2FQFA

Crystal structures of e. coli laccase cueo under different copper binding situations
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
486
structure length
465
Chain Sequence
RPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blue copper oxidase cueO
publication title Crystal structures of E. coli laccase CueO at different copper concentrations.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 133
structure length 465
sequence length 486
ec nomenclature ec 1.-.-.-:
pdb deposition date 2006-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2fqfA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2fqfA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2fqfA03
4YSAA 4G7QB 4GP5B 4HIPA 5AFAA 1PLAA 2YAEA 3PLYA 5IY5B 3ERXA 2UX6A 1IBYA 2PP8A 1AR1B 2YAMA 1AAJA 1ASPA 2FT6A 2FT8A 1AZUA 4E9SA 3QJTB 5D4IA 1IKOP 2UX7A 1AOZA 2DV6A 1TEGA 3OMIB 1CUOA 1A4BA 4BXSV 4CSZA 1X9RA 2FQFA 1GS7A 2CBPA 1E5ZA 3X1BA 2YARA 1WS8A 3WKQA 4GYBA 2BW5A 1ILUA 3IN0A 1RZPA 1JOIA 5TK2A 4DPAX 2FWLB 2IWKA 3D12B 4E9XA 1RZQA 2GC7C 1BXVA 1AS6A 1FFTB 4MFHA 4DP1X 1SFHA 3UACA 2YAHA 4KOCA 3FSZA 4NERA 4KNTA 1J9TA 2GHZA 2J57A 3FYIB 2BP0A 1NDTA 2VSMB 1JZEA 4YSDA 2X87A 4KOBA 4A2HA 1PZCA 1OCOB 1BEXA 1JVOA 1PZAA 4M3HA 2H5UA 4PAZA 5PCYA 3SQRA 2R7EA 4JHVA 1ET5A 1OOWA 2JXMA 2CCWA 2EILB 3NJKA 2XV3A 1OE3A 3AG3B 4GP4B 5D4JA 4BWTA 3QJSB 3NSCA 4YSEA 4M4RB 1E5YA 5B1JC 1KBVA 3SBRA 1XMEB 3NT0A 3UABA 4FA7B 4GXFA 1IC0A 2DYRB 2BZ7A 4Q89A 3NJFA 1GW0A 3FSVA 2JKWA 5B7FA 1R1CA 1L9SA 5B7MA 3PPSA 3JT2A 3NP3A 4N8UA 8PAZA 2YAOA 2FNWA 3TBCA 1HAWA 1EHKB 3EF4A 1WA2X 3FU8A 3EH3B 2HXAA 2HRHA 1BYOA 3ABMB 2AVFA 1TKWA 4N4YB 1BQRA 1PNCA 1XB6A 2XU9A 2W8CA 4QKTA 4YL4A 2AZAA 5AZUA 2YQBA 1BXUA 3DKHA 5ANHA 1JXDA 1TU2A 2XWZA 3V9EA 2PPFA 4A2FA 3WKPA 1JVLA 2XXGA 1QHQA 2WSDA 4KO9A 2FTAA 3UADA 1AZNA 3FSWA 1NPNA 1URIA 3QJQB 4RH4A 2AFNA 4F7KA 3S3BB 3T6XA 2CJ3A 2HX8A 3C75A 3NJMA 2J5WA 1FWXA 2RACA 3QJRB 3TA4D 3H56A 3NSDA 2FJSA 2ZOOA 2MRYA 2YAQA 5F7AA 2Y69B 3S8FB 4F2EA 2VW7A 1KYAA 1AS7A 1B3IA 4DP6X 1PCSA 5B7EA 3FQYA 4YSCA 3KW7A 2ZONA 3QQXA 1L9RA 1SNRA 1PZBA 4UAHA 3NP4A 5LDUA 2UXFA 3OD3A 1J5DA 1F56A 1L9PA 1A8ZA 2FQEA 1V10A 2XX0A 1ASOA 2E86A 3CVCA 1JERA 3QJVB 1ZIAA 2PP9A 1SF5A 2I7SA 1HFUA 4QLWA 3BQVA 2UXGA 3L45A 1T5KA 2XYBA 1WAEA 2YXWA 4TXVB 3FYEB 2BP8A 4FAAB 4A2GA 3HB3B 4ENZA 5I6OA 2OJ1A 2PPDA 2HZHA 3SBQA 2GC4C 2IDSA 2XUWA 2XX1A 1BYPA 1PNDA 2DWSA 3FU7B 4G71B 1CYXA 3NSFA 3S8GB 2BP8B 3N55A 4BDVB 1AZCA 2FQDA 1ZIBA 2VM3A 3AG2B 4DP5X 4DPCX 5I5IA 1HAUA 3MBWB 2H3XC 2GI0A 4YSSA 3ZIYA 2P80A 3WNJA 3RYMA 1CURA 1J9SA 3NJIA 3GXUB 1ZPUA 1A65A 2CAKA 3U25A 3WNIA 5E9NA 3UGEA 3WG7B 3T6WA 4DP4X 4HCGA 1DYZA 1BQKA 1NIBA 3AY2A 1SDDB 1L9OA 1WS7A 4AZUA 2XVBA 4F2FA 2J55A 1NWOA 4DP2X 2X88A 3PXLA 5I28A 2HX7A 7PAZA 1KBWA 1NIAA 2BW4A 3ZBMA 4KNUA 3ABGA 4G7RB 1JZGA 2IDFA 1GY2A 2VW6A 1BAWA 1PLBA 2YXVA 3OMAB 4W9ZA 1MZZA 1NINA 3T71A 1OE2A 3PCYA 2QPEB 3QPKA 2P80D 3DIVA 4P5SA 3TU6A 4AKOA 5B3SB 1X9UA 2VSKB 4HALA 3UAEA 1GS8A 2BWDA 3T6VA 1E65A 3NYKA 4YSTA 1AZBA 1GR7A 4HZ1A 1OF0A 3CVBA 4YVUA 1NICA 5I26A 5I5MA 3AZUA 2Q5BA 1JZHA 4A2EA 2IH9A 1PMYA 4A68A 2DY2A 9PCYA 4BWUA 5B1KA 1J5CA 2GB2A 3MX0B 3HEIB 3IE9A 1NIFA 2J56A 1QLEB 2PPAA 1ZDQA 2FT7A 2VMJA 1PLCA 3ABLB 3PAVA 2GIMA 3CDZB 5I6NA 3FPXA 4DPBX 2ZXWB 2XLLA 1AACA 1KGYE 5I5JA 1ETJA 2FQGA 1QNIA 3NSYA 5I6MA 1AIZA 1N70A 3WIAA 1NZRA 2JFCA 2VN3A 1NIDA 2BO0A 2HLEB 4AI7A 3TBBA 1A3ZA 2EIKB 1GY1A 3JTBA 2XV2A 4UF7C 5EHFA 5AKRA 4HCIA 2VW4A 1ZV2A 2DWTA 4DP8X 1ZDSA 3X1FA 1OCZB 5TK4A 1KV7A 4JHUA 3AG1B 2IDTA 2EIMB 2EIJB 3EH4B 2IDUA 1ILSA 3AG4B 4KO7A 3PAZA 4GY4A 4DP7X 1W6WA 2WO3B 2H47C 2ZWNA 2PPCA 3IN2A 4NAJA 1BQ5A 2UXTA 4BWWA 3NJLA 2IWFA 2W88A 4E9TA 2AZUA 3S3DB 3FU7A 2TSAA 3ABKB 4BDVA 3FU9A 3X1NA 1N68A 2VM4A 2GBAA 4KO6A 1MZYA 4WKXA 1YLBB 3TASA 4DP0X 1OV8A 5F7BA 1A4CA 1IBZA 3H4HA 1SFDA 4G7SB 3FSAA 1PF3A 1JZIA 1JXGA 1OCRB 1AANA 2WO2B 4E9WA 4G70B 4YSQA 3CZUB 3G5WA 1KCWA 1GS6X 1OCCB 2PPEA 2BZCA 6PCYA 1AS8A 3OMNB 4A2DA 1SDDA 3EH5B 4BXVA 3GYRA 3FQ2A 2PCYA 1L9TA 1ET7A 2QDVA 1M56B 2OCCB 2IWEA 1EZLA 3N2JA 4AKQA 1AQ8A 1FA4A 4KNSA 7PCYA 2MTAA 4EF3A 3FQ1A 1ID2A 3V9CA 4AX3A 3NJJA 5A7EA 3NJGA 3X1EA 4G72B 4CSPA 4YSUA 2N0MA 2QT6A 5I6LA 3NJNA 1JZFA 4Q8BA 1AG6A 2LLNA 2QPDB 4HCFA 2IDQA 1MDAA 4E9YA 3FPYA 1ASQA 1BXAA 1SHWA 1VLXA 2GSMB 2NRDA 1UATA 3ASOB 3FS9A 3OQRA 4WTQA 5D4HA 2BHFA 3IBOA 3S3CB 3OM3B 1NWPA 2HX9A 3FT0A 5FC9A 1CYWA 2DYSB 1JZJA 2A3TA 2I7OA 1M9WA 6PAZA 2BP0B 4E9VA 1V54B 1RKRA 4KO5A 1MG3C 4DP9X 4P5RA 4X4KA 1V55B 1MG2C 2PCFA 1A4AA 3T6ZA 1AG0A 3CG8A 2Y1AA 1SF3A 4E9QA 1NTDA 3KW8A 1OE1A 4JKNA 2CUAA 1W8EA 3DTUB 4W1TA 1GYCA 1XB3A 3WI9A 4HAKA 1NIEA 1CC3A 1RCYA 4YSOA 2I85A 3NJHA 3T9WA 2R7EB 2YAFA 1ADWA 1KCBA 4NB7A 4PCYA 2AANA 1L9QA 2IAAC 2UXVA 3CDZA 2CALA 1ET8A 4L0PB 1J9QA 5B1BB 3UAAA 1KDIA 3X2QB 1SHXA 2Q9OA 2EINB 4BK5C 3GDCA 3ZX1A 4AKPA 4E9RA 1WA0X 1W6LA 1GSKA 4ZK8A 2HRGA 5PAZA 2QDWA 2XV0A 4A66A 4YVNA 3AW5A 2YAPA 4HHWA 2B3IA 1M57B 4YSPA 4YSRA 4K9JA 5I6PA 1E67A 2PLTA 3BVDB 4UANA 4GP8B 5B1JA 3SBPA 3X1GA 1DZ0A 3ASNB 1I53A 2XXFA 1XB8A 3EHBB 1TEFA 1PAZA 2BWIA 1WA1X 1AZRA 2B08A 2IH8A 1E30A 1KDJA 3IEAA 1J9RA 2TSBA 1JXFA 3PAUA 3H4FA 4A67A 3QJUB 4HHGA 1NPJA 1SJMA 3CVDA 5I6KA 5B1AB 2OV0A 2PP7A 1IUZA 1PY0A 3ZDWA
