2FQFA

Crystal structures of e. coli laccase cueo under different copper binding situations
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
486
structure length
465
Chain Sequence
RPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Blue copper oxidase cueO
publication title Crystal structures of E. coli laccase CueO at different copper concentrations.
pubmed doi rcsb
source organism Escherichia coli
total genus 133
structure length 465
sequence length 486
ec nomenclature ec 1.-.-.-:
pdb deposition date 2006-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2fqfA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2fqfA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2fqfA03
2AZAA 4DPAX 4A66A 3T6ZA 3FYEB 4YSTA 1PF3A 1ZIAA 4M4RB 2H3XC 5B7MA 5B1BB 2FT7A 3IN2A 1ASOA 1KBWA 1PAZA 2IH9A 1ADWA 3WIAA 1NIDA 4FAAB 2WO3B 1SDDA 4E9QA 2WSDA 3NP3A 1V54B 3QJUB 2XUWA 5B1AB 3EH4B 1RKRA 2BWIA 2VW4A 4KOCA 4A2EA 1V55B 3FSZA 1JZHA 1L9TA 2DV6A 5F7BA 4RH4A 2UXTA 1AZUA 1J9SA 1WS8A 1ZV2A 1RZQA 2UX7A 4N4YB 4NERA 3IN0A 1SNRA 1GS8A 3GYRA 8PAZA 2QPDB 1KCWA 9PCYA 3NSCA 2IDUA 2DWTA 1W6LA 2FQDA 3NJGA 2GC7C 1EHKB 2HXAA 1OCCB 4BK5C 1MG3C 2FT6A 2YAPA 3EH3B 3H4HA 3MBWB 3PAUA 2X87A 2H5UA 4Q8BA 1E30A 4QKTA 1L9RA 4BDVB 3FQ2A 1BXAA 4AI7A 1NIFA 4BWWA 2FQGA 4HZ1A 2IWFA 1N68A 2HX7A 1JERA 3TA4D 4FA7B 3UGEA 1MZZA 1PLAA 1V10A 4BWUA 3N2JA 2AANA 2PPEA 2PCFA 4E9TA 3PAZA 2IDSA 4GYBA 2PP7A 2YQBA 3QJQB 2XXFA 1ET8A 1JXFA 2MRYA 4CSZA 4GP4B 1A4CA 3ASNB 2IDFA 3QQXA 4UANA 6PAZA 1WA2X 3X1GA 3QJTB 3T6VA 2YXVA 5D4JA 3HB3B 3T6XA 1E65A 4W9ZA 3EHBB 3FSVA 3AG3B 4DP6X 4AKPA 1W6WA 2FNWA 1JZEA 2LLNA 3NSYA 1KDJA 1GSKA 4A2GA 1NWOA 3UAEA 5AZUA 4YSDA 2BW4A 3NSFA 3X1EA 4ZK8A 2PLTA 3UACA 2XXGA 3AY2A 3ZIYA 2EIJB 1NINA 4PAZA 5B3SB 1XB3A 3FSWA 4HALA 3EH5B 1GS6X 1A65A 4HCFA 1N70A 4DPBX 3SBQA 3FU9A 1NDTA 6PCYA 4KNTA 3JTBA 1AS7A 2GIMA 4DP7X 1YLBB 2EINB 2VMJA 1ZPUA 1NIBA 4GY4A 1KGYE 1OCRB 3CVBA 3FQ1A 2PP9A 1AS8A 3D12B 1L9PA 4L0PB 1DYZA 5TK4A 3T71A 3AG2B 2ZOOA 3CVDA 7PCYA 1OF0A 1SHXA 1AZBA 2BWDA 1OE1A 5EHFA 2HX9A 1PNDA 3NP4A 4YSRA 4G70B 4GP5B 1ILUA 2GHZA 1L9SA 1XB6A 3V9CA 2OV0A 2EIMB 2YAQA 3ZDWA 2YAFA 1AZRA 5AFAA 1PZBA 5I28A 3NJNA 1XB8A 3OMAB 2PP8A 2BP0B 1CC3A 4HCGA 2P80A 4YSSA 4JHVA 4AKQA 1AG0A 1WA0X 1WS7A 2JXMA 4JKNA 3PCYA 2DYSB 4DP8X 1IUZA 2JFCA 3DTUB 1KCBA 3OM3B 3T9WA 4HCIA 4MFHA 5D4IA 3NJMA 4DP0X 1IKOP 2CUAA 4EF3A 1PMYA 4YVUA 2W8CA 1ID2A 1BXVA 1OE2A 3SBRA 2FQEA 3AG4B 4DP5X 2XU9A 3FPXA 4DP1X 2XWZA 3RYMA 1JZFA 5I6LA 3NSDA 4YSQA 3DKHA 1L9OA 2VW7A 2AZUA 2PPCA 1AIZA 3H4FA 1OV8A 2GI0A 4DPCX 3FU7A 2HRGA 4E9VA 2J55A 3KW8A 5I26A 2R7EA 3ABGA 1QHQA 1ET5A 1RZPA 1SFHA 3FT0A 2J56A 2A3TA 4JHUA 4F7KA 3GDCA 3ABMB 2N0MA 5F7AA 2HX8A 3TBBA 2ZXWB 3NJHA 3UADA 1E5YA 1BEXA 2VSKB 4G71B 4AZUA 2CCWA 4P5SA 4CSPA 2XV0A 4W1TA 3HEIB 3OMNB 1URIA 1OE3A 4HHWA 2IDQA 3EF4A 3IE9A 3CZUB 4NAJA 1VLXA 3PAVA 3WNIA 5I6OA 5B1JC 1T5KA 1WA1X 3BQVA 3PLYA 4UF7C 1JVOA 1HAWA 2J5WA 2Q5BA 3CVCA 1A3ZA 3JT2A 3U25A 7PAZA 1J5CA 1FWXA 2P80D 4HHGA 3UABA 2BZ7A 5I5JA 2BZCA 4M3HA 2BO0A 1JZJA 4E9XA 3PXLA 5PCYA 1A4AA 2HRHA 2PPDA 4YSAA 1M57B 3QPKA 1SDDB 5B7EA 3NJFA 4A2DA 2UXGA 3OD3A 1B3IA 1SFDA 4P5RA 3S3BB 1NIEA 1CYXA 2VSMB 2XYBA 5E9NA 1MZYA 2BP8A 2DYRB 3TASA 4A68A 3WI9A 4UAHA 1PCSA 4KNUA 5TK2A 1PZAA 3S3CB 2IAAC 3QJSB 1CUOA 3X1BA 3G5WA 2GSMB 3AZUA 4E9YA 2FJSA 3H56A 5LDUA 1AZCA 1KBVA 2QDVA 1HAUA 1NZRA 2RACA 1R1CA 3FSAA 5A7EA 2PPAA 5IY5B 2NRDA 1BYPA 2FT8A 2YARA 3ABLB 4TXVB 2I7SA 4BDVA 2QPEB 1ZDQA 2EILB 3MX0B 4A2HA 2XV3A 2FWLB 4A67A 2DY2A 3WNJA 4YSPA 2IWEA 1GY2A 4N8UA 3S8FB 4YL4A 4WTQA 3X1FA 1SJMA 1J9QA 4E9SA 3NT0A 2I7OA 5B1KA 1EZLA 4AKOA 4E9WA 3GXUB 2Y1AA 1GR7A 4KOBA 2W88A 1NICA 3L45A 2OCCB 2YAEA 2H47C 3FQYA 2HZHA 1DZ0A 5ANHA 4DP2X 2UXVA 3UAAA 1TEFA 4BWTA 4GP8B 2MTAA 1RCYA 2JKWA 1TKWA 1GW0A 2CJ3A 4F2EA 2TSBA 3ZX1A 5D4HA 5B1JA 3N55A 3BVDB 3V9EA 5B7FA 1GS7A 5I6KA 1M56B 1ILSA 1W8EA 3NJKA 3SQRA 1ET7A 2FTAA 3CDZA 4KNSA 4E9RA 2XX0A 2XLLA 2I85A 2YAMA 1E67A 2QT6A 3FYIB 4DP9X 1ASQA 1BXUA 2CBPA 1AACA 2J57A 1AZNA 2VW6A 1F56A 4YVNA 1PZCA 4GXFA 1BYOA 2XV2A 2BP8B 1BQKA 1JZGA 4K9JA 3WKQA 1BQ5A 2XVBA 2TSAA 1JVLA 3KW7A 3X2QB 1QLEB 2B08A 1IC0A 2E86A 1GY1A 2X88A 4BXSV 1PNCA 4F2FA 1AAJA 4BXVA 1AG6A 1OCZB 2IWKA 1KDIA 2VM3A 3ERXA 1PLCA 4HIPA 3X1NA 1IBZA 4KO5A 2YXWA 3ABKB 1QNIA 1SF5A 2AFNA 3C75A 3IBOA 2OJ1A 2ZONA 2GBAA 5I5IA 3ASOB 2DWSA 3FS9A 3WG7B 1ASPA 4G7RB 4PCYA 2B3IA 3TU6A 1X9UA 1AANA 2BP0A 1J9RA 1NIAA 2UX6A 1E5ZA 3ZBMA 2GB2A 1FFTB 3NYKA 1XMEB 5PAZA 2FQFA 2IH8A 1JZIA 2QDWA 2HLEB 1BQRA 4X4KA 5I6NA 2Y69B 2EIKB 1JXGA 3CG8A 1J5DA 2BHFA 1A8ZA 4QLWA 4YSCA 3T6WA 1IBYA 2IDTA 5I5MA 1A4BA 1AOZA 1JXDA 4KO7A 4G7QB 1FA4A 1NTDA 2YAHA 3NJJA 3SBPA 1OCOB 2XX1A 1X9RA 1KV7A 3AG1B 1SHWA 1CYWA 1SF3A 3OQRA 1WAEA 4YSEA 2GC4C 2ZWNA 2AVFA 3PPSA 4KO6A 5FC9A 4ENZA 3QJVB 5AKRA 3S3DB 2YAOA 2Q9OA 3CDZB 3FPYA 1OOWA 1ZDSA 1UATA 4HAKA 4AX3A 4YSOA 1ETJA 1KYAA 1NWPA 3FU7B 3AW5A 3OMIB 4KO9A 2PPFA 2PCYA 2R7EB 4NB7A 3TBCA 1GYCA 4DP4X 1ZIBA 2CAKA 1PLBA 1AS6A 1AQ8A 1J9TA 2VN3A 3IEAA 2VM4A 1CURA 1HFUA 4G72B 3S8GB 1PY0A 3NJIA 1L9QA 1MDAA 2BW5A 2CALA 4WKXA 1MG2C 2WO2B 3DIVA 1M9WA 3QJRB 1NPJA 4G7SB 1TEGA 1JOIA 1TU2A 1NPNA 3WKPA 4Q89A 1I53A 2UXFA 5I6MA 4YSUA 1AR1B 3FU8A 1BAWA 3NJLA 4A2FA 5I6PA
