1FNGB

Histocompatibility antigen
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
213
structure length
213
Chain Sequence
KKVITAFNEGLKGGGGSLVGGGSGGGGSRPWFLEYCKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAVTELGRPDAENWNSQPEFLEQKRAEVDTVCRHNYEIFDNFLVPRRVEPTVTVYPTKTQPLEHHNLLVCSVSDFYPGNIEVRWFRNGKEEKTGIVSTGLVRNGDWTFQTLVMLETVPQSGEVYTCQVEHPSLTDPVTVEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional consequences of altering a peptide MHC anchor residue.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords PROTEIN (MHC CLASS II I-EK, ALPHA CHAIN)
total genus 42
structure length 213
sequence length 213
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fngB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1fngB01
1FVDB 3H8NA 2GSGA 5SWQA 2VDRH 3WN5A 1MCCA 1OT1A 2NTFB 1CICA 2X4QA 1MRDH 4J7RA 2CKBA 4QY8A 2EC9U 1BJMA 2XPGA 3RJDA 3QNYB 1NANI 3VXTB 1DLHA 2BNQE 2CLVB 2BVOA 3ZYZA 3HN3A 1R5VA 1U95B 2WWKO 4YH6A 5C09D 2YD2A 2M26A 1EHLL 2YZ8A 4KVCH 3QXDB 5TE7H 3Q6FA 3QPQD 3UTTD 2HT4C 1UKTA 1A3QA 5FHBL 4OI7A 5HPMB 2IQ9H 4ONHA 3M17A 2HT3D 2VABA 1JRHI 2ITDB 4KI5F 5I1CH 1HI6A 1UJTA 2VZVA 3IKCB 2ED7A 1ZHNA 5EU3A 5GS0H 5TGBB 3L1OL 5I1IH 1HK6A 4N1EA 2MHAB 5IB1A 4N0RA 4WV1B 2ADFL 3EOTL 1MNUL 2CKBB 3O2DL 3RIAF 2QSVA 1FYTB 2UY6A 1U8IA 1KENH 1UCBL 2XY2A 1D9KD 2AJZB 1IGFH 3I3BA 4Y1AA 1G9EA 2H32B 1CFVL 3B2UD 4RAUB 4RBPH 2VMFA 1S9WB 4LSQL 4ZPVB 2NXZC 3HFMH 5EDXA 1YEFH 2HH0L 1FH5H 4X7TB 1IT9L 2NY6B 4GAGH 5EB9A 3QT2A 3JWDH 3TBYA 3ZTNH 1IC1A 4AENB 1CGSL 2Z92B 3IXAB 2XZQL 1KB5H 4M6MH 4FOMA 2F5AL 4XNZC 3JSSA 4D2NA 3O11A 1C08B 2ESVA 1HXMA 5C0EB 1KEGL 4TVPD 3MA9H 5SWSA 5TDPA 1NGYB 4R9HA 3O3EA 1AGBA 3D48R 4I0PA 5H94A 1NDMB 1NLBL 4IJ3C 3G6JB 4XNMA 4JRYB 1UEMA 1KPUA 3LRGA 1I7RB 2VKWA 4PREA 3TWCL 1OM3H 3MBXL 4DAGH 5FKPB 3EZ8A 3VRIA 5SWZE 3VWKA 1RK0B 4L4VB 1QBLH 4NO2B 2H1PL 4OLEA 3KPSD 1JNLH 1XZ0A 1LK2A 4AIZA 5J6GA 1W8NA 3S4SB 3IU4H 4TQEL 4BSWB 3HZKB 2KKQA 1ZXQA 4FQXD 4KDTA 4DUVA 3HUJF 3QH3B 4DGVL 1FZMB 4Y4KB 4XC1H 3OKEB 3RL2B 3WKMH 4PRIE 4E42B 1DQLH 5C0DB 3V7MA 4X7TA 1T5XB 1RHHB 2XG5A 1CDCA 1T7WA 2YOCA 4YQXL 4TNWF 4ZO6A 4F7PA 4QOKE 5EO0A 3PWNB 3QI9D 2BRQA 2QSTA 3LN4A 4JFXA 3T0DA 2Z31D 4NWUH 3T0ED 4PP1D 3SGEI 3C6SA 4DQOL 2JELL 2AJZA 4OZFB 4TNVF 3IFLH 1ITCA 3PHQA 5DVMA 3H9ZA 4OI8A 3L3JB 3PWJB 4Q2ZA 4HK3N 2HKFH 1FFNB 4OV6F 5ICXB 1CFQB 3W9EA 4H1LG 4P57A 2FHBA 4JGMA 1HI6B 2A73B 4ORGB 1Q38A 2AJUH 5E9DE 2DQGL 4P4KD 5DK3A 3W0WD 4YLQT 4NUJA 3WJJA 4LQFH 3DXAB 3MRKA 5FA3B 2I27N 3T3PE 3EFDH 4M5YL 4F15C 3A6CL 4CN1A 1G6RL 1FL3B 3ARYA 3LMJL 4HIXL 1JPSL 3UTZA 3ARBA 4K3EH 4NZTH 4HT1H 4OV5B 1N8ZB 1CG9B 1RZIB 1SQ2N 1EJ6A 1KNOA 3SOBL 3GI9L 1W0VB 5DK2A 2YC1A 1J1XL 1GOGA 3DMMB 4L4VE 2ENYA 1JUFB 4FMKA 6CGTA 1AE6L 2MQCA 4PJ9B 1C5DA 1DQLL 1I3RA 3BN9D 2ED8A 3X3GL 4OB5H 1KN2H 2R4SL 4QTIH 2EYTA 1IKNA 4KQ3H 1U2HA 4QXTA 2N7BA 2PNDA 4MD4B 1P4LA 3BOVA 1EAPA 3TVMC 4OKVA 3P73A 4DUXA 4MAYC 3RY6C 1F4YH 5DEGA 4R7NA 1TPXB 1HXYB 1ETZB 4CNIA 2W38A 2OR7A 2P5EA 3MR9A 1JF1B 1I3GH 3K2UH 3BH9A 8FABA 5M94B 1ZHBA 5FYKH 2GI7A 1QBBA 3SDXA 4K94L 2MQ0A 4N8PA 3RFZC 1FLRH 3IVKB 2YMXH 1F6AB 1GH7A 3AS3A 2BNRA 3Q1SL 4PGJA 5EU7C 3MGTB 2JK5A 3KXFB 3Q0HA 3CSYA 3FQTB 1MIEL 1DJSA 5E5RB 3SGKA 3NZHH 4HPOH 4HIJB 1SVZA 4OCXL 1HIMH 1YDPA 5DJXA 4JO4L 3EYUL 2DQHL 1SJHB 5C3TA 5DZLA 2EDBA 2GFBB 1KLGA 3TV3L 4JQVA 2ZUWA 5CJXA 5GSRA 3MRDA 4LRIA 1TJGL 1MJUH 3NZ8B 1GZPA 4WCYH 1GRWA 4W4OA 2WIMA 1OW0A 3MZGB 5IR1A 1S7WA 3FQUA 5T1KD 3WS6A 4LPTA 5IOPA 5DJ6B 1TNMA 4O00A 4OT1L 2ADFH 1DUYA 3TBVA 1WAAE 1PLGL 3N9GH 5MENE 3INUH 2FEDC 5DJ2B 2CLZA 2X6MA 3H6JA 1MFDH 2D0GA 1U8HA 4OFVA 3SDYL 1EV2E 4XPGH 4PJXA 5SX4H 1QSEA 1SEBA 5HGAB 3QI9A 3WNMA 5IBUB 1CFSB 4GBXB 2DWEA 4RQQB 5F3HA 4W6XB 5HVFB 1BFTA 1K8DA 2CXKA 1T1WA 4RAVB 4ZS6D 4P2RD 3QFJE 3P4MB 3NMEA 1SJVA 2CK0H 4ZG1A 4JRXD 1BZ9A 3VW3L 1BJ1J 1HNGA 1YNTA 1MCHA 3V4UL 1LGVA 4PP2B 1CD9B 4NBZB 2EDQA 4P5KB 5B22A 1C12A 4NP4L 3UZEA 5GGRA 4NKOB 3WFCL 2ZUVA 3OQ3B 5EUKB 3GRWL 4U6YB 4NM4L 3O3DA 5T3ZL 4JJ5B 1I1RA 3FB7A 5E0QA 1HINH 4NNPH 2DKMA 2D4FA 2AK4D 4DN4H 2VIRA 1II4E 2FL5B 5GS0C 1QPPA 4U3HA 3VI3E 4I3GA 2BC4A 4MVBD 5D1ZC 1MUJA 5CEZD 3WE6A 1J05B 3DBXA 4ODVL 4PJBB 4JN1L 4EEEA 3OKKB 1ZKAA 5T5NG 4IMLA 2RCSH 4K8RD 1A6UH 3FQXA 3CMOH 2X44D 4JPKH 4HFWA 3ULUD 3B5GA 4H8WL 3C09B 4JFQB 1AXSB 4ERSL 5CP7A 1LE9A 5C7XL 3EBAA 3CFIC 4P23B 2VDKH 4F7CA 1CT8B 2C3HA 4Q74A 3ZHLA 2EECA 4NJAH 2DMBA 1UWGH 1Y18B 5F3HB 3E1F1 1ZTXL 4RIRA 1T66C 3EYSH 3OKMB 5KVDH 2FX9L 3MLWH 5D1XA 4JFED 2YPLA 5IEHB 1DCLA 3GBNH 3PP3K 2C4XA 3P77A 2R23B 3VCLB 1S7QB 5HHNB 3K46A 3OBAA 4WWKB 1ETZA 1PG7W 1GGYA 5D2LE 1I7TB 4QGTA 4FQIH 5DJ6A 3MLXH 5AD0B 4PG9B 4Y19E 1F8TL 2KQNA 4NQEB 4XCEA 4XNYH 1P4LB 1PKQE 5AZ2H 3TCLB 3RY5A 1WK0A 4PJDF 3C09C 2RGSA 3I9GH 3V6FB 1I8KB 4MJIB 4X8JA 3GMLA 3BX7C 3QJFA 5F8RC 3O9WC 4DZ8A 1G7QA 4LKXB 5L2JB 4PJ8B 3C8KB 3RTQD 4X7CC 3T1FB 3E8UH 3QUYD 4U0RB 4YFLI 2XKNB 4WUUA 5HGBB 4KKAC 4XHJD 3EDEA 5IEHA 3QIUB 5CCKL 5H37H 3MO1A 2VQ1A 3HNVL 5EU6D 3V7AG 4C4KT 1NCDH 3DXAD 4P5TD 4GS7C 1ED3B 1UKQA 1FZJB 3W0WB 1CT8A 1PSKL 1HEZB 2XWTB 4P4KB 3CVIL 4ZS7H 