1FNGB

Histocompatibility antigen
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
213
structure length
213
Chain Sequence
KKVITAFNEGLKGGGGSLVGGGSGGGGSRPWFLEYCKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAVTELGRPDAENWNSQPEFLEQKRAEVDTVCRHNYEIFDNFLVPRRVEPTVTVYPTKTQPLEHHNLLVCSVSDFYPGNIEVRWFRNGKEEKTGIVSTGLVRNGDWTFQTLVMLETVPQSGEVYTCQVEHPSLTDPVTVEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (MHC CLASS II I-EK, ALPHA CHAIN)
publication title Structural and functional consequences of altering a peptide MHC anchor residue.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
total genus 42
structure length 213
sequence length 213
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fngB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1fngB01
1IAOA 4GLRI 1IEAA 3L7FB 3IFPA 3IVKA 1ZA3B 4PJFF 2NY1B 4GW1A 4UDUA 1Q0XH 5MHSE 4E41B 3G9VA 3BT2L 1WFOA 1K2DB 2VXVH 5T3ZH 3MRNA 5D93C 2E6JA 5IMKA 3B2VH 2G75B 5CEZH 5I8CB 2JF1A 2NMSA 3E3QE 3FQXB 2JJWA 3U79A 3MCKB 4PGDB 3EYQD 1BQUA 3JWDH 1BVLB 1M7DB 1INQA 5GGSB 3S5LA 5I17A 3HUJA 1MEXH 3RWHA 4OZIB 1FNHA 2IAMA 4NNYB 5FOBB 5K59E 1DQQB 3H3KA 3KPSD 2Q8AH 5C08A 1FFNB 3U0TA 3HRZA 4HGKC 1LO3L 2R1XA 3HKFA 2P49B 3RBGA 3SOBH 4Y19B 1IGFL 1ZE3C 4ZSOB 1BVZA 3KYOB 2GY7B 1R3HB 2BNUB 1R5IA 3FB8A 4XVTL 1JPFA 3DXAB 1T6VN 4DZ8B 2MCPH 1KPUB 4NHUA 2HJFB 2OXGA 1YEIL 4NO2A 1TDQA 1IL1A 5CSZB 2E9IA 1IARB 1X5GA 1NGXA 2WIIA 1S3KL 2CDFA 4K3EH 4BFGA 4LRNH 1T4KA 4U2YA 2XYCA 4PR5B 1V05A 1CVRA 1GL4B 3FFCE 1P53A 1ZVSB 1MFDH 1RIHL 3MRGA 2YKLL 5SWZD 2DQHH 3R0NA 4NQED 2XWTA 1DBAL 3SPVB 1PLGH 3QUKA 5F9DC 3CDCA 3IU3A 2YXMA 1ZGLM 2GT9B 4UMGA 3C5JA 4QRSA 1O5DT 3MNWB 5DRZB 2JTDA 4TUJB 1G7MB 4F7CB 3CFIC 3RX7A 3O11B 2R8SL 1BF8A 2X9WA 1BQHG 4PJIB 4JVPA 4YWGL 4X4XB 4GMSH 3WL9B 5KZCB 1XIWD 2UZIL 1MELA 1NFDB 3MCLL 5MI0C 1QNZH 3GSNL 3MFGB 5A43C 3RWGB 4MHHG 15C8H 2HG5B 4OTXH 3IDNA 5FF6B 5CEXA 3CX2A 4HFUH 3SDDC 1KN2H 4WV1C 5I1LB 1G1YA 1KB9K 1MFCH 3GSXA 1JF1A 4YXKH 4ODUA 3GMMB 4WTZA 3OKOB 5TH2A 1CK0L 5HD8C 1QRNE 4ONOA 1S7SA 1UH4A 4Z7UA 4TTDC 2R1YB 2VR5A 1GC1C 2IFFH 5FB8A 3TO4D 1MVUA 1U93B 4KTEH 4E9LA 1INDH 4NQDA 5F9AC 5H37H 3K80A 4F3FA 4QTHA 4OQTH 3DMMA 1AGDA 4NDMB 4IRJC 1MRDL 5CHNB 3G08B 4HPOH 4JPKL 3PGFL 4JQVC 1NAMH 4EJ1C 1MIML 4WFHD 4UT7H 3WIHL 1JZ5A 1D7FA 2A73A 3PDDA 3ZDZF 1MAJA 1P69B 3HC0B 5D7LD 4P5TC 4AQOA 2OMNA 1DN0B 1TVHB 5EPMB 1PQZB 5C3TA 4U7MA 3KPLA 1S7RB 5FYLD 4CMMB 3VI4F 3VMNA 3B83A 4XCEA 5DEZA 3LDBB 1SM3H 4NO3B 2Y7QA 4C55A 1YPZE 1HSAA 1FZKA 2AI0H 4PG2C 5C2UB 5IQ7L 4J7RA 5ILTL 4Y2DD 1IGFH 1YQ2A 1JPGA 3S35L 1QHOA 3L3GA 3VFNB 5HHOE 4FQ1L 3GMQB 3DVIA 5HHNB 2EDBA 2FL5A 1BWWA 1YEIH 4MAYC 4TUKL 2IEPA 3HZKB 2JK5A 5CD5D 4JM2A 1WWWX 2ENSA 1Z6JT 4OD1L 3EGSA 5CEZD 5J9PA 1FFQA 1UXSA 2V7HB 4Z0XA 3IDGB 3GSWA 1ZGLP 1A1OB 1FV1B 1F8TL 1YJDH 4KK9D 2YKLH 1AXIB 4PRDB 2KH2B 3FCTB 3IETB 4NBXB 1BJ8A 3D85B 5B8CA 3P4MA 4DZBB 4LSVL 3K81A 1QR1A 3IXAA 3S3SA 4LLMB 4OZFG 5MEPA 3L9RA 4OUUB 2L0DA 1A21A 3SDAA 1MCKA 1QVOA 2FYYB 5KS9F 3MV8D 5E4EC 2AEQL 2YA1A 3QUZB 4ZTPH 1HE7A 1BD2D 4BZ2H 1F4YL 3GKZA 4PB0L 3GI8L 4M03A 1SQ2N 1HSBB 4LCCB 1U36A 5JTWA 3MCLH 3IU4H 5DSCB 3OAZK 4BH7B 3U4BL 3QO1B 4OCXL 2RCSH 3L95B 3CPLA 2HAZA 1KEMH 1G1CA 1MRFH 2W0FA 5EN2A 1IM9D 3QNZA 5KJRH 3RWCB 3C5ZA 1LO0L 2Y4SA 3NFPB 4G43B 1CK0H 4OV6F 3RGVC 2WWMC 3FT2A 5ENWA 4Y4FB 4MJ5A 3CDGB 3NAAL 5JPNB 4NC2B 4JVUA 1DBBL 4YHIA 5FKAA 1W2KT 3Q2CA 2DWEA 3T1FB 1J11A 5CGYD 5FECA 3CJJA 4JFZL 2ESVB 5JIKA 5IMLB 1FL5B 3MJ7B 2PTUA 3HR6A 2AVGA 2Y6SD 4JPKH 2KBGA 3PGFH 2BSTA 2YEZA 4MCZA 1G9EA 2J6EA 1PD6A 2K7QA 4O2CA 1CGYA 3WIHH 5MP6L 4GRWF 2O93L 5FO9A 1KACB 4YHML 5JIPA 3GMRB 4LU5H 4U1LB 2HFEB 2FEDD 4N0FA 4HWEL 2EYTA 4Z7NE 1SJXA 4GAGL 5C0CB 4F15C 4Q0XL 3BD5A 2OJZL 5IW6A 3D0LB 5IVXB 3DUSB 4V1DD 3EYQC 3O4LD 5F1KC 1FSKC 5DS8A 4ZXBD 4H5SA 4EN3B 1C08B 5IQ7H 2YN5A 2VL5B 4QRQA 4ETQB 2VDPH 5ILTH 5I9QC 4X7EC 3BZEB 4PJ8C 3EYOA 1QBML 4JPWH 1X5AA 5H2BB 4FQ1H 2EDRA 2JELH 2B1AH 1EFXD 4OV5A 2W1NA 2HVJB 5L2JA 1KLUA 4PJDF 5KSAB 2A6JA 1Q9LB 1RHFA 4FFVD 5JHDB 4FQQA 5HYIA 4RNRA 1A6UL 3TBTB 5E6IC 3QQ3B 5F3HB 3IXTB 5A16A 3Q5OA 4HCRL 3H7BA 4BUHA 3T77B 1QG3A 4C83A 2CLZA 1T03L 1FYTB 2D7PA 3IJSA 4PRPA 1U91A 1FLRH 1K3ZA 4HLJA 1D6VL 1U0QA 3L3OB 4LSVH 3KXFA 3ARXA 2A0LD 2PW1A 2BRQA 1OAQL 3N1QC 1AGBA 5IJKC 3KVQA 3TV3L 1XGTB 4X6CF 3MZGB 4U2ZA 5F7KC 1F6AB 3MV9D 1DDHA 1E6OL 3GI8H 1RI8A 4A6YA 5HI4C 4NBYB 3OF6D 1GAFH 1T1XA 4YPGA 1S7TA 2R4RL 3PABB 2HVKB 2ZP0T 4PJCB 3V7AG 4QT5B 4MDJB 3U4BH 3LQAC 1U2HA 5E6ZA 4OCXH 1I8MA 4NKDA 2A6KA 2NXYD 3OKNA 2FB4L 4JDVB 2AQ3A 2OI9C 3MLUL 1ZTXL 4LVOB 5DHVA 1S9VA 4PJBB 5E9DB 2VDKL 3HE7B 2Q6WB 3J8F7 1RZ7L 1A3RL 4N0YL 2YPLB 4F8TA 2LU7A 3RIAK 2WINB 3QI9D 5IMMA 5BXFB 3I85A 4JFZH 3CMOH 2CUIA 4Z77A 1XGPA 1P4IH 5IFJA 1WK0A 3RDTD 1QTYT 3MR9B 3SKNA 5FKPB 5FEBA 1NLDL 4OLUH 5EU4B 1NL0H 5E94B 5SX5H 4AIZB 3LHPH 1EUTA 5FHAH 4HWEH 3D39A 1J0IA 1B4RA 1F2XK 4NT6A 2KQNA 4Q0XH 4KVCL 2OJZH 2EXYC 1TLKA 4NQDE 1DR9A 3GMNA 1E6JH 5IFAH 4LLVA 5C0AE 4L8SA 4LBEA 1LE5A 4PREA 3MGOB 3UDWA 3VXRD 3EO0A 2K1MA 3C9NA 3CFEA 4U1SA 4X98B 4N5EC 1RZJL 4NRZB 3RHWK 5KVDL 