chains in the Genus database with same CATH superfamily
5T3ZD 3TLRA 2ZKHL 1I82A 1I7UB 1G6RL 1IC4H 1MOEA 1JGEA 1TZ8A 4JHBA 2EZ0C 1PF3A 4YSTA 2PW2A 4PGDA 1TXKA 1ED3B 1RJYA 2SEBA 4EZMA 2D3VA 4L8DA 3BP6A 2JKNA 4LOUD 2UVEA 3P0VH 5INDB 3SGJA 2O5XH 4FERA 3NCEB 2IH9A 1QA9B 2BJML 3IPBA 4R7LA 5E1HB 1SEBA 3N85H 1KNOA 2ITEA 4FAAB 4G9FE 3NK3A 3TT3L 3QQ9C 3BWAA 1UG9A 4I9WE 2MKLC 3C5JA 3CFQA 4DGVH 3WTUA 2NY4C 4WW2F 3PL6D 5TF1L 1A4JB 4PHZA 5D5MA 1CMOA 3D4ZA 2UXTA 5T5FL 4L05A 5GZND 4OCSH 1AZUA 2ZCKH 4XNMA 1XD1A 5IFHL 2V3FA 3C6SB 4KKCD 5ICXB 2D0HA 3P4MA 1RZKL 2E6JA 4G8GB 1CD0A 3UJTH 5ESAA 1H6EA 3L2MA 4B9FA 3CDGA 3L5XL 4GSRA 2OTUA 2VDNH 2GC7C 5IMKA 3B9KB 3PHQA 4NWTH 2YPKA 1WBXB 3QZWA 3UP1A 3MX0A 3EFFB 5C0GB 4YN3A 5JXEC 3MXVH 1NFIA 4Y19E 1JNLL 5IGXL 4GXVL 4MVBD 1GTFA 1Q90A 3WTWA 2ZUQC 3NN8A 3V4VB 4HZ1A 2VL5A 3Q8AA 2IWFA 1HEHC 4R4BA 4HCRH 1Z5LA 3FHQA 3FT3A 4Y89A 1ZGLP 2AEOA 4IDJH 3BIAX 1XT5A 1OT4A 5E5LA 3TA3A 2AANA 2H0PA 4HIHB 1OGAE 3GIVB 3I9AA 4FNQA 2OYKA 3SGEH 2HWZL 4EI5C 3PAZA 2NZ9C 1OALA 3MV8B 3HC0B 2X05A 2VUYA 1B4TA 5DYOA 3SDCB 4LL4A 3GBNL 3K71A 4I0PC 4CDHA 1G9NL 2EKSA 5HHVL 2R69A 5J06A 2AABH 1KBGL 3DMMA 3BUTA 3NA9L 4G9FA 4AEHL 5I15L 3D3VD 3BEVA 3L3KB 3MOBL 4DCQA 2BX5A 4DP6X 3NEOA 3MRCA 4XNQB 2WLZA 4A2GA 3M1CA 4RESB 2YMOA 3INOA 1NGQH 3POHA 2OMXA 3LRGA 3BWSA 1JHLL 4EN3B 5EO1A 2WLHA 5F9WB 4Y4FD 4IIQC 2YD4A 1NINA 1QZNA 2YD7A 4AENB 4CADB 4URKA 5CZXD 3LS4L 3IVKA 4P2QE 1TR7A 1HESA 1W15A 5F72S 3VB8A 3L95B 4GSUA 4HT1L 4AYID 3QORC 4W68A 2HFTA 2VCOA 3Q2NA 1WEJL 1P6AB 1GKOA 3BE1L 3SBQA 1R46A 4E68A 4Y2DA 1T1YA 3ARDD 4JGNA 3JQOB 3RWHA 5FDWB 3WIHL 1XIWD 4IOSD 4Y19A 2P52A 4XO3A 2A6KB 3LKOA 1KGYE 1SN0A 3W9EA 3CVBA 4HW6A 5CS7A 3BAEL 5DU7A 4KY1L 3AT8A 5BRQA 5KYYA 2WBXA 4PBDA 4Z7WB 5IBTH 4H40A 3ZYZA 3LIZH 1OGAA 3FQTA 4X9HA 1GGIH 1YY9C 2TAAA 4NO3B 3UP6A 1TTCA 4MX7A 1HH9B 5BVPH 1KIPB 2VAAA 3EO0B 5I0VA 5EC1B 5DD0H 1G94A 2OXHB 4K2UH 5BO0D 2VLJE 1UOKA 5J6GB 4UZSA 2D7TL 1QEWA 4UINH 4U6XA 4X9IA 5HVHC 3OMAB 1CC3A 2KDYA 4HCGA 5GZOA 4PEEA 3AJ7A 4LCWE 3NACH 4FFWD 2OZ4L 5EZJA 3TV3L 4PGEB 1JV2B 3QIUA 2FR4B 4I1RA 2P8MB 1H3PL 4B9IA 2NW2B 2XWBB 2IANB 3IGAB 5JPNC 5AKTA 5A16A 3IDJA 1RUQH 3LQMA 3W3BA 4P2QA 2BY1A 1T66C 4OSUH 5BJTA 1CFNA 4NPYB 3VXSD 1CI3M 1QBML 1UQSA 3H3PH 5ESVB 1D5IH 3VW3L 3Q7JA 1U36A 2L04A 4KXZH 1RLWA 5E4AA 1PFOA 2WLKA 3DA0A 5C0DA 3BEWB 4JGJA 5DJ6B 2WYHA 2O5ZH 4D9LL 3ARQA 3GEFA 8FABA 4Q9QL 4AZ8A 5DC2A 2E56A 3BZ4B 4OZ4A 1L7TH 3APDA 3BPNB 3RI5F 2HRGA 2GTZB 4N2KA 4ESKA 2WUCH 4MNHB 1AYRA 1N67A 4HSAC 1ET5A 1HINL 5KZCB 3O6FD 3LEXB 4LHQB 4L3EE 3K6OA 2XICA 3RZCD 4NOFA 3WNMA 4WSJA 1LO4L 5IJVB 4Y9FA 2E7LA 1HZLA 2PXYD 1AGEA 1E6JL 2MPAL 4UB0H 2ID5A 3MLZH 2J1YA 3KG5A 3MYJA 1JRHH 2GCYA 2N0MA 5F9JA 4LLUB 4ZUTB 4ZUUB 3RPKA 2P1YA 3E3QE 3WUWG 3M07A 5I6XB 2D3JA 2WKLA 3WAJA 3H2WA 1X5ZA 2VLJA 3O8XC 1ZANH 4JKKA 5LG6A 1IGML 3AXIA 3KVPA 4KK6D 1VFBA 4BSWB 3UG3A 4KMTH 3GSWB 1A6AB 1BJ8A 1OB0A 5EO0B 4DUXA 2C1OA 4H20L 3IE9A 2MPVA 4LCWA 4WKZA 4FXGA 1RULL 4WTXA 3SDAA 5GJTL 3ARBB 3HNTH 4BFOA 3BHBA 3UPRB 3DV4B 3DI3B 1NCWH 4FQHA 4P46A 3GK8H 5E95B 2FSEB 4JFDE 7PAZA 2ADYA 2WLIA 1SLUA 2CHZA 1EEZB 1JZ5A 1HDMA 1JZJA 2VXSH 3GGWA 3P9LA 5D1ZI 5IVXF 2IDCA 3H42H 1LO2H 2AI0H 1SY6H 3QPKA 4ZFGH 3BVNB 4Z95H 3NAAH 1N64L 1G43A 1AJ7L 2DYPB 3CC5B 4OZHF 4PB0L 3Q1SL 1U8QA 1UZ8B 2ZUXA 3L9RB 5JQHC 4KV5E 3AADB 4LSUL 1UH3A 5EV7A 4FXLA 3RKDD 4PJEF 3R0MA 3SODB 3VYNA 4EI6B 3ZL2A 1PZAA 4RGND 1S46A 4L3EA 4WO4D 5E9DE 1AI1L 1CUOA 2W9EL 3GC3A 2ATKB 3LPPA 5BZWA 5CBEA 3AZUA 2Q7YB 4ZO6A 4PJAA 4LLVB 5BV7C 5KJ7E 3MDJA 2XZZA 2ZP9A 4U3HA 2HKHH 4JFXA 1HIML 3RAJL 1ZSDA 3D2UD 5E8DL 3ETTA 1KCSH 5TQ2L 3ASWA 5IROC 4CVZA 1DQDH 2QZ5A 4Q6IC 1KFAL 3C5XA 4HUUA 1I3GL 5E5UB 5LNEA 1DQQA 3SOTA 5KUKA 3U4BH 1A1MB 2DY2A 3SKNA 3KPRD 3MR9B 1MVUA 4N8UA 1BAFL 4J3XA 2EVFA 2VITB 3VSVA 1IEAB 2JV6A 3IPEA 1EZLA 4BIKA 3D30A 3VWJD 4UOZA 3VWKC 4JFDA 5AG8A 2ZIDA 4GPVA 3MGAA 1MCKA 4I0KA 3EJTA 1PYWB 3KAAA 2WXOA 4FFYH 3ZL4H 3B2PA 1Z9PA 3MRPB 5ANHA 4OFIA 3M46A 2C9QA 1HC1A 5DFVC 3PHOB 3Q8CA 3QRGH 3ILQD 2JB6B 5TTRA 5GS0H 4GMSL 4JRXB 1HHGB 1KYOK 1JPSH 3QI9A 4HLZG 2VISA 1YA5A 2F5BH 3LZFH 1Z0NA 1ZE3C 5B1JA 5HDWA 3RX8A 2KUTA 3VFOB 1HI6A 2EECA 4U0RC 4L23A 4WWNA 3P3UA 3EUDA 4OQTA 2P5WA 4LIQE 1IM9B 5E9DA 3NEXA 4OCWL 5E00A 4FHKA 1IFHH 3EBIA 4ZG1A 5FO9B 4HIEB 2HJKB 3MN8A 1IKFH 3Q8EA 3GZKA 4G8GE 4U3SA 2P42B 2JK5B 2VDLL 1WISA 2DD8H 3RGBA 1BQ5A 3FCSB 1JVLA 4GS7B 3KW7A 5T3XH 1GOFA 2LTQC 5EF0A 3CVHA 4G6JH 3V5KB 4AM0B 2FATH 1HHJB 3GRBA 4HH9B 3P9MB 4IBUA 4P4KB 1X44A 5J1SC 4KTGA 3O45B 5DMKB 1OSZA 3ABKB 5LAPA 4R97C 4JR9L 1I9IH 1Y6MR 2VQTA 1U2YA 1JYXA 1Q1JL 2X09A 3I6GA 1BQUA 2AP2A 4QRSB 4R7XA 1AFVL 4KGLA 3UIZA 2Y2TA 4POYA 1QKZH 3T5WA 1TG8A 1ED3A 3KJ6L 3TU6A 1QI4A 1AQMA 1U4EA 4DEPB 3FZUC 1B3JA 4WJKB 1PG7L 2BP0A 3VVWA 3MV8E 4UQDA 5INDA 4C83B 5E8EB 3D52A 4ZX4A 2Z64C 2YK1L 4RFOL 1QA9A 1ZT7B 2OSLB 1NGZA 2AQQA 3M8OL 4LCCA 3WN6A 3FT1A 4MD0A 