4TUOA

Crystal structure of monoclonal antibody against neuroblastoma associated antigen.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
214
structure length
205
Chain Sequence
EVQLLQSGPELEKPGASVMISCKASGSSFTGYNMNWVRQNIGKSLEWIGAIDPYYGGTSYNQKFKGRATLTVDKSSSTAYMHLKSLTSEDSAVYYCVSGMEYWGQGTSVTVSSAKTTAPSVYPLAPVCSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTWPSQSITCNVAHPASSTKVDKKIEPRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heavy chain of monoclonal antibody against neuroblastoma ass
publication title Structural Basis of GD2 Ganglioside and Mimetic Peptide Recognition by 14G2a Antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 42
structure length 205
sequence length 214
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4tuoA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4tuoA02
4NC0B 5F9DC 4NP4L 5EO9B 1MRFH 3IGAA 2AABL 3L3KB 4LDEB 4U6YA 1D9KD 4IOIA 3HMXL 2V17H 4D9LL 1EEZB 5FGBA 1WIPA 4L8SB 1KEMH 1NC4D 1SBSH 2N4IA 5L9DL 4HK0A 1RFDL 2YD9A 3LS5H 4I77L 3ZSSA 2EDLA 4PGDB 1MHCA 5DUPH 2AV1A 5DZNA 3RZCA 2JJSC 5KS9B 3WXVH 2XFXA 4LCYB 3MTRA 4JRXA 4MLSA 4HKJB 1JGVL 5GXBB 3KR3H 5A3ID 4IRJB 4JY5L 3QXWA 5D6CA 1KBGL 1T20B 4OI9A 5E1AA 1C5CL 1N6VA 3UC0H 3VFWA 1S7QB 1NMBL 3ZDYE 2GTWA 5HHPB 5GRVL 1VGEH 5D2NE 1A1NA 2BNRD 1HXYB 4E5XB 2ARJA 1XCTA 3D2UD 4YUEL 5B38A 4GBXA 4C56A 1ROWA 5HHQA 2OQJB 1MQKH 5F7DA 4JFDA 2NY3B 2DS4A 2AEWA 5EBWB 1BD2D 1JZ2A 3KYMB 1TTGA 2NY0B 2JJVA 3V5HB 4PRNA 1FDLH 4KK9C 1KXVC 5TE4H 4NT6B 1DQLH 4QHNA 4HGWA 1S7TB 2PR4L 4XNQA 2GHWB 3ECBB 3VFRA 2E9IA 4KI5F 1J86A 3C5SB 4Y16A 5E4EC 2XY2A 5E2WL 3FOMA 4KKBD 5LBSL 3TNMA 3F7YB 4MA7L 4K3EL 5IEHB 4KAQH 4OZIA 3S37H 1FSKB 1BOGA 3P3YA 5T3XE 3PABA 4XC3L 3G5ZB 4LLVA 4ZOEA 3DURA 2C3GA 3ZHLA 1U8QA 4PREA 4TSBH 4X8JA 5I1IH 4BH8A 1JBJA 2XQYG 1YN6A 3K46A 3FRUB 1HIMH 2EYTB 2F58L 5DC4B 1YN7A 4RAHA 5E9DE 4PRID 3V4PL 3QDGE 4ODXA 5KZCB 3KPLB 4KDWA 5DVOA 2VXQL 2P5EE 4PV9A 2IAMA 2YD4A 5SX5H 4LQFL 2CKBH 1IAII 3ZKQD 4NJAL 4Z7NF 3PGDA 3NACH 3SDAA 4XPAL 4QRRB 3E8UL 1MAML 2WMPA 2APBA 4HV8A 4P48A 5A3IC 3U82B 3JTTA 3N9GL 1GAFH 1H5BA 4Y4FB 1EMTL 2CQVA 2Y9RT 4DGIH 3TCXA 4NHUB 3UZQA 4GMTL 4PD4J 1QO3A 2X4QA 3VWJD 4D0BA 1JNLL 1NC2B 2QADB 3SDCB 1AGEA 3B9EA 2EXWD 1KF9B 3S5LG 1RK1B 3QFJA 1B4JH 1JE6A 1R5WB 1YJDL 4Q9QL 1BZQK 1U41A 4PJHB 3TLRA 1DLHB 5IR1A 4FQCH 4JN2A 1J1PL 3VFNA 5ERWB 3QWOB 3ALXA 3FCTA 3C2SA 5CP7A 4P23A 3O6KL 5C0DB 3MFFB 4QCIB 4XPTL 3MV9A 4J4PD 4KI5E 4L29A 3GGWA 2VQTA 4RFOL 2OXGA 5ANMB 4YHNA 4CNIA 3D48R 3KJ6L 4NQCE 1UM4L 2FJFB 3VXPB 5IK3A 4RNRA 5FIEA 4YX2H 1NUGA 5I1AA 2WBWB 3U4BL 1T1ZB 4QLRA 4U4BA 4R90L 1N0XH 4LLWB 1KPUA 2JCCE 4L4JA 5D8JH 4PJAF 3VFUA 3EO1A 4OLVL 2DKUA 3UPCA 5TQ0L 3TO2B 3P77B 5I2IB 4MB5A 1UXWB 1TJGH 3MRIB 3UP1A 4YFEA 2F5AL 2FD6L 3O6FA 1UZ8A 1VB9A 3O4LB 3HFML 3I6KA 1SM3L 4ZOAA 4MXWL 4N68A 4K71C 2AKRA 3DX9B 4PJCA 5J6HA 1KJ3H 3ROLB 1MCFA 5B4MD 4Z7NE 4U31A 1V8HA 4FQJL 25C8H 3CZJA 2AERT 2FX7L 3QUZD 4CUCA 1A2YA 4F7EB 5C9JA 1A3RL 1F4XL 3VWJC 1I7TA 3CFCL 3I3BA 2EXWC 4XVUD 5KN5B 4ODTL 1N64H 3VRLF 3MBEB 1FJ1A 4MJ4A 4X4XA 2SEBB 3DETC 5JW5B 1OAKH 1KN2L 3UO1L 3P73A 2XWBB 3H3PH 4LSRL 3BDYH 5IBUB 2P46B 5FOJA 2HT3D 1EH9A 1NJ9B 5LCVL 5LXGH 2YWZA 4M62L 2Q8BH 4PJEE 5HHMD 2JJTC 4Y2DD 3HG1A 4J4PC 4NZTL 1BQHB 3F6IA 1QQDA 3QUXD 4HJGB 1WBYB 1YDPB 4F7TA 3DVIA 5JNYA 7CGTA 2EDYA 3NBNA 2YA0A 2V2XB 1FVDB 1A7QL 1UKSA 5I9QC 5JHDE 4KK5C 2X7LB 4TNWF 3EAKA 2FSEA 2NY1D 4U2ZA 4FXGA 4OT1H 1JI1A 4NN7C 1JMZA 2VXTL 4PBWD 3W9EA 4JQXA 3RY5A 3OX8A 5JPMA 1T83A 2HN7A 4X5XA 5GHWL 4KMQA 5I8EB 4PJGB 4X6FA 4PJAE 1BJ1H 3EDDA 3H42L 5JHLH 4X7DC 4G6ML 3MFGB 4OFKA 1IQWL 4N90D 3D39E 2A77H 3VGAC 4BKLA 2R39A 1U3HA 3QQ3A 3FO1B 1KFAH 1XIWD 1LDPH 3DUSB 1IRAY 3FFCD 2CDFB 1FVEA 5HYJE 5B4MC 5CEYB 5GGQH 2P44B 4Y19D 3PWUB 1CLZL 3SQOL 3QUZC 4L4TB 1MREL 2VLJA 2B4CC 1T21B 3TCLB 1W2KT 1CLOH 1AXSB 4FQPA 1Y6KR 4JPKL 3PWJA 3IRPX 1FNGB 2HT2D 4M7LT 4QTHA 3NPSB 4IIQC 2VLKE 5T1MA 4XVUC 5F93C 5I74C 1RSFA 1NFDF 3OB0H 4PB0H 5T3ZH 4X98A 3D85B 3V8CA 3EYOB 5EG6C 1E4XL 2D7TL 4AY0A 2BZDA 1A6TA 1DLFL 2Z35B 1XH3B 1DBBH 1G7JA 4YHOL 3VRLE 4PJ8A 3MNZB 5DJ2B 3DJ9A 2VDLH 3DWTA 3ZHDA 5IW3A 4EIZC 4RFEB 2NTSP 1IGCL 1LEGB 1Q8MA 1JF5A 5DUMH 4UIMA 3QO0B 5EIQA 3O3DA 4ZQKA 3RY4A 2YEZA 3QUXC 4MA1C 3MRDB 4X6CF 5MERB 1Z3GH 1IAIM 2GIYA 2I07B 2XOTA 4ZUSA 4U1HB 1KLGA 4XVTH 1FGNL 2NY1C 4AEIH 5CJOL 4U1LA 4GXUN 5IVXA 3ZKXC 4MMXC 2EIZB 4PG2C 4WFFE 4H8WL 2Z92A 3BYTA 1U92A 1OWRM 3B6SA 4PLNC 3MLXL 3V6OE 3CFKB 1G7MA 1X5KA 4QHKJ 4XP9L 5DRWA 1G7LB 1XIWC 2I24N 2ADIA 1PG7L 2CGRL 2WW8A 3QIWD 1W0YT 3W5NA 2NY5H 4I8DA 3QQ4A 3LOWA 3T04D 3V52L 3EYVA 4PGEB 1WTGT 4YDLC 2EDRA 3O3UN 2FRGP 5LGHH 3BAEL 3L5JA 2QV2A 2QR0B 5IFHH 4P4RB 2VISA 4LF3B 2AQ3A 4PJ5A 5JR1H 3BEWB 3NVQA 3BMVA 1R3IL 2FEDD 5IMKA 5I8CB 1LEIA 2HT2C 1RPQA 4CL7A 4WFGE 3B2VL 2GTZA 3F7VA 4K9EC 3CSGA 3CDGB 2HA1A 3UX9B 1AD0B 1TETL 4ZD3L 5HDOA 5C0EB 1G9MC 4RRPA 2ATKA 5LGJA 3BPNC 4Z0BL 4XTRD 1WWBX 3PP4L 2C4FU 4N5EC 3RKDD 1XZ0B 5GIRB 1NFDE 4M48H 2OI9C 5EO9A 1QACA 3L3KA 2HFFB 1U2HA 2BNQB 3W2DL 5C09B 1K6QL 1EEZA 4JO3H 4GG6F 1REIA 3RVUD 4L8SA 1AGDB 3RHWF 5KANG 