH 3EIFA 3UC0L 3OF6D 1G6RH 1L0YA 4WGWB 2VDRL 4ZS7H 3S35H 4XCNB 5E6IA 3FQWB 1T1YA 4LBEA 3WNNA 4Y4FB 3LS4L 5ICYA 3L3IB 1B4JL 5KS9E 4QRPA 3JUZA 4XP4H 3MLXH 5HHXH 2A77L 3DV6A 4OD1H 3HA0A 2EIDA 2ZCHL 5DJ2B 3PDOB 4JB9L 5EIVA 1B0GA 1RZKH 2VN7A 2VLKA 4MA8H 1MIMH 3Q3GA 3GMRA 4D3CL 2F53B 1OCWL 5IOPB 3MOBH 5C6TH 3ZYJA 1TZIA 3MRRA 1D5BB 2NY2D 1Z3GH 4K7PL 2A6KA 3ZE0F 3FO0L 5C08B 3LEVL 3RIFF 2WW8A 3T4AA 3V5KA 4L4VA 4KRPD 2HAZA 3BN9C 1LNUB 5DVLA 1BFVL 2SEBB 3CIQA 3L5WB 5H37H 1FGVH 1V3LA 4QKXB 3G5YB 4L9DA 4XC3H 3CMGA 4YR6B 4PRIA 2R0LL 3FQXA 3LRHA 4P3CH 3MLYH 3CXDH 4ZS6D 3R0MA 4KUZH 5CJBA 3MRHA 3NFSL 1QFOA 1ZWIB 4YWGL 1J0JA 5TE6L 5F9WB 4JO2H 4GH7B 4D9LL 3OXRA 1IC7L 15C8H 3VDAA 2YPKB 3CFKB 4XP1H 3DYPA 4OLYH 4XWOD 3G6AB 2H2SC 4PRDB 5LAXB 1CE1H 4D8PB 5INDB 4GQPH 3RVVD 4WHCA 3TBSA 1MLBB 2FD6L 5IVXA 2IMNA 2ZPKH 2AEWA 3K8MA 4YHZL 1S3KL 3VI3F 1G7LB 1KLGA 1BZ7B 4NHUA 2FO4A 3WJLC 1ZT4A 1S8DB 4FQJL 4MDIA 5DMIH 3QDHA 4J8RA 1CXFA 1K2DB 1T2QH 4I18A 2V5SA 3KPSB 4JO4H 4YFLF 4Y2OA 3MRJA 1E0OB 1B2WH 3QHZL 1NCCH 2VKWA 1FZKB 3V95A 5DMYA 4WFGE 3X13B 2EH8H 3QG7L 2ZSVB 1HNGA 3ARTA 3EOTH 4XTRC 4H5SA 1QSEE 1EEZA 2JJSA 2XA3A 3VXRA 2FHFA 4GBXA 4JRYD 4Z7WA 4U6XA 3ULUC 4N90D 1KPUA 1DBML 3OX8A 5D7LD 4DEPB 1MPAH 4X8XA 4PJAF 1PSKL 1WK0A 1ZHLB 2VLJA 1U2HA 4R0LB 1I1AA 2CLVB 4QRQA 4N8CL 2H9GA 2DIJA 1Q0YL 3ARFD 4G8FA 1AIFB 2AQ2A 5K33A 5HBBA 1N5AA 5ICZB 3P4MB 2HRPH 3LS5L 3VFRB 4KHXL 1JPFA 4NWTH 4NNPH 2ADJA 1BX2B 4EBQH 1A6ZB 2MTPA 1Z0NA 5EC1A 1YYML 2O5XL 2B1HL 3MA7A 3VFOB 3WFHB 4C83A 4NWUH 3A67L 5DRXB 3ULVD 2VXSH 2OTUB 3RJQB 1I8KA 2HT3D 2EDJA 4KJYA 4YDVA 1SBBA 3I2CH 1WIUA 