1FNGB

Histocompatibility antigen
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
213
structure length
213
Chain Sequence
KKVITAFNEGLKGGGGSLVGGGSGGGGSRPWFLEYCKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAVTELGRPDAENWNSQPEFLEQKRAEVDTVCRHNYEIFDNFLVPRRVEPTVTVYPTKTQPLEHHNLLVCSVSDFYPGNIEVRWFRNGKEEKTGIVSTGLVRNGDWTFQTLVMLETVPQSGEVYTCQVEHPSLTDPVTVEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords PROTEIN (MHC CLASS II I-EK, ALPHA CHAIN)
publication title Structural and functional consequences of altering a peptide MHC anchor residue.
pubmed rcsb
source organism Mus musculus
total genus 42
structure length 213
sequence length 213
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fngB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1fngB01
1S3KL 4XCNA 4YX2H 2X70A 2BVOB 1X5JA 2WWKT 3CZFB 4ZFZA 1NCCL 3SO5A 1P7KA 2ADGA 1BF8A 1OQOA 2DBLL 3KPSE 3P77A 5FYKD 3V6BR 1RIHL 3DX6A 1QYGH 2DQFA 3K2UH 2V7NB 4Q9QH 3MOBL 4G3YH 1NC4D 2DQHL 4OSUL 4EI5B 5KSBF 4PJEA 2YPLA 5DHVB 1OOAA 4JFDD 2CLRA 5FA4B 2HTLD 4GAYB 4X99A 3H0TA 3IDIB 4X6FA 4P5KA 3GGWA 3ZDXE 2ZSWA 3O9WD 4NQDD 3CDGB 1D5XA 4NFDA 2FD6L 4FQXC 2CLZB 4XPTH 5FYKU 1KEML 3BX7C 1FLRH 4FMKA 3BQUD 3VFNA 4Y5YC 1IGCL 2DQCH 4XX1G 4OF0A 3CMOH 3W9DA 1ZTXL 3CVHB 3VXSE 5HVHC 5EZLB 2R4RL 5H2BA 2VLKA 4F80A 1CQYA 1FNEB 5B4MD 1NGWA 1I1FB 3UJJL 4RX4D 5IW1B 3QEQA 4LSUL 2Z91A 4PB0L 2NW2A 5F1IA 1IGJA 5D1ZC 1X9QA 1EO5A 5I8CB 4I13B 2B1AH 3HA0A 4YHML 3SE3A 1UA6H 2ED7A 3MRHA 1F58H 4ZQKA 4NZTL 3U9PL 5E7FA 3MV8A 3HN3A 4P23B 1GGUA 4IJ3B 3GSQB 4QTHB 1OAUH 4GMTH 1FYHB 1MNUL 4K3EH 4XVUD 5ICZA 1QEWA 2CIIB 3EOYG 4N90E 4QXUL 1KCUL 5GRVL 3QEUB 4L4TE 1H3XA 4JFQA 3LIZH 2PYFB 4OJFH 1I7TA 3CVHL 3OG4B 2O5YH 3FMGH 1F42A 5H35A 4MJ4A 1CLCA 1C08A 4NHCL 5EIVA 3NZHH 3DRQB 5DI8B 1SVCP 2ZKHL 1EEYA 5GGRA 4O9HL 4R96B 1BIIB 3EO1B 3LQZB 2GY7B 4BUGA 3L7EB 4NGHH 4R0LB 1SJXA 1AXSB 2I27N 2CIKA 3KYKH 3EYUL 5EBGA 3I75A 3SDXF 3U0TA 1WK0A 5IW6B 4WHTA 3OKYA 3IFPB 4XH2A 1A1MB 3NGBC 3JBG7 4FFWD 3K0WA 4NRXA 2QKIA 2RIKA 3E2HC 5EWIL 4OZFG 4PP2B 5IM7A 5IHZA 2OTUA 4M1CD 2PCPB 4J7RA 4U3CA 3B83A 4NNXB 1HXMA 4NM8L 3MV9B 3X13B 1KIUA 2IPTH 5DRNB 3UP1A 1BM3L 5DT1H 5FYJH 3EFFB 5E24E 3QFJB 4OM1H 4XZUA 3GBMH 4N0FA 4YHOH 3MACL 2FDBP 2C4FU 3REVB 4LSSH 2C3VB 3I6GB 3W39A 1RHFA 3G6JB 5E8NA 3S96B 2IMMA 3LHPH 4P46B 1OGTB 3CFKB 3QZWB 3HAEA 1PDKA 1VB9A 2Z93A 4J2XA 2BNRD 3SKOA 2EDNA 1JMZA 2ZG1A 1KSRA 3OG6B 1XGRA 4QGYA 4UMGA 5HYIA 2DYPD 3D6GA 3BMWA 4TNWK 3UDWC 2A6IB 3HNTH 2M2DA 5HHNB 4JZOB 1JRHI 3VMNA 1NC4A 1JHKL 1YPZF 2YKLH 4YHIB 5D1QB 5E8PB 3BUTA 3S4SA 3SE4A 5HGDA 4JFDA 4ODBD 5DJYB 4U6VL 2V9TA 3JUZA 2D7QA 3BXNA 5DJ8A 3O9WA 2A73A 5FO8A 3RAJH 4NQDA 1DQML 4FQCL 3RRQA 2VUYA 5GGTH 5IBTL 5B38B 1HHKB 3HG1E 4XCFH 5D9SB 4D2NA 5IMKA 3NPSB 5GHWH 2KKQA 2BZDA 3BQUA 3EHBD 5TDPA 4NO5B 3AY4C 1FZKA 5DMJB 3QUMA 2ATKB 4XMLH 4U1MA 4JJ5A 3QDJE 5ACZA 1U8LB 4O02H 3BH9B 2AKRA 2UY6A 3AREC 4M9PA 1QACA 4U1LB 4AL8H 1FZJB 4JZJC 3PDOA 2P5WB 4BQ6A 3BSZH 4QHKJ 4RX4A 2FSEA 4H0GA 3I3EA 1LK2A 3FO9A 4X83A 3HLAB 1FZOA 3G5XB 2FEDC 3V4PL 2FIKB 1XGUB 1INDL 4ETQA 4YUEH 1C1EH 3T77B 1PGRB 4XMKL 4Y88A 3RWFB 1K8IB 4Z78B 2Y6SC 3TBVB 1BJ1J 5FYKH 3O0RL 5AZ2H 4P5MA 4LLVB 1YMMD 5DJCB 4MS8D 1RK0B 2CDGA 4OGYH 1MFEL 1V8HA 2A6JA 1XEDA 3MUGA 3KJ6L 1TZHA 4CNIB 3GBLA 4MA7L 4I5BA 4GS7C 1WUNT 3IFLL 5EC1A 5E5MA 1TQCB 3BPLB 4OBRA 5EU3B 5SWSD 3RVXC 4HS6A 1T04B 1XIWD 1NUDA 5GGVL 4NZRH 4OIIH 4HBQA 3RPIA 5LGJA 3QUMH 5EU6D 2FJGA 3ZKXB 2GT9B 4Y1AB 3MRQB 2MMXA 2DQDH 3BEVA 5IMOA 3U7YL 3VI3E 5EU7C 5KW9L 2FJFB 2NZ9D 5JNYA 4EXPX 5IMLB 4KK8D 1CU4L 3F5WB 3TP4A 1IM9D 3M45A 4W6XB 1Z9MA 3K3QA 4K71C 5LAXA 4YDJB 4FTVB 2OR7A 1FCCA 1UWEL 1LE5A 4RISH 2X4UA 3HI5L 1JRHL 1W72L 1BFVL 1NUNB 3RL1A 2WIIA 4FZEH 3GK8H 3STLA 2A38A 4MJ6A 5F7UA 2ZUQC 5GGSA 5EZJB 4X5LA 1BAFH 3HC4H 2UWEF 5M95B 3P9WB 4ODUA 5I0ZA 1Z5LA 3H42H 3T1FB 2EDKA 3UPRA 4WWKC 1HQRB 3QO0A 5IESL 3Q3GB 2Z9TA 4QWWD 5C6TH 3MLWL 4NN5B 1KXVC 2E27L 5HHOB 1KF9B 1HYSD 5KG9B 3JWOH 2P5EE 4ZUSB 3JTSB 4OCXL 1OF2A 1S7RA 3BD5A 2BNRA 1AGCA 5CIPB 4GRWH 2AW2A 2EXYC 5HI4D 3OJDB 3M17B 2VITA 3GO1L 2UY7A 5EUKB 5D2LE 2DYPA 4N1HB 1KTDA 1G7HA 4NC1E 3MNVB 5AZEL 1GHFL 3UTZB 3RJDA 1IGIL 3WJLA 3WFHB 1A7QL 2ID5A 2W38A 2VE6A 3MBED 1RZKL 4JG1L 4BFEA 1GXEA 4XNYL 5DO2D 4KVCL 5GRVK 1SJVA 2NXYC 4I3GA 4OZGA 3P4NA 4UV4H 4YFEA 1FRGH 4JG0L 1A21A 5GGRY 4HJGA 4L8DB 4S1DD 1BQUA 2VIRA 5DURB 4OZFB 4AJ0A 5JOPE 2WK2A 4H8WL 3OXSB 3CSYB 5BW7A 1Y18B 5F1NA 3OR6A 1JZ7A 5DSCB 5EORL 5EFIB 1I8MA 3AVEA 4Y5VC 1OAYL 2A0LD 5HGGS 5I1AB 4Q6IA 1G9EA 4POZC 5EUOB 1AKJD 1U6AH 4YE4H 4R4BA 1UZ8A 3FN0L 3TO2A 4MJ5A 2OZ4L 2VXTH 2R15A 3QWOA 1CR9L 3KS0J 3LDBB 5FUCC 1XGYL 1T1ZB 2NY5L 3BP5B 4KMLB 5CEXB 5I1LB 3SKNA 3RI5K 1KPUA 5L2KB 3F6LA 4HUWA 5DHYA 1OTTD 5INCB 3W9EA 1KCLA 4U6XB 4NRZA 4PP1C 5CEYA 1R3HA 3TYGL 2PYEE 1AD0A 4JREC 2H2SD 1A6PA 3O2VL 2JJTC 3RZCD 3RIFK 1ZLUH 3MO1A 1YMMA 3MUHL 3HC0A 2VLJB 1JZ3A 5ALCL 3KAAA 1MRCH 4PG9B 1QSFD 5D93B 1VEMA 3ARDC 1MLBA 4XAWL 3W81A 1CLYL 3PP3H 2XN9E 4PRHB 1J0YA 3VFVA 4WU5A 5SWSA 5EBWA 2X4SA 1G7QB 1XIWA 2AV7B 1WBYB 3QUKB 3ZT6A 3IF1A 5L8KB 