4I2XA 3SDXE 1XZ0A 4LMQI 4G9FB 1H3XA 5DUPL 4TVPL 1TVBA 3H8NA 2DQFA 1KJ2B 1WSST 5IBUB 2E9JA 1D5ZB 5E56A 5SX5K 3ZDXE 3UTTD 1ZHBB 4G8EB 1H5BA 5FUZL 4MQSB 2GJZB 3MLTA 1IQWL 1A6UH 4S2SA 3TBWA 1W72A 3ZT7A 5D1QB 3DUUA 4HCRH 1L7IL 2IBGA 2D4FA 2H1PL 2K3TA 4P2OA 2QV2A 1T03H 5JZ7D 2XZZA 2CIKB 1NCAL 1EZVY 4RQQA 3TNMB 5GS2H 2AXFA 2R0LH 1FNEB 4XPBH 4XWGH 1P9MA 1T21A 3CLEL 2DTML 1OAQH 1MHHB 2SEBB 1FE8L 4I9WE 3H9SA 3V4PL 5F9JB 2V9QA 2V9RA 1BVKB 1EO8H 1Q9KA 1JCKA 5CINL 5F6IC 5EZLA 1QO3B 3MRIA 5KSUA 3WO4C 5JQ6L 1U42A 2Q3AA 2PTTA 4I77L 2O61B 1QRKA 4X6DB 5FA4A 2GSGB 2M1KA 3BP7B 3RZCB 4LSRL 2J3SA 2QKIA 2FB4H 4I0PD 3HRPA 3BKYL 4HS8H 4EIZC 1AJ7L 3MLUH 4WUUA 4QYOB 1BFSA 3DV6B 4YEFA 4L1HA 1NH6A 4FQ2L 1G6RB 3BPLC 4PJGA 3HN3A 4YDKL 1JGEA 2DIAA 4HUKB 4X9FA 2YMXH 4J3OC 4YHOH 1RZ7H 4PLKC 4XHJC 1TITA 2APTA 1ZHLA 4N0YH 2WQ8A 3AM8C 1JF6A 1AGEA 3EDJA 4XH2A 2WMPA 4NGHH 4GBXD 5HYJA 3DVFA 3MLSL 4HH9A 1JWMA 3ULUE 1MHEB 2ZSWA 3OGCA 4U49A 2X4QB 1J87A 5DEFB 2AJZA 4ODTH 4HLZG 4NRYB 3WXVL 4UOW1 5CGYC 3UJIL 5IJVA 3LKNB 4XZUB 1DQDH 4FQHB 3RI5K 2HRLA 2ZG3A 5DYOB 4G6MH 2NY6D 3LPFA 4DQOH 5GRJL 4YFLI 3NTCL 2B0SH 2AJSL 4JANB 4P2RD 4WI8A 1VGKB 2XTJC 2X9XA 4ZUTA 4RMQA 1BP3B 4FHBD 2KQMA 4HEPG 5BZWA 3VFVA 3DV4A 4KVCH 4TPRH 4PD4K 1PZ5B 3QWRA 1RZKH 2GSIB 2FEDC 2FO4A 4JRXB 1CR9L 2F54A 3BZ4B 5JR1L 3T0EA 1DVFD 5DA4A 5KVDH 1OTSC 1FIGH 3LRHA 4IMLB 1GIGL 2QSTA 5TQ0L 1HI6B 4XC3L 4TVPH 4PJ5A 5F97E 4LPCA 1UB6A 1RIVL 3CFKA 5F7NC 5FUZH 1CDUA 3OJ2C 4GJTB 5FM5M 3TVMA 1J8HB 4L9LC 3FB5A 1A9BB 2D7QA 2GK0B 4GRWB 5DVLA 1CI5A 1U8IB 4Y1AA 4YJZL 1KJ3L 3O2DL 2CGRL 2H1PH 4P57B 1XF2A 1BREA 3U0PB 1MI5A 1AGFB 1NCAH 4RGMB 3V5DB 1NCNA 2X40A 4UQ2A 2DTMH 5DQJA 4N0CD 1IC7L 2UWEF 1ZGLB 3MRQB 1FE8H 2YPKB 4JO1L 1B0RB 4GW5B 1RQ5A 1I9RH 3L5WB 4MAUH 3V4PH 1DLHB 4ZOAA 1EJOL 4RX4A 1JNNL 1DTUA 3DIFB 3WIFB 2VDNH 4WDIB 2FWOB 3V2AR 2YWYA 3G6JB 3PUCA 3D87B 4ISVA 3QHFH 1M05A 3HC3L 3KPPB 1RJLA 4LSRH 1MLBB 1FFRA 4P46B 5MENE 5C0JA 3BKYH 1AJ7H 3D25A 2BK8A 1HH6B 1HWHB 1IKFL 1U3HB 5T3XE 1JNLL 3CFJB 1IGIL 3PWJB 1JP5A 3BVNA 1FJ1B 4W70A 1FL3A 4ZPVB 5GS2D 4X99A 1MIEH 1NMBH 3QUMA 4X4MA 3LB6C 3W39B 1AXTL 3UAJC 1E28A 3GHEL 3QI9C 4YHPB 3HTLX 3CVHA 3HPLA 4OF8A 1U8NB 5HYSB 4K7PL 4R0LC 3NGBB 1U58A 3WXVH 3UJIH 4KDTA 2YHGA 1L0XA 3VH8B 5GRJH 3NTCH 3HAEB 4BSWB 5H35B 5GS1B 1SJEB 5FDYA 1YQVL 1AO7B 4O51A 1X3DA 2UZXB 5GGVY 3PWVB 5I19L 1U95B 4GKSA 4CVXB 4KHTL 1S8DA 1DUZA 5J12B 1DLFL 3ECBB 1AI1H 1NDGA 3O4OB 2A77L 5I8EB 1LDPL 4U6YB 3HLAA 1HINL 3SE3C 3VXQA 3FT4A 4HULB 2BHYA 3MRMA 5DJ6A 3RAJL 1T2QL 4P99A 1A7BA 2FD6L 1QFWM 1GIGH 2Y5TB 4DAGL 5F9WC 4XC3H 5DO2D 1YECL 5AYQA 3EDDA 3QEQB 4HS3A 4JQIL 1TNNA 4JZJC 2AV7A 4L3CA 1RIVH 3F7QA 5CMAA 4HJGA 1SHMA 4KRPD 1QFUH 3QULA 3H42L 4X7TB 5I1IH 2APXA 3O6ML 3ZDZE 5EBLB 4LRIA 2HT3C 3ZT6A 2ZOKA 2BVEA 1QSEE 4WO4D 1N8ZB 1GGCL 4RMRA 3O2DH 2X4RA 1YN7B 3TGXA 3F12B 4I2XE 5HVHC 4HUVA 2PKDA 4CDHA 3V6ZA 3WFZA 1MCWW 1I7TB 1NLBH 4D9RE 4JJ5B 5JZ7C 2IMMA 5DMYA 2YSSA 4PJHF 1XF4A 3VXUD 4Y4HA 4YDJA 2VKXA 4HDIA 1X5XA 2PCPA 4M7KL 3T65B 4QNPE 5GSRA 4TVPD 3T0XA 1I1FB 5EA0L 1OGAD 2ADJB 4WNQB 1C5CL 5FFLA 1BX2B 3HC3H 1KT2B 3EJZC 4HSQA 4K2UH 4LLUA 2GEEA 1E4WL 4ODWA 5C7XL 3GIVB 1I8LC 3GMLB 1IKFH 2D7OA 2PXYB 1EERB 1S9XB 2IAND 1A22B 4P9HL 3A67L 1C1EH 1JNLH 1AP2A 1SY6A 3ZHDA 5LCVH 1IGIH 4QLRA 4RAVA 4DKDC 4QRPD 3HUJF 4WJ5B 3M45A 43CAB 4RIRA 4RGND 3KHQA 3O3UN 4Q74A 3ULVE 3HZMA 4IMKC 3QUXA 5SWQA 3X13A 4M43L 3DVNA 2VH5L 2NX5A 1EGJA 3GHEH 2RHEA 4GQPH 2J8OA 3SDDA 4WV1A 2FJGA 3BUYB 5AUMA 1C12B 4PFEA 3VGFA 3SHSA 5C0NC 1I3RA 2R9HC 3NN8A 2G5BB 2W65B 4F2MB 1SMAA 5KVEL 5C0EA 4PJGE 4TQEH 1WCBB 1YQVH 5ICXB 2H32B 2EDYA 3ARDA 4JY6B 5IB3A 2BXZA 2NY6C 3EFFB 3NABL 1R6VA 1A0QL 4FQIH 4PV9A 5I19H 3FJTA 2FECL 4N5UA 4KHTH 1MH5A 4HH8A 3I9GH 1IAMA 4XBPB 2OSLB 3ZKMD 5HYJE 2BC4A 2VXUH 3ZKND 1FH5L 4I48A 3VXSA 2NY0C 5BCAA 5MEOB 3VGBA 4X5LA 5D2NA 1NC2A 1HHHB 4YBQC 1EAJA 2A77H 1LDPH 1J05B 5FUOL 1Q9OB 1HINH 3UBXI 1RZIB 1D9KD 5KANG 1T2QH 3QEGL 1KCLA 1WC7B 2FD6H 4LSTL 3VD5A 3KYNB 5DVOA 1A7RL 1YECH 2P4AB 4FFWD 5DUML 3QP3A 3FFCB 5J1SC 4MJIA 4C4KO 1J5OL 3ROOB 1DVFC 1YY9D 3VE0A 4UV4L 1R3KB 4P5TA 5DD6A 2ICWB 1PX4A 3H42H 5IV2A 2NY1C 2XWJB 3C6LA 1KENL 3O6MH 3GSOB 4G8GA 4F7TA 1T66C 4PG2A 3IS0X 3WLBA 4GUPA 1GGCH 4ZMAT 5EO9B 2OYPA 2EECA 3NZ8B 4Z7UF 4PG9A 6FABL 4B7LA 5F44A 5IG7A 3QEHA 5IB5B 4WGVB 4Q58C 1BOGA 1MCQA 3W9EA 4N90D 4P3DB 3GBMH 4LLDA 3PL6D 4KGLA 4NQCA 2FJFB 4MNHA 4JAMA 1K6QL 2PYFA 3BP5A 4M7KH 3ORJA 2J8UF 4QEGA 3U9PL 1J1PL 1JFQL 3MOBH 4EEEA 5EA0H 4OM1H 2R56L 1C5CH 1AH1A 2VLKD 2AJUH 2CJUL 1BEYH 1N6UA 4LPXA 3WJLC 1MI5E 1OLZA 1JWSB 5C7XH 4H25B 1J7VR 1XGQA 1A6VL 1XH3A 1QSFE 5I8KL 3K2UL 3V52H 4F7MA 4P9HH 5JDSB 3AC0A 3MA7B 2P8PB 4M6MH 4D2NA 2EIBA 3QJHB 3BOVA 1ZV5A 3MLYL 2FX7L 1HDMA 2VZOA 4IS6A 3U36B 5FYKE 1ORSB 5E08H 5JO5B 3ILPB 3D69A 3GM8A 4F7EA 5F88B 1RU9H 2Q3ZA 3IDXL 1Z9SA 4X7DC 5ESAA 1EHNA 4G7YH 5K9JL 2YRLA 3QG6B 4YIQA 4PRHD 3KPRA 4B50A 2R0KL 5FO7A 4UQ3A 3H7LA 2YPVL 4U31A 3F7PC 1G0XA 3TYGL 5I75B 1LD9A 4OT1L 3U4EB 1R5VB 1XCTA 4JKPL 1YPZB 3LQAH 3O45B 3DVGA 4UUJA 4X0KB 2CH8A 1NQBA 4GS7B 2X4TB 3TFKD 4Y8AA 1G7LA 