3T2NL 1PKQA 2NCMA 4Z5RA 2IPTH 4MX7B 3NH7L 1ACYH 4BSVA 5CCKL 4KTEL 3R1GH 5EA0L 4H25A 3EDJA 5ISZA 3K1DA 3GMMB 2R2HB 4BH7B 1V7NL 4WW2B 2EECA 4YEFA 4XNUH 2H6PA 3KPOA 1BQHB 3SEPA 1R3LA 4LNRA 2X42A 2AK1L 1P9MC 3SN6N 1OQXA 5IV2A 5BV7H 3EOBB 4F7MB 4LLQB 5DVKA 1MCPL 4NRXB 1TJGH 2C1OB 2X41A 4M6ML 3SY0A 4P57A 1ROWA 2R2BA 3EFDH 4X4MA 1MNUL 1RZKC 2Z8WC 4MXQD 4YIQB 2P7TA 4IRSB 1VFAB 1XF2A 5ESVB 4OCNC 1DQMH 4K3EL 3OR6B 3KLAB 1QRNA 4PUBL 5EBLB 3RQ3A 4Y4KC 1LP9A 1RQ5A 4NQXB 5DO2C 1MVFA 4P49A 2PYEE 1X6LA 1R5VB 3BZFA 5C9JB 2I07B 3OKYA 2B0SH 3T4YB 1JZ4A 1YMMA 3VD7A 3ZL4H 4PBXA 4KH2A 3WHE0 2JCCE 1CI5A 5J4MA 3T0EA 4P2QB 3WL9B 1AQKL 1SEQH 4GG6A 1S5HB 4JM4L 4NNXA 4PJ8A 4EDWL 5I30L 1W72A 4FTVB 1NFDB 4Y5VC 1IFHH 3MX0A 1T22B 3L7FB 5D2NC 3V6FB 1RPQA 4GXVL 4ZUTB 2QHRH 3LQAH 1XGUA 4NIKB 3RIFK 4APQB 1T5XB 1WZKA 3CSYA 4CVWA 5IMOA 5JW4R 2O5ZH 4IIQB 2F58H 5D1XB 1DE4B 5C0DA 4GQ9L 1JNHA 1IGFL 3U0PA 4NQEA 3J8F7 4CL7A 4YHPA 3JWDC 1HH6A 2HTKD 4X80L 1WF5A 4L8BB 2EDWA 4AG4L 4LCCA 5F72S 3V4UH 2F19H 2HH0L 4P46B 1JN6B 2FX9H 4NZDA 1PFCA 4UTAL 4XCNA 4MQXD 2WBWB 4XBPB 3FQWA 4BYHA 3FO9B 2D3VA 2EDTA 5EULV 1Q0XL 4Y4FA 4F15B 1M7XA 1AGEA 3L3IA 1AP2B 1OAKH 4BFBD 5HDBE 1PAMA 4CAGA 1I8LC 2X40A 4K3JL 4AH2B 5HDLA 1KYOK 3KS0H 4NC2B 2GJ6D 5DJ2A 1Q9KB 3PDOA 3BZDA 3VXPB 1PZUB 5IB5B 3I3DA 5A1AA 2F53A 3CUPA 2AEPH 1Z9OA 4PRPE 5IOPA 5EIIB 3SO3B 2BY1A 3QUXA 4BZ1H 2IG2L 2HJLB 4HG4J 1D5BA 2Z31D 4W6YB 4GSDL 2AI0L 2P48B 4U2ZA 5L2JB 3QJHB 1S9XB 4ZOBA 4KPHL 2E9IA 1IAII 5C08A 2PO6B 1KXTB 4M43L 2CGRL 5DWUL 4Y2DD 2FGWH 2W07A 1GPOL 1LNUA 4G5ZL 2A74B 3L5WA 4OBSA 3G5YA 2C5DC 4YR6A 5F70A 3U7YH 