3QFJD 2ZCHH 2F53D 2W65A 5EU6A 3CU1A 3KYAA 3LKRB 4Z7VB 2AJSL 2CDFA 5DQ9B 5EO0A 3C5JA 3JWDC 4XXDB 1J0JA 3PGCB 4NKMA 4P46D 5E2UL 2E7LA 5A1AA 1IM9A 1UCBH 2CRMA 3V4VH 5EA0L 4AMKH 4FG6C 3O6LL 3CFEA 1HYRC 4NPYB 4W4OA 4Y2DC 5D5MB 3A6CL 3ZE1E 1QFOA 1FFOB 1Q38A 2CO6B 4D9RD 4XPFL 3WN5B 2Q3ZA 1S3KH 3QXAB 5DMYA 1H3GA 4GQPH 3D3VD 4YDKL 3B3IA 5FA4A 4GAYA 1T21B 1EXUA 1NCCH 3IDNA 4PJGF 1OWRM 4ODWA 1XF2B 3HKFA 3MNWB 1RIHH 1F4XH 3P40A 7FABH 1QQDA 2CLZA 2DQHH 2XT1B 4OSUH 4H1LA 2LU4A 5IVZB 4G8FA 1IGYB 8FABA 4PJFF 4K7FB 3U9UB 1WZMA 3CVHA 5GGQL 4ZO8A 4S1SL 4PJAF 4Z7UF 5L7XL 1QR4A 1HHGB 2FD6H 4JE4B 4ZSOB 1FNEA 1D9KD 4F7MA 3ROOB 1MY5A 1N59B 4YK4B 3L1OL 4DKFL 1KEMH 1J8HE 3LEXB 3UTPD 4P4RB 4QHLB 1IGCH 3GI9H 1ZTXH 5IB5B 4L3CB 4JHZA 4R7NA 1MREL 4ODVH 1WFTA 4UQ3A 3MBEA 2R4RH 3HZMA 1G9NC 4LLWA 4HMEA 4HLJA 3DETC 5HYSB 4K94L 3UJJH 1MHHA 3BN9D 4FQQB 1TVBB 1XFPA 1HCVA 2WLYA 5E8EA 1YN7B 4LSUH 4PB0H 4QTHA 3VD4A 4PY7A 3HMXL 4FXGA 4YHMH 3T0XA 2J6EL 1EMTL 3VFUA 4ERSL 3IU3B 4DK3A 1UKSA 5ESVA 4NZTH 3U9PH 1TCRB 3H7BB 2AGJH 2NW3B 3BJ91 3TESA 1AKJA 1U3HD 1FVDB 2YMXL 3QRGL 3TO4C 3TT1L 5E5UB 3OKNB 4NDMB 2ARJQ 3MBXL 2UUDK 3O3EB 4S1RL 1MNUH 3B9AA 4PRBA 3BRGC 3OBAA 4HG4J 4H88H 4BA8A 4H1LH 4QXUH 1KCUH 4R2GC 4R8WL 3CVHH 2AP2A 1JWMB 3GMPA 5GGSY 1TNNA 1BIIA 3EO1A 1IEAB 3F7YB 5FEBA 4I4WB 4NHCH 4NZJA 4KUCD 1NMCB 4AY0A 1UC6A 1EV2E 1D7FA 2Q86B 1AXSA 4OLYL 2ZWLT 2ZKHH 1X5AA 1RUKL 4YR6B 1AQKL 2FZ3B 4O9HH 1XF5B 3RZCA 4D0DB 4ZDHB 1ND0B 1U93B 3JTTB 4JANB 1MVUB 3BYTA 4ELKB 1QSFA 3G04A 4K3GA 3QUXC 1M6OA 2NQCA 5IVXA 2NNAA 3RVTC 1QVOA 3EGSB 1PX4A 1KC5H 3ULVC 1EFXB 4JDZA 4Z0XA 4EN3C 3FT3A 4PGCA 4Y2OA 1B4RA 3BN3B 3QFJA 4GSDL 1L0XA 2F53A 3B5HA 2EYTA 1OPGL 3V6FB 3UBXA 4W6WB 4L5FH 4NM8H 3OGCA 3I6GA 5CEZE 3G6JA 4OLUL 1F6AB 1BFOB 5SWQB 3H2WA 4PB9L 4AEIH 4P46A 4D3CL 3IVKA 2OP4L 1BM3H 1I8IA 3KPNB 1FO0L 3FQUA 3CDCA 4JY5L 4CVXB 2MSPA 5F88A 3RKDC 4NRYB 2WIMA 5GS1C 4POYA 2R23A 3MTRA 5F3BB 3DSNA 4JGMA 2QR0A 5F44A 3VG9B 4RWHA 3VJ6A 1O0VA 1QBLL 3D3VA 5DJYA 1T2JA 1HHIB 1PZ5B 5JHDB 3U79A 4HXAL 5HYJE 4M4RA 3TCXA 1F4HA 4JJHA 4JFPA 4FFVC 4YHYB 4N5EC 2IAMC 4LSDA 3B9KB 1G7LA 4RIRB 3V5DA 1TVDA 4HJ0C 4I3RH 4RBPK 3ARWA 2VWEC 5DQJB 5DD1L 4U6VH 3LD8B 2X4TB 3DLQR 1DQMH 4FQCH 4UTAH 3QIBC 5IBTH 2BY3A 2ERJB 5DVMA 1D9KA 4M1DH 1OD7A 5DZOA 3UAJD 2DKUA 2ZNXA 4X7SL 1FYTE 4J3UA 2EDTA 4OAWB 3WKML 4NHUB 3G9VA 4X7FC 4ZOEA 1DQTA 2FIKA 1KLGB 2QADC 4OIAA 1B0RB 1I7UB 3L5WB 3V5HA 2ADFL 5GRZA 3EW3B 4R6UA 1K8IA 4RAUB 2XTJB 4KDVA 3S88L 3H8NA 3NCBB 1HNGA 2YC1B 3V0AC 3WFDL 4WHDA 3IAQA 4JQXC 2NX5E 3HS0B 1V7NL 5DJCA 1CLZL 1S7QB 2AJZA 3MLXL 1RK0A 1W72A 3MQIA 5KTEL 4G8IB 4YWGL 1U3HA 2AK4B 4GG8B 4DFHA 4CNIA 3O0RH 2AQ3A 2ADIA 5I8EB 5ID1B 1X4YA 5D7IE 1DUYB 1NCBH 4DW2H 1BZ7A 1MFEH 2PXYC 3CU7A 1Q9WB 3S97C 1FFQA 1JK8A 4KI5F 4MA7H 4N0UB 3IFLH 5ISZE 3VFRB 4HMDA 5I1HL 2FJFA 4LPUA 4ETYA 3EYOB 3UX9B 3T65A 3F5WA 1AR1C 1S78D 2HLFD 1R5VA 1TTFA 4KDTC 3VXUE 1EFQA 3FQWA 3I2CL 4NZUH 1AXIB 3U7YH 2GW5A 2Y36L 4L9LB 2UUDH 4R97B 1KLUA 5J1TC 1CU4H 3UYPA 5E1HB 5T3ZE 1N6QL 4YZFE 2EKJA 1JUFB 4ODSL 3LQAC 4G7YL 3KPRB 5EZJA 5FGCB 1UWEH 4MJIE 5MEOB 3HI5H 3G5YB 3QB7C 1JRHH 3BUYB 5BRZE 2A6DB 1W72H 1BFVH 1OL0A 1VFAB 3RDTB 4YGVB 5E70A 3CFJA 3OL2A 3GMOB 4WNQB 1FL5A 2D4DA 4ZUSA 2GTWA 3VFMB 4LNVA 4K7PX 2OZ4A 4LVOC 2V2WA 1JI1A 5I0DA 4HQQL 5IESH 4GG6B 3F6IA 2DJUA 5CIPA 1E4WL 3OJDA 2E27H 4FMFA 4PJBB 5EUKA 3OKLB 3TNNB 4LSRL 1C12A 1TCMA 5DD6B 1I9JL 4TYUA 3VRJA 1DLFL 4KPHL 3TBYB 2GUOA 1DANT 1X5IA 1NCAL 2NY0D 1NAKL 1EHAA 1XT5A 1UWXH 1MCOL 2EZ0C 2R2EA 4RA3A 4D9LL 5JR1H 2DQGL 2A9NL 2WWMC 4PLNC 4YFDB 4M8VA 3T04D 2BOBB 3VGAB 1GGBL 5AZEH 1GHFH 5I76B 1FIEA 4TVPE 1IGIH 1E4XL 3FFDB 4OZFA 3BWAB 1A7QH 4Z7QF 4YPGA 4DEPB 2EIEA 1RZKH 4JG1H 5DSCA 4XNYH 4UDTA 4KVCH 5L88L 1Z6JT 3WBDA 3QFDB 5EUOA 5MENB 1NBYB 4JG0H 1LP9B 4R4ND 1E28B 1PKQA 5DJ0B 2HT4D 3QO1B 1ZANL 4ZUTB 5D2NA 4H8WH 4MDJB 3QUYD 4LHUG 1OSPL 3D18A 4OZIE 4TRPL 1DBKL 1DE4A 3L3OB 1OAYH 1XCQA 2F8VA 2EKSB 1T1ZA 4XWOD 4BQ8A 5CBAA 4NQEB 3IKCB 3NAAL 2DQJL 2FX8L 5CEXA 4MXVE 2Z35B 5I1LA 3MODL 4P4KD 2YK1L 3CSPA 3WS3A 3ESUF 3FN0H 3MGOB 4PJGA 1AGFB 3F7VB 4KK6D 3G6AB 2OZ4H 2W60A 3PGDB 4JN2B 4CVZA 3F8UB 1CR9H 1WIUA 4F37F 4RBPH 5D7SH 5BO1L 2EYSB 1XGYH 2YUXA 2EDDA 4KWUA 1D6EB 2NY5H 1CFBA 1CDCA 4WO4C 5HGAB 4K8RL 3ZDXF 4PJFA 5C0BD 2IANB 4N8VG 3OTTA 1FL3B 3RZWA 3KNBA 1KTLB 3GJFB 3KWWB 1AO7D 3QDME 2APXA 3L95A 4QY8B 3FQXB 4C59B 4GKSB 4OFIA 2ARWA 3AB0B 1IE5A 4RMQA 2C3GA 4DTGL 5E2WL 3O2DH 1PD6A 4X8XA 1CTNA 1RMFH 4I77L 2EC9U 4PV9B 4YHNA 2R0KL 1Q9KA 3LKRA 3PG2A 1CLYH 4HC1L 4RMTA 2CPCA 3ARBB 4XVTL 4G6KL 3ZKNC 1T03L 4X4ME 5I74B 3I6KB 2V9RA 1B9ZA 1I3RB 4PGEB 4NPYA 1NLDL 3U82B 1CFSA 5ENWA 1E6JL 1FFOA 1LQSR 3BIAX 4XP6L 2OI9B 4ISVB 3MRCA 5E2UH 5EA0H 1CBVL 1FV1A 3O6LH 4ZTOH 5DRWB 5GGVY 5FIEA 3C09B 3S5LG 3MNWA 4JCMA 3A6CH 5D8JL 5TJWK 1E4KC 2V9QA 1G0YR 3LZFL 3NA4A 3H3KA 3HMXA 4HJJL 4KI5D 5C8JB 4XPFH 2J6EA 4QRSA 4LEOB 4MA3B 1SY6L 1L7IH 1JHLL 2HJLB 3D39E 4F7EB 3MFFB 5A3ID 3WIIL 1SEQL 4LARL 1IL1A 3MYJB 1ERNA 4XCCL 2P49B 5I15H 1DCLA 3ULUE 3LEXA 4FQPA 1IC4H 4ENED 4D0CB 4P4RA 4QHLA 1QRNB 5GGQH 3PL6D 4S1SH 