2X9XA 4BBWA 3RPBA 2PYED 2GFBB 1DVZA 3QAZB 4JX0A 1A1OA 1MEXL 4KJYB 2A74A 2J7LA 4QRTA 2VZ3A 1FFNB 4PJCA 3QJFA 1IBYA 5D1XD 4WHYG 4G7QB 1QQDB 2QHRL 3C6SA 3AAZA 4KRMB 1ROCA 1EGJL 1NCNA 4K5LA 3TZVD 1VCBC 5EUOB 1PDKA 1Z9OA 3OV6A 5CGMA 4G8GA 3MRBA 2Z91B 4U4BA 1CGTA 2GC4C 4ODVL 4XX1G 1TCRB 1C16A 4OLUL 3T77B 4ENZA 3ML9A 4YDKH 3OAZK 3QUGA 1QUNB 3IETB 2XVKA 3OWEA 5SWQB 2ZYRA 1WBXA 3IMSA 2OS7A 1KTBA 1NBCA 2X7LB 3U1SH 4S0SD 5DQDH 3FU7B 2BP3A 3IMUA 2HJFB 4PRBA 5DO8A 3TBCA 1DSFH 2WQXA 1MW0A 3GJFH 3OPZH 1H0DB 4MA8L 2CAKA 3TA3C 4OCRH 3V4VA 3ZKXB 4AJWA 4FADA 1AS6A 3B2VL 2EXSA 2LU5A 1MFVA 3CDCA 3NIFB 4NZUL 4Z7WE 3ARRA 1AGFB 4Z7UF 3ZZSA 3DMMC 4TL5A 3F7VA 5DSCB 1OVZA 4NQUA 2X1OA 1G0XA 3LN4B 1B0RB 4XPTH 3RNKB 2V7NB 5IQMA 3CDYA 5I6PA 3O6MH 5EIIB 2IMNA 4PWFA 1T1WB 2Z7YA 1I1YA 3L3KA 2BLFA 2DQEL 2V7HB 2X4RB 2FL5A 2VR6A 4HWBA 4K94H 1OIOA 1FBIH 3VTMA 5ITFB 1FYHB 2FGWH 1G7MB 4F8LA 4EN3A 4H8WL 2D8KA 2IANE 5FKAA 3FO9B 4Y2DC 4DN4L 3DDGA 3EH4B 3CQPA 4BZ1A 2D73A 5TD4A 4UWQB 3MZGB 1ZVSB 4M43H 3LSOB 4UQAA 3CX5K 5ESQB 3HE6D 2CO6B 4AQ1B 1QBBA 5BZDB 1Z7JA 1OT2A 2NOYA 1GL4B 5AW2B 5AEAA 5FDWA 2AV7B 4M48H 2A6KA 2VXVH 2DH3A 1FZKB 4I2XB 2ZKHH 3ARTA 3DJ9A 8PAZA 2EZ0D 9PCYA 2YMXH 4WWKB 2IGFL 1HYRC 1XGUA 3VD7A 1FNHA 2DQ6A 4IRJB 2NY7L 4CVXB 4ZD3H 1ROWA 2AXWA 4LHUG 1U8HB 4MRCA 4AVHA 2WN2A 4Z7WA 1PX4A 1N8ZB 3CN2A 3EH3B 3F85A 3MBWB 3ZTEA 3HI6L 1GOGA 3NRFA 3RJQB 3OLEA 2QBWA 3TT3H 3QQ9D 2IQ9L 1YQ2A 3T0EB 5I30L 5GZOC 3PFQA 2B9AA 1HH9A 2CXKA 3SGDI 4KQ3L 3V0AC 4JFEB 4ZMAT 2FQGA 4JJOA 4JANA 2P9RA 1JERA 2YRLA 4LHUD 1FC1A 2D3LA 4N90D 3MYZA 4AYBA 2EXWC 1LILA 3QIUC 1Z3RA 4FA7B 1ZT1B 5CSZB 3UGEA 1SLXA 4YHYC 2CMRH 5T33L 3DYMA 1KELL 3HUJF 5SX4I 3UTSD 2CA4A 2KKQA 4HWZB 1JZ4A 3KGUA 4ETYA 5G5DB 3A6OA 4JZOB 5EBMB 3KL0A 3QHFH 4YE4L 1ZEAL 3NRPA 5EU6E 3PWVB 4FC3E 5JZ7C 3HLKA 2NW2A 3IGAA 3X1GA 1IGYB 4LMQI 5C08B 3C08L 2VERN 2IG2H 3UTPE 5FYJE 2M1KA 1W6WA 5TPWL 1PEWA 1AGBB 3UTQA 2JLLA 4PJFA 2VO8A 2WSPA 4DESA 3UZEA 2X3AA 4QJ4B 4YSDA 4X6CB 2WXQA 2Z8SA 3MOAH 5DJ6A 2DQGH 1N5AA 3KCWA 5CR1A 2B2XH 4QRFA 4UYQA 3U30C 1A8JH 1F41A 2BSED 2E7LC 3FN0H 4EI5D 2NZ9D 4WNQB 3UBXG 2C9XA 3QISA 3R7RA 1JPGB 1UYWL 2WXGA 5BQ7A 3PV6B 3SE9L 4K4KA 2CU9A 2VQ1B 5E5RB 3S96B 1S4IA 2E47A 2NYZA 4WW1B 2AXHA 4ZUUA 3UG5A 2BS9A 3D12B 4JNXA 3R1GL 4F3FA 5K33A 3ENEA 4FXGC 3SDAC 1I75A 4H88H 2Q2EB 5K1JA 4F33A 2EDYA 2JQMA 4XOCA 2QVMA 4P46C 2CBMA 4Y5VA 1SOXA 3LRSB 2I5YL 3L1FA 4UTBH 4GKZA 2ED6A 2WYTA 1UH4A 1OQOA 3LS4H 1BREA 4NO5B 4R90L 2DICA 4U3XA 1U8LA 3DV4A 4M62H 3K6NA 5EU6A 1BJ1J 1V7ML 1MCPH 5A1AA 2IBZX 2FSEA 4N85A 1EBAA 1MCFA 4G1EA 5I28A 4MQ7B 3V2AR 2BY2A 3JV6B 1EEZA 2ADFH 2CLZA 3IDXH 1OAQL 1G7JB 3MFGB 4JQXA 5AL0A 2LU7A 4APQB 4EUPG 1THAA 1P7HL 1EX0A 4JFOA 3A0OA 2EDWA 4DP0X 4JRXE 5HJ3B 1FNEB 1CIDA 2XOTA 3ARVA 3HG0A 3KPTA 5HDLA 1UZ8A 2WVVA 3L9RA 1FG2B 3GS7A 4W6XB 1I1RA 1YY9D 2HPTA 3SPVA 2APVA 3LH2H 5JPMB 1NBQA 3E3QC 4MMXA 4V2CB 4X5RA 1NCIA 2Y1YA 2ATKA 2IIJA 4KKLC 2I9LA 2Q7YA 5J1AB 2D7TH 4N2BA 2UZIL 2Z35B 3EJPA 4YBQC 3DVGA 4RDQF 4DPCX 4D7BA 5HD8D 3BLKA 3VFNB 2OQJB 1KB3A 2FJFB 1RIHL 3FRUB 5ETUA 3VSUA 1A1MA 2FNBA 3WS3B 1JV5A 4FNPA 1KCUL 1I8KB 5TDNB 5F44A 1M6OA 1T66D 2X70B 3CCHA 3BWUF 2CIKB 3WS6A 4YHLH 2VJ0A 4P48A 2X1PA 1OCWL 4FMVA 4WFGD 3OKLA 2QQNH 2V8MA 1M42A 2XV0A 4JFZL 2D7MA 5EOCJ 4WW2A 1DUZB 4PRDA 4YDIH 1DO5A 4FQ1H 4LRNH 4X4ZA 3MRPA 5FM5M 4YDLC 4XPBH 5FF6A 5GRUH 5B1JC 3PHOA 1WA1X 2F74B 1KLGA 4C58B 1KJ2B 2BSSB 4LCYB 2JB6A 4NYLA 1HINH 1RVFH 3K8KA 3OJMB 4JRXA 2BVPB 5C7ZA 3AS3A 3ZE1F 2B7DT 4D0CB 1RAMA 2BNUB 1KBKA 5CUSL 4HHAB 2AK1L 1SYVB 3MRFB 4HMDA 2MPAH 4I77H 4M1GL 1Q9WB 5IMOB 2G60L 3HNVH 3CZGA 4ODTH 2W0FB 3QZBA 1IM9A 5H37A 4ERSL 1BZ9A 1CQKA 2OPCA 4YO0A 5FO9A 2JF1A 4PJDB 3ZU8A 3O8XD 4A2DA 4HIEA 3L3OA 1IGMH 2ZSVA 5BS0D 1SFDA 5EUOE 5ADOH 3FCTA 4LESA 4OAWB 4MJ5B 4QGTA 2V6HA 5D4QA 2PWHA 5AVTB 3KGTA 4ONGH 1PU0A 2I32A 1MZYA 1J05B 2K6YA 4L29B 3TASA 4Z7QB 4B60A 5KAQG 3HHMA 5GJTH 3IFOB 3UFIA 4H26A 1OANA 4XVSH 4WSKA 2RAMA 3EH2A 4OF6A 1UGKA 3L4VA 3GT6A 3ZW3A 1UACL 2E46A 5LGHH 3QQNA 3V5KA 3EJYC 5EDXA 1DSYA 4JG5A 2DJSA 2QDVA 2IADA 3O45A 4W70A 1C5CL 2RACA 3HCVA 1RPQA 3BZFA 1B2WH 3CU1A 3VGHA 3APFA 3HHSB 5DZ9A 1EJOL 3NIFE 2VN6A 5JO5B 3TX4A 2OTWA 1N64H 2B59A 3L13A 1IAIL 1VENA 1AJ7H 2ZNWA 4RMUA 4ADJA 1RUML 5JW4R 4LSUH 1HKLL 4KUZL 1BZQK 3WL9A 2OSLA 3L9BA 4D0DB 4RDBA 3D9AH 1GR7A 2W88A 5HHOA 3HLAB 1AI1H 2ZNXA 5DD6B 3MV7E 3RVVC 3UTZB 2GFBA 2AEWA 5EF2A 1J8RA 2P8LB 4LDCA 5FO7B 4KJYA 2WLJA 2XXCB 5EZOL 4CUCA 4X42A 2J4WL 5C09A 1QWHA 4BWTA 5IROD 1QQDA 1TJHL 3PF2A 1AGCA 1FVDB 1NA8A 1FNSL 3I75B 1D6EB 5TE6L 1OSPH 3B9KC 5BOPA 4QXGH 2OR8A 5JW5A 1AC0A 4KPHL 1GW0A 3FOMB 3S48A 3MGTB 4Q9RL 2CIIB 3HS0B 2TSBA 2P5ED 3SPCA 3T8XB 3N55A 3FF7A 1X5AA 4LB8A 4XCEB 3T77A 1QUNA 5SWQA 4U6VH 2X53A 3TBWA 1H8LA 3VWKD 1UWXK 2CKBH 3G5VB 3RVXC 1UT1A 4OM0L 3N6YA 5DHVH 4HP5A 2HJFA 2ATAA 1JSYA 1U3JA 4HSQA 4UU9B 1RURH 4MDIB 2G5UA 4I2XE 3UAJA 4R4NC 4GXFA 4LSPL 5DT1L 2BP8B 1ES0A 4K9EC 3T3PF 1IGCL 4Y4KA 4Z0BH 1M2VA 4F8QA 3SDCC 1LEIB 3HI5H 4JKLA 1XCXA 4EVNB 3I50L 1AGFA 5CCJA 3ZRFC 3U0PA 1ZHBA 4CNIB 4GMSH 2AAAA 3GJFB 