chains in the Genus database with same CATH superfamily
3PQYD 4FTVB 3VMPA 2ZWLT 4AWJC 3B2VL 3I75A 2CDFA 5I2IB 1E6JL 2ZPKH 2EE2A 3P73A 1C08B 1JNJA 1BLIA 4P2QA 4XP5H 1UTDA 3NFSH 4WI5A 1OAZL 5DZLA 5JHLA 1A9EB 1YNTB 2YD0A 2I32A 3QORB 3RTQB 1U93B 4LBAA 1U4EA 3JVGC 3RZWA 1LP9F 4G8GA 1BA9A 3PREA 2R69H 3R8BB 3DVGA 1A4BA 2SEBA 3S0PA 5BVJB 2NNAA 1IT9L 5CIPA 1EGJH 3RVUC 1SLWA 3IPEA 1JHLH 4XMWA 2ZXGA 5T33L 4MVBC 3BXNA 5JUEH 2IXQB 3DYOA 4GQPH 3WIFA 4U1KB 3TONA 4OJAA 2AQRA 3U30C 4PBWD 4AEHL 1IGJA 2HFFB 3BGAA 1KSRA 1RZPA 2EXWD 1EERB 4HHAA 4YIQA 1KLFB 5IHUH 4DPAX 1EANA 4PRAB 4X8JA 4F5CA 1F00I 2V9RA 3O9WD 1DJYA 2AJVL 3BGFC 2P45B 2F54E 1PQZA 5TPWL 4EQ2A 4OZIF 4FQXB 3V6FA 1J0JA 3BZEA 1Q72L 1M7DA 4KNTA 5DZVA 4G80A 1NM9A 2J57A 4X9YA 5BZZA 1FFNB 3NIGB 3FFCA 1LE5A 4WO4B 2APTA 3SKOA 1G7IA 3E3QE 3MLSL 1HIMH 1GJWA 3VRJA 4PRHB 3D06A 4X7TB 1SMOA 5CINL 4UTAA 1RZKH 1HHIA 2XY1A 3L5XH 5E1QA 3VDBA 4XZ4A 2WLNA 4PV8A 1VF5C 1FLTX 3PAYA 4LEBA 1MAJA 4HFWA 1OZTG 5C0GB 2W95A 5DD1H 1OT4A 2R2EA 3HZYB 1DDHB 3SGDH 3HRPA 3ETSA 3TT1L 3UZQB 1EQWA 5D55A 2CLVA 3S34H 1XWVA 1B0IA 3L3GB 1A6ZB 2L04A 3QUML 2BMKB 1KG0A 2CGZA 5C07D 4DAGH 1GJUA 4LCIH 2IV9A 5DJAB 5EUOE 4D9QD 4JY6A 1U8MA 5J12C 3KWXA 1V3JA 1QYGL 5IJKC 4ZFGL 4NO0A 1FRGL 2X4TA 4A6YL 1N59B 3VTAA 1H9VA 1IAMA 4ECNA 5E03A 4JKWA 4F2ME 4ZT1A 2DLTA 1MNUL 1GL4B 2VXUL 3DROA 2FNWA 3DVFA 3MRHA 5CFHA 1JGVH 4WU5B 3DI2B 2C1PB 3KPTA 3GJEA 5ISZE 1RPUA 4A1RA 4BFIB 1ERNA 5L88H 1O0VA 3FUJA 2IAMC 5GSVA 2IAND 1LVEA 4KMQA 4OCXH 3SE8L 4AM0Q 4RA3A 3AUWB 3QIBA 4J7RA 3APFA 4OVUA 4PJXB 3M86A 3HG1B 4DTGL 3MV9E 4QXUH 4WTXA 2WLLA 4MCYA 2G9HA 1Y6MR 4WSJA 4Z7WF 2QADC 3QJQB 1YYLL 5CLYA 5D2LB 1Z0MA 2AFNA 3P4OB 1MIEH 1FPTL 2HN7B 3T0AA 2A1WL 3LS4H 2VDRL 5T5NF 4E68A 2NQDA 4LIQE 1VSCA 4NZFA 3UYPA 3QUYA 3DXAD 2HA1A 4JANB 2ZOOA 4LOUC 3QCUL 5EN3A 3O6LL 2LABA 2HT2C 5BVPH 2XTJD 1KCVH 1Z5LB 3EJTA 3D3VB 1PCSA 3KL0A 3LZNA 3MV7A 1NGPL 3BH9B 3BPNC 4FG0A 1WIUA 3CIQA 1SNRA 4XN7A 3MYZA 1TTBA 2ADGA 3GB7A 4XTRC 2VNCA 3KG5A 4MMYA 4Q97A 5D6CB 2FQEA 5FGRA 4KROD 3N44F 1DVFB 4M3JA 3FNKA 3ZY7A 3OJMB 4R3SB 2WP3T 3MODL 1OAXL 1UWGH 3N85L 4EUPG 5ID0B 2DEXX 5CGTA 3DRTA 3KGUA 3SDCB 1A6TB 1DBJL 1JN6A 4R0LB 4GLRH 4JZNA 4L37B 3S7GA 1BBDL 5BPPA 2DQUL 2H2PD 3OB8A 3QUZC 3HC2A 2ODIA 3PWVB 2NY7H 4XX1E 3J8F7 4UNTA 3ZKQD 3BT2H 4GO9A 1PZUB 2BSTA 3TH3T 5DYOB 3ARED 3SYQA 1VFBB 2X3CA 3L9EA 4PD4J 4CAGA 2I9TA 5D1XB 4XNAA 4JRYD 3GSNL 2WV3A 1IB5A 5CGBA 2YRZA 1J9CT 2ZXQA 4BK8A 2Y7OA 4JK0D 1QHOA 3DV4A 1W72A 2LLLA 4Y9GA 4K8RC 1Z9SA 3RGVC 3LH2H 4M4RA 4EZMA 2WQXA 2CKBB 3ARQA 4FHKA 3LZPA 4J3WA 4PBXA 1NWOA 4DP2X 3UDWA 1GIGH 4NPYB 1EHLH 4BELD 2CHXA 4K5NA 1DBBH 3QWQB 4FFYH 1KCRH 3RQ3A 3KPQB 4GXUM 4MBOA 3QZNA 5FO9B 5IBLD 1CXIA 3L7EB 3FQWB 3WDIA 3FQUB 1P7HL 4LLUB 1GPOL 3G6DH 2WUCL 2CQVA 2ESVD 2IOMA 1QR1B 3TBWA 1DBKH 3U30B 3BQUD 2ZYIA 5EA0L 3SOBL 1OSPH 4U0RC 4K3DL 5EU4A 1NC2A 3NYKA 3N6YA 1QSEA 2WKGA 4Z3EA 3BGFB 3T2NH 4RMTA 2EXWC 1UJ3C 4QTIL 3NFPB 1HQRB 4YJZL 3H9HB 2P1YA 2CU9A 1RULL 4A2EA 1OAUL 3WJLA 4FYTA 1XVSA 1AGBB 1U3HD 3Q44A 3RDTA 1U8PB 3PS6A 3ZDXB 3IE9A 1MWOA 2VLMD 2C4XA 2DI9A 3GM8A 5IJVA 5AWNL 3CPUA 3DOIA 4H8HA 4XRCA 3SJVB 1ZDQA 2FT7A 3I6LE 4FL4C 5IOKA 4QCIB 5I6NA 4YFLF 2GW5A 2HFEA 4DPBX 1CFTA 4LP5A 3ROLB 1VERA 2DLHA 1QFOA 3IJHB 1JWUA 5GGRB 2B0SH 2Y4SA 3HKZA 2A6IB 3BZ5A 4KJWD 4YE0A 2H1PH 1MFCH 4DFHA 1NZRA 4N1EA 4JGJA 3R7QA 4ZXBA 1S6NA 4Y1AB 1D2PA 1DQKA 3TBBA 2DOCA 4AYMC 5T1LB 3HPJA 4R90H 1TZHB 1SY6A 4Z8FL 1FVEB 1IBGL 4YHML 5TK4A 5F70A 5MEPA 2F54A 1O9VA 3JTTA 2K8QA 2YIHA 5AAPA 3L9BA 2R4SH 3OAUL 4WHTA 3M6DA 3PIQB 1V7MH 1U92A 4WUUB 4E2OA 2AJZA 2B4CH 2J1ZA 3EOBB 3BP6B 4X98A 1JV2A 2R56L 2JKLA 1FAKT 5CSZB 2E7LC 3QNYA 2J7LA 3BCDA 3RUGE 4HIHB 3ZUCA 2OTWB 1OGAD 2VDOB 4PJIE 2XBZA 4ETYA 5EU3B 4MA3B 1IGFH 4B9PA 1QSFA 3UTQB 2IAMB 1TLMA 3EYQD 4XO5A 5D1ZC 2APBA 3GTTA 4Z7VF 3C6LD 2IFGA 5T3XH 4YQXL 2KH2B 3BRFA 4MS8D 3F7LA 4BZ1H 3KLKA 1H0DB 1GZQA 4YSQA 4ILDA 4UQ3A 2CH8A 1DN0B 3AAZA 1FO0H 1WITA 2LAAA 4HPYH 1DQML 2CMRL 5KS9F 5EDSA 1M56B 1S5HB 3GT6A 5F21B 2QADB 2B5IC 2DQGH 3O3DB 1N0LB 3OG6B 3V4VA 3W1ZA 4F1SA 3SZKC 3E1ZA 1SHMA 1IGIL 1TJGL 1CGUA 2HJFA 4HZLA 3BN9C 3WNKA 1FFQA 2FD6L 4JHWH 1MVUA 2PTVA 2QT6A 5F9DC 3S5YA 3T3ME 4B60A 4N2LA 1QWHA 3BMVA 5FA3B 4MDRA 5HYJD 4F2MA 4K7PL 4I2XE 1DL7L 3S96A 1LL1A 1ORSA 5DRWB 1PG7H 3BPNB 4PGBB 1YPZF 3IDMA 3LHPH 5DUPH 2YD9A 5D5MF 5MENE 3F85A 3HS0A 4H1LG 4TLKA 2FDBP 5ISZA 3S3CB 1NWPA 5BZDB 4LCWB 1SN0A 5BO0D 2I7OA 1JZJA 1PYWB 2Z4QB 1M9WA 1NMBL 2Y3NA 2QJDA 3GSWB 3UBGA 3T6ZA 5CU5A 4CVXA 3NGBC 2E46A 1SF3A 1GYUA 4L4VB 1TIUA 4X6EB 4CN1A 1NOAA 5L4JA 3MUZ1 4XH2A 3MV9A 4KJQC 4M8RA 4XZUA 3VWKC 1LO3L 5ANMB 2PYEE 4U6YA 4WNSA 5CNHA 2BSBA 1CI3M 4ELME 3QUZB 2DRUA 3A67L 4PFEA 1QRND 3R0NA 4UOQA 2X70B 2DH2A 3RU8L 1GHFL 5JW5B 2DKMA 2CALA 4N28A 3CFEA 4G9FD 1E6JH 4HU8A 2VR8A 1CB4A 5C0JB 4LL9A 2W0KA 1OD9A 5DJ6A 4BRJA 2FK9A 4F57L 5HTSA 1A1MA 1OAZH 4GBXC 1SEQL 1I7TA 1Q4NX 