4G6AD 3RIAK 4PGDA 4TVPD 3FZUD 4GW1B 4UOW0 5KS9A 4LCYA 4Q6IC 1CZ8L 4LHUB 4PRHD 3AC0A 1CFVL 4HKJA 4KV5E 5L0QB 1PDKA 2IH3B 3T0XA 4IRJA 2EDWA 4X6CE 3T2NH 4U6TA 3JWOC 1T20A 4LKXB 4U6VH 4HUNB 3K3QA 1S7QA 3O8XB 5KTEL 4G7YL 5GRJL 5HHPA 3ALWA 3W0WE 4NBZB 1HXYA 4E5XA 2J12B 3EHBD 1GGYA 4JGUA 2OQJA 3CVHH 3L9RB 5EBWA 3MXWH 3ARBC 2FBJL 3KYMA 3S98A 2EE3A 3V5HA 1NBVH 4GRWH 1KACB 4NT6A 5GGSB 1S7TA 5CUSL 5D2NB 2FL5B 1CR9H 4DGVH 3ECBA 1NL0L 4FQ1L 1HH6B 3SCMB 5HHXL 3C5SA 4Z7OF 1JNNH 3F7YA 1IKNA 5IEHA 5I1CL 4ZUTB 3G5ZA 1PZ5B 2EDEA 4JKMA 2ZNXA 1LILA 4XAKE 3WN5C 2FEDC 3B2UD 1EUTA 2UY6A 3U30B 2BVQB 4IRZH 1X4YA 4YDVB 5I1JH 2HMID 1QBML 1XF3B 4HWBL 1M05B 3DX6B 3FRUA 4NWUH 4XTRC 2EYTA 3ZDZF 3RKDC 4JRYD 3KWWB 5MHSD 4OD2B 1IC4L 1ZS8B 3KYKH 2AK4E 3S97C 3KPLA 1GGBL 5T5FL 1DR9A 3CK0L 1Q72L 1J87A 4GXVL 1KV3A 3FQXB 4JCLA 3RVUC 1A7RL 4D94A 3HUJB 1NCBH 2UWEF 3GUTB 5F7EL 3W81A 2DQDH 2GT9B 2A9MH 5CJBA 1P9MC 4J1UB 5E9DB 5SV4A 3FQNB 4QRRA 3HB3D 4DAGL 3DV6B 4YHIB 3JWDH 4ZOBA 1DSFL 1V5JA 4ZNEE 4Y4FA 4HLZH 1J05B 1F45A 4R7DB 4ZS7L 4L3CB 5HVHB 4NHUA 3FN0L 1WWAX 4JLRB 3C08H 3EHBC 4F57H 1FLRH 4MNQD 4K8RD 4LVOC 1NC2A 2BFVH 2R0KL 3SDCA 1ZXQA 3MA7B 3BZ4B 3VG0H 2A38A 1RK1A 4I48B 5I19H 3BQUB 4OLZH 1M6OB 2VMFA 3H9ZA 1R5WA 1CXHA 4Y4KB 1CTNA 5FYLH 3MCKB 4PJHA 2P1YA 1DLHA 1CDGA 5ERWA 3QWOA 4HQQH 4XP1L 5C0DA 3MFFA 2FO4B 5JXAL 2ADJB 1KOAA 2FATH 2DQEH 4YGAB 3BZEB 3SGDI 3WFCH 4Z7OE 4Z7UB 3CIQA 3GZKA 5CAYB 5CKAA 5AAWA 5ANMA 3ULUD 1J0JA 3BGAA 3B2UC 3VXPA 2FJFA 3IAPA 1EVUA 3HI6H 5BJTB 5ILTH 5IWLA 4WJ5B 5TPWL 5ACZB 1FYHB 5D1ZD 3BKCL 4WENB 1T1ZA 1KGCD 4LLWA 4YH6A 1KCRH 3TYFB 1BBJB 4HWZB 2DQJL 3TO2A 3P77A 3ZDZE 3JWDC 5I2IA 4NQCB 1UXWA 4Z8FH 3MRIA 2UUDK 5CMAB 4NC1C 3O4LA 3C6LD 1C12B 2JCCB 2ICEB 1H3PL 1O7VA 3DX9A 3KS0J 3HB3C 5D71H 3ROLA 5E8DH 5CZKA 3QP3A 1A8JH 2FB4L 3MXVH 4KHXL 1PEZA 1GOGA 3CX5K 1MFDL 5DHVB 2EE6A 2QTEA 4MSWB 2QHRH 3HE6D 3IRZA 4NKOB 2AGJL 4F7EA 2NX5D 3GHEH 4K8RC 4XWGH 3UCRA 1K4CB 4XCYB 5HJ3B 5DO2D 2B39A 2JTDA 2IF7A 2V9TA 2AI0H 5KN5A 1HZHH 4P3CL 2BVTA 4K94H 1HQRB 3MBEA 2SEBA 4HS6B 5JW5A 5T1DL 3SBWA 1WZKA 2GUOB 2XWBA 2EE9A 4FZ8L 5DD5L 3FO9B 3LIZL 4Z7WB 1NJ9A 1WFNA 1CE6B 5HI5D 3BD5A 3WD5H 1BQHA 4HJGA 1WBYA 1YDPA 2ARJQ 4NHCL 1K8DB 2OSLB 3U7AA 1VSCA 1FVDA 2KUTA 2V2XA 4M7ZC 4DKFH 4H25B 3L3JB 2JIXD 5DR5H 4R0LB 2CJUH 1D5XB 5D1ZC 1MUJB 1T2QH 2X7LA 1N59B 4PJEB 1IQDB 2V7NB 3K0WA 1C1EL 1MCPH 3R06B 2VC2L 4N8CH 3QIUD 4U6HB 3RBGA 3P11H 5I8EA 1OY3B 4ZG1A 4PJGA 3G5XB 5KVDL 1IARB 2E6QA 4FFVD 2R0ZL 4HC1L 4PJIF 1PLGH 5FUOL 1KUMA 2QL1A 4YXLH 1QUNA 3QCUH 3SE3C 1JV5B 3FO1A 4FQXD 3DUSA 5DD6B 2CDFA 2VERN 4JRWA 1TPXC 1BM3H 3GMMB 4ELKB 1KIQB 5CEYA 3REWB 4UDUB 1UH4A 1OAYH 3RA7H 2IAND 3HE6C 3PWUA 4OZGE 3GIZH 4OZHE 4O2CB 4YAQB 4L4TA 3MRRB 2RQ8A 1I9IL 3LQAH 1T21A 3MJGX 3TCLA 1AXSA 1FV1B 3PIQB 4F15C 2IBZX 1YA5A 2X4UB 2OM5A 4YDIL 4O02H 3C09B 2B2XH 2GJ6D 5DO2C 3BRDA 2FR4B 5A43C 2HRPH 1JHTB 1IBGH 5CHNB 4JHAH 3D85A 3EYOA 1I7RB 3VFGL 2XWTB 1UT9A 5GGRY 1BZ9B 2Z35A 1XH3A 5E2UH 4R4ND 3G6AB 4V2BA 2Y23A 3MNZA 5DJ2A 1ZT7B 2YC1B 3TH2T 4RFEA 1LEGA 1RZ7H 1A6AB 2VLKB 3TESA 3QO0A 1MCWW 1MELA 4RA0C 4TNWK 1GGTA 3PGFL 3RDTD 2XZCH 4BSJA 1E6JL 2DIBA 3MRDA 4NN5B 1ADQA 5MERA 1IAOB 2VRAA 2VR4A 2I07A 4ACPA 3SDXF 3PL6D 4U1HA 4UT6H 3DIFB 5FYJD 4L1HA 1FAIH 1EAJA 4APQC 4PUBH 1KB5B 4UTBL 3MLWH 4P4KB 1DBAH 2EIZA 2B4CL 2EICA 3S37X 2AW2A 3QIUC 4LPVA 1ES0B 4LSSL 3MGAA 3TVMD 3D3VD 1NPUA 2ZUQC 4QEGA 4QKXB 1RVFH 1SYVB 4FFVC 3V0WH 3ZSTA 3P4OB 3DVFA 1S3KL 1JGLL 3CFKA 3V4VL 4PJIE 4FQXC 1G7LA 2NY4D 5B39G 5CJXC 5SV3A 3FHAA 1JYNA 4EN3D 3Q5YA 1CK0L 1TCRB 4UQ3B 1UM6L 4PGEA 2KPNA 2MKWA 5IB5B 1JPFB 2W9EL 1U6AL 2EO1A 2QR0A 4F9LA 4P4RA 4I3RL 1K9TA 4LF3A 3MLPA 3BKML 4G3YH 3BEWA 5I8CA 2KQMA 4XVSH 3HI1B 3S36L 4QXGH 1WWCA 3CDGA 1AD0A 2ZCHH 4UILL 5C0EA 5MP6H 4PG9B 2OR9H 1MAJA 2IQ9H 1XZ0A 5GIRA 2EZ0D 4HK3N 4R4NC 5ADPH 2R56L 2H6PB 3SOBL 1JGEB 4EQ3A 2HFFA 2BNQA 5C09A 3QUML 1OGAD 4YHLH 4M6OH 1WUNT 4JPIB 15C8L 1OGTB 3PXJA 3RDTC 3TJEL 2DI9A 1CDHA 1AGDA 5EDXA 3GK8H 3FB8B 3HMWL 1U8IB 5C70A 4GW1A 3ZE2F 4P2QB 3CDYA 4PGCB 4N0FB 1V7NH 4BQ8A 2FX8H 4LHUA 4XPGL 2IH3A 2IG2L 3U1SH 4ZO8A 4LKXA 3SJVD 3SDXE 1PKOA 3O8XA 2VDKL 4AK1A 3HC3H 3TVMC 2YUWA 4BFIB 1LO0H 5DC9B 1MFBL 3WE6B 3RTQB 3FQRB 2HVJB 4PPTA 3L9RA 1A3QA 3U36B 3DGCR 4HCRL 4K9EL 3TBYB 1TZGL 1MWAL 4FFWC 1G9ML 4LRIA 2NY4C 4M5ZL 5GGSA 1HKLH 5D2NA 2FL5A 3VXUD 2OP4L 1WZ1L 4YQXL 1HH6A 3SCMA 3DVNB 4Q74A 1NMAL 2J88L 4ZUVB 1W72B 4HEPG 1W8OA 4LNVA 4QHKI 1A14H 3OAYK 4H20H 4PYHA 4U3HA 4ZUTA 1VENA 1PZ5A 4BSWB 3GJFB 1Q0YH 2AEQL 5IBLD 1E4XI 4N8PA 2BVQA 1KYOK 4DVRL 4YDVA 4RFNB 5L7XL 3TPUB 1XF3A 3JWOL 3QJFB 3RHWK 1TENA 1M05A 3DX6A 2H2PD 3E3QE 5DVKA 4LIQE 2EZ0C 3KWWA 4ODHL 4OD2A 1HCFX 4XPHH 1ZS8A 5ALBH 2W38A 5GISH 4AEHH 2VABB 3FQXA 3OAUL 5EZLB 3IU3B 3H9SD 3HUJA 1PKQE 2APTA 2YD6A 5C0CE 2DJSA 3GUTA 4YLQT 2BJMH 2GT9A 1CDUA 3BH8B 5GS1C 2CXKA 5C0AE 5I1EL 1AQKH 4JKWA 4J1UA 1CBVH 4N8VG 4YXHH 2YPVL 5E9DA 3FQNA 2AK4B 3NCJH 3DV6A 4YHIA 1KN4L 1VESA 1LO4H 4P46B 3EJZD 1J05A 4R7DA 4OZFH 4L3CA 4Y1AE 2R23B 3B9AA 4FQ2L 5CGYD 4Q0XL 2IFFH 5TFSH 4EVNB 3S3PA 3J7HA 1DFBH 3E2HC 4A6YH 4JLRA 4LASH 