3K0YA 4FN0A 5DSCA 4F2FA 4TUKL 3RE0A 1GH7A 3T0EE 1K4CA 2ZAIA 3WEAA 2AQ3A 4HCRA 1LWRA 1ACXA 4JFEE 4KO5A 5D2LB 1BW8A 3Q2CA 3RNKA 2V7NA 4Y8AA 2MFNA 5GSRA 3MJ9H 4OCWH 4QJ3B 1JZ3A 1OAZL 3MV7A 1Q0XL 3O9WA 3HMXL 4KKRA 4TNVK 4UQ3B 4EN3C 4NKMB 1R4XA 2CLRB 1MAJA 2V7HA 5IV2B 1X9UA 5K1NA 5IT2H 3BYYA 2QSTA 4LLDB 2A9ML 2EE3A 4A7GF 5I18H 4UCFA 1EDQA 5L88L 4GSQA 5C08E 2NY5L 3NGBB 3P2DA 3S35H 2QDWA 3FO9A 5CWSB 1K3IA 2GBUA 5KG9A 3ZTNH 1ZVSA 5FWQA 5HHMD 2VXUH 3LSOA 3WAKA 4QLWA 2XKNB 2KDGA 2CO6A 5LGKA 5DI8B 1RZ8B 5C6TH 4JR9H 2DWEB 1JCKA 1FYTD 1TVHA 4FI7A 5F6HI 2A1WL 2AV7A 4XNXH 5AOLA 1X9RA 1SHWA 2BH0A 4I2XA 4QNPF 5JA9A 2OP4H 3Q6GL 2JTDA 4ZNEE 3V79C 4FTVB 4KH9A 4WWKA 4TNWK 1T89A 4IRJA 3FZUD 4BQ9A 1PJWA 1SRDA 1WGOA 1S9YB 4FFTA 1K6QL 3GMOB 4N1HB 4HWUA 5FIEA 5MEOB 4XX5A 4WU5B 3DUHA 4FI8A 4YEEA 1N8ZA 3CDZB 1AMXA 1QATA 3B7UX 3MBWA 1HSBA 1URZA 1X4ZA 2R0LL 3TV8A 2NZIA 2EE9A 2GJPA 1RUAH 2JB5L 3FTGA 1NLDL 2OX5B 3QZWG 1MFNA 4MGXA 1T3FB 4UOJA 1PLBA 2N56A 5E99L 3S5YA 3UROR 2VM4A 4BFBD 4CJ1A 1HKFA 4ZQTA 4EIUA 2CHNA 3FT2B 3LIZA 3V7MA 2PW1B 5CSZA 4H1LH 2DQDL 4O5LH 5LAXB 4CC1A 4Z7NB 3U1QA 2Z31B 3QRLA 2HJLB 5IM7A 1OOAA 3C6LB 1ZVNA 4AL8L 2A99A 3OZKA 5G5DA 3LNEA 4POZC 1XGRB 4FFZL 2VN5A 2MOQA 1N3NA 4Q89A 1I53A 3PWVA 3PGDB 2DI8A 2K45A 5C08A 3UZEC 3UG4A 5ABDE 4DN3L 5BUAA 4MNGA 4PJEA 1FO0L 4BINA 4A39A 4JFYA 3UDWC 1SPDA 2L4OA 4ODHH 2A2QT 5F1IA 3TA3D 2VXTH 1CDIA 4MA8H 4UT6L 4QYOA 3IGLA 3BPNC 3HRZB 5DC9B 3P2BA 1T5XB 3B2VH 5FPIA 2WO4A 1ASOA 1D5MA 4BZ2L 1EZSA 3CZJA 4D0BB 5IREA 3CXHK 2EYSB 5L2JB 3MV11 1MF2H 2F5AL 2WO3B 2PR9A 5HGDB 2NNXA 4NUQA 3EFDL 3SDYL 2N7BA 4ZNEA 4OI7A 4G9FD 5HHXL 3DMMD 1E0OB 2JH2A 2NXYB 3T2PA 4P8QA 3BJ91 2WOYA 1IGTB 2DQIH 4I9WD 2DZEA 4DTGH 5I6XC 4X98A 4HXBL 3M17B 3MRDA 4ZO9A 1T0NB 1UUSA 2DQCH 3PHSA 2CJUL 4GRWH 2X2UA 4N6RA 3S96A 4BCYA 4AUUA 4LPUA 4NENA 4WW1A 1YEKH 3WTXA 1H8OA 3GIZL 2YZ1A 3NJGA 1R19A 3O41A 1FGNH 1P4IH 5EBLA 1XCQA 4CKVX 2EACA 3EF7A 4WGWB 2FCBA 1OPOA 2WLYA 3LRSA 1UURA 3CK0H 3OVUB 1LQBC 4JFQA 4Y2DD 3M6DA 4XNBA 3MJ8B 2EIEA 4Y19D 4HSCX 3PWNB 2Y6SC 3F3HA 4JQXC 3QQ3A 1XZ0B 2MOVA 3NA4A 4PRHB 3R4DA 5DK0B 3REVA 1ZHKA 3CSTA 2DOCA 3JV6A 1I9RL 4R7VA 4XODA 3SCMA 1V10A 1PX3A 1XCTB 5I9QB 4APQA 4E9TA 3DX8B 4DERA 2BNQB 4HF5H 3HG5A 1LHZA 1B4LA 1NC2B 4ODSH 1QACA 4MMXC 4XPAH 4UANA 5HJ3A 1FNEA 2QADD 5DMJB 2ICWB 3OQ3B 2C3HA 2X6BA 1N4XL 1SY6A 4WFEE 5T5NF 2R1YB 5DA0B 4AK1A 1VGKA 3PWLA 1F58L 5GZOD 5JPMA 1FL6A 1TKWB 2DLFL 4R4FL 4ZDHB 3DWTA 3OKOB 1A7PL 4PJDE 3CLFH 1PLGL 5J1AA 1MIMH 3ZQ9A 4LSVL 2Z35A 1EUUA 2GYSA 2PLTA 4TN9A 5F1KC 3VXQB 2EXWD 3NTCL 3QIUD 4KRLB 4OF5A 5E70A 3LZLA 3IFNH 5JDSA 2VTFA 1YNTB 3QUYA 5FV1L 3CH1A 2BOCB 2FECL 4Z7QE 4P2QD 2OQJA 1DQKA 3MRLB 5A2BA 3HOGA 1RJZA 1W80A 3WS6C 4JRLA 4Z7OB 1PVHA 3WS3A 1E2ZA 5JZ7D 4PUBL 1NDTA 2LV4A 2Y1ZA 3VB9A 1WZ1H 2WWKT 3C8HA 3QGVA 4WW2C 5TDNA 2YLHA 2CIKA 2B0SH 3LZRA 5EBWB 4Y0GA 3DSFL 5T3XE 4NT6A 5IB3B 4G8FA 2J5LB 4HUXA 2BVYA 1UZ6E 4GRWF 1XB6A 1XV8A 5IK3A 3CJJA 2G2RB 1BD2B 2BSSA 3MZTA 4LCYA 1CU4L 4AH2B 4D9QE 4PTTB 4ZFOA 4OJFH 5E2TL 2BVPA 5C0CB 4L8CA 1BQSA 5ECGA 3WNPA 2EUVA 2VLJD 4D0CA 4MAYA 3L3OC 3MLXL 2J8UF 4HHAA 1KGUA 3MRFA 1SYVA 3SE9H 5EU7E 1SJEB 1N0XL 3AROA 5CAYB 1AG0A 3HMWL 5F89B 1KGCE 1A21A 2W0FA 2DYSB 3GKWL 1IUZA 4S2SA 4U1GB 4AK2A 4LCWD 3WHE0 1QTYT 4A63A 3K6IA 3SDAD 2AXGB 4PLOB 4GS7C 4PG9B 3CHOA 4OAWA 2AQRA 3LRHA 5D7JB 3DURB 2XBDA 1EEUA 4P46D 3GZQA 3KJ4B 4APXB 1J05A 1OARL 3SBRA 1PSKL 4AVJA 1EAJA 1HSAA 4Z7UA 1NCAH 3MODL 3S2CA 1NAML 1D6VH 1XQ4A 1JVKA 5EZIL 3ES6B 1BECA 3WE6A 2NR6C 4G1MA 2VIRB 5AG9A 1LDPH 1NPUA 2XRAH 4BA0A 2VW7A 3BP5B 2KH2B 3H4FA 4R3SA 4F93B 4EQ3A 3OKKA 2AK4B 2LLLA 1CDCA 4E9VA 2BIIA 1QSEB 1IIKA 5DRZB 5EEYA 4MBRA 5FHBH 3JWDL 2CO1A 1KPUA 3PUUA 5I0XA 4L3ED 1L6ZA 1N2RA 4B9YA 5FOBA 3M45A 2KERA 3WN5B 3QAZC 1RZIA 4IKIA 4PV1C 2X0WA 4AG4L 5D2LE 2W38A 3IJHB 4HPOH 1O5PA 4W9DC 3ETBF 2ZX5A 3NCCB 4A55A 5FX3A 4TPRH 2GY5A 35C8L 4DQAA 3UTZA 4KKLD 3TVMB 1URIA 2O61A 4KZDH 1FAKT 1TENA 5GGQH 3SD2A 2F8VA 4ZQKB 1BVOA 3MNVB 3TH2T 5I6OA 2R39A 5EBGA 1UFGA 1FVDA 5HVWA 2Q5BA 3U25A 1RIHH 2HVJB 3FOMA 4S1RL 3WFBL 5EZPA 3UABA 5GSVA 3BVVA 3MGTA 4JFDD 2CIIA 1JZ6A 3HS0A 1J11A 1GW6A 3T8XA 4FNLL 2X3BA 3BDYL 4XPHH 2PCPB 2G0KA 3MLYL 3EXJA 1JGUL 3QPXH 4P23B 3UAJC 1QLEL 4WI3A 3ZKXC 5KBMA 2NY6B 1OCWH 1JZ8A 4Y4KC 3NJVA 4AE1A 2B4CL 4K5PA 4JFZH 2XPGB 1VHPA 4UU9A 2AXFB 4MDIA 3UC0L 3TCLB 1LK2B 1U91B 4RETB 2CR0A 3FRPB 2LVEA 5IHZB 4NM8H 4FTVE 1QWUA 2BP8A 3C9NA 2CK2A 4CKQA 1CGUA 1LM8V 2OR7A 1ORSB 4UM9D 3WIFB 1OHQA 2CKBB 3D09A 3GPSA 3R18A 1L3NA 3HUJA 1CD1B 4L5FE 3LZNA 5DRXA 4AYFB 1LEIA 2OMYA 1KUMA 5E9DD 1F97A 1CGVA 2EH8H 2G5RA 3GJFA 4TTGA 3IJ9A 2V33A 1DQIA 3VFWB 3O9WC 1M7XA 1BQLH 5LXVA 2F53A 3QEGL 3GMLB 4PGCA 5DJ0B 2G60H 5HDRA 4PRNB 3BYTA 4HVBA 3SE8H 2WP3T 4ERSH 1EMTL 3I6SA 3APMA 3PAYA 1KJ3H 3REWA 4UQ3A 2DBJA 3UYOD 4Z7NE 2XV3A 4NKMA 3TCTA 3D0AA 5EFIB 3D51A 1W0VA 1MFEH 1F42A 1YEJL 2CLRA 5F7MC 4L4VB 3EJSA 4YL4A 2W65B 2FLBT 4LLDA 1AD0B 3CVIL 1UM6H 2JIXA 4S1SH 1O0VA 4X8JB 5BO1H 4ODWB 4XAWL 1G7IB 4L37B 1F3JA 1IMHC 2IALB 5BZXA 5I1JH 4JPIB 1KN2H 4X5LA 1T04A 5CWSA 4XXWA 3LZOA 