4NN7C

Cytokine receptor complex - crystal form 2
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
179
structure length
170
Chain Sequence
DVTVVCHDLETVEVTWQLSLEFRYGTGALQPCPRYFLSGAGVTSGCILPAARAGLLELALRDGGGAMVFKARQRASAWLKPRPPWNVTLLWTPDGDVTVSWPAHSYLGLDYEVQHRESNDDEDAWQTTSGPCCDLTVGGLDPVRCYDFRVRASPRAAHYGLEAQPSEWTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine/cytokine receptor
molecule keywords Thymic stromal lymphopoietin
publication title Structural basis of the proinflammatory signaling complex mediated by TSLP.
pubmed doi rcsb
source organism Mus musculus
total genus 26
structure length 170
sequence length 179
ec nomenclature
pdb deposition date 2013-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nn7C01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nn7C02
2X41A 2AJUH 3S8WA 4Y88A 2E7LC 3DVFA 2VR4A 4M6OL 4Q74A 1REIA 4OZIA 1M05B 2GKIA 4S1RH 3S5LA 3W9DA 3C6LD 3DV4B 1IC5H 1CFNA 4Y4HA 5DDHB 3MTRA 4LLWB 1TPXC 3RDTD 2PYEB 1RUQL 3ROLB 3HTLX 2DQIH 4MA3A 4WRLA 4MD5B 2H2PD 4NM4H 3MODL 2BCKA 3LD8B 3BPNB 4D3CL 2DLEA 3FT4A 3KYMA 4Z8FH 1R5IB 1FVDB 3LQAH 1DBKH 3PHQA 5D7JA 4GG6E 5HHQB 1UWGH 1FPTL 2CDGA 2AXJA 4YBLC 1GGCL 2CUMA 5IJKA 3PL6C 4XAWL 4F3FA 1MFBL 4OF8A 2XWTA 4NFCA 1YECL 1K8DA 1G9NH 5FECA 3D0VB 1PAMA 1AE6L 4X5WA 4JM2F 4V1DA 3FTGB 1UWXH 2ARJQ 5FYLE 4FQLH 2VL4A 3U7WL 25C8L 3BWAB 4F8TA 2DIAA 3RHWF 1XGUA 3BQUC 1DEEA 3BSZL 5BMFH 1G6RA 5D2NB 2MKWA 4NRYB 3VDCA 4QWWC 1EO8H 5GRJL 3GMNB 1U0QA 1FQ9C 1IEBA 4XBPA 5I0DA 4PJGF 5I1HL 1KG0B 3CUPA 3KLDA 4JZNA 2WNGA 3RZCB 2CLRA 4N0FA 2XRAL 1KJMA 3EO1B 4LNRA 3AY4C 5IB5B 4B41A 2V5YA 3C6LC 4FRWA 2AJZB 3DVGA 3GKZA 4LARL 2VSDA 3LKPA 4H1LH 4NYLA 4LCIH 3KYAA 1I1AB 3H9SB 3RDTC 4RMSA 4GOSA 5DD0L 1UH2A 1T2QH 3FB6B 2B39A 3GNMH 3VRIA 2PYFB 3QIWD 2YC1B 4MDJA 4JHZA 5D7KD 1V3LA 4EIZC 1MCSA 3T0AA 5GS3A 2B2XH 3AC0A 4R3SB 1N6QL 4O9HH 4Z5RB 5HYSA 3MV9A 4L3AA 4YDVB 5IB4B 4Q6IA 4HUMB 5GGVH 4K94H 1LWRA 2QQQA 5INDA 2VLJA 1BX2A 5IEHB 4Z7WB 3BZDA 5DO2D 5DC0A 3V5KA 4JG0L 4Y89A 4UIKL 1HH9A 4OKVA 4G9FB 1TVBB 3GHBH 2BOBA 3MGOA 1YN6A 4OLWH 4PRPE 4H26B 2R8SL 2Q20A 3AAZA 1F4AA 5E4EC 3S36X 2E27L 5E8EA 2BERA 3SCMA 1T0NA 4MNGA 1RJZB 4NZTH 3NMEA 4E5XB 5IF0A 2VLKD 3CDGB 5JR1L 1HDMB 1BIIB 2YBRA 3DHJA 2BXZA 3W0WD 7FABL 1SJEB 3G6AB 4XNMB 3UPRB 1AHWB 3P9MA 4PJFB 4NPYA 2FECL 2RGSA 5FM8A 1BQLH 1MWAL 3JZ7A 4HPYL 1AKJB 3LEVH 3QISA 3T2NL 4QRUB 5J1SC 3VG0H 1NMAL 3QIWC 5KSVB 4JLRB 4NJ9L 4ORZC 4Q2ZA 5F6IB 3KPTA 5ADPH 1RFDH 3AREA 4WY7H 1DEDA 3GRWH 5EUOB 5ICYB 3O45B 3L9RB 4KI5D 4YXKH 4HG4K 2P5WB 3O4LB 1U8NB 4JG1L 3UYPA 1F90L 2DJUA 4NQTA 5A40E 4LQ1A 3QXUA 1OAZL 1T5XA 2VO5A 4PJEE 4ODTL 1MHCB 2ATPB 5DO2C 2ZCKL 5JUEL 4H5SB 4HJGB 4OAWB 5EUOF 3FT2B 3I75B 4JO4H 4ZPVA 2N4IA 4MA8H 2AK4D 3CK0L 1A14L 1X7QB 5GGSA 2G75A 4ELMA 3KPQA 4HIIA 4BH8B 5FDWB 2OJZL 3EOTH 4TTGA 2HFTA 1P4LA 3ZE1E 2BNRE 1BFTA 1S7XB 3NAAH 5IB2A 1V7MH 2VMFA 4FQ2H 5DR5L 4WUKH 5H94B 1SVCP 1KPUA 3VWKA 2ICCA 1NGPL 3JV6B 3KVQA 5DRXB 3ULUH 2VXVH 3FFCD 4Z77B 4PB9H 1MCDA 2VXTL 4CU6A 3V6OE 4YBHA 3PGFH 5EH1A 3REWB 1QSEB 3NCBB 4X4ZA 2BNQA 3QP3A 4MA7H 4NC1C 1EXUA 1BM3H 5ETUA 4KI5C 4C56D 2IAMB 5B38B 1X4XA 2X4SB 2Z4QB 2DQFB 3CVHL 2WIMA 5DS8A 1P2CB 3T77A 4KRMB 4YUEL 5JIIA 4XBEH 3I02B 3OMZA 1WTGT 4LLMB 3BZFB 3C9NA 4X0KB 1F2QA 1YEDB 3ZKMD 5DUBA 2GQHA 3FQTA 4J3TA 1AO7A 2FGWH 2G5BB 1I85C 4ETYA 4L4VA 1AXTH 3SOBL 2UUDK 5FGBA 2Z35B 4HQQL 3ZKQD 3EYOB 5FUZH 4WEBL 4RBPH 3G5ZA 1G7MB 1P7QD 1CLZL 1NGQH 5ACZB 3O3EA 1HNGA 5JW5B 5BW7A 2NY2C 3CSYA 2JCCB 4KMTL 2HT2D 4LK4A 2E7BA 3ZDZF 5TE4L 4GBXD 1DVFD 4NZRH 5JORA 3O2WL 3CU1A 1T5WB 3CDCA 4JHAH 1AGDB 4YGVB 4ZXBA 4GAJL 4YR6B 4M62H 1SBSL 2BRQA 4HMEA 5CZXD 1BBDL 1PY9A 5MEQB 4QHMB 1IGFH 1LEGA 2Z0BA 4LGRB 1UZ8B 3U9PH 2DRUA 4NQEB 2ESVD 2D7QA 1KCUH 2EDWA 1DP0A 1ZLUK 2F53E 2ZCHL 3C8HA 4MZ2A 3R8QA 3TYFA 2GSIB 1OQXA 1XR9A 1IZKA 2QEJA 4RZCB 2FRGP 4P2OC 1PDKA 5KVEL 4HXBH 3RWJB 4C83B 4LSPL 1EUTA 1WFNA 1ORSA 3SO3C 4QRRB 4NWUL 5DVNA 1FAKT 3TC9A 5L7XH 5E6ZA 4KGJA 3BUYB 2X4UA 3LMJH 1M7DB 4PG9A 2NW3A 2IBZY 3I6LE 3VFTA 4R8WH 3OG6B 3GHEH 1OVZA 1P69B 1B2WH 5CLWA 4FQJL 2YD4A 1ZA3B 2V7HB 4L3CB 2IANB 4MD0A 4KVCL 1FL3A 1H0DA 5DQJA 2VL5A 2XKNB 2HT2C 1O0VA 5BS0D 2DWEB 2VKXA 4GBXC 1KPRA 3B83A 1DVFC 3GFUA 1HK6A 2B20A 1YEHL 1GJIA 2ADGA 4HT1L 3LAFA 2L0DA 1NCBH 4PREA 2GIYA 1CXIA 2YN3A 1KIQB 1ND0B 5EO1A 2F19L 1WCBA 4OBSA 3V5HB 4YHLH 1FZKB 3U0PB 4P5TD 1GCFA 4PV8A 5CINL 1YNLH 4AENA 1WC7B 2R0KL 2XXCB 3FQUB 4NNYB 1EAJA 3VXOA 1P5UA 4GO6B 1MRFL 1ORQA 1DUZB 2XQYK 3KPPA 2BSSA 2NMSA 1KXTB 1MJUL 3HAEH 3KPSE 2BRRH 2VDNH 1I4FB 1NFIA 1RUML 5I1IH 1PX3A 3RBSA 4CNIA 5EU4A 3CXDH 4P48A 5FUCE 3WFZA 5J9PA 1MI5E 3H42H 4UNVA 2WWMC 4JRXE 3TN0D 1D5MA 4Y4KC 4BK5A 1HH6B 3V2AR 4FZEL 4L9LB 4FQXB 2CJUH 4G42B 3N1QC 3RGVD 4IRJD 5IOPB 2CR3A 4YIQB 1PLGH 4FFZL 3O8XD 2G2RA 1AC6A 2AV1A 2GJ6B 3H0TB 3HE7B 4HPOL 3X3GL 5H8DA 3V6FB 2UVFA 1J1PH 1NGZB 3GEWB 5D1QB 3CFJA 1HNFA 1LHZA 3FHQA 3UO1H 4LHUD 2RR3A 3VD5A 1GIGL 2X40A 5CIPH 5I19H 1CICB 1H5BA 2J12B 5I1EH 4B53A 4P5TC 2JTDA 1G7HA 5HD8D 2FBJL 4FXKA 2CKNA 2AEIT 3MLSL 1AGBA 2B5IC 3V79C 4P2RE 5CUSH 5CEZH 5FA3B 