4UNUA 2IJ0C 5E1AB 1QPXA 1OCWL 4MJ5B 4LLYA 4XT1C 1FL6A 2OQJB 2ZJSH 4J1UA 2HG5B 3C5JB 3F7VB 4UT6H 2APBA 3RWGB 1AXSA 4ENED 1WWBX 2UYLB 4WW2F 2EIDA 3V95A 4ETYA 1G7HB 5ESAB 4F8QA 3LN5B 5D96B 3W9EB 1N5AA 3F7YA 2QTEA 4LGRB 2DQJH 4PD4K 1KYOK 2VXVL 4PJAF 4PJHF 3SE4A 5GQBA 3U7YL 2EXYD 4HK0A 4GMSL 2V5RA 4JHAH 4TUKL 4XMLL 3V9FA 3PHQB 1H15B 2IBBA 5FYLL 5I74C 4IDJH 5HY9A 3V4VH 5F1NB 2DQCH 2AJYL 2EE9A 3L5XL 3NCJL 4QF1B 1JWMA 2Y36H 5IBLD 2BC4B 3B9AA 1TDQA 3E3QE 3KG5A 4X80L 5IFAH 3C60A 4TUJB 2WINB 4X4YA 3P9LB 4YK4B 1DEEA 2AABL 2IG2H 1CLZL 3DUSB 3CSBA 1I75A 3LB6C 1WCBB 4I4WB 4LL9A 4RISL 5F9WC 1ZLSL 4NKDB 5FKPA 3D3VA 3KWWA 1U93B 1BD2E 4XX1G 4QHLB 5I71B 2V2WB 3UP1A 5JXAL 2GJ6E 4EI5A 4KZEH 1KB9K 3T8XB 1IFHL 4NKMA 5HVGB 2DTMH 3WXVH 5JA8B 2FR4B 1NEZG 4FTVA 3RP1A 4OI9A 1SM3L 5DO2C 1D3CA 4UIMB 2VL4A 1WCQA 3HE6D 4OF5A 5I75C 3NIDE 1T4KB 4V1DE 2DQCL 2DL9A 5E2VL 3VFPA 3PGFL 3WFEL 4LAJH 1LO2L 4CVUA 4X6DA 4D9QE 5LGHL 1LE5B 4OF8A 1UACH 4UNTA 1FNGA 1QEWA 4AMKH 1FBIH 3RWDB 4EDWL 4LDEB 3IGAB 5GS0D 5DUBB 1CGVA 1D5ZA 1I9RH 5L6YH 4Y4FA 4LQ1A 3S35X 2WP3T 4E42A 3U9UB 5DHXB 2WUBH 3BJ91 5F71A 3K4ZA 5JNYB 1UYWH 3FCTA 3AVEA 3WIIL 4HUMB 4YR6B 3GJFA 5C0CA 2F74A 1MJ7L 3H9YA 4KQ4H 4JGUA 5JA9A 3AS1A 3S3PA 3ARUA 2GFBA 3QJHB 2I5YL 3MNWB 1OAUH 3PDGA 4PLKD 3BGFB 3GFUA 3UJTL 5EU3B 2JIXB 3C2AL 1FO0A 1HKFA 2Q3ZA 3A0OA 3UXFA 4XAWH 4GXUM 2P5WB 2IQ9L 1SBSH 1NC4B 3F5WA 1OP3K 1F6LL 4NRYA 1J8KA 3UYPA 5J6HA 1CL7I 3GM0A 5E00B 4ISVA 3X11A 4UAOC 4K7PL 4U6XB 5I30L 1F6AA 1NGYA 5E5UB 1U0QA 1RJYA 4PB0H 1OGAA 1JZ6A 4PJCA 3GSVA 3U7AA 3I9GL 3TGXA 4CN6A 5I8CA 4NCC1 1UB5B 3VXRA 4BKLA 4RSVA 3TBYB 1R3HA 4WEUD 3WFHB 4XNYL 5HGGS 2R1XB 3TO2B 3KS0J 4RGNB 4HUVA 3VRLF 4N9GB 3VXUA 4JZJA 2B4CH 1EAPB 4BQ9A 3MA7A 1IMHC 4YDIH 35C8L 5E95B 1AD9B 1PQZB 1RUPH 1LO5B 5C71A 3U9PL 3RI5K 4PJGE 1K85A 1X5FA 3DYOA 4XAKE 2DRUA 3BD4A 5HYJA 1NQBA 4IDJL 4LVOB 4RDQG 2LFGA 2NY1B 3MV8E 4G8EA 3L95A 3RKPA 3DX6A 5BRZA 4IDLA 2ZP0T 4WO4C 5FIEA 4W6YB 2R1WB 1AFVH 2BERA 1JPGB 3MJGX 2P8LA 1F00I 3WIFA 1SJEA 4URTB 5JOFB 4WTZG 1JRHL 1OP3H 3MV7E 3GMQB 1G9MC 2FDBP 1NBZB 1FL3A 2HTLD 4R2GD 2Z4QB 3CX5K 4U2ZA 5HHOE 4GRMA 4NQDE 2DLFH 2VISA 3BXNB 5I1AA 3JUYA 4KKCD 4OCXH 4QGYA 3MODL 2FIKA 4XCFL 4GRWB 2P8LB 5BVJB 2UWEB 1V3MA 4XTRD 3BZEB 3NACH 1LO3H 4LCUB 5F1IB 1LK3L 5FYJH 1YJDL 3RZCC 4G8EB 5JDSB 3BP4B 5I73B 3ILPA 2HA1A 3VI4E 4G7YL 1NMCC 5C0IA 2D7OA 1MCBA 3N1QC 5EA0L 2F74B 3GMLB 1F02I 1ZOXA 4FFWC 5DMIH 3MXVH 3FCTB 3CZJA 1TIUA 3CXHJ 5DD0L 2YD4A 2ATKA 5F3BA 4ZAKC 2FB4L 3BE1H 4V1DD 4MNGA 4EVNB 4OFDA 4Y4FB 4K3GA 4PJFB 1HHJB 5DUBA 5IV2B 3STZB 3LEVL 5HYJE 2GTWA 5K9KA 2C3VB 3P40A 3H9SB 4IRSC 1XGUA 4AT6A 1HDMA 1FGVL 1MF2H 2XYCA 1OWWA 4K23L 4LSRH 3RVWC 1RK1A 2WIIB 1QRNE 3E6FB 1QLEH 4Y5VC 5H35B 3NPZB 1ZT1A 2NY4D 1OQOA 5C0JB 3LS5H 5T3XH 3SGKC 5D5MB 3VXRE 5JHLH 3QIUC 1KTLA 2XQBL 1JNNL 1JPTH 2G9HA 3G5VB 1C7TA 4XB7A 5JOPD 4QXGH 4Q9QH 4P46A 1CU4L 5FDWB 4KJPC 4J3XA 1KN4L 3G08B 2I60H 1MHPL 4NQDB 1B2WL 4M7KL 2JF1A 1NAML 4HUNB 5DEFA 4HZAA 4LRIC 4FFYH 5KSAD 5E1HB 2O5YL 5DXWA 2D7QA 1KN2L 2XWBB 1WUNT 3FN3A 4M4RA 3NIGF 4HDIB 5FA4B 3SBWC 5MHSE 5EN2B 4RRPG 1XGQB 5CBAA 5INDB 3UX9B 2VIRB 4NHCH 5IB3B 5IVXA 4KRNA 2CH8A 3QO0A 2EDOA 2ICCA 1F2QA 5E2VH 2R56H 3C2SA 2QL1A 4M43H 1FYTA 1FC1A 4U6YA 4WEBL 2NX5A 4MQSB 1A6AB 3CXDH 3CPLA 2NY5C 4HAGA 3WCYA 5KN5B 5IHBA 4DK3A 1IE5A 1KG0A 1FSKB 1PDKA 5DJYA 5EU6E 1FVEA 5C2UB 3MBEB 3IDUA 3M17B 5EOQH 4N0YL 4Z7UB 5BRZD 4NN7C 2BSTA 3V4UH 3TP4A 1JWUB 5F9OL 1CVRA 3QUMH 4NBXB 1CE1H 5I9QC 5D5MF 4YE4L 4N5ED 3O2VH 3MJ9H 4L3EB 4QRUB 1DP0A 5E9DB 3NVQA 4HG4K 2UZIL 4C83A 3KHOA 1A64A 3RTQB 1WIUA 1A6PA 5EPMA 4KRPD 2IPTH 3T1FA 3BW9B 4R4BA 1ZLWH 4FQ2H 1IGJB 2B20A 1RUPL 1LHZA 3JV6A 4UOW1 4X8JB 2R56L 4XVSL 3GUTB 5C9JB 1EO7A 4UV4L 2O5ZH 4ZODA 4ZXBB 3WV0A 5KANI 5FO8B 4JREC 4OAWA 1TJHL 4RX4D 3OAZK 3ARGD 5IBTL 4I2XB 1E4XL 4F58H 4HUXA 5C86A 5CS7A 3CU7A 5KJRL 2XA3A 4NNXB 5CEZH 1SJHA 12E8H 4LIQE 3P77B 1VERA 5JLZA 4KH2A 4TSAL 3KPNB 3BIAX 5DWUH 4PJIB 4P49A 2DQHH 2VC2H 3NCFB 4JFZH 3S36L 3QIBA 5T5NF 1FL6B 2OQJA 5HHMB 1Y18A 4K8RH 5E2WL 3S6CA 3L9RA 5A2JH 4NJ9H 1P7QA 4XZUB 2HYMA 1KCUH 3O6FD 5AEAA 3S5LG 4F8TA 2AEPH 2R0LL 1UEYA 4JY4A 5D7IE 3QDJE 1KCUL 3UAJC 5BCAA 4TTGA 1MJJA 2H2SD 4ZUTB 5JO5A 1T6WA 2P8MA 5KZCD 3DRTA 1TVDA 1NKOA 3GIZL 4KMLB 1IILE 2AKRB 1DL7H 3HS0B 4OM1H 4XC3H 1AGEB 4M1DH 2J6EA 5C6PB 4M1GH 1J8HE 3TCLA 4F37K 5D7JD 4XCEB 2VLJE 3LKPB 5FYKE 4UV4H 4YNYA 2FH6A 4HLJA 4OFKA 1QTYT 1ZLUK 4JCLA 4Q9RH 1U6AH 2E9JA 1SMOA 4LCWE 1F4WH 4TSCL 4MZ3A 4NZDA 3JVGC 5ETUB 1RZKL 3X3FL 6FABL 4MA8L 5ICYB 4NSKB 4Y4HB 3TNNB 1BVZA 1QBMH 5IG7B 3BDXA 4OF6A 2Z91B 2YD1A 4DCQA 5C7XH 2NYYD 3MV11 4EOWH 2ADIA 4BK4A 4PGCA 3TT3L 3U0WH 2ADIB 4ODTL 3KS0H 4ZNEA 4H8WH 3HRZA 2EEBA 1V7NL 4GBXD 1F90L 3BGMB 3ZYJA 2PN5A 3MRPB 4G6KL 1WITA 2G2RB 3T4AA 4DTGL 4HKZB 4J6RH 4ZUSA 1OPGH 5BMFH 5F6HJ 1HHGA 3IETA 4UILH 4PB9H 2Y7QB 4PJXB 4EIGB 3MV8A 1CFVH 1UJ3B 3KPOB 4QRQB 1CXFA 4YUEL 1CR9H 4ELMA 5JQ6H 4MDIA 4IMKA 3UTSD 4FFVD 5F9JA 5T1KB 1IM3B 1B4JL 4QXWA 2P24A 2P5ED 1BBDL 1T66D 5FA4A 2VE6B 3U0TA 4R90H 4WENB 5E2UL 4AIXA 3TBSB 4HLZH 1MOEA 5IR1B 