1GYVA 3EJYD 4XP5L 1RK7A 4WWKC 4F92B 3DRTB 5DI8A 4Z77B 1T89C 4IRJC 1N6QH 5CBAB 3TEYA 1UB6B 4Z78A 3DVFA 3RU8L 3ZL1A 1RCYA 1J8HB 4OT1L 5J12B 1P2CB 1Y6NR 3GI9H 2N7SA 4LP5A 1GCYA 3ZX1A 3T0EC 5CEZH 1U8KA 2Z8VC 1RI8A 2NCEA 5MEOA 2I9TA 4TSBL 1YEFL 3EYSL 2I27N 3CDZA 3CDFA 3BPOC 5EMYA 4DVRH 2NQ3A 1E2WA 3BD3A 1GC1C 4ZMLA 5L8JB 5A3ID 5JTWA 1J1PL 3RVVD 5DJ2B 3QJXA 3BGMB 1T3FA 3D87B 4BFGA 2R0KL 4G8GD 4TQPA 3F7YA 4K9JA 1T0MA 3WKQA 4OF0A 2L3BA 2HSIA 4Y1TA 1NLBL 1WFNA 1YDPB 2K8MA 3T2NL 4F9LA 3B9KD 3OXSB 3OBAA 4KMQA 1Z32X 1YYML 2HJLA 4JDZA 1YMMA 3US1A 3IE4A 1MFBH 1IAKA 2OFQA 1J8SA 3FCBA 4NAQA 5E4IA 4AYGA 3LAFA 3ZDXB 5A2AA 4JKPH 1URLA 4HIPA 4P05A 4I5BA 5E2UL 5IQ9A 4PRHE 3MUGB 3MLWL 2Z65C 1KBBA 4PG2A 3RY4A 5DRWB 2EH7L 4XCFL 3HC3H 1MXDA 4H1LB 5F6IC 1Y6KR 1K4DB 1WV7T 4ZO7A 5T1DL 4P06A 4XGZB 3RVXD 3ZUCA 4OFVA 5EDSA 2LFGA 4OM0H 3U0TB 1ASPA 2J6WA 5AUMB 3HI1A 3HRZA 4R4ND 5DD1L 1T5XA 2BNQE 4LSPH 3MV8D 2VR5A 2W91A 1EXUB 4H2CA 4KKPA 3DX9B 5L2JA 1O7DE 3RIAK 5EZLB 3GSNL 1ZJBA 1Q0EA 5HGDA 1UD5A 3SDCD 4U1LB 2E9WA 4JVWA 4CN4A 2XZCH 1CZ8L 4AJ0A 5DEGB 4CMHB 3TEZA 3LV3A 3TBVA 2IDTA 1KG0B 2EDBA 3NFPA 1T0NA 4M1DH 2D9CA 3D06A 3BIKB 3II3A 4XAKE 3WY3A 4DGUA 4EN3D 4YHNB 1N12A 1SF3A 5C0BB 1NUFA 3MCG1 25C8H 2ALWA 1XTLA 1BP3B 2VZUA 4QRQB 4UTCA 3ARGA 1NOFA 2CBOA 3MRHB 4OD1H 3I2CH 1W72H 2A9MH 2O6DA 4Z7OE 2B3RA 2H3NB 2AJ3A 2IEPA 1MXGA 3QXVA 3RGVB 1ETJA 4HK0A 2C3WA 1KTDB 1KEGL 2FBRA 1SM3L 3MJ8A 4G5AA 4LSQL 4NB7A 2PCYA 3SCMC 4C57C 4Z6AT 3AREA 2Q76B 1XZ0A 5DUBA 4APQC 2Y7MA 1G1CA 2JJWA 3QRBA 2IWGA 1P4BH 4M7KL 4MCZB 4R8WL 3IGUA 1HS6A 1MHPH 4FYRA 4UTBA 2H2PC 3NABL 4PW3A 4K3EH 1WIPA 1R3IL 4E42A 3L7FB 3D39B 5IHWA 3Q6GH 4U1IB 1FLTX 1Z9NA 2BCMA 3EOTL 4OIIH 1BF8A 1BD2E 1NC2A 4XNZB 5IOKA 4EDXA 4GI6A 3ZTDC 1OEZW 5JPMC 1K6QH 4TLSA 5C0EA 1IJ9A 4N8VA 3UYRH 3P4OB 3TO4B 3ZPDA 3G6JF 4N87A 1CDYA 1IGIL 3A67H 3DPBB 3FYEB 3NIDB 2JB5H 4LEBA 4Q2ZA 5C0AB 2IQAA 3RZWA 1J5IA 3QUYC 3MRJA 4ZDHA 2B1HL 4YK4C 1FE8L 1FZOB 2JCCB 1INDH 1C7SA 2MCPH 4LVOB 4NUJB 3UZQB 4ZFZB 3U36A 3KMDA 3FQRA 3RVTC 2NY2B 3RY6C 3IBEA 3RTLA 1WTLA 3QXTA 3V95A 2IAND 2WHVA 3BFWA 4K0OA 4E0RB 5KVGL 2BOCA 3VG0H 4KOCA 4XN2A 3GMQB 1ORQB 5C6PB 5DWPA 1U8NB 3KPMB 3MRLA 1MFCL 4N5EC 4XTRC 4B95C 4FFZH 3BQUA 4JN1H 1JPTH 4M7JL 2E6PA 1B90A 1FJ1B 2NNFA 2DM7A 1N5YH 2UX7A 3STBA 3IYLW 4NSKB 1MWOA 4P9ML 3FOLB 4FEIA 1KJMB 4ANWA 5AVXB 3NSCA 1YPZF 5TH2B 3S2AA 5FHAL 4TMPA 1QSEE 2OZNA 4XNUL 3BX7C 5JYLA 4PJ5A 1EAOA 4NCC1 2HXAA 4HS8L 4BZ2H 4R9HA 5EU4B 3BPLB 3OJ2C 4JFFB 4KGJA 5HJBA 5IQNA 3SGDH 43C9A 1OB1B 2EEFA 3Q43A 1DLFL 1GIGL 5AALA 2IMMA 4B50A 4MAYC 4Y5XB 1YO4A 5KYNA 3FQ2A 3AC0A 2DM3A 3GSXA 1BD2A 2FX7H 5J0BA 2LW3A 5SX4H 5GS0C 1JGLH 1ZV9A 3JSSA 3D18B 2CDFB 4J3TA 3L54A 2CJUH 3MNWB 3BH4A 4HAGA 2X4TA 4PP2B 4QXWA 5F89A 3OJVC 1BEYL 1MCHA 5M95B 5I24A 2YRZA 1E2VA 3QJQB 2BWQA 4Q0XL 1ET8A 4FZ8H 4JHAL 5HGAB 5T3ZH 4N0UA 1BFOB 3RB5A 2DQHL 2AXGA 3VFTB 5D71H 3QDGE 1IGJA 4YC2C 4JZNA 5EU6D 3SYQA 5D7JA 3DURA 3JYBA 3STZA 4OFYD 4W9ZA 4CILA 2HPOA 3BVTA 3EHBB 3F84A 4I8DA 3UTPD 1FORH 5FYJD 4EDWH 2GI7A 3BP7B 2Y6SD 4HGMA 5C0ND 3UAEA 5C07B 1Q4NX 5IESL 1WZKA 1UGNA 1A6ZB 4X4XB 3BP5A 2Q8AH 4W9GC 4L0YA 2XY2A 5E8NB 4FLRA 3O4LE 2DYPD 3DVIA 1CFTA 3KPSB 1XB3A 3LMJL 3MA7B 4PS3A 4NKIL 3FB8B 1A65A 1H15B 5DRZA 3H9SB 2EE6A 4J12A 1CF1A 1JWMB 3FT4B 2E5EA 2GJ6A 2UUDH 1F11A 3OC5A 5H2BA 4JPSA 3ROOB 5I1AA 3GUTB 1GSMA 4BFEA 1H3VA 3R0NA 2XG5A 3RIFK 4JQVA 3M1OA 2VDKL 5CJQL 3O3BB 4GY4A 5EU7C 4XPFH 4AE0A 3PXJA 4NO0B 4OF7A 3IJHA 3IRCA 4HXAH 3VD2A 5HYSB 5EWIL 4HKJB 4KX9A 1AKJA 2CXGA 3VXUB 2FJHA 2HTKC 5JIQA 3WHE1 4LQ1A 1JXJA 2Q3ZA 3CFEB 4LSVH 2A77L 4OUUB 1KULA 3ARFB 4LHJB 4DFIA 4XE5B 3O2DA 3DHPA 5ANMB 2BMKB 2NY3B 4L4VE 4X7DC 3HS0C 3MNVA 1EO8H 3L3HA 3NIGB 3MJ7A 3S37X 4NHUB 3QDGA 5GGRA 1KPRA 3L81A 4YX2L 4K3JL 1YEEH 3QO1A 3ZR6A 4LLYB 3ESMA 1PGRB 5E23A 5KVDE 3NVQA 4NN6B 3RNQB 4YSSA 2JI2A 3ESOA 4L8SA 3COOA 1LL1A 2OMNA 2QGCA 4JM4H 4P23A 5EIVA 5EOTB 5D6CB 4DP8X 5CMAA 1S8DB 2ADJB 4LPTA 3DTUB 1KCBA 1M05B 2K3HA 3TWCL 3HR5B 3DSFH 1IKOP 3FB7A 2CUAA 5H37G 1R34A 5F9DC 1YSOA 1J8HE 4UT9H 3TCLA 3KR3H 5DK2B 2OSYA 1LK2A 1T1XB 1R3KA 3O4LA 4JRXD 4N2MA 1TSHA 3DHUA 4Z5RA 3WKML 3O6LL 4QTIL 5IHZA 1BXVA 2D2OA 3AMKA 2VRQA 5EUKA 2VABB 2YC1A 4J6RL 1ORSA 4PFEA 5ALBL 5I1EL 4Q58C 2CKBA 5ECJE 1KXHA 1ND0B 1QR4A 2YGOA 3FAWA 5DHVA 1XSOA 4WWOA 1ZWIB 1GGYA 3P30H 2FWOA 1NCJA 3N50A 3A23A 1IM9D 4ANVA 1F1AA 4JG0L 3CLEL 3WFHA 2PYFB 4NM4L 4QRPB 2AZUA 5LCVH 5HBBA 4HMCA 1QPPA 4OFDA 1BVLA 1T21B 1NBYB 1QNZL 3GKWH 4OM1L 3ABGA 2P49B 1A14L 4QY8B 5GHWL 5AZEL 5J56B 1U58B 3NGBC 2HH0L 2GITA 5IMMB 1UVQB 4L4VA 1ZGLB 4XXWC 5FA3B 4ABQA 1MPAL 3ZDXE 4OTXH 1AD0A 1BOGA 4PREB 3TYGH 2I60H 4K94C 4B0MM 4P4KD 2R29A 3MJ9A 4ODWA 5BNXD 1WD9A 1G7IA 1SYSB 4MJ6B 3SOBL 5CJOH 2IALA 4P5SA 4X5XB 1NAMH 4NNPH 4JPIA 5IBLC 1F02I 4X5QA 3AY4A 5DTFB 2OMTB 4LXFA 4MMYB 2NR6D 3HEIB 2ZCHH 3NZHL 3FB6B 2XQBL 5J3HC 3A22A 2L8AA 1EERB 2XFGB 3HC2A 4RQQB 1EZVX 2FGZA 4FQJL 3HG1E 2OMWA 4M7LL 1JGVH 3BQVA 1OTUC 1UB6A 2RIKA 3H9ZA 3KNBB 4UF7C 5KS9B 3AQXA 4OB5L 1J8HA 3TH3T 2ICEB 4WTWA 2G2PA 4HFUL 3JWDH 4GW4A 4RMTA 1J5CA 4MJIA 