4U1IB 1QSVA 2ZUUA 3QHZH 4PJAA 4YGVB 5E1AB 5HHOB 3MUZ1 5JDJA 4X4ME 4ODHL 5E8NB 1S7QB 1FH5H 1HQRB 5F7LB 3U7WL 3TP4A 1BZ7A 2X4SB 3I6KA 4MQXC 4URTB 3U9UB 3LOWA 1ZK9A 4ZFOL 3QEGH 3FONB 2EXWD 1OF2B 1E4XL 5TQ2L 1A7RH 5DUMH 3UYOD 2K7PA 4Y5XA 4HJJH 4Z7VA 1B4JH 4ODXB 1VADA 1LILA 1CFTB 4UV4H 3N50A 3SKJL 5DURD 4G80B 1C7TA 5DO2C 4GG6F 1DANU 1T5XB 4MJ2A 3MO1B 1EVUA 5EIQA 2I07B 5D7JD 1XT5A 4KJPC 4MA1C 4RAUB 3O9WD 5ICYA 1YYLL 2HLAA 1IKNC 1SEBB 3B9DA 1H3UA 2QR0A 1EEYB 4DKFL 2ED9A 3QG7L 4O2FA 6FABH 1HH9B 3O6KL 1LO5B 5I76B 5FCUH 1F4XL 3LDBC 2VXTH 3O2WL 5CJOL 3MYJB 3VRLE 1DBKL 1K6QH 3Q48A 1F6LL 2P24A 3MRPA 4IOIA 5EBMB 4L4VD 3EOAA 5E6IA 1RZJC 1J1PH 5HYEA 4PJEB 1PZUB 4HXBL 5HGAB 2C3XA 1KSRA 1R0AH 2R56H 5DQ9B 5ICZA 2HYMA 5KVGH 5BJTA 5F1IA 2CJUH 5C6WH 3BHBA 3P0VL 4MS8C 4KKBD 1WITA 5IFHL 1CFSB 3K2UH 1NJ9A 4JO2L 1IGYB 1A6PA 5SWZA 2E27L 3SN6N 5CJQL 4HHAB 2EIZB 4XCNB 2FX7H 4HAGA 4RWHA 4NJAL 2ZCKL 1DUYA 3HR5B 3ZE0E 3PIQA 2HH0L 3QO0A 4Y5YA 1A8JH 4D0DB 1CXHA 1NDMB 4PJXE 5BRZD 2YC1A 2GFBB 4HK3J 3IDXH 4I3RL 5K9JH 4OZHA 4M9PA 2B8OT 5DFTA 5D1XD 3DYPA 3HI6H 2YPVH 5C8JB 4QKXB 5IMOA 3EYUL 4DN3H 4U6VH 4TSAH 3QUZC 3QXAA 4HKBA 3IFPB 5BV7B 3IVKB 1CCZA 3BWAA 1IILE 3ZKXB 1A3QA 4LCCC 4XC1L 3KPQA 3LV3A 5IBTH 4UDUB 3HC4H 4B0MM 2NXZD 2WBWB 4KKCD 3MRNB 4LHUD 5F7UA 2DQGL 4LKXB 5K93A 4LCWD 3V6FA 3LIZL 4R2GD 5T1DL 2P5ED 1A4JA 4OLZL 1JZ4A 1INQB 1QYGL 3S5LB 2AK4A 4Y4FC 5KOMC 3RWHB 1C8PA 2IAMB 4N68A 1VFBA 3LSOA 3ARSA 2AJ3A 4KI1A 1E4XH 4P49A 4UIMA 5TQ2H 3ALWA 3SO5A 1X5ZA 3U0TB 4W68A 4HT1L 5TF0A 3SKJH 1C5BL 2O5XL 1NBZB 3PG2A 4OCYH 4YC2B 5I71B 2XWBB 3G6DL 3R8BB 3FB8B 5E8EB 1BJ1H 4JRWA 1JPFB 5D7LA 3KJ6H 1CGWA 4QO1A 4GRMA 1FZOB 1F5WA 4QOKD 3KNBA 1TCRA 4NHUB 5D2NE 4NO2B 2WIIB 1YYLH 2D7NA 5IB2B 2CRYA 2CDFB 4DKFH 3PP4L 3QG7H 1ZWIB 1LP9A 2AJYH 1LQSR 2J4WL 2I25N 1CXFA 4Y2DA 2OTUA 3MRGB 3O6KH 1D3CA 5A3ID 4WFGD 4NNPL 3KR3L 3O2WH 5CJOH 4WHDA 4EN3C 3C5JB 5AG8A 2IFGA 2VOTA 2OCFD 3FL7A 4HXBH 3C6SA 4QXUH 2CKBL 3FTGB 4I18B 1S7WB 1FLTX 4HG4J 4W4NA 2V7NB 2Y5EA 3L3DA 3QH3B 1YNLL 4JO2H 5AEAA 5CEXB 3O3EA 2E27H 4X5WB 3L5XL 5GGTA 1JBJA 4H0IA 5B3JF 4Q9RL 3TN0D 1H9VA 3CK0L 2QQLL 2R29L 5CBEA 1TZIB 5F7DA 4ODUB 4FFZL 3U4AA 3KJ4B 5TH2B 5I1DA 4LSDA 4WFEE 1S7SB 4Z7UB 3MV8A 3CX5J 5JQHC 2V5RA 1Z3GH 4Q7DA 5FB8B 1MVUB 4WW2F 2JCCA 3FOMA 1QR4A 4NOBA 5KG9A 5DD5L 4NQDB 4GG8A 3RBSA 4F3FB 4JFQB 4QTHB 4LFHD 3EYUH 1AGDB 4Y4KB 3ZHLA 3ZMRA 2VYRE 1IM9A 5HYQA 2VXQL 4QRRE 3EO9L 3QXUA 1ITCA 4XMKL 3PWPA 4XC1H 2PYEA 3PWNA 3WFHB 4P4RA 5SV3A 2FX8L 3AM8A 4GT7A 1HIML 3SDXB 1T0NA 1JHKL 3T3MF 4R4ND 2A73B 3B9AA 2RJMA 4BQCA 3CFCH 1Y0LB 2OTPA 3FO9A 2IBBA 3U0WL 3ABZA 2LV4A 4RCAA 1UEYA 3I50H 4MA7L 2JJVA 4PIRF 3HE7C 3KPLB 3QWQB 5E2TH 4P59L 3MV7D 4BELD 4PYGA 2X4OB 2FEEL 5FGSA 4XCEB 4M61A 4UTBL 3GHBL 2Y7QB 3NCJL 4X8XA 1A14L 3P4NB 1FZKB 1OD9A 4CW1B 3C08H 4HT1H 4TSCL 3SDYH 2E7MA 3T4YA 1C5BH 3BDXA 1U3YA 1JPGB 2FHCA 5I30L 4RDQF 1FZMB 3L3GB 3O6FD 4PJAE 4Y16B 1EO5A 3LVEA 5J0BA 2NLJA 1ZT1A 4KXZH 3LEXA 2H9GB 2FL5B 2DQUH 1I9IL 1NGYA 2HKHH 3PNWA 5DK2B 3GMPB 4YE4H 4JM2B 4YBLB 5DI8A 5ESQA 3U83A 5AYUL 3MRBB 4V1DA 4ZD3H 3O4LA 4QRUA 5B39A 2OJEA 4NZTL 4HIHA 5D6DA 3EGSB 4ZXBA 2VDQL 5BOZG 2QHRL 4KI5C 3O9WC 5JXEC 4MLSA 4Z0XB 4YDIL 2J4WH 1IBGH 3GSWB 4ZDHB 4OCWL 1YEHL 2EIDA 1OPGL 3VXNA 2EKSA 4NNPH 4DVRH 1MFNA 1CDCA 1CXEA 5B8CB 3P4MB 3PWUA 1EFXA 1XGRA 3IXAB 4L9LA 3O3BA 5MEPB 3BQUB 3L9RB 3BP6A 4WI3A 5CUSL 3C2AL 3SDAB 3LRSA 1QVOB 5EC2A 4LLWA 1OTUD 3QDMD 1N0LA 3MRHB 4F7PB 5JOFA 4KRLB 3HI1A 2ICCA 3KPSE 4XPGL 1N0XL 2VWEE 2NQCA 5SWSA 3BIKA 1YNLH 2YA2A 3CPLB 1KNOB 1TJHH 2QQNL 3BMVA 4Q9RH 4XNZB 3QNZB 2QQLH 2R29H 3C5ZB 1JVKA 1FFPA 4FFZH 5E6YA 3FT2B 3RNQA 4MJ5B 1JRHH 4P3CH 4PLJC 1OAZH 3MV9A 4IDLA 3IYLW 3OF6A 1S7XA 4HBCL 4YHIB 4Y0GA 2V2XA 5DD5H 4U0RB 2MKLC 4OUOA 3RX5A 3WN5B 4J3VA 1OAXH 1W0YT 3GBNL 2JJSC 3O6LL 5DUBB 4ZOEA 5D1XC 5SWZE 4YR6B 3OX8A 1NBYB 3HZVB 4NQEE 1CXKA 4XMKH 4HC1L 2BSTB 4MCZB 3CU1A 4QHKJ 2FX8H 4N8PA 4L8DA 5DVKA 2XZQL 2QLVB 2NTSP 1CIUA 8FABA 4HLZH 1VEOA 5IESH 5E24E 4H88L 1EFQA 3RZCC 2ZWLT 5FO9B 2YOCA 1VSCA 3QI9A 5MHSD 3ZZ1A 4N0FB 2EYTB 4X7CC 4OZHE 1AE6L 1GZQA 3BJLA 5IW6B 1HEZA 5C0BE 5C86A 4R2GC 5I1AB 5HYFA 1JZ8A 1PSKL 1N2RB 4NWUH 5ID0A 3GHBH 4F33A 3NCJH 1A14H 5DS8B 4I3GA 4X6EA 4H5SB 2BOCA 2ADGA 4QWWD 2JIXD 3RDTA 2WP3T 1JV5A 4QRQB 3GSNA 4TSCH 4J8RA 4LVHC 4FQPA 5C0GB 4NM8L 3DO3A 1MCNA 4FQJH 3VD3A 3SQOL 3RIFF 3R0MA 3UTPD 2QEJA 4XB7A 1F3DJ 3S4SA 2JKXA 4XGZA 5L2JB 2BERA 4MD0B 1T2XA 3RUGA 1LMKA 4OKVA 3NCYS 4JY4B 5TDNA 4WTWA 5AYUH 5KSBA 4CKVX 1U2CA 2FECI 4FQQB 4JREB 4RNRB 1EHXA 3DOSA 3VXRA 2BNRD 2HT4C 2VDQH 5A16B 2QHRH 5GPRA 5FO8A 4P4KB 1S5IL 3GB7A 4HWBH 4YDIH 3PDOA 2RFXB 2QSVA 4C83B 4NBZB 1AKJD 2CLZB 4OCWH 4WFHE 5MENB 1OPGH 1FRGH 1JF5A 4J23A 1U91B 3LN5A 2Z92A 2NYYD 5L6YH 3MRJA 4GKNA 5D7SL 1VFMA 3D0VB 1AQDA 3KXFB 1TMCB 2PW1B 2H2PC 3WS3A 2ADIA 1R3IL 5E03A 3E0GA 1NCCL 5HI3D 3KPOA 2HLFC 1PG7L 1DEEA 5CUSH 5FYJU 2E6QA 3FAWA 4MA3B 1KCSL 5L0QB 3IKCA 1KG0A 4PY7A 4J3SA 1HHIA 2VQTA 1DDHB 4A6YB 4YPGB 1S7TB 4XPGH 1N6QH 1CFVH 4NHCH 4MWFA 5AWNL 1HZHH 4XCCL 4QTIL 5GRWA 1RJCA 4NKDB 5I1HH 3ULSA 2A6KB 4UT9L 