3RWEB 3KYMB 3UZVB 4YQXH 1I7UB 4U6HB 2FX8L 1R0AH 3PV6B 4M93C 1AQKL 3KYOB 3FRUB 1UADC 2R0KL 1FIGL 5JPNA 5EUKA 3WNLA 5FHBH 3JXAA 2VXSH 5DD6B 1XZ0B 1OGAE 1NJ9A 2VAAA 1KCSH 1ZGLA 5GZND 2V9RA 2XNAB 3MMEA 3KXFD 1YNTB 2FNBA 5IM7A 4Q7DA 2ZUQC 3FT3A 1FNHA 3BVNA 2F58H 5D1XD 4H0HB 4LGPB 5I17A 1QFPA 3TJHD 3TWCH 3M1BA 4LLVB 5TE4H 4EUPG 2CPCA 4GQPH 3LKOB 4O51A 1AGBB 2DIJA 1SBSL 3HUJB 3KR3H 1KGCE 5ACZB 4PRDA 1Z0MA 5FYJE 1ZA6A 1A21A 4Q9CA 2GJ6B 5CJBA 1DBBH 1RFDH 5C6WH 1QYGL 4ETQB 3GGWA 4G6FB 3ES6B 4K2UH 5ISZE 1JPFA 1FLTX 1Z6JT 4JLRB 1VGEL 4NNYB 5B38A 4GUPA 5DQ9B 4ZOEA 2BHUA 2NY6C 4J8RB 3EYFA 4Y5XB 3D25A 3ZDYE 5I8OH 4FP8H 1I85C 1A3RH 1WV7T 4Y16A 1OL0A 1K5NA 2Q8BL 2BOBA 1CTNA 3H3PL 1NMCB 4MHHG 1JBJA 3Q2CA 2P47B 1I1AA 3GMMA 3MFFB 3KDMB 2MTPA 2EYTB 1ACYL 4RMRA 5HI5C 2APVA 1W0WA 5AYUH 4X6DE 4PJAE 1DBJH 5DFVD 2EH8H 1RJLA 4HF5L 2R2CA 4WV1C 1AD0B 5IROC 3OG4B 2A0LC 3VGHA 3BZEA 3FT2B 5L7XH 3IS0X 2W59A 1EFQA 5KOMC 4WU7B 4OV5A 3L1OH 3S34L 5EOTA 4CAGA 1KIQA 5EBLB 2Q76A 5GGVH 4DGYH 3NFPB 1NH6A 3VFVB 4X6BA 4XCFH 3WL9A 3D3VE 2NLJB 4MCZB 1K2DB 4MQXC 4G7VL 1IAOA 2NY2B 2W0FA 3HB3C 2VR5A 3VGDA 2NY5H 1V05A 1JHTA 3IDYC 1HH6B 1IL1B 3NTCH 1YMHA 5BV7B 2QR0B 4FHBD 2A73A 4LSDA 5D1ZB 4S11A 1Q72L 1KCRH 1TTUA 3LRSA 3EFFA 4QCIA 4DKEL 1MY5A 2X1QA 5D1QD 3MLVH 1J1PL 4W81A 3D39B 4PJHB 4BFIA 3C87A 1EHNA 1MCEA 1RIVL 3BIKA 4EUPB 5ID1A 2AEQL 3H9SE 2IGFL 4L5FL 2AABH 2B1HL 4NIKB 1IGYA 5F7WC 2VDRL 3JV4B 1MH5A 1BFVL 3U7WL 4X0KA 3SKMA 3NFNB 2P5EE 3QYCA 1X9QA 4JZJB 1TVBB 4PBVC 4YJZL 3MROB 5D70H 5L8KB 3ORJA 1U8OA 3B9KD 4CRPA 4MAUH 3LHPH 2X4OA 2NY0B 4BKLB 5J4MA 4ZO9A 2F54A 3JBG7 1PKQB 4HIEB 1DEDA 4JKPH 2APWA 4ZFZB 5IQ9B 4JHZA 4LAQH 4OIIH 4L4VD 1OP5H 1ZLSH 1FZOB 2ZSVB 3RVUC 2H9GA 1XF3A 3MODH 1RK0A 4L4VA 1BBJB 5F7FA 5CINH 1G7MA 4XBGB 4G6ML 5D2NB 5A2IH 3D18B 2BNQB 1RZFH 4I8DA 1BVKB 3VGAC 3EJYC 4GAJL 1FO0B 1CD0A 4N1HB 5IMOB 5A2KH 2XIDA 1KCKA 4QOKB 4TSBL 5EZIL 2G60L 4MXQD 4U6VH 1CGUA 2CUMA 2D3VA 4AG4H 1A0QH 4KTEH 4YZFF 1NAMA 2A77L 2NY6D 1M05B 1E4KA 5E8EA 5HSFA 2V6HA 1I85A 1MCDA 1S9WA 4WO4B 3OPZH 4S1SH 5D9SB 1QEWB 2CIKB 5T3XD 3U2SA 1YUHB 1WFNA 5C0NC 4OGYH 3O6MH 4JCMA 4WY7L 1Y0LA 4KZDH 4QOKA 4WV1A 3T77B 3TT3H 3ETBF 4M8QA 2F54E 5FGBC 5KVMC 1F6FB 1X44A 2XQBH 4QHUB 3LKQA 1MHHB 3QIWC 3MYJA 4FQQA 5A40E 3A67L 3U1SL 2VERN 4NC1C 1K6QH 5DDHA 3RNKA 5IJVB 4OJFL 1D6VH 1X3DA 1H8NA 5HVWA 2XTJE 4FFZL 2HLFC 3O11B 2FCBA 4G9DA 3S37H 3VXSB 1MVUA 4KV5F 2Y06H 3MGOA 2AEQH 2CO6B 2GT9A 3KPQA 1PAMA 1QFWI 5DR5H 3B6SB 2YXFA 4KKBC 4RNRA 5FYJD 4KQ3L 1JWMB 4PRPD 1JN6A 1FNEB 1C16B 4A6YL 1Q9KA 1GGUA 2BRRL 3MCLH 4B7LA 3FMGH 3KYAA 1B88A 4AM0B 4LLMA 3I2CH 5DUMH 5F7DB 1YJDC 3EUUA 5I2IB 4YHIB 1WICA 3OKDB 1XCQA 4CN4A 2BJML 1UCTA 1FRGH 4RGOH 3R4DA 1UM6L 3MRLA 5DFTA 4X6FA 3DI3B 1YY8B 3EFDL 2NMSA 2QADD 3RX8A 1MPAL 1WBZB 2MPAH 3R0NA 1BVLB 5D93B 1K2DA 2HLFD 5LGJA 3EYVB 3TBWA 3AROA 3GSUB 5KSBB 2VLRB 1J10A 4EN3A 4R4NC 3ZKMD 4UZGA 1A5FL 3QBTB 5K59E 2DL2A 5DSCB 1EVUA 3QRGL 4X4ZA 1QSEE 3O9WB 4I18A 1MI5E 2AI0H 1XFPA 1MLBA 3QIWD 4HEME 1DBAH 2ARWA 1IVLA 3LPGA 3N50A 3R1GL 4YXHL 5BW7C 1UA6L 2D4DA 2ORBH 2HFEA 4PG2A 2YK1L 4JKMA 4C56D 4BZ2H 4DFIA 5I66A 1SY6H 5JXEC 3DSFH 1KELL 2ENSA 1TJIL 1JZ8A 3VFWB 4U1SB 5F96H 1PG7L 1JNHA 4DKDC 1GGCH 3RX7A 1MAML 4WNQA 3PWVB 4FABL 1JWSB 5IVNA 1F11A 1PYWB 3ROOB 2HVKB 3HNSH 3GMNA 4AEIH 1RZKC 4GW4B 1YEJH 2I07A 1NCBL 1JTPA 3EGSB 2PYFB 1INDH 1G0XA 5ACZA 4YHIA 4KUZH 4N8CL 5JZ7C 1I1YB 3PQYE 1P6FA 5JHDA 3N06B 3O0RL 1HIML 5E7BA 5BVPL 1FPTL 5IESL 5HI4C 5HYQB 1K4DA 4HJ0C 1U9KA 3KXFE 4NKDA 4WJ5B 1S7XA 3SDXE 32C2B 4G8IA 4XNQB 4H26A 1MSPA 1OT2A 2K9UA 4HWZA 4KTDH 5GGTA 3S9DB 1JIBA 1S3KH 5ALBH 5L88H 5IFJB 2IADB 1ROWA 2DD8H 5LWYL 5JQ6L 3SDDD 1MVUB 4ZFZA 5L2KB 1DEEB 1U3YA 1WTGT 2GITA 5FGCE 1BGXH 1JNJA 4J2XA 1DQQB 1VFOA 4JFFD 4QF1A 1MUJB 4OZHF 4OCMC 5B39A 4XMPH 1FBIL 1CXIA 4NKIL 5K9JL 3QHZH 4FQIL 1EAJA 1S5HA 1INEL 4NCC2 3GSNB 4GKSA 4OB5L 3O4LE 5C07B 4DGIH 3V6OA 1FV1A 1G7IA 4PRPA 1N0XL 2WZPD 5I1KL 3KAAA 5BQ7B 1JGEB 1ADQH 3LV3B 1R5WB 3PIQA 1UM5H 3VWJC 5IVZA 4WFGE 1S9XB 2APXA 4GMTH 4QLRA 4UOW0 3BPCA 4CJ0A 3RWGA 3ULSB 3MRJA 1BD2B 1CE1L 3LMJH 3EO9L 3MRFA 4MCZA 1ZS8A 3TJEL 5A16A 2VZUA 2UWEF 4KZDL 4X98A 3SEPA 4CDHA 1KIQB 3ZKNC 1FG2B 5AZ2L 1R3LA 5E99L 1GGBH 3DUUA 4FXKB 1X5JA 2IANB 1OWRM 4TVPL 3QPXH 1NFIA 3ARBD 2IBGA 3MLXL 1NBVH 1MI5D 2C1OB 1FE8H 3TO4C 2VWEE 3BD3A 1X5ZA 1QD0A 1F3JA 3HE7B 4JO1H 3QFJA 3MV8D 1DL7L 2EDYA 5IMKB 1TMCB 2Q86B 2CR6A 1N6UA 1LWRA 3V0AC 2HMIC 4HGWB 3QSKB 3T0EE 5D6DA 3UPRA 2HVJB 2F53A 1I4FA 4HCRH 2XN9D 2WQ8A 1WT5C 5ESVB 5DJDA 5ACMA 3ARFC 5HBBA 3RPIA 1KPRA 5B21A 5T5FL 3CFBB 4Q6IC 5GS1A 3D0LA 1J0ZA 4JKKA 1WSST 3QQ3B 1OAKH 4C56A 2UZYB 3W11C 5BVPH 5IESH 3QG7H 1S7TA 5DQ9A 1CFNA 1TZGL 5HDBE 1UG9A 1YNLH 1VKXA 2R39A 1JL8A 2DM2A 3BWAB 4HIJA 4JPKL 1TZGH 1EUUA 1H8OA 2ZJSL 4G6MH 4HKXA 3BPNB 3QISA 4OF3A 3LKOA 4O51B 3EJYD 3PABB 4EQ3A 3IDXL 2QQKH 4NPYB 4YHLH 5I9QB 2BJMH 1MFBH 3VG0L 4LSPH 1VKXB 5EIIB 1S9KC 3DV4B 4OLVH 3VGFA 4HX1B 4POZD 4YHPA 5JIKA 4F57L 1AQDA 1UXSB 1HXYA 3FTGB 2X2YA 3SJVB 4Q9RL 2A1WL 1U8PA 5C0FB 3G6JF 1BFVH 4G42A 3HR6A 4FG6C 1AI1H 3R1GH 3T1WA 