5L2KB 3RWHA 3EO0B 2EDFA 2NY5L 3LN4A 3QO1A 1BJMA 3SKJL 4MLSA 3W2DH 3OPZL 5I1LA 3FL7A 2VDPH 4HF5L 3ZL4H 3CLEL 3QUKA 5GRXG 4Z0BH 3KJ4B 3TN0C 3U46A 3U79A 3QA3A 3QJHB 2V5SA 3Q3GA 5DYOA 3LQZA 5D7SL 5B39A 3OR6B 4F8QA 4JQVC 4TULL 3MRPA 3RGVC 4IRJC 4L5FL 1MFDL 2OTWA 2I9LB 4XXDB 1YEGL 5SWZE 1TJIL 4ZFFB 3MJ9L 2RBLA 3PDGA 2AJVH 1CT8B 1GZQA 1VCAA 5L6YH 2R1XB 2XZAH 4R97B 3BT2L 1T1WB 3IAPA 4NKMB 4I77L 3LVEA 3VFVA 4I5BA 1MEXL 4JFFB 1EO7A 4KRPD 4UMGA 3ZKXC 5FKAB 4LLYA 1RZ7H 3QUML 3KPRD 1T20B 5BOZG 2ZJSH 3STZA 4YO0B 3S9DB 4GW1A 3OX8B 2BOCB 3QRGL 4Y5YC 2ZOKA 2Z92B 3OKMA 3SDAB 1BF8A 3IF1A 1MNUL 5ICZA 2LAGB 2EH8H 4XPFH 4KWUA 4TPRL 4CRPA 1WITA 4DUXA 1Z0MA 1EJOH 3LN9A 1EMTH 4X7SL 3HPLB 4OF7A 4C4KT 3C8KA 3F5WA 2Y36L 4IOFC 2LVEA 1HHKA 5C0GB 1U8LB 2NNAA 3MCLH 1ROWA 4L1DA 2R0WL 3KWWA 3RWCB 2NYYD 3K1DA 4PJBE 4PJAF 4EUPG 2J4WH 2P8MB 3QPXL 4LCCB 5HHVL 3BAEH 3QQ3B 4MS8D 4OLVH 3MBXH 2H3NA 2DQHL 2NZIA 4QY8B 4ONGL 3QDGB 1AGFA 2MCPL 2VZUA 3QUZA 4YHIA 1KGCD 4K7FA 4NQCB 2B7DT 5M95B 4OZFB 4JFHE 4WFED 1U8HA 2IQAB 3LS4L 1PZ5A 5A16B 4M7KL 1N59B 3QUYB 5I1AA 5EG6C 2F8VA 3ZE2E 4YX2H 5KANG 4HV8B 2EYRA 3JTTB 4KRPC 4ZUUA 3TNMB 1QYGH 3CVHA 4RWHA 4XVJL 4X98B 3GMOB 5C09B 1AD9B 4WV1B 3TLRA 4F7EB 5B3NA 2DLTA 1D6EB 3HMWL 1UVQA 5K93A 3PV6B 2IALA 3I6KB 5KN5A 1FE8L 3O6FB 4WU5B 5KS9A 4Y1AD 2VDRH 1CD1A 1A6ZA 1CZ8L 1ERNA 1CE6A 5GGQH 15C8L 1BZ7B 1OP9A 4WENB 5I1DA 4G5ZL 1Q0XH 5IVXE 3BD4A 1FYTB 4PJXE 5I1KH 4UUJB 1UKQA 2P49B 1G9EA 1BZ9B 2NYYC 1HINL 1UXSB 2P4AB 4PJ9D 2XWBA 4I2XA 1MVUB 2E8YA 1O7VA 3OJDB 3QNYB 1CXEA 1WFOA 4MS8C 3MGTB 4X7TA 4XAKD 1ADQH 3S37H 3WS6C 2FHFA 3BEWB 4UT6L 3TA3D 4I48B 4JPWL 1CD9B 3RVXD 4IHOB 2X70B 4G8GD 2OR7A 1EUUA 1EH9A 2VQUA 3M1BB 2PKDA 2QADB 1UM6L 5D7LA 5E9DA 4LEOB 3UJJH 4J7RA 4M7LH 1HHGA 1EGJL 2P7TA 2PYED 4ALAL 1QFWL 1K5NA 4OGYH 3GSNB 3NZ8B 5FO8B 5GGTL 4M6MH 3ZHDA 1MCIA 2VXQH 3DIFB 3KXFE 3UXFA 3TO4A 2ORBL 4I3SH 5DD1L 2JJTA 3T0EE 5IVOA 3X3FH 3T1FA 5L88H 3VCLB 5ID0B 1NC4A 2DQCL 1VKXA 2HH0H 3LV3A 4EN3B 4KROC 5EBMB 1XGPB 1N7ML 5CJXA 3UTQA 4HH9A 1ZT7A 2ZKHH 4LL9A 4AEIL 1S7QA 2NX5E 1E27A 1KIRB 1DANT 2VUYA 2V17H 4PJCE 4XPTL 3U36B 2QHRH 5I71C 4YDKL 3MRKA 5I15L 3GSUB 5D2LF 4I9WE 4M02A 2AXFA 2VUOA 4LCWD 2IQ9L 3D3VE 2XN9E 3N1GC 4OBRA 4YHPA 3SE4C 4PJ9C 4DVRL 1ZA6A 3T3ME 1HOCB 1MFCL 1CQYA 3JBG7 3DUUB 1IGML 3QQ9D 1FO0H 3WHE0 4DGYH 1IE5A 1FAIL 3OB0K 1UJ3B 1A6VL 1A6PA 2BHYA 3RRQA 3JV4B 5BXFB 4DK3A 4EUPA 2EIZA 3NGBB 4S1QH 4WTWA 2FL5B 3C6SB 3PIQB 4BQBA 1UYWH 3VE0B 1QA9B 2EEAA 3PP4L 5C08D 1I1AD 4LHJB 5DUML 5EBLA 1QZ1A 3HUJF 3VXNA 5FM4A 5IB3B 3WNNA 4Z95L 5T1LB 4P9ML 1IMHC 2WAHA 3PXHA 3VH8G 4UINH 1HILB 3IGAA 5D6DC 1JYNA 1YEFL 3LD8C 3BPNC 4L8BB 1MHHA 4WU7B 3FOLB 5CJ8A 3VXMB 5HI4D 1IM9A 4WW1B 3INUH 4ONHB 4Y5XB 2DIBA 3UZEA 5CIPB 5HHOB 2EH7H 1C7SA 1DQJA 1RV6X 4E0RA 2FCBA 1OGAB 5EORL 3LPWA 3OAZH 3VRLF 5JLZB 2BFVH 5TDPB 1XR8B 3FQWA 2C3VA 5IBLC 1W72H 4P23B 1HI6A 4G9FD 4M9PA 4PRHA 3RWFB 4JRYA 1GL4B 3G08B 1B6UA 3QIBD 3IU3A 1TZIA 2QQNH 1AFVL 2FJHA 3MROA 4KVNH 4XRCA 1T04B 5ITBL 5D2NC 4RMUA 3LIZH 5JOPD 1N5YH 2GITA 1B4JH 4OV6F 4U6VL 5FKPB 3RZCC 2X4TB 1L7IL 4XPAH 4XNUH 4KTDL 3RJQB 4JO1L 3RVTD 4X99B 2XTJD 3HI5H 3KGRA 3QULA 1I1AC 1AKJD 1J5OH 3TPKA 1OAUH 2VABA 5JOFA 1NANI 3ESUF 3P11H 1A0QL 1KJ3L 3WFCH 4FG6D 5TPWL 4AH2A 1JN6A 3JVGC 4ZUSA 4JN2B 2WP3T 3MOAH 3QDJD 1QP1A 2ADJA 4DCQA 2P5WD 4PJ8B 5JA9A 3O4LD 1IFHL 1QFOA 2VN4A 4X5XB 3SDXA 2VZ3A 2LE9A 2KL6A 1BLNB 1BREA 3QUXB 1J11A 1MHEA 1K8IA 1Q1JL 1ONQA 4FXGB 1Q9KB 1QPPA 1XF3A 1D5IH 5IROA 2C1OA 3DROA 4OLXL 5IV2A 4OZIF 4ZO9A 5GSRA 5HHPB 3QIBC 4PG2A 4LLUA 3RPIB 3RL1B 1MREL 3DARA 4U1MB 4J1UA 3PNWB 1F11B 3BRGC 5E2UL 4DEPB 3GJFK 2GJJA 3PWUA 4LIQE 4JFQB 5HGHA 2FX7L 2OI9B 5GISL 3ULVH 2BHUA 2Y06H 1F4WL 1I8IA 1EEYB 1Q72H 1VSCA 4CVWA 1AHWC 4GRMB 1ZT1B 4HK3N 3CD4A 3RVTC 3MJ9A 4P46B 4K8RL 4PJDA 3WUWB 2XTJC 1EERB 4Y16A 2FEDD 4XB8A 1IGJB 1NEZB 1S7VB 5DI8A 3LSOA 2IFGA 2Q6WA 1D5XA 4FG6C 1HHHA 4PGCA 1P1ZB 5IEKA 1LO2L 4JFEB 4LBEA 2IAMD 5E1AA 3IAGC 2PF6A 4JVWA 1RUPL 2HAZA 3EIFA 4HWNA 3ES6A 3VH8A 4G9DA 1HHIA 5E08L 4F80A 2LQRA 1GGUA 4RMRA 4TVPD 2ZOLB 2DQTL 1X5YA 2HVJA 5C0CA 4RISL 4FZ8L 3EDFA 1J8KA 2AW2A 2NLJA 2ZUYA 5MERB 3VXPA 5I18H 3HC0B 5FK9B 4U1IB 5FUOL 4PJGE 5F7DA 4HIEA 1LEIB 3E6HB 1I7TB 3T0DA 4F57L 1CCZA 3N9GL 1AI1H 1MFEL 4XMPH 4P49A 4OJFL 3NH7H 3QAZB 4LHQB 4U1LA 3P0VL 1TNNA 5DMYA 3ZKSD 4R9HA 5EU5A 5C0EA 1YPZA 5I66B 1TITA 3HHRB 2CO6B 3WN5B 4O2EB 3X13B 4JGJA 2ARJB 4Z7QF 5MEOB 4PRAB 5FB8A 1DDHA 5FYLD 3CX2A 2P24A 1F4HA 2BK8A 2FEDC 1VFUA 2P5EE 4HUWB 3VW3H 1OCWH 4X4MA 3HZKA 3RP1A 5CD3B 1ZVSB 4OF5A 1AQDB 5DHVH 2IAMC 1I3VA 4TUJA 3PWJB 5DD3H 2A77L 1OB1B 2HLFD 2Q76B 4HS6B 4KUZH 5J12B 1RZJC 3HR6A 2BY0A 4LRIC 4M61B 4YDJA 3IRZA 1P4IL 1UFUA 1S9YB 4NWTH 4CGTA 1JIBA 1U3ZA 3S6CA 1TXKA 4RFEB 4YHZL 2GJZB 5E7BA 4UNTA 3IVKB 3WFHA 3DOSA 1IL1B 3EYFA 3R8BB 1SEQH 1I1FA 5IHBA 2Y25A 1T83C 2D0HA 2IAND 1AGCA 1KCVL 4DW2L 1OARL 5DQDH 4AIOA 1MCWM 2H6PB 1HZHL 1B90A 2OR9H 4ZNCD 2YPLE 1CL7L 5KSAD 3BMVA 4H88H 4J8RA 3HI6H 2HFFA 1T2JA 4KJQC 4X6FA 5KAQF 12E8H 3S3PA 1RZIB 2KZWA 2VDKL 1JPGA 5E6IA 4R2GD 4Z7NF 3BP5B 5GGTA 1QBAA 4NQSB 2VWEE 