1KCUL 1BF2A 5FYJH 1CFQA 4LEOA 1Q0YL 2C9AA 5HSFA 1A7NH 1ORQB 3QAZB 4S0TD 5DHVB 1S9VB 2OLDA 4Z7OE 1JMZA 4L4TD 5ITBH 1KXVC 1OGTA 5C9KA 1FNLA 4RGMC 4ZYKA 1A6TA 3MJGX 5IK3A 5B3NA 1NC4D 1MFBH 4EUPG 4HBCH 1XF3A 5H94A 5IMMB 1QRND 5CEZE 4XRCB 5CKAA 3QFJD 1JZ7A 1HXYA 2DDQL 3WNMA 1SBBA 3GBNH 1N59A 4YHKH 5GQBA 5JIHA 3F5WA 4I0PA 4X6FA 1UH2A 1CLZL 1XGPB 4L8BA 1Z0NA 5E8OA 4N0RA 1NCWL 4IMKA 4P46C 3B8YA 3QIBD 1BD2E 1A02N 1JYVA 2UUDH 4DN4L 1U3HC 4KJWD 2JCCE 4NT6B 1HXMB 4GBXA 5J3HD 1RJZA 1AE6H 3MUJA 5GZND 1NFIA 3KPTA 3GMNB 4LLVB 1PEZA 1OP3K 3S34H 1QSEB 1HOCB 1NGZA 4LBEB 4PREB 5E4IA 2DLEA 5K9OA 1NGQL 3FHQA 3C9NB 4H26A 1ETZA 3CUPA 1O0VA 4I2XB 4LVEA 3P9LA 4P2RA 1DEDA 4PGCB 3DGGA 3D5OF 1TVBB 3F65A 1H3PH 4CU7A 3P77A 4AG4H 3QZWA 4TN9A 2W0LA 3WD5L 1H5BB 4GAFB 3U7YL 5GS1C 1LO4H 1ZLVK 3MLTB 2IGFH 3W81A 1UGNA 4LLYB 2DJUA 3TBWB 1KB9J 3UBXA 5D71H 3DHJA 3DUUB 4DCQA 1S5IH 1DVFA 4JZNA 4P2OB 1KIQA 3HE6B 5J12C 2NY3B 4RQQB 3WNNA 2DQIL 4L3EE 2AXFB 2V5SA 3O4OC 5E2VL 3F58L 5D7SH 3I6LD 4DGVL 1E4XI 4CRPA 3PDGA 4E41A 3GUTA 3SBWC 3H9SB 1AGCA 3MLZL 4JG0L 3RY5A 1GXEA 1Q9KB 5EZLB 3FQXA 3O4LE 3NCMA 3MRIB 5KSUB 4KUCD 2PTTB 2BY2A 1IZJA 5AWNH 4OFDA 5FA4B 4QTIH 5DTFA 4QXTB 1KCUH 2QKIB 1BOYA 1Q0YH 1FFNA 4OI8A 4D9QD 5CP3A 5HVWA 2EDHA 4PJGB 2CD0A 4Y19A 4KKAD 2YRZA 4H0HB 1ACZA 4P23B 3QDGE 3KHOA 5TPWH 2WK2A 4DOHE 4LSQL 4JRYD 3UTQA 1KN4L 4KK6D 5HYJB 3DSFL 3JZ7A 1JWMB 2ZSWB 3OGCB 4D8PB 2E6PA 2I9TA 4F58H 1OW0A 2DRUA 2AJZB 4QXWA 5HGHA 2CXGA 1CLZH 4PR5A 1NCWH 3PV7A 5I6XB 3V6BR 3AUVA 4U6XA 4ZO8A 3SGKA 2VXSL 3UEZA 4OGYL 6CGTA 4HIIB 3VXOA 2PXYC 5DRZA 4DN4H 3QISA 4U6HA 1I3GL 4OB5L 4F7CA 1CDIA 2AAVA 2DJ4A 1ES0A 3QUYD 5CIPA 1N7MH 3L3JB 1J1XH 4WI6A 1SYSA 3LN4B 1NFDA 4JY5L 4PUBL 3RWGA 3WSQH 3SE4A 3E3QC 3DWTA 4TRPH 4JHZA 2MSPA 3TH4T 1MQKL 1I8KA 4MLIA 5GRZA 4PJ5B 4EI5D 1UB6B 3RVWC 2XXMB 3OKOA 1H15A 4R26L 1YEEL 5EBGA 1KFAL 5C0DA 2R1YA 1RZ8A 4G6FD 2YN3A 3TVMB 3FB5B 1N4XH 2HTLC 1L7TL 1N6VA 1RUKH 3VFTA 1T7XA 3ZDYF 4Y1AB 3ARBD 4V2CB 1XF2B 1MI5B 4NDMA 2DQIH 5FA3B 5CHNA 1MREH 1S5HB 3G08A 3B6SB 2FIKA 5EZOL 3F58H 4QF1A 4DGVH 5DQJB 1DN2A 3QIWD 1WBXA 2XN9E 3M17A 3NIFE 2QTEA 3MLZH 3OKDA 4JG0H 3BZFA 3T4AA 5T5FH 2P7TB 3S35X 3HC0A 3MV01 4K23H 2FATH 3QPXL 3BD3A 3SY0A 1S9YB 4K8RH 3VXRE 1BZQK 1PQZA 4X9GA 1M05B 2VC2L 4NKIH 1S7RA 1RJLB 5F1NA 4CMMA 4JB9H 3X3FH 3EYVB 5C0JB 5A2KH 5FAAA 5JXAH 5FHBL 1BM3L 4JPVL 1BAFL 4WI4A 2MMXA 3TCXA 2BVPB 4XXCC 4LASL 3VXUA 3UTTE 2YUZA 1FL3B 5ISZD 3R8QA 1MJ8L 2GI7A 4NN7B 3E6HA 4X99B 3QNXB 3SCMD 4JKWA 5F96L 3GMQA 3L3IA 1KN4H 2C1PA 4Z7VF 3GJEA 3HZKA 4X83A 1E28B 1KYOK 5IM7A 3HPLB 1TZGH 3FZUC 1U58B 4I3SL 5JA8B 2IANA 2V7HA 1MWAL 1BQLL 5C9JA 5DXWA 2ENYA 3ZSTA 1FNSH 4QRPA 4PRDA 3FCTA 1YUHB 2VXSH 3IETA 1GGYA 4PRBA 4LNRB 1JGLL 4X80L 3V0VA 2BY1A 5E70A 1I3GH 4GKSB 1S8DB 1DUZB 3B5HA 4OB5H 4OUUA 3G9AB 3MJ9A 1NDGB 5J3HC 1HSBA 4LCCA 1S78D 3HLAB 3RVTC 3FT4B 3I3BA 2HJKA 3MRMB 5DJ6B 5C0AD 3L95A 4GAYA 1ZLUH 1U8JB 2BDNL 4AEIL 1MQKH 1AR1C 2J1KA 3WUZA 3UTSD 3RWCA 5FGBC 1J1OH 1OOAA 4ETYA 5I75C 2AV7B 4L3CB 2YS4A 5DFWH 1V7ML 4G43A 4R26H 1YEEH 4HJGB 1EMTL 4Y4FA 3QULB 1PKQE 5JPNA 1UVQB 4GS7C 4WTZG 3GNMH 1YEGH 4NCDA 5CJ8A 5IB1A 1MCOH 1L7TH 3UJTH 4KU1A 2ZCLL 1D9KA 2HT2D 5EWIL 2APWA 3DECA 4K07A 4W81A 2DF3A 2ESVA 3NPZB 4HUVB 3V6ZB 2FEEI 5EZOH 5E5UB 1RURL 3EJYD 1AXSA 5H8DA 2I60L 2XACC 3JVGC 3TESA 1XF4B 4Y4HB 4YDJB 4HDIB 3JWOC 2AXHA 4TYUA 3GMRA 2IPKB 5GSRB 1UZ8A 5JPMB 2DIJA 4PJ9D 2CK2A 2VC2H 5I1EH 2YA0A 4NUJB 3D0LA 5M95B 1MCRA 4ODWB 2B1HL 2NY7L 5FHBH 3OGOE 1BM3H 4JPVH 1VGEL 1OARH 3Q0HA 3PL6A 4ETQA 1AD0A 4LASH 2X89D 1DQMH 1UC6A 3VXTA 4KK5D 3FRPA 3TYFB 5F96H 5D1ZD 3HZMB 4XTRC 2Z8WC 3BW9A 3QUXB 5SWQB 1BPVA 5MI0B 3X13B 1F02I 3DVNB 4UV7L 2O5ZL 2W92A 4XNXL 2NR6C 3BEWA 3BD4A 1Q9LA 2VLKA 4M1DL 1I7RA 1Y6MR 5JHDA 1KB5B 3SDDB 4Y88A 3TBTA 5AUMB 3IXTA 4NJ9L 4UIKH 1I3RB 1KJ2H 2Y72A 1MWAH 3ZLQC 3T77A 4QCIB 3NN8B 5BW7A 5C0EB 1TIUA 5E2WL 5C6PB 3GGWA 1ZLWK 3ARGD 4FG6C 3ARDB 5IB3B 4X80H 3RTQB 1LP9F 2W0PA 3EHBD 4I48B 1CD9B 4X9BA 1K4CB 1HQ4A 5D2NB 4ENED 5IVOA 2AEPL 1IQDA 4N8CH 3GMOA 3PABA 2HVKA 1OT2A 3U2SA 5TGBA 1X4YA 4OGZA 4QT5A 4MDJA 1AFVL 4HXAL 2CDGA 2BVOA 4W6YB 1F13A 2BDNH 2DYPD 2IADA 4AEIH 4Z76B 3LEYH 3MXWL 3HNSL 3VE0B 4D3CL 4I1NB 1FP5A 5DD6B 3CSYA 4FZ8H 3QFDA 1V7MH 3G5XA 1EMTH 5EU6D 2Q6WA 3HE7A 2OL3L 5DMIH 5BV7C 5IV2B 5E5RB 3ZKXC 4OGAD 3C6LB 2X4PB 2YPLA 2D03L 3C8DA 1FG2A 4G8GB 4F7TB 1CT8B 5DJAA 1VPOH 1AHWC 1LWRA 4ZUWB 3BGAA 1YMMD 4GXUN 3V79C 1U41A 2JB5H 3VU2A 5EWIH 3VI3F 1F58L 1G6RH 3TPUA 3WMSA 2RGSA 1OCWL 5BXFA 1WWBX 3QIUD 1NSNH 4GSDL 1EVTC 2HTKD 3ZHKA 4PG9B 4YHZL 1M71A 1EPFA 1FNGB 2ATPB 3QEHB 1RURH 4H0GA 1BOGB 3W9EB 4GOSA 2IAMC 4LLDB 2QQKH 1JHLL 2IWGA 4MNHB 4JAMB 4G8IA 2PYFB 3BP5B 4M3KB 5D7JA 1P2CB 4AIZA 4HUWA 5B38A 5LGHL 3INUH 3O9WA 2J88L 4YC2C 5I71C 4ZTOH 3IDMB 4J1UB 1MFEH 3V95A 2NY7H 4NZRH 2IG2L 1XGQB 1XH3B 3JV5A 4APQB 1VGEH 1QLRA 4F7MB 1P7QD 4PBVC 1UADC 3LMJL 4NRZA 3RKDD 3MUY1 4R8WL 3F62A 4MMXC 4G9FA 2GUOA 4G6JL 5I8OL 2C3WA 4AT6A 4LDOB 4L4VA 4IS6B 3WDHA 3RVVD 1KIRA 3D69B 4F7EB 4UV7H 5JORA 4PP1C 4XNXH 1SJHB 4M1DH 5ESAB 3MBED 3RJQB 4YIQB 4NZJA 3MLRL 