1FNGB

Histocompatibility antigen
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
213
structure length
213
Chain Sequence
b'KKVITAFNEGLKGGGGSLVGGGSGGGGSRPWFLEYCKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAVTELGRPDAENWNSQPEFLEQKRAEVDTVCRHNYEIFDNFLVPRRVEPTVTVYPTKTQPLEHHNLLVCSVSDFYPGNIEVRWFRNGKEEKTGIVSTGLVRNGDWTFQTLVMLETVPQSGEVYTCQVEHPSLTDPVTVEW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (MHC CLASS II I-EK, ALPHA CHAIN)
publication title Structural and functional consequences of altering a peptide MHC anchor residue.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
total genus 42
structure length 213
sequence length 213
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fngB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1fngB01
1Q9KA 4OUUA 3HPJA 4ETQB 3TJEL 2W1NA 3DSNA 3SDCA 3X14A 3U4BH 4B5EA 5HYJA 1MFBH 2AJVL 2VLJE 5CILH 2YEZA 4WENB 3RQ3A 1CFNA 4PJAF 1KT2A 4OZFH 3ZKMD 4U1GC 4EI6B 2V6HA 4Z78A 4BZ1L 1CT8A 3MRBB 4I2XE 4L8DA 2E9WA 2FEDC 2H2PD 2E7CA 3QWRA 4JFEE 3MRIA 4X80L 4P4KA 5GGRA 3HZVB 3DV4A 4NBXB 2J8UB 3RY4A 5D96C 3DX6A 3NACL 3IVKB 4JHAH 5EO1B 2XTJE 3SN6N 1YMMD 1PEWA 2EDNA 2CO7B 5GS1C 1UH2A 3MLUL 5GHWH 5GRXG 1KCKA 3KVQA 3ARGD 2I25N 1WZ1L 2P8PB 4RIRA 5C07A 3DVFA 5K93A 3S88H 3ARQA 5GS2D 3H42H 4NO0A 3GM0A 4HLJA 1MRDH 4TTDC 1MUJB 4K3DH 1OWWA 3M45A 3MV8E 4Q0XL 1S3KL 3MPCA 1QZ1A 4V1DA 5F71A 2EC9T 1IC7H 1ZWIB 1A7BA 3PL6B 3X11B 4XCYB 4HAGA 5JZ7D 1HHGB 2ADGA 4IDJH 2YD3A 1T22B 5F1NA 1CLZL 1VACB 3BKJL 1LNUA 3QUYC 4ZPTB 3W0WD 3AY4C 1QFHA 3D9AL 1MIEH 1HXYB 3TBVA 3ARWA 2C4XA 5F7NC 4YO0B 3QQ4A 5EUOA 1XGYL 2R4RL 5FUCE 4R96A 4LNRA 3FT2A 4KKNA 5EDXA 1QRKA 2XA8L 1HKFA 4PB0H 1F4XH 1D9KA 4LRIC 4OIIL 5E9DA 1VHPA 1S78D 2CDGA 2DM3A 1U8JA 3VXSD 4EN3C 4UMGA 1EAPA 1F3DJ 4Z7QF 3S4SA 1XR8A 3KPLB 3UYRH 2FO4B 5C70A 2XYCA 5BV7L 2YRZA 43CAA 1F11A 1TTGA 4OZGE 1UYWL 4UTBL 5FO7B 4MA3B 3B5TA 5HTSA 5EO9A 1CBVH 4JRWA 1C12A 4KTDL 4Z0BH 2GCYA 3VXPA 3DX8B 1NAMA 3B9EA 1YY8B 4R2GC 1FVDA 1ZVSA 3RNQB 1W72B 1EBPA 3TGXA 3QUXB 3RIAF 3NIGE 1YY9D 1OTTD 1YEIH 4M4RA 4NJ9H 2GW5A 3RVUC 3MRLB 4E41B 5INCA 3S36L 2X41A 4LCCC 4JRYE 4U1JA 4ISVB 1FZKA 1A7OH 3STZA 4OQ1A 1J0ZA 3JWDC 1IKNA 4EDWL 3EYFB 1OM3L 4OLWH 3TVMA 4QYOA 4Z7WA 1NCDH 2XTJC 2JB5L 2AK4D 4OFPA 3NZHH 2UWEE 3QZWA 3TV3L 4DN3H 1V3MA 5FYLD 3U7WL 1PJ9A 2AABH 2PYEB 4JQVA 3T2PA 1SEBA 3P4LA 5ANMB 4QTHA 3OGCA 4NP4H 1FZMA 2HTKC 1A3RL 4HIJA 4W68A 1SJHA 1ZEAH 4P48A 1QFUL 3OR6B 4HKBA 1G9EA 1MFEH 4QCIB 2AXGB 4JRXD 5I1HL 2DYPA 4HH9B 1FNGB 4FFVD 3QIWD 2YUZA 5E5MB 2CRMA 3WS6C 5CGYD 3NOIA 3MLSL 5IHBA 2OX5A 2IMMA 1ZGLB 1H3TA 2BCKA 3V6ZA 3KHOA 3FO2A 4JHWH 4JY6A 3IDUA 4FQLL 2DBJA 5IVXF 3VXMB 4PJXA 5CLWA 3WNLA 3S96B 3UJJH 2PR4H 1B0GB 4LF3B 5FUCC 3QXAA 2VSCA 5CUSL 1QR1A 4U31A 4YDVB 3KPNB 3T3PE 1DJSA 1G7LA 4FRWA 2RR3A 1E4WL 4DZ8A 4M9OA 4H88L 1KCVL 3T08A 2OR9L 2FGZA 1RU9L 1YNTA 4GBXA 3C8KA 3NIDE 2KUTA 4G5ZL 1EUTA 4PD4K 4XRCB 4G80A 4D2NA 3KPQA 4Z7OF 5EWIH 2EXYC 3N0PB 3L95A 4NZDA 1BF8A 1AQKH 3BO8B 3VXTA 3OXRB 4HXBL 4R8WL 5DRNA 1EERB 4PP1C 5AZEL 1J8KA 5D7JC 1XGUA 2IH1A 4RQQB 5L2JB 3IFLL 2MOVA 1CIDA 2B0SL 3IDMB 4PS4L 2EIBA 3OG6B 5I1JH 2ADIB 3QXWA 4P5TD 5FYJH 3TC9A 3W81A 5ICXB 3IJSA 2AEPH 2IH3A 3FRUB 3TBWB 1SEQH 4JFZL 3VG0L 4U6HA 4Z7UA 4PBXA 2UUDH 5DJYB 5GIRA 4PJCB 5IESL 3W9DA 3V79C 5D1XD 3TN0B 5DUMH 3B2VL 5HDLA 5GQBA 4UINL 1PX3A 4F7EA 3MLYH 4G6JH 4X4ME 4PR5B 4JO1L 3V8OA 2J6EA 2FL5B 2XRAH 5DFVC 3C6LD 3GIVA 5AAWA 4ZODA 4HWUA 4EIZC 1HHJB 1SJEB 5LCVH 4DAGH 1AJ7H 2UUDK 2CDEA 3DRQA 4QXWA 3VD7A 2BERA 4F7PA 3CH8A 1T7VA 2C3HA 4Y4HA 5A40E 3DUUA 1G7JA 3VA6A 3DTXB 3OV6A 1MWAH 1OHQA 3FO9A 5JHDA 4I0CC 3ILPA 3MV9D 1WQVT 5BZWA 4JFYB 2R69H 5FF6B 4U6VL 4HWZA 3WFEL 5EOQL 5I30L 3WCYA 3MQIA 4KK6D 3UTSB 2PO6B 4R97C 2F74A 4AJ0A 3CJJA 1HDMA 3MODL 1XGRB 1ETZB 3AM8A 2E27L 3B8YA 5F7YC 4L8SC 3TO2A 1JV5B 3FO1A 3EDDA 2OR8A 1I9IH 2GITA 4F58L 1S7TA 4MNHA 5IJVB 2NW3A 2EC9U 5I9QC 3WIHA 4JJ5B 2XWJB 4KRPB 4MJ5B 4ZSOE 5FB8A 3ZYOA 4KV5E 4OLYL 1AGCA 4Q9BA 1FBIH 3ARED 1NMAL 3OXSB 4MQ7B 1H5BC 4ZPVB 1T5XB 4FG6D 4OQTA 4OSUH 1KCRH 5LGHH 1YA5A 3P9LB 5H35B 4DKEL 2UYLA 3M1BB 1JYWA 3OJ2C 3AB0B 3MLTA 4HWEH 4PJDA 4YDLC 1K6QH 5L0QB 2BSSB 4OFDA 1QSFE 3HRZA 5HHNB 1MLBA 2VLJA 3L5WB 3MOBH 4ZOEA 4CW1A 3DO7B 1NJ9A 4P9ML 2F54B 4PGDB 2RCSH 3WEXB 1EPFA 4DN4H 4LP5A 1KOAA 3QEHB 1FZJB 4GKSA 4JFEA 3JTSB 4HPOH 3RX5A 4WWKC 4LPUA 4PTUA 5GGVY 1U93B 1VFBA 4R4BB 5F3HB 1CD8A 4UT9L 1FL5A 3UPRB 5TGBA 3CXHJ 5HJ3B 1LP9F 1F6FB 2CK0H 3MRJB 3V8CA 1TIUA 5DJZA 1OAUH 1G84A 5FV1L 4QKXB 1ADQH 2LU7A 4XPHH 3MJGX 3P0GB 2VXTL 3ALXA 5B3NA 2ED8A 2LTQB 4JPWH 1LEIA 3OKNA 3MV8A 4GXVL 2W0LA 4NQCB 1PG7W 4OV5B 2O5ZL 2GK2A 4QLRA 4X6BB 4D9RE 3CPLB 2IF7A 1N6UA 2DQGH 4ODTH 1FGNL 3CVIL 4OFVA 4PLOB 4Q58C 4W6WB 1G6RB 4LCWB 3G6JE 4TVPD 4YQXL 4MNGB 4C59B 2L4OA 2XKNA 4OTXL 4XPFL 1EHLL 1OLZA 1WC7B 4LEOA 3T3MF 2HRPH 3G6AA 2G5BB 3VFRB 4LAQL 4QWWC 4YHOH 3QG7H 1IILE 4U1SB 4XMLH 3QO0A 1BHGA 4YIQA 2G60L 1LK2A 2OJZL 5GGUA 1IC1A 1W8OA 1H9VA 3IETA 4FQ2L 4M93C 4OT1H 4PJ7E 1ZT4B 1KTDB 4N0FB 2MMXA 1SM3H 1QO3A 5L7XL 3BUTA 2IAMD 3BZ4B 4PGCB 1LK3L 3OHXA 3PWNB 