4LSSH 4ELMF 5EUOE 5CSZA 3V4VH 4X6DB 1NBVH 3UYOD 4ZSOE 2IC2A 4HS3A 1NAMH 2HLFC 1DSFL 3K74B 4XP1L 3FT3A 5KVMC 1XCQA 3QCVH 5HPMB 3DGCR 1AIFB 5ABDE 1XZ0B 2GEEA 3LQAC 4UQ3B 4KV5F 5CWSA 1IKFL 1CDUA 2H26A 3IXAA 4LSDA 4L8SA 1B3JA 3RA7L 4C54A 1OSPL 4KMQA 1QBMH 4JY6B 4G6ML 1G9NC 4K2UL 4B7LA 1PY4A 3UTPE 1RUAH 1JHLL 3S97C 4L4TB 4ODBD 2ITCB 2OSLB 1A64A 2UZXB 4UIMB 2BDNL 5HYQA 4FQXD 1NCCH 4TSAH 5SWSD 4WUUB 4PB0H 5C9JA 1ACZA 2E7HA 1MCLA 1NC2A 5KSAC 4KZDL 4OT1H 2XTLA 3ARFA 4X6EB 3HE7D 3PGCB 4Y5VA 2OK0H 5ADOH 4FFWD 3AS2A 1YEJH 5D1QD 5IBUG 4BH7A 1LDSA 4R2GC 2BNRD 4EDXB 43CAA 3QJFA 5DUPH 4UTBH 3SKUD 4NIKB 1X5HA 3QT2A 4HWBH 5HPOA 2J6EL 1CGWA 4Y2DA 3BDBA 1CICD 5GRZA 3HI1B 4GXUM 3UTSE 4LFHD 3IXTB 5FYKE 1R3IH 4PGJA 4ODSH 1U8KA 1A1OB 2WANA 5IBTH 4M3KB 4BFGA 2ICEA 3SKMA 5ESQB 3T4AB 5DJ6A 4K94C 4IDLA 3TBWB 5L2KD 3H6JA 3MYJB 3D69B 3D25B 1LNUB 4MJID 4CADB 1LEKA 2V2TA 1IC7H 2R39A 5JW3H 5I75C 1MELA 4QCIA 2DN7A 3RY6A 4D8PB 1MPAH 2H8PA 1Q94A 3BH9B 4CMMA 1L7TH 1XGRA 3E8UL 4ELKB 1D9KA 3R06A 4PGBA 4X4XB 4FQXC 1RIUH 5HGAA 1XGYH 5E8NA 1LO0L 4DKDC 1RURH 1UH4A 2ICWB 3HB3D 4Z7OF 3GI8H 1CN4A 4HSQA 4KK6D 1CG9A 1RI8A 2R69H 3HE7C 2OZ4H 4B5EA 2EDXA 1L6ZA 1WFUA 3GM8A 5D1QC 1KTDA 1V5JA 5F88B 2DJSA 3ULUD 5DQJB 5DK3A 4ZFOL 5GRUH 1P5VA 4QTIL 3CCHA 1CICC 4GRLD 2ZNXA 4R4NC 4NO5B 3FHAA 5EOTB 1UB5B 2WBJB 5D8JL 2CPCA 3IB4A 5F97E 1MFAH 2Q8AL 4JQXC 1Y18A 4TNWK 1YUHA 3GMPA 1ZGLP 3AS3A 2Z8VC 2B1HL 4FP8H 1P7KA 1NMCC 1Q9OA 2IPUK 5LWYL 4OD2A 3M17B 2CDEB 3TIEA 4QRRE 5HHMB 5T5FL 3F6IA 3FONA 5HYJE 4YHOH 1EEZB 2NY7H 4QRTA 4L8DB 4M5YH 2W0FB 1NMBL 5T1KB 3MV8D 4GAGH 4G7VH 5A2IH 2F53D 1RULH 3JV0A 1RZ8A 1H3VA 3VXUB 4A6YL 3WD5H 2D7MA 4UILH 5E00B 3B5TA 3IKCA 3RY5A 3HB3C 5IESH 1BVLB 3U4BL 2AGJH 1U93B 3DXAB 1IKNC 4KK6C 5T3XH 5C0AA 5E5UB 4XH2A 2FJFA 2GUOA 3TBYB 1S7SA 2J8UA 1IC1A 2LABA 3FO1A 3MLXL 4R97C 3ULUC 5C2BL 3QUYD 4HIXH 4I4WA 4MAYA 2I24N 2BHZA 5F9JA 3SGDI 1OP3H 2VLMD 4NNPH 4GRLC 2YPKB 2APBA 5C09D 2FX9H 5C71A 1F42A 2K3TA 4HC1L 2VLRB 4U05A 2VZTA 4EKXA 5ILTH 3GJFH 5DHVB 4QHUB 3O81A 9CGTA 1M6OA 4MHHI 3O6KL 1FCGA 2BVOA 1OY3B 3ILPA 4OB5H 4P59H 1T66D 5FYJH 1NKRA 2XQBL 1K6QH 1QG3A 3OKLB 1AP2A 3MLZH 3UTZA 4YXHL 2MCG1 2OQJB 5IM7A 1WCQA 4OLEA 1FYTD 1GVIA 1F4YL 4PJ7E 2IGFL 1ZVYA 1F3JA 5GS0H 2EC9U 2DYPD 2E7LA 3D39E 3ZMRA 1I9RL 2VOTA 4RFOL 2FZ3A 1KC5H 4HH8A 2MWCA 4LCCC 2JB6B 3KLAB 4JFZH 3DETC 3UTTE 1AR2A 5DURD 1UCBH 1J0YA 2FH8A 5E2WH 4R7DB 1IVLA 4BM7A 5HHNA 5CEXA 3PWPB 1G7QB 5H37H 2QADD 1E28B 3OQ3B 4JHWL 4KJYA 1FNSL 3ZYOA 3S3SA 1A3LH 2AV7B 5IQ9A 1WFTA 3QUYC 4WWKD 5C0BA 4OCWH 4F7TB 1MCHA 1TCRA 1RJLB 1ED3A 3U9UB 2GFBA 1FORH 3MRHB 3DGGB 5DD5H 3PL6A 2Z31B 3MLPA 1KEGH 4F7PA 1MWAB 3HZMB 2QSCH 4NQDE 4KH2A 1QRNA 1RZKH 5C0IB 2EKJA 4Y2OA 3BX7C 1G7PA 5I8CA 4KPHH 2X10A 3OXRB 4UT7L 1OAYH 1CGTA 1NAMB 2X42A 3BP6B 4G8EB 4JFDB 1T66C 3UBXI 3P0YL 2MSPA 5FA4B 5CILL 3SGKA 3E1F1 1GPOL 1TJGL 3QZWA 2F8OA 1N6UA 2X44D 4F7CA 4OI9A 5AD0A 4WNQB 4HKJB 1FDLL 1JWMA 3QFJB 3QHTC 3ARDB 4LASL 2V7NA 4XCCH 4CU8A 1SM3H 2H32H 5EIIA 2NW2A 2EDEA 2DI8A 4YQXH 3DYOA 4YZFE 3RDTA 5DJDA 3BW9B 3WO3B 1S9VA 5FOJA 1U8MB 2VITA 1T03L 3KPNB 3NA4A 2CLVB 2QADC 3CVIL 2VXSL 1UKTA 4FFYL 4ONFH 1S9WA 35C8L 5MP6L 3MLTA 4WWKC 2F9BT 1EA9C 3BZEA 2CIKB 2L7UA 4JFOA 5CEYB 4JHBA 5EBWB 2IMMA 1QR4A 2R2CA 2F58L 5KVGH 3QUZB 4GXVL 1CDHA 4AYFA 4U1NA 5SWZD 5TE6H 4AIZA 2D03L 1V05A 3LEXB 4N8VA 1UA6L 4UV7H 4F58L 1WAAA 3WIHH 4JPVL 2C26A 4PJAE 5FYKU 2Q87A 4GMSH 1JRHL 3SDDD 2HVKB 4XC3H 1FZMA 2PTTB 3CJJA 3GKWH 4RGNB 1R3LA 4WHCA 3HLAB 4MNHB 3L3DA 3VXQB 4Z7VA 5CEZD 5LBSL 5GZOD 1SJHA 3I6GB 4DN3H 5CCKH 3S35X 1KCSH 1RU9H 1AQKL 2VE6B 3D2UB 4TUKH 4LCUB 4O5LH 4H0IA 4PJ5B 2QBWA 5ISZE 4QOKE 4Z0XB 4NP4L 5K9OB 4I0PA 2M26A 1UJ3C 3QIWA 2LFGA 5J6GA 5GIRA 3G6JA 3NGBC 1NPUA 1UZ6E 4IIQA 4KQ3H 2XA8L 2FX8L 4XVSH 3PG2A 3OKKA 3EBAA 4J3WA 1HCVA 3NTCL 3ARWA 1T21A 2X9YA 4LOUD 4YHML 3ULSA 1D3CA 1DQMH 2DQUL 2J6EA 1MAMH 1I3UA 3ZTNL 1DLHA 4PJ8D 4P2QB 4ENED 1W0VB 4GFTB 4NC0B 2R4SH 4U1SA 2ENSA 2X4RA 3EYVB 4DOHE 3ARVA 5EU6B 1UQSB 2F5AL 3LKRB 2P7TB 3S88L 1D7FA 3VFGH 4L29B 4M6AA 4JFHD 5IHZA 2F74B 4BQ9A 1P84K 1DN0A 3D87B 3CFDB 1FG2B 1XH3B 2KKQA 2XG4A 3K3QA 4XNXL 4NCDA 5T1DH 4JANB 3GB7B 3LKNB 5TQ0L 3SY0A 5C0RL 1C12B 4ZO7A 1VKXB 2VLKA 4Z76A 3MC0A 4KUCD 1FSKB 3PHOB 1Z5LA 3C5ZB 1ZEAH 4PV9B 3W0WA 3D0LB 3G04B 1JTTA 4HH9B 3RWGB 1P4BH 5LGJB 4OZGA 4F37K 1U3JA 3WV0A 1IGIH 5K9KB 2OP4L 1F5WA 1CIUA 2PXYB 1N2RA 3MACL 1ZHNB 3V0AC 4NKDB 4DGIL 3C5SB 2FDBP 2XZCL 2PR4L 1E4XH 3LKOB 3VXSB 1ZAGA 4O51B 3T8XB 1CXFA 2X05A 5I76B 4ZPTA 4ZFOA 1CTOA 1F3DJ 4JGMA 4BK4A 3OWEA 1NLDL 4JFED 3T65A 4PJ8C 4J3UA 1G84A 2YPVH 4ENEC 3TH4T 4MYWB 2CDFA 5F1SA 1A7RL 3H3BC 3QIUB 1I8KA 2AK4A 2A9NH 5MEND 4ZAKB 3DX6B 3VFOB 2XNAB 5D2LE 5B21A 5F9WC 1WBXB 2QLVB 2ED9A 1M7IA 1G6VK 1PSKL 1UACL 4QRPB 3GJFB 4YHNB 1DFBH 1K2DB 3CMOL 1H3UA 3WEXB 1IQDB 1NFKA 3ZDXE 4L3EE 5ITFA 1FFOA 3DMMB 2BVQA 1AXIB 1OF2B 3T4YB 5LVEA 1OAQL 5IVZB 2F5BH 4YWGH 1P9MC 4DEPC 2P45B 1BQHG 3TNNB 1GZPA 2J88L 3FFCA 2C3VB 2OI9C 5F3BA 2WUCL 1F00I 4A6YA 4F15B 4K7PX 3HUJE 5FHAL 3PABB 4QT5A 1I7UB 1KSRA 4MCYB 4CVXB 2EE6A 4LNVA 3IJSA 4F7MA 2A6KA 2EIDA 