5CILH 4NFBA 2G75B 1IVLA 1X5JA 5FAAA 3MA7A 3BZ4A 3PWVB 5J57B 3WO4B 4I48A 3NAAL 5BV7B 3BQUA 3O45B 1M6OA 1RU9H 4Y4KA 5M7QA 2HH0L 3MCKA 4RMQA 4F2MB 4HFUH 3U48A 2BOBB 1J5OH 2OXHA 3GBNL 1KJ2B 1CGTA 1S7XB 2FO4A 5DJAB 2ADJA 1SJVA 3QCVH 4JDTH 3BZEA 4S1SL 4PRDB 4NBYB 5D2LF 5FKPB 4N0YH 4Z7UA 4JG0L 1MNUL 4TVPL 1KCUH 1UADC 4HF5H 1NCAH 4TOYH 5IBLC 2J5LC 5BJTA 4WJ5A 1VFAB 2XXMB 5ACZA 4WW2B 3SPVB 1FBIH 4KDTC 3ARUA 3G6JF 2EO9A 2H2PC 3R8BB 3TYFA 5JOFB 1DN0B 3QDMB 1CVRA 1BBJA 3FL7A 2E27H 3KYOB 4HWZA 3EOBB 1TQBC 2P49B 4NQCA 4P2OD 4NCDA 1OHQA 1J10A 4M7LH 3T2PA 5CMAA 4MX7B 1OARL 3R1GL 5E2JA 2R2HB 3MREB 1C12A 2JCCA 2MTPA 2ICEA 2NR6D 1B6UA 3L5XL 2NZ9C 5D1QD 5AYUL 3WS3B 5DDHB 1OM3L 3KNBB 5C7XH 1FNSL 2QQLH 1EEYB 3VGGA 5DHVA 3UTPE 4MSWA 1YQVL 4NKOA 1XT5A 2DL9A 5CGYC 4M3JA 5HI3D 1UWGH 4BQ9A 4FFZL 4HWEH 3HE7B 1EO8L 1UM5H 1K4CA 4XCYA 1MIEH 1B9ZA 5HJ3A 1TVDA 4M7JL 4K7FB 1HN1A 4PRHE 1JZ4A 1HQRA 4FN0A 2FH6A 4HS6A 1XMWA 5HXMA 1RURL 1WCQA 2GUOA 3MMEA 3QEQD 1MCHA 4KTYA 1EV2E 3FO9A 1QTYT 4ZO6A 1QYGH 4Z7WA 4WEUD 1CE6A 4OQTL 5SWSD 4GSDL 4PP1C 4XCEB 4CDHA 4YXKL 5CEZE 4AQ1B 3MJ6A 4C57C 1K8DA 2OSLA 1MIMH 3EUUA 3NZ8B 1KTLB 5D2LE 4TPRH 2BSED 3L3JA 4GAYB 2DQTH 4H25A 2XACC 2RGSA 3KDMB 1MJ7L 4RX4D 1KXTB 4R0LA 1D5XA 3W9DB 1P7QB 1MUJA 1N59A 4PJEA 1IQDA 4RMUA 2V7NA 2D9CA 2IPTH 3R06A 1FRGH 1YMMD 3ULUF 3TH3T 1RUQH 4K3DL 4U6HA 1DQDH 1LNUB 3G6JE 4R8WL 3QAZC 2A1WH 4L3ED 4P2OC 4HXBH 3G5XA 4K8RL 2R0WL 4PRPE 2OJEB 5IJKA 3TN0B 1KTKE 5JQ6H 4LSPH 4ODVL 2EKSB 4ZS6D 4R2GD 4I0PB 2V2WB 1JV5A 2HRLA 5FHBL 1J9CT 4RISH 2NR6C 3NFSL 5F96L 5DD6A 4MDIB 5GZNC 3DXAB 2UYLB 3GMMA 4JHZA 4I5BB 4NN6B 4PFEA 4ELKA 1KIQA 4V1DE 1DANU 3REWA 3BSZH 4UDUA 2YRPA 3EDEA 4M7KL 3EKCA 2CUIA 3Q3GB 1MAKA 4GT7A 4O2CA 3MRRA 3SQBA 4YAQA 1IE5A 1RV6X 2YXFA 2Z8RA 1FP5A 4ZTOL 5CP3A 1FFNB 5HI3C 1FV1A 3PIQA 5F89B 2X4UA 3MODH 3P4NB 3ULUL 4LPUA 2BDNL 2D03H 4XH2B 3FFDB 2VN7A 5FCSH 2OZ4L 2FR4A 3E6FB 1N0LA 1AI1H 2BY2A 3NA4A 5BO1L 1JHTA 4KXZI 1T7YA 2CD0A 4OZGB 4BZ1H 4OZHB 5CHNA 3VW3H 2AJSH 3FQWB 3L3GB 4GBXD 4C56D 1I7RA 1T03H 2M8XA 2XWTA 1MCEA 4DK3A 1BZ9A 4JFDD 5E8EB 3P30L 3G6AA 2EDXA 3DO3A 4IJ3B 1ZT7A 2YC1A 4YEEA 1A6AA 2VLKA 3UYRH 4MA3B 2YRZA 4MXQC 1JZ3A 3NCMA 3WEXA 1KCVL 4G6JH 3KLHD 3KPSB 1A7PH 2GK2A 5C0BD 4TULL 1WEJH 4X6EB 2D7OA 3U9PH 1IAOA 4XBPB 3B8YA 5BW7A 3N1MC 2R1XB 1OAQH 5DQJB 3VXSE 4GFTB 4IMLB 3DIFA 2E7LC 2FNBA 3MRCB 3BKJL 4KQ3H 4RMWA 4EUPB 1KB5A 4FQLL 4MXVF 5D1XB 3LKRB 4P4KA 3MYJB 2OR8A 1LDSA 2DD8H 1ES0A 4S0SD 5EU7C 5TF1H 2AQ1A 3O41A 3ESUF 3ULUE 1MJ8L 1SYVA 1BGXH 1TITA 4J3XA 3P4OA 5BRZE 1R0AL 1PZUB 2HTKC 1P53A 4ZS6C 4R2GC 1XF5B 1JRHL 1UEYA 2O5ZH 5AEAA 4KQ4L 5E2TL 5DEFB 1TCRA 3OR7B 4UQ3A 5JMOC 12E8L 1DCLA 5KW9L 2VXUL 2Y06L 3SDAD 1JP5A 5IB5A 1JPFA 3NGBB 5J12B 4QHUB 2IBZY 5TGBB 4KUZL 4DK6A 3MJ8B 3X3GL 1FNEB 32C2B 5DGRA 2PKDA 1YY8B 5EO1B 3CU7A 4HPYH 3HI1A 3FO0L 4YDJB 1F6LL 1S7VB 4G8EB 5KVGL 3M07A 4PG9A 1U3ZA 4GBXC 5FYKH 2FDBP 5DI8B 4P9HC 3G6DH 3LN5B 2H6PA 5LGKA 1CXIA 1JGEA 1CCZA 1I9EA 5CP3H 2CUHA 3QFJD 4HJJH 4NKIL 5DRXB 1VGKB 5TJWK 4JPIA 3MACL 1OGTA 3JUYA 1UGNA 3KLHC 3FB8A 3WDIA 1U8IA 4P23D 3QXAB 4P2QA 4L8DB 3QG7H 4PGCA 4N0FA 3V95A 4MQSB 3V9FA 3W39B 3MV8E 4IMKA 3SO3C 3OB8A 5MEQB 1NLBL 5C2BH 4MJIB 1YY9D 4RIRB 1CLCA 1XGTB 4MXVE 2R29L 4KRPB 4BFIA 4LVEA 4AIXA 2DM3A 4U7SA 3RTQA 3FQRA 3WE6A 4KHTH 5KSUB 2HVJA 5IBTH 3U36A 3TBYA 4LCWD 2IWGA 4FQIL 5TE6H 1YNKL 2F5BL 4NWTL 3PUCA 1QKZL 1B0RB 1H3WM 2OK0H 3O6FD 2ENYA 1CXKA 2X6MA 3DVNA 1I8MB 1NDMB 2AJUL 3IFLH 1OOAA 1GZQB 1E6OH 4ZUVA 3SDAC 3MLTB 4JB9H 5L8JB 3KPPB 4RGOL 2YK1H 2Y5EA 5C0ND 1CICD 2HLFD 3H9HB 4BSWA 4UTAH 5JDJA 4PJ9B 3GJFA 5AD0B 5ICXB 1BP3B 1H5BC 5MI0C 4NUJB 1JZ5A 4KUCD 1EHXA 2VDML 3TPUA 1HDMB 4HIIB 5FYJL 3QJFA 4X80H 4CW1B 1D6VL 1IEHA 4MVBD 3TWCH 3GSQB 2FCBA 1F4YL 4XNXH 3TJHD 3TFKD 2VABA 2LABA 3OKOB 3CSPA 4XP5L 5EZLA 3IU3A 3QEGH 4OFPA 1YNLH 2N56A 4G5ZL 3BH8A 4G9FD 4K7PH 2B0SH 4P23C 3NA9L 4UAOB 2AK4A 3EFDL 4NJ9H 2EIDA 5IROA 3MLSL 4RRPG 1ND0B 4P46A 2X9WA 2VTFA 4A2MA 4Y5XB 3WNMA 1YY9C 5C0CB 2YD3A 4RMVA 3WNKA 2R23A 4CMHB 4EVNA 3MBXH 4NGHH 1N6QL 5IP4A 5EBGA 1E4KA 4HLZG 2ZKHH 1HI6B 2G75A 3HZMB 3MV7B 2BVYA 2YUXA 1QSFB 1NDGB 3PWVA 2E7MA 2VWEE 4QHLB 1BEYL 4ZNEA 2QSCH 3TC9A 1KULA 3O45A 3WHE1 4JVWA 4DVBB 1RZ8B 5DK0B 2E8YA 3HNVL 4S0TD 4F2MA 2BOBA 4KTEH 3X12B 3VGFA 1KJ2A 1U3HD 4YFDB 1S7XA 4TQEH 2GITB 5DJAA 3CLFH 4UT7L 3MRPB 1SBBA 3ARRA 1PJ9A 4PRDA 5FKPA 5C0NC 3AREB 1CICC 2HLFC 2LU4A 4JKPL 3RL2B 1I8IB 1UWXK 4JN1L 5EC1B 5E94B 3RGHA 4YK4B 1NAMB 5DJ8B 1VFAA 1AJ7H 3QQ9D 4WW2A 1MCOL 3SPVA 2DI7A 3MZGB 1QBLH 1SY6H 1V7MH 2WAHA 2XKNB 5JOFA 1DN0A 3QCTL 3QDMA 4KKLC 4KJYB 4R26H 1KENL 4LVHB 3KYOA 3O0RL 3EOBA 3TJHC 2VDNH 3TFKC 4AIOA 3BO8B 3OKKB 5GS0D 5FHAH 5KVMC 1GC1H 3GJFH 4MX7A 5ICZB 4DKAA 2YR3A 2W9DH 2R2HA 4PJ8D 3MREA 1HINL 4YWGL 3UTTE 1Q94B 4NCC2 2VJXA 3ZL4L 1YEDB 2YD1A 1N3NB 5DD3L 2Z31B 3WS3A 5DDHA 3KNBA 2CKNA 4W4OC 1JYVA 1EEYA 1K3ZA 1IZJA 3L5IA 1I3GL 5F71A 2EYRB 5KVEH 2HJLB 3Q48A 5F6HJ 1EXUB 1BX2B 4U1IB 4RGNE 1L4IA 2DQFB 5I66B 1Z0MA 1MVFA 1IT9H 1DZBA 3HE7A 1KB9K 3V5KB 3HZVB 5ITFB 1JWMB 3VRIB 5EZOL 3LZFL 4JFOB 4K7FA 1T83C 3MLZH 5GJSL 1N6UA 