5L4FA 1P2CA 2HG5B 1HEZB 1T7WA 2XXMB 2PWEA 2Y7QA 4PJIF 2XBTA 5IG7B 4M3HA 3WENA 1WFUA 4JFSA 4OIAA 2B1OA 3EO9H 2IAMB 1SJHB 1X5IA 2VDRB 4MA7H 2PPDA 2Y0SA 4ZS6D 3ALXA 3NJFA 5AOMA 1J0HA 1RZ7H 4BD4A 4RNRB 3HZ3A 4XP6L 15C8L 4F9LC 2Z31C 5C0BE 4HV8A 4N1EA 2VSMB 4HWEL 4J3BA 1J5OL 4G9DA 3RDTB 5F0LB 5DD3L 2IOMA 1SVCP 3D48R 2VSDA 3JVGA 3JZYA 2F08A 1EHNA 1JWUB 2UYLB 4ZI8A 4DKEL 3OXSA 1LK3L 3MGOB 4Z9KB 4S1RH 3WFBH 2DQFA 3H56A 1AZCA 1II4E 2VXQL 4U1SB 2R8SL 4GW5B 1NC4B 4UV4L 4YL9A 1M7IA 3MUGA 3UAJD 1QLEH 3HRZC 2V9TA 4WENB 4H1LA 3ROLB 2EILB 5ABAA 4XGZA 4NQXA 1DCEA 4Y4KD 3R8BB 2B4CH 2H6PB 3L6FB 2WNGA 3D39E 2E8YA 3HNSL 4L48A 2DLHA 4C47A 3S8FB 3MOQA 2GABA 3FKUS 1N59A 4KDWA 3X1FA 2NXYC 3HG1A 3FO2A 3MRNA 4PWGA 3SYCA 2I7OA 3GXUB 5AD0A 4NKQB 3B7SA 3RX9A 3PQYB 4ZW7A 2G75B 5FB8A 2O6EA 3WTSA 4HJSA 3BWUC 3FFCE 3NZ8A 2XWJB 1TQVA 2QR0A 3MLTB 5C0AE 2P47B 4DP2X 1Q9KA 2DKMA 4Z3JA 3BPCB 2JCCE 1UWGH 3ARGC 4K3DL 4PCSA 3VDCA 1UHVA 2H6UA 1VFMA 4IS6B 1KB5H 2BP5M 1HCZA 1A3RH 1YYLL 1VFUA 4N0FB 1M7DB 5AW9B 1ZTMA 3I9GL 1G4MA 5FM5O 3ZLQC 1S6NA 4POUB 3G9VA 3QH3B 1GS7A 4PS4H 1TZAA 4J6IA 4N2OA 2QPSA 3L3IB 3AREC 2AHIA 4L9LB 1F4WL 4LSRL 2YEQA 3C2SA 3ZE2B 4WWPA 3VYOA 4JY6A 2HFFB 1XWVA 1E4JA 3CBRA 3UJJL 3QC6X 5I9QC 1W72B 4J3SA 2KI6A 1EHAA 2J8UA 3KPQB 4LCIH 1GZHC 4WWKD 3RL2B 4IRJD 1ZS2A 4N0CC 1X7TA 1QR1B 4GI9A 5ILTL 1WG3A 3VE0B 4ZYKA 1O7DC 4MKTA 5FUOH 4WY7H 2IXQB 5ID1A 4QXUH 3L7FA 3D39A 4KAQL 3DUSB 5D1QA 2CBTA 4CC4A 4UNTA 4QI3A 3I3EA 3T0ED 5F97E 4JFED 1Z0MA 1X5YA 3UEQA 1MRCL 3B3IA 3IBOA 4NQCB 3P4OA 5CSBA 2X9YA 4RZCB 3TO4A 2QMJA 4IRSB 3FFCA 3NQIA 3DPBA 4DKFL 1BZ7B 3ZKMC 5I0YA 5C0AA 2FO8A 4HBCL 3FMGL 3T3MB 2XJKA 4JO1L 1JYWA 3SYAA 3QDJA 4XWGH 3UZQA 5ADPL 1TMCB 5ISZB 1KTLB 4MA3B 5L7XL 3FULA 4NQVB 1FVCB 1JZIA 1ODAA 3T2LA 3DXAA 4NZTH 5IOPA 5C08D 4ZFFB 3LD8B 4E0RA 1BQRA 1YEDB 3DROB 4X4KA 2Y69B 2ZOLB 1ORQA 2G9KA 3GMQA 3L5IA 4R83A 3CG8A 1UADC 4GKSB 3V0WL 1MREL 3T6WA 4KO7A 2YAHA 5C07E 1QUPA 3P4LA 4XCFH 3RJDA 2FZ3A 1WFOA 3BH9B 2Y06H 4XVTL 1UWEL 2KPNA 3KPSE 2BHZA 1WAEA 3WO3B 1MY5A 1U6AH 4W9FC 2HN7B 3O81A 3Q2WA 1OAUH 2F68X 1G9MH 3H9SE 3VFVB 3EJUA 2OL3L 1MW3A 2F8OA 3S3DB 4K7FB 1KV3A 2X4QB 2VLKB 4KKBC 3U9WA 1NWPA 3N42F 1LD9B 3HAEH 1UA6L 1OGTB 2V2WA 2OLDA 4X6BB 1YQVH 2ZP0T 4PJBB 5FDYA 5AW5B 3FUEA 4HKXB 3C5ZB 4U1GC 3VXUE 5CD3A 2CDFA 3OGCA 4AXWB 4LPXA 1CO1A 1L9QA 1MDAA 3MNWA 4WVRA 1MG2C 4DK5A 2Q10A 4H25A 5D7JC 1S7XA 3PXHA 3LPGA 4FQXA 3KJ4C 1AQKL 1RZFH 3I6KB 2IPKB 1AC6A 3NIGE 4WI6A 5HGAA 1BFOA 1R5VB 3G6DH 3RUGF 1JJUA 4GG8B 1HHHB 4A2FA 3CZEA 3POCA 4NZDA 5C86A 5E94A 3HIZA 4RRPM 3ATBA 4L2LA 4QPEA 4BZYA 4LSQH 1HCVA 4NFBA 3JTSB 4IKNA 1GMIA 4G7VH 5AVWB 2NQDA 1NJ9A 2JI3A 4APQD 2VDQL 5C07A 1SDYA 4UQCA 4Z3GA 1ADWA 1FSKB 3SBWA 5E8NA 1SDDA 1MVFA 1TQBB 4GINA 4G8IA 2ZT9C 1THCA 3FB8A 4JQVC 3KLKA 4LKCB 1JWMA 3FT4A 4HJJH 5K9KA 2X2IA 1E28A 1G1OA 3UYPB 1ZV2A 2YRPA 1C5BH 1DLHB 4QRPE 4P5TB 2FX9H 3S4SB 4OJYA 1JNNL 2R59A 4RMWA 4DW2H 1KCWA 5HYSA 3MLVL 3QUYD 2ZZUT 3HKZA 1V05A 1BIIB 3VXUA 4IHOB 1XBDA 4QCIB 3ARFA 4X7SL 4Y2LA 3RVTD 3PIQB 3OZ9L 1E30A 4QKTA 3P0YH 1DFBH 3P3TA 2XTSA 4GUPA 4QHUA 4JO2H 4P23C 5FYLL 4N5ED 4MDJB 1MFCH 1S5IH 3AABA 4NHUA 2R69L 4XTRD 2YJQA 5JIKA 2YD1A 3VD3A 4WHDA 2KC0A 3LZQA 4AIZB 4LRIA 3ZDYB 1MZZA 3RNQA 5FV2A 4WI8A 1K2DA 2QVTA 5H94B 2IDSA 1NCDH 1UOLA 4Y16B 2A0LC 5D1ZA 2YGNA 5LG1A 1E4WL 3HR5A 5D7KE 4XBEH 5KS9E 1H3TA 4I3SL 4Q9BA 4XPGH 2P7TB 4L2YA 2J25A 5E2VH 3FUKA 5IKCA 1L9NA 1OPGH 3N43F 5GS2D 3BAKA 2XTLA 2Z7ZA 4DGYL 4EIZC 3K1DA 4MAYD 4LCUA 3SY0A 2P46B 4WFED 2CM5A 1OWWA 5TQ0L 2O5YH 5EO9B 1GSKA 2NT0A 4LT7A 4IRZH 4LU5H 5GIRA 2WWKO 5F7HA 4I87A 3CFBB 1JXKA 3UPAA 4QRPA 5LWYL 4HEPA 1JF1B 2EIJB 1KENL 2F7RA 1S9XB 3U9PH 5JLZB 4YGAB 3Q6FB 2AQ2A 2BNRA 1Q9OB 2XZAH 2CHXA 1T21A 3AU1A 4C56E 4YXHH 3E9UA 4NJ9L 1TIUA 4NOBA 2IGTA 5DHXB 3FNKA 4H7VA 5FCUH 2DQTH 4B53A 4LKXB 1U58A 5IF0B 4WAFA 5IMMA 1ZGLA 2VH5H 3AY4C 5FA3A 4MNQB 1F2QA 1YLBB 3OAZH 4H8UA 3MJ6A 4PREA 4TRPL 1MCCA 4B5ZA 5BMFL 3K4DA 1LO0H 3TJHD 5CP3H 4MJ6A 4OY9A 5TK4A 1JYNA 3KH3A 4X5XA 3AG2B 5F0PB 5CJXA 3S36X 3MV9E 5AB9A 1VA9A 4MMYA 3TL5A 3BN3B 1QX1A 5T3XD 5IESH 2JKJA 4K8RH 5MERB 2HX9A 4EI0A 2DW5A 5FYKU 3T4AA 4N2AA 3EG9B 1UB5A 4NKIH 1E3FA 2W0KA 5D9SA 5I1CL 5DJ8B 3NJXA 3MUHL 1XR8A 1BLNA 3KEHA 4D9QD 2ICEA 4JDVB 3PQYE 2FEEL 1EEYB 5FYKH 5GS1A 2HG5A 1HEZA 3TN0A 5ALCL 4QHKI 3L48A 2PP8A 2GVYA 2J43A 3H9HB 4UUJB 5I8OH 1O9ZA 1RLBA 1Q9LA 4XC1H 2VDKH 1I8IB 4LASL 1SJHA 2KMWA 4NN7B 3O3DA 3O0RH 1S3KL 4XCYB 4RNRA 1PBYA 4EF3A 2HTKD 3QZMA 3TPUB 1F00I 1QTPA 3EFOB 1NMCC 3LKPB 7TAAA 2JELH 2VE6B 1FQ9C 1XGTB 4C56A 1LWJA 1QABA 2B8OT 4QF1B 2FQEA 1UTDA 7FABH 1EPFA 2BSRA 2C3VB 1KYDA 2UYLA 4ZW8A 3ZE2E 3NFNB 4MB4A 3FPXA 4H0HB 3QNZA 5GRWA 3L4UA 4BFIB 4OIBA 4ICXA 4PJ8B 1DL7H 1EFXB 3GMNB 4U1SA 4G6KH 4GW5A 1EJFA 3U46A 4JHWL 3BD4A 4KITB 2Y07L 2G3MA 3KPNA 1RIUH 4O2EB 3ROLA 3MV9A 3U1PA 3FT0A 2ZOWA 3VI3F 3L6FA 3ECBB 4N9GA 1DEEB 1QI3A 3BKJH 2AGJL 3E8VA 5JUEH 1KLUA 3WHXB 5HYJB 1CFSB 5F7AA 1IU1A 4J6RH 2D03L 2ZXWB 4R7DB 2K7PA 1FHGA 4NQCE 3WJMB 3PJNA 3DYOA 1QPXA 4I0CC 4ZOCA 3CFCH 1MCWM 1A9BB 3MLTA 4FQQB 5B8CA 2EDJA 