2AJXL 1WZ1L 3DX9A 3BISA 3JV0A 3GIVA 4W70A 3BPLB 1IAOB 2EDRA 2NLJA 1TJGH 2R0ZH 1I1FA 4LIQH 5KSBF 2XXMB 2Q86A 3G04A 5T1KA 5D7LA 3IYLW 4ELMB 3O41A 3QIBC 3ARDD 4FFVC 2DMCA 2X4TB 5C2BL 1R3KB 3D3VD 2WQRA 4U1NB 3RGVA 2DYPD 1VFMA 2ZPKH 3ZYOA 5CUSL 4HIIA 5I1GL 4LASH 2VXTL 1C12B 1RZKH 3UAJD 4AZ8A 3BGMA 3TZVA 5BS0B 5L8LB 3NA9H 3FAXA 1CYGA 1IC7H 3VDAA 1QFWM 2V17H 4M5YH 5E2WH 4OD2B 4ALAL 1T83A 3ARRA 4DCQB 4HMEA 2A6DB 2XTJC 1JZ7A 3P4MA 1CFQA 1IJ9A 1K5NB 4D94A 1A6WL 3O45B 2YPLD 3EYQC 3TNNA 4FN0A 1L6XA 1VFAB 4NSKA 5J89A 1ACYH 3S5LB 2DM4A 2AS5M 4ZDHA 5FUZH 5IB3A 1GZQA 3DJ9A 3CFJA 5DD3L 1NGXB 4OUUB 2Y07H 3MXWL 2AJXH 2VTFA 2YUXA 5FECB 4N0UB 2CMRH 1VHPA 2CUHA 2ZNXA 3BVNB 2BVPA 5HHOD 2XWBA 1J0JA 4LSSH 2D2OA 4FXLA 1S7VB 3FQRB 3NZ8A 1B0GB 2LQRA 5KS9A 5DVNA 2OYPA 4U3XA 4LLUB 1RIHH 1YYLL 3U0PB 5TDOB 3PG2A 3D6GA 3WFDL 4G80B 2I9LA 3EDFA 2I24N 1KB5A 4AIZB 4YXKL 5JXAH 1RZFL 2XICA 4HT1L 2X9XA 3VD7A 1A7RL 3E2HB 3ZLQC 4FTVD 3QEHA 1K4DB 4OZIF 2H45A 4L8CB 3O6KL 1XGYL 1A7RH 4RGNE 4OZFH 1UH4A 2JK5B 3KPRB 2PXYC 2HFFB 4JY6B 3WIHA 5SWZA 2YD6A 1EHXA 4JZNB 3ARBC 3BPOB 1VB9A 1DZBA 1CWVA 1TZHB 3EGSA 5IP4A 3B8SA 5TJWK 1H3VA 3S5LA 1NFIB 3HC0A 1DVFA 3DV6A 4FQ2L 4QHKJ 1Z0NA 4FZEL 4JREB 5C0BD 4LCCA 4CU8A 2LU3A 2VLMD 3IDIA 1BOYA 5T3XE 2FSEA 2W91A 5DD3H 1MJ7H 2X4NB 3JWOH 1IKNC 4A6YA 1U8NA 3F8UB 4M7ZC 3QEGL 2CRIA 1FL5A 2VDQL 2Z8SA 3DX7A 4CDGC 2XWJB 4PJ9A 3T4YB 2ZUQB 4K7PX 1R5WA 2X9WA 2UY7A 1KSRA 5BQ7A 1IKFH 2GAZA 3V2AR 5C0GB 5GISH 5MEPA 4FXGB 5F7EH 3QUYC 4PUBH 3GHEL 4ALAH 4E5XB 1FJ1B 1MLCA 1KB9J 2UWEA 1J11A 1MCPH 2GJZA 1RJZB 3AXLB 4UU9A 5J12C 5FOJA 4GMTL 3ARDA 1NBYA 1JWUA 1HHIA 5D5ME 1NBZA 5IB4B 1EGJH 2VKXA 1WC7B 1WBZA 4H1LH 5I1DB 4UT9H 4P3WA 5C3LD 3T04D 1R24A 4HG4J 5ICXA 4RMTA 1ZLWK 1JZ2A 4N0CD 2ICES 1HHKB 1PZUB 5FM5O 4ONGH 4J4PA 1CBVH 3W81A 3P11H 4YPGA 1S7XB 1ZK9A 1A3RL 5ID0B 5D7JC 3LN4B 4AYFA 1N3NB 1QHOA 1RVFL 1KCRL 1LDSA 5F7NC 3HR5B 3G5YA 3L3DA 1OVZA 1MWAA 3EHBD 3L5XH 4IRJB 2GT9B 3LS5L 2Z8VC 2DM3A 2IH3A 1MRFH 1S8DA 2NNAB 3MRHA 3B3IB 5JLZB 3MRRB 4GRLC 3SDCD 1ZT4B 1OQXA 1JI1A 2AXFA 1OTTC 4YWGL 4NBYB 2BCKB 2ITCA 4Q6YA 2GTZB 4GG6B 3CFBA 4QEGA 1ONQB 1SYSB 1JYVA 5F9DC 1ZT7B 1UC6A 3REWA 3U36B 4APQB 1G9NC 4X4ME 2VLKA 1ZGLM 5C0JA 4O2CB 2X4PB 5DQDH 1DUZA 4LMQI 4HGWA 3G6JA 4UBDC 4IM8A 5GRWA 1G1CA 1IGJA 3RY6A 5TQ2H 5GGTL 1L4IA 1FCGA 2JJUA 5I19H 2FJHB 5FF6A 1UACL 2AXJA 4C56E 4H88L 4Z7VE 3CLFL 4QRRA 1EEUA 3DUUB 2CIKA 3NA4A 1MCWM 4AG4L 4BZ2L 4Z7WA 4JZOB 1HHJA 2OXGA 3MLSH 5E08L 3BQUB 3T0EA 3WKML 1A02N 1BD2A 4LU5H 1DQDL 4FQCH 4GFTB 1QA9B 4OZGE 3WXWL 1JVKA 3BPCB 2B8OT 4R97B 1FVEB 4TVSa 5GHWH 4NGHL 4J12A 4JQIL 3VFNA 5T1LD 4XH2B 1BAFL 1NANH 3ILPB 4M8VA 3TM6A 2E27H 2FD6H 2NX5B 3WD5H 2R29L 3ARVA 4JFOB 1YPZE 2YD5A 1J0IA 4NFDA 4HK3J 4N0YH 5D2NC 5C07A 4DAGL 3VXMB 2CKBH 4UOJA 1XGRB 4ODSL 4Y19B 2FH8A 5HYEA 5E8PA 4OZ4B 5I71C 5ADPL 4Z7NF 1NKRA 3DPBA 4JRYE 5B39B 4XAWL 3C5ZC 1EXUB 5EO9B 5C1MB 1JYXA 3IFOA 5KVEH 1M7IA 7FABL 3BH8B 4NFBA 1DQJA 1E4KC 5CIPA 2DIBA 4D8PB 5JOFA 4MVBC 3V4VL 1SYVA 5SWSD 3GHBH 5EULV 2EKSB 3X13A 4PGZA 3VE0B 3V5DA 2VZ3A 1RIVH 4HJJL 1JI2A 3AAZA 2P5WE 4MZ2A 3MROA 2VITA 3UBXB 4K3DH 3SGEH 3SKOA 3DX8A 1KTLB 1WVZA 1MCNA 1YN7A 1JTTA 4KPHL 1S9VA 1QFWL 2KPNA 3QWOB 5DJ0B 2ICWJ 4JM2F 5FM5M 5GGUA 1WQVT 5DJZB 2QADC 1ZEAH 1OAXH 1B9ZA 5FYLD 4Y2DB 2IMNA 2HFGL 3MV9B 4P9HC 1A7QH 4UQ3B 3UPAA 3VXRB 3OKLA 3TYFB 1JZ3A 4WTZA 1T0NB 1TCMA 2DTML 3WXVL 5E4IA 2E7HA 1PGRB 3PWUA 4WWKC 2OMNA 2PETA 2ZCKH 2FEDD 1R5IA 3FJTA 3RNQA 4HJ0D 4JFPB 2Z31A 2E7LC 3NFPA 3RL1A 1N59A 1INDL 2VZTA 5CEZL 3OXRA 1KTKE 4RISH 3W5NA 4KKBD 4F9PC 1GC1L 3EDKA 1AY1H 3DO7B 4B53A 4Y8DC 5IEKB 1F8TH 4NZUL 4BUGA 4LCWD 4M1DL 4IRSD 1AI1L 4QTIL 3KNBB 1TJIH 2W9EL 3TYGH 3ULVE 3ARXA 1NC2A 3F58H 1UWEL 5IBLC 4N0UE 2C3XA 4HXBL 4ZAKD 3BHBB 3U9UA 2DJ4A 4OT1H 2PO6D 2GTZA 3CLFH 1T21A 4KJYB 1ADQL 2DLIA 3LH2L 3UYOD 3RUGB 3WLBA 2ZSVA 4KJWC 5GZNC 3K8LA 4ACPA 4WWKA 4I3RL 1V7MH 1T0NA 3MRRA 4ETQA 2J8UB 4G9FE 5CEXB 1U8KB 3QHZL 3HPLB 4P2RA 4LLDA 5F7MC 3G5XB 5E56A 3O6ML 4XCNB 4L9LB 3ZL4H 1NCWL 2X40A 5JR1H 4U1JB 5CWSB 3QAZB 4JDZB 3T8XA 4RWHA 3O4OB 1LE9B 2EDKA 4JPVL 1LO5A 2PW1B 4PJ7A 4ZUWA 1RUAH 3UTOA 2HTLC 4R2GC 4ODWB 4GXUN 1UM6H 1JV5B 1EJOH 1MIEH 4HJJH 1PBYA 3ZMRA 1AO7E 1ZHKA 4JZJC 5F72S 2DD8L 2HWZL 3AFLA 1XGPA 2J88L 1D9KA 5TFSH 3B6SA 1CD1A 4GJTB 4S0SD 5FEBA 3U30B 4MXQC 3WUWG 5ITBH 4FZEH 3ZE0F 1UWEH 3VRJB 1H5BA 1MCRA 5EZIH 3LB6D 5TQ2L 1SYVB 2Q87A 3AREC 1HH6A 2ICWA 2W9EH 3TYGL 4TULH 4GQ9L 1WC7A 4U6XA 2QQNH 4FFYL 3WL9B 1EMTL 4P2OB 1C8PA 3DROB 2CKNA 1DTUA 3T09A 4IHOA 3HZVA 3WD5L 3K74B 1BM3L 5DC9B 2JIXA 3T2NL 4I3RH 3HC3H 4HKBB 3PGCA 2JJSC 3BAEH 1AKJA 3K8MA 3VGBA 2KDGA 4AEEA 2J3SA 1A1OB 5HYSA 5CZKA 2BHZA 5E6ID 7CGTA 3CDGB 2W65B 3G6AA 1AKJD 3MRBA 1WAAA 4XP6L 2PCPB 3QIWA 5AUMB 4KGLA 1JGVL 2VDKL 3C9NA 1JFQL 3MRGA 5FUCC 3ARZA 2CJUH 1K4CA 3UTTE 1MY7A 4MJ5A 1MCPL 5BS0E 2E5EA 3SGJA 2CGRH 3WIHL 4ZUUB 1GAFH 2DAVA 4Y1AD 3T3MF 5I15L 1J8HB 1QNZH 3BKJH 5DJ2A 4X7SH 2CLRA 3CUPA 1A5FH 4U33A 1PKOA 1DQTA 3WJLA 5LCVH 4Y4KC 3PGDA 3VA2C 1AGDB 3D2UD 3L5IA 5ISZD 1NGZB 3VFRB 1AJ7L 2VLLA 1MQ8A 3GK8H 3QUZB 4LVNB 