5L7XH 1B0WA 1YY8B 3G08B 1KCSL 5IBLC 3L1OH 1CDJA 3LRSA 5TDOB 3RWEA 3GUTA 4J3SA 4JFOA 5DA0B 3TN0D 4LIQH 5GZNC 5J11B 4AIXA 4MSWB 1H3UA 5KANG 4HLZH 3IU3A 4NM4L 1NH6A 4MJ2A 5KSBB 5IG7B 4YHLL 5DHXB 1TCRA 3D2UB 3H7BA 4K94H 2NW3A 3MOAL 5IFAL 1OLZA 3HPLB 4KRPC 1A6AB 1JYNA 1FVDA 2VN4A 2QQQA 2W9LA 3OKNA 1TTUA 3I50L 3HMXH 3QUYA 1RVFL 2J6EH 4PJ7A 1EMTH 4ERSH 3OQ3B 1U8JA 3C2AH 4GW4B 5I73C 1H0DB 5JW4Q 4X6DE 5A2JH 5TH2B 4P4KA 2YMXH 1RZ8B 3FO1B 1EO7A 4JFFD 5BZDA 4TNVK 3GSRB 4X6EA 4S1RH 4IHOA 4PJ8C 2O61A 5HYEA 2N1KA 1N3NB 1VPOL 2Q86A 1FO0A 4R8WH 4BQ9A 1UH4A 4LRIC 4ZDHA 1ND0A 5C0BA 1YEHH 1EBPA 1ETZB 2BSRB 3KYMB 1NBVL 4G43B 3U7WL 2F5BL 1JF6A 1AO7A 5I18H 2R0ZL 3TPUA 4JGUA 1HWHB 4ELKA 5BS0D 1TMCB 3I3DA 1G7PB 3RTQB 4AH2A 5HDBF 1RUKH 1UJ3B 1AQKH 1H3VA 5J7CC 4HK0A 4KGJA 2CQVA 3HRZB 1NBZB 1M05B 1A3QA 4L8BB 5MHSE 2DQIL 1MI5B 1S9WB 5C09D 2DWEA 2AQ1A 3MLVL 3R8BB 5IEKB 3BISA 3S36L 1KULA 1VADB 3KPMB 2HLAB 1YNKL 1BFOA 4ZXBB 2OMBA 4I2XE 5DJ6B 3NTCL 5L2JA 4JFYA 5IQ9B 3VGBA 4BH7A 4XAKD 5HBBA 5HDQL 2DDQL 4GSDH 4QTIH 5SV4A 3L3JB 4E41D 5HHQB 3MRIA 1IKFL 4OLUH 2ARJB 4PTUB 3B5TA 1Z9OA 4D3CH 2OP4H 3JVGC 3QAZC 4J8RA 5L9DL 1FO0H 1VFUA 2OX5A 5HGHB 3KPPB 3SDXB 4JY5H 1G9ML 5L0QB 1NGYB 4LHQB 4K8RD 1A1OA 5ALBL 1P9MC 3B9KA 3I6LD 1PYWA 1F4YH 5JA8B 1AIFA 1KPVB 1DR9A 4Y4HC 1T83C 1A64A 2VXVL 4PLJD 1YNTA 3ARQA 4NN7C 1UWGL 3FRUA 1OM3L 2VXQL 1P2CB 4IRSC 2GAZB 1DVFD 3VFSB 3ARGC 1OTSC 2DMCA 1BVLB 1RUMH 2HN7B 2LVEA 3QJHA 4NQED 5EIIA 4OAWA 5ITFB 3PL6A 3WJJC 3NOIA 2YXMA 1FORL 2JCCA 3B2UD 1DEDA 4Y1AE 1B0RA 4BM7A 1I7UA 2BSED 1IAKB 2AV1B 1QLEL 4XCYA 3TIEB 4HXBL 4J1UB 1CD1A 5KANI 3PWNA 2F19L 4RAUA 4X7SH 1CGYA 3PHQA 3RY6A 4KKLD 3WKMH 5E94B 3TN0A 5CS7A 2YC1A 3GJEA 5D1ZB 4CU8A 1AQDB 4ZUVB 3N85L 1HQ4B 1TJHL 3GMNB 5FHBL 3O6FD 1VACA 3LKQA 5IB3B 3LEYL 5FO9B 3GZKA 1YPZB 1CCZA 3UZQA 4ZFFB 1NGZA 3QI9D 3OR7B 3SJVD 4ONHB 4APQD 4G8IA 1RAMA 3IXTA 1S9YA 2RB8A 4GG8A 1A4KB 3EYQC 4QRPE 4MB5A 4LCWE 3S88H 3ZHKA 1NL0L 3SGDI 3WFDH 4N9OB 2ICWB 4E0RA 1V7NH 4DJMA 2G2RA 4PGJA 2GKIA 3MLXH 5KTEH 2FX9L 4YWGH 4HFUH 2YSSB 3QULA 5D72L 4LPCA 4JFFA 1N6UA 1U3YA 4FA8A 3ARBD 1KGCE 5CZXC 4YXKL 3PGFL 3GJFK 4I1NB 5HHPB 3WLWC 5CLTA 4TUKL 2NYYD 4RGNC 2X89D 4DUWA 3BKYL 2WZPD 5F9WC 1S7SB 4UNUA 4ELMA 2D9CA 1C8PA 1SYSB 2XWTB 1JWSA 1KJMB 2D4FA 1SMAA 3G6DH 5BS0A 5IV2B 1D5ZB 2B20A 3LN4B 4QGTA 4ALAH 2VXUL 3I2CH 3QP3A 1PY4A 2GSIB 4LSTL 3NGBB 4OFVA 2Y36H 4KVNL 4PJCF 3M07A 2RHEA 3BUYA 3H9HB 4LLYB 4Y7MA 3E2HB 1N6QH 3BAEL 2R2CA 3CC5B 1RSFA 5C09A 4YGVA 2R2BB 4OUUA 4YAQA 4ODSH 5DMGD 3IJHB 4G7YH 3ZDZF 4KK5D 4N9GB 3VFMA 5DC0A 1KIPA 2A6KB 3V8OA 3ARXA 5DGRA 2Q8BL 2KDGA 1F45A 4PJBA 3OKLA 4Q2ZA 2EICA 3RUGE 2NMSA 4E41A 3DARA 1GOHA 1LO4L 5ILTH 2P8MA 4AG4L 3KYOB 3NVQA 5L2KE 3O8XC 4IOIB 2G5BB 4MWFB 3X17A 4JDVB 1HH6B 4LOUD 4J12A 4HQQH 1OLLA 5GQBA 3AM8A 1E4WH 4MAYB 4EUPG 1Q9LA 4LSRH 5I16B 2Y5TB 3DECA 2H3NA 5I2IA 5I76A 2Q6WB 3KPOA 2ZZUT 3WSQL 3CXDL 2A83A 3FFDA 3IU4H 3D85D 1I9JH 3MLYL 4M7KL 1H8NA 4V2BA 1NCAH 2QLVB 1NAKH 1MCOH 4D9LH 4CVWA 2DQGH 2A9NH 3QFDA 4PIRF 1NBYA 1LP9A 4NQTA 1GGBH 2NZIA 1LMKA 4F7PB 3WNKA 4C55A 1DVFA 3ALPA 4FXKB 4Q7DA 5D7KD 2YD9A 1URLA 2J3SA 1HI6A 2EKSA 1YDPB 4JFED 3KDMB 4NQEA 2VSDA 4ZAKD 1FHGA 1A22B 3FTGA 2VC2L 2VLRE 4G6AD 1W0VB 5B21A 1ZHKA 1F11A 1VKXB 3RVWC 3G6AA 4HC1A 5CFHA 4PJDE 5AYUL 1OSPH 3AREB 4NO0B 2NY2C 3DSFL 4TRPH 4NUJA 3GSNL 1DBKH 2EYSA 5MEQB 4U0QB 2Y5EA 1L0QA 3NAAH 2DQJH 2E6JA 5SV3A 3MODH 5HGAA 5C0JB 1JL8A 5C0CB 3FKUS 3FT2A 3O6FA 2R8SH 1NCTA 1MRFL 3GJFA 3QI9A 3SJVA 5BO1H 4APQA 1FVCB 4CW1A 5E00A 4F2MB 4Y8AA 4HS3B 1GZQA 1OSZA 5JW5A 2NY4C 4K8RH 4I48A 5CWSA 3BOVA 4CMMB 1NAMB 4UQ2B 4IEFB 2QSCL 3KHOA 1MI5D 1NKRA 4U7SA 1CG9B 4JKMA 1WEJH 4KHTH 5I9QC 2JELL 3BKJH 3HNVL 1SY6A 4CRPA 1X6NA 4LHUD 4F8TA 4OKDA 4DTGH 3ARBA 5E2WH 4N0YL 2VDQL 1RU9L 4OF7A 4ZXBD 2P24B 4I77H 1BWWA 2X89A 2R4SL 2R0KH 1CDGA 3AXLB 1IT9L 4OUOA 3T08A 4JM2D 3BRFA 4FQ2L 4XVTH 3WIHL 1T03H 4MDIA 1I8LA 3IKKA 4LL9A 1IILE 1MH5B 1UG9A 2Z31C 5HY9A 1LK3L 3MLUL 4K71B 1NLDH 2BRRL 1WBXB 2YPKB 3DGGA 2IQ9L 1E6JH 5CHNA 4AQOA 4LSQL 1KNOA 4O2EA 4PV8B 1UXSA 4XP6H 1KJVB 1OP5H 3RQ3A 3OAUL 4UB0L 3FB7B 4MA3A 2XZAL 4RQQB 1IEBB 4NWTL 3QIUC 1DDHB 4L4VD 3PWLB 1A6TB 5HXMA 2CUIA 5C3TA 3DV4A 4PD4J 1RULH 1TLKA 3LZFH 4XBPA 4HJJH 2GK0B 4FQXD 3IDGA 4TTDC 1JZ8A 2RQ8A 3ESVF 4HIEA 4E9LA 1JHLH 1QSED 1C5DA 4OCRL 3DX7A 1MAMH 1LEGA 4F9LA 3WIIH 1SEQH 4LARH 4Z7WB 5L8LB 3WKNA 4U1NB 1NCNA 3FL7A 1T89A 3VXMB 1YQ2A 2NXZB 3VG0L 5TDOA 3WO3B 4HPOL 3VWKB 3NBNA 3D85A 5D1ZD 1QO3B 2ZOLB 5F7EL 1DQQA 2R56L 5D96C 5DJXB 3S34L 2BJML 3MXWH 4PD4K 1Q1JL 3FFCB 1KCSH 4HIIB 2Y07L 2ICWJ 4RMWA 5F6IB 4X98B 1WAAE 4X7TA 1A6AA 1WBZB 2R1XB 3E3QC 2YRZA 4U3XA 2GITB 4DUXA 4NM4H 4KV5E 4YIQB 4YHLH 4JFEA 5IFAH 4LVNB 1XGPB 3MOAH 1TFHA 4ZAKA 4PJ9B 3KYNB 4Y4FC 1RZ8A 3FRPG 3FO1A 3DMMC 5F6HI 4KZDH 4JQIL 4ZPVA 1KT2A 2MQ3A 4PJAB 2OMNA 4Z7UB 3S9DB 3I50H 3SKMA 1RVFH 1J12A 4NQSA 2W0LA 4HX1A 4PJEE 1N3NA 2EDLA 1X5XA 2ITDA 1B2WL 5M7QA 1LO2L 3FONA 2BY1A 4U0RC 4HF5L 3D5OF 3PXJA 2DLHA 2BSRA 4F8QA 1DUZA 3KYMA 1MCDA 4EUPB 5JW3L 1LE9A 5EC2B 3HUJA 4NWUL 3K8MA 1UJ3A 3OX8B 4ONGL 4NBZB 4I0PC 