4OFYD 4XVSH 4XWGH 5ERWA 2H3NB 4XCEA 4OZGA 1AR2A 4Q7DA 1MNUH 4RISH 1HE7A 3HMXH 1XIWC 4JFHD 3QUXD 4V2CB 5D7JA 5D7LD 1OB1A 4KVCL 2VKWA 2HLFC 4E41D 1NAKL 4XBGB 2FX9L 3BD5A 1G7MA 3RZWA 2M1KA 4OJFH 5E70A 2VLKD 2OI9C 2NY7L 5FGRA 2EO9A 3VFUB 1DZBA 3MCKB 1KELH 4MAYA 2DQUL 3CFEB 5H8DA 1C5DB 5BOZG 1WZLA 4HPYH 3RWDA 1I8MB 4U05A 2JELL 5TDOB 1BBDL 3QDME 2R4SH 3OKMB 2MPAH 4JRYA 1AH1A 1KGCD 3ULUH 2R2HB 2BNQB 4LSSH 5IOPA 5MP6L 1PG7H 2OXHA 3BRGC 1BQLL 4P46A 1UKSA 5F7EL 2PYED 2F53B 5ESVA 2AEWA 5FA4A 1AIFB 3PIQB 5I18L 2BMKA 2H41A 2D4DA 1J1XH 4RMVA 1DEEB 2GT9A 1U95A 2UWEA 1HZHL 3NTCH 4CNIA 4OZHE 4AENB 2ESVB 3CLFH 2P5EB 4XT1C 4EQ2A 2JCCE 4CAGA 5DVKA 3C9NA 3IS0X 1R3JB 3NCCB 4HBCL 2VYRE 4UQ2A 2CRIA 2ITDA 4XXCA 4ZO9A 1LMKA 1WBZB 1U0QA 1G1CA 3U1SL 4R6UA 4X9HA 4ODXB 4KRLB 1BBJA 1D3CA 1CFTB 5BW7A 4LHUA 5E6YA 2DQCH 2AXFA 3TLRA 3O3AA 1QNZL 4HS6B 2GJ6E 3QI9B 1XCQA 1JF1B 5CSBA 5HGBA 4H25A 2GEEA 1CGVA 4ZDHB 1NFDF 3N9GH 1UQSA 4NHUB 4YHNA 3TEUA 5C0GB 2YD9A 1QBML 4HUXB 4HWBL 3EYQD 3RY6A 2NY3B 3QR2A 2DDQH 3IDYC 1BREA 4NCC1 1PGRB 2V2WA 3QDAA 2GY5A 4M48L 5DLMH 4WV1B 5TE4H 4NIKB 3D6GA 4DUXA 5C2UB 3FTGA 2HLAA 5CP7A 1JI1A 2KDGA 1IBGH 2D0HA 3IFPB 2OM5A 3QHFL 2A6IB 3EOBA 2YPLE 5DA4A 4CVXB 3GMPB 1DVFB 4L8CB 1D6EA 4U33A 2L0DA 4LLDA 2AXHA 3FQXB 1KPRB 1PZUB 1X44A 5BVPL 4U1KA 4NKDA 4HJ0C 3T0DA 5J6GB 1AI1L 2R23B 2I60L 4HBQA 2PF6A 5DQJA 5TF1L 4NZUL 4UOW1 2P7TB 4HUUB 1U8OB 5FO8A 4NBYB 1WWCA 3Q5YA 5GRWA 3SCMA 2A83A 5BRZB 4UU9A 1JP5A 4L3CA 2FATH 1ZE3C 3R06A 4G8IA 2Q8AH 2WBJA 4PP2B 5MEND 4N8CH 4WWKA 4X4YA 2ZG2A 5IQ7L 3OWEA 4XBEL 5F8QC 1X4XA 2I24N 5T3XL 3X3FL 5JLZA 3L7EA 2DICA 1NCAH 3HRPA 4X4MA 1RZ8A 3G6DL 5IVZA 1XGTA 4AEIH 1AKJB 2E6JA 2Z31A 1J9CT 2CUIA 3RKDD 1S8DB 1MLCB 2ZUSA 1H3VA 3V52H 3WUZA 2NZIA 3E2HB 1QKZH 2ICES 3EKCA 1N64H 1P6AB 4Y0GA 3F7PC 3CU7A 1I1AA 1PG7X 2J4WH 4Z9KB 3V0VB 3UTSD 1OAQL 4PUBH 3BDXA 4X98B 2I9LB 5GZNC 4JPIA 1ZA6A 2ZG1A 4KKLC 1N3NA 1KJMB 2HFFB 2X4QB 5EIVA 5KBNC 3UDWC 4ZS7L 4M1CD 2OP4H 4HKJB 4H5SB 1VPOH 4MDIB 3M8OL 1GJIA 4I3RL 3DBXA 4Z0XA 3G5YA 2W60A 3HI1A 4UV4L 5E6IB 1TQCC 4TOYL 4KRPD 3MREB 3GMMB 1ZA3A 5DJ6A 3TJHC 4UV7H 1TMCB 3OSKA 2ADFH 1DEDA 4P2OD 4TVPL 3IJYB 1ZHKB 2OMBA 4R7DA 4ZXBC 2NXYC 3VWJC 4M3JA 1IQWL 4F9PA 5J6HB 4PJEF 1G7HB 4K7FA 3FFCB 3GJEA 2BY3A 1UEMA 2Y36H 1FJ1B 5DHYB 2FNBA 5C0FB 4Y4KA 1ORQA 3P4MA 2VN7A 3LS4H 5C0AE 3G04B 1MHEA 4DCQA 1IL1B 4HD9A 1G9NC 3LQZA 5AYUL 4OB5H 3W82A 5IR1B 5FKPB 1XIWA 4AEFA 1QSEE 2C7UA 4RMWA 5TFSH 3SKNB 4LCIL 2VWEC 4QRRB 4G43A 2BK8A 5HYIA 2XPGB 3C09C 2NY5L 2DKUA 4KJYA 2CKBB 1BLNB 3IKCB 4YUEH 2X7LA 4HG4J 4NFDA 1EEYA 1N5YL 5AD0A 1QSFA 2EDFA 3MRGB 5FAAA 5BS0E 5E1AA 1Q0YL 2Y6SC 5IFHH 3VFGL 4PJHB 1W72H 4HUVA 2C26A 3RIFK 4C4KO 2ZOLB 1PYWA 1YEHL 1KPVB 4RFOH 5FUZH 3LPWA 1SY6A 4X6CA 1BFOA 2KH2B 3QFDA 2FH8A 3CU1A 4FFZH 5F89B 5LBSH 3TT1L 4X6DB 4LLUA 2HFTA 1VGEL 3KWWB 1MCLA 2Q3ZA 4A6YA 4YDIH 1CICB 1CE6B 1OGTA 4YFEA 2VZUA 5EPMA 1LE9A 3H7BA 3VFTB 3NFPB 3ZTNH 2K7PA 5ESQB 4DTGL 1UWXH 3FOLB 2DL9A 4JEGB 4IOIB 2X89A 4KVNH 4Y19B 1JI2A 4ODHH 3QCTH 3HPLB 1KN4H 4LCWD 1UG9A 4M5YH 4WFFE 5IQ9B 1I4FB 3O8XD 4O9HL 4DKDC 2W9LA 2CSPA 4Y5XA 5GGVH 2WK2A 1XR9A 4NO5B 1KJ2L 2YMXL 5I1LB 4YDJA 1UWXK 3G6JA 1QYGL 1QACA 3CDYA 5IEKA 1R24A 1GGIL 3C5SB 3GO1H 3O2DH 2NPLX 3FCTB 5LAXA 1HILA 3ISWA 3VRJA 3O2WL 4DEPC 1YPZF 1JZ2A 2ATPB 1C08A 3BP6A 1IM9A 5IFAH 5KS9B 1FLRL 3KYAA 1MFCH 1X5JA 1OSPL 4KKCD 3GBMH 1H3XA 2R0WL 4PJ7A 1QBLL 3BJ91 3OJMB 1QBAA 4HK0A 2EKSB 4YNYA 4X7TB 2EDXA 3BN9C 5IF0B 1NFIA 2IFFL 1UJ3A 5F9DC 3WXWH 1IAMA 5EZJB 1YJDH 5BZDA 2BC4A 3TZVA 3QEQB 1CFQB 2ZSWA 1NSNH 3T4AA 5C0DB 3TIDB 1WIOA 5SWZB 3SDDB 5E6ZA 3LKNA 3RKPA 1CZ8L 1HI6B 2GFBA 1QEWA 1CL7L 3WXVH 3KXFB 5FYJU 4R90L 1T3FA 2ZUQB 1A7PH 5MI0C 1CE1H 4GLRH 5IHZB 1QRNB 1JPSH 2F53D 4G8FA 5HGDB 3QDMA 3VRIA 4QXTB 4OCNC 4IOFC 4XC3H 3FB5A 4LCUA 4QRQB 2G9HA 3EOYG 4IJ3B 3MRDA 2R8SH 2B20A 4FQQA 3GSWA 4B41A 2ESVD 2A1WL 2WUCL 2P5ED 3UJIL 3V0WH 3EJZD 5I15L 3NAAL 4F7CB 2R1WB 3BKML 4NUGL 2LVCA 4G3YH 5C0BE 4HLZG 4KGLA 2V9RA 3EOTL 2CRYA 1KC5L 4UQ3B 4OZHA 5D2LB 5F96L 5CJQH 5EO0A 1WBYB 3KYMA 2JCCA 3S3SA 5BCAA 1Z5LB 4M5ZH 3RPKA 2ZUTA 3CFKA 4M43L 4IS6A 5E0QA 4KZDH 1XEDA 1P7KA 1RJZB 1L7TL 2DF3A 5E8NA 2BXYA 2Q86A 3QI9D 3WFHA 5AYQA 4JM2F 3RA7H 1MEXL 4GRMA 3Q0HA 4L4TB 4QNPE 5DF0A 5BV7C 1TCRA 5I1CH 4XVTH 5CSZB 3ARUA 1SBSL 4AT6A 2GJ6A 5DMIH 2J3SA 2Y4SA 2W0KA 2RJMA 5EIQA 4KI5C 2HG5B 4LVOB 3MOAL 2HMIC 4PRBA 3U48A 2C1OB 5HPOA 2VE6A 2NY3D 1CDHA 4M7JH 3DETC 5FOBB 2BVQB 4WDIB 4ZXBA 5FYJE 4LASH 1KB5L 2F19H 3B4NA 1L7IL 3UAJD 3LS5L 4XXDA 2F5AH 1CL7I 4HJGA 3TM6A 3KYOB 5JUEH 4F7TA 4GLRI 1MY5A 2GSGA 1DVFD 3H3PL 1ZT7A 1Z9MA 1P7QB 1U2CA 3IRZA 1HCFX 4LQFH 1YN6A 1U3HA 3TFKD 2NY0B 5LWYL 1FYTD 4PJGF 4FZ8H 1INDH 2BFVH 4GAGL 2DS4A 5I1DA 2XFXA 2CDFA 2YPLA 5GXBB 4S10A 4ALAH 4D3CH 2Z35B 5BRZD 1KEGH 3K46A 4LSQL 3EBAA 4QHNB 3LDBB 3MLVL 3V4UH 5EZIH 1A4JA 5J12C 3S37H 1UACH 1A14L 4F9LA 4FQXB 2MCPL 1FC1A 5D1ZC 2QSQA 1LE5B 1C5CL 5BVJA 3HCVB 4TUOB 1YMME 4XZUA 4ZS6C 2FGWL 3TCLB 5CZXC 3QUZB 4JCLA 2Z4QA 4JO2H 2PXYC 4EDXA 1AKJD 5C2BH 4WWID 3MROB 2PW2B 3P0YL 4J6RH 4KTYA 1INEH 2AJSL 1ZLUH 1UM4H 