4WWID 3B8SA 3F58H 5F7LB 4P46C 4QXWA 3HZYB 3HPJA 4GKNA 3AB0B 4C56A 1WISA 4S2SA 3FQXB 5J57B 1VA9A 5C6TL 2W9DH 1JZ8A 4LSQH 1I3GH 2Q8BL 3IDGA 4M9OA 1JNHB 4N0UB 5FF6B 1CBVL 1ZLVH 4EJ1C 4S1SL 1DL7H 1ZGLB 2CLZA 4UTAH 2HG5A 3VXME 4P2OA 2EIBA 2WM0A 5AYQA 1IGTA 4AEHL 3FO9A 3VD3A 4HC1A 3NCJH 1KTLB 3MA9H 3CXHK 2H1PL 5KVDH 5FOBA 5I2IA 5L9DH 1OGAE 3GGWA 2Y5TB 3OAUH 1WT5C 4TUOB 4FFVD 4OFIA 1RHHB 1QSFB 3BGMA 3VGBA 4YHKL 1A6AA 2C1PA 3FO2A 1CR9H 1MIEL 3OR7A 3LH2H 4JE4B 3C60B 1AGEA 5KSBA 1KLGB 2BNUB 1NFDA 3CPLA 2AJ3A 4LSUL 3VDAA 4HKXA 4PGZA 1CF8L 2VZVA 3QFDA 1DVFA 5TGBA 5DTFA 5B22A 3OHXA 3ZO0A 3QEQA 4A2LA 5E8OA 3LRHA 2H32B 4HLZG 2YK1H 2ZUTA 3NIDF 3WN5C 5DJ8A 4CN4A 5DJAB 5F9OL 5E2VH 2R2BA 4D0DA 1V7NH 1FBIL 5CMAB 3L7EB 4ZUWA 2HJLA 3GSQB 5JIPA 3LHPH 1MF2L 1QEWA 1B0RB 2W65A 4JFYA 3ARGA 5BZWB 1M71A 2R56H 4M03A 4OZIE 5K33A 1V3MA 1J8HB 1G6RH 1XCTA 1K4DB 4OF0A 4D0CB 1XGTA 3Q2CA 4XXCA 4GS7B 3IT8D 3IDNA 4ZDHA 2DL2A 3V0WL 1J0KA 2Q6WB 1MCFA 2IWGA 4FFVC 4EVNB 2HP4A 1PBYA 3NN8B 5EOQL 3QUMB 4Y4KA 1O7SA 5DVMA 4CMHC 2A83A 3EDEA 4BZ1H 4GW4B 4HXAL 3KPMA 3ABZA 1P6FA 1FLRL 4EI5B 1JGDA 1PD6A 3UJIL 5EPMB 2HYMA 1NCDL 4L4TD 1URLA 2AXGA 5ENWA 2R23B 4N5ED 3MV7B 4QF1B 5E6YA 2VB5A 4IRZH 1FFRA 2DDQL 3BPCA 2UWEB 4WUUD 4V1DE 5J56B 2KQMA 1BQHA 5IWLA 4MB3A 4Q58C 2VN7A 4YDIH 1TZGL 4JDTH 5SWQB 1TJHH 1A6UH 3ETBF 2COQA 3L95B 3SE9L 3GDBA 3HC4H 3PWVB 1TQCC 3SKOA 1VGKA 3AS1A 1VPOH 4KDTA 5T1MA 3S35H 3SGJC 5IT2H 4X5LA 4GT7A 1IBGL 5T33L 1OAXH 1KCRL 1QSZA 4H8WH 2XG5A 5EZOL 4P2CG 1MCWW 4RWYL 3QDAA 3EJYD 1NCAH 1ZANH 4HFWB 1AY1H 1F58L 1FL5B 1NDMB 4LPCA 3G9VA 1F6AB 3P4NB 3QCTL 5E5RB 2V2WA 4BSVA 4F2MA 2WUBL 2UY6A 3KHQA 1QHPA 5HYEA 1DBJL 4QO1A 3HFMH 3VGHA 3MV9E 2R0ZH 4ODUA 2DI7A 3I3DA 1GOGA 4PY7A 1NGXB 5J1TC 1GGBH 4JQVA 4IRJA 4OCXL 5A2JH 2VLJE 4Z7QE 4PD4J 1WBYA 4ODXA 4CL7A 4U1HA 1PYWA 3MMEA 2V9QA 4G8IA 4HWUA 1JE6A 4N5EC 5D96B 5C6WH 1R3KA 1BWWA 1IQWL 3S34L 1U6AH 3ZDYF 1QKZH 3TVMD 4LHUA 4QRSA 4XPGL 4TOYH 1KENH 1N8ZA 3FN0L 3GBNH 1NBZA 2Y72A 1U95A 2JE8A 1BEYH 3C08H 2ITDB 3BOVA 3F8UB 4MNGE 2DWDA 2I07A 1KCKA 3KLHD 3A6CH 3EYUH 3MNZB 4R26H 1ZS8B 3HR5B 2GSGB 3QI9B 4Y5YA 3AU1B 4AJ0A 1Q8MA 3BYTA 3S7GA 1GH7A 5L0QB 4AT6A 5D9SA 3ZT5A 4KKBC 3LKQB 3B3IA 2GK0A 1K4CB 1JI2A 4HFUL 4OLZL 4P5MA 3DPBA 4XZUA 1IT9L 2CQVA 5HHMD 2XY1A 3U4EA 2WIIB 1A4JB 2ADIA 1ZOXA 2A74B 3F7YA 1IC4H 4G6JL 2EZ0D 5HDLA 4OTXL 4YEFA 3CFKB 3BUTA 2N7AA 1T22A 3HG1B 1WIUA 1EDQA 4NDMA 5JQ6L 3JWNC 3UROR 4E41B 5BZDB 4HIJA 3VXUD 2A6JB 4M8QA 3SE3C 4Z7NE 5EWIH 5ICXB 1LP9B 3DRQB 3QBTB 1FGNH 4XGZB 4ELME 3EJZD 2X7LB 3ECBB 6FABH 3ULVC 3L7FB 1DQQB 1W0WA 4U49A 3DHMA 1J1OL 4M4RA 3KPRA 1I7RA 4HZLA 4J6RH 5E0QA 4JKLA 3KLHC 4K23L 4Y8AA 5IFJA 2X9XA 2AEQH 1LP9F 4MJ5A 3HC3L 4HHAA 3SBWC 3OKOB 1RZJL 3DTXB 2YKLL 3OV6A 4K7PH 1EEQA 4KV5E 4NO2A 3H7BA 3KDMA 4TVPL 5E56A 3VD9A 1NLBH 2VLRD 3FN3A 2ATKA 3P4OB 4NUGH 4UQ2B 3MRFB 3TPUA 1E6OH 3RUGB 4TNWF 4MQTB 1FL6A 2I25N 1RUKH 1Z9SA 3WE6B 4CN1A 5D1ZB 1WZKA 4XPHL 1HSAB 4M6NH 3QH3A 1QO3B 2JK5B 4MCZB 2EDKA 3F7QA 3WHXA 1BD2B 1OGTB 2O5YL 2EZ0C 3WS6A 3D18A 2GYSA 5I8OL 1UENA 5MHSE 1JGEA 4Q7DA 4OM1L 3NCMA 1KB9K 4G6KH 1NANH 3L6FB 3IDUA 5HDOA 2AJUL 2R1WA 3VGDA 3MRMB 4L4VE 3EJZC 3MRJB 3QSKB 3BN3B 1GC1H 2Y7QB 4S1RL 5KG9B 4RMQA 2HTLD 1IC5L 5F3HB 1S9KC 3MRBA 3IDMB 3PWLA 3SO5A 3X14A 2EYSA 4GKZB 3WIFB 4OD3H 2DQIL 3UTPD 1ZHKB 2VAAA 3QG7H 3I3BA 5E8NB 4NM4L 3VFMB 4NKOB 1AH1A 4HX1A 5EC1B 4Z8FL 3LQAL 1DBKL 2PW2A 1UWGL 4FS0A 1KOAA 3U0WH 5DRWB 5L2JB 4YK4C 3VMOA 4PLNC 1G9NL 3UX9B 4JFDD 1T7WA 3QB7C 3S96A 3SE4A 3RU8H 1IGYA 2GTWB 3BXNB 4FQLL 3A67H 3EJJX 3BH8B 4U1GC 1RUQH 3OKDA 4DQOH 4Z7OE 5JPNA 4J4PD 5C6PB 5BMFL 3E2HB 3WS3B 5JHDB 2YD3A 1CLCA 5F8QC 1EO8L 1PKOA 4NRZB 4PLKD 1M05A 2J3SA 4JN1H 3DV4A 4M00A 3BD5A 4LLWA 5EO0B 2PYEA 4UNUA 1FFNB 3WNLA 3PHSA 3ROLA 4XPBH 1JWSB 4CKVX 3W5NA 3PJSB 4BQ8A 1VENA 2HTLC 3MZTA 1JF5A 4LCIL 4MD5A 5D6DA 1T2QL 5A1AA 3GNML 2CRZA 4LKCB 5ANMB 1R5IA 3F7PC 1FVDA 2VAJA 5C0DB 2VR5A 4MQ7B 2DKUA 5HHQA 3WL9A 4PRIB 4X7FC 4XT1C 5I74C 2NTFB 5HBBA 2B2XL 43C9B 5D7IB 1MY5A 4O9HL 3S4SB 3BSZH 3PF2A 3WYRA 3MJ7B 1JUFB 2ZUXA 5GGVL 4K94L 3D0VA 2A1WH 1BIHA 4ISVB 1UEYA 1WQVT 4HWZB 4LQFH 4FQ1H 3FTGA 4MNQB 3BWAA 2PO6B 1FN4B 4LCWA 4MXQD 3M45A 5D2NA 3GHBL 2C3GA 4NRYA 4JREC 3GMNA 3QDMB 2X4NB 4P4KB 5DD0H 2YSSB 1KG0A 4RGND 2ARWA 3RZCA 4J4PC 1UT9A 3MO1B 3EO1A 1VB9A 3D2UD 4PLKC 5IB5A 4NZTL 2AJZA 2VR9A 3K4AA 4KQ4H 4HIHB 5B38G 5FGCB 1I1AA 3H9SA 1VACB 1C5BL 1MH5B 2YA0A 3FB6A 5GZND 3KYNB 2PYFA 3EHBD 1KNOB 1YNKH 3ARPA 2YC1A 4OZHB 4JJ5B 1FYHB 2APVA 3LEVL 3VG0L 4R3SA 1EX0A 4Z5RA 1KT2B 4YDVA 5ADPL 5IB4A 1RFDL 3UEZA 4WY7L 2R8SH 3GRWL 2MFNA 4YXKL 5IEHA 3P73B 4Z7WA 2FD6H 3QO0B 1I9IH 5F93C 4XCNB 4DKFH 2QKIB 3FJTA 4RIRB 4G9FA 2E8ZA 5A2FA 3THMH 5EC2B 2FHBA 3JWOH 2R2EB 3KAAA 2B0SH 4H26A 1J12A 3ARBD 1MIML 4U7SA 1KN2H 4JO4L 1CVRA 3CZFB 4K07A 4QHLB 4I13B 4MA8L 4MXQC 1U8PB 4G43B 1RJZA 3AMKA 4RGNC 4E5XA 3CDGA 4F33B 3EOTL 1QRNB 1HDMA 1BIIA 4QYOB 3VGEA 2EICA 1FIGH 1HQ4B 1NDGB 3ESVF 1SJEA 3G6AA 4XNMA 3UPRA 1AHWA 5DJ0B 3WJJC 3NABH 4PJFA 1FHGA 3NAAL 1V7ML 2AQ3A 3BQUB 4FQ2L 1AKJA 3R1GH 4QRUA 4WUKL 5GZNC 2PXYD 5KSVA 