3ETTA 4LLQB 3R19A 4F7CB 1UT1A 4DKFL 4M5TA 1RIHL 3RGVB 1LEKA 4ZS7L 5DJXB 2LU4A 3EGXA 1WT5A 2L7JA 2HG0A 2YPKB 1CU4L 2MFNA 5DRXA 5E9DE 5EEWA 3VM5A 4UUJA 1IT9H 2PWEA 4ODUA 1A1OA 4OJCA 5GRZA 5T33H 1U8QB 3WLWC 4J39A 2R0KL 3MRJB 3WY3A 3ATFA 2F61A 1DUYB 5E6ZA 2QSCL 4L3EB 5JPMA 4AEHH 3P9MA 3L3OA 3DHJA 4NRYB 3Q8BA 3VSVA 6CGTA 3APCA 1CF8L 1TNMA 3L3JA 3PY9A 3DC0A 3KR3L 5GIRB 4G83A 5HHMD 3U0WL 1LM8V 3TBYA 2AJVH 5F3HA 3U2IA 3L8QA 1G7LB 1PX3A 4QAWA 5TPWH 2DL2A 1Q72H 1XL6A 4P3DB 4U0RB 1JFQL 2VXQL 4L3AA 3ULVE 4XVOA 1AZUA 3O3UN 4KWUA 5D4IA 2P8PB 4ZUTA 3TZVD 2PTUA 1MJJB 1UJ3B 3MLSH 1CQYA 3P1VA 4FKHA 3X11B 2CKNA 4JL2A 5EZIL 5GZNA 2PNDA 5CINH 4PP1D 4GKZB 4ZFOL 3DUHA 3PU7A 3PJLA 4PLKD 1CICA 3CSFA 2ICES 4Z7OF 3X1BA 1NFDE 3VXUB 1AFVL 3RIAK 3U4KA 4LL4A 1JZ2A 5JQ6L 2D31B 5IHZB 4WI9A 2MOVA 4J8RB 4FL4B 3TT1H 1XZ0B 4XXWC 1YVLA 5DURB 4BUQA 4QUOA 3RJQB 1Z66A 4ESKA 3QUMH 3DURB 3TA3C 2A9BA 3DX9A 3QZWB 1UZ8A 2KS0A 3UX9B 4KOCA 5B8CA 2WXNA 3VFMA 4BSWA 4IKLA 1AHKA 1QYGH 2Z7YA 4KJWC 3VGAC 4BKSC 3FRPB 3IWUA 4ODXA 4ZFGH 2VLKB 1PW3A 3CHPA 3GSUB 5JOFA 3ZT6A 1FRGH 4A6YH 2KERA 4FZ8L 5T3ZE 1AO7E 4V1DE 3C5JA 3O11A 1MUJA 1G5AA 1MNUH 2QPFA 2VXUH 4IRZL 4AGNA 4EN2A 1J8HE 4W9EC 1ED3A 3TEWA 2BVTA 1SXZA 3POHA 4JFSA 5PCYA 4LHUA 3T3PF 1BWMA 4QJ5B 3X12A 1I9IL 3JWDL 1RZ7L 3KWWA 2JXMA 1VA9A 3QXTA 3SE8H 3GUTB 2XWXA 4RDQG 1CFBA 1YUHB 4DOHE 2OMNA 3VX1A 2OMUB 4DVBB 2VQTA 1FSKC 3E2HC 5IVXE 3DX6A 2E9GA 1OTTD 2UUDH 2HKHL 5D1ZB 5HI3C 4LLDA 4Q0XL 4A7QA 1ZLWH 3V5HA 3VGGA 3HTLX 1TF4A 1YYLH 4N2EA 2AJXL 4XP9H 4ZUVA 2CIIA 4ANWA 5A6MA 5C0FA 1FPTH 3BP5A 3BP7A 1SOXA 3MVSA 5DLML 5AVQB 4XCNB 1RJYB 5DUBB 4FQIH 5C8JB 2A1WH 1GOFA 5DC2A 2KT6A 1UM5L 1A4KB 1IAIL 2B5IB 2DQJL 1N5YL 4XCCL 3QCUH 5L8JB 4N8UA 3O6LH 2G0KA 4QIRA 5D6DC 4BFRA 5K9OB 5B22A 5LBSA 5CN1A 5HDBE 2QVFB 1DANT 2K8MA 4IRZA 2IQAA 1NM4A 1WWCA 4HAGA 5HJ3A 5H35B 2PW2A 3B5TA 1NFAA 1PNCA 2XU9A 1G5GA 5IW1B 4P23A 1XF2B 4JKMA 4AM0A 2E7HA 3WUWA 3MODH 2VQ4A 1OAXH 1ZT4A 3B8YA 3N85H 4GI9A 4ANVA 1T1XB 2R29H 3TVMD 5BRZB 4PG9A 5D1QC 1N5AB 2FTAA 2QKSA 1DBJH 1HSAB 4KKBD 3IJYB 4IRSD 2WINA 4PRPE 4F7KA 3K6DA 1I4FB 4NQUA 1BBDH 2KLSA 2FEEI 3VFSB 3ZIMA 5GSRA 4Q14A 3G04B 3LKNA 4Z1PA 2X0VA 3RWEA 4GG6F 1UWXK 5K9JL 2VQ1B 1QBLL 5IEHB 3BAEL 4E5XA 1G9NL 3IF1A 3VWKB 2FEJA 3L6FB 3NSDA 4NO3A 2QR0B 3FOLB 4XP6L 3ZDZF 3FT2B 1C5DB 1ZVYA 2Y69B 1TITA 3QAZC 5GGTL 1CI5A 4B0MM 3GSNH 5EEUA 1V3KA 1ZS8B 4IOFC 5J1AA 1B3IA 1WP6A 4U1MB 3F2LA 1CG9B 4WFED 3IS1X 5IFJB 1PZBA 4X5XA 1N6VA 1BDYA 1N6UA 1BYNA 1H6UA 4F3FA 1HILB 1BOYA 1F4AA 3KLSA 3K6OA 2QSQA 1WVZA 2NY6C 3CVCA 5JW4R 2ZKYA 2VN4A 4MDJB 1XGQB 3KZ8A 4GBXB 4MLIA 5E51A 4MJJA 4N5EC 4I2XA 4PTTA 4NDMB 2Y2TA 3KEHA 2UXGA 4AVJA 3UEQA 3EDDA 5KSBF 4KKAC 4PW4A 3OAYH 5MENA 4N8VB 4MQXD 3LZRA 5EOTA 3SE9H 5FYJD 4JFFD 5DCCA 4ELDA 1B0RB 5A16A 4YZFF 2XFXA 3IB4A 4X6FB 3GSRB 4QT5A 5I73C 3F64A 2QPSA 4JFZL 1GPOH 3FT9A 2WNWA 4PV1C 2WUCH 2KL6A 1NGXA 3B3BA 1VESA 4NPJA 3QXAB 4NLAA 3S8GB 2VUYA 1GXEA 1H5BA 4N0UB 4D0BA 5EA0H 3SOBH 4K3DH 4ELMA 4PWEA 3QPQC 4DERA 4Z78B 1JDAA 4KFMA 5HPOA 2QQKL 3MMEA 2Y36L 4QTIH 4ZOAA 4JFXB 2WXFA 3MRKB 1I7ZB 2X9WA 1T6WA 3Q01A 4K3JL 1QFWM 1RULH 5JO5B 1KGUA 3CFJB 1YY8B 5DJCB 4PJGB 3FONA 3MJ7B 3PV6A 3TCXA 4O2EB 2F1BA 3WIHL 3W82A 4ZW7A 1W0WA 1EO8L 3Q8AA 3V7AE 5AWNH 5AB2A 4G7RB 4KY1H 2WVTA 4IOSA 4IU3A 4PUBL 2YD6A 4PIRF 4RMSA 5J6SA 2YXVA 4M8VA 2BZDA 4UT9A 5EIIA 4M6OL 5AG8A 3FMGH 2EEFA 2QPEB 4L48A 4WEEA 5CEXB 3R18A 4AENA 4XXCC 2KI6A 3KPSA 1OQXA 1DVSA 1X5MA 4GRMA 5B3SB 5BMFL 3RZCD 3TF4A 1X5IA 1AKJB 1AR1C 1GS8A 2F7RA 3TL5A 3W5NA 1P6AB 3OWRA 2F53B 3TA3B 2CO7A 3E7JA 3EO1B 3WKNA 5C7ZA 1AI1L 1IBGH 4HBCL 3AZUA 3NRQA 4NN6C 4YHMH 3UTTD 2D2CC 2V7NB 1TJXA 1JYNA 1NANI 5J9PB 5D7KE 3VGAB 2IH9A 3OAUH 4P4KD 1OK8A 4A68A 3II3A 1EBPA 2R2CA 2WQWA 4KHXL 5BQ7B 3RPKA 3TF7C 4TOYL 3PNWA 1AC0A 4UQAA 4KQ0A 1J5IA 3FU3A 3TEXA 1R24B 3UPRB 2R56H 3JQOB 5AW4B 3M7FB 2VZTA 3N5AA 1X6NA 2EZ0C 3ISYA 2WCPA 4GG8B 4BUHA 3CDZB 5KSAD 1C1EL 5EO0B 5LCVL 1SJEA 3B43A 1AACA 3EJSA 3GMMA 3A5VA 2ZXCA 3ZE0F 1X5HA 1IC4L 3K4DA 1NFDA 3F7VA 2CG9X 4YQXH 3HMWL 5BOPA 5JIHA 4AXWB 1E40A 2VN3A 1A4JB 3WO4C 1FSKB 4UQIM 3E2HB 4JFOA 4YDJA 3KPOB 1DQMH 2CMRH 3QIWD 1AGDB 1SLUA 1Z1WA 3H53A 1P0SE 1G7QB 1I9JL 1L0XA 4K3GA 2R0ZL 5GRYA 2Z92B 1OTTC 3ECBB 1AQMA 1CDUA 2EIJB 1I7RA 4NKOB 5D71L 4J3SA 3QFJD 1ILSA 4J3OG 4ALAC 2HMID 3HC0A 1TJGH 4UT6L 2PCXA 3VXNA 5CGYD 1FJ1B 2BNQB 3IN2A 3LVEA 2FD6H 2W88A 3B6SA 4Y4KA 4FKEA 4V1DA 3QORD 4OGQC 1XSOA 1UEYA 1T4KB 5IM7B 4UMSA 3TFKC 4K7PH 4LKXB 3FTSA 1F02I 1DL7H 1PPIA 2W60A 2GBAA 2WGXA 2BVQB 1J8HA 5A40E 3FSAA 2H2SD 3DGCR 4Y19E 1I1AD 2K6ZA 3O2DA 1NMBH 2GTZA 3G5WA 4L23A 5HDRA 3EBAA 1JPGB 1T6VN 2GEEA 2ZYSA 5IVXA 2COQA 5FYKL 3GYRA 1XAUA 2LQRA 2PCYA 4N26A 5D1QB 4FADA 2FJGB 2ZF9A 1LO3H 3HB3D 1YJDL 2B9BA 1G43A 3IFOA 3O3AB 4FXTA 1K6QL 3A67H 3AQDA 3ES6A 4P46D 4KKBC 2W94A 4R8WL 3RU8H 1GHFH 4OZGE 4TN9A 1NCNA 4N5UA 3SEPA 4MD0A 5C97A 1JWSB 1AGEA 1IKNC 3L3IB 4OLYL 1FBIH 3QRLA 1I75A 1AG6A 3QAZB 4Q8BA 3WL9B 2NTFA 4MJIE 4CSTA 4DO4A 5IREA 1RVFL 1UOKA 1MDAA 4F57H 4ZZFA 2CHDA 4PJ9C 3D87B 4W4OC 5DLLA 3O6FA 2IGFL 4BQ9A 