3BKYH 4OFYA 2MJWA 3VXTB 3VWJD 3TZVC 5EB9A 3TJEL 3BGFC 2OP4H 1KC5L 1ZWIA 1KLFA 5DD5L 1EO8L 2PW2B 4D9QD 1EXUB 3G04B 4RBPK 3GSXB 3X3GH 2YPKA 3RWCB 3CFKA 3S34H 4LHUB 4PJGB 4PRDA 5LAXA 5INDA 3O9WB 5ACMA 3DUSB 1MLBA 4GRLB 3UC0H 1A1MB 1H5BC 2VSDA 1G7LA 5GGRB 3P9WB 1BZ7A 3B3IB 3N1QC 4LASH 4PRAB 1S8DA 1T80A 2WWKO 3LS4H 3WO4B 3WUWB 3O41B 1B4JH 1K2DA 5HVWA 1F4XH 1YECH 3MRFB 1A1NB 1MFAL 2A77H 3PNWB 5BV7C 2ZCHH 1KJ2B 4PBVC 3OG4B 4JB9H 4RGMB 4X6DB 3X13A 2ZSVA 4G8GE 4D3CH 1ND0B 4AEFA 5I1LB 3SKOB 4MJIB 4JFXB 2BVUA 3PWNB 3KJ4B 4K3GA 1S5IL 2ZNWA 4XRCB 4X9GA 3H9ZA 3SDCC 4ZAKB 1NCBL 4DUVA 4DQOH 3FO0H 4U05A 3LEVH 4R0LA 4OGXL 3VRLE 4O9HL 2XIDA 1S7UB 4PJBA 1EMTL 4N8VG 3WV0A 1AIFA 1PDKA 1U2CA 2XWJB 4I0PD 3W9EB 5ICZA 3P4MA 1BFVH 3V7AG 3VFRA 2VH5L 2V5YA 4QT5A 4JCMA 3ZE1E 4YXLL 3WSQL 2R0LH 4Y5XB 1A6ZA 5BS0D 4X98B 1OT1A 1IC4L 1MFDL 1F4AA 5I1HL 1F45A 3VFOA 3WFHA 4XT1C 2BOCB 4HCRA 1QSFD 5KTEL 2DJSA 1W72L 5DRXA 4K23L 1D5IH 4EN3B 2OTUA 1KSRA 2XQBL 5FF6B 5DMGD 4KK9C 3U4BL 3RWGB 4D9LH 1Q8MA 4HMCA 1IC7H 3JUYA 3CJJA 1C12B 4HIJB 4Z0BL 2YC1B 4M9OA 1U8HB 5F6HJ 4D94A 4AQ1B 5IFAL 1XIWB 1KGCE 2FD6H 4MNQE 3U2SB 2D9QB 1E4KA 4HKBA 1KOAA 2DM2A 3GMMA 4HK0B 2R2HA 4WUUE 3LH2H 5D2LE 2NY3D 4BH7A 4WW2A 1TFHA 2DQGL 3RGVD 1JRHI 2PCPB 2CXKA 1BQHA 4GW1B 3BUTA 1G7JB 4JFFB 4ONHB 3QHZH 1P5UA 3EOBA 2ED8A 1I9JL 4F7MA 4LLQA 3QFDB 4LRIC 4YHOL 2FYYB 4L3EE 1OAYL 2C1OA 4NQTA 1IC1A 5CIPB 4YIQA 4M4RA 1WISA 2YPVH 1RIHH 4JANB 1VFAA 4P48A 5ESVA 4F7CB 5FHBL 3OR6A 3KLAA 4R9HA 5EBLA 1BM3L 4RGOL 4OZGB 2ZOKB 4NQXA 1DBMH 1H3TA 5BW7A 3GRWA 2X4TB 1PSKH 3MOAH 4UUJA 1JGEA 3QP3A 3PGDB 4N8CH 3TP4A 