1PG7X 4GRLC 4ZFGL 2D0GA 1XF4B 5TF1L 4L8BA 4PRPB 2VLKE 1NBVH 1S9VB 3U7WH 4U1HB 2ILLA 2F5BH 2BX5A 1MI5A 2R0ZH 4UI2A 2FHFA 4JO2H 3HE6B 2MHAB 3U7AA 5LGKA 2RAMA 3HMWL 4OV6F 5J6HA 2FWOA 1FN4B 3ARDB 3QEQE 1VADA 3HTLX 4LHUA 5C07B 1LO5A 1S8DA 5MERA 2YA2A 4ZXBA 2DQIH 5DMKA 1HHHB 5IQ9A 4Y8DC 1T4KA 3MV8E 4M1GL 5EIQA 1MIEL 3MLVH 5F7NC 5HHME 2EDYA 3S36H 5K33A 5I1KL 3MZTA 4JM2A 2AJVL 2JJSA 5CSZB 3EOBA 4K3DL 3BZ4A 1CXEA 1YNKH 4QF1A 2ARJA 3MA7B 4PTUA 4PBVC 3ARFC 3VFWA 4IDJL 3NTCH 2AERT 5FYJE 5HDQH 2DDQH 4HV8A 4IMLA 3ARPA 5DZLA 5I17B 4N8VA 32C2B 2NY1B 4OQ1A 1GGCL 1RZGB 2V7HA 2XTJE 1IKFH 5KVDL 5KS9F 3TEUA 1MJ7L 4BQCA 2YD3A 3RWGA 5L9DH 4EDWL 2DKSA 5D1XB 1LVEA 4L4VA 1E27B 1G9MH 3IDJA 2VZSA 4PRID 5MEPB 4DGVL 5ALBH 2YEZA 5DK3A 4FQXA 1FFPB 3PF2A 2BVQA 4MB4A 5ICYA 2VXVH 3OJVC 3M1BB 1QSEA 1OTUC 4Y5YA 1WC7B 4IOFC 1DANU 1UWGH 5ITFA 1OM3H 2VOTA 3BVNA 2C1OA 3JWDL 1OGAD 4PJ5B 9CGTA 2N7AA 1T2QL 1IAKA 1XF3A 1FNGB 3ARED 4MCZB 3TIEA 1T66C 1X5YA 5SWZB 3BH8B 1MCSA 4EI5C 4LKCA 3MGAA 1U8IA 4YZFF 2FEDD 2BY2A 3U4EA 5ITBL 5D1ZA 1HKLL 5C0CD 4XP5H 3MPCA 5LKNA 1HQ4A 5BVJB 2I9TB 1M7IA 5DJ2B 1I7ZA 4WW2F 5DA4A 4OV5B 3P9LB 4ZNEE 4ZFFA 1QLEH 3S5LA 3W2DL 4ONHA 4GOSA 3A67H 4EEEA 4HXBH 1BFSA 4LNRB 4DAGH 3DVNB 5IJVA 2Y6SD 3G5ZB 4WI5A 2APWA 1NC2B 4U7KA 2CH8A 5TFSL 3N85H 2ICWA 3KPRE 4ZODA 1TJHH 5FHBH 4PJHE 4Y0GA 3LEYH 1SBSL 2FGWL 1KENL 4MD4B 3RFZC 4HKXB 4PJXA 5KOMC 3REWB 3LKSB 1JNLL 5C0DA 1JN6B 1AGBB 4IIQC 5FYKE 3MV01 3WXWH 3ZKMC 2VKWA 1RI8A 2QHRL 2BC4B 1SJHA 3FZUC 3RVXD 1A7PL 3UXFA 3RBSA 2FX9H 5B8CA 1EAPA 4UIMB 4D8PB 3DI2B 4NCDA 2VAAA 4NQDE 5DYOB 4P23C 1S7SA 3VMOA 1FNSL 3PWVA 5IQ7L 4TOYL 4YXKH 3BZDA 3PGFH 1G9NL 2X2YA 4IJ3C 4B50A 1KJMA 3VE0A 4Q9CA 2ADJB 2AEPL 5FECB 1NDGA 4TUKH 4FQHB 3KR3L 3BKYH 4EVNB 1ZT1A 5T3XH 1PQZA 3S37X 2AEQL 4LLYA 4OKVA 1PY9A 2BK8A 2Q1EA 4OZIF 4UOW0 1J0ZA 3DTXA 4ONFL 4TSAH 3ULUC 1ZT4A 3IJHA 2VXUH 5GISL 4TUOB 5F9JB 4N9GA 4LSTH 1UACL 1FDLL 1JF1B 1CI5A 3S7GA 4UU9B 4EN3B 2BFVL 4U1KB 1P5UA 4WWKD 3L6FA 4YBLB 3BAEH 1ORSB 1OAQH 1WIOA 2X7LA 3L3IA 5HPMB 3GRWH 3KYOA 4NJ9L 1LD9B 3W0WB 4BFIA 1I1AC 2XQBH 2EH8H 2G5BA 4MWFA 1HH6A 2Q8BH 3VRLE 3SY0A 1B0GB 4GT7A 4BSJA 5CJOL 2KL6A 5IFJA 4FQLL 3UDWA 1LO4H 2Q6WA 1JZ5A 4AG4H 4RNRB 2E8ZA 3BDYL 4KFZC 3HNSH 3D0VA 5HDLA 4GRWE 4TSBL 4QXWA 4WJ5A 2NXYD 4WUUD 3DXAB 1RJZB 4E5XA 1ZS8B 2YR3A 4NIKB 4PRIA 4M7ZB 3WSQH 3CXDH 3MUJA 3ULVL 3QHTC 5JIIA 3MLYH 4M7KH 5H94A 1SBBA 2VISA 4O5LH 4MVBC 3KDMA 1J1PL 3AY4A 4Z8FL 4POZD 1YEFL 2GSGB 2GJZA 3GSXA 1DL7H 4CBPA 1OGAA 4GW5A 1VA9A 1ZLWH 3AREA 4HK3J 3O4OB 4G6FB 4HULB 4JZJA 2KQMA 5MEQA 2B2XH 5D1QC 3IXAA 2ZSVA 1OAZH 1T3FB 3FN3A 2VC2H 3SKUD 1YYML 5C0CA 2QADB 4AT6A 4QHUB 3PIQA 4HZLB 2VZ1A 5AYUH 3VXRD 3WIHA 2AEIT 3WNOA 3AAZB 4A2MA 1LDPH 1YEGL 4JHAL 5IGXH 1FVCA 3DSFH 4PP1D 2BP3A 3GSNH 4KAQL 4LVHC 3U0PB 3VDCA 3LV3B 1C5BL 2QTEA 4KJYB 1CICC 1UADC 5FDYA 4PJIB 5C08E 4HCRL 1T6VN 4R9HA 2Q8AL 4G9DB 4PRPD 1MRFH 4OF8A 3EO9L 1KELL 1DQJA 2HJKB 1HK6A 1RUQL 1Z9LA 5JZ7C 1NDMA 3VD5A 3ARDD 5C07D 4F33B 1YA5A 3UMTA 3CK0L 1Q8MA 5IB1B 2P45B 2CKNA 1Y6KR 1KIRB 2QSCH 3DIFA 3O4LD 3ME0A 2XRAL 5JMRA 3CUPA 3MRLB 4OZGE 4EDXB 2JELH 3NFPB 2GHWB 5FYLL 4LSVL 3PWJA 2HVKB 2D0HA 5TDNB 3BKML 3PHOA 3KPSB 4N0YH 4G6ML 4Z77B 4U6HA 3H6JA 5AAWA 1MH5A 1SVZA 4FG6D 3VXQB 1IAOB 1RHHA 1RURL 2JK5A 1IT9H 4WTXA 2VR9A 1ZWIB 4Y2DD 2YPKA 3L3KA 3WIHH 2DMKA 4PV8A 5C0NC 3LPFA 3FB7A 4RQQA 1DDHA 1TITA 4X6DF 1LK3H 2PW1A 3MLUH 3L5JA 5BQ7B 4PTTB 2BRRH 3LKNB 4JR9H 2VB5A 2R2HA 2IQ9H 3VXSB 3S98A 4LSQH 2NTSP 1U91B 2GK0A 4MAUL 3ZKXC 4WWKA 5FV1L 1A0QL 3OAUH 4UB0H 4NC0B 5I1IL 2XZAH 2GEEA 4NWTH 3WL9B 2E9IA 2A9ML 3FQTB 4OLVL 4M61B 4JRXD 1YMME 4YDVA 3QNZB 2E8YA 2WBJC 4PJ5D 4LVOB 3OAZH 1UVQA 3TH4T 3EKCA 3IRZA 2MKLC 1I4FB 5SWZD 4OCRH 5C86A 4CJ1A 3Q6GH 4LP4A 3WHE0 2CKBL 2F54D 2PR4L 4OZ4B 3OV6A 4LKXA 3DETD 1T5WB 5BJTA 4WUUA 4Z9KB 2WANA 4WHYG 2OL3L 1MCCA 4HPOH 3LQAL 4Y89A 5EU6E 2VO5A 1WZLA 4L4TB 2I26N 1NC2D 4NN5C 1AHWA 5JPMA 5JOFB 3VWJB 5F7EH 5DRXB 2R56H 4HK3N 1G6RB 2Y07H 3QCVL 4Y5VA 1FG2A 1LNUB 1XGPA 4X9BA 1VGEL 3QEHB 4LLDB 2IALB 1CE6A 5F89B 5BZWB 1FAIL 3TO4D 1BGXL 2HVJA 1I1YA 3U30C 1P84J 4OQTL 1RZ7L 4J4PC 4OI7A 5C2UB 5I1GL 1OT2A 1YY9C 1K4CA 4R2GD 1BPVA 4JQIH 1U8OA 3W11C 3B9DA 2ZUSA 3VXRA 3L3HB 3JWNC 4EUPA 1KXQE 2FO1A 1B2WH 4OI9A 1LO2H 5E0QA 4WUKL 1JNNL 5GGUB 4LBEA 4ODXB 4HF5H 2OTPA 2JJTA 1EUUA 4KY1L 4CN6A 4PRPA 1S9VA 4UT6L 5FCUL 4YQXH 2K7QA 4M6AA 4QO1A 1KLFA 1P84K 2BY0A 4IS6A 4NWUH 5E03A 3ARVA 1ADQL 3ARDA 3LDBC 4ONGH 2XNAB 3QUXD 5C07A 4ZFGH 3RVTD 1B3JA 1KJ2L 5TF1H 1MFCH 1D5IL 4JRYD 4S10A 3RGVB 2VQ1B 3ULVD 5F3HB 4EN3D 5DEFB 4ZFOL 3JV6B 3O4LA 1CF8H 1HHHA 4NOFA 4GKZB 3T0VA 1NMBL 4OLXL 4DQOL 2YZ1A 2NTFB 2BHYA 1K3ZA 1HHJA 1JIBA 3MA7A 1ES0A 4U1IA 3P11L 4M1GH 1MIEH 5GSRB 5BOPA 5JHLH 3TA3B 4BKLA 1LWRA 2J8OA 3MFGB 5I1KH 4Y2DA 1RZGA 3RKDD 43C9B 4K3DH 5D93C 1ZVHA 3QEGH 4IDJH 3HG1B 3BPOB 2LAAA 1GGIL 4AYFA 4RRPG 4FFVD 4N5ED 3V6ZB 2IAMD 5A43C 1MJ7H 3QDJB 2WLZA 1FFPA 1MCKA 4HJ0D 4U2YA 1FIGL 4OLWL 2DLIA 3M1BA 3ZTJG 5FFLA 3WDHA 1JTPA 3BGMA 4JRXA 4NKDB 4Q97A 3I9GL 3QIBD 4PJ5A 1EX0A 2UVEA 5FA3A 4K7PL 1FL6B 2H9GA 4GAFB 1CIUA 