1IARB 4JLRA 3DVNB 5F70A 3STLB 3ULUL 3LY6A 4Q9RH 2VXVL 2VISB 1PKQB 2ZCKH 4DVBB 3PWPE 1TQBB 4PB9L 5AAWA 5EUOA 5ICYA 3O45A 1HIMH 3L9RA 3OGCB 2P5WA 2W9EH 3O4LA 1U8NA 1CFQB 3PGFL 2EDRA 3C6LB 4JY5H 1IILE 4MVBD 5T3XD 3SGEI 1A14H 4MA7L 1PQZB 1RJYB 4XP6H 5TJWK 1MHCA 4UT9H 2ATPA 5FO9B 4H5SA 4HJGA 4OAWA 3FT2A 3UTTD 3I75A 5IQ7H 4XBEL 1X7QA 5IG7B 4BH8A 3ARBC 5FDWA 3ZYJA 2FGWL 4QRPD 4NN7C 5IKCA 1HN1A 5CSGA 2NPLX 4UDTB 3QWRA 4BQ6A 1AXTL 1IAIL 1S7XA 4JQIH 3CU7A 1WZMA 1FSKC 4XC1H 5DHYB 5FUZL 1J05B 3RKDD 5H94A 5FYJD 5DJCB 5T5NF 5EU7E 3JV6A 1LE9B 3B9AA 1NGQL 5DRXA 4IRSD 4Z77A 5HSFA 4N90E 4F37F 5GS0D 2OJEB 4F9LC 2PXYC 1VESA 4LPVA 1QSEA 3BE1H 2F54D 4G8FB 4NZRL 1R3LB 4LVOC 4JO2H 4HULB 4TSBH 2IAMA 5B38A 2X4SA 2Z4QA 1WAAF 2DQFA 4M62L 4MVBC 2ZUQB 1P2CA 1XIWD 1OW0A 3I02A 4QNPE 4RFNC 1IGFL 3IRPX 4LLMA 3BZFA 4TTDD 4JCLA 3U9PL 4X0KA 4Z7VF 1YEDA 5F96H 1KCUL 2D7NA 3VFSB 1MVFA 2VJXA 4U33A 2G5BA 5A3IC 1S8DB 3HN3A 2W0KA 1JZ5A 3SEPA 1WGOA 4HXBL 1MJ8H 3MGAA 2DQDH 1T21B 2IG2H 3DI3B 3EYOA 5GGVY 1QSFD 5L7XL 3G6JF 5DEFB 4LSRH 1G7MA 3IETB 2E9BA 3C60D 3KR3H 5ACZA 5I1CH 3ALPA 3GHEL 5JW5A 1M7XA 2A38A 3RKDC 1SY6A 2BJMH 2YA2A 4K3DH 2JCCA 5ID1B 1B2WL 1RD6A 4PRNB 3OJ2C 3EAKA 1FZJB 3MREB 2DM3A 4IRSC 2OXGA 3W9EB 4PJ5E 3GSWB 4F15C 5GS0C 1T5WA 4YGVA 4DN4H 1AGDA 4YR6A 5IMKB 1HYSD 5GGUB 3MUHL 4RA3A 3GSNL 3EO9H 3AB0C 4HBCH 4QHMA 5MEQA 2E5EA 4ZYKB 2IADB 1UZ8A 4NQEA 4RAVB 1NCBL 4YFLI 1KN4H 1XIWC 1IAMA 4MJ6B 1EHLH 2GSIA 4TTDC 4DAGH 5ISZD 4QOKD 5EIVA 4RZCA 4PD4K 4C83A 3RWJA 4YHLL 1NCWH 4P2QE 5E5MB 4EQ3A 1YNLL 1JF1B 4QRRA 2CKBH 5D7LE 3PXJA 5E9DE 3VJ6B 5EU6E 3BUYA 3ARQA 4X6CB 1M7DA 4WI8A 5E1HB 3ARYA 1BVKB 1INQB 1J7VR 1RZKC 2BRRL 2VDNL 5I1IL 1TZHB 1TDQA 2SEBB 1UWEH 1ZA3A 2V7HA 2IANA 4L3CA 4P99A 4KI5F 3CXDL 3BP4B 3PP3K 1EHNA 3C60C 4JCMA 3H42L 3MRGB 4APQB 2XKNA 4NO0B 2VTFA 2DI9A 4EI5D 2DWEA 2F19H 3UDWC 2Z93B 5ESVB 2CJUL 3MV7D 1BP3B 1OP5H 4LSTH 1MSPA 3SGDH 3WUZA 3NCYP 4X9GA 1HYSC 1PLGL 3N1FC 4V2BA 4PR5B 3KYOB 1FV1B 2W9LA 1KIQA 1ND0A 1YNTB 1J1PL 3SE8H 2CH8A 4HUUB 5IW6B 1HYRC 3PDDA 3V5HA 2AJXL 3QWQB 3S36L 3U0PA 2IFFH 3UO1L 4A6YB 5I19L 1WC7A 3FQUA 4NNYA 3KLSA 1DUZA 3I85A 3QG6B 5I1EL 4QEGA 4O02H 4EOWH 3DYMA 3MLRH 3AXLB 1I4FA 4FZEH 5B4MD 1H8OA 5E94B 4LPXA 2Q7YB 1S5IH 3FFDB 5CUSL 4XCFH 5BJTB 5CEZL 1KYOJ 3W2DL 1EFXD 1UG9A 1L9NA 3FQNB 2JELH 2VDPL 5EZLB 1BOGB 5KBNC 3MFFB 1HH6A 2ED7A 4AM0B 4UB0H 3ZL4L 4ERSH 1CFTB 4L9LA 4FQXA 3NCYS 3FO0H 4NGHH 4OZFG 2AERT 4Z0BL 5SWSA 4G42A 3OB8A 3CFCL 5IOPA 4EI5C 4YIQA 4LKXB 1UC6A 2YD7A 4GW5B 5KSUB 2GJ6A 4P3CH 5EUKB 3H0TA 3HE7A 5F1IB 3V6FA 3BVNB 3LKSB 1S78D 1NGZA 4N0CD 5D1QA 3O3AB 4PRHE 4JRYE 4NUJB 1P7QB 2A2QT 1BZQK 2MPAH 1R6VA 2AJVL 3ELAT 2VIRB 2VRAA 5CJBA 1CICA 5L6YL 4GBXB 2XZAL 4FQPA 5CAYB 2X09A 1HKLH 4JQXA 5D5MB 3QI9D 4XNQB 1YEKH 1NFDF 4C59B 3D85D 1RZ7L 2BMKB 2OXHA 1XEDA 4GXUN 1E4KC 1NQBA 2ZJSL 1IAKB 2YEZB 3LEYH 1F3DH 5L2KA 5FA3A 3EO0A 3R4DA 4U6HB 2ESVB 4NQVB 5JXAH 4WI7A 1BOYA 3KHOA 2UV3A 4LSVH 4ZOCA 5D5MF 3NFSH 2DBJA 2EH8L 4XPFL 3WJLC 3BDYH 5E99H 3MJGX 4N1CA 1EJOL 1PG7W 3MRIB 4B7IA 3IFNH 3QJHA 2ZUSA 3H7LA 1I3RB 3CSPA 3PQYB 2WQ8A 1H3PL 3NIDE 3OR6A 4M43H 2D7PA 1K3ZA 3MCLL 1INDH 2I9LA 4XXDA 4LP4A 3T2QA 4DGVH 1IKNA 2J4WL 1MEXH 5CZVH 3BAEL 3UAJC 4ZFFA 4ZFGH 5EZIH 5D96C 4OLVL 3MBXL 4P57B 4R96B 1CT8A 4H0HB 4Z7UB 1S78C 4N0CC 3VWJD 4YC2B 2R1XA 2KDGA 4WFGE 1T1WA 4NKMA 3MRNB 5J1AB 5JDJA 5IMLB 2NTSP 4JFFA 3M07A 2VXUH 3WNMA 5BS0B 5FKAA 5HJ3B 1T20A 4HK0B 1LK3L 3BISA 4E9LA 4Z7UF 4YO0A 3OX8A 2BOCA 2Y36H 4OGZA 2N7BA 4YX2L 3QI9C 3DO7B 2Z92A 4QXTB 3AM8C 1QYGL 3SDAA 1EHXA 1MHPH 2Q86B 5JXEA 1A02N 1LO3H 5L0QC 3P40A 4JKKA 4NRXB 4PJDE 4L8CB 1QLEH 5HHVH 4WTXA 2VDMH 3HPLA 3VRJB 4NHCH 1CXKA 1PX4A 4P5TB 3UJTH 5C0GA 2VDRL 1U8LA 5D1ZD 2E3VA 5LG1A 2GI7A 5GGQL 3RWCA 5A2LH 2ZSVB 2B5IB 5IFHH 2P8MA 1Q0XL 4LCCA 3QQ3A 1MAKA 5I1KL 3GMQB 1QTYT 3RWIB 4NZUL 4GRWH 1FFPB 3HNTH 3DV6A 3GIVB 1MCRA 4RMTA 4QY8A 3QDGA 1WZ1H 3TJEH 3IDIB 5C0CE 1ADQL 3S37L 4NQCA 2OL3H 4OZFA 1WICA 3VWJC 3TN0B 1JMZA 4R4FH 4BSWB 2IQAA 5JZ7C 3TGXA 5A16A 4AIXA 1N59A 3QUYA 3LB6C 3RGVB 3UJJL 4HV8A 4M7LL 3JTTA 3TNMA 3WMSA 4X98A 3GMOA 5C09A 3O8XB 1AD9A 3FB8B 1YMMB 4WV1A 4F7EA 4OGYL 4XP9H 4M6ML 1D6EA 2VXQL 3R0MA 4I3SL 1YPZE 4NKIH 3MLVH 4JPIB 3X3FL 3PV6A 3I6KA 5L88L 4PY8J 3O6FA 4WU5A 3D9AH 4XI5D 2HH0L 1HINH 1S7WB 2A0LD 1T2XA 3G5XB 3ZKXB 2HJKB 4JM4H 1L0QA 1BZ7A 1QVOB 5EIQA 2ZKHL 4X4ME 1FYTA 1ACYH 3P4LA 2CKBB 4YEEA 5D1ZC 5EOCH 1MJ7H 2HLAB 4UUJA 2V17L 2CRMA 1BZ9A 2QHRL 2P8LB 1UXSA 4OUOA 4R4BB 1MVUA 3OJDA 3QNYA 5B3JF 1E0OB 3MGTA 2VDLL 3ZDYE 3BEWA 4ODWB 2YRPA 5FIEA 2DKSA 4I48A 1SEBB 3ISWA 4IHOA 2B1AL 1RZFH 2X70A 3M1BA 3MLWL 5K9QG 1X5GA 3KYKH 3O0RH 4LEOA 3O6MH 3RJDA 1FO0L 4DGYL 2HRPH 4WI2A 3T09A 3S5LG 4PJHB 1ZLSH 4WWKA 5BCAA 3NFPB 4WEUD 2PUQT 3GSNA 3NZ8A 1N7MH 3U30B 3N06B 5FO8A 1JPSH 3DIFA 1UYWL 5F89B 3MV9D 5CGTA 5JIHA 5D1XB 1F8TH 1KXVC 4MSWB 4TN9A 4K3JH 3BPLB 3VCLA 5ID0A 2VLJD 2ICES 5DC4B 4EN3A 5EBMA 5IJKC 4PRID 2E7MA 1XGPA 1C08B 3INUL 5IMMB 2IQ9H 5F7KC 4XI5C 3OKEB 1U2CA 2A0LC 2EH7L 1KIRA 3MUGB 5JPMB 3U36A 5F71A 3W39B 2BFVL 4OZ4B 1ES0B 1ZT4B 2J8OA 1JNLH 3GSUA 4J3SA 3WSQL 