1R5VA 1EHAA 3T4YA 3NCEB 1Q0YH 1YY8B 5JQ6H 4KHXH 3O4OB 4P2QA 1IQWH 1FBIL 4P2OB 4M1DL 2VQ1A 4FTVA 5L0QB 2O5XH 1NFDA 1Y0LA 2X4PB 4OCYL 2BY3A 2EIZB 3AY4C 3V6FA 3TA3B 3QH3B 5F88B 1IBGL 3FHQA 3AFLA 3M07A 4APQA 4PJXF 1QR1B 3NFPB 1T5XA 3O2VL 4R26H 3GMOB 4KKBD 4RFEB 1F5WA 5I15L 3C6LD 1QFWM 5TFSH 5E4EB 5DQJB 4IIQA 3QCTH 1DE4A 4M1CC 4LAJH 4UQ3A 3NH7H 1YPZB 3BH8A 1PZ5B 1XF3B 3WXVH 4KTEH 5EBWB 2PF6A 5EA0H 3WIHA 4L8BA 5BRZE 3O2WL 3D85B 2P5EE 1L4IA 4P46A 1OB1B 1JN6A 1V7NH 3PDGA 3DVNB 5TF1L 5D1QD 4XBPA 4L4TD 5HYEA 3FO9A 4ZSOB 1JPST 3D0LB 4LSRL 1X5GA 2AK1H 2VKXA 1AP2A 3VDBA 4XHQA 4XMPH 1T4KB 5IBTL 3MBEB 5MP6L 1EVUA 5FGCB 1MCPH 1CTNA 4MMZC 3WO3B 4F9LC 1Q9KA 4M6MH 4EI5C 4NN5C 1FVCB 2J6EA 4PG9B 5DJAA 3VXPA 1AXSA 5IB5A 1FAKT 4K3EH 3V4VL 2ICWJ 4PUBH 3QEQB 1MEXL 2IEPA 1WC7B 2R9HD 2HJLA 5HTSA 6CGTA 3REWB 4OZIF 5L2JA 2DOCA 3QJHA 1S9XA 1KUMA 3P4OA 3PWVB 1I7TB 4ONGL 4AIXA 2PO6A 2GT9B 1CFVL 1T83A 5JPMB 2CK0L 2X2YA 2KQMA 4UDTB 2A74A 3QIUC 1AQKH 2H45A 5C0NC 1NCDH 4JM4H 3MJ7B 4EDWH 4FZEL 1BZQK 2APXA 4C54A 3SJVA 3C8HA 1KCUH 3H9YA 3VXTA 4XMKH 3FFCA 2F8VA 3VGFA 1H15B 3MACH 4NN6B 3BUYA 4PRHD 2PW2A 2WV3A 3G04A 2VABB 1UCBH 3KPPA 3GSXA 4TUJA 4UBDD 3WEXB 4GQ9H 5TDPA 5EG6C 1IGFH 3CMOH 4LHUA 4OFKA 4PJGA 5DURD 3SKJL 5C6WH 1ZV5A 3O9WA 4X80H 2FIKB 3DUSA 3BW9B 4XPTL 4AG4H 1A1MA 3S88H 2QQQA 1IGIH 4WFFE 3LRGA 4UTAH 3BXNB 2VUYA 3B3IA 2LTQC 4LARL 2FCBA 1Q0XH 1G9NC 3PG2A 1TIUA 3RUGF 3QDGB 3O41A 2F54B 1ZVHA 5MERB 1Z5LB 4FXLA 3MRFA 1A1NA 3CFDB 2W0PA 2Y7QB 3PNWA 5I1KL 1RUKL 3ZE1F 4X6DA 5IFJB 4TNVF 1HHIB 3KXFE 1G9EA 1ND0A 2YRZA 3SKOA 4MJIA 3PWNA 2IG2H 4Z8FH 3QSKB 1GGCL 