3L3DB 5TE4L 5SWZA 3SDYL 3WN5C 5K9KA 4X6CF 5FYLD 1QFWL 2F54A 3U6RB 3JWDH 2QADD 1CFTA 5DJ2A 5ID0A 1T2QH 4C58B 2X9WA 4JY6A 1MCNA 1U92B 2F53E 3ZDYE 5GS3A 3G5ZA 1NC2A 1AH1A 5ITBH 4ODTL 1HKLH 1L6ZA 2X41A 4LAQL 4PRAA 2YUZA 4F58L 4H26B 4TULH 4TUJA 4HKXA 1U8PB 3LKSA 3HHRB 2CRIA 4KRPB 3NH7L 1MWAL 2WUBL 5CMAA 2WSKA 4YK4C 3TO4A 2HT2C 3DGCR 4IMKC 2CGRL 4D9RE 5DTFB 5INDB 4EOWH 4D9QD 1CZ8L 3D3VE 5CILL 1KENH 3BEWA 5I73B 4LLUB 2PXYD 4UIMA 4D8PA 4WV1B 4NKOA 4U6TA 1N26A 4LPWA 5HHVH 4OB5H 3ABZA 5BVPL 2QHRH 1ORQA 1QPPA 4U1JA 2EIZA 5IBUB 2HP4A 1A7PH 4ORGA 2FEEL 4LCCB 4P2CG 1ZLSL 1U8QB 5E1AB 1RK1A 5F70A 1AR1D 2KBGA 1BREA 2VSCA 4DGYL 1LEIA 3VXPB 2C26A 1BZ9B 3O6ML 5HVGB 1FNSH 5IQ7H 3CDFA 4HUUB 4TOYH 1G9NH 3QPQC 2GFBA 1XGQA 4BSWB 3IGAA 2Q3AA 2B8OT 8CGTA 3PE9A 2AEPH 3U36A 1GOFA 3UTPE 4JPKL 1CDIA 3QUXA 1NFDF 4KKCC 3KR3H 4R3SA 4TUOA 1F2QA 1F4WL 2D7OA 5HJ3B 3C6SB 4JRYA 3VXSD 2JLLA 2AEQH 2UWEE 4UU9A 3UJIL 4EN3A 4U1KA 4JM4L 4PJDF 4M62L 3FRPA 1WFUA 2W9EL 3IJSB 2DAVA 2NLJB 4ONFH 3TCLB 1NMCC 3IDYC 4O2FB 4HUXA 5GISH 5D2LB 5HPMA 3NZ8A 4Y5XC 1UACH 1FDLH 4MGXA 5F7DB 2BFVH 5GJTL 2Q76A 4JO3H 3MRFA 3UTSE 4RAVB 5JQHC 3MV7D 4Z76B 2C1PB 5IVOA 4FNLL 1KB9J 5DF0A 3FCTA 1E6OL 1WISA 3GB7B 4NJ9H 5GS1A 2OJZL 1RUAH 6CGTA 1AGDA 2OCFD 3IETA 1U2CA 4O58H 4XX1E 3OKKB 3QAZB 3PV7A 4KJWC 5HTSA 3QDHA 4S11A 2WWMD 1RJZA 4RFEA 4AEHL 5CJOH 4EKXA 2OTWA 4FQLH 4DKAA 1BEYL 1I1RA 4HCRA 3BDYH 2IAMA 2LE9A 3IFNL 4IRJB 1ITBB 4JKLA 3T09A 5I71C 3C87A 3U46A 1BQHG 4TSBH 4ZO6A 1DBAL 2I5YL 5IIEB 2I9LA 4OFKA 4NN7B 1ZKAA 4I3SL 1J8KA 3QIBA 3PABA 2XWBB 1KB9K 4F7TB 3ULSB 2LTQB 2YBRB 5T1LB 2PTUA 3MREB 1S5IL 1ZHLB 2PW2A 3V7AE 5C92A 3EYSL 5AUMB 3VG9C 4Z8FH 1YEFH 4WRLA 1S7VA 2PYEB 3AS1A 1FZMB 1CXFA 4R7DA 4NN6C 4M03A 3NCFB 3T4AA 3U0PA 3BHBB 3LV3A 5DDHB 3BP6B 4KJYA 4WO4D 1T1WB 3O3BA 3PNWB 1FJ1B 1YYMH 4PJIA 4S2SB 3LD8C 1MHEB 3BIBX 3BKCL 4PFEA 4JQXA 4HEME 3WD5L 4C4KT 2XN9B 4QRTB 4J3OC 1YEGH 5IROC 4JHAH 2P46B 3DV6A 1C5BH 2ERJC 3OKEA 1JGLL 2N4IA 4G8GD 1S5HB 4HCRH 4MHHG 2Q8AH 3P30L 1CD8A 4KQ4H 5FF6A 3WLBB 2V2TA 1KIRA 3ZKSD 5FHAL 3EO9H 1KELH 2EO9A 3MUZ1 1CE1L 4XCEA 1RUQH 2PXYA 2DWDB 4EDXA 4RAHA 2VJXA 1S7WA 2AXFA 3OAYK 5I1CL 1R5IA 1DTUA 3CK0H 4GAGL 5E8OA 2XTJC 3EYVA 3ZKND 4X5WA 4WFHE 3MROB 1WT5C 2XRAH 1U0QA 1WIPA 1QA9A 3FO2A 2PETA 4AM0B 4Y4KB 4KDTA 2WINB 1IAOA 5LWYL 5FYLH 3DUSA 4LSVH 3CPLA 4AEEA 1PKQE 1X3DA 3GMRB 3BKMH 1XZ0B 1T2XA 4OTXL 2CKBA 2B1HL 5D2NE 1CK0L 4LCYB 5GSVB 4CVUA 3HG1D 4FFZL 5MI0B 2XZZA 4KV5F 2R69L 3FFCE 1AFVL 3QUZC 4CDGC 1RURH 3UPCA 1G0DA 3RHWK 5BQ7A 3LKNA 4QHMA 4PJGE 3DRTA 3VXSA 2OR8A 5FKAB 2W0FA 1R3KB 1KB5B 4PGDA 3ZSTA 3WNLA 1JZ6A 4YGAB 3TBWA 5EO1B 1J8HB 2ZUVA 3IYLW 4PJFE 4M61A 2WBKA 2GJ6D 2J88L 4QNPF 4MAUH 4OQTA 2FHCA 1TETL 1A0QH 4Z5RB 2YD6A 5I1IH 3LKOA 1XR8A 4L9LC 3MV7A 4R97C 5FK9A 4C56D 2A9MH 1ZA3A 4XB7A 4XTRC 1SJEB 5C0AD 4OLVH 2BVPA 4JGJA 4G80B 3VW3L 1QUNA 3M8OL 1UEMA 5AWNL 2VABA 1T5WA 5IBLD 1RJLB 1JBJA 2XKNB 4QT5B 1FPTH 3BMVA 1A9BA 3RDTC 3INUL 2CKBH 5GZND 3TH2T 5HD8D 1EGJL 2PR4H 1IQDB 4LK4A 2VZOA 4XNMA 1LNUA 1ZHBA 3ILPA 2VQTA 3VCLB 3ZE2F 1MHCA 2OL3H 2Z8SA 3QEHA 3LQAH 4LLDA 5E6IC 1K8DA 4KRPD 1ADQA 1FNLA 4BZ1L 2J12B 5F89A 1QPXA 3AUVA 4LIQE 1WJ3A 3JV5A 1KJ2A 3PJSB 4U33A 2BMKA 4UOJA 4X0KA 4ZFOA 3T4YA 1BD2D 3QCVH 1MY7A 1VGEH 1KCRH 4DCQA 3PV6B 1MFAL 3E8UL 4BFBD 4DGIL 4JPIB 4NYLA 2HJFA 4UNTA 2XIDA 3VGAC 1A7NL 4HT1L 1DZBA 4OQTH 3RX8A 4PJ8D 5I66A 4PR5A 4DEPC 4ODHL 3DO7B 1UXWB 1N4XL 3NMEA 4ODXA 4WO4A 3TGXA 5CSGA 4QHNB 1EIBA 1NUGA 2AXJA 2CK0L 3WNNA 1WCBB 3KLAB 1DJSA 5KSVB 3G5VB 1WLHA 3D0LA 4G8GA 4WUKH 2XNAA 2BSTA 1NLBH 2HRLA 3SBWC 2BCKB 4KY1H 1BQHB 3KLHC 4UT6H 3OPZL 2P5ED 1MAJA 2J7LA 3AU1B 5ERWB 4GKZA 3EO0A 3K1DA 3R8QA 1NSNL 1ADQH 1C5CL 2Y7QA 4QXGH 4H5SA 2NTFA 1CFNB 3H3BC 1KJ2H 1JPSL 1D5IH 1QLRB 3UTTD 2EE2A 1R3LB 2OQJB 1AXTL 3PDGA 5ETUB 1NMBH 2F5AL 4OLXH 4DQOH 1MCIA 1U8KA 2VLLA 1XR9A 2DIBA 4UUJA 5HYJB 3AB0C 3KXFE 4HD9A 4QCIB 2HFTA 1J1OL 4PJ7E 4CDHA 1TIUA 3HG1A 3PQYD 1U9KA 2D7TL 3P11H 1JYWA 3VD3A 5GIRB 3ARTA 4MX7B 4KC3B 5T5NF 1X5GA 3OAYH 2DQTL 4HDIB 3QSKB 4H25A 4A6YB 1E4KA 5KSUA 2EH7L 4UIKL 5J9PB 5CEZL 4FFWC 3S3PA 2YZ8A 5ELIA 1UH2A 4RMUA 4Y4HD 5I74C 4G7VL 3BI9X 1MWAA 3LS4L 1FYTB 3JV0A 1S7UB 1PVHA 3H3PL 1U8MB 5JQ6L 1Q94B 5C0BE 1MEXL 2GJ6A 3EFDL 1FBIL 4IRSD 4M7LT 3FQNA 2BDNL 4XVJL 3QQ3A 4DK6A 1F97A 1AO7E 1W8OA 1SEBA 4NO3B 2BVYA 4OLWH 3ARGD 1OTSD 2FO4A 3GHEH 2X40A 2JJVA 4C56A 4L29B 2OI9C 2YD1A 1UKQA 3BZEB 5C0AA 1NFDA 3I9GH 1A3LH 5EO9B 1MIML 4EI6B 3P73A 4ZG1A 4K7PH 5GJSL 1ZGLB 5TE4H 1ED3B 1U3JA 2ENSA 5CD3B 3SDYH 4DUVA 1T5XB 1ZT7A 4MNGE 4RFNB 5EPMB 5I19L 4W6YB 4P2OC 5D7IB 1BVKA 2APVA 2ZNWA 3R06B 3WUWA 3CFBB 1EUTA 4M3JA 2LFGA 3EYQD 3O45B 2L0DA 1S7TB 3WHE1 4MCYB 1UB6B 2CMRL 4LAQH 4YDLB 4OZHF 4F58H 4QHKI 5ISZB 1MUJB 1BD2A 1IC5L 4JKPH 4HWEL 4FN0A 3R0MA 2IGFL 5E9DD 3NH7H 1MWAH 4RZCA 2WUBH 3UYOD 1YEKL 2IH3B 4OGZA 3VXUB 1FFRA 1KOAA 4X7CC 2CGRH 1DQLL 4L1DA 4KI5E 1VFMA 1PLGL 3QIWC 3STZB 5CZXD 4PJ8A 1AP2B 4ZNCD 5J11C 2R1YA 5JIHA 2ATPB 4NQVA 3WLWD 4UDUB 4RCAA 2FJHA 3C8KA 2BNUB 4U0RB 2XPGB 4RGND 3LCYA 1MFBL 2EDFA 3BFOA 4LRIA 5CKAA 4Z95L 2APBA 4LRNH 