1KIQA 2VCOA 4DKFH 3S8WA 2XNAB 5K9QI 4ZS7H 4OFYD 2NY6B 4JM2D 1CU4H 1CK0L 1VZIA 4APQD 2QKIC 5C0AE 4U3SA 1AG0A 4GH7B 4R7XA 3GMQA 2R1YA 3EJZC 4X4XA 2R0KH 1KXVA 4MNGE 5B38A 3A4AA 4AQAB 2QSCH 3MJ9A 3GO1L 2PKDA 2BP3A 2ZNWA 1JNHA 4V2BA 4PRPA 3T9WA 3RI5K 4C4UA 1L6ZA 2PCFB 5EO1A 1CF8H 1ADWA 4N9GB 1KCBA 3KR3H 1UVQA 5C2UB 1E2VA 2N56A 5FFOA 4PV9B 1O6TA 3MLYL 3RNQB 3U0WH 1MCBA 4POZD 1CO1A 3O41B 1ZANL 2BOBA 1JFQH 2VXQH 1JZ8A 4OCYH 2BOCA 3ZUNC 5DHEA 5D4QA 2CBOA 5I9QC 2HT4C 1M7XA 1LO2L 2AITA 1JV5B 5EU7E 4KX7A 4XAWL 5I6PA 4NQQA 3LKSB 3L3HA 2ZG1A 3BVDB 2FO1A 1E4HA 3OGCB 3F83A 3IETA 4Z7VB 3LB6D 3NACL 3VH8A 1BOGB 1IQDA 2Y7QA 4S1DC 4AZ8A 4AYDC 3NIDE 3SCMA 3BVTA 1AFVH 3HOGA 4XBMA 2PTTB 5GS1C 4YXLL 1VKXB 1HT6A 3DWTA 5KS9B 5I6KA 4WENB 3UGXA 3BLBA 3B9KD 4GIPD 3FO0L 3OXSB 3ZDWA 4XO8A 2YS4A 4QXTB 2VC2L 1IGML 2BSRA 3EZ8A 2X6UA 5ITFB 4A38A 1D9KC 1QPKA 2ZF8A 5KBNC 1Q1JL 4HP5A 5IKCA 3GSVA 3MO1B 1AMXA 4EZKA 3CH1A 1AR1B 2CO6B 5T3XE 1AAJA 5GZOA 3C5ZB 2FT6A 4B27A 1CS6A 3FFDB 2H32A 5G55A 2NY1D 3BSZH 2ZQKA 2GFBA 3FRUB 1MIML 2VDQL 3RBSA 3D69B 3G6JF 3SHSA 4FZ8H 3TN0C 1TEGA 3DVNB 4NN6B 3SDXE 1RUML 4XAKD 1XXDC 1ZT1B 3ZK0A 1CUOA 1D2OA 3Q5TA 3MRLB 1W9XA 4OGAD 1TNNA 4IRJC 3AGWA 4AGOA 1KFAL 3B7TA 5F8RC 4Q58C 3RJDA 2HVKB 5JORA 1JF5A 5FKPA 4EIGB 3GI9L 1I9IH 3JWDH 1RZ7H 3IFPB 3L1GA 5C0DB 4HKZB 3M17A 1PY9A 2DJ4A 5DJ0A 3O8XA 3KYNB 4Z18A 1FZOB 2HKHH 2WB1A 4Q0XH 1P4LB 5GJSL 2JJUA 4NHCL 3CFCL 2FECI 2UWEF 4CRPA 2H7WA 4TNVK 4KJPD 5DLMH 3MROA 4R4BB 4TUOA 4RISL 3WTVA 5EBWB 4U3HA 3W0WE 4P9HL 5F7KC 1X5LA 1UM5H 2DQJH 1IAIH 1LXMA 1N5YH 1WK0A 4XCCH 1I8IB 1I3UA 4EI5C 3GI8L 2FBOJ 2DYPA 3KVPA 4LAJH 1GTNA 5GRUL 3SDAD 2B15A 2XZZA 3MNZB 4MSWB 5JZ7C 1NKOA 1OCOB 4NQDD 2W0LA 3HE6A 4LOVA 4F8PA 3CXHK 3ILPB 3MRNB 2ZCHL 2EXSA 2QQQA 4P2RB 5EC1B 3CZEA 2XWTA 2DN7A 3SO3C 4X80L 3V0GA 3VGBA 4NOBA 3ZQ9A 3SSGA 5KG9B 3LNEA 4QRPB 1YQ2A 4K9EC 4AW7A 1BFOA 2CNZA 3TBTB 2YPVA 3QQ4B 5E8DL 3CFDA 1F3DJ 2W59A 4HSAC 4JAMB 2L8AA 4GMTL 4H5SA 1NDMB 1KUMA 1S7TB 3UROR 1SOKA 4FA7B 1IILE 2EVFA 5E2TL 4ZMAT 3ZO0A 3QDME 1NCAH 5EU5B 5K9JH 1QBLH 1JPTL 3LRSA 3TPUB 2GHWB 3BAEH 3DIFB 1G9NH 2PWHA 4K0OA 4AVHA 4QHLB 3QUXA 3RIKA 4E41D 4UDTA 1OAJA 2WLJA 4P2YA 4B50A 4XP6H 5GGTH 2W38A 2YAOA 3N9GL 1WA2X 4I0PD 1RJCA 4ETQA 5IROD 1T2XA 4JFDE 5CUSL 5I17B 1L6PA 4Y2DA 1KXTB 5EDXA 1A6WL 3LNIA 4KI5F 4N4YB 1JRHI 5K33A 4YL4A 3AVEA 4X6DE 4KH9A 4QYOA 4S10A 2X4QB 3MLUL 4PJ9B 4RDQF 1HXKA 4OTXL 3QG7L 5DVMA 1LO5A 2IVFC 3HPLB 4B5EA 5CP7A 3NK3A 3EJCA 1M7IB 4WFHE 4Y19A 3HZ3A 5CHNB 3AITA 2C34A 2QKIB 4K5MA 3S3BB 4MKMA 4Z76A 1IEAB 2ZAGA 4L05A 3PGCA 1M2VA 1AQKL 4WFGE 4JFZH 2P5WE 4BM7A 4LCYA 4OLVL 3MSPA 4ES8A 4ONFL 4GJTB 2VIRA 4APQC 3H56A 4W70A 2EO9A 2X4SB 5FYLE 3S4SA 3WEMA 2WBJA 1MKFA 1IM3D 1CQKA 3VRLE 4ADIA 4PJBF 5C86A 3ZR5A 4IKJA 4MS6A 1I1YB 1FNEB 2BH0A 1SXCA 3U6XA 5LGKA 3DO3A 4YDLB 3FB7A 3QQXA 4NUQA 3AWGA 5FDWA 2QQKH 1JUFB 2Y36H 4OZGA 1ZHBB 4XCYB 3VXOA 2X42A 2ADIA 3VRIB 4X5RA 4X8GA 3T08A 3RHWF 5IBUG 4K3JH 4XBGA 2XN9A 1F1DA 3D07A 4J4PA 2UYLA 2X7LA 3D39D 1SMAA 3ETBJ 4JX0A 4XX1G 4WWID 5I9QB 4ZFZB 2WKOF 1KGXA 4RGNE 1RPQA 1I1FA 4WSKA 4BZ2L 3NG5A 3WIHH 3OF6A 4O02L 3AB0C 1EO8H 1L0PA 5KOMC 5CP3A 1Y0LA 4NQCE 4JHBA 4PUBH 4GKNA 4HF5L 4M29A 4B9ZA 1V8HA 2L3BA 1DSWA 3OTTA 3QJFB 3NZHL 4QHKJ 4WI0B 2APSA 2ZSWA 1AGCB 4ABQA 5EWIL 4M6OH 3TBSA 4M9OA 2GBVA 5GS1B 2VUOA 1OAKL 4MNGA 5JOPE 4MMXC 2FWOB 3R0MA 4OZHE 2VLLB 1S7RB 1CFNA 3KPRB 4Z0XB 4DJMA 1SMDA 2DQHL 3CDFA 3KPPB 2K7QA 3OZ9H 5I15H 3GXUB 3BHBB 5IESL 1D9KB 3ULUC 3VSTA 4IBQA 1AI1H 3ZE2E 4HBCH 3MRCB 5C9JB 4AZUA 2J55A 5I6XC 2DQTL 1D5XA 1XAKA 4KHXH 3KYOB 4TOYH 4DKAA 2XACC 3TN0B 2GJZB 3DOHA 1E9PB 4J3VA 3IM1A 5JIQA 1S9WA 3BUYA 3K72B 5BZWB 2NY1C 3PGDA 3MQIA 1BQHA 4IRJB 4Y4HC 3MRDB 1ZSDA 1FG2A 1C1EH 3ILQC 1BAWA 2WY3B 3KCPB 5LCVH 3ZE1F 3T71A 1KTDB 3UC0L 5FA4A 1IC4H 1DJHA 1HNGA 2D3VA 2FZ3B 1DQJB 4P5SA 4K15A 5I0ZA 3V0VA 1E4KA 2VN6A 3HMWH 2BIOA 3BFWA 4BSVB 1CE6A 4RETB 2WZ0A 4YN3A 1IGCH 2GITB 4ISVB 4K4KA 3VD7A 1RIUL 3IS0X 3ZDZB 1TQBC 5C0BB 1T83A 3QUKA 2A0LD 1RZGA 1I9JH 3UJIL 1F2XK 1S2EA 3F58L 4OLXL 4ZQKB 3UTZA 1S9KC 4GFXA 1QUNB 4PIBA 1WBYB 3P3SA 5D71H 3A4FA 3ZTCC 4CVWA 4KH2A 4UT6H 3AS1A 2ZUUA 1S3RA 4HS6A 4ZUSA 4OAWA 1D7BA 2I07A 3JT0A 1HK6A 4EI5B 3SDXA 5I8CA 5KSBB 1ZHLA 1H8OA 2EXYC 4F1ZA 3DNKA 4NRZA 4NCC1 4N2GA 2O5ZL 4YMPA 2BY0A 4WDIB 3FB8B 2CO2A 1AIZA 1D7CA 1YZZA 3SO3B 1J1OL 2ADJB 4IMKA 1AE6L 1UXWB 1UFUA 5JW4M 3JTBA 1Z9NA 4L3ED 4KMTL 4LVNC 3QDAA 5IB4B 5FYKH 3WTTA 2RJMA 4OJDH 3U46A 1CTMA 4DP8X 2FIRT 3ZJAA 5DS8B 2PO6C 4Y9CA 5DJYB 1YJDH 5KJ7E 3PL6A 2APWA 4WEBL 1FV1B 1IFHL 5IV2A 3U1PA 2EKSA 2Y7SA 3BW9B 1K6QH 1ITBB 3RRQA 1BZDA 3CV5A 3NTCL 4X0KB 4IIQC 4R8WH 2F7QA 1IQWL 3NN8A 4BWWA 5EBLB 5CEYA 3DBXA 3W0WA 5IQ9B 3F7PC 4CU8A 1JK9B 4OLYH 4ZPTA 5CJXA 1VZGA 1XGYL 1XSIA 1RVFH 2AI0L 3RKDC 4HUMB 4XOEA 3TNMB 3EDEA 4S1RL 1FL3A 5F7BA 4E5XG 5E94A 3QXUA 2IGFH 4D8PA 2DM4A 3P30L 2Z6FA 2EAEA 1UADC 1C5CL 3HUJE 2E47A 3CVHL 4S1QL 1ONQB 4NO5B 1A3RL 1BD2D 5AUMA 5DWUL 4WVRA 1CK0H 1H8NA 2DWEB 3F04A 1GS6X 4HXAL 2BZCA 4KXBA 1AS8A 4A2DA 1W0YT 2JKSA 5DURD 1EFXA 1KGCE 4NFDA 4XMLL 3GO1H 1MCNA 