1Q0XL 1A8JH 2XNAA 3MMEB 1EUTA 4GRWE 1YQVL 2X1XR 3MV7D 2ED9A 4CVZB 4WFHD 4KDWA 2DKSA 4M7ZB 4F7TA 2BMKB 2AQ2A 3O8XB 5KG9B 2YMXL 4H5SA 3ZE0E 4BQ6A 4ZFOL 3PL6D 1QLEL 3HCVB 3ARWA 2HKHH 5ANMB 5FYJU 5KBNC 2R8SH 2CDEA 1LP9F 1UZ6F 2W0LA 1OTSD 4M7JH 2NZ9D 5AYUL 4OIAA 1YMMB 2AJ3B 5L9DL 2JKXA 3VFMB 3L7EB 1EH9A 1N6QH 5FK9B 3IVKA 3WSQL 2HT2D 1T04B 3O6FA 5D71L 1HKLH 4NOFA 4WHCA 3FB5B 8FABB 5JZ7D 1T1YB 5HD8C 4J4PD 4HK0B 1F13A 4KMTL 5DF0A 4BELD 5D70L 3UO1H 1YQ2A 3MXVL 35C8H 2YK1H 4OKVB 3OMZA 4JM2A 3SOBH 1UQSB 4L8DB 4MD0A 3T2OA 1D5BA 3MJ7B 4PJ5E 5HYJD 1B4JH 5MEOB 1MFCL 2QSCH 2C26A 3TJHC 4WI7A 4YHNB 3BZFB 1I3RB 1IT9H 1YECL 3EOAB 4YUEH 1MIMH 4MS8D 2X10A 4OCWH 2WLZA 3L3OB 3MLVL 2E7CA 1MWAL 2HN7A 5LAXA 4U0QB 1ZWIB 3N1FC 3WJJC 5LVEA 2GJZB 1YN6B 4PTUB 1A14H 4WU7A 2HRPH 1MHEA 5F1KC 5JTWA 5ICZA 4MA1B 3VJ6A 5HVHB 1DANT 1IC7L 4EOWL 1EFXD 4JFDB 3JWNC 3FFCE 4OQTA 3NOIA 4OZGA 2EIZA 1A22B 2DQIH 5IMLB 1J5OL 25C8H 4XPBH 1BZ9B 4JPIA 4BH8B 2Y07L 3MXWH 1G7JB 5ILTL 4XVJL 4X4XB 4C55A 1NFDA 3WN5C 4G5ZH 1CICC 5F7YC 4YHPB 2NY2C 5CMAA 4UV7L 1ZVSA 3C6SB 4MWFB 4YHKH 3H3PH 3RU8L 3FB6B 3UDWC 1LO2H 3SDAA 4OIBA 2VLKE 4JVUA 4LEXH 2EIEA 4ZYKA 4OIIL 5HHVL 2APTA 2LE9A 4YXKH 5TDNB 2VXTH 4D0CB 1GOFA 3OXSB 1IC5H 4JG1L 5ISZA 3QDMB 3OHXA 3PWPD 4G8GD 4XGZB 3X3FH 6FABH 3TN0B 3VMPA 5E2JA 1O7VA 3FOLA 2FJFA 2H2PC 3F7RA 3HC3L 4PBXA 5SWZD 4YBHA 4M61A 4PJBA 2ZNWA 5F7EL 1WLHA 4P2OA 5ERWA 1JGUL 3OWEA 1AO7D 2BNRB 4I0PB 1SVCP 5KSAA 4RA0C 4R4BB 4W4OC 3D2UB 1DBKH 2FWOB 4NQVB 1I9JH 4N5EC 4TULL 4PJ7E 3CGTA 5DK0A 4M5ZL 1TJHH 4HGMA 4TYUA 3UYRL 2XN9E 1F4XH 4GKOA 3KPRE 5D72H 5DURD 2P8PB 1ZLVH 2BXZA 5CD5D 1X5GA 5EUOA 4L4TB 4HCRA 3P4OA 4P5KA 5B4MC 2C7UB 4LSVH 1K4CB 3CSPA 4MNQE 1JV5A 4KI5D 5C0BA 2D31B 4NO3A 4P3CH 4S1DD 3MBEA 3BKYL 4JANA 5AZEL 2OZ4L 1S9XA 4LKCB 4BSVB 2HJLA 4NN7B 2OJEB 5I16B 2Y5TB 4JDZA 3WNPA 2Z8WC 4YFEA 3OF6A 4L9LA 1AKJB 4JO3H 1CFSA 4RQQA 2PUQT 5DK2B 4GKNA 5E6IB 2F54D 4D9QD 5IB1B 4FQXC 4HUUA 3K7UA 3CU1A 2R29H 2HKFL 4PTUA 3FFCB 1F97A 2FIKB 5E8OA 4LP5A 2VISB 3BXNA 5I1AB 3QUKA 3IDMB 1XGQA 5CZVH 2A6IB 5FGRA 2DQTH 3WFDH 5HDLA 5J13C 2DLHA 4Y0GA 2UVEA 2E6JA 4LCCC 1VGEH 1TQBC 1CXEA 1GL4B 4MB5A 5GSRB 3DLQR 2GY7B 3NCJH 4JAMA 3VFTA 2C1PA 4X5XB 3UPCA 2AKRA 2VSCA 5GJSL 2NY7H 4QY8B 1NBVL 5FYLH 2AQ1A 4NKIH 3Q6GH 4PRHA 5K9JH 1OAZH 1VFUA 1F4XL 3AC0A 2AI0L 1N7MH 2HAZA 3DO7A 1DN0A 1T1XB 5D8JH 3BRFA 4WFGD 3VXSE 3MJ8A 4ZUVA 1QRNB 1E6JL 1XCTA 2PO6A 4LLQA 4H20L 4YC2C 5B38G 4BZ1L 2HLAB 1KPVB 4Y4HC 5I76B 1HHHB 4FQJH 3EO1A 1HQRB 1H0DA 3MTRA 2H3NB 3CC5B 2H6PB 3F6IA 5CEXA 3QIBD 4G43A 3HCVA 1NMAL 1QO3B 1NLBH 4UQ2B 4PJCB 1Y6NR 3GDBA 5I18H 1RJYB 4YGAB 1FFPA 1KLUB 1EVTC 5C92A 1OAYL 3MLUH 3S88H 3WHXA 2ZPKL 3DSNA 4ODHH 2HT3C 3TESA 3C6LD 4JFZL 4OAWB 2PTUA 2H26B 1P1ZB 4GAGL 4OZIE 2PO6B 2XTLA 1OF2A 5GIRB 2VYRE 4D9RE 4XXCA 3EKCA 1YEJL 1DBKL 3IFNL 3L3IA 4XWOD 2FECL 4MAYA 1CDHA 4XTRC 4NUGL 1IGFL 3ZO0A 4LCUA 4YHKL 5D7JA 3VE0A 3HE6C 1CG9A 1RZIA 1IM9B 2PF6A 1JHKL 3RIAK 3O2DH 3KVQA 4D8PA 2A1WH 1LEGB 4FXKA 4AY0A 4MXVF 1S78D 2FLBT 3BKMH 4XPFL 5GRUL 5FA3A 2Y23A 3SN6N 5C09A 2YPVL 1FNGB 2H32A 4I0KA 4RFEB 1NLDL 4LVHB 3HG1D 1L7IH 2YA0A 3W11D 1U8QB 3VD4A 2E6QA 4M6AA 5F89A 5KN5A 5KOVC 1U6AL 4Z18A 1JCKA 3IJSA 1BM3H 2IALA 1FGVH 4HKBA 1X6LA 4Y2DD 3S36X 4OZFA 4LVHC 2JLLA 4J3UA 5CJQL 5INCA 3SE9H 5BZDA 1QA9A 3SKOB 1FORH 4U05A 1PVHA 4LCIL 2EXWD 4KKLC 4FFWD 1DQQA 4RNRB 4ZSOE 4X6CE 4LSVL 4R3SA 4X9HA 2J7LA 4YO0A 1KFAL 1QSFB 3SCMC 5E2TL 1C1EH 2R4RL 3RZCD 4N0FA 5IF0B 1OGAB 3WUWA 1RZGB 1IAII 1JK8B 4TUKH 3UTPD 4WGVB 3FO9B 5CGTA 3C60D 1IGML 4KMTH 4NWTH 4Z7OE 2F5BH 5DLMH 1I1AC 1U8JB 3CK0L 4UILL 4Z5RA 3FHAA 3PXJA 1G1YA 4V2CB 3BKCL 1CDYA 1ZT1B 2BOCA 3OTTA 2H2SC 1I1YA 1V8HA 2CQVA 1UWXK 3TN0A 3QULA 4OF0A 2IALB 2V5TA 1P6AB 4DOHE 4M7LT 4PR5A 1U8KA 2WIIA 2KBGA 4ZFOA 3JTSB 3T0AA 3IKKA 2IH3B 3DGGA 1KLFA 3CD4A 1UXWB 4MA8H 4MQTB 4WNQB 3SCMD 4GO6B 3CSGA 3B5TA 3QFJD 3VGEA 3RWDA 1R3JB 5ESQA 5L2KE 1QRNA 1XCTB 4MWFA 2DQTL 5HDBF 3HI6H 4EXPX 2W9LA 3IJYB 1Z9OA 4P2QD 2AJSH 4PRHB 5CJXC 3C8KA 5FB8B 3D5OF 1NGQL 1G7QB 4LKXA 5L2JA 3IFNH 1OW0C 4GQ9H 1BGXL 2Z0BA 2DS4A 4OCYH 3V8OA 1YEIH 4OD3L 1J1XH 1XF4B 5LWYH 1QSZA 5KSBE 2IAMC 4QHLA 5ITBL 5T3ZD 4XBGA 4GAYB 2A6IA 1Q9WA 3RAJL 4YHMH 2WMPA 4EXKA 3C6LB 1J0YA 3TPKA 1YQVH 4JN2B 4KK6D 5F70A 1YEKH 2FEEI 4U49A 3QQ4A 4LBEA 1OTSC 2NNAA 3O4LD 2PXYD 3GHEH 1EERB 4NHCL 5LAXB 1WF5A 1AXTL 1A1MB 3HR5A 4IRJD 2J1KA 3QFDA 1CS6A 1N6VA 3ARFB 4X0KB 1M71A 3O6FC 5HHPA 1FL5B 1Q9KB 1J1OH 1MH5B 4JFQA 1P7HL 1H15A 2CDGB 4JFYB 1X7QB 1QRND 5CZXC 4HFWB 1VESA 4GSDH 5CP3A 2W60A 3FQXB 3PGFH 1PG7X 4M48H 1R3HB 1RV6X 2BXYA 4TSBH 5JIIA 3VXQB 3DHMA 1UA6H 1RZJL 1MQKH 4NM4H 4I2XE 4LSPL 2PR4H 3VFMA 3R06B 3RNKB 4JRWA 4JKWA 5E00A 4P4KA 5C0AD 1CK0H 4NZUH 4NP4H 4KDVA 1VA9A 2K7PA 4M02A 1I8MB 3VXUE 5C70A 1NFKA 3MRNA 4X5LA 1T20B 3FFCA 2PYED 5LXGL 4MXWL 4I9WD 2DQUH 4QWWC 3OSKA 4KRPC 1IZJA 3BGFC 2VUOA 5GSVA 5E5MA 1I9EA 1KB5B 3QZWG 3RRQA 4WW2B 3OL2A 4HGKC 3GMOB 3SDXF 4PJDE 3FN9A 3RWIA 3QDJB 4OGXL 3OXSA 3QDGA 3LD8B 2NQCA 4YR6A 5C0CB 5ENWA 3GBML 1FRGL 4LLAA 4NZJA 3HPJB 1JF5A 4N8VB 4PGBB 3VFOA 1T7ZA 3P4OB 1WWWX 