4LCUA 4MJIB 4WDIB 4P9ML 3U4AA 3LEVL 2FH6A 5BRZB 1ZLSH 5CKGA 4F3FA 4N1CA 4DGYH 3TT3H 3HR5B 1BOGB 4YPJA 2X44D 4I0PB 3FB8A 4FQ1L 4BK4A 5KAQF 4YO0A 2PO6B 2FX7L 1GZPB 4HKZA 2P5EA 3CNKA 4HH8A 1W0WB 4C54A 5D6CB 1J5OL 1UFUA 4L3ED 3IJSA 2EDRA 3VXTB 4O2FA 4XNXL 2VYRE 1HSAA 1F4WH 1HINL 4QRRD 5KOVC 4TNWF 3GMMB 3QZWG 1BP3B 2CLVA 1S7XB 3UTTA 3UJIH 1CLOL 1PSKL 5I1DB 3QA3B 4BZ2H 3FB6B 3Q6FA 4MQSB 3N1MC 4OBSA 1YN6A 3MLZL 3VXOA 4M62H 3P9MB 5CCKL 2P4AB 3WHXA 2W9EH 2X1WL 1A5FL 4RAVA 5T3ZL 2C1PA 3V5KB 4I8DA 2AK1L 4BYHA 5SX4H 3RTQC 2PTTB 2EDJA 1LDSA 1P4LA 3O8XD 4GQ9L 4WW1A 1D5BA 3PQYA 3ARFB 5GJTH 3OKDA 2VDLL 3JVGA 2VLME 1XAUA 3ZMRA 2YWZA 4NKIL 3DUUA 3CFDA 4FNLH 5KVFL 1E6OH 4JFFE 5DC9B 4LF3B 5B38G 4HIJB 1P9MA 2NY7L 2OJZH 2Y25A 1ZK9A 3EJZC 3IAPA 4Z7QE 4GUPA 1AI1H 3IS1X 4WCYH 3RU8H 4Y4HA 1NGXB 1T83A 4OZIB 1B4JL 4OZGF 4AEHH 1JPTH 5DWUL 2WAHA 5B39B 3S35X 5KN5A 4IRSA 3IFNH 5F7YC 4URTB 3ULSA 2Y06L 3NCEB 4EQ3A 4ELME 1ZVSB 3ARGA 5BS0E 1DSFL 1CGSL 2MCPL 3WJJA 2DM2A 1FZMA 1MCPL 4PY8J 1R5WA 3CLFL 1CGUA 4GO6B 5F1KC 1K5NB 3RVWD 2EE3A 5L0QC 2HFFB 4NT6B 3KHQA 1ZHNA 1H15A 5TGBB 1S5IH 2IPKA 2NY2D 2OJEA 5CGYC 5C09E 3EYSH 4V1DD 3QDMB 3BP6A 1VGKA 4HZAA 3PNWA 3L3GB 1FJ1A 4S2SA 2YN3A 5C3LD 2E7CA 5EZOH 5K59F 1SM3L 1GPOL 3C5SB 1MCJA 3BDXA 4QRTA 1U58A 2J8UF 4XAKE 1UB5B 4K7PY 1CDUA 5FO7A 1AD9A 5HHXL 4RRPA 5F9OL 4G42A 5E8DL 1WCQA 4ZOAA 4XPAL 4E41E 3HZYA 2A74B 5C0GB 2ZOKB 4RA0C 1S5HA 2NY4D 2Z4QA 4HUKB 1K4DB 4HKJA 1EVTC 3BKCH 4LPTA 3WD5H 5CBEA 3FOLA 4PREB 3V6OE 5CEZD 3QXTA 5IK3A 3I02B 5E9DA 1JGLH 3O3DB 4M5ZL 4IIQB 2GJJA 4GMSL 3E6FA 3I6LE 4PLOB 1Z0NA 2VDPL 4P57B 4P9HH 5FKPA 2DRUA 3P30H 3MLTB 3L5IA 4N8CL 1MCFA 1VFBA 5FHAH 3SE9L 1CE1H 4D0BB 3FO0L 5C70A 2QQNH 3RA7H 3HFML 4K2UL 1Q72L 1XZ0A 2Q7YA 1YQVL 3QH3B 1KYOJ 2UZIL 4NOBA 4UINL 1OP9A 3WIFB 5C0EA 4WI8A 4RGOL 2Z31D 4PLKC 4QXTA 3UBXI 1BX2B 3D39B 1DN2A 2E7HA 4OTXH 1PG7L 2B1HH 2VTFA 5FKAA 1EGJA 1A7OL 3QHFL 4FFZH 3RWHA 4U1SA 4JFXB 3T2PA 4L3EA 5KJRL 2R69H 1AFVH 1IJ9A 2QV2A 3QIUD 2MWCA 1IFHL 1NJ9A 3IDXH 4G9FD 4QRRA 4XP4L 3LMJL 4PBXA 3QPXL 4XT1C 3FAXA 5T1MB 2MKWA 1XH3B 3ZTJH 3K46A 3SJVE 3O41B 2M8XA 2VH5L 1KUMA 3ARSA 3CCHA 1I1AB 2J88H 3O8XA 3RNKB 5H37G 2IF7A 1UQSB 2JE8A 5IB4B 1TETH 4P3WA 2NX5D 5I1JL 2BSSA 3TJHC 1A8JH 3GSVB 2XKNA 3KPLB 4QT5A 3DURA 4P48A 1QSZA 3NFSL 3O3AB 2H26B 1EZVY 2P7TB 3VW3H 1A9EB 3M8OH 5AWNH 4YBQC 5EH1A 1U8HB 1LO3L 3ULUL 4X6DB 1PBYA 4ZPTA 3RX5A 3TVMB 5TQ0L 1RZIA 2DI9A 5CP7B 3INUH 1KIQA 1Q0XL 1EGJH 3RI5F 3MRGB 5ISZD 2G9HB 1MCWW 3ZO0A 2L4OA 3MR9A 3PV6A 4BZ1H 4L8CA 4Y4FD 3VFPA 2V2XA 3DMMD 4MAYC 1A6ZA 2H8PA 3VXUD 4JPIA 2X4RA 3RIFF 2VZTA 2GCYA 4MNHA 4PPTA 4V1DA 3MCLL 3BP4B 4I0KA 5T3ZD 4X80L 1MFAH 5DK0B 2D03H 4QHNA 1A6VL 1A7NH 4HT1H 4QKXB 4MJID 5F6HJ 4ZUUB 3V52H 5IHLB 3QJFA 4M4PA 2HG5A 5BRZD 4HIHB 1I9RL 3KLAA 4LVHB 4ODHH 2GK2A 1X7QA 2MQCA 4N0CC 1OP3K 4JFHD 1N4XH 1CICB 1JVKA 1L7TL 4X4XB 2MTPA 3C2SA 4I0PD 3MRRA 4GRLD 5HDBE 4XNQB 4Z18A 1N5AA 3HZKB 1T0MB 2WWKO 3NN8A 3WDIA 4X4YA 4YC2B 1DLHB 5F93C 5ERWA 4NNYB 4P5TB 3L7FB 3TYFA 1WQVT 4I2XB 3NPZB 1KN4H 3SDDC 1M7XA 2L7UA 3FOMA 3DX9B 4RDQF 5IVXF 2Y72A 4E42B 1JGDB 3BDBA 1G7IB 1VEOA 1MQ8A 3OPZH 4GRMB 4WU7B 1M71B 1F3RB 1M7DB 5IHUL 5ETUA 5B22A 4NSKA 5GXBB 3HAEH 5CSBA 1C5CH 4JPWL 4DN4L 1JHTA 4G6JH 3ZDYF 1ULVA 5J6GB 1EDQA 3CH1B 1SHMA 1JPSH 1J05A 2X4PB 5D7KE 3G6JF 3ARFD 3UTQA 4OZHA 4GW1B 1AXTH 3ISWA 3WFEL 1P7HL 2X4OB 5GIRA 1P4BH 3TZVC 4MX7A 3TV3H 1HILB 1CFQA 2Z31A 1AY1L 1J0IA 3L5HA 1QFUL 4HDIA 3ALXA 1QRKA 1J1OH 3OWEA 4RWYL 5AG8A 3S37L 3IB4A 2GIYA 1H8SA 3C60C 3QIUA 3QDGD 4G9FA 3ROLA 5JLZA 1I9IH 2DQTH 3WS6C 4DKEL 5FOBB 2EH7H 4UIKH 1ZSDA 5CEZH 1G7JB 1HXYB 1UEYA 1IGFL 4NO3A 5E5RB 3HUJE 4GXVL 5EU4B 5DMIL 4L29A 1OAXL 1IGTB 1OTUD 1J0KA 3RY4A 3LKPB 1WSST 2C5DC 3LS4H 3QNXA 4IOFD 4P3DA 4C83B 3Q2CA 5JO5A 1MEXH 3EFDH 3F12B 1FBIH 1DEEB 5HYSG 2ZUYA 2WBJB 4P2QE 4XVJH 1CGXA 2NX5A 2BERA 4Q0XL 5JORB 1ZGLA 5IMMB 1P1ZB 2LAGB 4O2CA 4EI5D 3D9AL 5J1AA 5IFHL 1FC1A 1Y0LA 3MMEA 4QRPB 4LCWB 3JZ7A 3QXDA 3C08L 3HPJB 5D7IA 5GJSH 1RQ5A 4CN4A 3HC3L 3P0YL 3P4LA 3CH8A 1CN4A 3ETBF 1VSCA 2HT3C 1X6LA 4XI5C 2ICEA 5I19H 1H3WM 4K23H 5DEGA 1YEDA 3HI6L 2Z8WC 5ISZA 2EDEA 2VAJA 2P8LA 1P4IL 5T1KB 3LAFA 4HBCL 4NQUA 1JPFA 1QBBA 4YFLI 4IRZL 4Y4FA 4K9EH 1KJ3L 4WEUD 5DJAB 3VXUA 3DMMA 2NXZC 4Y19E 4MQ7A 2CMRH 3VWKC 3STZA 3U30B 1IC5H 3MCKB 5F96L 2DKMA 2FBOJ 4HWEH 3UAJC 2IGFH 4JN1H 4L4VE 4UDUA 3T8XB 4DZ8B 2BNUA 2XPGA 1YEKH 2ED8A 3DBXB 5F6IC 4RGMC 1L9MA 5CGTA 3KPQB 1DQLH 3CX5J 4P23D 3SPVA 1PLGH 5JDSB 4MJIA 4K07A 3OKMB 4KUCF 5BRZA 4QYOA 2VXSH 1QSEE 3X12A 2XFXB 4CKVX 2H32B 3LPGA 4I0PA 4GRLA 4LVNC 2HTKC 2EEDA 4PJ9C 1GZPA 4XBEL 1KCVL 3K4AA 3N1FC 1M1SA 4PJCE 3FB5B 3JV4B 4AIZB 4M93B 3TLRA 2VDNH 5ICXA 3ULUD 2N7BA 3F65A 4AENA 4FQ1H 5EN2B 3RUGB 1V7ML 5T3XE 3ZDZE 4ZYKB 5BV7B 3RVUC 3FB6A 3CX5K 4OFYD 1J5OH 1HE7A 2J8UA 2R0LL 2H6PB 3V5KA 4XNXH 1OP3H 2C3XA 2BRQA 1HINH 2GI7A 3D1MC 3RWIB 1A1NA 3RP1A 1I1AD 2IQAB 4PS4L 4L8SB 43CAB 1CLOH 3ARFA 1EH9A 1PSKH 2PTVA 3OZ9L 2COQA 3MLZH 3MZGB 4PJXE 5CCKH 2K9UA 5C6WH 2VDKH 1A5FH 3W5NA 2AK1H 1UCTA 3HE6C 3ORJA 3ALWA 1A02N 3QRFM 1OT1A 3MNZB 4GQ9H 4QRUA 