2AI0H 4I2XB 2ZUQB 4XRCA 2IWGA 1R6VA 5LCVL 4KROC 3L3HB 1EFXD 4ZAKA 1CF8L 4JM2A 1BFTA 4LVHB 5DJZB 2B1AL 1MAML 1S7UA 2P46B 3HFML 4JQIL 4HAGA 3LV3B 2CGRH 3GRWL 5DWUH 1JVKA 3EKCA 4NRZB 2EC8A 2XWJA 1GPOH 3W9EA 1HXYB 4G5ZH 3ZE2E 3TM6A 1J1XH 5AZEL 1JZ2A 4HKXB 4GG8B 5IVNA 4Y5XA 4X98A 3WJJC 3FB7B 3F12B 4X6CB 5EOCJ 4W4OC 5KS9B 2E27L 4MAUL 4LLDB 4QXUL 1KC5H 5E94B 1IGCL 2NY1C 4NO3B 5MI0C 5FF6A 3B2UC 1CQKA 3MJGX 3Q5OA 4XCFH 4MA1C 3SGKA 2FBOJ 2IPUG 3F7VA 2YC1A 1S7XB 4EI6B 5SWZE 2P42B 3PWPD 5E08L 1DJSA 5GRWA 5M7QA 4PJ5A 2HLAB 4J23A 5ESAB 5D96C 2WANA 1BD2D 4HWNA 3SE4C 2PCPA 3WD5L 2CRMA 3CZJA 4L1HA 4NM8L 4GW1A 1QG3A 4ONHA 5E6IC 1HK6A 2FR4B 1MFAH 4LPVA 1D9KC 4Y19B 3SDXB 5CD5C 3I6GB 3QFDA 4UT7L 2FYYA 4YDIH 5I76B 1YDPB 5CIPA 4B5EA 2Z8VC 5E9DE 5BO1L 1SYSB 3C8KB 4JVUA 4F7CA 3GBML 3NACH 1S5IH 1I3UA 3ECBB 2J6EL 4OZGA 3HR5A 4LSVL 1MCEA 1ORQB 2EE6A 2ERJC 2X4TA 1NCBH 4DVRH 2ORBL 4RGNC 3PGDA 3HG1E 4OGXH 4O9HH 1AC0A 1EMTH 1FNHA 4AMKL 3U30B 4ETYA 4HEPG 1YY8A 2V7NB 4ZXBB 2BJMH 4RWHA 1CLCA 3HI6H 4YXLH 3KYMB 3WSQH 1DZBA 3ULSB 5CEXB 3QI9D 3S36H 4P2OA 4OM1L 3F6LA 4NQDB 3WIIL 1IC4H 1KIUA 3IAPA 1MFDH 1ZSDB 2X4PA 3QUZD 5I1HH 2EIZA 3TA3A 3HI5L 3QH3A 5F88A 4JFYA 1BIIB 5I8CB 1XGTB 4Z7NF 5KTEH 1W72H 1AE6L 2EKSA 1JL8A 1QR1A 1A6VH 2XQBH 3NFPA 2OQJB 5DYOB 3U4BH 5DQ9B 3GMOA 1JF6A 4RFEA 3ARVA 3I6KB 3MLZL 5DQJA 4MNHB 3ARPA 4Z0BH 1YPZA 1PZ5A 1XF3A 1QSEB 5IFAH 1VERA 1VB9A 3UDWA 1IILE 1WAAE 2J88L 3D85A 1SYVB 3SHSA 1OB1A 3L5XL 3DVNA 3P0YL 5F1IB 2HVJB 1W0VB 2DBJA 4LLUB 5I1GH 3QUML 1GGBL 1DVFD 4ZSOA 4PRPD 4QRRE 2FBJL 1U8JB 4JKPH 1F11B 5HI4D 2BNUB 1T4KA 3MBEA 5DXWA 3O3EB 