3I3DA 3RHWF 5H37G 2VR4A 1N64H 4GG6F 3ZT5A 1KCVH 3EYFB 3IDJB 4LSTL 4H25A 1OARH 1QP1A 3MCLL 4Y8AA 1WEJH 2MWCA 2Y25A 3GSWA 2FJHA 5FF6B 2MFNA 2HFTA 3ARED 1U3JA 4NRXA 3FB8B 1QQDB 3RJQB 1IQWL 1Q72H 3LKSB 1IQDA 3FT4A 5K93A 3SDAC 1O5DT 3IDNB 5M95B 2EEDA 1A6WH 4HSQA 4AMKL 2JJVA 4XPHL 3KPRD 4PRID 4B0MM 4PYGA 4APQA 1BQHA 4P5TC 3HZYA 4LFHD 4E9LA 4QKXB 4RMUA 2DQFA 4JFDA 4FRWA 1BQLL 4KI5C 4R8WL 4XP6H 1EK3A 4G80A 3OHXB 4NQCD 3K4DA 3QXTA 5DUML 4KROC 4KZEL 4FTVE 5K59F 3PWPB 4WI5A 4E41A 3P9LA 4ESKA 1S8DB 3LEXB 4P4RB 3SPVB 4ZYKB 4Y5YB 5IHUL 3VI3F 3Q3GB 1U8OB 1MF2L 4JHWL 4LSRL 3WE6B 3MGTA 4LCYA 1NGQH 4QRPB 4RMWA 1JZ4A 4WHTA 2P24B 1A7PL 1TCRA 3EOAA 4DKFH 4WGWB 4YHNA 3VFGH 3DX9B 2F8VA 2FYYB 4ZDHB 1A7PH 1GYAA 4XNZB 2QKIA 1CQKA 5I8OL 1C7SA 2F5BL 3LPWA 5E08H 4KK8C 2MCPH 4K2UL 5MI0B 2ZZUT 1YC7A 3ARFD 3CFEA 3WO4C 1CLOH 1NCAH 4DEPC 3BYTA 4QCIB 1ZHKB 5EIIA 1T7VA 5J0BA 5IW6A 1BBDH 1QLRA 5J06A 1KFAH 1KT2B 4GG8B 1A0QL 4KTEL 3RWJA 2NW3B 5GPRA 4E41E 4U1MB 4X9BA 4XMLH 2A9NL 4HBCH 3WNKA 3ULUL 5I8KL 3WKNA 5CILL 3I75B 4H8WC 4NNPL 4AQ1B 1S7RA 4BJLA 4DKAA 2VSDA 5JMOC 1HEZA 2XWTA 4P4KC 2FGWH 4QRPA 4ODXA 1Q0XH 3QHFL 3VJ6B 1EFXB 2VC2L 4MA3A 4UINH 2R2EB 2Q20A 5GRJH 1XR8B 4OZHA 4LF3A 2DYPB 4WI2A 3ZT7A 4Z76B 4NT6A 12E8L 5D7LB 1DUYB 4XP1L 3TBVB 5JDJA 3ET9F 5LXGH 5CJ5A 1WBXA 3VW3H 4Z77B 5C08D 5IBTH 5DJAB 5DRZB 4DUWA 3JWDC 3RPIB 2YWZA 3BZFA 1RIUH 1XF4A 3HI5H 5DTFA 3H0TB 4P2QB 4TUOB 1EGJA 1CFTB 1PEZA 1CLOL 1RULL 1NSNH 4TNWK 1QYGH 4HS3A 4WUUE 3ZKQD 2P44B 4J8RA 4XHJC 4Y5XA 1A4JA 5BXFA 1OY3B 3MSPA 5J11C 3QFJB 1S7QA 3CH8A 2VOTA 1V3JA 3VXOA 3O2VL 3TIEB 3H7BB 5FUOL 1CCZA 1R3JA 5ESQB 1UM4H 2B2XL 1V7NH 4MA1C 1YEGL 5BO1H 3NABH 5GRXG 1J9CT 5DZNA 5J1AA 1V5JA 4XVTL 4MXWH 3O3UN 5MEQB 3O4LA 2O61A 1KIRB 3ECBA 3ZKXB 2GSIA 1A9BA 4D9RD 4JO3L 2V9TA 3R0MA 3UJJL 5IW6B 4OLYL 4H5SB 1ZGLB 4CVXA 3LHPL 3S88L 3GMOA 1MQKL 1ES0B 3PL6B 5EBMB 3UTQA 4ZSOB 3BZ4B 3GJFH 2BNUB 3MUGB 3QEQE 3OR6A 2EE2A 4GKZB 5KTEH 1A7BA 3FRUA 3U0PA 3OKKA 5J1SC 3GSOA 3OG6B 4BQBA 2J88H 4GW5A 4X7DC 1KJ2L 1OGAD 1B3JA 4KQ4L 5DWUL 5I19L 2CRMA 1DBMH 2X89A 5EWIH 4N0UA 3NPSB 1VFBA 2FZ3A 3BRGC 4U1LA 4ZTPL 3O3EB 5DRXA 1FIEA 3LKNB 3QCTH 2BHYA 3U4BH 4DKEH 3UTSA 1U3HD 3GSXA 2LAGB 4ZNEE 1QHPA 5GRVL 3MV8B 5DMKA 1OTUD 5I15H 4YO0B 2IADA 3ARBB 3ESUF 4D3CH 2D9CA 3NPSC 2VDPL 4XMKH 3WFEH 4ZOAA 2NCMA 2X4SB 1A6ZA 3NCYP 3S8WA 1OGTB 2CDGA 4WJ5A 5H2BA 3MRJB 1BQHB 4Q0XH 4XVUC 4ODWA 3RX5A 3Q48A 3ZHKA 3P4NB 4YHML 3H3BC 2NY3D 3I50L 1BOGB 2EDJA 4R4FL 1U8IB 3RUGE 1FFNA 1A1MA 3ISWA 3GSNH 2CKBL 1U8LB 4I5BA 5FYKL 4LLDB 3DUHA 4U1NA 3RGVB 1QSEB 4M1CC 2I07B 4JG0H 3VWJB 4L1DA 3M8OH 4OQ1A 5E03A 3QG6B 4PUBL 4MD5A 2OMBA 1DE4A 3HKFA 4JN2A 2DICA 1T0PB 3BWUC 3QQ9C 1KXQE 1CLZH 1U3HC 1G6RB 5EN2A 1TLKA 1T21B 3K80A 4I77H 4KJYA 4DW2H 1HH9A 1MI5A 2ICEA 1N5YL 4NO0D 4PBWD 2IH1B 3L3KB 4QTHA 3QQNA 1QFHA 2CLVA 2MJWA 1U8PB 4BSWA 3QDJA 3BD5A 2QJDA 4XPBL 5L2KD 2VLJD 5E6IC 4Y5XC 1P9MC 3CVHB 3AB0B 5SWQB 2F9BT 1RZ8B 4QHMA 3DV4A 3V4PL 2DBLL 3T0BA 4YHLL 1KXVC 4O2CA 1H3UA 3F12B 5T33H 1JP5A 2VLKB 3GJEA 1FGNL 3TPUB 2PW1A 4PJ7B 4PY8I 4ZUWB 1OAXL 2Y4SA 1A2YA 3HI1A 3CFCH 2H26A 3MLTA 3ZDZF 4JRYA 3RBSA 5EZLB 1XH3A 4UNVA 3ZL4L 3L9RB 3RNQB 1BVLA 5FV1L 3MUY1 2R1YA 4QNPF 2GK0A 4K3DL 4ZQKB 1RMFL 3VXNA 4K9EC 2ADGA 4P3CL 1T89C 4JN1H 2H6PA 1IEAA 4IRJA 2W60B 3STZA 2Z93A 3QXAB 3FZUC 1XF1A 1FVCB 3FQWA 3EJJX 1B4RA 3H42L 4R0LC 1FLRL 4QYOB 4F7MA 2AXGA 5GGQH 2NXYD 3W39B 1XIWA 3ARFA 1EZVX 1RU9L 2QV2A 5T3ZH 3QNXA 2CMRL 3BMWA 3DMMC 5JIPA 1I1AD 4ZAKA 3FOMA 4Z7VA 4BSJA 5IMMA 5CHNB 4I18B 1KNOB 1A1NB 5FCUL 2BFVL 2OL3B 5EUOF 5BVJA 5DC0A 3B9EA 4EUPH 5A3ID 4MAYD 3O9WD 4FNLL 5IROA 1P53A 1R3LB 2GYSA 3NN8B 2I9TB 3QEQA 1JPTL 2OP4L 5E94B 3ZT6A 5DMIL 3NIFF 5IQ7L 2BSTB 3EYVA 3BPNC 3EZJB 1QSED 3RGVD 3T0VA 2FO4A 3I6LE 4NUJB 5TQ0L 1NDGB 1OAQL 4WI6A 5E8PB 1SJEB 4JQXC 2Y5EA 3TLRA 1A9EA 3EYOB 5ELIA 4QHUA 1J86A 5JW4Q 3UJIL 2QADB 4YDKL 4RRPA 4POYA 4GOSA 4TN9A 1CICB 3HAEH 4XNXL 4X6EB 2GSGB 3S36H 1LILA 2Y5TA 5IWLC 4XXCC 4JDTL 1J18A 4Z7OF 4RWYL 2V7HB 3QCTL 1OGTA 4G8FA 1IGMH 3OKNA 4Y88A 1FVCA 5EUOB 1IAIL 4YBQC 1BWWA 2JB6B 3DGGB 4WTWA 3ARSA 4MJ6A 1MFCH 1XR9B 4JB9L 4QRRB 4XBPA 1VEPA 1UB5A 4X6CF 1MCOH 4N9OB 5I0DA 4HPOL 4PJEE 2FWOA 4NQVA 1TZHA 4ZFGH 3VXSD 1JNNH 2ZG3A 4QWWD 2AK1L 4NC0B 1HINL 1T80A 2D9QB 2NR6C 4NO2A 1E6OH 1MEXL 4Q6IA 2BOCB 5GS1C 1RZ7H 4G6AD 2CXGA 3RKDD 3KPSA 5GRVK 3W39A 1L6ZA 5D5MA 2XTJD 3F12A 3LKQB 1I7RA 3GJFK 4Z5RB 4PRAB 2DTSA 2FX7L 5EIVA 3GM8A 5IBUG 4XNMB 4WW2C 1SY6A 4ZPTB 3GKWL 4WIQA 2V2TB 4FQXA 5IT2L 4F2MA 3QDMA 5K9QI 1Y0LB 2R15A 4MNGE 1PZ5A 5DRWA 5E6ZA 4XCCH 3BP6B 4PTTA 5CSZB 5B3NA 3GSNL 3U2SB 3C5SB 3CC5A 3FHQA 4TPRL 2QEJA 4EI6B 3S98A 3SDYH 3ARDC 3L3DB 1AR2A 1CF8L 1YEHL 4KRMB 1P4BH 4PJFA 3I85A 2V2XB 4XP9L 2FO1A 3MA9L 1LNUB 3H7BA 5DJCB 3G9VA 3GJEB 3HMXA 5BOZG 1KEMH 1ZVSB 3MJ8B 4ZUVB 4YXHH 3MPCA 3M45A 1DN0B 1MCIA 4FS0A 3WSQH 3CVHA 1YNKH 1T0MB 2OTPA 4MSWB 3MRIA 4X7EC 1NFDB 1JGDA 2WUBL 1VPOH 2BY1A 3MV7A 5EC1B 1MJ8L 2QR0A 3P4NA 3DYMA 3RVTD 1LP9B 1V3LA 1JHTB 1B2WH 1BFOB 4IOIA 4E0RB 3KWWB 3LEYL 5IB4A 3DECA 4APQD 1YEKL 2PXYA 2VDQH 4S2SB 3S96A 1FZOA 4LNRB 