2VB5A 5GRZA 1G84A 3WIHL 3TA3B 3PQYE 1II4E 1KLFA 1FO0L 3UTSB 1AGBB 1UJ3C 4U1JB 2V2TB 2P4AB 4XZUB 1U3HC 3BHBB 4FXLA 1BQLH 1NUDA 4UT9L 3WS6A 4XCEA 1FORH 1A3LL 3TH4T 2XTJB 2DTMH 4YE4L 4POYA 4F9PA 3NZ8A 3VXQB 1KTLA 1NCDL 4B53A 3BPOB 7FABL 2OJZH 4MLIA 4GAYA 1NCWL 4JM2D 1GC1C 1CF8L 3KDMA 2B5IB 1YUHB 4FNLL 3W9DA 3INUH 1P7QA 3QQ9C 2ZG2A 4N9GB 4PJ5D 3VWKB 5F9WC 1QFOA 2BMKB 2R69H 1ZLUK 5CLTA 5FV1L 5C6WH 3QZWB 4JM4L 1C8PA 1LNUA 4X7SH 1NCUA 2WIMA 4ZFOL 5CIPB 5D2LB 1MPAH 3V6BR 4TTDD 4FFYL 1YEHL 5GS0C 2QSVA 2OJEA 1CGSL 3TN0A 1KEGH 4ODUB 5JA9A 1YEGL 2EKSA 4FHBD 3O6MH 4I0PA 2V2WA 3MOQA 1CU4H 1QLEH 4M1CC 3CZFB 4MDIA 4Q7DA 3LKSB 1TQCC 3DXAA 4WTXA 1DBML 2E7CA 2G2RB 2UYLA 4I5BA 3T65B 4PRPB 4NKDB 3LSOB 4WCYL 3Q3GA 3VD5A 4ZODA 1FFNA 1JTTA 4ZXBD 4M5YL 3A6OA 1BFVH 3GSWB 5F89A 2DMKA 3P4NA 1SMOA 4XH2A 3T4YB 2IH1B 3FFDA 1IAIH 3FB5B 3E6FA 4JGMA 3G08B 5C07D 5ESQB 3IDXH 3IYLW 4XPBH 4OZGA 4OZHA 1KG0B 1KELH 3L3GA 3FQWA 4UV7H 4GKSB 4LHJB 2DLTA 1SBSL 2CUMA 3TIDB 2PYED 5E8EA 3RQ3A 4LCCC 5CJQL 5GGRB 3WXVL 2NY0D 1MCSA 4MA3A 3C2AL 4QHMB 1UACL 4RZCB 2JELH 4Z78B 1OAUL 1PSKH 4Q9CA 1I9JH 2ICWB 2FGZA 3KPSA 2CLVB 5AZ2L 2NY6B 2E7HA 4X6EA 1J0KA 2MMXA 3B8SA 4WUUB 5DA4A 4XBPA 2R1XA 3U2SB 1YECL 4JM2C 2YUVA 5DQJA 2YWYA 2PO6B 2FWOB 1Q9OB 3MRCA 3UYPA 3JXAA 3K74B 1MCKA 5FUZH 4EUPA 5D1XA 3LKRA 2D9QB 3MYJA 2NPLX 3CXDL 4YIQB 3UJTL 3LD8C 2EDQA 2YD2A 5IBUG 3EOAB 5JOPD 4TUJB 4TTDC 1DQLL 4LVNB 4GQPH 3PV7A 1FNAA 1BQHG 5IF0B 2X89A 4ESKA 5KZCD 1XF5A 5HGBB 5GS2H 5JXEA 4EOWH 1ZHKB 2VLRE 4OM1H 3O2DH 1R3JB 3CH8A 3ULSB 5DEFA 3OR7A 3B9KB 5BRZB 5IV2B 4HW6A 2Z8VC 4QHUA 2L4OA 2MQ3A 5TGBA 4ZXBC 3MJ8A 1FNEA 32C2A 4O51B 1HIML 1F8TH 4FP8L 4OF5A 2ESVE 1BWMA 1YY8A 5EO1A 3S8WA 4HK3J 2DKMA 4D9RE 4YDJA 1S7VA 4G80B 4G8EA 5ICYB 5IESH 2RJMA 4M93B 4HSQA 1NC2D 2QADD 4GUPB 3VFPB 5DI8A 2CKBL 5I0DA 3LN5A 2ZWLT 1YEFL 4MMZC 5HHVH 2NY0C 2DLEA 3KLDA 5DRXA 1VGKA 3LEVH 5DQDH 2HVKB 1FGVL 2I5YH 3AM8A 3NTCL 4JFPB 1RUAH 1U8OB 2QSTA 5CINL 2G60H 3QXAA 4L8DA 2VKWA 3MRNB 2D0FA 3W39A 2XRAL 3X11B 5MEQA 4YHYB 1A5FH 3L3DB 2OL3H 4ONGL 3HHRB 4MJIA 2QQQA 1LE9B 3HCVB 1IFHL 2R0LL 4JFEE 4XMLL 4ONFL 1UYWL 3QPXL 5BVPH 4RIRA 1XGTA 2G9HB 1ZV5A 4WFEE 3QG6B 4NO0B 4QGYA 4P59H 1RIHH 5KSUA 2KL6A 5BOPA 5J1TC 1WWWX 2BHUA 2X9YA 2O5XH 5MENE 5EOQL 1B0RA 4K3HA 1AO7B 1IGIH 4P9HL 4EUPH 3HC4L 3ULVH 5I17B 3O4LD 4D9QE 3N50A 4W68A 1I8MA 4G43B 1NDMA 1WFUA 1P4BL 1XGQB 1GZQA 4LSTH 2WK2A 3MLTA 1HXMB 3KPPA 3BE1H 1JPSL 1EFXB 1OP3H 3H9HA 5KANI 1ZGLM 5B21A 1U8LB 4PJ9A 5AD0A 5ICXA 1B88A 1NANI 3TZVB 3ARYA 4NUJA 4XMPH 1WAAE 1HDMA 1TJGL 3QUKB 4HIIA 1F11B 5J13B 1UKQA 4S1DD 4CW1A 2EDOA 4JRXE 3GSQA 1V05A 3I9GH 3SEPA 3MBED 4NM8H 3OKOA 3ET9F 3MLUL 1QD0A 1OLZA 1XCQB 4OCSH 5KOVC 5K9JL 3V4UH 4YC2B 5DJZB 3C60B 1EGJA 4C56E 3GKWL 2I26N 4BK4A 5DMIH 2C9AA 3WKML 3ARFD 1ND0A 2EEBA 4ZFZB 4Y5XA 5C0CA 4LDLB 3WCYA 5JZ7D 4GRLD 5K9QG 1Z9SA 5JA8B 5IWLC 4HZAA 4NQED 3RWGB 1HI6A 4OF6A 4OZFG 1JRHI 2ID5A 1AP2B 5GGTA 3HZMA 3MV7A 5FV2A 1QSFA 1NDGA 4G6KH 4KMTH 4QHLA 3WIIL 5GS3A 2R4SL 5MEPB 4KK6D 2Q8BL 1IILE 1IGMH 5D7SL 2CPCA 1QRKA 1X5XA 3T0EE 4KU1A 4DVBA 1FZJB 1RZ8A 4UU9B 5DK0A 4JPVH 1H3VA 4HAGA 3ZYOA 1JFQL 2HTLD 5I30L 3BRFA 1EHLH 3LS4L 3X12A 3DTXB 2FX9L 2GITA 1Z9LA 1IEAB 3MRPA 3AREA 4LGPB 4Y5YB 1F3JB 3F65A 3RL2A 1I8IA 2VDQL 4MJ6B 4H0HB 1MJUL 3NFPB 2XWJB 4HIJB 4L4TD 4LSVH 5E94A 5EC1A 5EBLB 1FNHA 1NAMA 3GRWH 2X1WL 5DJ8A 3U7YL 4D0CB 4PJCF 5JHLL 4Z7QF 5D70H 4G8FB 2XKNA 1BZ7B 4S1DC 5IW6B 4KJYA 1L7IL 3P0YH 3QRGH 3MBEC 3BO8A 3OV6A 4KJQD 4R7NB 3D85D 3OKKA 4TSCL 1ZLWK 2VKXA 1J7VR 5EA0H 4OQ1A 5B8CC 2E5EA 5J9PB 5ICZA 5J11B 2Y6SD 4EBQH 1Q94A 1R3HB 1YEDA 1N3NA 4U1NB 2Z31A 1ACYL 1CLOL 1XF4B 3ARFC 2C1PB 3KGRA 5F6IB 5IQ9B 2YOCA 2EYRA 3QFJE 3D0LB 2HJLA 3OQ3B 4JZJB 4ZDHB 4GRLC 1EXUA 1BX2A 4U1IA 3RU8L 5JZ7C 5E7BA 5IT2H 1WTLA 2DQFA 5I66A 3UTTB 3O2VH 3WO3B 5B22A 3ARWA 3HZVA 3M8OL 3V5KA 1JWMA 4I13B 3VRIA 5ITFA 1PBYA 3NH7L 4JFOA 3TBTB 2LVCA 4OLXL 1EGJH 3MV9E 1JI2A 5CFHA 4KK6C 5EU6D 2EH8H 4U6XB 1CLYH 4DZ8B 1F90L 4RGNB 4XNYH 3TA3A 2HTLC 3UTSA 1AGBA 2HKFL 1FYTD 4U1JA 3VH8G 2V2TA 3LAFA 2AK1H 4XZUA 3BHBA 5F44A 1NFKA 4YHKH 1Z3GL 1YYLL 3A67H 4FS0A 4Z95L 5GGTH 2NYYC 3PQYB 4XB7A 1WCBB 3VXQA 3F58L 3QWQB 5CZVH 1NEZB 4X4ZA 4RGMC 2Q8AL 1YUHA 1GOFA 2XT1B 3CFBB 4N9GA 3WBDA 2PTVA 3VWKA 2BMKA 1CQKA 1ZTXH 3HMXA 5H37H 3QZWA 4PJCE 1PY4A 2X70B 1WZLA 1EZVX 3GSNB 5T3ZE 2DBJA 5CIPA 5D2LA 4KJQC 5D7IB 4FZEH 5TE7H 4GXUM 4WFHE 1AC6A 4NZUH 1IKFH 4ODUA 4FRWA 3CMOH 1PAMA 1JIBA 3EW3B 5IKCB 2BNQD 2VAJA 5C09D 5E1HB 4WY7L 1G9NH 4W6XB 2D0GA 3CZFA 2J2ZA 5HDQH 4MJ5B 3LKSA 2WZPD 2G2RA 1J1OH 3T65A 3N1GC 4M6MH 2J6EH 4PRPA 4F58H 4NKDA 4HFWB 3LSOA 3TIEB 5F9JB 2N7AA 4LHUD 3K2MC 2DQHH 2FHCA 4QO1A 5SX4I 2LTQB 1Q0XL 3G04B 3GSWA 4PRAB 1F3RB 5E99H 3DSFH 35C8H 3RBSA 3IKKA 3T4YA 2IH1A 4OGYH 3FB5A 3O8XD 4KI1A 3F8UB 3HG1E 3G08A 5F6HI 5ESQA 4LSQL 2XQBL 5DRNB 1NGQH 1KG0A 4GKSA 4GRWF 5A40E 1HK6A 3H7LA 4GW4B 3TIDA 3HC0B 2ADGB 4O9HH 4PS4L 5E5UB 1T22B 4NOBA 3AAZB 5IVXF 5DJXB 5GGRA 4MNHB 3V79C 4W6YB 4HBCL 1P69B 1H3XA 5M95B 5GS0L 2JB6B 4QHMA 2CK0L 4RZCA 4Z78A 2ICWA 4M6NL 2CLVA 1RUKL 5HDLA 1G6RH 2YMXH 4WUUA 4JREC 