3LB6D 1OARH 5JOFA 3U0WH 1BF2A 1V3KA 1GGCH 2ICEA 1V5JA 2B4CC 2AAVA 3AU1A 4C56D 3V5KB 4PY8J 1FH5H 3LSOB 1OTUD 3H9ZA 1QFWM 4LVHC 2J7LA 4YXLL 4JFOA 4KK9D 3FQRA 4QF1A 5T1KA 2D31A 1ZLVH 3CX5K 1ACYH 1DQJA 2BXZA 2GK0A 4HIXH 2DBLH 1ZLUK 3LV3A 3UXFA 4Z95L 3W0WE 3VDBA 3QUMA 4LLQB 5D8JL 5TDPA 4KWUA 2HP4A 3QQ9D 4UOW0 5DVNA 2W92A 2HT3D 5EUOF 3E6HA 4O58L 4F37F 1S7QA 3WS3A 5E6ID 1S7SA 2YPKA 1G6RH 4NQSA 3KS0J 1ZLVK 2L7JA 2VDLL 3VXSE 2P8LB 3BUYB 4MSWA 3OR7A 2X4SB 2P45B 4JFDB 2IPTL 4G8GB 4O4YH 3PHSA 3C8DA 4RAHA 1VADA 3MRFA 3DVGA 3KPPA 2QQKH 1T5WB 3MFFB 4OZFA 3U0PB 1CGUA 1BZ7A 3BAEL 3STLA 1I1YB 2APXA 5IHUH 5BJTA 1JNNH 3PV6A 5EFIB 4X80H 4Z8FH 1P1ZB 4QRRD 5E94A 2QADB 5C0AA 3NACH 5HY9B 1NGWB 2DI9A 1QSEA 1Q9LB 3BH9B 1KLGB 4P2QB 1Q0XL 1U91B 2EXWC 4D0BB 3DNKA 4NC0B 2YUXA 4R4FH 2YBRA 1T03L 5EIIA 5LQBL 5MEQB 2BY1A 2CIIB 3HNTH 8FABB 3BZDA 4LSPL 3MNWA 2Z8SA 5ISZB 2HTLD 2R2BB 5ETUB 2D03L 3PXJA 5KSBE 2CLVA 2ZUUA 1S3KH 4YGVA 2AI0H 3T0EC 1HIML 4P5KB 4K2UL 1CICD 2WINB 1HHHB 2FZ3B 1Q8MA 1YDPB 2DTML 4Z7WF 3TP4A 2AK4E 4YC2C 3LEVL 1QLFB 3T8XA 3QNXA 1C16A 5FYLE 4HK3J 1MRFL 3DURB 4PIRF 2ENSA 2CO6B 3S35L 2YR3A 1L0QA 1RZJC 3PDOB 5J1AB 5EZLB 1T7YA 1U92A 3MRKA 4HDIA 4P3CL 1BAFH 4Y19D 5CAYB 1UT9A 3KDMA 4LKCB 2ZZUT 4JRXE 4HZLB 3S37X 1LEGB 5CMAA 2PW1B 1YYML 4XCNA 3UX9B 1T0MA 3RFZC 1BFSA 3Q48A 4Y5VB 4ELMB 4F7MB 1NGZB 4NKOB 4I9WD 4OIIH 4RAVB 1D6VL 1ITCA 1EMTH 3FOMA 4S1DC 3VGFA 4R3SB 1F4YL 3F7YB 4R0LB 4G8EB 4PJXF 4U1LA 1EFXA 1FAKT 3MA7B 1UKTA 2BOBA 4GW4A 3QNYA 3HUJB 1JNLH 1R3KA 1CGXA 3TO4C 2OMNA 4LIQL 1JHLL 1HXMB 4XPTH 4XBPA 1RY7B 2BJML 4NO2B 4YE4L 5TJWK 4ZAKB 4PJBB 4PJ8A 2ZPKH 4U0RB 1S78C 2E3VA 4EXPX 3KYNB 5FO9A 4U2ZA 4X7EC 5C9JA 4LLWB 4HXAH 4AEHL 1NGYB 5C0RL 3QDGB 3C2AH 5JW3L 3NIFF 1IAOB 1HYSD 5EC2A 1DLHA 1PAMA 5HGHB 4DVBA 2MQCA 4LEXL 1NC4B 1SYVA 4IIQA 5CZVL 2MJWA 4XNUL 3MGOB 2UVEA 2YD5A 3DPBA 5FXCH 5HSFA 4OZ4A 1RVFH 2AEQL 3ULUE 4L9LA 3HC4L 2BHUA 3QEQD 1YEEL 4UDTA 3RPIA 1DUZB 3TBSA 1TZHB 1FFNA 4JPVL 4TULL 1CQKA 3BVNB 3ORJA 3B3IB 4HS8H 1QVOB 3KXFD 1YY9C 1U6AH 3TV3H 1ZSDB 5L8JB 4NWTL 3U7WH 1UEYA 3GIZL 4Z7UF 4MLIA 1QRND 5IJKC 5EB9A 3NPSB 4D94A 2HN7A 3FN0L 4IRJB 1G7PA 5C0EB 2VUYA 3QCVH 1N26A 5LGKA 1NANI 4NRYA 3MLXH 5I1HH 2BVYA 1KJ2B 2QBWA 2IBGA 5CEZL 3OKDA 1A9BA 5GGRY 2NCMA 3TNMB 2HWZH 4CVZB 3MLSH 4RBPH 3T2OA 5T1DH 3R0MA 1BEYL 1URLA 3H0TB 3HZYB 1WTLA 5FFLA 1L9NA 4FQLH 1EJOL 1YYLL 1ZANH 3FN9A 3ZKXB 1TVHB 3V6FB 2E8YA 3GK8L 1VENA 5C0BA 1MCPH 4O51A 4P23B 4FFVC 5CUSH 3QIWC 1DP0A 4ENED 1HINH 3SGJC 5CGYC 5TDNB 3K4AA 1I9JH 4AIZA 1CGSH 4RBPK 1HEZB 2YD4A 2ARJB 4LPVA 4H88H 4OD2A 2I5YH 4ZYKB 4KXZI 4JKPL 2OR9H 3BDBA 1RU9H 3V4PL 2HJLB 3LMJH 2X6MA 2CKNA 3BHBB 5IFJA 4OZIB 1VA9A 4YGAB 2HJKB 1I9RH 4C54A 3UTQA 4AG4H 2D7MA 4NNXA 1MAKA 4R8WH 1VKXA 2Q76A 5GGQL 4TVSa 3RWEB 3DGCR 5DRXB 3C87A 1VERA 4F57H 5GSVA 1N8ZA 3S5LG 3W11D 1A1MB 3FB8B 5BQ7B 3KYKL 5B38B 3Q1SL 5MEPB 1JF6A 3DX7A 4TSAH 1H8SA 2QJDA 2B8OT 3DECA 1MHCB 3SDAB 3GSVA 2DTSA 1JWMA 2X1OA 2NY0D 4QT5B 5I17B 2A73B 1Q1JL 2NY1B 1T4KB 1IGTA 2GJZB 3H8NA 3U2SA 5IIEA 3ARBB 2VDQH 4EVNB 3HZMA 3QUKA 4X7DC 2EYRB 2C1PA 4PJDF 3BQUB 2GKIA 3T4YB 5TQ2H 4E42A 4KPHL 1VFAA 1EEZA 4FQXD 4P5TC 2J8UE 1HH6A 3F7RA 4EI5C 1T1XB 3ZSTA 5DQDL 5T1MA 3FRPG 2QV2A 5D7KD 3SO3C 3QO1B 4D8PB 5JIPA 3QUZD 1MPAL 1DQLL 3PGDA 1AGFB 3JTTA 1JZ4A 5D1XC 1YEJH 2CKBH 3VGDA 1OPGL 5KW9L 2PTTB 2BSRB 4MJIB 2E7LA 4YAQA 1YMMA 3OJDB 4HIEB 4ZTOL 5HYJD 4ZUWA 4NZTL 2B2XH 5KVGL 3Q5TA 1MWAA 1HQ4B 1AFVH 1HQRB 2VLLA 3ARGA 5KZCD 4PLKD 2AV7B 1FPTL 3IAQA 3ARDB 3WFEH 3CFIC 5EOQH 3CSPA 4CMMA 1P84K 1JHTA 2WWMD 2HVKB 3QWRD 5DEGA 1MH5B 1XF3A 1A3LH 2J5LB 4KMQA 3MODH 1BQHG 3KJ4B 5F97E 4ZUUA 5DQ9A 1LO5A 4BUGA 1IJ9A 2ICWA 2W9DL 4NYLB 2JJSC 3IB4A 3CVHB 3WN5A 3SHSA 1CLOL 3RZCB 3L3DA 2BVOB 4Q97A 3BZEA 3QA3B 3DX9A 3DMMC 5KVMC 3BIKB 4O02H 5TF0A 3NZ8A 1U8PB 4NO0D 4M7KL 5HHXH 5TE7L 3RHWK 3W0WA 4OLYH 1A1OB 2HKFL 2FX8L 2LFGA 3WE6A 4V1DD 5DSCA 2FJHB 1CFBA 3OZ9L 1A5FH 4JFDD 2A9NL 4G8GD 2YN3A 5DJ2A 1LDPH 4POZD 4ZO8A 3F7VB 3QIBC 4NDMB 3EDJA 4KAQL 3V0AC 1FN4B 2QSVA 2H26B 1T1WA 3JV6A 3ROLA 3RVWD 1F90L 1MVFA 3AROA 3WLBB 3VXSA 1BGXL 2DLGA 4ZQKA 4X5WB 3LQAH 2WP3T 4AMKL 1ONQB 2QHRH 5IMKA 4QHMA 4G6AC 5D1QB 3I50L 4OZGF 1GZQB 1U8HA 4JFHE 3LPGA 4M1DL 2E9BA 5F3BB 1FIGL 1RIUL 1D9KD 4O5LL 4JVUA 3UTOA 4E41E 4P2QD 5J9PB 5GPRA 1NEZG 5I71C 2ZWLT 1DBML 3MCG1 2XA3A 1X5XA 2VLKE 3IDXL 1YUHA 2AKRA 1L0YA 4HKXA 3M17A 5ISZD 1I8LC 1Y0LA 2HRLA 3NIGF 4M7LL 1HHKB 4ODVL 1JUFB 2LABA 2YC1A 1CWVA 4MD4B 2ERJB 5IJKA 1I7ZB 4NKMB 1S9VA 3FB7B 5I6XB 1KGCE 2NY2D 5SWQB 2VXTH 1ADQA 4XNYL 1R5WA 4JG1L 3UO1L 3FL7A 1MCRA 2PYEE 3FT4A 3MBXL 3NH7H 5ANME 4UDUB 4GXVH 4NNPH 1CR9L 1I7UB 2AK4A 4G42A 4HHAB 2UWEF 1FGNH 4BFGA 2XACC 5J11C 3C5ZB 4UIKL 1R5IB 5ICZA 4PRDB 4Q2ZA 2GY7B 1ZHLA 4YQXH 5IBTH 3LIZL 1B4JL 2FWOB 4XPFH 3LHPL 1T20A 2PKDA 4YLQT 4MCZB 5IW1B 1T21B 2UY7A 4J8RB 4XNZB 4JRXA 4JKKA 1X5LA 3LVEA 3TCXA 5LKNA 1TXKA 4TNVK 1GRWA 3VU2A 2CLZB 5ILTL 4AH2A 2H9GA 25C8L 2OJZH 1UM6L 3CAFA 2MHAB 1JMZA 5KOVC 4GQ9H 3BKCL 1ORSB 4D0DB 3SKMA 2P5WB 4XWOC 1GHFL 3MNZB 5DK2A 4Z7VA 2AW2A 2X10A 4ORGA 4P57B 3WUWG 1XF2B 5I2IA 