2AJUL 3ALWA 1RHFA 4YHOH 3ZHDA 5HD8C 4MS8C 1JGUH 3VFUB 1OAYH 1L7TL 1FVCA 4PG9A 4I18C 2JTDA 3ILPB 1P7KB 4XNMA 2Y1VA 1FG2B 5FHBH 1Q9WA 2XQYG 1MY5A 1BM3H 5K93A 1WC7A 4RGOH 3RBSA 5CJ5A 3VGEA 3REWA 1F6LL 3R8BB 2QHLA 2JJTA 1EO7A 3PWVA 2AXFB 1I7TA 4Q6IB 2GAZA 1GOHA 3S35X 2GT9A 3VXNB 3EFFB 1TPXC 2ZZUT 3AM8A 5JPMA 4LLMB 5D5MB 5TPWL 1NCAL 4UDTA 2UZYB 5F9DC 4RFNC 5BOPA 3E6HA 1I1AC 2BFVL 2GI7A 2UUDK 2ICWB 3PP3K 4M1DH 3NZHH 1LO0H 3GHBL 1W0YT 2DLFH 4OF7A 4TOYH 3MTRA 4RFOL 2BP3A 3KYOB 4LCWD 4LEOB 3TPUB 2ZJSL 2DJ4A 2B20A 1H15A 3O2VH 3AROA 1AGFB 3Q6FB 5I15H 5JNYB 1VA9A 2DD8H 2VABA 3D48R 5I8OH 2V2XB 1V3KA 2OS7A 3GKWL 2FIKA 2QKIB 2A0LD 2YBRB 1RK0B 2DQUL 5I73B 5C0FA 3GSOB 1A7NH 4XBGA 2XZAH 2PYEB 3O4LE 5TF1H 3BXNA 5KSAB 4G8GD 4LSRH 1C7SA 1HEZB 2GSIB 4WI7A 3G5ZB 3HCVB 3QDGA 2F54A 1WBXB 1JTTA 2JCCB 5IBTH 1Z5LA 5JOFB 5MP6H 5CUSL 3CFDA 2Y7QA 3HE6C 1Q38A 4S1QH 4JPVL 3SE8H 3ZE2F 3MUY1 5I66B 4AL8H 3UPRB 5IFJA 2QSCH 1HHIA 4X9FA 1OGAB 5ERWB 1MEXH 3G6JB 4V1DB 3P4NB 1IAKB 1JFQH 4I2XA 3AREC 5CS7A 2ZKHL 3J7HA 3QA3B 4A2MA 4WI8A 1F02I 4TPRL 3QWRD 3L3HA 4JN2B 2DIBA 5D1ZD 5DJZA 3GJFK 1AC6A 4ONGH 4CNIB 4MWFB 1CFVH 3W11C 2CK0H 4NRZA 4NO2A 1P53A 5I6XC 3T2QA 1INEL 4N5EC 4HKXA 1I7RB 4FZEH 4GG8A 3FB7A 3F12A 4X6CA 2VXVL 2BVYA 5FB8B 1H8OA 4AYFA 2X7LB 3C60D 2G5BB 3TWCH 1QD0A 1S9YB 2ID5A 3T0EC 1KGCD 3E3QE 5E94A 4PJ8C 2NYYD 4E41B 4NO3A 2YK1L 5GS0D 3P3YA 3UAJC 4HCRH 1BF8A 5TQ2L 4Y7MA 4NP4L 1MSPA 5B21A 1TNNA 1KELL 1WTGT 5DJYB 1EDQA 2ARJB 7FABL 5F96L 3SKJH 4KMLB 1S7XA 4NGHL 1FYTB 3HNSL 4EI6A 2OJEA 4XPTH 2YD3A 2ENSA 4FXKB 1Q72L 2HLAA 1R3JB 1NSNL 4P2RE 5FUOH 1OWWA 5I9QB 5IHZB 