4UIKH 4UV4H 3QH3B 1UKTA 3K8LA 1D3CA 3U2SA 3DMMB 4XHJD 2X9XA 2PO6A 1Q9OA 4OLUH 5J7CC 1U2CA 4OV5B 1ZLSH 5BXFB 2YN3A 4YIQA 1OAXH 2DYPD 3EOAA 4TUJA 2RCSH 2VZVA 3SGDH 2PCPB 3DARA 5T3XD 3T2QA 5FA3B 3UJJH 1U58B 2VLJE 4G8GE 3RWHB 1I1RA 5IF0A 4KC3B 1S9YB 1EA9C 2X4NB 5HGBA 5DD1H 2VE6B 5TDPB 3VD4A 1F58L 1NBYB 1ZHKA 2AABH 3EYUL 1QFWL 1F3DJ 4OF3A 3WSQL 4E41A 1OSPL 1R3JA 5ECJE 3ULSA 3HMXH 1JN6B 4D9LH 3B9KA 3P4MB 4OGXL 5BRZA 4NKMB 5L9DH 4U7KA 1RFDH 3NCEB 5CIPH 4I77H 4LFHD 5E9DD 1MOEA 5IV2A 5L0QC 1T1XB 4LU5L 3GHBL 4O51A 2P5ED 2GFBB 2VLRB 4URTB 3SDDB 1JGVH 3LPFA 4WEBL 3O8XC 4K7PX 4JY5H 1KBGH 5KS9F 4G80A 1C5CH 2JKXA 2J4WL 3M45A 3WYRA 5ICYA 1N2RB 4GQ9L 2BY3A 1NCBL 2AJ3B 4WGWB 1Z9OA 4GUPA 4P2RA 3VFPA 3HTLX 4YUEH 5DMKB 1WICA 1NC4B 2ESVB 4GRWE 5IGXL 5DSCB 1WFOA 3I02B 4P3WA 4UNUA 1KNOB 1NEUA 4N1HB 1CFBA 2HVKA 2H9GB 4Y4KD 4JFPA 5D2NC 1FAKT 5LWYL 1ZT4B 3MC0A 1U8OA 5BS0E 1HNFA 2PR4H 1MEXL 4IHOB 3VGDA 3MRNA 2DQGL 1FVCB 2DIJA 3X11A 4ODWB 2IMNA 5E2WH 5LBSH 4MA7H 2VR5A 4K3EH 1FLRL 1GGIL 3L3DA 2PW2B 3MOAL 3NCBB 4ENED 4UNTA 1LE9A 5SX5K 1CG9B 1RHFA 3HCVA 1A7OL 3QEUB 3QO1B 4XC3H 3U30C 4Y8DC 2D31B 4UUJB 1UWEH 5I19L 3OJ2C 4HG4J 4YBHA 2NCMA 2G9HA 4QNPF 4X7TB 2XG5A 3QG6A 4NO0A 3OSKA 3EYQD 3BUTA 4KI5D 4OFYD 4TVSa 3ZYIA 4HQQL 4NQTA 4ZTPL 2X5PA 1Y6NR 2F58H 4NQCD 1LK3L 4JFEB 3V4PH 5F7LB 1AO7A 1MCCA 3UTQB 5I17A 2YXMA 4G43A 2VUYA 1XGQA 4LQFH 4BSVB 1HXMA 5ILTL 5J56B 4NJAH 4F8QA 1X9QA 1EFXA 4R9HA 4XPAH 1U8LA 5MENB 1KCRL 3E8UH 1MAMH 2BOCB 3O9WB 2Q1EA 2BXYA 2W0KA 4KROB 3BZFB 3TZVA 3MLYL 3UAJD 3N9GH 5JLZB 1MF2L 1QRNE 1FN4B 3ROOB 2WWMD 1EMTH 3QUKA 4PRIB 1F11A 2VOTA 2Y1VA 4H5SB 1BAFL 1XGYL 2WUBL 2NQCA 3AY4C 2MCPL 5GZOD 5DTFB 3S6CA 5JQHC 2HWZL 2VDRL 4DEPB 1JNLH 4LGRB 1H3TA 5FYLE 2DOCA 5E8DL 5IOPB 4Y4KC 1IC5L 4YZFF 1XCQA 1P7HL 4K71B 3O3EB 2MCG1 1QNZL 3HRZB 5DJZA 4Q9QH 1XR9B 3C60A 2X4SB 1J1PH 1P84K 1RJCA 3QXUA 1ETZB 3TO4B 1DL7L 1YEJL 4PJHF 4XPTH 4ENEC 4HUVB 4ZFZA 4RFOH 1VFMA 4OF8A 5L2KE 2AXJA 5IB3B 3KJ6H 3RWGA 3VA6A 1EEUA 1UM4H 4G8IB 5F21B 2YHGA 1AP2A 4UZGA 4BK5A 3EYQC 4KI5C 3U4BH 4B0MM 5DC0A 4R90H 4L8BB 4PJXE 4QNPE 5MEPA 4XGZB 5FF6B 4KWUA 4PRNB 2E6JA 4U7MA 2VXSL 4OLVH 3FN3A 4P5MB 4QHNB 4YO0B 1FZJA 4UU9A 2QQKL 4NCC1 5JHDD 3Q1SL 4IS6B 4B5EA 2F5AH 3DTXA 2FD6H 3QPQD 3GI8L 1IEAA 3HFMH 4I4WB 2A74B 2WUCL 1SM3H 4MXWH 5E8NB 5I9QB 5JO5B 4Y5YA 3S96B 1F3JA 3T0EB 2Z4QB 4MJ6A 3MCG1 4Y7MA 3NFPA 2XWJA 4FQJH 4HIJA 2VDPL 5HHOE 3UAJC 3QULB 5EBLA 3MJ9A 3BKYL 2WWMC 2VL4A 4D0CA 1CGYA 1AGFB 2FX7H 1YJDC 2WLYA 1I1AB 1QPXA 4NUGL 5LG1A 4G8FA 3EFFB 1ZHNB 1BZ7A 3CFEB 5HYJD 1WQVT 1A3RH 1F4XH 5IW6A 4QRRE 5D72H 3C5JB 5GZOC 1EJOH 5CS7A 4MS8D 5C1MB 3CFCH 5F7FA 4R7NA 4OI7A 3VGAB 2XG4A 4Y5VB 2Y07L 4JFFB 1NKRA 3D69B 5J9PA 3MUHL 1J8KA 1KN2H 3UO1H 1R3HA 4YZFE 4HLJA 2VLKD 4LSRH 43CAB 4YR6B 4U1NA 1XF4A 4Z7VB 1OP5H 4AT6B 4KZDL 5LCVH 2C1PA 3L3IB 4M62H 5C71A 2YZ8A 4X9FA 5IQ9A 4NZTH 3D0LA 1K2DB 4ZDHA 4JZJA 3GNML 1R5VB 4EI5B 1QP1A 1KIPB 4PJHE 4R0LC 3UTTA 4Z5RB 4IIQB 4JY6B 1JHLL 1A7QH 5I74B 2H26B 5F1KC 4P4KD 3TBTA 5K59F 1ERNA 3V6FB 2CR6A 4YFLF 4U6XA 2VXTH 4DZ8A 1ZWIB 5ANME 5GHWH 3BZDA 1F4AA 4L9DA 4XVJL 4HUMB 5KSBF 4LEOB 3H42H 5IVZB 4OGAC 2X4RB 1P2CB 4G6MH 3QPQC 4QY8B 3ZTJH 5HGHB 4WFFD 4PJGF 3OB0K 4LPWA 1FZMB 4BZ2L 3PQYA 4NNPL 1WCBA 4TRPL 2CRZA 5F7MC 1NEZA 3RI5F 3NMEA 5EN2B 3CFBA 1GPOL 4JQVC 1CLZH 5ALCL 3SQOH 1MREH 4H1LH 3TBSB 4F3FB 5DJDB 5F8QC 2X70A 3GSNA 4MS8C 4L9LB 5D7IA 5E7FA 4R97B 2GCYB 2ZPKL 1XFPA 3B3IB 1KIRB 1XIWB 3FFCB 2WINB 4QRPB 1E4XH 2D7TH 4ORGB 3ARPA 5IKCA 1DLFH 5DYOB 4WFGD 4YHOH 1TTUA 4WV1C 4MJ5A 1CIDA 1BIIB 1L9MA 4YDLB 3BGFC 1IGCH 2WWKO 4OM0L 3QHZL 4LPTA 4HFWA 4NN5C 4P2QD 4WHTA 5BW7C 2C3XA 3TIEA 5F9JA 4EXPX 4BUHA 4PRAA 3G04A 3LN4B 2I60L 4PBXA 3RNQB 1QSEE 1X6NA 2H8PB 4P4KC 4LGSB 5DJCB 3FT3B 1BVLB 3EO9L 2XN9B 5DRNA 4OLYL 2OI9B 3DHJA 4H8WH 2BSTB 3PWPE 4GW4A 1AHWC 3HC0A 1FFOB 2ADGA 5K59E 1J0YA 3HN3A 1T22A 1RK0B 1VEPA 3AAZA 1ZE3C 5DJXA 3DROB 3VFTB 4MNHA 1XGPB 3DLQR 2VSCA 4Q97A 1RZFL 2J8UF 2JB6A 3MLXH 5KSBE 5LQBL 3VXME 3W0WD 4Q6IB 5AYQA 4X7CC 2R8SL 1LO3L 1PG7H 5TQ2H 4Q9RL 3MLVH 2OTWB 2W91A 4PJGE 3QH3A 3UXFA 4CJ0A 1CIUA 3V52H 2FIKB 3DMMA 3IKCB 2D3VA 3V6OC 1LO0L 4DUXA 5EOCL 4DQOL 4OV5A 2FZ3B 3BAEH 1ADQL 3RX8A 1EZVY 5BXFA 3VMPA 5DK3A 1TJIL 1R3IH 1JPTL 4KRNA 3E6HB 1N8ZB 3ARBB 3B2VH 1FCGA 3TT3L 5FFLA 2PCPA 3QR2A 3TV3L 1DEEB 1CS6A 5FA3A 1TETH 4ZD3H 1U58A 2EXYC 3ARDD 3QQNA 1ZVHA 3RWHA 3SE4A 1S9YA 4Z0BH 3LQZB 3JV0A 4XAKD 3PP4H 1LO2L 2X4NA 2VE6A 1A14L 5TDPA 1HSAB 1M7DB 1NBYA 3MRJB 4HS8L 3WFBL 3U0WL 8CGTA 2XZZA 4L4VE 3W2DH 3PDGA 1K6QH 1JN6A 2PETA 3P4MA 1WIOA 4NKMA 4G8GB 1V3JA 2XZQH 1ZK9A 2AK4D 3FMGL 2QLVB 3WN5B 4IMKC 3OZ9L 1T1XA 2A6DB 4OLWL 1Z0NA 3T0VA 2DLGA 2Z93B 2GFBA 1CZ8H 4P46D 2VLRA 3SDDA 1N4XL 4UMGA 3WJJC 5I1LB 3RVWD 1EBPA 1N2RA 4WUKL 2CK2A 2YA1A 5KTEH 4G7YH 4OCLC 3HNTL 5GRJH 3U83A 4P5KB 2AJ3A 3H8NA 4FTVE 3QDHA 2BJML 2QEJA 5T1KB 3IDMB 4N0CD 5DMKA 5EOCJ 1NC4A 2ESVA 1G7HB 4YXHL 3I02A 1I8KB 1KNOA 2HYMA 1D5MB 3RFZC 3EDKA 2H9GA 2FBJH 2GJJA 4QOKE 5IIEB 1ZT4A 5E6ZA 3CVHB 1P7KB 3B5HA 2J8UE 2CDEB 5CUSH 4IHOA 1VFBB 4OD3L 1NL0H 4FQ1H 4ZO7A 1FVCA 2YD7A 5HHXH 4ODWA 