1LK3H 3D39B 2ZKHL 3BH8A 2XN9B 3OJVC 4FXKB 2DQTL 3AS3A 1N59B 1BX2A 4GFTB 5ACZB 2WQRA 3HMXA 3QDGD 2PYFB 2W0FA 3T3PF 4OKDA 1HNGA 3HB3D 1TFHA 4LKXB 5F6IC 2B1HL 1NC4D 5E8EB 3FONB 3ZHLA 1M05A 4B53A 1T0NA 5EN2A 2Y7QB 2JJTC 1Q94A 2NY5C 2IAMC 4HFUL 1D5ZB 3NIDF 3BP5A 5H94B 2FIKA 4WHYH 5HPMA 4O2EB 3MR9A 4WJ5B 4NSKA 3QWOB 1MF2L 3RGVB 2NW2A 3BXNB 4OI8A 4WNQA 5I16B 4PJCE 3GEWB 2AXJA 4GBXD 3H7LA 4P5TA 4UNVA 2XI9A 4C83A 5I18H 1RHHA 3VI3E 1IGYA 1AGBA 4WO4A 1UM5H 1HZHH 3LKSA 3K8LA 1RUMH 4HFWA 2AP2A 4ONOA 5D1XA 1PW3A 3VMNA 2CD0A 3OGOE 5AZ2L 5A2LH 5KG9B 2R1XB 1N6QL 5CGMA 3SOBH 4ELKB 1Q9WA 2W9EH 5I8OL 3C6LA 2OR7A 2IC2A 1KPUB 5EBWA 4J1UB 2EE6A 4OI7A 5FDWB 5DJ0A 4MVBD 3U7AA 4P23D 5INDB 5M7QA 3LZFL 4XAKD 3VXNA 5IG7B 4BSVB 4Y2DB 2B39A 3V7AE 3UTSE 4HX1A 4EUPG 1DLFL 1K9TA 2IBZY 2OTWB 4HWBH 3BPOC 3BW9A 5D72H 2ZG3A 5CWSA 1ZHBB 1RUQL 3ZLQC 1E6OH 3EOAA 2VQ1B 3CK0L 3PWLB 2YKLH 4M48H 1AR1D 4MA7L 1FVEA 4KMLB 4Z77A 5EOCL 4K7PL 1CD1A 4WCYH 4NZRL 1A22B 5TH2B 3D2UB 1R0AH 3QHFH 3ZL4H 3H3KA 1T2QH 3TT3H 1EK3A 3RTQC 5DVMA 2A6KA 5A16A 3OKEB 5DD0H 2I07B 3Q2CA 3MXWH 3SKOB 4ONFH 3SDAD 4UNUA 1S5HA 1MCSA 1QTYT 3QIUB 5BVPH 3EYQC 5I1GL 4QXGL 5ABDE 2QQNH 5BMFH 1LEKA 3L3OB 2D7TL 3RJQB 5C3LD 4NZUH 1UA6L 4QY8A 3SY0B 1WF5A 1A02N 4KV5F 2IGFH 3ARBD 3U4EB 3AREA 2A74B 4OCSH 2VJXA 3T1FB 4MNQB 4ETQA 1YNKL 3HZKB 3UYOD 3PWUB 3GDBA 1IGFH 3BQUD 1V7MH 3UC0L 4G7VL 3SE3A 1A0QL 3N1MC 4LHJB 3OG4B 3BPLC 2DQDL 1TZIB 3BDYL 4EI6A 2E9IA 5IMOB 3EGSB 5B22A 2FH6A 4Y8DC 2Q7NA 3L3GB 3MRBA 5I19L 3OAUL 4X8XA 3GSRB 1JPTL 1VEPA 2WMPA 1EJ6A 4XPAH 3HZVA 2J8UA 5TE6H 1P6FA 1MQKL 1CYGA 3KG5A 4MJID 3IVKA 4LLYB 5EO1A 4X6CF 3NA4A 32C2B 4XPBL 1BD2B 5T1LB 3KGRA 4LARL 4KH2A 5SWSB 2P8PA 4OD1H 3W2DH 3WSQL 2CUMA 3ARDD 1EHAA 2EE9A 4NJAH 4MGXA 3OKOB 4DQOL 1OAQH 4YX2L 3QSKB 1MUJA 3F5WB 1CDJA 4LSRL 4YHML 5CJXA 3SDXB 1YNLH 4NQCE 3RKDC 3SGEI 5HVHB 1NAML 5EU3B 1ZWIA 1JWSB 4ZS7H 3OF6A 1XH3B 1FGVL 3HN3A 3VGEA 3VD5A 3PL6A 1IGML 3X11A 4XCYA 4LCWE 1QA9B 4PFEA 1HHGA 2QR0B 4MB4A 2P44B 1T22A 2GIYA 4NPYB 4MNGE 5CBAB 4TOYH 1VACA 1ZXQA 3IU4L 4Z7NE 1TZGL 3WO3B 4ZPTA 4MXWH 3RGHA 1HXYA 1OTSC 1I3RB 4YO0A 1MRCH 4PTTB 3NN8B 3G6JF 3UP1A 3VWKB 43C9B 1I75A 4KDTA 1P7HL 5ENWB 4M1CC 4NN6B 4O2FB 5KSVB 4N1HB 4Z5RB 1ES0B 4WI8A 4KJPD 3HFMH 4Y5YB 4K3HA 3LOWA 1H15B 5JPNB 4P59L 3QHZL 3KPLA 3WDJA 2FO4A 4LCIH 2Z92B 4P2OC 5D1QD 1NEZB 5FO7A 4MA3A 3T0AA 2AJ3B 5IGXL 3E8UH 4PJ7F 1NUGA 4WW1B 4ZOCA 9CGTA 4WU7B 5KN5B 4B7IA 3NFSL 1FE8H 2QQQA 3U6RB 1N5YH 1UH4A 1PKOA 4J4PD 4JE4B 3DX8A 4OFYA 1YY8A 4NN5C 5KAQG 1UCTA 5JXAL 4XP4L 3RNQA 4DKAA 1W72A 3QUXA 4EQ3A 3DIFB 5KVFH 4E41A 3MRLA 3SKUD 4NC1E 5JOPD 3S4SG 1VSCA 1VGEH 1QSVA 1I7RB 4ZD3L 3QYCA 1X5GA 2VLKA 2CXKA 4ISVA 2BNQE 4NQEB 1OAYL 4XCFH 3NGBB 1JGDB 2NXZD 3IJHB 5IT2L 4DTGH 4GG8B 3EYFA 2F53E 4K71C 2BVPB 3JWOH 3VA2C 4W6XB 3FT3B 4Z76A 3IU3B 3S8WA 3EYSH 2ESVE 2PYEA 2P5EE 1BZQK 1KBGH 4GMSL 5ANMA 4NC2B 1WTGT 3PF2A 4LRNL 3OR6A 1YQ2A 3EHBD 1OGAB 4DW2L 5MEOB 2CUHA 1G7QB 2GSIB 4HLZH 4QCIA 2LTQC 1KJ2H 2AXGA 2OTUB 3MMEB 5AEAA 2V9TA 1JN6B 5JOEA 5JR1L 4JRYD 4HH9A 4OZHF 1FNGA 2JCCF 2AJXH 5E5MA 3UBXG 4DGIL 1WFNA 4P46D 3WUWB 4YEEA 1CXFA 4M7ZC 1DQDH 3UJTH 3T65B 3QZWG 4M6NH 1ZGLA 3S3PA 3O2WH 3O8XC 5ID0B 4LFHD 5DFWH 4OD3L 1R3LB 3VXMA 1RZGB 1FLRH 3D39D 3C08H 5A2IH 2GHWB 2D0FA 2XN9D 4XP1L 4U2YA 3KAAA 2R0WH 3S96A 1T80A 2E7BA 1B0GA 3DJ9A 5E2VL 4FTVB 4LF3A 3H9HB 1BZ9B 1PLGL 2EZ0D 4URTB 4YDVA 3KPNA 1BIHA 2J6EL 5DTFB 4KDWA 4PPTA 3FAXA 4WUKL 4HIIB 1I8KB 1PKQB 4H8WH 4JM4L 3W39B 2XZCL 4XRCA 2FR4B 4KKCC 2R29L 5C6TL 1EGJH 4HUWB 3BO8A 4UIMB 3OXRA 2DRUA 2EEDA 4X8JB 3DI2B 4U1HB 2RHEA 1ND0B 4RQQA 1FYTE 3RVVD 5L2JA 4M6ML 1WEJH 5KVEL 1TNNA 1ZLWH 3IDMA 5C9KA 2ADIA 5K9QI 1J87A 5BRZE 1T83C 3QNZB 4OLXL 5ICXA 2MCG1 3NABL 2VR5A 4JB9H 2B5IB 5B8CB 4TNWK 3SEPA 1K2DB 3FRUA 3TBWA 1FFRA 4FFYH 5D93C 4XNXH 5FYKH 5DJYA 3UJIH 4PJCA 5I15H 3NAAH 4GRLB 4NUGH 1YECL 1KB9J 1IKFL 1JCKA 4KY1L 3TN0A 2IPUG 3V2AR 3EOTH 3EYOB 1ZLWK 4OV6F 4PR5A 5F96H 3WIHL 2FL5A 4XCCL 1X5KA 3Q6GL 1F8TL 5J13B 5CS7A 2LU3A 4U6YB 1MELA 2R9HD 4YHZL 3ULSB 4PJ5B 4KGJA 5KSAB 1HHJA 5J1TC 1SJEA 1K85A 4LDEB 2XY2A 5ADOL 5KOMC 1G0YR 1NBQA 4ZFGL 3QCUH 4XH2B 3ZDXE 1G9ML 1LILA 3EJZC 3FZUC 4OGYH 4AL8L 3B9AA 4MX7B 1KXTB 3QJFB 3VDAA 4WUUB 4Y2DD 3CMOH 4S0SD 3DTXA 2WBJD 3T0WA 4GW1B 3F12B 4N0YL 1IEHA 2Q1EA 1MCKA 4JFYA 5IB1B 1HH9B 5FF6A 1NBYB 5JMRA 1M7XA 1NUDA 4GG6B 1M6OB 3NPZB 3TWCL 1DSFL 3UTSA 2PO6A 5DXWA 3K2UL 5MERB 1XGRA 1ETZA 1KB5H 3OAYH 1FNHA 5GRJH 2ED7A 1A7NL 1BJ1H 4K9EH 4W70A 1JV5A 1MFAH 2KBGA 4QRTB 3GSNB 1W0WB 5IJVA 2AVGA 1UWGL 1I1AD 3FFCE 2E5EA 3QIUD 1T66D 4OBRA 4XVJH 4JJ5A 2XWJA 4MJ5A 4LGPB 5I8KH 4TRPH 1RURL 3ARFB 4F2MB 1DL7H 4I0PB 4QXUL 1C1EH 1CDUA 4FZEL 2B1AL 4GS7C 3OAYK 4RGOH 4WV1C 2OYPA 3OXSA 3UAJC 4LSQH 4MQ7A 8CGTA 4MNQD 5FGCB 4ZPVA 1T5XA 5FECB 2V2XB 4QGTA 4W4NA 4QRRE 4Y89A 5T33L 3MRRB 4Y16B 4FQ1L 3FB6B 3P9LA 5H35A 4Q74A 3M1BA 5I73C 5D7IB 4P2YA 3GHBH 1RPQA 3TPUB 1CTNA 2Q8BH 3TFKC 1FRGL 4TQEH 3U9PH 2BSSA 2OQJB 5HHNA 4Q9QH 4I5BB 3L5WA 5FHBL 2VC2H 4PJGB 3DO7A 5D7SH 3P0YH 4P4RB 4PBVC 2VDNH 1F3RB 2AJSH 4PGDA 3TBYB 3WEXA 2X5PA 1F42A 4X6DE 