2FR4B 3UPAA 4MA8L 4JB9L 4ZUWB 1YJDH 2VDLH 3MV9D 3T3MF 5FDWB 1NGXA 4NKIH 2RFXA 3THML 1YUHA 1BLNB 5AG9A 5KVFH 1RJYA 1N5YL 3QDGA 3DUHA 4M6NL 5DUPH 5DUBB 1L0YA 4ZTPL 2VLRB 2NY7H 2OSLB 5IOPA 2V5RA 1KG0B 3GMQB 4X5XA 2LU7A 2BOCA 4I9WD 4PJDB 1PEWA 2RR3A 3WFCL 5E95B 4MVBD 2YUVA 3X3GL 1TQBB 5DD3L 3T2NL 5EUOF 5C7XH 2BVOA 2B4CC 5DWUH 2BNQE 3CZFA 4OD2B 2NY1C 2Y06H 4NT6A 3MLSL 3TFKC 3BIKB 1MPAL 2V7NA 1DSFH 1CGSH 4EI5A 1Z9SA 5IKCB 2MCPH 5D1QD 5DHVA 3L3GA 3U1SL 1MCPH 3EZJB 3CLFH 3IDIA 5D1XC 3QXVA 2DBLH 15C8L 1UB5A 3RNQB 5MHSD 2ZCLL 3CDGA 1BJ1H 3MOBH 4YFLF 2DQUL 5ESQB 2A74A 3Q1SL 3WFBL 1CICD 3TPKA 5DS8B 1JGEB 1SM3H 2LQRA 4DZBB 1GPOH 4IDLA 3P2TA 3DX8B 3SCMB 4X4MA 5EZLA 1UH3A 4TTGA 1CGWA 2ITCB 5E8DH 3O11B 5JZ7D 4KQ3L 3O3DA 2AXGB 3ZSSA 4IIQA 2ORBL 1I1FA 2P5WD 3O3UN 5J13C 1U36A 2V5YA 5HGBB 5C0RL 4OCSL 2M26A 5IW1A 3CXHJ 4FQJL 5D7LE 2EDQA 3QUYC 2XZQL 5I8CA 3WE6B 3BZFB 1QD0A 4M5ZH 4PRIE 2NY3B 4Z7VF 4P23A 5IR1B 2CDEB 4N8CH 3GSQA 5D6DC 1H5BB 1XF1A 3BW9B 4NP4L 3SE9H 3U0WL 3FO0H 5DJZB 4WY7L 3QQ9C 5F1SA 5GZOC 5DHVH 3HFMH 4YXHL 1QFHA 4K2UH 2CIIA 1OGAE 1Q72H 3QEUA 1CXHA 1LO0L 3MGTB 2PYFA 5DK2B 1YQVH 1XCTB 2UZIH 1N8ZB 4UINH 2FECL 1K2DB 4KRMB 4DFIA 4RGOH 2IFGA 3DRQA 5DI8A 1BVZA 1J7VR 4UBDD 3MRMB 1PG7H 1EHNA 3T0EE 1F3JB 2ZUWA 5LQBL 1A4JB 4Y1AD 1A7OH 4OFYA 4R96A 3QHFH 2NCMA 1TJIL 3LQZA 3TC9A 5KJRH 3L7EA 2XI9A 4W81A 4WI4A 1QR1B 1F8TL 3IDYB 1FLTX 1IFHH 4R0LA 4P2RE 3K81A 4XP4H 4Y5XB 4XXCC 1I1AA 3LMJH 3RNKA 3QPXH 3P0VL 5IW6A 2DJSA 2WBJD 4FTVD 1QZ1A 2KZ1B 3IFPA 1A1MA 4UILL 3GSVA 2VH5H 3C6LB 1FVEB 3C5ZB 2R1WB 3FAWA 1II4E 4PP2A 1QP1A 2KH2B 2PCPA 3EYUH 4HG4K 4GXUM 1A2YB 3K2UL 4NNXA 2W59A 5I1JH 3MV9A 3LVEA 3X13A 5CGMA 2X70B 3EBAA 5DRNA 4MLSA 4ZFZB 4YBLC 5EWIH 2JTDA 1P7KB 3EFFA 3R1GL 3NFSH 5HHOD 3DX6B 5I71B 3MRGA 4KI5C 3REVA 1KGCD 2C3VA 4PJEB 3ARZA 3S96A 1LO3H 1OGTA 2CLRB 1FLRL 2E6PA 3CFKA 3QZWA 4X99B 5TQ0H 3H0TB 4X6FB 4P5KB 2ZSWB 2OXHA 3KS0H 4TQEL 2A6IA 3MACH 4H20L 2VL5B 1D5XB 5HHNA 4J4PD 4JZOA 4PJ7F 2HKFL 2I24N 3NACL 3PXHA 1YY9D 4YHIA 5D1QA 5E8PA 4WTZG 5JW4M 2QSTA 3VFNB 1FAKT 3W9DB 3W11D 4WTWA 1QHPA 2A77L 4NN6B 4KKNA 4M7ZC 4ZUUA 3KG5A 3LB6C 2VLKB 4WFED 5DURD 5B38A 1HHKA 5D9SA 2VNCA 1JHKH 3B8SA 1CICA 4X80H 3D25B 4N8PA 3E6HB 3QEQB 3HZKA 4NO5A 2Z91B 2NW2B 1IGJB 2ATKA 1A6VH 4GMTL 1SYVB 3H9SE 4NNYA 1T7VA 4K3EL 1YZZA 3MRHB 1U8LA 4I2XA 5JTWA 3BH9A 4L4JA 2IH1B 2X1QA 4I18C 3MV8B 2K3TA 1PFCA 3O4OC 4U1LA 1FZJA 4D94A 2P5WA 3DX9A 5HHMB 5A16B 1ZEAL 4JO4L 3LH2L 3UTOA 3HLAA 3G5XA 5MP6L 4GRMA 4WU7A 1M71A 1XGUA 2APTA 5L2KD 3CFIC 3NZHL 2AABL 4WUUE 3T77A 1W0YT 3LS5L 1QEWB 2F9BT 1HH9B 4GBXC 3RWFA 4JFQB 3BPNB 5JW4R 1CQKA 1I7TB 4Z78A 3CH1A 3TBVA 1CL7L 1YEIL 2DIJA 1RIVL 1E4XI 1EJ6A 1O7SA 1PAMA 4LLVA 3RX7A 2IEPA 5H35B 3V4PH 1C08B 1INDH 1T22B 3OGOE 1J86A 1IC1A 3E1F1 1C7SA 2VLJD 4XMKH 3VFOB 4U3HA 1EEYB 1WWAX 3NIGF 5GGRB 1N0LA 3WO4C 5KS9E 2EIDA 2L7JA 3WFEH 1PZUB 2X1XR 4PRHD 3KJ4C 4WENB 5FUCE 5EU3A 2ZPKL 3QUZB 1T04A 2FL5B 1AY1H 2CIKB 2X4QB 3S8WA 3D87B 2NY6B 3U0TB 2SEBB 3I75B 1QFUH 3KJ6H 4WHTB 4XH2B 3DJ9A 5HI3C 2GT9A 4Y1AA 3MRQA 4RWYH 3S37H 5DT1L 5IM7B 5IHZB 5I6XB 5IMLA 1GIGL 1YECL 5GGVH 4CU6A 5B3JE 4DKEH 4OCYL 2WBJA 4YDJA 4FTVA 3VGGA 1IGFH 2P8PB 4GXVH 5KW9H 5DMIH 5A40E 4XZUB 2ICES 2C4XA 2DQEL 4NZDA 4KI1A 3HCVB 2JCCF 3HPJA 3QCTL 1U42A 3O4LE 3W39B 1REIA 3SQOL 4DOHE 4Q0XH 4PJHB 3T1FA 3V6OC 3MV11 2Z93B 2NR6C 5IWLC 1HQRA 3T1WA 3D9AH 3Q3GA 5IFHH 2JJUA 1XGRB 4ONOA 3GSWB 1V3LA 3C08H 4LMQE 5HHOA 1JZ4A 2YRLA 5KG9A 3QR2A 4TNVF 1NC4B 5ANME 3EDJA 3HC3H 2E9BA 3P0YH 3JTSA 5EG6C 3S4SB 5KVGL 5HGDB 5E6IB 1HEZB 4HH9B 3M17A 5DJ8B 3MLWH 2LVCA 4QOKE 2HT2D 2A73B 3O9WB 4NQDB 4CU7A 3MNVA 4J4PA 3UTZA 3MCKA 3WFHA 4PG2C 4HBCH 4OCXH 5IMKB 3BSZL 3BQUB 4IRZH 2VMFA 5C9JB 3GO1H 3QUMB 3TWCL 2DL9A 5FM5M 4U1MB 4JJ5B 4YUEL 2QSVA 5ACZB 1C1EL 3SEPA 4L8DA 3OKMA 3UZVB 2AKRB 3VWJC 4MXQD 3OXSA 3PDOB 2FYYB 3CSYA 1Y18A 1H8OA 5EFIA 1LK2B 5I1AA 1FZOB 4JRXE 1V05A 4F9PC 2O5XL 3SGJC 4ZD3L 4ETQB 1V5JA 3WUZA 3QPQD 4LFHG 2E6QA 5JXED 1JCKA 4ELMF 4MZ3A 4YHZL 4AIZA 4OGYL 5EORH 1RJCA 1RPQA 3H9ZA 4KKCD 4JPVL 1P5VA 5EN2A 3RUGA 2F54E 3BP5A 4P5MB 4P59L 1KCVH 3MOQA 1AE6L 5L2KA 5F7HA 3IT8D 1KFAL 1X5LA 5INCA 1BZQK 2CDGB 3UYRL 2A6JB 4U6XA 5CIPH 3I85A 1GRWA 1TZHB 1GYAA 1V7MH 3RWIA 2DQDL 5A2FA 2XWJB 5EC1B 43CAA 4JY4B 3MRKB 4HS6B 4GG6F 1ROWA 5T33L 2DL2A 2R0LH 2VLJA 4GRWB 5H37H 4PJBF 2FJGB 4EBQL 4PG9A 3TYGH 3CDYA 2P44B 3MNZA 5IMOB 4PS4H 1PJ9A 3O2VH 4OZFH 4PRHA 5JNYB 3RGVC 4KJWD 1EFXD 3GK8L 1Z3GL 1G7QA 1P6FA 4MMZC 3ARUA 2AV7A 1WBYA 3QUKA 5ALCH 5B3NA 5LAXB 4Q9RL 3BRDA 1LE5B 1EZVX 3GMQA 3LPWA 4Z7VA 4MA8H 2X4UB 4JB9H 5DQ9A 4XAWH 4LQFL 4XXDA 3RL1B 3THMH 2WIIB 4ZS6C 3CX2A 3PGCA 3WV0A 1N5YH 1LP9F 4M6NH 3HE7C 4ZTPH 5GGSB 5GRUL 3TA3C 2Z92B 3WNMA 4ESKA 4ODUB 1KN2L 2AJSH 1NCDL 4HGKC 5D5MA 3UPRB 3QO0B 3WFCH 4EZMA 3RL2B 4NNPL 4Q58C 3RKPA 3WN5A 3X3GH 5IKCA 3QXAA 4HEPG 3BPOC 5JHDD 1F5WA 1T21A 5DQDL 4JRYE 5C08B 3VMPA 1XF2A 5DRZB 3MLSH 1GCFA 2R9HC 3N1GC 1OF2B 1S7RB 3B9KD 1G7MB 4EIGB 1T89C 2VITB 4YDKH 2DYPB 3U1SH 5DS8A 3DOSA 1G7HB 4YLQT 1FSKB 5IVZA 1F90L 3R0NA 1IGYA 4TN9A 4K7FA 4P2OB 5GRYA 3U9UA 3KPTA 