4WU7B 5HHNB 1MRDL 1RUML 2PW2A 3SKJL 3S4SB 4I9WE 1CG9A 5I1CH 2Q76B 3QEUA 3QO1A 4LBEB 3A6BL 3S34L 2D31A 1A1OB 4UUJA 4LVOB 5BS0B 4RFNC 1RU9L 3LV3B 4C54A 3BPLC 5D7JB 4X7TA 2BP3A 3V7AE 4ZUWB 1BJ8A 2LE9A 3ARDC 1QBMH 4HWBH 4WRLA 1NGWB 3V5DB 4JFEA 3LH2L 2Y25A 2QQNL 3B9DA 2JJUA 4LAQH 1J0ZA 2Q7NA 1GGBH 2AXFB 4WHYG 5D93C 3UTQA 5C0JB 1NCAL 1A7RH 4OBSA 4KK8D 4BSVA 3RKPA 5FO8B 4EUPG 1JJUA 5IW1B 3OXRB 4JGJA 3HUJF 3JBG7 3LB6D 5MENA 2C1OB 3RAJL 2BOCA 3O9WA 4K7PY 4P46C 1I3VA 4UQ2B 4DAGH 3BZFA 5T33L 4OCMC 5JLZA 1DSFH 1GL4B 3ROOA 1FN4A 2C3VB 3RVWC 1OVZA 1E4KC 5LGJB 4PRIA 4M7LL 5FYKU 3C5ZD 3HE7D 3QNZB 4ZS7H 1RUPL 4H5SA 2NMSA 3FN0H 4N0CC 5HGGS 5DTFA 1WF5A 3WO4C 1I85A 5BV7C 2R0KH 1INQB 4P3DB 5T3XL 5IOPA 1D5IL 1WAAA 3EYSL 1QRNB 5JW3L 1X5LA 3O3EA 2QQLL 5GGVY 2OMNA 3HRZA 5FECB 1XR9A 4X0KA 1SJXA 2X4SA 4KXZH 1ETZA 2NXZD 3TO4A 1I9RL 4XP1H 3AXLB 5JXAH 4HUVA 2Y36H 2EC9T 2P45B 2AXGB 3QEHB 4MNQB 5SWZE 4CN6A 5FB8B 1P7QD 4WW2C 1DQTA 5IB3A 1LMKA 4G8IA 4DKEL 4Z7UF 1L0QA 5T1LD 5TPWH 1QFWI 2K9UA 3BKCH 4X5WB 2DLIA 2Y4SA 1QPPA 4L8BA 2CDGB 3VI4F 1RZKC 4XGZA 5FF6A 1CDYA 3LKPB 2P8PB 4WI5A 4JKLA 4UOW1 3BDXA 1OF2B 2DQJH 2EDNA 4P5MA 4YO0A 3CU1A 1X4XA 3LRGA 1U95B 5ENWB 5L2KB 3TN0D 2B1AL 2JJTA 5IMOA 4IS6A 4J4PA 5HYEA 1I1CA 4I0PD 5E4IA 5FO9B 4KK8C 4R4FL 2JB5L 4I4WA 2A74A 4M7ZB 3STZB 4PJXB 5KSVB 4AG4H 1JK8B 5E8NA 5JO5A 2Q6WB 3LB6C 3S96A 1H3PH 3T0EA 2Z4QA 5IHUL 1QVOB 5ETUB 2FB4H 2JCCF 4KHXH 2DLFL 3QULA 3HUJE 5KVFL 2AJZB 1F4WL 4IOFD 3ARVA 2BSSB 4DN3L 1AGFA 1SJEB 2AGJH 1I1AA 3C5ZC 3HE7C 4KMLB 3EFFA 2CLZB 1ZHNA 3CFEA 1T2XA 5CBAB 4LSPL 3C5JA 1OL0A 1D9KC 2B1HL 3T0WA 2VZUA 5J1SC 1EIBA 5HHOB 5J6GB 3S35X 1QFPA 4X7FC 4Y5VA 4JFFA 3D69A 4M43H 4P3CH 3BSZL 3RP1A 2F15A 5T1DH 1TPXB 5DA0B 1I3RB 4DGYL 5KAQG 4FZ8H 5DD5H 43CAA 4YR6A 3MOBL 3LIZH 5BVJB 2NXZC 4AT6A 4Z7VA 1T0NB 3HE6B 1MCBA 5EU3B 3ZTNL 3L3IA 4J2XA 3LMJL 3RJDA 5C92A 4F9PC 1A9EB 4M03A 1K2DA 5L88L 3OPZL 4Z7WF 1NAKL 1R5VA 3VE0B 4NHCH 4EI5A 1KIPA 4PIRF 5ELIA 4Z5RA 4IIQA 4JY6A 5GRUL 2AJSL 4X4YB 5CJ5A 1FFQA 1OQOA 3IFOB 2H26A 4OGZA 4XP6H 4NSKB 1C1EH 4M9PA 1FIGL 4Z7UE 2X1PA 3KLSA 3V6FA 1DE4B 1ZHBB 2VC2H 1ZWIA 4PGJA 1A9BB 4PJEF 2O26U 4G6JL 3VI4E 3TN0C 2W60B 2MWCA 4LEOA 2X89D 3BEVB 5KVDH 5IVZA 4KKBC 2X4RA 2R0ZH 4HC1H 4I0PC 1P2CA 1QEWB 3K7UA 5FUOH 3OGCB 4QY8A 5HGHA 1JWUB 1A6UL 4NN6C 1FZMA 5IHLB 2DQIH 3BD4A 4WNQB 4GG8B 2VLME 3M17B 3T08A 1DP0A 3G9VA 1H3UA 1CFSB 1SQ2N 4M00A 2EDBA 2P8LB 4APQB 5J3HD 1AE6L 5EN2A 4IOFC 2G5BB 3VI3E 4PG2A 4C4KO 4KY1L 2K1MA 1RMFL 3TBSA 4F3FA 2FHBA 2ZUQB 5DJDA 2FHFA 1ONQB 2AP2A 4YDIH 3KPRE 4L9LA 5H37G 3L1OL 4K3JL 2GCYA 3ARSA 3QHTC 3B3IA 2DBLL 2WBKA 1KIRA 1XIWA 2O61B 3FFCA 4IJ3C 2WINA 4QRPA 4ORGA 3VFGH 2K7QA 5DYOA 3OKNB 1B6DA 5E0QA 5F1NB 1T89A 1BIIA 1X44A 1HE7A 2F54E 3PGFH 5JW4M 4HPYL 4J3SA 3A6CL 1E6JH 1ODAA 5I8KL 2GJ6B 2WM0A 4NFDA 4XT1C 3LN4A 4Z7WE 4JFHE 2EEDA 3RNQA 4R4BB 4LMQE 2H8PA 4LCUB 3JWNC 5DJYB 1Z9MA 5DJCA 3FT3A 1BVLA 2XN9A 1RIUL 3H2WA 4UTBH 3LN9A 4KRPD 2B4CH 2BSTA 3OR6B 2OYPA 3DNKA 1FFOA 4LPYA 3LVEA 2Q3AA 4LSSH 1RK0A 3CX5J 3RDTB 2VSDA 3RI5K 3DROA 1PY9A 3VFTA 1QSEB 1XGPA 1S3KH 1JGLH 4NQDE 2OLDA 4Q6IA 3CSYB 1UENA 3PWPB 2OTWA 3SKOB 1CK0H 1JGUL 1P5VA 4L5FL 2FIKA 3NGBC 5GSVB 3IKCA 3PJSB 5J3HC 1UM6H 2GAZB 3RWFB 5DLML 2W9EH 5KSBB 2FZ3A 3FOLB 3VXMB 3TVMB 5F7KC 4I3RH 1F97A 3BKMH 3ES6B 4C83B 2ADFH 2VLLB 4CAGA 3QNYB 5FYKE 3E6HA 2VUOA 3C8KB 1IGJB 1N8ZA 3ARBA 1DEEA 3S36H 4U1GC 1A21A 1KB5L 5IB2B 4UILH 3NCFB 3LQZA 3H0TB 4F7CB 1QFWM 4JB9L 1A6VL 1HSAA 2R56H 3KHQA 1M7DA 3MRJA 3MUGB 3SOBH 2RR3A 2D7MA 3TF7C 1UA6L 4PTTB 3QUMH 3NCYP 2KZ1B 4AENB 3KPTA 3TJEH 4G8GA 1D6EB 3HMWH 3WN5A 4XAWL 3IDGB 3QZWG 4J12A 2A6DA 4NNYB 2Z93A 1FL6B 3O3AB 3FRPA 3MNWB 3WMSA 1U8HB 3MV01 4XPGH 2HAZA 3PE9A 1FZOB 1O5DT 2IG2H 4L4VB 5C0CD 5I1LA 3ELAT 5C0AD 2WWKT 3GMRB 5JW4R 4KRPC 2APVA 4P5KA 3RGVD 1P4IH 1SEQL 1OGAB 4QXUL 5IEKB 5T1KA 3IDMA 1PGRB 4NZRL 1OW0C 3RY6C 4HT1L 2HT3C 1MFBH 3FB6B 1G7HA 3RWCB 1AQDB 2E9BA 5E8PB 1I8KA 4Y8AA 1D5MA 5GS1B 4Y2DC 4Y1AD 4HCRH 2XPGB 4K9EH 1P9MA 1RHHB 1TZGH 3D9AL 5IIEA 2LAGB 1G9MH 2W07A 4KV5F 2UV3A 3CVHA 1P7KA 3DX8B 4M5ZH 4FTVB 2CDEA 4POZD 4P57B 1VFBA 2OP4H 1WZ1H 5JDSB 4YQXH 3MUZ1 3RVTD 1T4KB 2WNGA 3MRGB 3O2WL 1A6PA 4YFLI 1SJHB 4WU7A 5CSBA 1NMAH 2ZKHL 3IF1B 1CYGA 2J88H 4XBEL 5DT1L 5HHNA 1ZT1B 3S4SA 5J8OA 2Q76A 1O7SA 4QOKB 1T0MB 3E2HB 4LBEA 1FFRA 1HYSD 1A1OA 5BS0A 4NQVB 4ELME 3ZMRA 2J8UB 1ZANL 1GVIA 2AEQH 3LV3A 2OBGA 5D7JA 1S8DB 4MWFB 3BP4B 2YPLE 4ZUWA 5GRXG 1S5IL 1XR8A 4EI6B 1S9VB 1AXTL 3RX7A 3JWOH 1IM9D 2IJ0C 3GEWB 4ONOA 3VXUB 3WFHB 1NGWA 3V5DA 1ED3B 4ODHH 4M6AA 5KSAD 2AXFA 5I6XC 4AMKH 1KLUB 5C0JA 1HHHB 4N1EA 3OAUH 3RUGB 3KPOB 4NM4L 4ZPVB 5DWUL 1MFCH 4UAOC 5FO8A 1G9EA 3BD3A 5I1EH 5IW1A 3LY6A 3P0VL 3D1MC 3OXRA 1LEKB 5F9OL 2C1OA 5I75B 4UQ2A 4EDXB 4Y5XC 1W72L 5MEOB 2ATPB 4I2XB 4CMHC 2C3VA 1FO0B 1CL7L 3DYMA 4LL9A 2BY1A 1KCSH 3QNZA 1TQBB 3RGVC 3I50L 4FQ2H 4P2QE 4Q0XH 1OAZL 4CVXB 3VFMB 3UTPD 4OZFB 4PGBB 1MY5A 4KKCD 1INQA 4XNZC 3TA3D 4P3DA 4MQTB 1QRNA 4O00A 4JKKA 1MCNA 4A6YB 3NAAH 2JK5B 3UTSD 2V5YA 2ENSA 5FECA 3TYGL 4GW5B 2HH0H 4MCZB 3RVTC 3VGHA 2PN5A 1HKFA 3GBNH 1IT9L 2XTJD 