5K9JL 3UTTB 2A5UA 3T3ME 3BPCA 3QIWB 2Y5EA 1PG7W 4HOXA 4F7TB 3DIFA 4OM1H 5ISZE 1HAWA 2I25N 4N0FA 4OKVA 1YPZA 1U95A 3SDXF 2HH0H 3LNFA 1HQ4A 2NY0B 4XXDB 3A21A 4NKOA 1A0QL 3QH3A 2V9QA 2V17H 3N41B 3L3IA 4NZ8A 4L9LA 1KB5B 5AW0B 3KLAA 1A4AA 2HRHA 3IJEB 4P2OA 3SOBH 1KCRL 2CK0L 5F0JB 5IBLD 1MHHA 4EUPH 4QAMB 1NBVH 1G6RB 4JY5H 3VAEA 4DK3A 2ZICA 1HHIA 1W72A 4WUKL 3H55A 2WP3O 1Y1UA 3ULSB 5J3HD 5D1QC 4CC4C 3SKMB 3I6LE 1TJIH 2YUWA 3KPQA 4FTVD 2I24N 1S7QA 1BBDL 1NM4A 4XNZC 4ZFQA 1WFJA 1XGZA 4HPHA 1OTUD 1QR1A 1SJXA 3VE0A 2VLKE 2Q87A 3LHPL 3U4EB 2AKRB 2IXQA 3L3JA 3W9DB 3TO4C 2ZX6A 1KBVA 2KL6A 5B22A 1IAMA 2B16A 4JREB 5H4YA 3N1FC 4MS8C 4UT7H 4BDVA 1DANT 2X1WL 4NQCA 3VCLB 4BKTC 5CSGA 3RKPA 5DLMH 1OY3B 3BJLA 3L3GB 1QP1A 2F1BA 1F5WA 4DETA 2Y6TE 1BZ7A 3OC8A 3QW9A 15C8H 1QO3B 2Y1VA 1U2CA 2Z31D 4C4UA 5HSFA 3C6LD 2G5BB 3TEUA 3KL5A 4WJ5B 3S0PA 2R23A 3NT0A 1DJWA 4MA3A 5ISZA 1L3WA 4NDMA 4Z7VB 5HYQB 4GQ9H 4P59H 3OSKA 1FVCA 3LXAA 1ZTXH 1XF2A 4NI6A 4RDQG 4DKEH 4ZFFA 3IS0X 2A4CA 3QJHB 5E08L 1XH3B 4LMQE 5DQ9A 2VAJA 1YEGH 1AXIB 4OQTL 3EGSB 3O3EB 5T3ZE 4GKSA 2UXVA 3SEPA 4JFPB 4U49A 2FVNA 4MYPA 2MTAA 3DJTA 4MS6A 2UZYA 3BPLC 4LF3B 4NNXB 1ADQH 3IXAA 5IR1B 5K59F 3VXNA 4Y5XC 3HNSH 3ZUNC 3BW9A 4FJZA 4KNQA 2CRZA 5B7FA 4QTHB 4TVPE 1MJ8H 4P57A 2NXYD 1ILSA 5AKVA 2C9RA 3O3AB 1W16A 2GK0B 1NFKA 4XE0A 1R0AH 2NW3B 2VLKA 3CVHL 2I85A 4LBEB 2QT6A 1NSNH 1MLBB 1OW0A 3TFKC 3BKCH 1LD9A 4TSAL 5CEYA 4ORGB 4S1QL 4X6BA 3WY1A 5AVQB 1BQKA 3F05A 1LTXA 4TSCH 2FHCA 3ILEA 4PY8J 4K3DH 2JQZA 3MMEB 1GY1A 3HAEB 2ICES 4QHMB 3I9GH 3L4CA 1IM3A 1KDIA 4RVBA 3T4YB 4Z3FA 3OG4B 5EPMA 4R5XA 2ERJB 3MBEB 5CIPB 1R5VA 1QNIA 3MO1A 3OPUA 2N7AA 3A24A 4GG8A 1CVSC 4LSRH 2WZAA 4PRHD 3TJEH 2BSBA 2QQKL 3ZDYE 4N8VG 2J72A 2FYYB 3HFMH 3QUXA 4PCYA 3PABB 3LEVL 3SBWC 3JTSA 4LIQL 1AY1L 4UILH 3MNMA 1I7ZB 4FJ6A 3OLGA 3OF6D 1MHCB 5A6LA 3IJSA 4A6YH 3VMPA 3WTVA 2BNQD 3DX2A 3NYKA 1XMEB 3GO1L 4XP4H 5BV7H 5BXFB 1NC2D 5TE4L 1P5UB 2NY1B 4N0CD 4HX1A 2ATPA 4TVUA 5EOCL 3CBJB 3KLHC 1P9MA 4AT6B 3CAFA 4U7MA 4AEEA 5I1HL 2PWGA 3IF1B 1DSWA 5DJDA 3TNNB 3F2LA 2NUTA 5I19H 3T0BA 3EJZC 3PL6A 4JN2B 4HUCA 4P5TA 3GXTA 5GZNA 1KV7A 3ZDZB 2VOTA 4L1BA 3V4VL 3MKKA 4XAKD 1F90H 2WB7A 3ARFC 3TM6A 2Z8RA 3OR6A 4DKFH 4G83A 3ZKMD 4H4NA 4KTDH 2XETA 2QGEA 1FHNA 2VR3A 3VXMB 1L7IL 4PU2A 5AKRA 1D5ZB 1F3RB 4J28A 2UZXA 2PABA 3VQ2C 4LARH 5CGTA 3PIQA 3GNML 4U6HA 4K9EL 4MNQE 5L2KB 1U8OB 2ZUSA 4LRIC 2MIZA 4XVJH 4NN6C 5E1AB 3GMRB 3Q1EA 3V0JA 4IBQA 3JV0A 4P2AA 3H0TB 2WVSA 4PJIA 2MNUA 3QDAA 1FAIL 4G72B 5D1ZC 1KTJA 4LP4A 1JD9A 1ZE3H 3G5ZB 2X4NB 3V9FA 4RGOL 2JCWA 4MQXC 1NPJA 4HWBL 3KPPB 3MKGA 4G7SB 3QEHA 4Y9GA 5T1KB 3ECVA 5HI4C 2X10A 2ZKWA 2DDQL 2J2ZB 4O51B 2CGRH 1BD2D 1FL3A 2AEPH 1I8AA 1N26A 4A7TA 5BCAA 3JV4B 4KKBD 3WIIH 1GGCH 4BZ1L 4OGXL 4BK5A 1AKPA 2D2CC 2R0WH 3QT2A 1FP5A 4N0YL 3SO3B 5AW1B 2XWEA 3D3VA 3C60B 1LJMA 4RWYL 2FT7A 1U3NA 4UT9A 1GXEA 3M86A 2BDNL 3MREB 2DL2A 3I9IA 5K9QG 1RP9A 3Q6FA 1AHWA 4E9QA 4Z3EA 2E9IA 3QJUB 5D7JD 4RSVA 4Y4FA 4LE8A 1T4KB 1CLVA 4WK0B 4Y9EA 3WFCL 1N8OE 3VXRB 5EEVA 4GB9A 4U1KA 2BFGA 4AUYA 1RHHA 3VQLA 3CMOL 4RRPA 5IF0A 5CJXC 4PRPB 5LCVA 5ACZB 1GHFL 4FULA 3EYVB 4MNQA 1GS8A 3GYRA 2YQGA 5D96B 4AYEC 1XIWA 2OMVA 4IOSA 2G3NA 1UWXH 5GRYA 4AGPA 5BRZB 2FQDA 5GRVK 3SY6A 1FI8C 1A7QH 3IDGB 5D7IB 1A3QA 4M5YL 5SWSE 1QSED 2W81C 2P28B 1MG3C 2ICEC 3H4HA 3MU3A 1S3RA 3GTTA 3MFFA 4A7UA 4Q8BA 1ZY9A 3L4XA 3QUMH 3KDMB 1E5BA 5F9OL 5HYJE 4ZUWA 1FZMA 4RGMC 2IAMC 4Q56A 1PD6A 3IRZA 5KVEE 5I17A 1N68A 2QQQA 4XP9H 1MQKL 5MEPB 2ZCZA 4XMZA 3H9HA 4UUJA 1AKJD 3QO0A 1LVEA 2YD6A 3V4LA 4DZ8B 1JNNH 2EABA 1I8IA 1SOQA 4GMTL 1QFWL 3X14A 5FA4B 4XCYA 3KLDA 1BLIA 4I7ZC 5CLXA 3STLA 1FFPB 2V9UA 4GKOA 1V3JA 3MUZ1 3ZZLA 1WAAE 4GEJA 3TPUA 4XHJC 3QDGD 3U6XS 1OM3H 3RGHA 1CPUA 5JR1H 1LEKB 2R56L 1YN6B 4YZFF 1XGTA 1FL5A 2C7UA 1GYWA 3AS0A 5GGVL 1QYGL 2C3VA 5ICZB 4P23D 5J6HB 5IW1B 1VFAA 4WV1A 1X5MA 2NY6D 2X40A 3Q48A 3UIYA 4PJ8A 2VRAA 3ZOAA 3K6SB 3GMMB 3GMNA 2FX8H 5L6YL 3G7TA 4CN1A 3D0VB 3FC8A 3O4LD 4ELMB 4ADIA 5CZRA 4HIXH 4XVOA 5SWSA 5JORB 3V5HB 5ID0B 4I3SH 3ECBA 3QUKA 1DVFB 4FS0A 3T04D 1KPVB 1QLFB 2XWRA 4DP7X 3RZCA 5HPMA 1HNYA 1ZPUA 2GSGB 5HYJA 1G87A 2C4XA 5B8CC 3TBTB 1UEYA 2ZYIA 2WWOA 4R7DA 3EYOB 3F83A 4BSJA 1C8QA 4HS6B 5FKPA 2CM6A 1A9BA 4XXCA 1AZBA 2EXYC 4FQQA 5EOQH 4G70B 2OK0L 1J1OL 5I8KH 2VDLB 4IBYA 3VDAA 2WINA 3EOBB 1EXHA 2X4OB 4L4VD 4X7EC 3V52H 2EIMB 2RA1A 1H9VA 3QHZL 4X99A 5H8DA 3UGUA 4F7TA 4GBXB 4YDVB 2C9SA 4Z7VE 1BX2A 4L9LC 5CINL 1TETH 1WAAA 1YAZA 1CFBA 2R2EB 4P2OC 1PZBA 2YSSB 3VQ1C 1LMIA 4N86A 3VSTA 5JQ6H 2QZQA 3LVTA 3ZRCC 4JDTH 1A2YA 1KB5A 1DJHA 5BMFH 1X4YA 2ZAHA 2JFCA 1I31A 4IBWA 1BV8A 2H2SC 5C9JB 4HCIA 4UIMB 3CIAA 1IIIA 4K7PL 4Z0XB 3RTQB 4F24A 1QSZA 1VEMA 2K70A 2LGNA 5MP6H 1N10A 1Q94B 5HDOA 1J8HD 3T65B 2DWDB 3ULSA 4GRMB 1PJ9A 5LN8A 2GSIA 3V4UL 1DBKL 1OD7A 2VDMH 2QSQA 4HFWA 5IUCA 4TNVF 1CN4A 2E59A 1DJIA 5B4MC 3HPJB 4WO4A 3MTRA 3RX5A 3MLPA 2GJRA 3AFLA 4IRSC 1RSFA 1I8UA 4JL1A 5DRNA 3RUGA 3VH8B 4ES9A 1MFDL 5DVMA 3K8LA 4OZFB 3SJVB 4B7IA 1XGPA 2ZYHA 5FO8A 3RFZB 4ONHB 1XX9C 2R7EA 2XY1A 5DJZA 3EOAA 2ZF9A 1DEDA 1RZPA 