5DEZA 5T5NF 4YXHL 5K9JL 3QEHA 2BDNL 1FZJA 5T1LD 2FHBA 3JTSA 1S5IL 2HH0L 1JNJA 1OSZB 2L7UA 2NNAB 2EDYA 2NTSP 3G9AB 1U93A 3LEXB 3RDTB 4YXLH 4R4BA 1DBKH 2RFXB 5DC4B 1WISA 5F3HA 4KUZH 1JZ6A 3BE1L 3UPRA 2EDOA 2WUBH 3D18B 5HJ3A 3MRJA 4GKOA 5M95B 3ESVF 5E08H 5H37H 4Z95H 5HI5C 5LJYH 4Y19E 4WHDA 1QSFD 2YWYA 3LB6C 3HA0A 3HNVL 1EEUA 2EYTB 1RIHH 1RQ5A 4BK4A 5GRZA 1OY3B 2XY1A 4NQCA 1HNFA 4OV5A 2CJUL 3CFBB 2HKHL 4X6BA 4IMKC 4I9WE 3CPLA 1ZGLM 2WSKA 4WI4A 1RZ7H 3DRTB 4DGVL 3J8F7 2GTZB 4HJJH 1AHWB 1G6RA 4LCWA 2VRAA 2IPTH 3VWKD 4OFKA 4MNGA 4BZYA 3WLWD 3KHQA 3GMQB 4FQCL 1WC7A 3C60C 1YN7B 3MRNB 4XP9H 4AZ8A 3IAGC 4JO4L 2HT3C 4H26B 4PLJD 2G5BA 3R0NA 3VFRA 4UBDD 3BKYL 4M61B 4U1SA 5T3ZD 3RVTC 3LN5B 5KS9E 4DK3A 4RGNB 4RCAA 4HULB 4NKQB 1ZT4A 1DBAH 1HSAB 1KTDA 3H9YA 4N0FA 2VNCA 1AGEB 1VDGA 1RZFL 2DMKA 2VTFA 1WSST 3BZ4A 4FP8H 4PGCA 5D70L 1P5UA 1SVZA 3PWNA 4RMQA 1YZZA 2H3NA 5CJBA 3QJHB 2P46B 4LSPH 4KHXL 3U36B 1IAIH 5E8DL 3QEQE 2V2TB 4FFWD 2CMRH 4XBGA 5HDBE 3QULB 4RDQG 3GSXB 3KXFE 2VITB 3VFUA 4FS0A 5E99L 4NQED 3MCKA 1W2KT 3CFEA 3CGTA 4ODWB 1C5DA 3BWUC 3SE4C 1QRNE 5E2WH 5HHPB 1I8MA 5TDOA 3RRQA 1A2YB 4MAUL 3OKMA 3P77B 4P3CH 2R2HA 2BNQA 2HTLC 3C8HA 4H20L 4DZBB 2QQLL 3O9WB 5HHMB 2F53A 1DQQB 1AIFA 3PIQA 4OGXL 3UBXB 1DEEA 1A6WL 1OGAD 3PQYB 1J1PH 4RNRB 2W65B 1XCTB 5D2LE 5CJ8A 4AENA 2ESVA 4PGZA 2P5EA 3QZWB 1U8LB 5JTWA 3TYFB 3SGKA 5CCKL 4JKLA 1SJXA 1GCFA 1R3JA 4JHBA 5E2TL 1JGUL 3O4LB 1XMWA 4HMCA 1WBZA 4KJWC 1FORH 5IP4A 3WJLC 2VQUA 4G9DB 2AK1H 2VDRL 4ODXA 1EA9C 5L88L 2A0LD 1FNSH 1VCAA 1CFTA 1MQ8A 1EHXA 4HS6A 4FTVD 4HGKC 4Y2OA 3GMLB 3GHEL 3QI9A 3V6OE 4W4OC 1JF1A 2APVA 3MLWL 4OBSA 3EJYD 2GUOB 5D71L 5ESAB 4ZDHA 3KPMB 2BRQA 4QNPF 4TN9A 4XNUH 3RP1A 4ONGL 1S9XB 4NHUA 5C0GA 1WT5A 2R0ZL 4RWYH 4DGYH 3F6LA 3HC4H 3FN3A 4HUXA 4RMRA 3SQOL 2YWZA 3JZ7A 2IQ9L 3CFJB 4JLRB 3A6BL 3B9VA 4Q6IB 4TULH 2NLJB 4LHUG 4WV1A 1IQDB 1WGOA 1RIVH 1HYSC 3O0RH 4JQIH 1ZLSL 3IFPA 1EUUA 2F58L 3GIZH 4JGMA 2A6IA 1X6LA 3GMPA 1QFOA 4GMTH 4CVXA 1DVFA 4L8CA 4S1QL 3FN0H 1Q38A 3JBG7 3PP3H 4KRNA 1B0WA 3FQXA 1KPRA 1DN0B 1TPXB 4GO6B 3TA3B 1F4WH 5IM7B 1OCWL 6CGTA 5J6GA 2PTUA 2R23A 4PGEB 1Z2KA 2N7AA 5CEZH 5C09B 2P7TA 3GKWL 1U8OA 4HUUA 4JKWA 4APQC 1JZ8A 4GRLD 4P49A 1JTPA 5BRZA 2E7MA 1LO2L 4BZ2H 5D7KE 3ES6B 5DD3L 3BP4B 1BEYH 3O11B 2GJJA 1F58L 4PG2A 4U1GB 1JZ7A 2FEEL 4PP2A 3BP7B 4F15C 1YYLH 5DJDB 3PP3K 3VW3L 1VFUA 2P4AB 5I75C 4QHLB 4IJ3C 5HYJE 4KQ3H 5KSAD 5JA9A 1JGVH 1SHMA 5D96B 1MSPA 1AKJA 5KJRH 3OL2A 1S8DA 1MLCA 5GS1B 3TESA 4V2BA 4WUUD 2WNGA 3HR5B 1TVBB 4IRSC 4MA8L 5DD5L 4PRAB 1W0VB 1JRHL 4YBQD 1MJJB 1M71B 1RUKL 5FCUL 2VXQL 2W59A 3V0VA 3HLAB 4IMKA 3IDIB 2VDKH 4X98A 2I9LA 3EO0B 3IRPX 3NFNB 4YHKH 4ENEC 1BWWA 2DLFL 2O93L 1KJMA 2HFFA 2X4QA 3D0LB 1GOFA 1O7SA 2EIEA 4HKJA 2OSLB 3NCJL 4H5SA 4PGJA 1SY6L 3VFWB 4MDIA 2VABB 3ZE0E 1NCNA 1PX4A 2ORBL 5D6DC 3SJVB 3DARA 3QUYB 1RJYB 4JFDE 2E8ZA 1JGLH 4G8GE 3LKRB 4ZFOB 4ZO6A 5E6IA 4A6YL 3P3YA 3MREA 3GMMA 3HHRB 1PSKH 5T1KD 2VR9A 3ARFD 4I0PD 3IJYA 4LHQB 1RK1B 3X3GL 1ZHKA 4OIAA 5J6HA 1G7HA 3FFCA 3W11C 1YEFL 1FL3B 1FAIH 4X6EA 5DHYA 5C0FA 4MS8D 4EN3B 3RWCB 4LP4A 3ARVA 4Y16D 3IXAB 3G04A 4JM2C 2YD7A 1A6UL 1IL1A 2FEEI 2KZ1B 4LMQE 5IR1A 1QFWL 3D69B 3IAPA 5FKPA 3WKNA 3MJ8B 1WVZA 4P2QE 1JGEB 1MPAH 3SKNA 3A67H 4QRRA 5EORL 3WNOA 2XPGA 4X0KB 2CLRB 3ULVH 2CKBA 3Q5OA 1LD9B 1BLNA 4IMLB 5DYOB 5A3IC 5EU6B 5ISZE 4R2GB 4Q9RL 3AXLB 3IKCA 3PHQB 3MRGA 3QPQC 2AJYL 4FQXC 5F9OH 5F9WC 1JPGB 3SE4A 5HD8D 3L9RB 1UZ8B 2ZOLA 1KPVA 1DUYB 5IMLB 1WFUA 4MYWB 5F89A 1L4IA 4LCCB 4X6DA 4ZTPH 4FNLL 1RAMA 2W9DH 3KLAB 3QEGH 3KWWA 3ROOB 4I2XB 1CICA 5EU7E 1CE6A 5HVFB 1QSED 4NRXB 1NCWH 3P11H 3VFTA 3NFPA 3VG9C 5ESQA 5T5FL 4CDGC 4XP6H 3FQWB 4YH6A 4S1RL 4HCRH 2BRRL 3ZTJG 4ELME 3FOLA 4M7KH 3ZDZE 5TE7H 1VGKB 2F15A 4IOIA 3D48R 3BGFC 4U1MB 4Y19A 4P4KC 3F65A 1DQMH 4I0KA 4QRUB 3ZT7A 1B2WL 2VERN 3I6GB 5EU4B 4N1EA 2A9MH 3HPLA 3WHXB 3OZ9H 2DQEL 1YQVL 1UVQB 5IQ9A 1I4FA 2J8OA 2XNAB 4NO5A 3HUJE 4M8QB 5I1LA 4Z7VF 1D5XB 5ACLA 3C5SA 4PJBE 1QFWI 4NM8L 1MAML 3FCTA 3VXRB 3QDGE 1RIUH 5DEFB 1QOKA 4POZC 2ATPA 1FHGA 1GVIA 1HOCB 2MQ3A 4MD0B 5KS9A 2OK0L 4X99B 5E2UH 3RVWC 4JG0H 5EOCJ 3L5XH 4WY7L 4PREB 2ZNXA 2ZUYA 4BH7B 1EFXD 1MJ7H 2EKSA 1FYHB 4X7TA 1VEMA 4LSTH 4ODVH 4PJFB 1OAZH 5IF0A 5LGJB 3QG6B 3WKML 4LSUH 5EZJA 3OTTA 1D9KC 3UO1H 3ULUF 3QEQA 1CFQA 4JFQB 5TPWL 2X4UB 1MCQA 1DFBH 3ZMRA 4JY5L 5C0DA 1UWEH 3TIDA 3WFCH 5SWZA 5CINL 3SDDA 4PB9L 1HI6A 2EDQA 2DQIL 3EYUL 3KXFA 2BHYA 3QT2A 4TSCL 5IHZA 2AQ3A 5JXED 1QRNA 3O9WD 5IW6B 1TJHL 1MIMH 5FYKU 3DROB 1Z3GL 4XB7A 5HGDA 5JPMB 1B4JH 3WO4C 4QXTA 1O5DT 2NY2C 5JW5B 1NMCC 4QRQA 3LD8C 2V17H 3B9KB 2X9WA 2CGRH 4GT7A 1OD7A 3MACH 3AUVA 5I1EL 5EU7C 1P4BH 4KDVA 4NQVB 5ILTH 4F7CA 2R1WA 4U1NB 4Z7UE 4MB5A 1U2HA 3LEYL 2WQ8A 1AXSB 3O4LD 2VZOA 1G9NL 4UQ3A 5J0BA 3V9FA 1QHOA 1RULL 1X5YA 2HA1A 5D2LA 4XAKE 5L6YL 1WBYA 5DUPL 3MRCB 1Z5LA 4YXKH 1U42A 1IKNC 3QEUB 4PRHB 4UILH 1LO4L 4DFIA 2APTA 5DRWB 4EUPH 3UTPD 5E5UB 1IC5H 4JDZB 5JHLL 1U3YA 4L29B 1RJZA 4LPCA 2WIMA 5A2JH 1O7VA 1KFAL 3KPRB 4OZIE 4GSDH 1HHIB 1AY1L 5CSZA 4XPGL 2DQJL 5E56A 1BBJB 4FQJL 5GRUL 4DVRL 1NH6A 