3TBWB 5C0FB 3GBML 3AXLA 2NLJB 4LPXA 4NRXB 4ZFOB 4S1SH 2AXGA 3QEHA 1X4ZA 1JHKL 4JG0H 4JO4L 5HGDB 1HYSC 1EK3A 1MNUH 4MNQA 5E03A 4TVPH 4MD0B 1FL3B 4Y0GA 1B0WA 3DYPA 5FB8A 4JG1L 1HWGB 5EPMB 2P8MB 1R3KB 4Q9BA 4QTIL 3VWKD 4ODBD 5CEZD 3ME0A 4N9OB 3PNWB 4X5WA 4LVHC 2CDGA 1I7UB 3QBTB 3LKPA 2P8PA 1FORL 5SWZB 3QIWC 4WW2F 4YDKL 1OF2A 5E6ID 3PGCB 5KSAC 1C7TA 1FNFA 1U95A 3KPMB 5ENWA 5L2KA 5EU4B 2NY2B 2VXVL 5BV7L 5FO9A 1TVBB 1A02N 5FM5O 3I85A 2DJ4A 3T77B 1OARH 3U7WL 1JPST 3R1GH 2UZIL 3STZA 2DWDB 4PJXA 4DWHA 5KSVA 3KLAB 1JK8A 1QOKA 4NBXB 1X5GA 4NYLB 2Q6WA 3L5XH 1HCVA 5L6YL 1QVOA 1KJ2L 4PRPD 5AYUH 1MFEL 1I4FB 1OM3H 1YEEL 5ETUA 1FNSH 4OIIL 1MPAL 2AJZA 4HUUB 5I18L 2BSSA 1SJEA 3GM8A 3IAGC 5FM5M 3QAZB 2CLZA 4Q2ZB 4P2OB 4FFZH 5CBAA 5K9QI 4V1DD 3O6ML 1EO8H 5HVWA 3VMNA 4KKCC 3FN9A 4M7JH 2AVGA 5HHOA 2WP3O 3TA3C 5J6GA 3SE3A 2A83B 4HMDA 3T2OA 1T0PB 3B9VA 4G6AC 5DF0A 2G5RA 3WXWL 3FZUC 1RZKL 3LKOB 4O4YL 3BW9B 1I3RA 2X44D 4KGJA 1NUFA 1KYOJ 3G9AB 2C3WA 1B90A 2V7HB 5BVJA 1T0NA 3CC5B 3HE6A 3VH8B 3K1DA 5EU3A 4YPGB 4OQTH 2NY6D 4GSDH 5BMFL 1A9EA 4YXKH 5HSFA 3VE0A 4AIZB 4X4YA 5H94B 1PG7X 1MJ7H 3IFOA 3QI9B 4DW2L 4JPWH 4NSKA 3BT2H 5D7KE 3DOSA 1DE4A 3QEQB 1ZHBA 3SGKC 2ZUYA 2F8XC 4GMSL 4U1SB 1A9BA 4K3DH 5E6IC 3VXSD 2FGWL 4NDMB 4R8WH 5HGAB 2W60A 5IFAL 3BEVA 3GMLB 4K8RH 3GO1L 2R0WH 1QLFB 5HTSA 1QEWA 4ORZC 5A1AA 3OGCA 2NTFB 4TNVF 3TBVB 2ORBL 1JWUA 2DMCA 4RA3A 2RHEA 3QDME 5FHBH 1JF6A 3Q6GL 1GGUA 1QA9B 5F96H 4WNQA 3T3MF 4GG8A 1NMCC 5CD5D 3M17A 5BRZD 1CFSA 4PJ7B 2P8LA 4APQA 2R1WB 3PDOB 2HMIC 2V9QA 5DFVD 2G5BA 4M7KH 3W5MA 1A4JB 1LHZA 2N7BA 4EJ1C 4Y89A 5INDB 1IEBB 5HYSB 3ULUH 3UJIH 1ONQA 2BDNH 1BBDL 2I27N 3ARGB 5BO1H 2FEEI 2DDQL 2O61A 5CJXA 5KOMC 3MGTB 4WDIB 1NANH 3HPLB 3RVVD 2FBOJ 2ZG1A 3OKNA 3P30H 5F1NA 4OZGF 4OZHF 1CGWA 4Z76A 1T04B 1TCMA 4NRYB 3KPRB 5TDOB 1F8TL 2ZOKB 2FO1A 2NY6C 5FA4B 1KCVH 4N0RA 1IJ9A 1H8SA 5IESL 4TULH 1RULL 5E24E 2GJ6A 1U8PB 4O58L 3T0DA 3MA9L 2W0LA 3RZWA 4R4BA 4W70A 4LCUA 3IDNB 4HJ0D 5DJYA 1CFTB 2ZSVB 2F54B 3BKJH 4XPFL 4FQLH 4BH7B 3WNLA 1URLA 1TZHB 4LVNC 3OR6A 4NO0D 3MV8D 3WFEL 3MMEB 3K2UL 1BQUA 3VXNB 3ULVF 3RDTA 1MJ8H 2AJVL 2BRQA 1NGPL 4OFDA 4WTZA 4CDGC 4CRPA 1R0AH 1QSEA 4P2CG 4HIXH 5C0BB 3UBXB 3SGJC 2HT4D 3GMQB 1A5FL 4ZO9A 4JAMB 3CSYA 1JRHH 3DGGB 3ULUC 3SO3B 3PWPA 5CD5C 4XMKL 1H8OA 4KQ4H 3SKOA 3LKQB 5BVPL 5TH2B 5GSVA 2C26A 3PJSA 1AIFB 1B2WH 3T3ME 1HSBB 2GAZA 5DFVC 1EFXD 3RWFA 5KW9H 3BJLA 2VXUH 2Y06H 5KSBA 4CVUA 3FOLA 2BX5A 1AKJD 1UCBH 1J1XL 4NQDB 3TVMA 3VXMA 4KUZH 5BZDB 3TZVD 5F3BB 3NFNB 3X3GH 1OTUD 3DXAE 3IDYC 3OBAA 2EECA 1GSMA 3ES6A 4C83A 5LVEA 2VLLA 3QNYA 3N06B 3C8KA 1IGJA 1J12A 2XKSA 3FO0H 4M93C 1SYSB 3SGEI 5IB2A 5KVGH 2DF3A 4N0UB 2UVEA 3C6LC 2ZZUT 1UZ6E 3MCLL 1KC5H 3H0TA 2B20A 3RVVC 4C4KT 4F7CA 2GYSA 2GW5A 1LD9B 3MUGA 2ZJSH 3PXHA 4PY7B 4J6RL 1NEZG 1ZEAL 5ID0B 4PTTA 1FQ9C 4NKIH 2AJYL 4AENA 3MACH 1EPFA 3C60D 1D6EA 3IDGA 3UPAA 4NNYA 1FL6A 3O3AA 1T7XA 3GJEB 3MNWA 4DTGL 3QDAA 1U8HA 1FZOA 4L4VA 1YEIL 5J06A 4HJ0C 4XB8A 1NLBH 1OPGL 3I9GL 4O5LH 3DUHA 3GBLA 1T2JA 3GMRA 3KPSE 3VFSB 2FIRT 4OCXL 2EDKA 4DFHA 1OGAA 5IEKA 1GHFL 4DOHB 1MFNA 2R29H 5FUCE 2FLRT 3FB6A 3RWCA 1LGVA 1AQDA 5E8PA 4QRQB 5HI5C 5E6YA 1U8KB 1UB5B 5GS1A 3BWUC 4XXCC 1G7PB 2XPGA 2HT4C 3WEXB 5A2KH 1RHHA 3ULVE 4W81A 4FQIH 1UVQB 1YNKH 2F5BH 4NWTH 5IVNA 3DX8A 1QKZH 4FTVA 3IU4L 3DX7B 4P57A 2A6KB 5JDSA 1EERB 4XXDB 1T4KA 3MRGA 3G5VB 3OKLB 1SJHA 2AJUH 2O5YL 3IF1A 4KPHL 1ZT1A 4UNVA 4RGOH 2OX5A 4JR9L 4QOKA 1T0MA 5I1KL 3TZVC 2Z0BA 4S1QL 4HWNA 5DVMA 1OTUC 4NQVA 3NZHH 2J8UA 3WUWB 1RQ5A 3O41B 1X3DA 1S8DA 4LCWB 4MAYD 4MWFA 5J13C 3BP4A 2LVEA 3U4EB 4EI6A 1S9VA 1T3FB 5KAQF 5FYJH 4OCWL 3VFOB 3VXUA 3WFHA 5KBNC 5KJRL 1UJTA 1D6VH 4RSVA 2X09A 1ED3A 2GSIB 4ELMB 3CLEL 3QDJB 3DI2B 3EZ8A 1F4YH 4P9ML 4XP5H 1KLUA 1HHHA 1RD6A 4CVZB 2DB8A 1CGUA 4LRNL 3RUGA 2YPLB 3KPOA 4ZPVA 1CICB 3C60C 5DS8B 4BA8A 5F1SA 3KAAA 5A16B 3KXFE 1MH5B 1YZZA 2X1OA 4XCCH 3IB4A 3NA9H 1LEKA 2ZCKL 2EKJA 3HS0B 3Q0HA 1X5FA 3EFDH 2WQ8A 4EDXA 1KJVB 1GIGL 5MEOA 2ATPA 2ZUVA 2MNUA 4P2YA 4I2XA 1ZMYA 3MLSH 3QRGL 2HP4A 1FO0A 3UTTD 4YHZL 3L7EB 1MSPA 5EB9A 1A7NL 5J1AB 1N6QH 4OB5L 4CVXA 4OJFL 1FLTX 3SE8H 4K55A 3NABH 1UB6B 3VFMA 4OZFA 5ITBL 4PGBA 5EO0B 1U8JB 4G9FB 4MJIE 4RGND 4HH9B 1BEYH 4A6YA 5SX4H 2V5MA 2JK5A 5DMGD 5FXCH 3E0GA 3HZKB 1CE1L 2PXYD 4GW5A 3MZTA 4IDJL 3U0TB 3HNVH 2MSPA 4MCZA 2VWEC 3PL6C 3O2VL 5C0FA 3TBWA 1OT2A 2NLJA 3BP7B 2KKQA 4YEFA 1HILB 3PQYD 1P1ZB 3GJFK 4NRXA 4KJWD 4ZFOA 1MFAL 1CWVA 4LIQL 2ITCB 1EGJL 4ZPTB 5HGDA 5AAMA 5ISZE 4MD0A 1FL3A 4JKPH 3AB0C 5EPMA 5L8KB 1I1YB 2P8MA 4JN1H 1R3KA 1AFVL 3B83A 4MAYC 3OJVC 4IDLA 5IM7B 1MCOH 3PNWA 4W6WB 1I7UA 1MI5E 5A2JH 1NCTA 1JYWA 3QCTH 1UJ3B 1KENH 5SWZA 5GJTL 4EN3C 3O0RH 1RZGB 3PGCA 3KPMA 5EU4A 2AEPL 1VACB 5AWNL 1TVBA 4HUWB 2OTUB 4D2NA 3T77A 1IC1A 4LEXL 1QLRB 2DWDA 1HINH 3OKEB 4YWGH 3KLAA 3ZL4H 4NYLA 1WGOA 5DD3H 5F6IC 4R96B 1L6XA 1QR4A 3WNPA 5HVFB 1I4FA 4ZMAT 1L0XA 4J3UA 5F9WB 3F12B 4CJ1A 1I3GH 2HKHL 4HUUA 2W65B 3IFPB 2DKSA 1NSNL 1IKFL 4Q2ZA 4P2OA 3HNSL 4MZ2A 4WIQA 4KKNA 5J89A 1OT1A 1NAML 1CD9B 5EZOH 5FM8A 3LZFH 4BZYA 5HDQL 2Z9TA 3J8F7 4WI4A 3N1PC 