5FO7B 4ZPTA 5CJ5A 3RZWA 3SKOA 1UFUA 5DD3L 2C3GA 4UILL 1XCTB 1NMAH 2DTSA 2CIKA 4I18C 3G04B 4Q9CA 1IZKA 3VXUE 5E2WH 3UPCA 2PR4H 5DMJB 4ZO7A 4FABL 4TVPE 4GRWH 2Z31D 2W9DL 4PJAB 5BRZA 5JHLL 5CAYB 1OGAE 5F9JA 2VDML 3TJHC 3FQWA 5BMFL 5D1XA 3QHTC 4U0QB 4Y2OA 3KJ4C 2NY2D 1X5FA 3I6KB 4IOFD 1OSPL 1CU4L 2EDNA 1AFVH 5I1KH 4HXAH 2GSGA 3AGVA 2FHBA 4U33A 2GCYA 5C6TH 4XNQB 5GS0L 3WEXA 4QRPE 1S78C 4Y5XB 1RHHA 3DV6A 3RL2B 4RGNE 4F37F 3Q1SL 4LHUA 1RZGA 4GXVH 4Y4KC 1HHGB 3MXVL 1WFUA 2OL3H 1ADQA 5DT1H 4KV5F 2NY5H 3WUWB 2ILLA 3QDHA 2R39A 4OI7A 1OCWH 2HLAB 2X4QA 3KPSB 2VN4A 2QR0B 3ALPA 3SO3C 4O2FB 4LNVA 2EIEA 2Z8VC 3W9DA 3LKNA 4XZUA 2CUHA 2R0ZH 1JHLH 1OT1A 1MVFA 1MY5A 2P24B 3MRPB 4IOIB 3WFEL 4QOKA 2VZTA 5LGHH 5ALBL 4XAWL 1T5WB 3SGJA 3UTZA 3PWLA 5DJYA 2CRIA 4LIQL 5ICZB 3ROLA 3F7YA 4Y16C 4OF3A 5IW3A 3THML 1RUML 3QXVA 3GFUA 1XMWA 3ZTJG 2XIDA 4JRXA 4DEPC 4YZFF 4JM2C 2VDOH 3LMJH 5F7EL 1FO0L 5SWZB 4NQEB 2WIMA 2XG5A 4IMLA 5A40E 3ZYOA 2H6PA 4G6JH 5I8OH 4EI6A 4X4ZA 1P4BH 3SEPA 2Q87A 1MFAL 3NIGF 5D7IA 4OAWB 4RMTA 2IBZY 3QO0B 3IRPX 1RPQA 4Y5YB 4HV8A 3KGRA 4PLNC 2XZAH 1V7NL 5D6CA 3BN9D 4KH2A 3VWJD 4ERSL 2D31A 2WAHA 5B8CC 1CZ8H 3OXRA 3W11D 4OZHB 1XIWB 4QGTA 4M8VA 3MLRH 2OI9B 5B22A 3BQUC 4BSVA 1FPTL 3SDAC 5IMOB 4LCUA 3GM0A 3EAKA 4N90E 2I26N 3QXAB 2IF7A 4P57A 5E0QA 3RUGF 3ARRA 1ZEAL 4XWOD 2RQ8A 1A2YA 3H3PL 5KSBF 4Z6AT 3LV3B 3ULUC 5LAXA 1RULL 4Z0BL 5TFSH 4UTAL 4H8WC 4EVNA 3NIDF 4AJ0A 2W9DH 3MRQA 3UPAA 2R4SL 5JHLH 2YPKA 1URLA 2DM2A 4L5FH 2WBJD 1Q38A 3L5WA 4XNZC 3TO4B 1D5BA 3V6FB 1CS6A 3IF1B 2VLKE 2D7TH 1A4JB 1NPUA 4LVNB 3G6JA 5LXGH 1JTOA 4KKLD 4CUCA 2AK4B 3FFDA 1CU4H 4OZFA 1Q1JL 4J4PD 3HB3D 3HNVL 2BX5A 4UIMB 5HDBF 1MLBA 4U0RC 5CSBA 4RDQG 3WN5C 1HKLH 1U3HA 3MOQA 3Q1SH 4K7PX 1G7IB 1MCPL 1I9JH 1U8QA 3VW3H 4HK3N 3CSPA 2NTFA 4GRLD 5D7LB 4ZPVA 1NCDH 3LRGA 5EBWB 4GRMB 1VEMA 4M7LH 5F6HJ 5K9QI 4PRHE 3KNBB 1PAMA 1TCRB 3DI3B 3OKMA 1DSFL 1FGNL 3WNLA 4LSSH 5GRUL 3W39A 2ICEA 1TXKA 2BHUA 4MNGA 5DJ0B 4YHPA 1VHPA 1CTOA 1TETL 2V2WA 4EZMA 4JR9L 3SGDH 1U8NA 5HYSA 5HDLA 4HJ0C 3PGCB 1JPSH 2AJXL 4Y2DB 2OTUB 3N85L 3VH8A 2OZ4L 1BFTA 2ZJSL 3FB6B 4K3DL 3HAEA 5EH1A 4BSWA 1HYSD 1QP1A 4MB5A 5HHPB 1SJEA 5GS1A 1OVZA 1AO7A 3WFEH 1KC5L 1FNFA 1U95A 3H9YA 3MOAH 1MRCL 3C6SB 4LIQH 1HKFA 4M48L 2ZUVA 3TT1L 5DHYA 2VZSA 5F1SA 4YGAB 1G7PA 2VB5A 4CN1A 2DAVA 3K2MC 2H32H 3N1FC 4U6YA 3ZDYE 4P5KB 1FO0H 1MPAL 5LBSH 2JB6A 3N9GL 3SBWA 4JREC 4PJ7E 2DLFL 2Y5TA 1QA9B 3FT3A 3VA6A 3IDUA 1YDPA 5CBEB 1QSFD 1R3LB 4P4KC 3WHE1 5EUOF 4MYWB 4FZEL 3TA3D 2DIBA 5ANME 3WO4B 1WZKA 3QR2A 3MV8B 2EDWA 3QDMA 1BD2B 4HUUB 2JCCB 4WHTA 3FOMB 2C5DC 5KG9B 4AYFA 4GG8B 4EUPH 5L0QC 5F7WC 1YN7A 1IM9B 1ZEAH 1QHPA 4OZGF 5IF0A 4WI2A 3CVIL 1RULH 1UCBL 1MAML 4M5YL 5IVZA 1MHCB 4L4VE 3GRWL 3ZYJA 5J89A 2R4SH 3AROA 4JFDD 3JV6A 4I0CC 2A2QT 3FO9B 4YX2H 3T65A 3VFPA 3QAZC 2Z31C 1J8KA 3SDCD 1HCVA 1BX2A 1YA5A 1CGUA 1Q1JH 2AQ2A 3HA0A 3HNVH 4Q6IB 4U1NA 3VXMD 4JJHA 2X7LA 4M62H 2F5AL 1X4XA 3T4YB 2PXYA 5F70A 3TH3T 4JHAH 3RKPA 3VFWB 5IHBA 1MCPH 4HK0A 5DJCA 4LEXL 5EO0A 43CAA 3P73A 3L7EA 5JW5B 2BSED 1ZT1B 5D70L 5DD1L 3LEXB 4NFCA 4Q97A 1NGYB 1CL7L 1WJ3A 1DSFH 4LCIH 4MGXA 3ARED 4POZD 5GRUH 4CN4A 4V1DB 3O4LB 5B39B 5KVMC 2OJEB 1RD6A 4JFPA 3O41A 4ZXBB 4JR9H 2JIXA 1NAKH 3VMOA 2ZUSA 4O5LH 1H3GA 1WAAA 3I6GA 3K74B 3MRDA 4KAQL 3N85H 4I5BA 2EKSB 1UQSA 2OZ4H 2VSCA 1D5IL 2ZJSH 4K3DH 5ELIA 5LG1A 1MHPH 4LCWE 5D8JL 1JI2A 5T1KD 4XP6L 3JBG7 5GS0D 1EFXB 1XGRB 2E5EA 2Q7YB 1KC5H 3O3BB 4JY6A 2P5EE 3EFFA 5D5ME 5IT2H 3BP6B 1J88A 2P42B 3LRSB 3MZTA 4ELMA 5EC2B 1MRCH 4N1CA 4LLWB 4XBPA 4M48H 2OSLA 1I1AD 3TT1H 5MEOA 1UACL 1MY7A 5JOFB 2WBKA 1QZ1A 3HI1B 4XI5D 1UM5H 1HHHA 3DUHA 1KEGL 2DKSA 1H5BC 1PFCA 3HMXH 1AKJA 4JE4B 1RZIA 2UVFA 3CX5K 3BIAX 2PO6D 3DTXA 3N9GH 5ECJE 2I27N 2XOTA 1YEFL 4NCC2 1FFPB 3RWIA 4FZEH 3WYRA 4P2OC 4QOKE 3RNQB 1LVEA 3HE6C 1NFDF 2X4UA 2NY3C 4X7FC 3MV9B 1VB9A 1IC4L 5GGRB 2ORBL 3JWOH 4HFWA 5CSGA 1OP9A 2H8PA 3VWJC 5I73B 2XPGA 5B4MC 4TNVF 2NXYB 5EO9A 4P2QE 3RPIA 3ULVC 4WFGE 3OX8B 4UOW0 1KIPB 5D7KD 1PY4A 4DGYL 3OZ9L 4M5YH 1UCBH 4L8DB 5IB5A 4P3DA 8FABB 3GRWH 1PY9A 5D7IE 5HHMD 2FJFA 4OLWL 1F45A 2Y36H 3QI9B 4QGYA 1QRNA 3QFJA 4NUGL 2WBJC 5GGVL 1K8IB 1HEZB 2KL6A 2CKBA 2OR8A 4P23C 2ZUXA 4O4YL 5ID0B 4ZOBA 5DRXA 4G9DB 2NNAA 3RVUD 2EH8L 1AQKL 3MBXL 2F5AH 2ADGB 5CCKL 2WWKT 1J0JA 1NKOA 3RDTB 4KDVA 1JV5B 3GSNB 2HMID 3VXPA 4WWID 1JNJA 1WEJH 3NACH 4R4BB 4LEXH 3JUYA 3QIBA 5E2UL 4HIJA 1B0GB 2OR7A 3S4SB 5D70H 5DD1H 3QCUL 4JDTL 5I6XC 1ORSA 5JO5A 1MCHA 3C60D 1CL7H 2R0WL 1JYXA 1RMFL 1FVDB 5F88A 3KYAA 2X2YA 2PF6A 1QFHA 1SEQL 2XZCH 2V2TA 2N4IA 3PP3K 3QG6A 3VXRB 2CQVA 2XG4A 5FO8B 3HFML 3M8OL 4XB8A 5GGUA 5FGBA 4JFHE 4KPHH 1OAUL 4J3WA 1NCBL 4KQ4H 5D8JH 3MRJB 3CH1A 1AQDB 2MQCA 4BQ8A 2ADIB 3UTTB 3KPOB 5T3ZL 1DEEB 3C8KA 3B2VL 5HHOA 3IKCB 1KG0B 3MV7E 4PY7B 2WP3O 1HHIB 1S7QA 1X7QB 3VD4A 2X6MA 5ID1A 1HQRA 1XF5A 4WCYH 4MNGE 2HKFL 4AL8H 4K3GA 2X4SA 3STZA 4JDZA 3JVGA 3U9UA 2R23B 1GRWA 3DYOA 2IPUG 3FONA 4QHMA 3TVMC 3JTTB 4LEOB 1TJIL 2Q8AL 2FX9H 1CFBA 3D18A 3SOBL 1U3JA 2WW8A 2ZUTA 2APBA 1TZHB 1OGTB 2YBRA 3WFCH 4EDXA 4ZYKB 1A6TB 4O2EA 4JO3H 