3DV6A 4ZFQA 3FQ1A 3V9CA 1MFAL 4AX3A 3TM6A 1N10A 1YMMA 1K5WA 2R9HC 4J3OF 4UBDC 5KZCD 3MLYH 3PDOA 2YGNA 4PCSA 4CSPA 4LLWB 3MRGA 2VDKB 4UTBL 2VLKD 4P5TA 1AD0B 2DMGA 4QRQA 2VL5A 1ZANH 2Z93A 2NNCA 3BKCL 3I02A 4NN7B 4B9CA 5ICXB 2A73B 3MRFA 1LO2H 1QKZL 3FS9A 5ECGA 5I0XA 4ZTOH 1WWBX 4NAQA 5CZXC 4JFDA 1MLBB 1QLRA 3FT0A 1U3YA 3GMOA 4IW4C 2HTLD 2Y24A 2A3TA 3GMNA 4XAWH 1EXUB 3MRBA 2EYTB 4JPQA 1ZGLB 1XIWC 2ODHA 4XPAH 5I1DB 3N1FC 1A4AA 2W80C 4QRTB 4X6DA 4Z7IA 3NACH 1Y1DA 4L8SA 1LO0L 1C7TA 5EU6B 2HFGL 1X7SA 4OF6A 3AABA 3AB0B 4HJ1A 4YXLH 3AT8A 3MNVB 5KYUB 1ZXKA 5F88B 3MRIA 1HVXA 1Q9OA 2ZXDA 2K6YA 5KWYC 3FO0H 2ZICA 3BAWA 2VC2H 1IGMH 2P5WA 4HZAA 3FN9A 2NY4D 3VD5A 3CUPB 1Q1JH 2G60L 4HOZA 1AD9B 1XGPA 1L9NA 1KULA 5C08D 2Q3ZA 1WBZB 1W6LA 2ZWKA 5D7LE 2ZYRA 4WKZA 4ATWA 2X4UA 5EIIG 4XNMA 3V4PB 1MIMH 4FQLL 1DJGA 3ZT5A 1U3ZA 3JV4A 1RUMH 1CPUA 4Y4FC 4H0HB 1FYTD 1JAEA 1S9VA 2RFXB 1F4XL 2D7TL 4IGBA 1YN7B 2EDOA 3VMNA 3OX8B 2OM5A 5I6XB 5IBTH 1EZVX 1KFAH 4H8VA 2G2RA 1HL5A 2ZUXA 1KJVA 1WA1X 3ARBA 3VYNA 3GI9H 1KIUA 4Y4HB 3K81A 3GINA 2Q8BL 4NQCA 1I8KB 4RA0C 1AGFB 1U93A 4R7NA 2FJFA 2TRYA 3QEUB 1GGCL 1PLAA 2P24B 5GJSH 4NHCH 3VD0A 4LAQH 5BVJA 2V4LA 3CFCH 2FT8A 1BFVH 1JTTA 4OZHA 1PIGA 2HVJB 1MLCB 1TQBB 4RISH 3GBDA 2ZD0A 2W81C 2OTUA 1GA2A 4P9HH 1RIVL 1B4LA 2X1QA 3GMRA 3V0IA 1D5MA 2AMUA 3DHPA 3GI8H 5DA0B 4LNRA 1IZJA 3TO4D 1HYSD 1KTLB 5GRUH 3H3PL 4Z3TA 2QZQA 1O5DT 5J57B 3WMQA 2F19L 4I7ZC 4BUGA 4OIAA 2CBPA 2J1WA 4JRXD 4MJ6B 4EN3B 3ZKNC 2ZCHH 3OHXB 4NQEA 5DTFB 2A6KB 4PRBB 1P6FA 4GMSL 5AVYB 3TEZA 4G42A 35C8L 1ILUA 4OQTL 5ESQA 4GKOA 4X80H 1USZA 3LRGA 1JOIA 4MZRA 1QQDB 2Z9TA 3ARDC 2IWKA 1G6RA 4QMEA 4PJ5E 4XN9A 1K9TA 3GRBA 3FTVA 3QXVA 2BP5M 1XSKA 4GMTH 2HUEA 2X41A 3SDDD 5LBGA 2JJSC 4WWNA 3Q2WA 3Q43A 5FGCB 3IMRA 2NX5E 1BECA 1NBYA 1TTAA 4G9DB 3KLHC 5H2BB 5E2TH 4LVNB 2C1OB 2Y22A 2AKRA 1EWHA 4U2YA 5IHWA 3ARFC 3W39B 2ZOKA 1JPTH 1NAMA 4MXVE 4U1IB 1NFIA 2PO6B 2C3HA 2FX9H 2XETA 3ZZSA 2R29A 2ZUWA 3ZO9A 3N9GH 3P4MA 5D7JC 1YEEH 3LN5B 3MV8D 4H1LB 4IIQB 3VXRB 2JK5B 3RVVD 4U1HB 5CUSH 2A6DB 4ZX3A 3Q2NA 3FL7A 3VGEA 1A6WH 3O4LE 2Z1PA 3QSKB 4S0TD 3MLUH 2FH8A 3P9WB 3QJSB 3LS5L 3CLEL 3EJYC 3NSCA 4JR9L 3MZTA 4LSQL 5TJWK 3VNZA 3TEUA 4OTXH 4AT6B 3QG7H 4MJ4A 3VFWA 4I0KA 2EICA 3WSQL 4H8UA 4L1TA 3DO4A 5SWZB 1XMEB 3TJHC 1IC0A 2DQEL 3RVWD 1AQKH 4BFIA 1YO4A 4WWPA 4OLVH 3VFVB 3L17A 5CILL 2JKWA 2OMBA 3CQFA 2XWBB 3BFQG 4HS3B 3W9DA 4Q9RH 4RSVA 3BKMH 4GUCA 4U1GC 2EACA 3IXTA 4PJXA 4HV8B 3U7AA 4EJ1C 2EDJA 4PJAE 5C0CB 3RWHB 3ZDYF 3FU8A 2BCKA 5B38G 2P48B 5F93C 3GXDA 5EPMB 5FYJU 4HJ0C 1MCDA 2Y23A 3VWJD 4K3EH 1AIFB 2OZ4A 3IDIB 3IFLL 1U8JA 2K4AA 3BVNA 2B2XL 2WXJA 1B2YA 4P4RB 3QEQB 4H26B 4I9WE 1J86A 1F2QA 4Y8DC 4BZ2H 5KBKA 1OGTB 3FSWA 3TV3L 4O02H 1RH8A 5AW0B 3HUJA 2DM3A 1FDLL 1P1ZA 5HHOE 2OULB 5ALBL 2WBXA 1Z5LA 5TE7L 3ZGIA 1IX2A 4HF5H 1DFXA 2GJPA 2AXJA 2CHNA 2HTLC 3NZHH 3Q5YA 2CKBL 5IQOA 3QJRB 5EWIH 5KSVB 1W8NA 4URTB 4H88H 1RK7A 1NCWL 2HJLB 3RBGA 5I18L 1AS7A 4M8UA 1QLFA 4MNQB 1NGWB 4DP6X 4L5FE 5I71C 4N6QA 4QRRB 2X4OB 5IESH 3H7BB 1T5XB 2W9DL 5IG7B 5EEXA 1NGZB 4U33A 3NH7L 1L9PA 1R19A 1RSYA 5JXED 3ZZ1A 1ASOA 4LEEA 2XBTA 1HOEA 3WHE0 3WTYA 2V5TA 5HPMA 3NABL 1A6PA 2DQTH 2GJ6B 4ZSOB 2NT1A 3ZRFC 5DYOA 4GSRA 2DIJA 5D1XA 5DMJB 3RURA 4HJUA 4DGVL 4TUKL 3B8SA 3F00A 4XB3A 1BQLL 4Y4FB 2EIDA 3D33A 4JDZB 3VQLA 4TVPL 5E8EA 3BSGA 3QNXB 4AY0A 3CC1A 4KITB 2QEJA 4G43B 3FBKA 1ODUA 4QGYA 4NXSA 3SBQA 3UC0H 1T22A 5IOPB 1U4FA 2VLJD 4NENB 1K2DB 1OF2A 4LFHD 1FNGB 2BP8B 4R5XA 2GSGB 3D4ZA 2ZOWA 2V5RA 5IF0A 5I1KL 4DP5X 4OW6A 5CSGA 1N64H 4OBRA 4OJYA 3CU7A 4NQVB 2CO1A 4ORZC 3RA7L 1RIUH 3V0EA 1KBBA 4JHAL 2N59A 2VDNB 5DZAA 5HGDA 4OZ4B 1MCIA 2CAKA 3U25A 4YK4C 3UJIH 5HGHB 2C3VA 3F58H 2IBZY 5LQBL 1NCIA 3W11D 5D7LA 3VX0A 4Y5VA 4B9FA 3EGDB 7PAZA 1QR1A 2EECA 1TT6A 3BPCA 4N2FA 1ORQB 3ZBMA 2V8MA 4CNIB 4NS0A 1KFGA 1G4MA 3RVXD 3A22A 1FVCB 3L3DB 3GFUA 3P4NA 4YLCA 2X1PA 3WEXA 3OV6A 5CD3B 3OZLA 5CLXA 5E6SB 1PLBA 4QKXB 3ORJA 2O5ZH 3QDJD 2NY3C 3UMTA 3PCYA 2NZ9D 2Q2EB 5C07E 1B0GA 5IWLA 5AVWB 4JQXA 4D9QE 3AXLA 4H4NA 5LG6A 1J1OH 2MOQA 1AE6H 3SPVA 1PG7X 1HEHC 2EYRA 2D2OA 3ARDB 1E65A 1DQIA 3LXBA 1O7VA 4HZ1A 4X6BA 4DK6A 1AQHA 1HDMB 4PJBB 2DM2A 4FMVA 2VDOL 2C7UA 1N26A 3QWRD 2R2HB 1N4XL 4GSQA 1JD9A 2YEQA 2B8OT 4IJ3B 4WEUD 1TZGL 4WEBH 3VFTB 4BE5A 3CQPA 1E9OA 2WZ5A 4NQTA 4PRNA 4U3XA 4AQEB 5K9QG 3NTCH 3QUYC 4N6RA 2EDTA 5GGRA 4AH2B 1IQWH 1UA7A 4D7BA 5F7UA 3Q8EA 1J10A 2ZOUA 5T1KA 1UXSB 1QI5A 2IANE 2BHUA 1XGYH 3HZKB 3LKPA 1KB5B 2AI0H 5D7JB 3ZKXB 1PLCA 3G5VB 3CBRA 3ZYJA 2ZXWB 4S1RH 1IFRA 3IKCB 5L2JB 4U4IA 3P30H 4POYA 4U4BA 3D18B 1C5CH 3CVHH 4S1QH 2XQYK 1Q90A 1A3RH 2Z91A 4S2SA 4Z3FA 5DWUH 1U33A 3C5XA 3FFOA 4M3KB 5D7IE 1V3LA 4P99A 4HXAH 4RNRA 3LKRB 1VGEL 4LSDA 4KGJA 5F7LB 1KPUB 1UB5B 4Y9EA 2DWTA 4Q6KA 4HULB 1KIRA 1QFUL 1H3TA 2WLIA 2YA2A 4KZCA 5K59F 5L2KB 3DVIA 3DXAE 2EIMB 4ELKA 1J5OL 1IRAY 2QMKA 1MFAH 2NX5A 2OMVA 2AK4B 3CWGA 5ESVA 2XTJE 4HKXA 2DDQL 1CN4A 3H9YA 4MX7B 2NSXA 2B16A 2FL5B 4UU9B 5JIIA 3VXMB 4UTBH 2CHWA 4NNXB 4AVKA 2AZUA 4U1GB 4D9RD 3GXNA 1CE1H 2V6HA 4FLHA 3BKCH 1J0HA 1BW8A 1RZJH 