1ZTXL 3V6OA 2HG5A 1QP1A 2C1OA 4LNVA 1LGVA 1GYAA 4QRPB 2X2YA 1GGYA 1KLUB 5FOBA 2BVQA 4NUJB 4WDIA 4L8SB 1NBVL 3WHE1 4XB8A 1KTKE 2KKQA 3DSFH 4K8RH 3O6KL 3HB3C 4P0DA 5F93C 3GBNH 3KYOA 4LU5L 5FYKE 3GSNH 2R0LH 3LCYA 3R1GL 4NT6B 1GOGA 1P7QA 5FGBC 5ADPH 4I77H 4DKFH 5F1KC 7CGTA 2C3XA 1H5BB 4EOWL 4P9HH 5CIPB 1ZHNB 4MA1C 3KR3H 3QUML 5J3HD 2Z35A 2BZDA 4R4ND 4QHNA 3BPNB 2ZSVB 1NQBA 2YUVA 3IT8D 5TQ0L 1Z6JT 4X9BA 4GBXC 4KTEL 4FQXA 2ILLA 5FYJD 2Z93B 3PWVB 3U7YL 4YDLB 2J8UF 1I3GL 1LE5A 2FEDD 4MJ2A 2XQYG 4MJIE 3HCVA 4LBEB 4TUOA 2XXCB 3NCMA 3TCLA 4U6TA 2ZNWA 3GNML 1YC7A 3QUZA 5K9KB 2DM7A 2OJEB 4BQ9A 4RZCB 3LZFH 4PJDE 3VXQB 3MROA 2PW2A 5GSRB 3U4BL 2FLRT 1MFBL 5CILL 3U83A 3ME0A 3PGCB 4JFXB 1DLFH 1WZKA 2Z8RA 5GJSH 2EDDA 4TTDD 5EBMB 4JY4B 1OL0A 3V5KA 4NGHH 5GS0H 3RUGB 4HWBA 3EDEA 4G9FB 3LSOA 5DT1L 4MVBC 4FHBD 2WW8A 1CD0A 4MA7H 4K7PH 2HJFB 5IKCB 2XQBH 3FQTB 1R3IL 1RZKH 3E3QE 1KTLB 1OP9A 4N1CA 4LOUC 4LLQA 3PWPB 4GW5B 1GC1H 3NMEA 5D9SB 3S88L 4NN7C 3W9EB 4JQXA 3H42L 4PY7B 3SJVD 3QUYD 1UB5B 4QXGH 1MY7A 1QPXA 2IQAB 4K3DL 4YHYC 4GUPA 3MCLH 4OF7A 3OQ3B 2YD1A 4Y4HC 4YFDB 3QXUA 4ETYA 2P8LA 1IC7L 3BUYA 1J1OL 4OCLC 2X4SA 4LLAA 3RIFF 4JFDA 4BH8B 4G8GA 1A8JH 1NPUA 3RU8H 1A0QH 4IDJL 4EN3D 1U8IB 2PCPB 3BDYH 1T5WA 3LH2H 3MFFA 3U0PA 4YFLF 4TSBH 1I1YA 1B3JA 2Z91B 5I19H 3OAUH 1MIEL 4M93B 2PETA 5EFIA 1JPTH 3AM8C 1P1ZA 3LPFA 5A43C 3SGDI 4QRSB 3I9GH 2WIIB 4ZSOB 2P8MB 3BQUC 4OCYH 4I48B 5HY9A 1NGWA 5EU6D 4BYHA 5KVDL 4R2GD 3HE6B 4JN2B 3AMKA 1Q9LA 1ZT1B 1KLGA 3BH9A 4P2QA 5GRVK 1U91A 5JOPE 4D0BA 1CU4H 3LN4B 2DI8A 1BMGA 4X7SL 2IANB 3VGBA 4E9LA 2ZJSH 5MEQA 3UYRL 1MCOL 2CIIA 4MWFB 3IFOB 8FABA 3HE7B 1IT9H 4Q6YA 4DQOH 1P5VA 5ISZA 1T7WA 4OZFG 2R2BA 4YX2H 5ETUA 5DZLA 4BQCA 3A6OA 2OI9B 4N0CD 4FA8A 1S7XB 4P5KA 1CBVL 1MFDH 1G9MC 2WINA 1HHHA 2DLEA 2FZ3A 1YDPA 4Z0BL 4KI1A 4IHOB 4N0UB 1QLFA 3GM8A 3DURA 1BVKB 5I0ZA 1U8QB 2IMNA 1I3UA 4X9IA 4QHKI 1DDHB 1YEIL 3PDOA 4NJ9L 4I8DA 5J1AA 1WV7T 2MWCA 5EZLA 1CLCA 3BOVA 4LKCA 1A7QL 2Z8WC 4HZLA 1LEGA 3ZT5A 2PW1A 4XGZB 3MA9H 1HKLL 4Y5VA 4ELMA 4XX1E 3P0VL 1JVKA 1T7ZA 3UZEA 4B7LA 4F7MA 2A6DB 1NGZA 4NKOA 1LO0L 4OLWL 4RAVA 3U9UB 2Q3AA 1MHHB 2WV3A 4MD5B 1JHKH 5EUKB 1NCDL 4R3SA 3NZHL 3F7YA 4R0LA 4DN3L 4P59H 3E3QC 1FDLH 4G8EA 3D39E 3IF1B 2XN9E 3MOQA 2IWGA 3MA7A 3V5DB 1T6WA 4NP4L 5IEHB 3INUH 3O3DB 3HUJA 1ZEAL 3BD4A 3VXRD 2NMSA 4M62H 1HXMA 5F7FA 4NO2A 1MFEL 1X5FA 3RI5K 4ZAKA 4PJBA 2R1YB 3ZDYE 3O2VH 2OXGA 5C3TA 4NQXB 5JO5B 3MV7B 4XP4H 3KYNA 5EA0H 4K7PX 1DBJH 5E95B 2VDOH 4LLWA 1NGYA 3QDGA 3GUTB 1IAOA 1U3JA 5HGHA 2B4CL 2YN5A 3BJLA 1YEKH 1NC4A 3BZFB 5B21A 3X12B 3MSPA 3MGOA 4MQXC 2V5RA 4GKZB 4MDJB 3AAZB 3ZHDA 3VJ6B 3UJJL 1JL8A 3OKYA 1PZ5B 5FGBA 1DBBH 1DUZA 2FECI 1EO8H 1TZHA 4U3CA 1V7NL 2Y06H 3BVNA 1RUAH 3B3IA 3OB8A 4WW2B 1QVOA 1J05B 1KIUA 3PP4L 1JZ3A 1ZSDA 2BSTB 2HVJB 3QFJB 4K94H 4HT1H 5DO2C 1MCEA 1TJGL 3DV6B 4PJCF 4UT6L 2NY4C 4IRJA 4LRNH 5EWIL 2FX7H 2P43B 2VL4A 3VI3F 4DW2H 1A3QA 1P4IH 5C0EA 3K4ZA 2NXZC 1AQKL 5F7HA 3B9KD 2EE3A 4KROD 4P5MB 1PBYA 1BVLB 1ODAA 1KJ2A 1I8IB 1FSKC 3ULUD 1N7MH 3TNMA 4CVZA 1FNLA 1R3HB 5I1JL 4RA0C 5D2NB 3H0TA 3HZYA 5CZKA 5FYJL 4YR6B 2XTLA 2AEPL 4K3JH 4WO4D 4MAYC 1SEQL 4PRHD 3R8BB 1TVHA 3V6FA 3D85B 5E2VH 2O61B 4P23A 5DUML 1NCBH 5TDNA 4P46C 4XNMB 1GGBL 2YHGA 5I1IL 3KPRD 3MLYL 4G6JL 1ZS8B 2IALB 1HEZA 2XRAL 5IMMB 1KG0B 2ARJA 3VRLE 1IEBB 2W0PA 4ZYKA 1M7IB 2M8XA 1SQ2N 2HJLA 2EDJA 2XV6B 4DAGL 3BHBA 1AJ7L 4OZIA 3SDYH 1FO0B 15C8L 2HJKA 4QRPD 3ILQD 1UXWB 2VZVA 3VFOB 2NR6C 1EGJA 1F3DH 1PEZA 4PYHA 3RWEA 1CGYA 3L1OL 2Y72A 1H3GA 5DRXA 5JW4R 1MWAL 3LY6A 4XXCC 1QG3A 3FB8A 5FM4A 3WL9B 5BQ7A 1IGIH 5B38A 4NOBA 1RZJL 2R69L 5F9AC 5MEPA 3VXOB 2VZ3A 5C92A 1TQCB 4OLXH 1MHCA 3NABH 3SDAA 4MNQE 4N9GB 5BW7C 5ITFB 4E0RB 4OGZA 4QT5A 4WU5B 2NXYB 2X70B 2A73A 3VWJB 5I17A 1T4KA 2GJZA 3GSOB 1NDGB 1VESA 3ARBA 4EVNA 4X4ZA 1JJUA 3VFVB 1U3ZA 3MZTA 2EYRA 1I9IL 1NCCH 3BQUA 2VAJA 3BGAA 3RVVC 2UVFA 3T4YA 1NBZB 3V7MA 1TJIH 1AQDB 2DJ4A 2RGSA 4E5XB 2YXFA 1T1XA 1OLLA 3RY6C 4ZFZB 4J23A 2C9AA 3P4OB 3QO1A 4D8PA 1FBIL 2EC8A 3C09B 3JVGA 4ZFGH 1IFHH 1E27B 5SWSE 1AGFA 1KCRL 3GRWH 4LSVH 3S34L 5LGHL 4GJTB 2PTTA 2BSRA 4MJIA 1Y6KR 3OJDA 4HIEA 3RAJH 3QXTA 3SDXE 3WHE0 1FNEB 1HQ4A 2C4FT 5DDHB 3CD4A 3EZJB 1HQRA 1PY9A 4AY0A 1NLBL 2VLRB 2AV7A 3VFPB 3ARDA 2GAZB 4G9FD 3TWCH 2HVKA 3MOBL 4DUVA 1MH5A 4HQQH 4X6FB 3I75B 3SCMC 3BYYA 3JWDH 3BT2H 2RCSL 4NYLA 4X6CE 1A7NH 4DN4L 3CVHA 4BFEA 1WBXB 4P2RB 3RZCA 4HPOL 2BVOA 2WBJC 2D2OA 5FK9A 3QA3A 2V5SA 3PWPD 5C7XH 5I1AB 4GAJH 1MJUH 4K3GA 2VDPH 5IROC 3BIKA 1KCSH 1UWGH 1U8PA 2XZQH 5ALBH 4X5XB 4NHCH 3UCRA 4Z7NF 5FGSA 3MV01 2CK0L 4XP5L 1A1OA 2Z31C 4MLSA 2ICWI 4FZEH 3MXVH 1ADQL 2FJHA 4KRMB 4XPHL 5JMOC 2UZXB 4JKMA 5T3ZE 1OVZA 3OF6D 4IDLA 2FYYB 3PL6D 4JPWL 3F7VA 4NDMA 4K3EH 2FB4L 4QWWD 1FN4A 2H45A 2H26A 3WLBA 1I1AC 4U0QB 4X9FA 4ZFFB 5FYLL 2DQGL 2RB8A 4ODTL 4X5WA 4YPGB 5D5MB 5HYQB 4NWUH 1I1FB 1ONQA 5D1QA 4DEPB 1P9MC 1GZQA 4OKVB 3KPTA 3H2WA 5F3BA 2HRPL 2Y07L 4YXHH 3HE6D 2BDNH 3QXVA 4J4PA 1NCUA 3O3EB 3MO1B 4YHOL 2HH0H 5CD5D 4XMLL 2K7QA 2HLFD 3HE7D 3CSYB 4NQEE 1FVCB 3THMH 2VQTA 3SE9H 3B9DA 1HHKA 1F6LL 