3MO1A 5IK3B 4CJ1A 1EUUA 1ERNA 1KJMB 5H94B 1B6UA 2X42A 2I07A 2V9TA 2MCPL 1B3JA 5BS0D 5HHXL 5J06A 1ZMYA 1HXYB 4IEFB 4DW2H 5E8DH 5FIEA 4I0PB 1EEYA 3LEVH 4K3EL 4ZQKA 4L8BB 4YQXL 4DGYH 1HH9A 1JL8A 2VKWA 3VD7A 4XNUL 1TQCC 3OKEA 4ODSL 4XPTL 2OTWA 3T3PF 4QRRD 5I76A 3WNPA 4K7PY 1YEDB 4OLWH 1K8DB 5JLZA 3QDME 5FXCH 5EBMA 4JRYA 4XVUC 4GBXB 4AMKH 1RJZB 4NN6B 2F8OA 5GGVH 1NFIB 5HGAA 3FQRA 3SJVD 4NN7C 2XTJE 4M6NH 1NGZB 3DX9B 4L3AA 4GMSL 5K9OB 2EH8H 1AQKH 1ONQB 4H26B 1FC1A 2XA8H 1CFSA 15C8L 1I3VA 2NY6B 1BJ1J 2IH3A 4R9HA 1BFVL 4HFUL 1KN2L 1JHTB 4P2RB 1BQSA 3DGGB 3DPBA 4QHUB 4RFNC 2A9NL 1N3NB 4YXKL 2EDXA 3X3GL 3NZHL 3QCUH 4KDTC 4AIOA 4FTVD 1UT9A 3GIZH 2R0WH 4D0DA 1M7IA 2DM7A 2GFBA 4U1JB 3VG9B 2IFFL 3ARUA 1II4E 4LOUC 2F74A 4WI9A 3FN0H 1CQKA 4KTEL 1R24B 1KLGA 1GVIA 5EB9A 4DCQB 3M8OH 1DVFB 3H6JA 2B4CL 4PY8J 5C8JA 4JZNB 4M5ZH 1KIQB 4OQTL 2OMBA 5CLTA 1OAUH 5J13B 1REIA 5DFVD 4HPOL 1NCBH 1V8HA 5ITFB 4HC1A 4I13B 4YLQT 1NAML 1T1YA 4NKOA 4UT7L 3GUTB 1G9MC 1AHWA 1AGCB 2AQ1A 4LKXA 4K3HA 5GRYA 4UI2A 2KKQA 3D3VD 4OM0H 4K94C 2Z4QA 2EEBA 5GRXG 2HKFH 1ZVYA 3ARBA 4PV8A 1BLNA 1WAAE 2PN5A 4WWKD 4XAKE 2VLRD 5DTFB 5DZLA 4XI5C 4LRIC 3MA9H 2W60A 2NPLX 1SM3L 3QYCA 4DUWA 1TJIH 4XBGA 2AI0L 2Y23A 3UTPE 5M7QA 3SGDI 5ACLA 4PRID 2XKNA 1N64H 1NBZA 2XXCB 2ZOLA 2XWBA 3MTRA 4PJCF 4GAJH 1I7ZB 2W9EL 4ELME 5E8EA 5EOCH 5L9DL 2GTZB 4BUGA 1FZOA 2BNRE 3UTQB 4M4PA 5GXBB 5HHXH 5JW4N 3TJEL 4XP9H 4Y4HC 3QQ9D 5IB2A 4PJBF 2I9TB 1WZ1H 3ILQD 5DRWA 3W2DH 5HGHB 1ZWIA 2FBJH 4YQXH 4XNUH 4S1DD 4ODSH 1FC2D 1YJDL 4U6XB 4XPTH 3DRTA 1GCFA 5ISZA 3DX6A 3P30H 4K9EC 3K7UA 4YPJA 3SCMA 4JO4H 3VXOB 1GZPA 4JQXC 4X9IA 3MNZB 3QQNA 4U6HB 1JPTL 5FDWA 4XMLH 3ZE2E 1ES0B 4OD3H 5CIPB 4RFOL 4ZTPL 5SX4H 4BZ2L 3FTGA 4I18A 1F4HA 2AEWA 1S7WA 2VQ1A 1SYSB 2HJLA 3T2NL 5C08D 3QUXC 1QFPA 3IU4L 4OJFH 4V2BA 1F00I 1LGVA 1HNFA 1T0MB 2V7NA 3MJ6A 5C0BD 5AG9A 1KBGL 3QH3A 1RUQL 2RCSL 4KI5F 1BFVH 4L4TE 4X5WA 1KEML 1MRFL 4FN0A 2OX5A 3LN9A 3WO3B 1I8KB 5KJRL 3BPCB 2HMIC 1TZIA 2A9NH 3X3GH 3NZHH 3MLXL 5I1GL 5BQ7B 4YHLH 1H15B 3MACL 5C0DB 1M7XA 3QFJE 1RZ8B 2UVEA 2VRAA 4M1GL 4DTGL 1Z2KA 3FQNA 5HXMA 2VMFA 3ARDC 1JGVL 5JW3L 3RTQC 2A9ML 3QPQD 4DFIA 2ITDB 3VFTB 5IBLD 4KROD 2B4CH 2DQTH 4JFQA 4TUOB 1V3JA 5C0AA 4OKDA 2VABA 4Y4KA 5D2NC 3UTSA 2FIKB 4QF1B 3WFHA 2J8HA 3SDXA 5HPMB 1CLYH 1WBXB 4X5XA 3M17B 4KRPB 1EX0A 4MA1B 3OKDB 3BZFB 3T4AB 3OG4B 1Y0LA 4LU5L 4WO4B 3L6FB 3CC5B 3SY0B 4ZUUA 2VO5A 4FQCL 4KMLB 2DLGA 3S37L 5F1NB 3C6LC 2X4OA 5D96B 3OKYA 3IDIA 4ACPA 3TBVB 3P4NA 5KAQF 2EDJA 5EOTA 5I2IA 4CW1A 2FJHA 2VDPL 1MUJB 3VXUB 3PQYD 1H3VA 1FZMA 4JPWL 4X6DF 3AS0A 1ULVA 3E6HB 1MCCA 1OWWA 2W9EH 3QXTA 4Y16A 4ZAKD 3FHAA 5L9DH 2JELL 3BYYA 1A7PL 2B1AL 2H9GA 4CADB 1OGAB 3L3IB 3OHXA 2C1PB 2GJ6D 5DK2A 4JN2B 3TJEH 3GMPA 3GJEB 1L0YA 5T3ZD 2YZ1A 4X4YB 3NBNA 5IM7B 3MRBA 5DLMH 1YEJL 3DMMD 1BGXH 2FZ3A 5B21A 3DSNA 3VFSA 2E7HA 4EKXA 2IANB 2P5WD 3MSPA 3I6LE 3LPGA 4N0UE 3T0BA 5HHVL 5C9JB 2BZDA 2FLBT 4WI5A 4ZDHA 2PETA 4QRPB 2RIKA 1UM4L 1FLRL 4RGNB 2VDLH 4PRBB 1ED3A 4APQC 2BSRB 5D1ZA 3IT8D 3V0VB 1W72L 1UKSA 1JPTH 3BQUA 3VFMA 4UB0L 1P4LB 5L2KD 3B2UD 1JN6A 3CH8A 4ZS6D 4RFOH 3MRHA 1FIEA 4F7PA 1GAFL 3E8UL 3T2NH 3EZJB 2ZG1A 1IM3A 1OB1B 2HWZH 2HJKB 4WUKH 4D9QE 1KBGH 3J7HA 4LGPB 1RUQH 1K3IA 4GAYB 4OFYA 2A38A 1KNOA 4G42A 1KV3A 4MZ2A 4KRMB 1G9NC 1KPRA 4QXGL 4LPTA 5D2LE 5DF0A 4A6YH 4OZGE 5CS7A 4OCRL 3MLXH 5I1GH 4ELKA 3WE6A 4JRYE 3MACH 4JGUA 2LTQB 3QBTB 4M1GH 4DTGH 2L7JA 3DURA 5IP4A 1WFTA 1WICA 2MKWA 1JGVH 5JW3H 2A9MH 5IB1B 4XPFL 4YHYB 1D9KB 3WN5A 5DJZB 3BAEL 3LD8C 4WFFD 1ZANH 2DYPA 3CMOL 5DUBA 4YR6A 1NBYA 3HZVA 3DX8A 1AXSB 2QHLA 1P4IL 1W0WA 4KK8D 3S98A 5EU6A 4OLXL 4RWYH 4L3ED 1PYWA 1OSZB 4PJFA 2C4FT 4OLUL 4Y5XC 2EDFA 3BKCH 1NL0L 1RV6X 4OZIE 3LHPL 3U6RA 1UZ8B 4XVSH 5FHAL 3ZL4L 1KCKA 1FDLL 4AZ8A 2KDGA 2JJTA 4FQCH 3VFRB 5HY9A 1CL7I 3S37H 1E6JL 5IFAL 5I1AA 1N2RA 2C3VA 3KAAA 4JZOB 1EA9C 3PL6B 2Z91A 1AD0B 3G6JF 3ZTJH 5C0GA 4OSUH 4RMUA 1JUFA 2VWEC 3VXTB 1LK2B 3FOLB 4Z95H 1DCLA 1T22B 1A7PH 1EXUA 1QQDA 3BW9B 4MD0A 4Q2ZB 3BEWB 2VLKB 4JY4A 1C7SA 1I7RB 2BVYA 3QDGD 1PG7X 1CN4A 1YEJH 1CLOH 4QHKI 1UG9A 3IJHA 3TZVD 1TTFA 3BDBA 1P7QA 4P4KA 5LGKA 2DI9A 2RFXA 5HHVH 5B39G 1UWGH 3ILQC 5DVMA 5MENA 3GO1H 1UM4H 2R0LL 4XPBL 2ZPKL 3C5SA 4JG1L 4XWGL 3GGWB 4XP5H 3D0VA 1A4KA 1HILA 5TE7L 1W72H 4PJIE 1LEGA 3IAPA 4UB0H 4FMKA 4MA3A 2C1OB 4NO0D 4PRHB 1EO8L 1HQ4B 2EE2A 2V5MA 4M1CD 1QEWA 2AV1B 1IQDB 2D0HA 3E8UH 5L8KB 1UCTA 3GMOB 4Y5YC 1U8PA 3U2SB 5TGBB 3OKKB 3MRCA 2CDGB 2BVOB 3VGHA 2VAAA 3V0WH 2IADB 1XIWC 1CXIA 3VGGA 4HS8L 4QXGH 5ISZE 1QKZL 2IQAB 1ND0B 4OCRH 1ORQA 3CSYB 2Z31A 3QFDB 4BFIB 4FFYL 3CXDH 3G5XB 4H1LA 4CDGC 4Z7WE 4MXVF 5IKCB 2MPAH 4YHOL 5TF1L 2YMXL 3MRFA 4IDJL 4ONFL 3CDYA 1FG2B 2YWZA 3T0WA 5DJAB 4NGHL 4XPFH 4XRCA 2RAMA 3R06B 4LAQL 1CE1H 2IC2A 3TPUB 1WBYA 3BAEH 4OLEA 3TO4C 2D4DA 3Q6FA 2KZWA 4U1MA 4U05A 3CFBA 1M71B 1S7VA 5DMGD 4IHOB 3B43A 4LVNC 4ODTL 4PRPD 5DURB 5EIIA 3QUML 4PJ7B 5T5NF 1DQDL 4G6ML 4OLXH 4DQOL 5GZOD 8CGTA 4G8IB 4X6BA 2B0SL 2J2ZA 3CVHL 5D7JB 3UPRA 4HUWB 5B38B 3NA9L 5ANMB 1UZ6E 2XN9D 3ZL4H 3O9WB 1HXMA 3X11A 1FDLH 4TSBH 5ALCH 1SYVB 