4BDVA 3I75B 1BFSA 2CDFB 3VSQA 3X1NA 1I3RA 2RQEA 2VRQA 4PJ8D 5KUKA 3CJJA 4WHYG 3P73B 1QKZH 1X9LA 1E7VA 1YNLL 4NZTL 3RY4A 3S4SG 5FPIA 4GQQA 4P2QB 3PE9A 4TQEL 5CO1A 4YGAB 2AAVA 3ZE1B 4TSBL 3UYRL 1JL8A 1VEPA 1QATA 5JW3L 3UDWC 2HG5A 3O4LA 4DETA 3MTXA 1KB3A 2XPYA 4BQ8A 4G8GB 2H0FA 4ZS6C 4P5MA 1SN5A 2ZUYA 3DVGB 3FQ2A 1LO0H 2HFGH 4BH7A 2ZG2A 5FA3A 2SEBB 2FYYA 2NNAB 3BH4A 5JHDD 3UOAB 5CIPB 5I1LA 2X53A 4Y1SA 3BXNB 2I60L 4JRYE 3NJJA 4OUUA 5A2CA 4JM0A 3WIFB 2AAAA 4M9PA 4DK5A 1FFPA 4MRBA 4E9LA 4ORGA 5F9OL 1IGJB 2NY5C 5H94A 2Z4QA 5G2NA 2G60H 4LVHC 5I6LA 4HHAB 4YIQB 5ACZA 4X0NA 4HCFA 1O9WA 4X8JB 4PJHA 3Q9PA 1X7QA 5EFIB 4E9YA 4YDKL 1SVBA 5DFVC 5DHMC 1VEOA 3BAIA 1PQZB 4FQ1L 4HS8H 3HI6L 4B41A 3V6FB 3BZEB 2BHFA 1IIIA 4FQLH 1BBJA 4HK0A 5AOIA 5EOQL 5I0YA 4G80B 1TZAA 6PAZA 1YN6A 3L4CA 3NCBB 5HHVL 1F4XH 2D7TH 3WJLC 5KAQG 1LE5B 3SKOB 1G7IB 1U58B 2WVSA 4X7SL 3WTUA 1TZIA 2PXYA 1FHNA 2AW2A 1U9KA 3KXFD 4XPTL 4DFIA 5JXEC 4QRPD 3NESA 1HHIB 3WAKA 2ESVE 3WI9A 1NIEA 3OXRA 4RBPH 4PV8B 1W0VA 1OO2A 2Q8BH 1URLA 4HFWB 5HHOA 4WUKL 3MNWA 4LLQA 5F9AC 4JJOA 2R2EB 1JPFA 5BOJA 1S7WA 4MMZC 1GGCH 3GJFK 4HUNB 2YPKA 3PQYA 4ZXBC 3EBHA 2CLVB 5HBBA 2OTPA 3GDCA 2VMEA 2I69A 1KG0B 1Z5HA 3E9UA 3L08A 3B37A 2A9NL 2XV0A 4JO1L 1QBAA 4JY6B 4YVNA 1U8MB 1YEHL 1RIVH 5A6IA 4MXQC 4CJ1A 5INDA 2EIEA 2VLME 4YHPA 5SV3A 4NFCA 4NO0B 3C12A 1C5BL 1GH7A 4N2MA 1DLFL 2F19H 1INDH 1PAZA 3E3QC 1IL1A 1G1CA 4M8QA 3HG2A 3SE4C 3MRHB 4RAUA 3DROB 2XVLA 4YBHA 4GMSH 3S35L 5J7CC 1A6UL 35C8H 4OQTH 2ALAA 2K4WA 2HFTA 1MJUL 4Q74A 1F41A 2NY3B 5GSVB 3NJXA 4XXDA 3FO9B 2CCVA 4F91B 5D2NE 3BUBA 4GP5B 3OPZL 2FNBA 3QIBB 3K80A 3O9WA 1AH1A 3FUDA 3C09C 2BVPA 3L1FA 4W68A 3T2OA 3EFDL 2WNKA 4TLTA 1NH6A 5CKGA 1OAQH 5IJDC 1UKSA 2WLLB 4MCYB 2G9HB 3IRPX 3VXUA 5I16A 4LO9A 4LRNL 2UX7A 5IW3A 5EH1A 1T89C 1R3HA 5IQLA 4DQOL 1RK1A 2P28B 4DEUA 2EADA 5DZ9A 2Y9RT 4EAEA 1WF5A 1ZTMA 3BVVA 5AYTA 3QUYB 3TLRA 3UYPB 1OGAE 3U82B 1H3GA 3CZSA 2GPZA 3Q06A 2ZAHA 2BW5A 1SEBA 5HD8D 4YBQC 3T4AA 4F33A 4AIOA 1UD4A 3FRPA 3L4YA 3HS0C 4EOWL 3LS5H 3B9EA 3CLEH 5DI8B 2ADGB 4JR9H 2BINA 3GB7B 4LSQH 5JIPA 4HUWA 4MMYB 4AV0A 5FEBA 1JHTA 1I8AA 3FAWA 2YXMA 3K8LA 2AQ1A 3TIEB 4PVLA 3WSQH 1MCPH 1TQSA 1R4XA 2NDFA 3OZKA 1TCMA 4ZAKD 2DQEH 3DRTB 4KKNA 3FTUA 1JN6B 2VXTL 4JZNB 4YHKL 5CILH 4LF3A 4NUPA 1D7FA 1U36A 1DHKA 1NFDF 3SKMA 2X6AA 3HJEA 4NUGL 1NGYA 3GTNA 4JPIA 3WJMA 2BSTB 5HYJE 3QHZL 2X9XA 1KGJA 3KEDA 2EDBA 2I9TB 1YEFL 1JYWA 1HHGA 1OTUD 2LT9A 3LPWA 4R4NC 3IFLH 3HBZA 2QVIA 3NJKA 2IQ9H 4GP4B 3DV4B 1W72B 2FH6A 3UGUA 2B2XH 3L5IA 4ZYKA 1E2ZA 2XPGB 1Z9SB 3GXFA 3VG0L 5F96L 4M4RB 1WT5C 4GRWE 3TV3H 4G1EB 4ANUA 2FWSA 4WIQA 5DR5L 1CBVL 4PJ8C 4A7UA 1FDLH 4DWHA 1CLOL 5ALBH 5TE7H 2XQ0A 5D7IA 3SGEI 2DYRB 4L4TD 3HJ0A 4UM8A 1QRNE 2J20A 5CF3A 4TNFA 2CKBH 3TO2A 4HOMA 1GW0A 2ED9A 1ZJAA 5JPMC 2EDKA 3L3OC 4G9FE 5B21A 1TQWA 1ZHNB 1WUNT 3LYRA 8PAZA 1NCWH 4QHUA 2YGOA 3DXAA 5HJGA 1HAWA 3ZMEA 3ECVA 5I18H 5AW1B 4ODHL 1E5BA 3A23A 4OGYH 3T65A 4KKPA 1T1XA 3TBWB 3KYAA 2RB8A 5K9KA 4LVHB 3HNVL 2W9DH 2OL3A 1F18A 3AT0A 5EU4B 5DO2C 5HXMA 1NC2B 3NH7H 1QSEB 1JGUL 3QE5A 3W5MA 3HHSA 2QGCA 4K23L 3C8DA 3KBPA 2VQ1A 3NABH 1D5IL 4XN1A 5AW8B 3WKPA 4JB9L 3H2PA 1ZK5A 4KV5F 4DGVH 2DS4A 1RMFL 4TUKH 1URIA 1BQLH 2H45A 5E2WH 3RL2A 2CPCA 4TVPH 4KUZL 2FE0A 1CICC 2WAQA 4N8CL 4JE0A 4M43L 3MCG1 5ERWA 4U1MA 2XWCA 5TH2A 3RDTB 2JCCA 2WANA 1U8LA 1JXKA 4HEPG 5IJVB 3ULSA 5HHME 4XRCB 4UQ9A 2VERN 1GCFA 3CX2A 4WW2C 2HFEB 3BISA 5I1KH 3TXAA 4F2EA 4LZKA 2VXSL 1JK8A 3U36A 2Y2WA 1JWUB 3RA7H 4B7IA 4JRYA 3KW7A 3FN3A 4JHAH 1ODAA 4MMZB 5GGQL 4JFUA 1HCFX 2J8UF 1I9EA 2A9AA 2ARJQ 3QUHA 4ZXBB 3C08H 5C6PB 5ETUA 1A64A 4X6FA 1KJMA 3GSRA 1DVYA 3O3BA 3OMZA 3EYSL 2YO3A 5LQBH 4HJJH 5MEPB 4MDIA 2F54B 3JTTB 3FYEB 4FNUA 1PG7W 2J4WL 4NWTL 1UWXH 1E7UA 3F5WA 3U9PL 3GSXA 5I6OA 1U92B 3KYKL 2AJZB 4Z78A 3LRLA 4X98B 1JV2B 4HWEL 4HIEA 2GC4C 1S4IA 4NFBA 2XX1A 1TVDA 4TL4A 1E4WL 1IGTA 3QNYB 2NXZC 3GBLA 3T0ED 1ZLDA 2VGLM 5CEZL 2ESVA 1KCUL 3AG2B 4RAVA 4K7PX 4YX2L 4TM9A 3NFNA 2OMYA 2NY0C 2WYHA 3BQUA 1CGVA 3MJ7A 5J13B 4TTGA 2VMDA 1A65A 1GZQB 2VDOH 4UQ3B 3C09B 2FLMA 2CUMA 4R26L 3ZDYB 3AAZB 3D30A 4GQ9L 3PP4L 2A83A 1TPXC 1TZGH 1BAFL 1QBML 3TS8A 1Q0YH 3APDA 3IT8D 4OF8A 3BESR 1N19A 4TNEA 3V4VB 3LPFA 2MJWA 5JLZA 5CEXA 1J05A 1KBWA 2AABH 1GC1C 4KK6C 1U3HA 1EAOA 4QGTA 3W56A 1J1PL 1T1WB 1R34A 2EE3A 2HJFB 2WVUA 4HZLB 1GY2A 2VW6A 3GS4A 5TGBA 1MVUB 3TA3A 2CJUL 2B39A 2MMXA 3WEOA 4P23C 4F2MB 4S1SL 3S96B 4LU5L 1ORSB 2QGEA 5IMKA 3G08A 4G6FD 3S5ZA 2BWDA 3HS0B 5ISZB 3LPGA 2DWXA 2WLMA 4HH8A 1VGEH 2LLGA 1QEXA 3FTXA 5TDNB 1ULVA 4NP9A 3IJSA 4RRPG 2NXYD 1G1OA 5D2NA 1DVUA 2IADA 1QFUH 4L8BA 1BVLA 4CVXB 4IQHA 4P06A 2BCMA 4XP1L 2AEQL 1J5OH 1KZQA 5CXPA 4XH2B 2X09A 3MV9B 4PJ7F 5HY9A 4XZUB 1MFEL 2DDQH 4U6YB 2J5LC 3HEIB 1YG9A 4XNZC 4L1SA 4W81A 1YYML 5CZKA 3VA6A 3HE7D 4O00A 4G82A 2VR9A 3VO0A 3PJNA 4WHCA 3CFEB 5FO7A 1S7SA 4UQCA 3CX5K 5HYEA 1OGAA 2Y7NA 4NZTH 5DJ6B 1A3QA 4TQEH 4JFTA 4TSBH 3UYRH 1A1MB 4DPRA 5JW3H 5HGBA 1I7TB 1EEZA 3C6LA 2UY7A 2FBJH 4RESB 1IVTA 2BNQA 3C2AH 1LEKB 3B4NA 4HCIA 4Z3JA 3EGXB 3II2A 5DRXB 3AUVA 2CM5A 3HCVA 