1SFHA 2X3CA 1QLRB 4M7LT 4H1LG 4ZX5A 2OI9B 1H9DA 1QO3A 1XH1A 1A5FH 4CGUB 1Z9SB 4LQFH 4QO1B 3AXHA 1D9KB 2G5BA 3RWEA 4EPSA 3TS8A 4PH8A 1XR9B 2DTSA 4RFEB 4Z7VA 5HYQA 3ARUA 2CCWA 2WJ7A 2IH1B 3F6JA 3VWJA 4K23L 3WGUB 4UM8A 1MVYA 3BFOA 3QJHA 2WUBH 2BIHA 1G0DA 4TNWF 4XOEA 4XVUC 1ZLSH 2VMDA 5FM8A 1H6UA 3EO1A 2BERA 4IIZA 1Q38A 4YFLI 2H0FA 3GLEA 1IL1A 1UKQA 3FSOA 2WTRB 3HG1D 3LY6A 3CVCA 4X8CA 1OXYA 2J88L 5IR1A 4GG6B 1OW0C 2DQUH 3T8VA 3K72B 4QTHA 1IQWH 1MWAH 5F1OB 1E8WA 3QJOA 2CR3A 4JS7A 1A6TB 1UM4H 3G04A 5B7EA 4LBEA 1O7VA 2UXGA 5KYXA 1MLBA 3VMOA 3S9DB 1BVKB 1OP9A 3O4OB 4X7TA 4ORGA 3ZDZE 2C1PB 3S3BB 2AJVH 4AMXA 4JO5A 4N2CA 2F19L 5E0QA 2DYRB 5C0BD 3VGFA 4C54A 5DJAB 3VXME 3QBTB 4Q74A 4RMSA 3HAEA 4Y8DC 5KANG 1RU9L 2Y9RT 5IJKA 3CTTA 4QHMA 4XHQA 2WVUA 1R47A 3RGVD 5L2KE 2EDRA 4U2ZA 3T4YA 5FFGA 5IHLB 3QUXC 2BVOB 2QPFA 2Y5TB 2DPKA 3MBEA 2PPAA 4GO6B 2H1LM 5CIPA 5E1IA 2C3GA 1IC4L 1W9XA 2B5IB 4ADGA 2LOEA 1EAPB 4PGBB 3AWEA 2LU4A 2YOAA 3RVUD 1S2EA 1MUJA 3GWJA 1KCRH 4JBSA 3IXTB 1FSKC 3X12A 2O5XL 1P9MC 2JQAA 3WNOA 1TQBC 3ULAB 1IB5A 4FCHA 2WKOF 4HLJA 3U0WH 1I7ZA 3N85L 3D39D 1CCZA 3IKKA 4E9SA 4MMZB 3VMNA 4V33A 1SHSA 3TYFB 4E9WA 5IMLB 2HRPH 1P5UA 4DGVL 4NRXA 3PL6C 2DLGA 4Y2OB 3U48A 3LHPH 2WQVA 4EO5A 3IAGC 2IPTL 4P5TC 5HGHB 3O2VH 4OCSL 3TO4D 3X3GH 3V5DB 1PZ5A 1OO2A 2ZJSH 5DR5L 3UAAA 5C0AD 4MS8D 4OF8A 1ML0A 3QCVH 1HVXA 2C4FT 4EZLA 2HLAB 4JN2A 5D1XA 3S8WA 3QULB 4FRWA 4QHPA 2J21A 3VGGA 2VDNL 2GJZB 2CO4A 2NY2D 1IQDA 3TZVA 8CGTA 4NWTL 2BK8A 5KUMA 1MI5B 1Q72L 5D4HA 3V9EA 4I88A 4TQEH 5ES4B 3VXMA 4FOMA 2C26A 3MXVL 1W8EA 5KYUA 3SIKA 2DKUA 3SQRA 2ZAGA 2EDFA 3BESR 1QRNE 4LK4A 4O02H 4PRPE 1T2QL 3P77A 1PZ3A 4P5MB 2V5MA 3QNFA 1JWSA 5JHLH 4F7MB 3I02A 2RQEA 4HCRL 3GMRA 4TV3A 4IDJL 4YVNA 5LO7A 4FYSA 1YCSA 3X13A 1KT2B 5BRZE 3RWCA 1KGIA 3RURA 5KOVC 1BSIA 1KWGA 1GJWA 3FO0H 1CXLA 2G2NA 1TO5A 3G5ZA 2ENPA 3EH1A 2GBTA 5CJ5A 2IWKA 1CDHA 4J7RA 1TQUA 2V5RA 1Z66A 2AABL 2IV8A 4N3TA 2J2ZA 1ZS8B 4ZPTB 5FECB 1OTSC 2ZD0A 1ZLVH 2O1AA 2EO7A 4BCXA 3W37A 3VD0A 2XFXA 3MLSL 1ZLEA 3TFKD 4JGUA 4QUOA 3WG7B 3K46A 1NGQL 4L1HA 1I85A 3IK2A 1AHWC 3C60A 1SBBA 2WOBA 4P2YA 4Y4FC 1O6TA 2E75C 3JWOH 4AJVA 5JOEA 2MQ3A 5FYKE 3EGXA 3LXCA 4JY4B 1GGBH 2XN2A 1XSKA 3D4CA 4HS3B 3LNHA 4W6YB 4BRVA 5DMYA 5FWRA 4RIRB 1RK1B 2GBVA 1P4UA 1TZGH 2K9UA 4IRZA 3VI3A 5L0QC 3RPIB 1XIWC 4YSCA 1QRNA 3NJJA 3ESPA 4X6EB 1BMGA 2VWEE 1JNJA 2DLEA 1BVNP 5C07D 2QQKH 1YRKA 2ITCB 1GJIA 4Y5YB 5J7CC 3OQRA 1J8KA 2OM5A 5IBTL 5BRZA 4EEEA 1GC1L 1R33A 3KPSD 1IAOB 3LIZL 3QFDB 2ZWNA 4ELME 3RIKA 1GGIL 5ENWA 2OMZB 3PPSA 5HYSG 1JK9B 3H9SD 2KQMA 2LE9A 3FPYA 5BVPL 1UATA 4AX3A 3KLHD 1FZJA 3AUWB 2YMTA 4IBVA 5L4JA 3QK0A 5DD0L 4K2UL 5I1HH 3KDMA 5CP3A 4WI5A 4UINL 4TUJA 4EXPX 1RMFH 1S9WB 1OF2A 6FABL 3SDXA 4KVCH 4NN7C 4NO0D 1DJGA 4FDWA 4S1DC 2J1ZA 3W57A 2GY7B 4MQTB 3WFDH 1UOVA 1V7NH 5MEPA 1PKQB 3EJZD 3BO8B 4MD5A 4RMQA 2H41A 3AGVA 2BC4A 4HWNA 3VXUD 3QDMB 1QVOA 3DIVA 3SKOB 4IMLA 3QJRB 1FFRA 3ARFD 3B6SA 5C2BH 2XCMC 1YN7A 2NY3D 3GB7B 1WIOA 1RUQL 5FA4A 1FFPA 2WJ5A 1K8DB 1WCQA 3H3PL 1D5IL 4OCLC 4WV1C 2LFEA 4B41A 2YPVA 4ZODA 4A37A 4PJ8C 1BFVH 4D94A 3LH8A 1AXSB 1TVBB 2YEZB 2O5ZL 3OKYA 4U1JB 5B7MA 3MRIA 4MRBA 5B1BB 5J6HA 1OLZA 3ZQXA 1L7TL 5TDPB 3ZHNA 4ZAKB 2N3JA 3K6SA 4J23A 2QFRA 3B8YA 1S9VB 4N3UA 1FAIH 1AMYA 1BVZA 3GMMA 2WUCL 2B14A 3EDFA 1P7QB 4ZNCD 3WSQH 1KYUA 4HEPG 4ODUB 2ICWI 2EDEA 3D0VA 3S37H 1JZ2A 3RZCC 2ETWA 4BRJA 2WIIB 4YNYB 4UB0L 5HI4D 5JORA 2ESVB 5ID0A 3MLZL 1H6TA 3OJDA 5F8RC 3ULVH 1YEIH 1OAJA 1JRHL 4RA3A 2EICA 4GSDL 1RZQA 4I1PA 1VESA 4HK3N 4NPJA 1ZANL 3ETSA 2ALAA 4XXCC 3H7LA 4OGXH 4QRPD 4ZMVA 3IU4L 3SJVE 2XN9B 4KMTL 4TQ8A 4W4NA 1U93B 1M1SA 1F86A 1W6LA 2JKIS 3QIWC 1OZTG 2YBGA 3D69A 1WITA 3VNYA 3WUZA 4JMNA 2A9DA 5CCKH 3HPLA 3HNTL 4DOHB 5IWLC 2HCZX 5LXGH 4RCAA 2X87A 2ZWKA 3PG2A 4HOMA 1L9RA 3GK8L 2NY0C 3EOBA 1KTCA 2DEXX 5H4ZA 1U33A 1JFHA 5T1MA 4YDVA 1D5BB 5B38B 4JDEA 5KYWA 3NPZB 2VXSL 2HX7A 5F7DA 1P7KB 3H42L 1LO2L 2AI0L 1MKFA 1SY6L 1XSIA 2YXMA 4ENEC 2EDHA 5BOZG 1ZT4A 5CN1A 4ZFGL 1CFQB 1S78C 3P11H 4FTDA 3NAAL 4Z95L 4CW1A 5D7EA 5C70A 1LO5B 2FD6H 3JTTB 2AMUA 4NLAA 3VFRA 5GGUB 1MNUL 1QFOA 1ZTXE 4GFXA 4Z0XA 2OMUA 5D2NE 2IDFA 5D7KD 4JZJB 4YDNA 1LE9A 1AR2A 3BDXA 2K78A 1T83C 3RKDC 3T6VA 4GG6E 3T65A 2DWDA 5AYQA 3T6XA 4GRMA 1F45A 4TQHA 4HG4K 3U4AA 4JM0A 3CZKA 2DLIA 4JREC 3MSPA 5F9OH 3QEUB 2IAMD 4M5ZH 4QRBA 1KCSL 3HPJA 4M9OA 3WTTA 1DQDL 5BVJB 3IJYB 4JRYB 4GNKB 1NEPA 1RZKC 4XNAA 3SJVA 3AT9A 3T08A 4XP1L 3U4BL 3ZN6A 4GMTH 1XF4B 3DJZA 2R15A 1NEZA 3RDTD 1G7LB 1T6BX 4X0NA 4YBLB 1QLRA 1LXMA 3DYPA 2BVEA 3G5YA 1XSJA 2V5YA 4NKDB 2D31B 2HFEA 3JTBA 4JEGB 2P45B 4XHJD 3VWJC 1Z6JT 3KVDD 5C1MB 5FXCH 3O11A 4KZEH 1ITBB 1KJ2L 3DSNA 2ZXGA 4S0TD 2J1XA 1KJVB 4NO2B 4XMKH 4ZFOL 3GFUA 1NC4D 2ADGA 2WBWB 3I3BA 2OCJA 4A7SA 1CDBA 1QYGH 1KCLA 3ZL4L 4U1HA 4BJLA 4DUWA 2VQUA 1ETZA 4H13C 3MV9D 1DZBA 3ULVF 1VEPA 3PWJA 4LNRB 1KYOJ 3QRGL 1T0PB 4I1NB 4HIIB 3H3BC 2A83B 5HHNA 5GS0L 4RBPK 1JPSL 1HQRB 2EKJA 1QEXA 4P3WA 2F5BL 3LZFL 2YAFA 5D2NA 3PGCB 5EA0H 5I1LB 4BH8A 1R5IB 1YJDH 4DKTA 4GG6A 1OAKH 4YPGA 2FBOJ 3PQYD 1QG3A 3E9TA 2X4SB