1W72L 1DQDH 4S0SD 3RTQB 3HZVB 1GSMA 2YWYA 1I9JH 4XHJD 3QDMD 4NC2B 2QQNL 1VGEL 4P4KD 2A6IB 1HOCA 4KVNL 4NM8H 1EZVX 1GGYA 3DUUA 3UC0H 4P9MH 3E2HC 1UJ3A 4AL8H 1NEZG 3LIZL 3A6BH 1N5YL 1VFAB 3JV4A 5BXFA 2XWJB 3HG1E 1A7NH 2FL5A 3C6SA 1B4JL 3PIQA 2QQKH 3VE0A 1QA9A 5L8KB 4FQIL 4Z78B 3ARED 2X1PA 4XPAL 5IB3A 4PUBH 4XNUL 4OFYA 2AEWA 4X80H 5T1LA 4D9RE 1HILA 4UAOB 5C92A 2JJWA 3HI5L 5KW9H 3VA2C 1W8OA 5INCB 1J5OL 4L8BA 1OAUL 4N68A 4WU7A 3VXMA 3RPKA 3FOLA 4X6BB 4WW1A 4ONHA 4Y5XA 3WFCL 5CIPA 5HHOA 4EBQH 2OR8A 3TT1H 7CGTA 3MOAL 2Z8RA 1YYLH 5JLZA 5TDPA 5B8CB 5C07B 1XR8A 5CKGA 3MX0A 4K71C 3DBXA 4HW6A 4RDQF 4P23A 3X14B 1X5FA 3RWFA 4H8WC 3G08A 3UBXB 1A6TB 1D5IL 2AKRB 2IMNA 1L7IH 2PO6C 4KK9D 3RVWD 1T04A 2X1OA 4XHJC 2IPTH 4P4KC 4Y1AB 4KY1H 1VADB 1X3DA 3VWKD 5CZKA 5FKPA 2X4TA 2EDTA 2J2ZA 4KI1A 4GJTB 2FSEB 3OG4B 2AQ2A 3ULVL 2IBBA 3NIFF 4LLAA 4X99A 1FC2D 2Y06L 2YXMA 3IU4H 3WO4C 2BNQD 2PETA 4PJ9B 4HWEH 3TF7C 2BVYA 1BFVH 1Q72L 1BFSA 4DTGH 4CDGC 4OCRL 4M1DH 3SQBA 4JN2A 5FYLH 5A2KH 5DVKA 3TA3B 4D9QD 4U6YB 4PJ8A 4WW2B 4ZFZB 4Q9QL 1QPXA 4X5XA 1N5AB 4G8GB 3ALXA 5MHSD 4UZGA 4LLDB 2C9AA 1BLNA 3QUXA 2R0LH 3UPCA 4FXGA 5DJ2B 1AO7D 1Q9KA 3V52H 3GMLB 2X4QB 4POUB 4QXGH 4L4VD 4AMKH 3W5MA 1BQUA 4YAQB 4XB7A 1DR9A 1A5FH 2MHAB 2BXYA 1V8HA 2DQJH 5HHPA 5KAQG 2XZQH 2NXZD 4P4RB 3RPIA 3RL1A 4KK9C 4U1MA 3WL9B 3PNWA 5I18L 1F11A 3MRLB 1P9MA 3WXWH 3FMGH 5J89A 4DUVA 2OCFD 4JFQA 5DVLA 3LRSB 1OM3H 3VWKC 3RL2B 1AI1L 5IUSA 3V8OA 4XMPL 2RAMA 3FKUS 1EEYA 3NH7L 4GRMA 1ZT1A 2NZ9D 4P46A 3WUWA 3CDYA 4ZXBD 4LCWB 3IDXH 3L5XL 5C3TA 4U31A 3V5DB 3U48A 1QNZH 4M7LT 1LDPH 1IGJA 3QEGH 1NEZA 1S7VA 1MCOH 1OTTD 5TDNB 3IFPB 1NGWB 1WF5A 2YD1A 1P1ZA 1TQBC 1BAFH 2OL3B 4MX7B 3MJ8B 1HE7A 3WFDH 4JFEA 1KUMA 1ZGLM 3VW3L 1OCWL 5ANME 4YGAB 2I5YH 5C08B 5E2TH 5D71H 2DJ4A 2E6JA 3IDJB 5GRWA 2HKFH 1TTGA 2ZZUT 4CVZB 1Q9WB 3WBDA 5DD3L 1WT5A 2ZOLA 1CXLA 2EYTB 4X83A 5C0AE 2H2PC 4KUZL 1HEZB 1G1YA 5MERA 3HC0A 5FGBC 3GI9H 4U1IA 5FK9A 2J8UE 4P2YA 5E7FA 1I8MB 4MNQE 3MZGB 3QXAB 1LEIA 5I8KH 4Z18A 3E6HA 4HDIA 1I7TA 4LDLB 1LVEA 4NWTL 2K7QA 5EZJB 2XPGB 3HCVB 3TIDB 5C0FB 4EI6B 1SEQL 1FNAA 1TMCB 5I66A 3WN5A 4JPKH 4O2EA 1Y6MR 3QIBB 3X13A 2NZ9C 4GKOA 1J0JA 4Y19B 2ARJA 5MEOA 4FMFA 2IBGA 1ADQA 2XQYG 4PRAA 4Z7WF 4ZXBC 3FAXA 4XHQA 5DQDL 3HMXA 1RIHH 4HUWA 1G9MH 2OR9L 3VFPB 5CD3A 4E42B 2QV2A 4H88L 3HI6L 1ZVSA 1AQDA 5LCVH 2YD9A 3ZE0F 2G60H 3P30H 1KYOK 12E8L 5DQ9B 1CE1H 3OTTA 5CBEB 1FGVH 3PWJA 1GC1C 4X8JB 1OB1A 2ZUQC 2XTJB 2Q76A 4HS6A 4LSSL 4MGXA 1A47A 3V4VL 4JZOB 1NBVL 4M61A 4ODHH 1NAML 1UXWB 1S9YA 3LDBB 3QDJB 4PJFF 4RFEA 5E03A 1BJ1J 2GJZA 3Q6GH 2V5RA 5GS2H 1YJDH 1Y0LB 3IVKA 3TZVD 5CKAA 1IL1A 2HTKD 4HLJA 5C0BE 1X5ZA 4JVUA 2NY0D 3CFEB 4UOW0 4HD9A 3ZZ1A 5C7XH 4NQXB 4LP5A 5BRZB 1QBML 2GHWB 4APQD 2APWA 4FN0A 1QRNE 4NO0D 1RUAL 1EV2E 2H6PA 3A0OA 1PZUB 3VXRB 5GGRY 2V2XB 5IKCB 1NCCL 4KK5D 3EOBB 4TSAL 1LO4H 1RZIA 4PB0L 4OT1L 3BP5A 3SGJA 4NQSA 4PLJD 3WFEH 3BFOA 2YUWA 5TH2B 2OK0L 5ADOL 3IFOB 3QHZL 4X6DA 1YEJL 3DO3A 3DI2B 3MOBH 4P9HH 1MCEA 4YXLH 5M94B 1JZ2A 4A2MA 4EIGB 5DUPL 3RA7H 1FZOB 4HWBL 1LO5B 4IOIB 5HPMA 1AIFA 4NZDA 5BQ7B 4FTVB 5GPRA 4D94A 1XZ0A 4UQ3A 2HMID 1R3IL 5F7WC 4ODSL 3SN6N 1PGRB 5IBTL 3TZVC 4JY6A 3VFNB 5AYUH 2NY0C 4KZDH 2LTQC 4LF3B 1JGUH 4WHTB 5DEGB 4L4TA 4XWGH 1IC7L 2ITCA 2OSLA 5JW3L 4UIMA 4HS8H 1MPAL 4APQC 3TYGH 4U1KB 1L7TL 3TH3T 4WUUA 3L3OB 1CLOH 3C2AH 4WFHD 4PGDB 5FCUL 5F7UA 4X6EA 1CDBA 3HRZB 1WAAE 3QXDB 3MBEB 1HHJB 1XGYL 3PGCA 4KK5C 4H0GA 1ZLWK 4GG6B 3TJHD 1RURL 3GI8L 3CH1B 3KPLB 2DMBA 1F45A 4EDXA 1JFQH 3O3UN 4PLJC 4DKEH 1H5BC 2R69L 3CFBB 2OZ4L 4NJAL 4Z7VE 3U82B 4BZ2H 3SJVD 3QEUB 1B0GB 2Z9TA 3HI1A 3IXTA 1J10A 3JUZA 4GSDH 4GG6F 1A1OA 5GRUL 2VH5H 3P9LB 1Z9OA 1RY7B 3ARRA 1G7LB 4CW1B 5ESQA 3T4AA 1NBYB 2JCCF 3V7MA 3G6JE 5D7KE 2HMIC 1QFWM 2DD8H 1MFAL 3TBWA 4UV4H 3RI5K 2WINB 2DKMA 3MYJA 3D69A 1MQKH 3D25A 1LNUA 3L5HA 1CGSL 4CU7A 1I9EA 4CADA 4F9PC 3P4MB 1BQSA 4FP8L 4D8PA 4QGTA 3QR2A 3BH9A 3EGSB 4ELKA 3T2OA 3JWOC 4YHOL 3E0GA 5DK2B 2NY7L 3ZKMC 3S37X 4PTTB 4M5YL 3PQYD 4GAGL 4X4XA 2WBWB 2XKSA 4G7VL 3SE3A 4AEEA 5HY9B 2ICWA 1RULL 4IMKA 1S9XB 3DX8B 5F7FA 5B39G 3K0WA 4QTIH 1FP5A 2WSKA 3WD5L 4UILL 3V6BR 1INEH 3TJHC 5IESL 1U92B 2AGJL 5F88A 5T3XL 3OAZK 3G6DH 2VLKE 3SBWA 4RRPG 4G7YH 2BVPB 1NBQA 5FHBH 3W0WE 5HGDB 2MNUA 5KSAB 3L5WB 5T5FH 4NO5A 1JP5A 5EOTA 1UB5A 4HIXL 2WBJA 4PRPB 5IHUH 4OZGE 1R3HB 2WQRA 2E9IA 4NNPL 1PVHA 1TVDA 4R2GB 2RIKA 4UOJA 1CWVA 3BKMH 2FX9L 5CZXC 1QQDB 4H1LB 2OTUB 4NC1E 5EO9B 5ILTL 3M17A 3QPQD 2CDEA 4KI5E 5DD6B 4LVHB 1DE4B 1EEZA 4PYHA 1HXYB 4L8DA 2W0FA 1R24B 5DMJB 5T1KA 3T0XA 4TQEH 1E4XI 4OB5L 4P59L 3C5JB 3T0WA 5FYJL 4KTEH 1K6QL 5FXCH 3MLZL 1KXQE 3TV3L 4ODVH 4O58H 3VXUA 5GS0L 4NN6C 5E00A 2AK4E 2ERJB 4Y7MA 1KIUA 1BVLA 1KC5L 5D7LD 1U93A 3DXAA 4R7NB 5E9DD 4RAUB 5I75B 5C86A 4FABH 1A7OH 3AMLA 4JFZL 3EFDH 3TBYA 2ED8A 2FIKB 1UM5L 1UCBL 4PJEB 1NUGA 5E2WL 4YC2C 4WGWB 1Z9LA 3TO4D 1FJ1B 1JWUB 2D9CA 3RNKB 4NO3B 5SWSB 1NC4D 3RZWA 2YPKA 1EBAA 3NZHH 4TVSa 1YMMD 1ZXQA 3FFCE 3WLBB 2XQBH 2VLRA 4OCWL 4PJEF 5AZ2H 1BBJB 4ZS7H 5DHVA 1A1NB 1WK0A 4QHUA 2EDBA 1FORL 3L3HB 1LE5B 1F4YH 1G7JB 