1JUFA 5KTEH 1OAKL 3BI9X 4F9PC 3OKLB 1ULVA 4MD4A 1SM3L 1BFVH 1I7ZA 4NKMA 2YD6A 3S7GA 3FB7A 4JFPB 1H0DB 1MOEA 2R39A 4Y4KC 4ZNCD 4XVSL 5SWQA 1F5WA 2OL3A 4U1IB 4XWGL 7FABH 3DVNB 1MNUL 1U36A 4RISL 2O5YL 5EULV 3HMXL 5JW4N 4UDUA 4Q9CA 5MI0B 5DVLA 1I7UA 1OGAE 3OAZH 5BS0B 1DR9A 4HHAA 5J89A 3CX2A 4OJFL 2YK1L 4HMDA 2FJFB 3C5ZA 2R0KH 3HC3H 1R5IA 3BWAB 1TTUA 3K7UA 4RFNC 1CVSC 2DLTA 2FWOA 2LAAA 4MCZA 2QSCH 5IW1A 2IADB 4HZAA 1T21A 4JO4H 3IFNH 4J8RA 4H1LG 3ULUL 4LSSL 1R5VB 3QPXH 1QD0A 3A6CH 3BKYH 3FQUB 2HFEB 2CLZA 2A77H 4NO3B 1C5BH 1LHZA 2MHAA 1EXUB 2J2ZA 1ORSA 4D0DA 1J1XL 4FTVE 2P5WA 4U3XA 3KPSB 3MNZA 3VWKC 1FV1B 4P57A 1XF2A 1RZFH 3NTCL 3D39A 3CLFL 2OZ4H 2XN9A 4FXKA 1EVUA 3HI6H 4PLJC 1N59A 1N0XH 2NX5B 4UBDC 1PKQE 2VIRB 5E8DH 3U30C 1A4KB 5ACZA 1XGQB 2F5BH 5BV7B 1GGUA 2PYFA 3L3IB 5C0IB 1D5MB 4LKXA 5HYEA 1REIA 1E0OB 5HGAA 3P30L 5E8EA 3FONA 4UTAL 4Y5XC 3VXMD 2Y7QA 3CDGB 2EO1A 3NVQA 2DQCL 1D5ZA 1MI5B 5H94A 3GSUB 2X1WL 4O2EA 3N1QC 4WJ5A 2JB6B 3IGAB 3QWOA 3SE8L 1XF4B 3RGVA 5EOTB 3BXNA 4FFWC 3N9GL 3QFJD 5I16A 4R7NB 4UNTA 5IBLD 4WIQA 2FRGP 1CFVH 4OLVL 1II4E 4TUKH 2FJGB 3WV0A 4HJ0D 4BQBA 2DDQL 5GGTH 2LU4A 4N90D 1RZIB 1EIBA 3RVXC 3FO0H 5DLML 3QHTC 5CIPH 5IBUG 5IV2B 1GAFH 1IBGL 1J5OH 4OLZL 5LXGH 3RL2B 5E2TH 5SX4H 3VXUB 5J12B 4PJ5E 1JGUH 1UJ3C 5K9OB 4YHLH 1P4LB 4PJIB 5D1ZB 2VISB 5KG9A 2R1XA 4ELKA 3TZVC 5MHSD 2DLHA 3HNSL 2W38A 1KPUA 4J1UA 4R26H 4WUUE 2P48B 3Q6FB 2AJZB 5FDWA 2PXYB 4QHUB 5DJCB 2R2EB 1T89A 3BMWA 4LDLB 5INDA 3ZDXF 3GHEH 2FATL 4KQ4L 4S11A 5IG7A 3MLWH 5GJTH 3TN0D 5BO1H 4KJQD 1QSZA 1G0DA 4BSVA 5DGRA 2IG2L 5C8JB 4GG6E 1SJVA 4Y2DA 3CXHK 4BFIB 4N8CL 4IM8A 5IB3B 4ONGH 1SYSB 4UUJB 4K55A 5IROA 5A1AA 1MCDA 5AWNL 2OTWA 3S97C 4LVHB 3TIEB 1NCAL 3O6MH 1ZHBA 5GZND 2VQ1A 2WZPD 4AEIL 3PWLA 2C4FU 3DVIA 4KKLD 1ZGLP 4I3GA 5EZOH 1G1YA 4HUMB 2JLLA 1A1NB 3EJYC 5TH2A 3D2UA 4G6KH 1KJ3L 4RX4D 1QKZL 2GQHA 4GQPH 1T04B 3ZKND 3OKEA 2I07A 3SKOA 3HG1B 4KK8D 2J4WL 4HW6A 1G7IB 1AD9B 3QIUA 5DK3A 2DQFB 1CXEA 3FQNB 4WEBH 2PO6D 2NXYD 4JREC 3S3JA 3L3OA 3GKWH 3SY0A 1A21A 5D7IE 3U4EA 2RIKA 1P9MA 2A74A 3T1FA 4OCXH 4MNQA 3HZKA 3PWUA 5CJOH 2OP4L 1U8MB 1VPOL 2ZCLH 4UB0H 1TZIA 2H8PB 2DIBA 5F1IB 5IMOA 1GXEA 3EGSA 3TPKA 3L3GA 1E4XH 5HI4C 2XICA 3GSRA 4YHIB 4GRWB 5F88B 3I2CH 1V3LA 2Y36L 4LVNC 4OI9A 3QDJB 4LLYA 3LS4L 4MA8H 2Y6SD 1FFOB 2X4PB 5GISH 4DK6A 32C2A 1JRHH 4X6DF 1BD2A 5T1LA 3RHWF 1MREH 4HF5H 5J13C 5SWSA 1U3HC 2VLRD 4K23H 5TFSL 4NRZB 5B4MC 4OLUL 3OKOA 3IDGB 5F9JB 3T0EB 1JFQH 2Q7YB 3F5WA 4D9LL 3L7FB 3SDXA 4YC2B 2F54D 4I4WB 3ZTJH 4DFHA 4YUEL 4HKZA 5EU3A 1X9QA 2DQHL 4P2RD 3GSQB 1JWSA 4F9LC 5IFHL 1W72L 1XH3A 2G2RB 1SY6H 1QA9A 4RFOL 2QR0A 3FHQA 1NDMB 4FFZL 4NPYA 5CBAA 3GJFB 4FN0A 4HK3N 1RUPH 2RBLA 3EFDH 4JN1L 4YDIL 3X3GH 1OOAA 3AC0A 5HYSG 1I3RA 4PTTA 2D9CA 3NN8A 3U46B 2QLVB 3VWKA 5DD6B 1XF5B 3S98A 3GI8H 2DM4A 2VXUL 5ENWA 4O2FA 5KSVA 2VL5B 1AGDB 3NCEB 3I02B 4RGNE 4Z5RA 1ES0A 3GKZA 2P24B 1I1CA 4L1HA 3MLZH 4HC1A 4NQCD 4Y5YA 1IAIM 3CZFB 2CPCA 5EU5B 1H15A 5JPNA 4ODHL 3QCTL 1KN4L 3IDNB 4YDKH 3TO4B 2Z92A 5KS9F 3CUPB 4M5YL 5GS3A 1NEZA 1E4XI 1U8NB 4FQPA 2AJ3A 5GGVL 2KQMA 4WW1A 4WU7A 4YWGH 1BVZA 4XHJD 5KN5A 2VXSL 3JV5A 2DIJA 4F33B 1QLEH 3U6RA 6FABL 1EO5A 2COQA 2V7HB 3PHOB 3VMPA 4WFHD 1IM3B 3GO1L 3PNWB 3DIFA 3RWFB 1IGCL 2QKIB 5CD3B 3QRGH 4PV8B 1J8HB 2AQ1A 4B50A 3HTLX 5HDBF 1U8KB 4YFLI 4M6OH 1ED3B 5DK0B 1CK0H 4BSWB 1IEAB 5IFAL 1MFCL 4NQEA 4TNVF 3BX7C 2ZOKB 3GBML 4L4VB 1JGDA 4KHTH 4NCC2 1H3PH 3ARRA 3CXDL 5T5FH 3IJHA 4RWHA 1AXTL 2J88L 4GG8A 5HHME 2BVPA 2BRRH 3LRSB 1BM3H 1FCCA 4HCRA 3WMSA 3FT3A 3DYOA 3MJ9L 4KZEH 1F02I 3IU3A 2EYSB 3WXWL 1F2XK 3WJJA 3UTTB 1KACB 1YJDL 3D25B 4H1LB 4LDOB 1NSNL 3L5IA 5KSBB 1A6VH 2H6PB 1AE6H 2KQNA 3F58H 1OGAA 4FABL 5MEOA 1C7TA 3O4LE 1G7QA 5DHVB 3HS0B 2GSIA 2X4NB 2OTUA 3MMEA 5ALCL 2YUWA 3OX8B 1JN6A 1I85A 5D2LF 1BOGB 2BNQD 3P9WB 1A7PL 3MGAA 1CE1L 1GPOH 1TENA 1CVRA 3WUWA 1FP5A 5DD1L 4I1NB 3UTPE 2ICCA 4JZNB 3T65A 3F8UB 4ZO7A 4XC3L 5DJ8B 4XC1H 3WNPA 3VFNB 3KPSD 3U79A 5ID0A 1UADC 4CJ0A 1R3LA 1NL0H 1RZGA 1NCTA 4AIOA 1RMFL 3QIWB 1KEMH 3V0WL 1T1ZB 4LK4A 2EH8H 4FMKA 5B3JE 2NX5D 1X5AA 4FTVA 3SKJL 4OF3A 4G3YL 2WP3O 2BY0A 3H9HA 1BZ9A 3SBWA 3O45B 5E00B 1DE4B 5DTFA 2AJUL 1OP3H 4NKIL 4KI5D 4M5ZL 2HMID 4HIIA 1I8KA 1PKQA 3L3KB 1CQYA 1EDQA 3W39A 4KZDL 3G08B 3DETD 1MI5D 2VH5H 4JO3H 1FO0H 2FR4A 4G7YH 4HUWA 4UIMA 3RA7L 2I9TB 4X8JA 3WYRA 4U1HA 3PWJB 1ND0A 3EO9H 2D4FA 4TSCH 4CADB 1JK8B 3NA9H 3O4OC 4GXUN 3CC5B 3VFMB 3QQ3B 1OP3K 1E6JL 5DMIL 1TJHH 1BJ8A 5C09E 3HMWL 4U6XB 2WBWB 3QNZA 2AV1B 5B8CA 4PJ8C 3WD5H 4M7JL 1K2DA 3ARZA 4CU8A 5C1MB 1A7RH 4KFZC 3RWIB 3UZQA 5L9DH 4LASL 4MJ6B 3VCLB 4S1SL 2F5AL 4QOKB 2JJWA 3G5VB 2J12B 4GRLA 4PBWD 5F21B 5HI3C 5JUEL 2JIXB 5DS8B 3VXUD 4IIQC 3DGGB 3O3BB 1F4AA 1G9NH 2YSSB 3EYOA 5AUMB 4EI5B 3O9WC 1RULH 1CF8H 2MNUA 1JTTA 4KMTH 2QEJA 4L9LC 4ZS6D 5JDSB 3SO3B 1LO4H 2O26U 4U6YA 4FZ8L 2BFVL 3FMGH 1KIPB 4HG4K 3ULSA 4PJ5A 5DI8B 5KSAA 4ALAL 2ZUXA 4D3CL 1Z9SA 4U7MA 4XTRC 1KEGL 4XH2A 1BFTA 1JE6A 4J7RA 1XGPB 2LE9A 4MX7A 2XQYK 1KUMA 4RRPA 3QJFA 3V4UL 5EZIL 1HWGB 3S37L 1OD9A 4WUUA 1UACL 4AM0B 1CN4A 4F80A 5HBBA 4JCMA 