4NM4H 3JWOH 4UUJB 1DDTA 1J0KA 1A1OB 4GOSA 2XHNA 2K78A 2XIBA 3JYBA 1QACA 2I60H 3LEYH 1WHOA 1HCYA 4X5PA 1J88A 2KQMA 2PPCA 4X9BA 5HI5C 4GW1A 3GRGA 5JPMB 4WFEE 1R75A 1H5BC 3P9MB 4IS6A 5F9OH 3L3OB 3VA2C 3AMKA 3K1KC 4R2GC 1WQVT 5IBUB 3U0PA 4QRSA 1TTRA 5IQMA 2O6DA 2TSAA 1PAMA 4B9KC 3D85D 1E28A 4OLWL 3ABKB 4YDKH 5E6ID 1BJ1J 4WTWA 1PFCA 5EZOL 5F3HB 3FJTA 3TBYB 5HYJA 2E4TA 2DQDL 4I13B 2IH1A 3WU1A 5EOQH 1NEZA 4WHDA 1MPAL 3WO3B 2AEWA 4CMHC 4KZ0A 4G70B 4JFFE 5FYJE 5HHVH 4EI6A 4EN3D 4KKLD 4ZUTB 5GGRY 4C4KO 4X7SH 1SYSA 1E4XL 4XPTH 2V37A 3GXPA 2KPWA 3L3IA 3M1CA 1U8CA 1CICB 2WXOA 3DRQB 4ZMPA 5F7DB 3R4DA 3KJ4B 1T66C 5LWYL 4WUKH 3WN6A 4F20A 4O2CA 2IV8A 1G7MA 3NDZE 5JXAL 3ARZA 1LWJA 4RX4D 3BYYA 1WG3A 4FOMA 3NSJA 3TH4T 4G9FA 3OL2A 2P5PA 1GYWA 3TH2T 3FPYA 3GPSA 3AS2A 3OR7A 3QI9D 4MA1C 1OGSA 3KBFA 1KC5L 4FFWD 3VI4E 4F27A 2BRQA 4HG4K 1SVZA 2GSMB 1UZ8B 3STZA 4JO1H 1PLGL 4XX5A 1YEHH 3WCYA 4Z7NE 5B8CB 2DQCL 3VFMB 4BSWB 4KXDA 4OFPA 5DJDB 1COBA 4E9VA 1RKRA 4ODXB 3ULVC 2PCFA 4TVUA 4HUVA 5JOFB 5HI4D 1C5BH 2PWFA 2N1TE 1DLFH 3C5JB 3O11B 2QFPA 4FJZA 2LHAA 4HUCA 3ENEA 2CUAA 2ZP0T 3CN2A 1MUJB 2XKSA 3SYCA 4C8XA 4HEME 3S35H 1AC6A 3JSSA 1A6UH 3MX0A 4KK8C 1RCYA 1ED3B 4DHLA 4LHUB 1MJUH 4JBSA 1CDBA 3GGWA 2V2XA 1G84A 3F7KA 3KLAA 3X12B 2BNUA 2CBTA 2YEZA 3KWWB 4NGHL 1JGIA 5AYQA 2ZKHL 4JMNA 2ZXEB 2NXZB 2QPUA 3PWLB 4MJ2A 2WN2A 2BIQA 3WTSA 5B3NA 3Q9QA 3FZUC 3EFDH 3UTTE 4MJHA 2NY0B 2ZKXA 1BOGA 1ZTXL 4LLDB 3VD2A 3V5HB 8FABA 2M83A 3MV11 4LRNH 4XN5A 4ZUVB 2CIIB 2VXVL 2VZ3A 3C2SA 1SOSA 2RR3A 5C0FB 4YSPA 3BP5B 3BP7B 4JL1A 5H37H 3TZVA 4DQOH 1TPXB 2PLTA 4UANA 1MVFA 3X1GA 1TJHL 3T2QA 1C7SA 3EDJA 1HX0A 4U1JA 1F1GA 2YEVB 4Y4KC 3P2DA 2WYTA 3GXMA 3MO1A 2G30A 2GY7B 1P5UA 2EC8A 3MLVL 4J6IA 3UBXI 1JGEA 3N41F 3QEQD 1J18A 4PJDE 4UOJA 5AL0A 4P57A 2IQAB 2APXA 5HJ3B 2EDYA 4MB4A 4EOWH 4F8NA 2PW2B 5F7NC 1S3KL 4N0FA 4ALAL 4CDHA 15C8H 4YE4L 3DVNA 4P23B 4IBZA 3ZR6A 2E4FA 4N3TA 4AM0B 3D1MC 5CBEA 3WUWB 4KQ3H 3ZTNL 3RUGB 5HSFA 1ZT4B 2YAMA 4FTVE 3VXSD 4JFPB 4PG9B 1XCTA 4WWOA 2HVKA 3QFJE 5L6YL 5ALCL 4QHKI 2VXTH 3I9PA 4YHKH 1AOZA 3CTTA 4GAJL 4L4JA 4HKZA 5GSRB 2L7QA 3LKNB 2BHYA 4NUGH 4U3CA 5E1AA 4PJCE 3GDBA 5E4AA 4E5XB 1UXLA 3IF1B 5MEOA 3QHZH 1E5ZA 2RQ8A 2WD0A 3LAFA 4NO3B 2J5LB 1YEFH 4XNZB 2HCZX 4IK6A 1MCKA 2C9UA 1OXYA 3QYMA 5DRNA 1M71A 3CCHB 5J1AB 4Z3IA 5IQNA 3L13A 3TURA 5F44A 1HI6A 4NJ9L 4X5XB 1HL4A 2UZYA 5DK2A 3BUQA 4M48L 3VG0H 2F7PA 3T3MB 2CO4A 3PP3H 4DP1X 3RAJL 5DR5H 1CBVH 4I2XB 4PTTB 5FLUA 1CLOH 1BZEA 3J27A 3BRGC 1T21A 3MRNA 5MENB 1T7YA 1R5IA 4LPCA 2YZ8A 3G6AA 4OGZA 5T1MB 1CFSA 2XFXB 4FQ2L 3EYVA 4QT5B 1AYRA 4AQ1C 3NIGE 3SGKA 1I31A 2AP2A 1UC6A 2Z7UA 4ODHH 2H5UA 1NGXB 3E80A 3KHQA 3B2MA 2OS7A 4JAMA 4XMKL 4BFNA 3I50L 4MTMA 5A3IC 1H5BB 1NDMA 2PYEB 3ESOA 4D0BB 4R2GB 4KI5D 3HNVH 1DQQA 2IGLA 4ELMB 2E3VA 25C8L 5GS2H 1EVUA 1JGUH 2IJ0C 1ZCRA 4JG1L 3S37L 4K23H 4N2NA 2Q86A 3MMEB 4CC4C 3N40P 3BUPA 1D5IH 3E38A 3DX7A 4JB9H 3LZFL 1AJ7L 4HIJA 3VFRA 1RMFH 5E6IC 1U3NA 4CMHB 3F7YA 2JNZA 3II1A 3TVMA 1HOCA 5J3HC 4KUZH 1FYHB 4N8CH 4S11A 3D2UD 4M43H 3FONB 4GXFA 4UMGA 3PV6B 4EMZA 2F9BT 3MA7B 4BFFA 1HKFA 1W0WB 1YHPA 1IKNA 3W2DL 1XCQA 3SE6A 2CR0A 5E9DB 3QWNA 3C87A 4IU3B 2YA0A 3KWUA 2WSPA 5EIIB 2VXSH 1RZKC 5SWQA 4KKZA 1WEJL 3F6LA 4R4FL 2DIEA 3QRFM 4AENB 5GGQH 2CXGA 2KZBA 3QJHA 4GRMB 1TQCC 4WO0A 4RMWA 1TKWA 5GZOC 2W8CA 4E42A 1NC4D 2AZAA 2CO7B 4MA1B 5F2FA 5ANHA 1JXDA 3DA0A 5CR1A 3EYSH 1W15A 5DA4A 1ZA6A 4WI4A 3KWVA 4LVOC 3JV5A 4RFOL 3GNML 5GGVH 1JVLA 1OAYL 4OZFA 1QSZA 2J4WH 3REWA 2H1LM 4NWTH 3U9PH 3H3BC 5CD5D 2MCMA 5A7BA 3T0WA 3KYKH 1XEDA 4M62L 4NQSA 4JG0L 2R59A 4HWEH 1IGYA 3CNKA 4JHZA 3UBXA 1NMCC 3EGSA 1JYXA 5I1CL 2D7QA 4Y5YC 5CEZH 3O8XC 1KCUH 1SJEB 3GMMB 4AYFA 4YX2H 3ALWA 1JYVA 2EDFA 1TYRA 5AAMA 1NFDB 5B7EA 3QDGD 2YWYA 3F7VB 4X6DF 5E8NA 1BF2A 3SDYL 3MNMA 3GS7A 1L9RA 4C58B 3NP4A 4CJ0A 3RP1A 4UQ2A 2JTYA 5AB1A 5JA9A 1DO6A 3C8KA 4R26H 4FNLL 2ARJA 4JFOB 1U8HA 2BNRD 4YDVA 4GQ9H 3VFOA 3PP4H 2D4DA 1QFWI 4CADA 5LG1A 1BAFH 1QBMH 3QJFA 1KNOA 2BWQA 4WI0A 1HFUA 2EDMA 1JWMA 5AW3B 3VI4A 1WAEA 1CLYL 5KSUA 3MHZA 4M7LL 5KVGL 1QHPA 1I7RB 1JDDA 3ATBA 3IXAA 1MWAA 3CSTA 3HC0B 3HE6C 3VXNB 5JR1L 1J1PH 4ONHA 3C6SB 1KTBA 1MI5A 4XPGL 3B6SB 4Y4KB 1AO7B 4V1DB 2E6JA 4GSUA 1HSBA 2CJUH 2D0HA 1YEDA 4YLBA 3QGVA 2CK0L 4G8GD 4OCRL 1RP9A 4S1SH 2KC0A 3UG3A 2W60B 4HEMA 2CIKA 4LU5H 5CBAA 1J8HB 4Z5RA 5KYXA 4Y7MA 4KPHL 4W9IC 3TN0A 1HEJC 2BY1A 4J3BA 4TUJA 3R8QA 4RLDA 2B1OA 2GTZB 3CC5A 2GIYA 3S3JA 4L29A 1NL0L 4DOHB 1IC5L 1DYZA 4XVSL 4CKQA 3FRPG 5LNEA 4XP1H 1F90L 4BJLA 2AEQH 1NJ9A 3UTTA 5IVXB 1ETB1 3IJ7A 4PREA 3I3EA 3QUXC 4NQDE 1YNTF 4TNWK 4XBEL 1MFEH 4P4KA 3REVA 3IFOB 1IC1A 1P9MC 3UTSD 1YYMH 4C83A 3O6ML 4BSVA 5IB3A 4Y8AA 4Z3GA 1A1NA 4EVNA 3Q1SL 1YAIA 3VFUA 2FUQA 4PWJA 1BMZA 4MD0B 3B7SA 3ZXAC 1MZZA 5DFAA 3FFCD 2NSMA 4GW5A 3RDJA 3ZKMC 2NTFB 4AW4A 4XWOC 3I6KA 2NMSA 3LRKA 1ND0B 4XMPL 5LUMA 4KTGA 3KPMA 1KIQB 4PJDA 4TYUA 4YGVA 4YSTA 3FQNA 2XN0A 3ZLQC 4ZNEE 1AXTL 2RHEA 2VZSA 5CWSB 3QIWA 3AQXA 4U3SB 1TDQA 4ODSL 4E41E 2AV1A 1E5UI 1U30A 3WN5C 3GMQB 2W65A 1JZHA 1KY7A 2P42B 2R1YB 4X4XB 4WWKD 5B38B 