2BNRB 4JDVB 1A6WL 1KEGL 1TVHB 1I9RH 1U91B 2QSCL 3QPQC 2NR6D 1CVSC 1RZKL 2JJSA 4HKBB 4C56E 3ORJA 3GJEB 5HYFA 1OL0A 3OKLA 4KPHL 4OSUH 1OAYL 2YHGA 3MCG1 4R0LB 2OQJA 4K9EH 4U0RB 3RNQB 1DBAH 3Q5OA 5BOPA 5HVFB 5H2BB 2D7OA 5GRYA 5L8JB 1NMCB 1J88A 1OAKH 2JB6A 3L3GB 5GJSH 2GT9B 3KLAA 1VEOA 3D48R 1SM3L 1MCJA 4MJIB 5HGBB 4R7DA 3EOAB 4XNZC 3LPGA 3PWPA 1G7QA 1FNLA 3PWNB 4YQXL 4PP2B 1FVEB 3SGEH 3FOMB 5FDYA 1E28A 1Y6KR 2EO1A 5E2JA 4JEGB 4PTUB 2AV7A 2X6MA 3TO4C 4MQXD 4OLYH 5KSBE 2FWOB 1NFDE 4D9LH 4F7TA 1IM9D 1RJLA 2ZCLH 4BFBD 3U9UA 5DJZB 2RQ8A 3MRHA 2D0FA 3DGGA 4ONFL 5D1XD 3O8XC 3GSVB 2Z31A 4TNVK 3P0GB 1MWAA 3HZMA 3QEQE 4M7ZC 4RRPA 4JB9L 5D5ME 1JPFB 5C0IA 1X5XA 3OXRA 1WWBX 4LPTA 1NAMA 3TCLB 4PRDB 4U6XB 3MRQB 3BP6A 3FCTB 5KVGL 4PRHD 4G8EA 1S5HB 4JRYD 2NR6C 2NY6D 4JFDA 4BSJA 5TE6L 1M4KA 4I3RL 2ZSWB 3LN5B 4GRLB 5FA4A 2ESVE 3KJ6H 3DRTB 3E3QC 4UV7L 4LGPB 3WIHL 4IJ3C 5HD8C 4WNQA 4HKJA 3QFJA 3ARDA 2H9GB 3ULUF 1CFBA 3RWDA 3RTQD 3UZVB 2BSTB 4XC3L 3DUSB 1DLFH 4P3DB 1MLBB 2VXSH 3GKWL 1H8SA 3A6OA 3BW9A 5J3HD 2D4FA 4MWFB 4DN3L 1KCSL 1RU9L 1U8MA 4DUWA 4TUKL 4O5LL 3KPNA 1R3JB 3MV8B 4K3EH 5DRNB 2CLVA 2F53B 1I1YB 3H3KA 5I1GL 1JTPA 2JJVA 4GXVH 4ZD3H 1ETZB 4OD1H 3I2CH 1SHMA 3U30C 4H25B 4KQ3L 3O6LL 1RJCA 2CIKA 5CEYA 5D1XC 3BIKA 3DV6B 5EBWA 1YQVH 4XVSL 3BPLC 1J1XH 4HJJH 2MQCA 4OCNC 5TFSH 4PIRF 4HWBA 1DQML 1MAML 4RGOH 1RAMA 2LVCA 3LEXA 5C07D 5AEAA 2R4SL 4I1NB 2NY6C 5FO7B 3T0VA 4OLUH 3WCYA 5DJYB 1ZK9A 3VFGL 2HVKA 4WTZA 2PTTA 3HLAA 1CK0H 4MNHA 3VXQA 3GO1H 2JKXA 2FB4H 3VG9B 5DFVD 3I6GA 4WVRA 2WWKO 1QFHA 4OIIH 2VE6A 3RTQC 3D2UA 5T1DL 2EE9A 1N0LA 4LCUA 1A7BA 4PJ5A 1JHTB 4Z0XA 4HLZH 3ZTJG 5J11C 5J3HC 1ZEAL 2ILLA 1W8NA 5K9OA 1WEJH 1P4BL 4Y16D 1RK0B 1IGIL 2DYPB 3UYRH 4WO4B 5IR1B 1OLLA 4M48H 4CVUA 5ESAB 2AXHA 2D3VA 4N9GB 2ADFH 2OZ4A 4UAOC 4DZBB 5DURB 3KPSB 2EXWD 4P2QA 4YPGB 1U8IB 1W0VA 3VD7A 4OCYH 3EYVA 4YFEA 3N85L 2Q3ZA 4OFKA 5EU6A 1UQSA 1CLYH 1MI5B 4FQCH 1YEIH 4ZUTB 5C0CD 3LKRA 1PJ9A 2YPVL 4JRXB 3ARBA 5B8CC 4L29A 4WWKB 2QTEA 2F74A 1QBLL 3B9KB 3CFDA 1FG2A 1XH3A 2A9NL 4XMKH 5D72H 4PG2C 2DQEL 1C5DB 3TCXA 5B3JE 5IHLB 3V0VB 4BUGA 5J6HB 1FCCA 4JANA 3GB7A 3LKNA 3QXWA 1C12A 2YMXH 4I0CC 2FO1A 1ZLWH 3PHOA 3C5ZA 1DFBL 4PV9A 1PEWA 5DFVC 3D0LA 3G04A 1OPGH 1F2XK 3RWGA 2E9JA 1J87A 5LGJA 4KHTH 4D0BB 2I60H 5K9KA 2F5BL 4YWGL 2PXYA 3WIIH 4XVUD 1ZHNA 4Y16C 4NKDA 4JDZB 3C5SA 2ZPKH 3HAEB 1GXEA 3B2VH 1LK2B 1T1ZB 3LKOA 5IW1B 3VXSA 1DBBH 4O51A 3K4DA 3TM6A 3T8XA 2Q3AA 5I76A 3F58L 2LU4A 2OTPA 1P6AB 1RVFH 4P2RB 3TA3C 4S1DD 2EXWC 2J5LC 2W9DL 4NOFA 2HJFB 4WW2C 5D70H 3RVXC 2EE2A 1JJUA 4LSQL 5DGRA 2E9WA 3QIUA 1DL7L 4X7DC 3JWDH 4YHYC 1JMXA 3DX7B 5AAMA 4NSKB 3IJYB 4ZAKA 3DX6A 3VFOA 2XNAA 1TENA 4UTAL 5DRZB 3GSRB 2N1KA 1WBXA 4L9DA 3GBLA 3NCJL 1IRAY 3DX9B 3MA9L 3ARTA 4QRPA 3GJFA 5HYIA 4YHNA 5KVDL 1K2DA 1AD0B 3WEXA 5L9DL 3KPRE 3WDIA 1KB5H 1IQDA 3OAUL 4WCYH 4GQ9H 3DMMA 4BKLB 1OF2A 5SWZB 3T4YA 4EEEA 1KJ2H 5IVZA 5JTWA 1BPVA 5J06A 2HN7B 1U42A 1CR9L 3F7RA 3TNNA 4POZD 3LH2L 3O3BB 4JKWA 1C7TA 5C6TH 1V3KA 1KTKE 3DBXB 4O4YH 4JZJB 5DZNA 1YDPB 3PABA 1I7UA 4M4PA 4WI5A 4MCYA 4ZNEE 4CVXA 4XVUC 3SDDB 5I73C 4Y19D 1X4YA 3HZYA 2KBGA 1H3WM 3MLYH 4OQ1A 2YK1L 3FQXA 1RZGB 4RA0C 1I75A 2ZP0T 5FF6A 4JR9H 5DVOA 1JNHA 4N0UA 2KPNA 1ZGLA 4OCSH 3U0TB 5E2VL 3QQ9C 1V7NL 3QNZB 5F6HI 3ZHLA 4S1DC 5AZEH 2P42B 3MXWH 4KAQH 3LHPL 3MXVH 3BGAA 1HQRB 3MR9B 2I9TB 1KTLA 4AY0A 4LIQH 1JNJA 4XP5H 1KGCE 4IS6B 4WFEE 2Y5TA 5CJQH 4TUOA 5JHLH 4OCMC 3OKYA 1AXSB 4PJBB 1P53A 4MXWL 2XXMB 1RHHA 3K2UH 1QSFA 1Q9LB 3IJHB 4D9RD 2C3XA 5HI4C 4JFPB 5C0JB 3TBSB 3C60A 2F8XC 1J0ZA 1KLGA 1R5VB 2BNUA 4OM0H 3FRUB 2GAZB 1XF4B 2HKHH 1SYVB 1MCNA 2RJMA 2L7JA 4PRBB 1KJVB 1MRCH 4PJBF 5MEPB 3NIFE 5I30H 5F9WB 4U3HA 5IMOB 4BZ1L 3MYZA 5BRZD 4GAFB 3UDWA 3UCRA 3SQOH 3J7HA 3SHSA 2FGZA 2H32A 3F7VB 4FA8A 3ARFD 3RVUD 1OP3K 4U2ZA 1T7YA 3VXRD 2DMKA 5DJAA 5BVPH 2O61B 4IRZL 1JYVA 5CMAA 3L7EA 3GSQA 2ZWLT 4YDIL 4XAKE 4JDTL 4ZUVB 1TJHL 1A6UL 1B0RA 5BZWA 4ZTPH 3HE6B 4KUCF 3HC4L 2EDNA 1RIVH 3S35L 5ERWB 1J8HA 1K4DA 4DZ8B 4D0CA 5IVXB 1JZ6A 4PJXB 1OAXL 4LLQB 4H8WL 2PYEE 5JMRA 3MLUL 2NQCA 2H2SD 3G9AB 4FTVD 1KIPB 2P8PB 5E8PB 1N3NB 1VEPA 1L0XA 4EVNA 3LDBC 5CP3H 1NCAL 1ZANL 1A9EB 1YMHB 3NN8A 1AY1L 3QUMA 4MD4B 4XP4H 1MAJA 4HUXB 3GMRB 4GW4A 4LRNH 3WIHA 4HK3J 5MENB 1D9KD 1FIEA 1UH3A 1T1XB 4EI5A 4RSVA 5ACLA 3HFML 5EPMA 4XTRD 2EEBA 1GRWA 2R0ZL 4XCEB 3F6LA 4KGLA 1GGBL 2R23A 3MV7A 4QF1A 3VXTB 2M8XA 3ARFC 3KXFB 1S3KL 3RVUC 2UWEA 4LMQE 1DQLH 1MJJB 2X89D 3NCFB 3BZ4B 1YN7B 5DFWH 4HDIB 3T0EB 5SWQA 3REVB 3MBED 4LCWE 2IPUG 3L95A 2W92A 5D2NE 3PWVA 1U6AL 1HSBB 1QKZL 4TOYL 5CHNB 1X5KA 3BRFA 5FCSH 3GBNL 1F4XH 5HDBF 1WUNT 2YRZA 4AG4L 1QR1B 1BEYL 1VERA 2NX5B 2CIIB 4PJCB 1E4KA 5DWUH 3A6CL 4WHYG 3EYUL 5AUMB 4R26L 4PYGA 4HFWA 3H9SE 1FL5A 1NDMA 3TBTB 3P4NA 1F6AA 4M7JH 5EB9A 3U6RB 3D3VB 2XN9B 2H2SC 5I17B 3L5IA 3WJLA 3U7AA 4PJCF 5LAXB 4W70A 4U2YA 1D9KC 1NGXA 3GK8H 3S34H 4HUVB 5CD5D 4Z7WE 1ZTXH 4XTRC 5F6HJ 3ET9F 3T3MF 1H15B 3FRPA 4OGXH 3TO2B 3QRFM 2CMRH 1IC4L 4W68A 5KJRH 4G9FE 5DC9B 1ZHLB 4K8RD 5C0AD 3UMTA 4CMHB 1KLFA 4G6FB 2RCSH 1NUDA 3MBEC 1GGIH 5EWIL 1FGNL 