2VZOA 1B6UA 5J1AB 2QADB 4LCCC 1TVBB 1G7IB 5SV4A 4JR9H 1HH9A 3B9KD 1SJXA 4YK4B 3MJ6A 5I18L 3MRCB 3V6OC 5F9OL 2FR4A 2ZNXA 4Y19A 3SDXA 2X4QB 3I6GA 1RUKH 4LSDA 1KIPB 1LO4L 3TO4B 3TN0B 5I76A 2DM3A 5HGGS 1YDPA 5C0CB 2Q7YB 4PY8J 2DDQL 4ONFL 4YHKL 2UY6A 1YN7A 1SYSA 3C8KA 5KW9L 3ZLQC 5A40E 4OLXL 4Z95H 1P7QD 2HYMA 4M8QB 5E2VL 1CF8H 3ROOA 5GS2D 2R0KL 2B1AH 3BJ91 1FIEA 3QUXC 4XAWL 3V79C 5GRVL 4Z7OE 4JQIH 3HFMH 4EQ3A 3BZ4B 3GRWH 4EOWL 2FHBA 4YO0B 4ZXBA 2FLRT 4MMXC 4DN3L 1KG0B 3KYMA 5AZEH 4GXUM 3ULSA 5CEXA 2KL6A 4K9EL 1FVEB 4NQDA 4D9RE 4XPHL 1X5FA 5IR1B 4ORZC 1ZSDA 4F33B 2AK4E 2MOVA 4P4RA 1EHNA 2DLTA 2E27H 1CFTB 5E2WL 3FB8B 4QXUH 1BIIA 1JWMB 1IGCH 5I8CA 4HULB 3MRLB 2IPUK 2P5ED 5DYOA 2OQJA 5DQ9A 4M03A 3I6KA 3SE3A 2DL2A 1TENA 4MNHA 5T3XD 5J06A 3UTTE 1ZS8A 1RU9H 3UPCA 3O3DA 2HKFL 2N7AA 5E08H 3VXOA 1SYVA 1SMAA 3SDDC 3OTTA 3ZSTA 3HNTL 3MLVL 2O93L 1UZ8B 3WIHH 4JE4B 2R23B 2HVJA 4NPYB 5F1IA 1W0VA 4XAKE 4LLUA 4UTBH 4ODUA 4LIQL 1U8NB 4Y1AE 3KAAA 4NM8H 3OKNA 1U8JA 3TYFB 1LO3H 1F11A 1OAUL 2BNUA 3ARGD 2WINB 3O3EA 5A2JH 1PYWA 3VFUA 4CADB 3EOAA 2APBA 1CDCA 3ILPA 1P7KA 4EEEA 1C08A 4E42B 1FG2A 3GBMH 4OFIA 3VH8B 2BVOB 1PG7X 2J6EH 2X89A 4HZLA 4PLOB 1RIUL 3TYGL 2YD4A 3P77B 4X6FB 2XNAB 2ORBH 1NDGA 2AXFA 2OR7A 3QAZB 4HUWB 4UT9L 3DETC 4Q6IA 4AMKH 3VXNA 2KDGA 4LLMA 5C0BD 5D5MA 2OZ4A 4WUUB 3WE6B 4L8DB 1MHPL 1U42A 2V9QA 3WLBB 5TDOB 1UVQB 4OM1H 5EO1B 2OJZL 2ICWA 4WRLA 1I8MA 1MJ7L 5ALBL 5ADPL 5HYSB 3UJTH 3HI5H 4JPWL 5IM7B 3X11B 4LEOA 4OI8A 1AE6H 3TPUA 4NBZB 3TT1L 1F42A 1AGFA 3Q6FA 3QUKB 3MLZH 4L3EB 1UACL 3MBXL 1T1WA 2V2XA 2XI9A 4TSAL 2EIBA 1A8JH 1XF5A 3REVA