1CD8A 3EKCA 1SDAB 4A7SA 5DT1L 5IT2L 1KLUA 5EB9A 4CBZA 2H6OA 1JNHB 1UOWA 1PU0A 4HCRL 4PRPB 4WF7A 2J56A 1HNFA 5EO1B 1RJZA 1ZT7A 2HLFD 4TLSA 1OB1A 3GPEA 1QLEB 3QISA 1UVQB 4I3RL 4PJEE 2D9QB 4OLWH 4RGMB 5LO7A 2OSYA 2JCWA 5CGMA 3Q8CA 4PJCA 4CN4A 5EZOH 1NLDL 2A74C 2DQDH 2BOBB 4NKIL 5IUCA 1MPAH 1Y6NR 4OT1L 2BOCB 1ZJBA 3C8HA 4J4PC 2BO0A 2HLEB 1I1AA 2VDKL 4AI7A 5JNYA 2FX7L 1GY1A 1AMYA 4A63A 5C92A 1HEZA 1WH0A 1E4XH 3L3HB 4EXKA 3P0GB 1CFQA 1QPXA 3ELAT 1OP3H 2WQVA 4YPGA 2DTSA 3IETB 4U7KA 3VH8B 2PABA 4BFJA 1IQDB 2Y7QB 4AZ8B 2VLRD 2VE6A 3QQ9C 3SCMB 5LWYH 5JA8B 1RPKA 3P69A 4ZUUA 1ETZA 1PCXA 4KUCF 4JO3L 4NAJA 4P46A 5JXAH 1PZDA 2GCYA 4WZ9A 3E8UL 4NUJA 3U4AA 4HIXL 3UXFA 2BSRB 5L4FA 3CLWA 2FEDD 1FAIH 4HCRA 4QNPE 4YHOH 1KC5H 4Z7UE 5GS0C 3MBWA 5IKCB 3GSVB 3H4HA 3LTVA 3D39E 3AGVA 1PLGH 1TQCB 3CH1B 4IHOA 4QWWD 2R51A 1WAPA 2FUTA 2DQCH 2E6PA 3OKOA 2DLGA 1OCRB 3JWNE 3LV3A 3O81A 2H32B 2AGJL 3IMTA 4MHHI 1A47A 2GFBB 1KCWA 2HJKA 4OFYA 1ZSHA 4PJXF 4JM2A 1VADA 4LVOB 3MI6A 1QABA 1CD1A 4APQA 3ARWA 3MV7D 4JDVB 4EBQL 3AJ7A 5EU7C 3QVAA 5F9JB 1EZLA 3DIDA 1FFOA 3LZOA 1UD8A 3V4PL 1OB0A 3ULUL 5D2LF 2MTAA 3RWGB 2F7OA 5F3BA 5JORB 5FKPB 2CBMA 2I9LA 1MJ7H 4LESA 5CLZA 4EIZC 4NGHH 1NMCB 1E4KC 2B4CC 2ZKHH 3DMMD 3M17B 4Y5YB 5DJ0B 4J8QA 3O8XB 2X6BA 2F7IA 1RZ8A 3T77A 1ADQL 2WC7A 1ZTXH 1S78C 1T83C 4IU2A 3OLDA 5GRVK 1QO3A 1KJ2A 3B1UA 3ASOB 3UAJD 2EE0A 1C9SA 3KS0H 2LU3A 2VXVH 2V3FA 1BJ1H 4XNBA 3MNDA 5ADPL 1LK2A 2GK0A 3MROB 4TUOB 1XL4A 2KKQA 4X4KA 4MRCA 2FAUA 1TJHH 2C3GA 3QO1B 5HYSB 4LVEA 3H85A 2BM3A 4HD5A 4XI5D 4BFOA 4OU3A 2E7MA 4LK4A 2X10A 4PEEA 4AJWA 4MMXA 2DYPB 1AD9A 3ZRSA 3L3KA 3MLVH 3RIAF 4KTDL 4PH8A 4M7KH 3HE6B 1CXKA 2BIPA 2HTKC 1UKTA 2HVBA 5AAWA 1UENA 2NLJA 3DDFA 2F8IA 2P7TA 1TFPA 1EPFA 4PCYA 2DI8A 5KVFL 3B9KA 4AEEA 1S3KH 2XWTB 1E3FA 1XV8A 1R46A 1ZXQA 4YE4H 5EUKA 4IMKC 4UILL 2HLAA 5AVXB 1BFOB 2E7DA 2ZYHA 4JCWA 3ZTNH 4A55A 5LDSA 4JW3A 3CFDB 4X9GA 3VD9A 1WJ3A 4P2AA 1GKOA 4H5SB 2XRAL 3LXUX 2QDWA 5L6YH 2YSTA 2MNUA 4Z6AT 1EDYA 2BXZA 1HXMA 1EJ8A 4LCCA 4GAJH 1J8RA 2XQYA 3UEZA 4KTEL 1KCKA 1EUTA 4Y4HA 3IMWA 1MCLA 3LRSB 4M1DL 3QUXB 3F05A 3QH3A 5BV7C 4UDTB 1QSED 3DUUA 1MW3A 4P2OD 4CC1A 1JXFA 3PAUA 3GRWH 3O2WL 2JKNA 4PG2C 5CLWA 2DBLL 2OR9H 1VCAA 4ETQB 3WS6A 1P5VA 2D3JA 2GJJA 2NR6D 3O3EA 4NJ9H 3EOAA 1WWWX 4Y2DB 1J8SA 2C9SA 2UZIH 3QJZA 4L3EE 2QMJA 4H44C 5AFAA 3RDTD 4AE0A 4QYOB 2WXQA 2UX6A 1KTLA 3CHXA 5F9WC 4A39A 4KI1A 3VUAA 2J8OA 4NCDA 1BG1A 1LO5B 1CD9B 4LSSL 2MQ0A 5CP7B 2ICWI 4DZBA 2PW1A 2EEXA 1MH5A 4Y19B 5B4MC 3A0OA 5LVEA 3H2WA 3QCTL 5IFHL 4FQ2H 4ZBJA 4XN2A 4Z76B 3NCJL 2KDGA 1U3JA 3PGCB 1M2VB 1QFPA 2JV6A 4LCYB 1W80A 3BUIA 1H3XA 2VIRB 43C9A 4Z9KB 5I74C 4P2CG 5I82A 3S4SB 4PTUA 2C9QA 4KKQA 4HK3J 3I50H 4XMKH 2ZOTA 3FHEA 4NQDA 5KYYB 3ZDXF 4GAFB 25C8H 4F9LA 1BD2E 2G2NA 3FB7B 5FDWB 5FW7A 3S37H 4XNUL 4OZGB 2V17H 3VXOB 2BVYA 3DJZA 4AJ0A 2ADIB 1KZYA 1OSYA 2A74B 1H3PL 3MZGB 3PXJA 3CN3A 3LZFH 4H40A 1AJ7H 5I1AA 4XBGB 4MJIB 2XN9B 1NUFA 1XHHA 2UYLB 2X7LB 5EN2A 2YAHA 1BVNP 1OLZA 5E56A 4YDNA 5ICUA 4BCZA 3PUUA 2ENPA 1I1FB 4NZDA 1NDTA 1DJIA 2WIMA 2EKJA 4LP8A 4ZO7A 1Y0LB 3W2DH 1QSFD 4PS3A 3MRQA 1B4JL 2Z7ZA 4GKNB 5C0AB 2VLKE 3FH7A 4E41A 2ZSWB 3TBSB 4ODTL 3C60D 1WEJH 3FHQA 5DVPA 4R4FH 4MNGB 2JH2A 2DMBA 4LQFL 4ZO9A 3MC0A 4GW4A 2G2PA 2YRLA 2NCMA 5IROA 4WEMB 2MHAA 4BRVA 1CFNB 1KENL 1X5ZA 1UKQA 3NIFF 2HYMA 4MD5A 1ACZA 3EW3B 2ZJSL 1INQA 2QV2A 2V5MA 4PJEA 1D6EA 3L5WA 2AQ3A 5HDWA 3VFVA 3N41B 3FT4A 4RFOH 3GNMH 3GJFA 1Z0NA 3AMLA 2ILLA 5ICYA 1UG9A 2JJVA 3ZZLA 3LH8A 1D5XB 1XD1A 5DJ8B 2E9WA 2W07A 3KGRA 3ARBC 4M62H 4A04A 1WAAF 3FCSA 2YPLA 4JG0H 2ZXAA 4RGNC 1WIPA 4EIUA 3BUYB 1BIHA 3FSVA 4PMFA 1A6VL 3PGDB 5I1CH 1BQHB 1ZSDB 1A7QL 1OPGL 1FG2B 4OF0A 5FA4B 4HC1L 4AUJA 1IM3A 3AY4A 5ABAA 3NOIA 1C8PA 5C08E 3SDYH 2QVKA 3NIDB 2OI9C 4X42A 3HA0A 3V0VB 1IAKA 2EEAA 5I75C 1BYOA 4C55A 1IBFA 4DO6A 1CE6B 1JD7A 1XIWA 1LP9E 3DBSA 1BQRA 1N0XL 2KZ1B 5BXFA 4FNLH 1HZHH 4U6TA 1B6DA 1FYTE 1T7ZA 5AZUA 4AMXA 3WNPA 3QUKB 3T8MA 4KRNA 4A2FA 1RZGB 1VGKA 2HRPL 4Z7UA 3UTZB 2WUBL 1CLYH 3DX0A 5E4EC 3RZCA 3D39A 4Z77B 4KRPB 5KVGH 4P05A 3FQTA 2CDGB 3GMLA 4JZJC 2VDNL 1U42A 3QIUD 1K4DA 5B39A 5HYQA 3CBJB 3UAJC 5JR1H 4ZUSB 4PJHF 1FO0B 1HN1A 4OAWB 4XPGH 2I07B 4L9DA 4F7PA 1XGTA 2E6QA 4JRFA 4G8FA 3SDXB 5I8CB 1ZHLB 4UYPA 1O7SA 3C5SA 2XWJB 1P4IL 3K6SA 4OCRH 2CK0H 4OZIE 4NRZB 5BRQA 1UJTA 1GGBL 1PZSA 3B5GA 4PR5A 1R0AL 3HG5A 1G87A 4QRBA 2A9DA 1GGYA 4KPHH 3GHPA 3EOTL 1FNHA 3PHOA 4IBYA 3QNXA 1FCGA 1NL0H 4BBWA 1IC5H 1F56A 4XVSH 2ICWA 2V5YA 2YWZA 3G5XA 3QJVB 4P04A 4YDIH 1F90H 5DZNA 4QLWA 5IHLB 3U46B 2VDMB 4LLVA 4P5KA 4PJ6A 4XBEH 2WHVA 5INCA 2EO7A 3PL6B 4JRXE 1AHWA 2BP8A 1EAQA 5IV2B 4AMWA 2EKSB 3V5DA 1D5BA 1KYOJ 3O6MH 2MPAL 2NZ1A 1IAIM 4M5SA 3ARXA 3Q1SH 3OVUB 3NN8B 4KX8A 1VJSA 3DK0A 4H8QA 1R6VA 5CEYB 3RTLA 3DBXB 3W0WB 5BV7B 3SYOA 4ZMTA 1PNDA 4ZPTB 4UOW1 1CMOA 5KOVC 2NW2A 4UB0L 1IAOA 5GZND 4XHJC 1FL3B 2ZX5A 4XMPH 2GI0A 1M6UA 2VO8A 4TNGA 5E94B 4D8PB 3HAEA 3WFBL 5C0EA 2YRPA 1KB5L 1OP4A 5AUMB 1AXTH 3WNIA 3MGAA 1BSIA 3BPOC 4ODSH 4KFZC 3V6OC 1PBYA 4Q4IA 1KBGL 3WGUB 5DXWA 1EFXB 1DN2A 2Y7LA <