3TP4A 5EFIB 2ITDA 4MAYD 2DQGH 2X1WL 2RB8A 4HKZB 6FABL 3MNZA 1T3FB 4DFIA 1ZS8A 3HR5A 2GSGA 2FECI 3QI9A 3AM8A 3AU1A 4J6RL 4PJFE 2AEQL 4JKPH 3FB5B 2AJSL 4PRPD 1FO0B 4GLRI 1LD9B 1KLUB 3LKQA 3QNXB 1EGJA 1FRGH 4K7PL 1TQCB 2QQLH 1K4CA 3HRPA 2LV4A 1QFPA 3KS0J 1XFPA 1DUYB 4O2FB 3TT3L 3VD4A 1NL0H 1NLBL 4GG8B 2GY7B 4NUGL 5JQ6H 4O2CB 4RQQB 2P5WE 3RI5F 3O4LE 1E6OL 2WIIA 5ALBH 1A4JA 3K46A 1RUKL 2HFGH 4QGYA 2A74A 1R0AH 2C7UB 2WMPA 3EUUA 1T4KB 5K9JH 5CD5C 3QQ4B 4M6NL 3CFKA 1KB5B 3HG1A 4N0YH 2Y6SD 4M93B 4E41A 5BZDA 1KACB 4X6DF 1KJ2B 2A6JA 1N64H 5FYKH 5ICXA 1LP9A 3DRQA 4JFXB 4XGZA 5DXWA 2HWZH 2YR3A 2X7LA 1QLFB 4G6KL 3ECBA 1SMAA 1W72B 3L7FA 1DQQA 4AQOA 3NIGF 1I8LA 3S4SG 5C0BD 4MAYC 4B50A 1GC1L 1BGXH 3M8OL 5E4IA 2CGRH 5IP4A 5EA0H 3I50H 3OKOA 3DTXA 3PL6D 4NT6B 4LCYB 1ZKAA 4OD3L 5IK3B 3QG7L 3HS0B 3P4OA 5DZOA 4UQ2A 3MRFA 3V7AE 1E4WH 2O5YH 3RUGA 1MRDH 1QSEE 3Q6FB 1Z3GH 1N6VA 1SY6H 3WE6A 4QWWD 5D1ZA 3V6ZB 1RK1B 1HSAA 1MLCB 1QO3A 4LVHC 3BESR 2OS7A 2JK5A 2V9TA 3U0WL 3CX5J 1EEUA 4MCZA 1ITCA 4U3CA 1BD2A 1OGTA 4GH7B 2KH2B 3ARUA 1BJ1H 4DWHA 2DBLH 4O00A 3RU8L 4ZOAA 2FYYB 4TVPE 2Y6SC 4HGKC 3A67L 5GS2D 4N0RA 5CFHA 5CP7B 5HVHB 3BKYH 4DQOL 3L6FA 4X9HA 5CGMA 3OXSB 5CBAB 3P77B 2A6DB 2ERJC 3MRMA 3IFLH 1OWWA 1D5BB 3MRJA 1XAUA 2Y7QA 5KG9A 4JN1L 4U7MA 5E8DH 5F3HA 1VEMA 2GY5A 4PJIB 4UI2A 5DJXB 5DK0B 3ZDZE 3MOQA 3IDMA 4JM2B 3NA9H 5SX4I 4CN6A 3W11D 5GGRB 4GKZA 3Q5TA 3WIFA 5C8JB 3I9GH 4XPBL 3DSFH 4WFFE 4EDWH 1ZHKA 4JAMB 4XCYB 3FZUD 3VFMA 4NKOA 3BKCH 1G9MC 2JCCE 5K59F 1JZ4A 3TVMB 1A1MB 4PJIF 5EC1A 4YE4H 4PJGB 5HTSA 3I3EA 5LJYH 1B88A 3BEVB 4FFWC 1IZJA 3WNPA 5I1JH 1JNNL 5DRWA 4KTYA 5L2JA 2CUIA 8FABB 3FN9A 3GSOB 3SGKC 2A1WL 3H8NA 5GGSY 4BFIB 4H20L 4LQFL 1R5WB 4FQ1L 3ULVF 2GTWA 4NQEE 5TF1H 3BXNA 4GUPB 3BGFC 3BH8A 4R0LC 4U0RC 1QFUH 4Q9BA 3VGGA 2VZ1A 3WS3A 5JHDA 3RX8A 1NAKH 4LVNB 1CXHA 4NRZA 2FR4B 1YJDC 3GBMH 3L1OL 2P5EB 3QZWG 4N9OB 2D31B 2IPKB 3V6OC 4I0PD 4ZO8A 3O9WB 1ZLVK 5EO0A 4S11A 1FFNA 1Q0YH 1JWSA 3FQRB 4X9FA 1HWHB 5EU3B 3H9HB 5JW4M 3PJSA 4KQ4L 2FLRT 3O41B 5DMGD 2DM2A 1HKFA 4KHXL 1YYMH 2DTMH 4TSCH 4XBGB 3W11C 4MDIB 4LKCA 5ANMA 2IANE 1YNKL 4X9BA 5C0DA 5J13C 4MQ7A 1UB6B 4PRIA 2AABH 2MJWA 3GUTB 3FZUC 4BQCA 4ZS6D 2NTFA 5KZCB 43C9A 5D7IA 3D1MC 3WKNA 4HEME 3S4SA 5T5NG 3MSPA 3RKPA 1FNHA 3MJ7A 1JUFA 1G7IB 3QEHB 4TNVF 3B9VA 4ISVA 3I6LD 2RFXB 4HWZA 2FD6L 2O5XH 4MNQA 3MRRB 1G0DA 1I9IL 2GTZB 4P9HC 4DKFL 4WJ5B 5DLMH 2PO6A 1FN4A 2CXGA 5E70A 5BVJB 3THML 1DBMH 4N8VG 1CD0A 2HFEB 3JWOL 3QDMA 2B0SL 4K7PY 1C5BH 5KANI 2X4NA 4JGUA 1KN2L 4P4KA 2YSSA 3T2PA 2YPLB 1U8JB 5I8EB 4IEFB 3MV01 2VDQH 3MO1A 1YY8B 4YK4B 2GW5A 5JO5B 2X4OB 1PG7H 4I0PC 4HIHA 2R4RH 3ZYIA 1VACA 1MH5A 3FB7B 1FIGL 4IIQC 3KYNA 2ZG2A 1KNOA 3NABL 4U1GB 4OZHA 4JJ5A 5DMGC 4ZSOB 2E6QA 5F1KC 3R1GL 5ECJE 5LKNA 4ORGB 2DTSA 2P1YA 4WO4D 1D5ZB 5EULV 1KT2A 3G5VB 1A9BB 2KQNA 4RGMB 4Q9RL 3OZ9L 4XVTH 2G9HB 2V5TA 1U9KA 1HIML 4ZS6C 1MIMH 5SV4A 5AG9A 2W9EL 5SWSE 3P73A 4W6WB 3QO0A 3KPSD 4XCNA 5DFTA 4JY5L 3B6SB 3L3JB 2QKIA 2GJ6E 4KDVA 2HT4D 4RIRA 2B4CH 3GIZH 4XP6L 4UT9L 5EC2A 1MI5D 1KELH 2C3WA 5IGXH 2R2EA 4PGEB 1XGQB 4JRXD 4P5KB 3CZFA 1CFVL 5IQ7L 2O5ZH 2CK0H 1XF2B 4QHLA 3B9KD 1U8QB 5I74B 4MQSB 3WNKA 3TEUA 3MRCB 4U1JB 1U8PA 3R0NA 4G43A 2QSTA 2QR0A 2NY2D 3ROOB 3RY4A 3BPOC 1A3QA 4F33A 4QXUH 4QYOA 4XMLH 5JIKA 3VG9C 1HQ4A 1NDGA 1D6VH 5DJ0A 4YNYB 4JQIL 5LXGH 2NXYD 4MAUH 1ZSDB 1S7TB 3BQUA 3O3DB 4XC1L 3B8YA 5L2KE 3ILQD 3B5GA 1L0YA 4JREB 3CC5B 4NCC1 1HWGB 3Q1SH 4N5UA 3DVNA 2EKSB 4MJIE 5SX5H 3U4AA 1J18A 3STLA 3IS0X 2VISA 1PKQA 4DVBA 1J86A 3UTSB 3WXVH 2PNDA 3OGCA 3P3YA 4WO4C 3RWDB 3AY4A 1CFQA 4FNLH 2IEPA 2JB5H 3C6LA 3BE1L 4BZYA 4JO2L 1SJVA 4P2OD 1PQZA 1RJYA 4TSBL 4P2RD 4ZG1A 5FO9A 4HCRH 1NUFA 2AK1H 2HT4C 3KPOB 1IAIH 1C5CH 4Q0XH 5FUCC 1CGXA 5IG7A 4AEFA 1A7QH 2R2HB 5F96L 3SPVB 5IJVB 3ULUE 3QWOB 2I26N 3PGDB 3RWEB 3B9KC 2FNBA 4JFFE 3BIKB 4UDTA 1RHFA 1MJ8L 3K81A 4OZFH 2XA3A 2DQDL 2IG2L 4W4OC 3X11B 5DHYA 3F65A 1J05A 1LILA 4N8CH 5DJCA 4I18B 4PS4H 2AJYL 4LSRL 5HI3D 3QEQD 4QHNB 1I7ZB 1LE9A 2NXYC 2UYLB 3KR3L 5I1CL 3F12B 3TBVB 2BJML 1FNEB 4K3DL 3ILQC 1BFOB 1IM3B 2OJEA 4NHUB 4ZQKB 2VLLB 1SMOA 2D9QB 4G8FA 3MV8E 2AEPH 3JTSB 3N0PB 1AC0A 5JDSB 1TTUA 4P3WA 4DN4L 1Z6JT 3UP1A 3RIAK 4QTHB 1P7HL 5DSCB 3ARGD 4IMLB 3EO9L 3LRGA 4KKNA 3U83A 4HBCL 4M1GH 1AJ7H 1KV3A 3OBAA 4UDUB 1WWCA 4YFDB 5HYJB 2YD2A 1KN4L 3QDGE 3VFSA 4FQHB 1EHLL 3SDCB 1SYSB 1S8DA 4NQCE 4G80B 4DAGL 2AS5M 2OMNA 1OWRM 3AGVA 3HA0A 1HCFX 2WWMD 4ZODA 3V8CA 4RNRB 1DN2A 1E6JH 1NCWL 4W81A 4Y4KD 2CKBL 2VLME 5DEFA 2DIJA 2YUXA 5C09E 3CLFH 3IETA 5LGHH 2VZOA 1QBBA 1A7PH 3LS5H 1MUJB 2L4OA 3F62A 3CMGA 5ID1A 3GSNH 1X5IA 2BX5A 3J8F7 4PRNA 1UWEL 5HI3C 3ARBB 5DT1H 2LU7A 3NFNB 1FZJA 3MREA 4OQTH 1RMFH 3W9EA 4K9EC 3GSWA 4NN7B 2D7TH 2DMCA 4JZJC 3QCUH 3PDOB 3BRDA 4JY4B 1KCLA 5IMKA 3SDDC 1Z9MA 5GGUA 1FYTE 2UZIH 5GZOC 4ZYKA 2IADA 1V3JA 4LSTL 4RAVA 4ZTOH 1MY7A 3BHBB 4ETQB 3EFFB 3ARGC 4MJ6A 1U8OB 2YS4A 3VFRB 2VC2H 3SE8L 4YPJA 5F7MC 5I16B 3HE6D 4XXCC 2BY3A 2QHLA 2IFFL 1CDYA 3TWCH 4LVOB 5E5MA 1I1CA 1QFWI 1T1YB 1ZWIB 1JF1A 3D5OF 2W60B 3VJ6A 4PJ7B 4X6CA 3D39B 3TZVA 2R29H 1NJ9B