2A83A 4RBPH 4OCRH 1MCQA 2JE8A 5GJSH 5DMGC 3B43A 3VCLB 1BWWA 4MB4A 3WIHH 3LHPL 3LKOA 2PXYC 2CXGA 3BW9A 4PJDB 1FO0H 1RJZB 2V7HA 3MV7E 4QT5B 3FAWA 3CC5A 1QSFE 1B3JA 2LU3A 3VH8A 3S35L 4YPGA 5E99L 4UT9H 1G1CA 5F1OB 4KJWC 1A3LH 5I1GL 2MPAL 3DMMD 4AIZA 4DJMA 5GSRB 1OCWL 1NCDH 7FABH 1T7VA 4JQIL 3EDFA 1NCWH 5AG9A 1RI8A 2ED9A 1CF8H 5H94A 4F80A 4XC1H 3QI9A 4LARL 1OB1B 1F42A 3WV0A 4OI8A 3QEQA 1F13A 4QRTB 2EH7L 4LCCB 2BRRL 4U1SA 4JM4H 4GH7B 1Q9LB 4NDMA 5HGAA 1IC7L 1YEKL 4FFYH 3GMLA 1YEHH 5FGCE 1QLFA 2W0FB 4X4MA 2NTFA 3TBVA 1XGRB 1YEGH 3S36X 1BECA 1CL7I 5EORL 1QA9A 4JM2B 4GAGL 2CO7B 1ZLSL 2ITDB 5C6PB 1DBMH 4FABL 2E7LA 1A6WL 3O3BB 4E0RB 4PJ7A 1JF1B 4UI2A 2R1WA 3PDOA 4OF0A 4U1KB 3STLB 4UINL 2LTQC 1A4JA 2HJKB 4LLAA 4LKCB 4WCYH 2EDFA 4U0QB 2RFXB 4XCFL 3LD8B 1XAUA 2VLRD 3SDDD 5INDA 4M5YH 1I7ZB 1IEBA 5HYSA 4TSAH 1DBJL 1I8LC 3FQUB 5C0IB 3IS0X 4RAUB 3ARGA 1H9VA 5CEZL 4JFYB 3UTOA 1HOCB 4ZAKB 2B8OT 4OKVB 3MGTA 4WDIA 4AEFA 2ESVD 5IQ7L 3HPLA 5HPOA 4NFCA 3U9UB 2AS5M 5ADOL 4D9RD 1BVKB 5CJQH 3LRSB 1F2QA 1T04A 4NRYA 3KPRA 5TDOA 2LV4A 2ZOKA 3MRMB 4WTWA 3MGOB 3EJZC 5E2VL 1LQSR 3C2AH 4ZXBB 5FA4A 1UACH 3IS1X 4H88L 2WP3T 1KPVB 1OAUH 5I15L 1L7TH 5AZ2H 3DMMC 1V3LA 3UTSE 3MUY1 1U8PA 5C07B 4HPOL 3KJ4B 5D96C 1YECH 3ZKMD 1EUUA 2W59A 3IDNA 1CFTA 2ZSVA 2F54A 4MGXA 4TNVK 3SY0B 2PYEB 2XTJE 1EX0A 1ZLVH 4BH7A 5ID1B 4PJBB 1TZHA 4B50A 3CXDH 4OCYL 3UJTH 3SE4C 3VXNA 5I16B 4XCNB 3Q5OA 3SDYL 5C0BA 3UBXA 2X40A 4JFED 1RY7B 3H3KA 3DV4B 3LEYL 4DN4H 3GMQA 1MHPL 4JAMA 1DQML 1KB9J 4OSUL 3DGGA 1BIHA 2F19L 4WFED 1S5HB 1P4LB 4I3SL 2X1QA 4JEGB 1J0HA 1UWEL 3U6RB 2PW1B 4KTDL 3LKQA 3TGXA 3O6LL 5TH2A 1AIFA 4ALAL 1HSBA 1C5BL 4HWUA 3X3FL 2F53E 3PWLB 5MEND 3WFDL 3O9WD 4NQDA 4KROD 4LK4A 3SDDC 5BZDA 3EOTL 5F3BA 3NFNA 2ZUTA 1T1YB 1KPRB 4D9QD 1CFQB 4M1DL 3S88L 2J8HA 3CAFA 4FP8H 4LNRB 2P24B 1U36A 2P5WE 1SYSA 4KVCL 3SE9L 3ZYJA 5I71C 3AU1B 4N0UA 3LCYA 3VRJB 3VXTB 1CDBA 1CQYA 4P99A 2DRUA 1GXEA 1LD9A 2F8VA 5CCKL 4PY7A 5D1QC 1YEFH 4ZFFB 5ID0A 4ZFGL 4OLEA 3RNKB 3RZCD 2YKLH 1FGVH 3NTCH 4S1RL 1DUYB 4M8QB 4JRXD 5E5RB 5CINH 2R15A 4K2UL 3TO4D 2L0DA 3T09A 3GJEA 3I2CL 3JV5A 3ZKMC 2XRAH 3MYZA 1WIUA 1ULVA 4ONGH 4KFZC 5EZJB 1IFHH 3VFSA 1F6AB 1T5WB 2R0LH 4XMLH 4WUUE 1YYML 4ONFH 1UYWH 3QPXH 1OP3K 1DVFB 2OL3B 3DETD 4HXAH 1CDIA 2ICWJ 1K4DB 3FTGB 4QRQA 1U8KA 1UB5A 2JLLA 1G7PA 4G7VL 5DEZA 4BQ6A 2HFGL 3UTZB 4HIHB 1UVQA 3VXRE 4Y16D 5EUOB 5EOQH 3BYYA 2YSSB 2I9TB 3DX7A 4P9HH 2A6KA 4X9GA 3HC4H 4X6DB 4HKXB 4XXDA 3G5VA 1P4BH 3OKLA 2IPKB 5LJYH 5DZLA 3T0ED 4GS7C 3O9WC 5AZEL 1WT5C 3GMPB 4KK5D 4KROC 4M1GL 1JPSH 3MRHB 5DD0L 3QIBB 1N5YL 4MHHG 4FQHB 4E41E 1E4WL 3RWEB 5I73B 3WUWA 1I1AD 2CIIB 4LCWA 4NO3B 2DN7A 3U4EA 4CVWA 1T3FA 4I0KA 1HQ4B 4Y2OA 3SHSA 4ONHB 3VFOA 4DEPC 1I85C 4KZEL 2RB8A 4MZ3A 4UB0L 3I84A 2IAMD 3MSPA 2GSIA 1VADB 5FGBC 4ELMA 1S7SB 3QDJA 4JFFD 4WHDA 1BJMA 3TT1L 4CVZA 3UZEA 3MLUH 1J88A 3KPQB 2YPLA 3RZCC 1CICA 2H45A 5DS8A 1RZJL 5I1HH 5A16A 5K9JH 5FM4A 4P2RE 3TO4C 1MH5A 2BVUA 3GKWH 3HS0A 2ZG3A 4G42B 3WKMH 1KJVA 5D72L 2D2OA 4ZSOB 5EZIL 1EJOL 4K23L 2CRIA 4EI5D 1BFTA 3L7EA 2VR9A 3KXFB 5J1AA 1FH5L 1OD7A 1UB6A 3OF6A 5B8CB 2VQ1B 5EO0A 3WNNA 4CU6A 5EC2B 1U8JA 2NY7L 4G9FA 4JHBA 2UVFA 4HH9A 3WIIH 1NQBA 2R4SH 3OKMB 5HYQB 3HZKA 3GKZA 5D7SH 5K93A 1TJHL 3WDHA 4Y16C 4LSUH 4IEFB 3ARFB 3FRPG 4W4OA 5I30H 1JFQH 3U0TA 5E70A 3LS4H 3MV9D 4GRLB 2FX9H 2KBGA 3BP7A 1HILA 3T0EC 3ABZA 1P1ZA 4TYUA 4NQEB 4RMSA 1HH9B 4IRSB 2ITCA 4ZPTA 4HZLB 3D25B 1AO7E 2W1NA 3B5TA 4PTUB 2OS7A 2W9LA 2VDQH 3K81A 1I1YA 5JPNB 1MJUH 1I1AC 5ACLA 4PB9H 3U7YH 3BJ91 5IM7A 2AQ2A 2P42B 1UG9A 3BVNB 3GSVB 4OTXL 2VITB 1UJ3A 3WLBB 1JUFB 2IAMC 4WGVB 5ISZB 1L7IH 1RZGA 3O4OC 1U42A 4Y5VC 1BLNB 1SY6A 3MPCA 4GAJL 1U3JA 4TSCH 1VACA 1NKOA 4QRPD 4IM8A 3QJHB 4HUWA 2OTUA 3S4SG 4Z77B 4TUKL 1QLRA 1AXIB 1MI5B 5T3ZD 3OKEA 3RRQA 4RGMB 4R96A 4WFHD 1ACYH 1G7QB 5B3NA 5EULV 3F12A 5C0RL 3GI9L 4EI5C 2W65A 5E08L 2V5RA 3IFPA 3RU8H 2HFTA 2CO6B 1BVZA 1LP9F 2W0PA 5IFJB 4XNUL 3M8OH 3MJ9L 4N5ED 1BPVA 2XN9D 3NH7H 5HY9B 4OLXH 2XICA 4OFVA 1AR2A 4JFXB 2RAMA 4D3CL 3VCLA 4AL8L 1F90H 4JVPA 1ZSDB 4PJDA 4ISVB 1RJZA 2HKFH 5K9OB 3HG1D 4QT5A 3K80A 1YYLH 3EJYD 2H1PL 2HFEB 6FABL 3E1F1 4KDVA 4Z95H 3VA2C 2AV7B 4JO1L 3LPGA 4ODSL 1ZA6B 4JFZL 3F58H 5GSRA 4KVNL 2HG5B 4C59B 1DBKL 5FGSA 5D7LB 1IM3B 3THMH 2Q8AH 2ZCLH 5EU6B 5GGVH 1OB1A 3N85L 1F02I 2C5DC 1U9KA 4QRTA 1YPZB 1FYTB 4LCCA 4L9LC 1Y18B 3ARBD 4R97C 1Q9LA 1CT8B 3ZE0F 3PHQB 3O6FC 4PBVC 5TQ2L 3MLVL 1MCDA 3RJQB 4LLMB 4WEMB 3BMWA 5LAXB 2W0FA 2EDJA 4RMRA 1XGRA 1T89C 2OR7A 4WWKB 4JREB 5D7IF 4NO2B 1CGXA 4JM2A 4WY7H 5F88B 3H7BB 4JHWL 1XGUB 2ITDA 3O3BA 2VLJD 4G8GD 4RWYH 2IGFL 4WO4B 4YHML 4E0RA 1JF1A 2CMRL 4NZDA 5FGCB 3STLA 4U1KA 1VKXB 1RZIB 3QWRA 3MLRL 2HJKA 4LKCA 2QKIB 2RFXA 3RVXD 1KTRL 5H2BB 4MVBC 1I7ZA 1Q0XH 4JO2L 1N7MH 2A6IB 1LP9E 1QFUL 5FCUL 3FQUA 5C0IA 4RAUA 4F37F 4LSQH 1F3DH 4JFYA 1HOCA 2XQBH 4ZAKA 3ZKND 5T1KD 2ED7A 5FEBA 4OKVA 2DQCL 2ED8A 3GSNL 4PS4H 3HI5L 3U9UA 3I6GB 3NOIA 2XZQL 1J11A 1BVKA 3LRSA 4NQXB 4HBCH 3EJYC 3MRMA 5EWIL 3MGOA 5GS0H 4MA8L 4ZXBA 2XZAL 2CK0H 5ESVB 1KPVA 4NOFA 5CLWA 4M6NH 1OD9A 1RUKH 1IGFL 3CMGA