4YDKH 3HNVH 3DRQB 3CCHB 3V0VB 1F5WA 1JF6A 3MRLB 3WUZA 4AK1A 5EBWA 1UM5L 4FQPA 3KPSE 2DOCA 3E8UL 1CGWA 2NZIA 3FOMB 4Z7VB 3L95B 4U1LB 4EBQL 2NTFA 2X4QB 4Y2OA 1IGTB 3L3OA 1KTDA 5F7DA 2VAJA 3L3IB 5DEZA 1G7PA 2NY0C 1XIWB 3A6BH 4GW5B 3DX7B 1FQ9C 5ID0A 4DGVH 5GGRY 1I1AB 3RU8H 2BVQA 2BDNL 5F93C 5DRNB 3IU4L 4TQEH 4HUVB 1OAZL 3CFEB 1ZHLA 4LHUB 5I8EB 2W92A 2P8PA 3QO1B 1UXSA 2IAMA 2QLVB 3DSFL 3WS6C 1PJ9A 5CD5C 2Y9RT 4JM4L 4RMVA 1YMMD 1HILB 3QDGE 4M6OH 4XPTH 3D85A 4JEGB 4G7YH 2QHLA 3NIGE 3RVVD 3STBA 4KK6C 1P84J 1HHHA 4AJ0A 1EO8H 2EE3A 4JY5L 3O8XD 3BN9C 5EU5B 2ESVD 4HKXB 4Y5YA 2VXVH 2ZUXA 3TIEA 5DFWH 5IB2A 5CBEA 3DYPA 1WISA 4P99A 4EN3C 1NCWH 5MEPB 1A4JB 4ELMF 1AD0A 3RZWA 2H2PD 2VLKD 2PYEA 1CIUA 3HFML 1NCBH 4PJCF 4DZ8B 1E27B 3T4YA 5IFHL 1AHWA 5D7LE 4P2QA 5CGYD 1X4YA 3PUCA 3QUZA 2FX8H 1CD8A 4Z7VF 2HVJA 4J3VA 3BDYL 3KPMA 5EOCJ 3PHSA 4ZD3H 2R69L 1HH9B 2VE6A 3U0TB 4D0DB 1KEML 1Z3GH 3GHBL 1KTRL 5E2TH 2AAVA 4NQEE 2HWZH 2X42A 3UYRH 1EEYA 3ZE1F 5HHNA 4MD5B 4NT6B 5GS0L 2EH7L 2MCPL 1NCCL 1A4KB 3TBTB 3U83A 2OK0L 4HH9A 1HHGB 3IETB 4OBRA 1F58L 3QPXL 5C0CD 4YHOL 1Z9MA 4F7CB 4GAFB 1ZS8B 5A16B 3MLYH 3E2HC 4P23A 1MAJA 1P2CB 5EU7E 3B9VA 3O8XC 5FO7A 3DTXB 3PNWA 2YWYA 3O4OC 1KGCD 2XZAL 4LMQE 5DRZA 1GIGH 2PYEB 1Y6KR 4JKPL 1OSPL 4NM8H 4XP4L 3GNMH 1MAKA 5T1DH 1GGCL 1G7IB 4M1CD 1MEXH 2AK4A 4XAKD 4DJMA 5IHLB 1N0XH 2VXUH 1X5IA 3D0VA 4AQOA 4XWOC 4MA3B 3O41B 3TIDA 1RULH 1BZ7B 1TQCC 3V52H 3MOBL 2Q1EA 4CU6A 1YY9C 5DHVB 5F1SA 4ONOA 4K3HA 5IGXL 3MJ9A 4U2YA 4XVUD 2DDQH 4ZD3L 2IBZX 1HOCA 4KKLD 3D0VB 1D5BB 1LQSR 3IDXH 3MJ7A 5L2KA 4MHHI 4P23C 2WBJB 3S35L 1T03H 4PJ7F 5HGHB 3MC0A 2Q7YA 4Y2DC 2JJTC 1HSAA 3AY4C 3ZTJH 1AQDB 4CVXB 4UMGA 4G7VH 4UDTA 5TDNA 3FB5A 5DVKA 3KJ6H 2GJJA 2DMKA 3O4LB 2O61B 1BX2A 1S7SB 3AMKA 2IAMD 2WK2A 5CWSA 4X6BB 1NMAH 1MRFL 3FB8A 1W72A 3PQYD 1DVFD 4PIRF 5ICYA 1DDHA 5BXFB 1HZHL 3FN0H 3VG9C 3WLBB 3WDJA 4YNYB 1G9NH 4X4XA 4Q97A 3D0LB 1MCKA 3EYQD 3HPJA 3VFOB 3WBDA 1E28A 2BDNH 3BUYA 4K7FB 1NC2B 2IANE 1CLYH 3EOBA 3JTTA 4WEMB 2ZUYA 1C5CL 2HFEB 4Y16D 4G42B 2X9YA 4NQEA 4XPGL 2DKUA 4Y16B 3VRLE 1YEEL 3MRIB 3GBNL 4XP5L 2V5YA 4YDVA 1RFDL 2ORBL 3LOWA 2V7NB 5IVXF 4V1DA 4OLVL 4HX1A 5EPMB 3U7WH 1XEDA 4U7KA 4JLRA 5JUEH 1X5LA 3KR3L 4P2QE 1TQBB 1W2KT 2W9DL 4WFFE 1T20A 1GIGL 5EFIA 3HUJA 1MFEH 1DN2A 2WWMD 4CL7A 2W0KA 5LGJB 2E7LA 5KVGL 1EPFA 3Q5YA 3C5SA 5GGSY 5CAYB 4FZ8L 5HHXL 2HKHL 4XMPL 2EDLA 3PQYA 3BH9B 1UH2A 4ZFOB 2MNUA 4OCNC 2IAMB 3RIFK 2J8UE 3MV9A 3CPLB 3CVIH 4C4KO 4F2MB 2OZ4H 3OKDA 2EE6A 4HH8A 4R7NB 5GSVB 1P4IH 1S7UB 1CZ8L 2IFGA 3QQ3A 1OB1B 1X5XA 4LAQL 3S34H 3IRPX 3KYOA 1S5HB 3QA3B 3Q1SH 2FYYA 4MAUL 3TT1H 2MSPA 3OJVC 2XFXB 2VO5A 2WBJD 3GI8H 5HJ3A 3VFSB 1UKSA 4U6VL 2ZOLA 2XN9B 2MOVA 3TO4B 3GBMH 3MNVA 5DHVA 3HMXH 3SKNA 3OV6A 4WFFD 3NGBB 3BW9A 2CDEB 4KK9C 4I77L 1M6OB 1TXKA 1N8ZA 2QQQA 3P11L 4MJ6B 5HYFA 3VFUA 1NUNB 1E4JA 3S37L 5HI3D 5GGRB 2JJTA 2ZSWA 1UB6A 2DQFB 3JWOC 4G9FD 4JG0L 1FAIH 1EBAA 3E6HA 4BYHA 3MOAH 3AGVA 3PJSB 5INCB 1OP5K 4G9FA 1D5XA 3DXAE 3MLWL 5I1JH 2A6JB 3LRHA 3MBED 3TZVC 3CLEL 3HG1B 5EC2B 5F9WB 4HXBH 1SY6L 3G5ZA 2DWEB 4Q2ZB 3OAYH 3IJSB 5HXMA 3T2NH 2CLRB 3CUPB 3BQUD 2D7MA 1B6DA 3GSNA 4YK4C 2K3TA 4UTAH 4PGDB 5AG8A 3LZFL 1O0VA 5C07D 5L0QC 3SY0A 4IOSD 3AREB 4Q58C 3RUGA 4F9LA 3GMPB 3OAUH 1QBAA 4MDJB 3ELAT 4JZOA 4IRZH 1HZHH 3FN0L 3MRGB 2X7LB 3UDWA 4LVNC 3HMXL 5EWIL 1YNKL 5D2LA 2IEPA 1OARL 3DURA 4NQDA 5KVDL 4PG2C 3G08A 4PJFE 3SDDB 1J5OH 4NQDD 1FHGA 4HS6B 3E3QC 2X1OA 3QNXB 5IEKA 1G7LB 3KYNA 3PWLA 4DN4L 3MLRH 3BYYA 3CZFB 3QDJD 5GIRA 4GLRI 5JW4R 5LQBL 3FKUS 3V6BR 4QYOA 3AM8A 5EU4A 5T1DL 5TQ0H 2YN5A 4PGEA 5FHAL 2OCFD 3FQWB 1BBJA 3LN9A 4PV8A 1BPVA 2BRRH 4TSAH 3SGJC 3VDBA 3GMQA 1ZA3B 1OD7A 1DBJL 1VACA 4G6JL 3WYRA 4CU7A 1C08A 2ESVB 5IF0A 4HZLA 4Y5VB 2YPKA 5C0BE 2R0WH 1MFAL 4CADA 5JQHC 4P0DA 2OI9B 1E4WL 1L7IL 2EYRB 5HD8D 1HQRA 1EA9C 3RVXD 3EOYG 5JUEL 5EZLA 1Q1JL 1A3LL 4MA7H 4RAUA 1I9IL 4HWBA 4O4YL 1KC5L 5HDQL 5I66B 3UC0L 2AGJL 4TSCH 4LHUD 1ZANH 4OCLC 3FFDB 1M71B 1I9IH 4U1JA 4Z9KB 3IXTA 4MNHA 3DETC 3UMTA 1V3KA 2ERJB 2UZIH 4XXDB 2EYRA 2R69H 1QR1A 1CR9L 1L0YA 1XIWD 5FUZL 3LRSB 3RTQA 2RB8A 4LBEB 1B6UA 2YPKB 5KVFL 5E9DA 4H1LA 2IH1A 4GXVL 5CIPB 4WHDA 3STLB 2OI9C 1NDGA 4LNRA 4MB4A 2PXYB 4S2SA 3S96B 4Z8FL 4NQTA 1NBYB 4U1GC 3FO1B 4R26H 1SEQH 1F58H 3RPKA 3SDCA 4E0RA 4R4FH 3SQOL 5GJTH 4H0IA 4IRJC 4R2GB 1KOAA 1J88A 4YWGH 4I3SH 4LLWA 5AWNH 3W2DL 3MACL 1A7QL 5MP6H 1KJ3H 5IMMB 2FIRT 3MREB 1U8QA 2FEEL 4YBQD 1U8MA 4YDJB 3BDYH 4M5ZH 3LSOA 4HS8H 4J4PC 4A6YB 5EO0B 4P2OC 4MDJA 5FCUH 4Z7WB 4EI6A 5D7SH 1L9NA 1FZMA 2BNRD 3PP3H 4Y4KA 1AO7B 1JPFB 1GAFL 4FP8L 4KK8D 1T3FB 2NZ9C 2A83B 1CDIA 1NCNA 3EOTH 3SCMB 5A2FA 1BFSA 4DN3L 5J12B 3D2UA 4PRDB 4CUCA 4D0BA 2H3NA 3G5ZB 5SWZB 4FTVB 5DDHB 3BT2L 2H32H 2FR4A 1NLDH 4OM0H 5I17B 4NRYB 5EOCH 3VRIB 1YYMH 3DO3A 4HJGA 4WW1B 1SJXA 3IJHB 3ZE2F 2P4AB 4PJIE 4G9FB 3QDMD 2AJVH 3BIBX 3D18A 1U91B 1W72H 5C9KA 3U4EA 4CJ1A 3WHXB 4RZCB 1FAKT 1FNLA 2IMMA 3AS2A 3CH1A 1WCBA 3BZ4A 2JIXD 4EDXB 4D0BB 3QJHA 5C0RL 1TZIA 5HHOB 4ENEC 3FO2A 2O5XH 3FRPG 3DURB 1IKFL 3EDJA 4PJ5A 4LLUA 1XGUB 3QXVA 4TOYL 1S9YB 