4HAGA 15C8H 1UM5L 3W5MA 3V8CA 1MCRA 1HHGA 4ZSOA 2DQUH 3MLPA 2AXGA 4OZGB 3P4NB 3Q1SH 3WFBH 4X9FA 3ROOA 1N59A 5HHMD 4IMKA 4HJGB 4QEGA 1QHOA 2VIRB 4HPYL 1TJGL 4U2ZA 5IB5A 4L3CA 4OF5A 5F1NB 4NFBA 3OR6B 5EBLB 1I8MB 5HYSA 3STBA 4Q6IB 4DKFH 3B5GA 4G6AC 1MJUL 4FQQA 5C0RH 4OCSH 1TVBA 4R4BB 1UZ8B 2XTJD 1C16B 3QIWB 1YN7A 4FQJH 1MCBA 2HAZA 2VWEE 3QHZL 3QWOB 3AS3A 2FB4L 2IBZX 1MREH 3DI3B 2AEWA 2DICA 4FQIL 3SKNB 3ZT5A 2AK4D 1KPUB 3GDBA 5DK2A 2XXCB 1XCTA 4HUWB 5DHYB 3ILQC 3W9EB 5JXEA 1N8ZA 4NDMA 5FGBC 4NP4H 3U0WH 3O3EA 5CEYB 3QUZD 1ZAGA 3UC0L 1R3HB 5FYLE 4YXHH 1AD0B 2FIRT 5IUSA 2N56A 1G9MC 1LO0H 4WV1C 3BWUC 3EDKA 3MO1B 3QRGH 1F3JA 1JWMA 1YMMB 2AI0L 3GIVB 3TT1H 3V4UL 3HC0B 3MBXH 1IEAA 12E8L 3F7YA 3T0WA 4I4WA 4AEFA 1QR1A 1T0NB 4LCCC 1DBML 5TF0A 1MLBB 4Y5XA 1I3VA 4YR6A 2FZ3A 5DD5L 3VFVB 1XF5A 4WU5B 1VENA 5EBWB 2X4SB 4D0DA 4KTYA 5LXGL 1XIWB 1U93A 3JTTA 4JANA 2BHUA 1F8TH 3IF1B 1MVUA 2W65B 3P4MB 5EU6B 3SQBA 4XTRD 4J3VA 4OLYH 4ZO9A 2EO1A 2CDFB 1A6WL 5EO0B 5FM4A 3P0VH 5E4IA 3KPRD 1DP0A 3EGSA 4UILH 4P2YA 4NKMB 1EFXA 3DVIA 1CS6A 2I60L 1IM9B 3BESR 4FS0A 2LV4A 3MJ9L 3CFEB 3RDTD 2XY2A 5F7WC 3V6FA 1F4XL 1WF5A 5IVNA 7FABL 4NC1C 5SWQA 1F6AA 1F00I 3B3IB 5E6ID 1EXUB 3KPNA 2CR3A 3IDNB 3R1GH 4ODWB 4LLMB 1OPGH 3EDEA 2UV3A 4CVXA 1UM6L 1BIHA 2VL5A 4NRYA 4UTBL 4M5YL 1QQDB 4OF6A 5F3BA 1JE6A 4PB9H 4H1LB 4G8FB 8FABB 1HHIA 1PZ5A 4H0IA 4U6YB 5JHDA 2RJMA 3GI9L 1IAIM 4G8EB 1QFWM 4TQEH 2ICWI 4ODVL 2IFFL 5IW3A 4H20H 1NMAL 2HKFH 3NACH 5CD5D 2FLBT 4IRJC 4F7MB 4RIRA 3VGDA 4KK9C 1QBLH 5DQJA 3D25A 2W1NA 3BE1L 4WI2A 4Y16C 3E6HA 5MEND 2A77H 2X4TA 4HXAH 5ABDE 4LASL 4R7NB 1SYVA 2HA1A 2WW8A 4UQ3B 3MBEB 3UEZA 5IROA 3HZMB 4GKOA 4P3CL 3QDAA 4H0HB 4LLWB 3MV7E 2IH1A 1BBDL 2LTQC 3HUJF 2AGJL 1NCWL 1MHHB 5DD1H 4YNYB 5E8EB 1T6WA 5A16A 4M00A 3V7AG 3GBNL 4Z7OF 1CDHA 2D0FA 2X5PA 1WWWX 4NHUA 4PY7B 4UT9L 3KLHD 4FXGB 1JV5B 5J57B 3HI1B 1KLGA 2QQKL 3VFUB 3NCJL 5ESVB 4FABL 2Z0BA 4H88L 3L5WA 1G0XA 1AKJB 1HH9A 5F8QC 3DO3A 1MAKA 1ZEAH 4JO4H 3LH2H 2XXMB 3RVVC 5MP6H 3QWRD 1T22A 1WT5A 3HS0A 4PRBB 2AABH 2IAND 4P0DA 3LS5H 1S7QA 2QBWA 1FNFA 5B8CC 3VFOA 1JZ2A 1INEL 2J5LC 2ADFH 2FLRT 2AK4A 4JM2F 3GMPB 2GY5A 1CL7H 1YEIH 2EC9T 5ID1A 5I8EA 1RIVH 1IZJA 4LU5L 1WV7T 1DUYA 5DFVC 1CLZH 3QUZA 1JTOA 2FL5A 2X4QA 4OCWL 2IPUG 2SEBA 1R6VA 1Q9WA 3RZCB 5J4MA 1KC5L 3NABL 5GGTA 1RIUL 3EOTL 3ARYA 4N0UA 3VFRA 1JJUA 2ZPKH 3EYOA 5DJDB 1QSFB 3G04B 4WGVB 5GRXG 1FP5A 4L1HA 1M6OB 5IVXB 4Y4KC 3DVGB 2NNAB 1QVOB 1JMXA 4L5FL 4JDZB 4Z0XB 4AEIL 3FT3B 1BJMA 3IS0X 2P8PA 4PGCB 1AJ7L 2DLGA 4ZNEA 5I1HH 4L9LA 4NQXB 4G8GE 4K3JL 5BOZG 5ACLA 2F53B 2EYTB 5MI0C 1GIGH 1YECH 2AAVA 3UBXB 2F15A 4KMTL 3B2VL 1JUFA 3HCVA 4KKAC 4X6CE 5CJ5A 4OCYH 1I3GL 5C08D 1QKZL 3OGCB 3KPRA 4XPGL 3EZ8A 3EAKA 4GLRH 4PJHA 5MEOA 3IVKB 1QFPA 3G5YA 3GM8A 1I8IB 2A6DA 3FQUB 1VFAA 3GSWA 3RDTA 2DQEH 5F88B 1ACYL 4P2OD 4KRLB 2R23B 3QCTH 4UNVA 3GMOA 4WNQA 3SQOH 2QR0B 4I3RL 3VJ6B 1EEQA 3BT2L 3D3VB 4X4ZA 5E6IA 4GG6A 1HEZA 4HH9A 3TNNA 4JFPB 5IHBA 4UTAL 5TE7L 3RIAK 1QRND 3S35L 4XNUL 5DD6A 1G7LB 3V5DB 2Q7NA 4M1DL 3TBYA 5KVGH 4KU1A 4PJXF 4JEGB 2AJXL 5C9JA 2OBGA 2BOBA 1ZLUK 4XBGB 3B8YA 1VCAA 3QIWD 4HKBB 3EJYC 1ZA6B 3BWAA 1D9KB 1DLFH 1GC1C 2XYCA 4KGLA 2FYYA 4KPHH 5TE6L 1KV3A 3D2UD 3TWCH 1L9NA 5MENA 2GJ6E 3PP3K 4U1GC 3NCMA 1E28A 5DD0L 5DJ0A 3QO1A 2UWEB 1E4XH 3T0EC 4ZUTA 1EERB 4MDJA 3V5HB 4PGBB 4C56E 3O2WL 3C9NB 5L88H 5C0AE 4HLZG 3L3OA 5J3HC 1NFDE 3SBWA 2O5XH 3IKCA 4ZD3H 2Z35A 3HRPA 1NCBL 3MGOA 1AGFA 3F7VA 2AJZB 4WI9A 4DW2L 1ZANH 4YHZH 1W72B 2I07B 3PGDA 4JN2A 5GS0C 3UTSB 4B53A 1U3HB 3OMZA 3KLDA 3SDDB 4JPVH 1T7WA 2ADIB 3PWPE 1D6EA 3NFNB 2FX8H 4P59H 2XWJA 2YK1H 3MRKA 4JY4A 1AE6H 3QWRA 1KFAH 4WTZA 2IANA 3F62A 1FL3A 1BZ7B 4N1EA 3UYRH 1KTLA 3KWWA 4Z7NF 2XG4A 4QY8A 3FQXA 5AAMA 4GKSA 1JK8B 4NZUL 1HDMB 3RTQD 4NKQB 5J1SC 4C57C 1IC7L 1BD2E 3O6KL 1X4XA 3T65B 4BK5A 5T33H 3TZVB 2EXWC 2A1WL 5I30L 1R5VB 1JTTA 4LFHD 3K74B 1Q9OB 2IBBA 3FQWB 4P49A 4EBQH 4PV9A 1DFBL 3EJZD 5FCSH 1KLUB 3K4ZA 3C60B 1Z3GH 1RV6X 5BXFB 5KVMC 3I6KA 2J8HA 4PGEA 1I3RA 4W68A 3H7LA 4Q9RH 2Z92A 1ZLVK 4JO1L 2QEJA 1IZKA 1WGOA 4LQFH 1ZMYA 4HC1H 4G6KH 4MNQE 3OF6D 3RL2A 4ISVA 5GPRA 3FT4B 3CFJB 5DRWA 5GRUH 5C08A 1FL5B 2GTWB 5DRZA 1KN2H 1NCDH 2V2WB 3N06B 4CMHB 4LHJB 4JQVC 1NAML 5C8JA 1DBBL 5CGYD 2ZCKL 5JR1L 1G7MA 4NNPH 1QBML 3GJFH 4NQCE 4JHWL 3JSSA 4LEOA 3ZTNL 1C12B 1CBVH 5DQDH 4P2OA 3UTTE 2HJLA 4F7EA 3MFFA 3VRJB 2GUOB 5D8JH 3V2AR 3MYJA 1UYWL 2R2EB 2DB8A 2IG2L 5FV2A 1VHPA 1MJJB 3Q48A 1F90H 4D0CA 1SY6H 1AHWC 2Y23A 1I1CA 4YPGB 1QRNA 2YD2A 3PQYE 1UM5H 4XCCH 5EBLA 2AS5M 4UDTB 3DVFA 1YY8A 2VZUA 3G08A 2E9WA 3MJ8B 1F2XK 3Q5OA 1PKQB 1H9VA 1JWUB 4OCNC 1C16A 3QIWA 4HPYH 2BXZA 4XMPL 1OHQA 1TJGH 4RFNC 5D2NB 3T2OA 4MSWA 4XGZB 5D7SL 3D18B 1DE4B 1XCQB 2EEAA 2C7UB 5CBAB 5KSBA 5IG7A 2DTSA 3D2UA 2ESVE 1MJUH 4RGMB 3HPLA 3WS3B 2YD8A 4XVSL 4PJGB 3SDAC 3BO8B 4MA1C 5HVFB 2W60B 4HWBL 3QHZH 4CVZB 1AC6A 1HZHL 2FB4H 5FM5O 4YDLC 4FQIH 4GW4A 3MJ9A 1H0DA 2VDML 4PLKD 3A6BL 5TH2A 4X8JB 4PJFB 3SE8L 3O2DL 3GIVA 4LMQI 4B41A 3V9FA 3V95A 3KVQA 4KKBC 4XP9L 5DVOA 3GSRA 3KNBB 1RMFL 1PX3A 3L95B 3BPCB 3MJ7B 5EU5B