3UJJL 4TPRL 3BO8B 4Y8DC 3K1KC 1RZKL 3GSRA 2W59A 1QSEA 3MJ8B 1HOCA 2VIRB 4QY8A 2G2RB 4JKKA 3UTSE 1QLRB 1DL7L 1CFNA 1FIGL 1R3JA 4HUMB 1NEZA 1FVEB 2EKJA 4Y5VB 2GUOB 3L3KB 4IIQA 4PGCA 1V3LA 4AT6B 3OXSB 4L4VB 1FVCB 4Y2DC 3TNNA 4FXGB 1KIRB 5JORB 4CGTA 5FM5O 1IGML 2BNQD 2E7BA 3S4SG 2WLZA 4LLYA 4ZPTB 3SKOB 5CD5C 4KZDH 1LNUB 3NH7L 3IGAA 2XT1B 4BQBA 3HE6A 3OJDA 1T20A 3OAUL 3UYRH 5ERWA 5JMRA 2ZPKH 4JG1H 3JWDC 2X44D 1DQJA 4K71C 3VWKD 5TE7H 4KK9C 3D39D 1UB5A 5BRZB 3VWJA 1MCLA 4MAUL 1I9RL 5K59F 5FYKU 1EBAA 2LE9A 1BWMA 2VDNL 3FQWB 2GKIA 5D1XB 1YN6A 5I0DA 3B9KD 5GSVB 3B2UC 3QHFL 2EE3A 5KS9A 3T09A 3G5ZB 2GCYB 3KDMA 4QXTA 4ZO6A 4U3CA 3WEXB 1ZHKB 2ADFL 2NXZB 4RFEA 2ZUYA 1QKZH 1RHHB 4HKJA 3K0WA 2DQJH 4JVWA 4LHUB 1RZGB 1IFHH 1IAIL 4FFYH 3OPZL 4LCWB 2WBJA 2XFXB 1H3TA 4DKEL 5CBAA 5TF1H 3T3PE 4IDJH 4ONFH 4R2GB 4P23A 2P5EB 3PXHA 3GSVA 3ETBF 1MIEL 4PGEA 1NMBL 3WCYA 1YY8A 4OLYH 2VLMD 3ZE1E 12E8H 4HZLA 1MCEA 4LAQH 4LVHB 5J1TC 1NBVH 4D8PA 3OTTA 5IWLC 4JLRA 3W9DB 2R2EA 3QUMH 3WLWD 5C07D 3VGDA 2Y6SC 5C0CE 4Q6IC 1KYOJ 2FHFA 3O3DA 1RUAH 3RIFK 3CVHH 4QOKB 1MSPA 4HIIA 5IVXE 3NA9H 1IEBA 4LAJH 3LQMA 4YO0B 3UTZB 3PWLB 5DJYB 2I9LB 3UJJH 3ROLB 4Z7QE 2FRGP 3F7YB 2QJDA 2X5PA 1GC1L 1AI1L 3L3JA 4EDWH 3LN4A 4WUUD 5DQDH 4PPTA 1DL7H 3I75B 5DJDA 4U7KA 3TM6A 1UH3A 1GPOH 3REVB 2ICES 5D6DC 2H6PB 3UC0H 1KCRL 5EU6E 4ZXBC 4EI6B 5I66A 4PJFE 3BXNA 1UJTA 5D7IB 2XQYG 3PHQB 3ZSSA 4HV8B 4GLRH 2JE8A 4KUZH 5D6CB 1YMME 1GOGA 2P48B 3QQ4A 1W0VB 5ETUA 1QFUL 1RAMA 2D31B 3GBLA 1IGMH 5I1IL 3OXRB 2DQCL 3QZWG 5HDOA 4LSUL 5DDHB 2B39A 1FYTE 4K94H 4BSVB 4FFVC 4C54A 3NH7H 4LCUB 4PJDA 4AENB 4OIAA 1MLCA 3LY6A 4MVBD 3TN0B 3OAUH 3UBXG 5FA3A 4ALAL 1A2YB 1QSFA 1S5HA 3B6SA 2ED8A 5LAXB 3MROA 3TA3A 2GYSA 1NLBL 3OB0H 4EVNB 5MEQA 1A3LH 4NQSA 1N26A 4M6OH 1T7YA 3RWFA 1D5BB 2FBOJ 2P7TA 5INDB 2A0LC 1YPZF 2LU4A 4JFXA 3QEUA 1T7WA 4X6CA 3T1WA 1S9YA 2P45B 4UINH 5HTSA 3FFDB 1A7OL 2F54D 1U3ZA 3T0ED 4OZFB 3AAZA 4LCYA 2DLIA 4K2UL 3EYVA 3HCVA 1X6LA 5E9DE 4I0KA 2ADFH 5I73C 5IQ9A 1ZHNA 5DK0B 1YEKH 2BVPA 1IAIH 2NXYC 1C1EL 2EH7H 3LKRA 3OPZH 5LCVL 1U8QB 4DKEH 3OB0K 3MGTA 4FQXD 2NTFB 5I15L 4JKMA 3QNXA 5CZVL 4K9EH 3OKMB 4M8QA 5KVFH 3MV7B 1CVSC 4KJYA 3SDCA 2FR4A 1B2WH 4HD9A 2ICEB 1SY6H 4MNGB 3VXMA 3TIEA 2V2WB 2NCMA 3QRFM 2QADD 3I2CH 4ZODA 3U7AA 3O6FB 4F9LA 2FIRT 1I85A 1EGJH 4TQEL 1YUHA 2R2HA 3FQUA 3LH2H 1IT9L 3HG1D 3RDTC 2XRAH 3WFBL 5HGBA 4LNRA 4IRZL 4XP1L 5GZOC 4FQIL 3AREA 3ARFD 1KJVB 1WTGT 3I9GL 2E9BA 5IW1A 4P2YA 2VXUL 4Y89A 5DHYB 3QT2A 1G7PB 1GC1H 4WIQA 3S96A 4WTXA 5A2JH 2DL2A 2XY1A 2GTWA 1XCQA 1KPVA 2HFGL 3CZFB 4S1QH 2JB6B 2Z93A 4PJEF 1U8JA 1KCRH 3FT3B 3O8XD 5T1KA 1YDPB 3GSQB 5GJSH 1LEIA 1UJ3A 2VR4A 1LHZA 4M9OA 2Y06L 3P4OB 3MRLB 4CNIA 4ZNCD 1U92B 3QDMB 1GH7A 4UBDD 2DWDA 1J10A 3AMLA 4WHTB 4BQ9A 2DQCH 1UVQA 4LSUH 5F21B 1MCFA 3EOTH 1CICD 4NZDA 2KUTA 4PS4L 1JNHA 5E1HB 5JIIA 3L3HA 3VI4E 4ALAH 3RVXD 4YDVA 5IF0B 4Y7MA 5IVZB 4Z7NF 3CU7A 1CLCA 1JGDA 3GBML 2IPUK 3MCG1 4TOYL 3F6IA 3JV6B 2IQ9H 4XNYL 3AS2A 2Z0BA 2CK0H 3OR7B 4MJ4A 3VFPB 1J0YA 2IPKA 5GHWH 5JPMA 1UM6H 4PJXA 3D2UD 3MOBL 4M4RA 1JK8A 3O81A 1A7OH 4M7ZB 1SVZA 4OM1L 3UP1A 1OTTD 4NUJA 4KTDH 2AJUL 1BEYL 4U1NB 5T1MA 2X7LB 2MCG1 1OWRM 3TH2T 4R6UA 3V52L 4JQXA 4HK0B 5DJCB 1X5HA 4I0PC 2EDEA 4M6ML 3S6CA 3STLA 5EO0B 3P73B 1OY3B 3L7EB 2A83B 5I15H 5CZVH 3TWCL 2OK0H 5E08L 3TYFA 2UV3A 1L6XA 1RU9L 4JFED 2VLJD 4JFPB 4WU7B 3MRRB 1A5FL 3OJMB 4G7YL 1EH9A 3O41B 1KB5A 5KS9E 1F3RB 3C87A 4POYA 4RMWA 1J0KA 2JIXB 3NCFB 4JFYA 4GBXC 1N5YH 4NN6C 1ZOXA 3FO2B 3I6GB 2IALA 3MRDB 1WIOA 4M7JH 5J8OA 4I5BB 4QCIA 1BBJA 1UQSB 3LQAL 4MQ7B 5E7BA 1Y6NR 4RA3A 1WF5A 1IT9H 3WLWC 2P8LA 3WFBH 3C60A 4IRZH 4D0BA 1O7SA 3RTQA 4XP1H 3QHZL 1EDQA 1KCVL 4ELMB 4A2MA 4FQLL 1X6NA 1B9ZA 2BNRB 1K4CA 1IGCL 2F19H 1EK3A 4WHYG 4EBQH 2HFGH 1AKJB 4Z9KB 5I74B 3VG9C 3DTXB 3U1SL 3PHOB 3P9MB 3WXWL 4UT6H 4Z76A 4LDEB 4HJJL 1B4JL 3RWIB 1WISA 3VGAB 2AP2A 4ZFZA 4PGJA 2Y06H 2X4UB 5J13C 3QXWA 4GRWE 5INCA 4YHNA 2NX5D 2X4PA 4DVBA 2C7UB 4HFWB 1CT8A 1VENA 2WUCH 2H8PB 3CSGA 4ZUWA 2XPGB 5DWUH 2H3NB 3BSZH 3H9HA 4PS4H 3RPIB 1JZ6A 5HD8D 5LGJA 2AXGA 4ZS7H 2C4FU 5IOPA 1FNGA 2ATPA 3S8WA 2F53D 4L4TB 1BIHA 4MDIB 4TOYH 4HX1A 5FCUL 4PP2A 2VXTL 4XNYH 1NC4B 3ET9F 1HCFX 4N0CC 4IRJD 1QRNB 1P2CA 4MNQD 3VXSD 4Z78B 1NC2D 3QFJB 5EIVA 2NW2A 1G7QA 2DBLL 1R0AL 3IDMA 3GDBA 3LZFL 3SDXF 4J1UA 2CKBB 4IRSD 5KVGL 4PJDE 1TJGH 5C71A 4LQ1A 5DRXB 4FMFA 2NNAB 4O58L 4MJID 3MNVB 3TPKA 4APQA 4EOWH 3VXPB 4B7IA 3ZDXF 4P5TD 4QRRA 1OW0C 2B5IB 1WBZA 3IS1X 3QIBB 4HIJB 4M00A 3TWCH 1CG9A 1QPPA 5BZDB 1KTDA 3SGKC 1KTRL 1K4DB 4X6CE 5GGTL 1SJHA 1NUNB 2R2CA 3FRPG 1A5FH 2V2TB 3BZDA 3O0RH 5CILL 4NRXB 5FCSH 5GGUB 5KN5A 3HI6L 3HPJA 3EDKA 4HMCA 5CFHA 4BSJA 4DN3L 1HWGB 4U6VL 4TSAL 4MAYD 4JFDE 3G04A 4JM2F 2QADC 4NQCD 2EYRA 5LJYH 1QFOA 3CH1B 5IBTL 3HC4L 3JTSB 3ARZA 3SE4C 3GZKA 3K3QA 4B41A 3C8KB 2YUXA 1KCVH 4BH8A 2WWKO 1BFOB 4FQLH 5IEHA 5ID1B 1XF5B 1IGCH 4WENB 3VFUA 3VXME 2VSDA 1MJUL 3STZB 1MNUL 3L5HA 4JDZB 4YXLL 1T1WA 5FK9B 3U1SH 4QHMB 3WXWH 4LDLB 1L6ZA 4XNQA 3CMGA 4N0UB 1Q94A 2BVQA 2ATKA 3D18B 5JUEH 3RL2A 5T1LD 1AC0A 4OCYL 2FNBA 2YBRB 