1KCLA 3C60B 4TUJA 1EDQA 5K9KB 1DQJB 3NBNA 4JFDE 1BLNA 1TFHA 2J4WL 3EO1B 3MNVB 3QNZA 4LSUH 2AQ3A 3NFNA 2XQYG 3QZWB 4QRRD 5E8EB 3GI8L 2PW2A 1H3PL 4MDIB 2HLAA 2FHFA 2N7AA 5CFHA 4NC2B 1QKZL 3LSOB 4HEPG 2DF3A 2X09A 4RGMC 4JM2C 4CMMA 2BY3A 2CO7B 3D39A 1S7UA 4PJHA 4BFIB 3IAQA 5E6IA 4HQQL 4AEHH 1AGFB 3DVGB 2NY3C 3F7YB 5F1IA 2IPTL 4XH2A 2O5YH 4JO1L 3MRPA 1G7JA 4IRZL 3IU3B 4XC1L 2DLFL 4LLWB 5BMFL 4JPIB 4U1IB 4BH8A 2UYLA 1TVHA 4JJHA 2J6EL 5DTFB 5ECJE 3VH8B 1MHPH 3ME0A 2BNQA 2C7UA 5C0RH 5D2NA 5DC4B 4Z0BH 2EDNA 3W0WA 3ARDB 4BQCA 9CGTA 4HKJB 5E94A 4AEIL 2OTWA 2CK0L 1W72L 4JFEA 4PRBA 4QRTA 5I8KH 3VFUB 4O2EB 4FABH 4JY5H 5E24E 3LH2H 1Z2KA 1XR8A 2XQYK 2R1WA 4NCDA 4X4YB 2YPVH 4KHTL 2JCCA 3G04B 1MFDL 4MAYB 4OZGF 4ODXB 1WTLA 2AGJH 4LNVA 3I6KA 4YEFA 4M43L 1JYWA 3P4LA 3NCBB 1NUGA 2HJLB 4S0TD 4R96B 2JB5L 1QACA 3OB0K 5TE4L 3SHSA 2IQAB 4DKFL 5GGTH 3FOLB 4RGNC 5AD0A 4ZSOA 1VCAA 4ZUTA 2L7UA 5JO5B 3G6DL 4ZMAT 1Z5LB 1DDHB 2W1NA 1DVFB 1F42A 3GIZH 4YIQB 5I8CB 3I84A 3VXNB 2GSIB 2X70A 3X12B 5D1ZD 3T2QA 2DLTA 4L8SC 1RZ7L 2UUDH 3L5JA 1O7SA 3HMWH 4U31A 5J1AB 1GPOH 3B2VH 2D7TL 1KPVA 2A2QT 3QIBB 3ULUH 4P5MA 2P5WA 4J3SA 1GPOL 4HHAA 3QIUA 3LDBC 2I25N 3PWPA 2I5YH 5EU6B 3CDCA 4E41B 5CD3B 3LQAC 3FT2A 2VAAB 4YFLF 3QUZD 1GGIL 2V7NA 2G5BB 2HRPL 4TVPE 2EO1A 1WIPA 3X14B 3U6RB 2F15A 3O6LL 4PJ8A 5ISZB 2X41A 4LCWA 3IF1B 4RGMB 4L3AA 4OKDA 3BSZL 3BUTA 5C9JA 3GMMB 3MFFA 3BUYB 3LD8C 4WHYH 1NGZA 3VFRA 1WWCA 3ZDXF 2I60L 3HLAA 3I6KB 5B8CA 1G6RA 3CDFA 3FT4B 1GHFL 1CIDA 4XVSH 3IDYB 3SY0B 1PY9A 4NNYA 5B38B 3BN3B 3VCLA 1YEEH 1PFCA 4NO0B 4XP5H 2C1OA 1NSNL 2AJVL 4C83B 3VFPB 1S5IH 1FJ1A 1MLCB 4O4YH 2WW8A 4WWKD 4QRUA 1M7DA 1ZWIA 3BFOA 4JFEB 4PRBB 3QUXC 4NM8L 4XP4H 5HHVH 4HC1L 3TFKC 4WI8A 4HW6A 1BX2B 1S7SA 2IPUG 4KVNL 4OD2A 4GT7A 1TVHB 3E6HB 3G6AB 4ZFFB 5IVZB 2E7BA 3HRPA 2NY3B 4NGHH 2IG2L 1LVEA 4P9MH 2R0KH 3LQMA 4S1SL 4KI5E 1NMBH 3WLWC 3DI2B 3GSXB 4UDUA 5IVXB 5FAAA 4AH2B 3O3AB 1EIBA 1HWHB 1EEZB 4M48L 1J12A 2HFFA 1VFBB 2FZ3B 4JY6A 1I1FB 3HLAB 2E3VA 3U82B 4JB9H 4S1DC 1U3HB 4YX2H 5F1NA 3C60C 3UTPE 4I0PD 1UZ8A 1URLA 1UQSA 1H5BB 1OTTD 4JPVH 2AK4B 4QRSB 5D7KE 1OB1A 3P0VH 4GAJH 4EDXA 4A2LA 1QR4A 2I9LB 4HKZA 5F7KC 4E41D 4CVZA 4KXZI 5HHXH 4TTDC 2EC9T 1IBGL 5JOPE 2DQUL 1JNLL 5BV7L 3QCVL 3THMH 4XNUH 4PGCB 1HYSD 1T04A 4NDMB 3QFDB 3OX8A 5MERA 2QSCL 3VG9B 5KS9F 5FO9B 4ZO8A 4P2RB 1X5AA 4C59B 4HAFA 3I2CL 4GH7B 3SCMA 5I1KH 4XI5C 3ESVF 5DS8A 1OSZB 1BHGA 4Z7QF 3KPLA 1JWSA 4MQ7A 1Q1JH 2ATPB 3C6LA 1IEHA 4F9LC 2EZ0D 4PJ8C 3LIZH 5ADOL 4JGJA 3FL7A 2YXMA 5ACLA 4HWBL 1AY1L 4OLUL 4ONGL 2PCPA 3QIWB 1S78C 1UGNA 4NYLB 1KLGB 1Q9LA 1WEJL 1WBXB 3V5HB 2F8OA 2PTTB 4CMHC 1VEOA 4CBPA 1LMKA 4WTXA 2XACC 2JE8A 3GRWA 2CUIA 2R23A 2VQTA 2XRAL 5CSBA 5KZCB 5L8JB 3V0VA 4L3EA 1TTFA 3AS0A 3MRNB 5HGDB 2OTWB 4QRTB 2BY0A 4R7DB 4GRMB 1AP2A 3ZKND 1R5IB 5HI4D 3IDGB 4U0RC 3GIVB 1X5KA 1ITBB 1NBQA 4WY7H 2BVEA 3AU1B 3SO3C 5DJYB 1JPGA 4OCYL 2W65A 1X5HA 5DJ8A 4WI9A 1JGEA 3DHJA 4XB8A 1MFEL 5ANME 4MSWA 1MIML 4I2XA 4MJ2A 4U6TA 5C6TL 3ALWA 4Z78A 3FFDA 3QUZC 1T5WB 1MRCL 1C16A 4JFXB 2DI8A 5FK9A 1KIPA 1JFQH 5FDYA 4PJ9D 3KPQB 3GKZA 1IFHH 1UH3A 3MGOB 1F4HA 3HTLX 3WNOA 3O0RH 4P4RA 4B7IA 5I1JL 1U2CA 2OTUB 3MGAA 1GGBL 3U7YH 3NCCB 3WEXA 3QRGH 5KS9E 4HUWB 4CGTA 1CD1B 1GC1H 4U1KA 4ZPTA 3VMOA 2VN7A 5E8NB 1NEZB 2XTJB 3MYZA 1AC6A 5FKAB 4K71B 2B2XH 4K7PH 4I13B 3U79A 5ITFA 4FMFA 3CK0H 3MV7B 5EC1A 4LU5L 2GHWB 5F9AC 3BKYH 3E6FA 2X4RA 2AK1H 3PGDB 3W0WE 2PYFA 3GEWB 1F3JB 3F62A 4CMMB 1KEGH 1HDMB 2P49B 3MCKB 4HWEL 4XBPB 2Z92A 5B3JF 5DJCA 4ODUB 5EORL 4OQTH 3QZWA 4X7FC 4X99A 1ULVA 3T0EB 3PE9A 3JUZA 3WFZA 2Z31B 5SX4I 4D0DA 2MMXA 1S7WB 5B4MD 3NGBC 2HMID 1GZPB 3BJLA 4X7SL 4JDVA 4K55A 4IRSA 3EJZC 1CICD 3ILQC 4Y4KD 3FO2B 4J3WA 2CIIA 4YAQB 3RWIB 5D7IF 3WO4B 5L88L 2M2DA 3KNBA 4X6EA 4FQXB 4Y2DA 1RD6A 2QBWA 2X4RB 4JHWH 1R3IL 4LRNL 3TJEH 4OTXL 1MLBB 3F6LA 2NXYC 1V7ML 4WDIA 3OJDA 1U91A 3P0YL 1EO8L 5ITFB 3RAJH 2P45B 3GRWH 4WW1A 5I1EL 3SDCB 3FAWA 3GNML 3ALPA 1N4XL 5E8NA 4GRWH 3P9WB 4XCCL 5H94B 4U1KB 2OP4H 1A6TA 3F7PC 4DGIL 3STLA 2YD8A 2ZCHH 3NCMA 2R2HA 4BM7A 2ZWLT 3UCRA 4XVTH 2BVOB 3T08A 4XWGH 5KSAC 2UVFA 4CNIB 3L3HB 2GCYB 4U1HB 4NN5B 1JZ5A 1ZHLB 4XWGL 2NY1C 3IAGC 1FIGH 3OKNB 4ZPVA 2KUTA 1FNAA 4LPXA 2NXYB 5LKNA 2ILLA 3N85H 5D1QA 1T22A 4Y4FD 4YPJA 1YN7B 5D1QB 4XVJH 1FNEA 2O93L 1FO0H 1XGTA 3ALXA 1U8MB 5CKGA 1J0KA 2XZCL 1EHAA 1KCVL 3EYSL 4N9GA 4KTDL 4FQ1H 3TT1L 5GZOD 3OZ9H 2A77H 3LCYA 3NCYS 3MLUL 2ZKHH 2NY2D 4WU5B 2VDNL 3KYKL 2Z8RA 2FLRT 1IAIH 1HQ4A 3VFNB 4HIXH 3OGOE 1MCFA 3OF6D 4Z0BL 1QRKA 1Z9SA 4O2FB 1NUDA 3IDGA 3K1KC 3BQUA 1UENA 1AP2B 2W07A 4OGYL 4KPHH 1LO0L 3QUKB 1IQWH 4PGEB 3UTTB 4UT7L 4OZ4A 1VPOL 2ICWI 3MO1B 2HJFA 4NWTL 1OLLA 1R5VB 4ORGA 4EI5C 5I74B 1SBBA 3I02A 5D8JL 1DLHB 2E8ZA 3JWOL 4RGOL 1HYSC 4LARL 1IGIL 5JOEA 4ZAKB 4JFOA 4W4NA 4LHUG 3L3JA 4OLXL 3C08L 4K71C 3IJYA 3U4AA 1IEBA 3MOBH 2KQMA 4L3EE 3T2PA 1Q0YL 1FO0L 4NYLA 3QCUH 5K33A 4JANB 3INUL 3VXUD 2DQEL 5C0BB 1NMBL 5GS3A 4YDLB 4PRHD 2J5LB 1N59B 5C0ND 4M00A 4GG6A 4KJQD 4JFPA 5CJQH 5GS2D 5C0DA 4G6KH 4LCCB 2KZ1B 3VWJD 4M1GL 4UAOB 2ADGB 1J1PH 1RURL 2GQHA 4S10A