5ITBH 1N4XL 3F12A 4GW1A 3CLEH 1QQDB 5B39G 2ZCKH 3RWGB 5GRUH 5BXFB 5ICYB 5IB1A 3B2UC 4HEPG 1CXKA 2AERT 4YK4C 1HH9A 1TETL 1NBYA 2DB8A 2N4IA 4GG6A 1M6OA 1OW0A 4JO2L 5I66B 2X1XR 2YPVH 3V5HB 5C2BL 2X4TB 2Y1VA 2ITCB 4J6RL 3SJVE 3O6KH 3BYTA 1OARL 3U0WL 3MV9B 3DMMB 4JANB 3CFCH 3N1GC 3VD3A 3R1GH 4QRTA 3GSNA 1FH5L 1W0WA 3HG1D 3REVB 3ZE0F 1FQ9C 2ZUWA 3KNBB 1GIGL 1H3WM 1Q72H 4RGMC 1K8DB 5HHVL 2Z8VC 2Q87A 4PJ9B 3ARFA 1ACYL 3FFDB 3ABZA 4I0PA 4F2MA 5GGSB 1D7FA 1KCUH 2VXVH 3V7AG 2Y5TB 3MRHB 4HIXL 1B6UA 2DBLL 5DHXB 1FNAA 1JMXA 3IS1X 3QIBB 1TQBC 2XWTB 4Z6AT 2PUQT 5FECA 2V2XA 2NZ9C 1GOHA 1IMHC 3MRQB 2SEBB 2UV3A 3WFBL 1AO7B 3MRRA 4Y16A 3VMOA 3FB6A 3U7YH 1I3GH 1CG9B 1K4DB 5E03A 5D7IA 1WK0A 4OM0H 4YEFA 1FG2B 3TPUA 5DJXB 1JYNA 1IC4L 5EU6E 4CKVX 1G6RL 4XAWH 4OCWH 2OQJA 2KPNA 2WWKT 1JWUB 4I5BA 3TJEH 4PD4J 4Y1AB 3DI3B 3FFCD 4PJGA 4O4YL 5J3HC 4R4NC 4P4RA 3QDJD 5F44A 1KNOB 2EXWD 4ZUTB 1TCMA 2AJVH 3TBYA 5I71B 1SMOA 4OIBA 2OLDA 2QQKL 4NM4L 2H2SD 3A0OA 2HFGL 1JYVA 3U82B 4BZ1H 5IHUL 5IW3A 1S7WB 3BGMB 1JNNL 1OSZA 2NNAA 5DT1H 3X17A 3CFDB 3AVEA 4Z8FL 1JF5A 3ZKQD 3LEXA 3RDTA 2ZUVA 4O2CB 2RFXA 3T0ED 3JUYA 2GTWB 1A6AB 3D18A 3AGVA 1R3IH 3LRGA 2J8HA 2EH7L 4OM1L 2Q6WB 1NGXB 1QHPA 2IJ0C 3D0VB 3MLUH 3GMRB 4R4FL 1EHNA 1RHFA 3ZKMC 1WZ1H 2EYTA 3HNTL 1ITBB 4EEEA 5HYSB 5E24E 4OGAD 4PJAB 2H2PC 4ELMF 3CFBA 3ZDZF 5J11B 3MV11 3TBTB 4I3SL 2AI0L 4Q0XH 2FBJL 3DRTA 3F7QA 2GTZA 1AHWA 3RWJB 3KLSA 1J1OH 2E7LC 1DQTA 5F1OB 3EDFA 1NC2B 4CN1A 3PUCA 1L6ZA 2C3GA 3GMQA 4RAUB 2YA0A 4S1DD 1B90A 3MRNA 1FFQA 1YN7A 3ARGC 2Z9TA 2FIRT 3H9SB 4H26A 1CLZH 3VXRE 3HUJF 4OAWB 3L3JB 3W5MA 1BAFL 3BKJH 4M61A 2E7HA 3R4DA 5GRYA 3D9AH 3LN5A 3TO4D 4PJBF 1XGYH 2R4RH 3WN5C 4C57C 1O0VA 2XA8H 1HSAA 4CVWA 1S7VB 2VZTA 5KVDH 1B0RB 1E4KA 4U49A 5FA3B 1AGEA 3W5NA 1EMTL 4PJFE 5JZ7C 4ONHB 4RA3A 5DR5L 1C7SA 4X7SH 3QJHA 5IHLB 5KSUB 4Z7VE 4C55A 1MCOH 3U36A 5BV7H 5F6IB 2V2TA 1J8HD 1UYWH 1FC2D 4UTBH 1JNLL 2I26N 5EBLB 3OKKB 4WTZG 3QULA 4XPTL 3VD4A 2IAMB 4CJ1A 3GSXA 1UCBL 1MCIA 3E1F1 1CLYL 4KTDH 2VITA 1CD9B 1RI8A 2ZPKL 2ICWJ 4L4VD 1ERNA 4HIHB 3PE9A 4ODWA 2O5XL 4S2SB 1KTRL 5HHPA 4HXAL 2CRZA 3KPOB 5D7LB 3ARXA 3C2AL 1A2YA 1JNHB 1F2QA 3P77A 5IVNA 3S36H 4DZBA 1A7QH 2B7DT 2VLKB 1A6ZB 4N0CC 5JXEA 3UTTD 1RVFL 3O9WA 1DQQA 1JPST 1HKLH 4D0CB 3P0VH 2FHCA 5F8RC 5F7DB 5E5RB 3UBXA 4EDWH 4N8VG 5I74C 4L8BB 3PQYA 3BPCB 1LO0H 4RNRA 1PD6A 2W65A 1OM3H 5SWZD 1XCTA 3SDDD 1G0XA 4Z76B 4HS8L 5FM5M 1U6AL 1U8LA 2JB5H 1OTTC 1Y6NR 3TYFA 3MUGB 4PRHE 4PG9B 5CGTA 2WM0A 2DN7A 3O4LA 4LLMA 5DFTA 1MCCA 5I8CB 1A3RH 1F3JB 1EV2E 2CIKB 4F3FB 1QFUH 3RNKB 3QCVL 4G9DA 3KPRE 3MLXL 1T6VN 4FQHB 4I18B 1C8PA 1TNMA 2BOCB 3E0GA 4IEFB 2NY6B 2HWZL 3GMLA 1CS6A 5T1DL 5GGSY 4YBLC 2AEIT 2B4CH 2GUOA 3QISA 4TNWF 3JSSA 4QRPE 5ESAA 3VI4E 4OZIF 3O3UN 2ZCHL 3KPMA 3KS0H 4PRIB 3RWHB 5DUBB 3BPOB 1ZANL 5E8PB 1S9XA 1L6XA 1B9ZA 1EFQA 3MYZA 1MCPL 1EEQA 3CFJA 4JLRA 1V7NH 4Q6IA 3D5OF 1MCWW 1HINL 2NLJA 1IZJA 1I9JL 1CGSL 3PP4H 1IQDA 1E4WH 4L4TD 3UPAA 3RTQB 3FAWA 2I5YL 1LVEA 1KCVH 1TJGH 3MJ7B 3WFDL 3LMJL 4UT6H 2VLMD 4LCYB 4G5ZH 3UTZB 5J06A 1I9RL 4HS3B 1DN0A 5CHNB 4AG4L 3TA3A 3DOSA 2HAZA 5IM7A 5IVXB 4HXBH 2XKSA 5AZEH 2X09A 4PGEA 5C09A 4F57L 5FM8A 4QOKD 4PY8I 4MXVE 1BIIB 1WJ3A 3IFLH 2JIXD 4MCYB 3LKQB 4OF0A 1N6VA 2B0SH 4TSAL 3ES6A 4PS4H 3BPLB 3BP4A 3MNVB 3O11A 4EI5D 4Y4FB 4NQDB 3O81A 12E8L 3BP7A 1P7QD 1HN1A 1FCGA 4JZJB 5DJDA 4JFZH 3VG0H 4QHLA 4L3EB 3V95A 3B9KC 4KROC 5IESH 2VDQL 2C3WA 4GRWH 1A6PA 2VOTA 5B39B 3ULUC 3B2VH 1GGBH 5I1IH 3RUGE 1X3DA 4UINH 5TQ2L 4G9FE 4NNYB 5GS1A 4ERSL 5HYFA 4JO1H 5MENB 1J10A 3HR5A 1TVBA 4PRAA 1KIQB 1W0VA 5F7MC 1OT1A 1CFSB 3G5XB 4WO4C 1MJJA 1LWRA 1M71A 3UROR 4D9QD 5HGGS 3EO1B 3QQNA 5DMKB 3S36X 15C8H 3HLAA 1YEDB 3IDIA 3PWPE 1YEJL 2CKBL 4CMHC 3EO0A 3NCYS 3NFNA 4JZOA 3L1OH 5EBGA 5LVEA 4IOSD 1UFUA 2B2XL 3DMMD 3D0LA 5HHOB 1AFVL 1RZJH 3ECBB 1MCNA 1ZMYA 5D6CB 1KENL 2OSLA 5C71A 5GS2H 3C6LC 1PDKA 3VFWA 4U6VH 2VABA 2XZAL 5I30H 2X1PA 3SJVA 3GJFH 5IB5B 1A3LL 3DHJA 1RJYA 3QUYA 4UAOC 4ZFOA 3AY4A 3LKRA 4X7FC 4JHZA 3ILQC 1AD0B 4PJ9D 2E27H 2V9QA 1CXLA 1RK1A 3ZT6A 1KB5B 3DXAB 3QDHA 3QIBD 4LRIA 1HK6A 1FL3A 4F58H 1A6TB 4O02L 4DOHB 4LLVB 4EN3A 3RWCA 1AO7D 1T2JA 3IXAA 1H8NA 5HHXL 5E4EC 2X4RB 3NCFB 3GJFK 4KK6C 4P2OB 1XF1A 3D69A 4G6AD 3MJ8A 1IZKA 1JGEA 5JW4Q 4HAFA 1NMAH 5HHQB 3FJTA 1A5FL 2IANE 4XI5D 4X0KA 4Y1AD 3S34H 2CLRA 1LDPL 3GRWA 2D7PA 1K8IB 3MRMB 3VGAC 1LD9A 3BPNC 4IMLA 5DYOA 4TPRL 5EU6A 3O6FB 4NN5B 1EZVY 3AXLA 4DKEH 3PHQA 2JTDA 1JPGA 1X6NA 3L9RA 1NLBH 1UZ8A 3LQAL 5T3XD 1W0YT 5JNYB 1XZ0B 5CJ5A 4N0UE 2QHRL 4PGBB 1DUYA 1IAKB 5IMLA 2QADD 3MBEB 2BNRB 2DOCA 4LCCA 5C0CB 3AREC 2XWBB 4P9MH 3ROOA 3KLAA 4FG6C 1IRAY 1CDBA 4I2XA 2EDKA 4M1GL 4ODSL 1GSMA 2ID5A 4NRXA 3SE3C 4K71B 2MQ0A 3G5ZB 3U0TB 3FQWA 3CH1B 1UB6B 1GL4B 1VGKA 4UT9H 3BISA 1D5BB 5IK3B 1IARB 4XP5H 4U1MA 5IWLC 4QRUA 1FNFA 3I6GA 5EU4A 1EAJA 4WFED 3QH3B 3WHXA 4H1LH 3IXTB 1UVQA 4ORZC 1NC2D 3D3VB 4GAFB 3MUZ1 2XXMB 2JF1A 3NH7L 5DHVH 4NNPL 2FB4H 2XNAA 5FDYA 3T09A 3ETBF 3H9SD 3Q3GB 3WS6A 2O5ZH 4M8QA 5FYLH 1YMHB 4NFBA 4M7ZB 1D5XA 2X1QA 3CVIH 5CJXC 4YZFE 4XWOD 1KXQE 4TUJB 5IBTL