3ULUF 1HHGA 2GQHA 4EDXB 3D3VA 4OD2B 4MXWL 4O2EB 5CD3A 3LS5H 4ZNEE 4C56D 5EC1A 5F72S 2BY3A 3KJ6L 3WUWA 3DX7B 2GITB 3GEWB 3KPRD 4ONGL 4KTYA 3GI9L 4KRPC 1P84K 1UENA 2VLRA 4S11A 1J86A 3QNYB 1QACA 2ZUQB 3KPSA 3RGVD 2WWMD 4JGJA 4ZQKB 1VKXA 4WO4C 4O02L 2CMRH 1JYNA 2AJYL 4PRIA 3KLAA 3WBDA 3OKEB 5FYLH 2OTWB 5D96C 3V5HB 4S1SL 5D2LB 1FFOB 5JLZB 2OQJA 4JRYB 3DO7B 3FKUS 2DBJA 5E00B 1T5WA 4GXUM 4ZG1A 2DBLH 3FQRB 4QXUL 5J1AA 3LZFH 1AD9A 2VE6B 1IMHC 5B38G 3S88L 2G60L 4O58H 1BHGA 1OTTC 1LO2L 5JOPD 2IH3B 1U8MB 1IGJB 3RA7L 1ODAA 4NQEA 2EDQA 2G9HA 3MLWH 3WKMH 3K4AA 5EFIB 4NWTH 4M02A 3NMEA 5EZJA 4OAWA 2AXJA 1MJJA 1M7IB 3QUYB 1OD7A 4RGNC 5GGTH 1Z3GL 4PJ8D 4LIQE 5CILH 2F74B 4CU6A 1ACYH 1XIWA 1X5IA 5IBUG 2C3HA 1KLGB 5D7KE 1EJ6A 5IIEB 3S36H 5C0BA 3QWOA 4NO5B 4ZOCA 3HMWL 4R7NA 3C2SA 4LPUA 3U30B 2ZKHH 1IE5A 4EI5B 5HHME 5GGQH 1FZJA 5ADOH 1CF8L 1DP0A 3GJFA 1T1YB 3FO1A 4NKOB 1WIPA 5GJTH 1AHWB 2GHWB 5E6ID 4AM0A 1B88A 5DZOA 4G6FB 1IAII 3D9AL 4XX1G 3CFCL 5TE6L 3TO4A 4HZAA 3DROB 2AABL 3IF1A 2Z4QB 3ARBB 1MJUH 3I50L 1MNUH 4PV8B 1BLNB 2LTQC 4O9HL 5E2TL 4YXLH 3ZKMC 4OIIL 3ZKNC 2OP4L 3DRQB 5KAQG 3D48R 4KRNA 1CBVL 2W60B 4W6XB 1A6AA 2UY6A 4XBGB 4R4FL 2WQRA 1JZ2A 4YHYC 3BIBX 3C08L 1O7VA 1D9KC 35C8L 3SDYL 2YXFA 3QIWB 4OLVH 4YXHL 2XKNB 3EO1B 5HI4D 2VITB 1G7IA 1Q8MA 2ZOLB 3KYKL 1HN1A 1N5AA 2Y25A 4FFWC 4GKZB 5LWYH 3T2PA 1CYGA 3G6AA 4MXWH 1YY9C 1Z9OA 2ICWJ 4LHUG 5EBWA 2YR3A 2DQUL 2HKHL 1A47A 4ONGH 4H20L 4YE4L 1EZVX 3GI9H 1G84A 4ZD3L 1KTLA 5DJ0A 5DRWB 4O02H 3A0OA 2X05A 4RMVA 1ZS8A 3PGCA 5IHUH 1IBGL 2F8XC 2VDRH 4HIEA 1IRAY 3AS1A 3PQYA 4P2QD 3DRTB 4S1SH 5AD0A 5ISZB 3DX6B 1U8OA 1FAIL 3FB6A 4DVRL 1HK6A 3SCMB 4ZAKA 2LAAA 5HHPA 3NA4A 1GZPB 3MRKA 4YNYB 4Z7WB 3PL6C 2GJ6A 5FDWB 4HAFA 2AK4D 2CO6B 4LK4A 3MFFB 3S88H 4HBQA 1KULA 2J8UA 4XCFL 3V6OA 1WIUA 2G60H 2VQ1B 3BEVB 2HJLB 2WV3A 2P5WA 4FXKA 1I1CA 3EW3B 1LO2H 1B0WA 4IRSC 3BT2H 4P5KA 2VISB 3RA7H 1SVCP 1TJHL 1TTGA 3ELAT 2MJWA 4WU5A 4QHLA 5F6HI 1QA9A 4LSPL 4OCMC 2EXYD 1R3LA 4BZ1L 4HIXL 4P48A 3ARVA 2UWEE 5BS0E 5BW7C 5L2KA 3W0WD 1JRHL 4MB4A 4P3CL 5L8LB 1OAZL 4X8JA 1BD2A 4N5ED 3FQNB 4HUUA 4GW4A 3ZYIA 2G5RA 4GQ9L 5EO1A 4LLQA 4KMTL 3MODL 1LO3H 3VA2C 1OAXL 1U8HB 5C0AB 2VABB 3HMWH 3SE9L 3RWJA 4MCYA 3UTSB 4QNPF 4J3XA 3E2HB 4XVTH 1CF8H 1A6ZA 2W38A 1MHCA 4JFHD 4X5XB 4F37K 5IESL 5FUCE 1C5DB 3D9AH 4DGIL 5TE6H 3SJVE 3TFKC 1S3KH 2AABH 3SO3B 3OAZH 1Z5LB 5IWLA 5FM4A 2YD1A 4ZUUB 4JFFD 4O9HH 2F8VA 4OIIH 1RIHH 2OP4H 3NFNA 3IDIB 1CBVH 4NWUL 4MD5B 5F7FA 1DBAH 4Q6IA 2EO1A 1QLFA 4R4FH 4LFHG 5EOTB 5DMKB 5I2IB 2FJHB 3ULVF 35C8H 43C9A 5A2IH 4ESKA 3REWA 4YXHH 2EXWC 2H26A 4L3EA 3VFWA 3NPSB 4FTVE 3KYKH 2DLTA 4FQJL 2R8SH 3BISA 5E5MB 3WIIL 4PRNB 4YH6A 5JW5A 1XF1A 3ISWA 4PJ9B 4YWGH 1IC5L 4F80A 2UZIH 3OHXB 4NC0B 1V3MA 4H20H 4DEPB 2HN7A 3GSNH 4GG6A 4E0RB 4CMHB 3KPMB 1CDHA 4PJGF 2FZ3B 3IDYB 5D7JC 2BY0A 3VRIA 3VFSB 1P7HL 4PLKD 1ZT4A 4WEMB 3PWPD 4XHJD 2PYED 4HWBL 5C09D 2VL4A 4OQTA 1FRGL 1FAIH 5HYSG 4PJEE 3RL1A 1PBYA 4U1KB 4O00A 2W0KA 1OAYL 1ED3B 5L6YL 3D3VE 3SKUD 5D1ZB 1QBAA 2X1OA 2Q7YA 1NAMA 3VH8G 4OCLC 3HAEG 3VFMB 4AH2A 4YDLB 3QDGA 3K4DA 1JN6B 4Y5VC 2VLRE 1MRDH 4XCFH 1BZ9A 3TZVA 3DGCR 1N6QL 1IM3B 1CFVL 4NHCL 1HZHL 1MIMH 1OQXA 2XTJD 5I1HL 4PRIE 4G42B 2FSEA 3PHSA 4KKBC 5FYJL 3A6OA 5EDXA 3GSUA 1Q72L 5DA0B 5D9SA 1KPRB 4LSPH 3ARGB 4IOSD 1A7NL 4BZ1H 4HIXH 4ELKB 3WE6B 5IHLB 2BXYA 5ITBL 4NQVA 2MHAA 4NO0A 4PJHE 1D6EB 2A6DA 3DURB 5GGRA 1OTSD 5DRNB 2CR6A 4KHXL 1MFBL 3QDJD 4GQ9H 1SMOA 4KMTH 3MODH 1TQBB 2BOBA 2X4NA 1IGTA 5EOQL 1SBSL 4YHKL 2DYPB 3S35H 2I5YL 5T5NG 4LP5A 3SE9H 3ME0A 4MQTB 1KIPA 3RWEA 3DX8B 2E3VA 5K9QG 2BHZA 1W0WB 4HUNB 3VGEA 2X1XR 5EU6B 3PV6A 4TUKH 1PYWB 4PJFB 4DGIH 3HUJE 2PNDA 2NXZC 4KKCC 4OD1H 3U6RB 4MHHI 1A6WL 1YMMB 3BPNB 4P9HC 1YC8A 2F5BL 5C08E 2R2BA 5CGTA 1K8IA 3QIUB 5SWSD 5M94B 2H45A 5HY9B 3BH9B 3PJSA 1F8TH 3S34L 2CO7B 1KGCD 4G9DA 2C3VB 1MCSA 1AC6A 4RRPA 4XAKD 1G7JA 2Z91B 3UXFA 7CGTA 1JUFB 1J18A 4AEFA 5F93C 4R4BA 2GY5A 2AEQH 3WIIH 1H3PL 5IEKB 1PEWA 1F4YH 1B0GA 1NMCB 4PB0H 4AG4L 4B5EA 1EXUB 1QQDB 2XN9A 1IC5H 1R5WA 4NZUL 1JWUB 3NFSL 1FVDA 2H2SD 1WV7T 1LO4L 4ORZC 4BA8A 2IGFL 1W8NA 5JMOC 3IJHB 5F1OB 1E4KC 1IAKA 4CVZB 5D71L 3SGJC 1P7QB 4BM7A 3LPWA 1LO0H 4NFDA 2D9QB 1ZLSL 2R69L 3NAAH 3C5SB 3LB6D 1OAYH 3UAJD 1DBBH 1A4KB 1HILB 5EU7E 5A3IC 3UTTA 3UO1L 1LEGB 3HS0A 3WIHA 4TNWF 2BNQA 3MBEB 1DANT 1QD0A 1X7QA 5IR1A 2DI8A 1QEWB 4K7FB 2XQYK 4D0CA 1U8PB 3AB0B 1C16A 3BI9X 3MRCB 1U8LA 1I3UA 3FB7A 2R23A 2VAAB 5MP6H 4JN1L 4OFPA 5JOEA 3PQYE 2E8ZA 3JTTA 1Q72H 4Z7UE 4YHMH 5IB4B 3VWKA 2Z31B 1A9EA 5DC0A 4H1LB 4GAGH 1TZHA 2GJ6E 3TN0C 3MRFB 3KPNA 5T3ZE 1G6VK 2XA3A 1I8IB 5TPWL 4KHXH 3LAFA 2NY2B 3B9KA 1KJMA 3VCLA 3JV4A 2J8UE 3V6OE 1HHJB 4LPVA 3B3IA 5F89A 3RPKA 2P5WE 4NSKA 1WBYB 5CP3H 1S9WA 2DB8A 5EOQH 3BESR 1SBSH 3Q6FB 3VRLF 4U1MB 4WW2A 1QBMH 4GO6B 2I5YH 3CFBB 1S7VB 4F58L 1RK1A 3ESUF 5J6HA 2UYLB 1DQTA 2QQQA 2AJVL 4NNXB 4ODBD 5EIIB 1VDGA 4ORGA 2HT3D 1MWAB 3MC0A 4ODVL 3NCEB 4X6BB 2NY4D 5L2KE 1YEDA 1K8DA 3UPRB 1A6WH 3RFZC 4R4NC 9CGTA 1OQOA 3X11B 2J12B 1PKQA 2F5BH 1RJYA 3GSRB 3OAYH 1N7ML 4KGJA 2R15A 3DX9A 1M6OA 4N8VA