2FQFA

Crystal structures of e. coli laccase cueo under different copper binding situations
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
486
structure length
465
Chain Sequence
RPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blue copper oxidase cueO
publication title Crystal structures of E. coli laccase CueO at different copper concentrations.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 133
structure length 465
sequence length 486
ec nomenclature ec 1.-.-.-:
pdb deposition date 2006-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2fqfA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2fqfA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2fqfA03
4E9TA 4GP5B 2BZCA 2YARA 1KGYE 3FPYA 1OF0A 1PLAA 3NJKA 4BWWA 4KNSA 1W8EA 3DIVA 3FS9A 2DYSB 3BQVA 3PLYA 1VLXA 1NIFA 3AG4B 4DP8X 3UAEA 4AI7A 4JHVA 1GS7A 2X88A 1GS6X 4BWTA 3G5WA 4P5SA 4N4YB 2W88A 1NPNA 4DP1X 3FU7B 3FSAA 3FQ1A 5B7FA 3PXLA 1ZDQA 1WS7A 4HALA 1GSKA 3NJHA 2GC4C 1CURA 4PCYA 4A2HA 8PAZA 1IKOP 3SBPA 3GYRA 1M56B 2BWIA 1XB8A 4ZK8A 3S3BB 2VSKB 3ZBMA 2AFNA 3IN0A 2YAPA 1TKWA 5LDUA 3GDCA 3SBRA 3S3CB 2IWEA 5I6PA 3NJJA 1NWPA 1DYZA 1KDIA 2EINB 5EHFA 1OCZB 4BXVA 1AR1B 3FU9A 3DTUB 3CVDA 1L9RA 3SBQA 4YSAA 3ERXA 3FU7A 2Q9OA 1SHWA 1A4CA 1A65A 2IH9A 3PPSA 1BXUA 2FT8A 4E9VA 1M57B 3HB3B 1PCSA 1E30A 4KO5A 5I6MA 2P80D 3AY2A 2HRHA 3X1BA 1NPJA 3IE9A 4EF3A 5I6OA 4YSEA 1XMEB 1T5KA 2FT7A 2XV3A 2IDQA 4HZ1A 1PLBA 4DPCX 5AKRA 1RZQA 2HX7A 2I7SA 3CDZB 5B1JA 5IY5B 3V9EA 2B3IA 4E9YA 3AW5A 1PF3A 3CZUB 1OE1A 3NJMA 4DPAX 3NJGA 3ZIYA 2JKWA 1ASPA 2XWZA 1OE2A 2R7EB 1WAEA 5FC9A 1KBVA 3CVBA 2UXFA 1PZBA 2FNWA 1GY1A 2X87A 3X1FA 3N55A 1NICA 3QJRB 1AACA 2FJSA 3OMNB 2UX6A 3T6XA 1ZIAA 3NJNA 1JZEA 4YSCA 2QDWA 1BAWA 3GXUB 4HHWA 1IC0A 2XVBA 3ASOB 1AZNA 2QPEB 4K9JA 1WA2X 4L0PB 2XLLA 4DP0X 4GY4A 2MRYA 1IBZA 1JOIA 2LLNA 2ZXWB 4KOCA 3OMAB 4HHGA 3PAZA 1A3ZA 5I6LA 1TU2A 2XV0A 1PMYA 1OCCB 5B7MA 2DV6A 5I28A 3ZDWA 1L9PA 1HAUA 4YSRA 1WS8A 4F2EA 3FYEB 3WI9A 1NIEA 2FQDA 3UACA 2VW7A 2B08A 1YLBB 1CUOA 3N2JA 1PNCA 3OQRA 4A68A 2JXMA 3NP3A 3NSDA 3WG7B 2J57A 2VW6A 4YVUA 3X2QB 4E9XA 5B1BB 2PLTA 4FAAB 1QLEB 3KW7A 3FQ2A 2Y69B 2XX0A 3ABMB 4UANA 1ZV2A 4NB7A 2PP7A 2TSAA 4E9RA 4G72B 3UGEA 1BQRA 1BYPA 1PAZA 1KV7A 4M3HA 2HZHA 3WNIA 1A8ZA 1PNDA 2HXAA 3TBBA 2UX7A 3C75A 2YAEA 1AANA 4YSDA 5I26A 2CCWA 2Q5BA 1KYAA 1BXAA 3X1EA 2PPAA 1OCOB 2UXGA 4NERA 2BZ7A 2HLEB 3FPXA 5I5JA 3T6VA 5D4IA 1NIAA 2VM3A 5PAZA 2Y1AA 5PCYA 4TXVB 3NJIA 2AVFA 3ASNB 5AZUA 1OCRB 3IBOA 2XUWA 1RKRA 3CG8A 3NJLA 3AZUA 4E9SA 2DY2A 1AAJA 1CYXA 3BVDB 1AZBA 2IDFA 2YXWA 4M4RB 4A2FA 1W6WA 2N0MA 3AG1B 1IBYA 5B1AB 2GSMB 4QKTA 2GHZA 2YXVA 4KNUA 1GY2A 3UADA 3QJSB 3WKQA 1I53A 2E86A 2HX9A 5B7EA 2OV0A 1F56A 1ET5A 2UXVA 3H56A 4ENZA 4KO7A 1JXFA 4HCFA 1IUZA 3WKPA 1AOZA 1HFUA 2GB2A 4CSPA 1EHKB 1WA0X 4BK5C 3HEIB 2H5UA 3ZX1A 2P80A 2PP9A 1UATA 1GR7A 5TK2A 5AFAA 4HCGA 4A2DA 4AKQA 3MX0B 4HAKA 1JVLA 2BO0A 4G70B 1PZCA 2IDSA 4KNTA 2MTAA 4AZUA 1JZGA 5E9NA 1FFTB 1L9TA 3WNJA 1J5CA 2BP8A 2VN3A 3L45A 2BW5A 1PZAA 2CBPA 1SDDA 2WO2B 1BQ5A 2DYRB 2J55A 1L9SA 3OM3B 4Q8BA 3X1NA 4F7KA 3WIAA 4X4KA 3SQRA 3TASA 2FTAA 1W6LA 1NIDA 2IDUA 1QNIA 3EH5B 1NDTA 2VW4A 1E67A 3OMIB 4YSTA 2XYBA 1PY0A 2YAMA 3PCYA 4P5RA 1AS7A 4DP5X 4E9QA 2I85A 1SHXA 1OV8A 1ZIBA 2DWTA 3NT0A 1AS8A 2FWLB 5D4HA 1GW0A 1L9OA 3FYIB 3OD3A 2YAHA 3T9WA 4YVNA 1KCWA 4YSPA 5I5MA 4GP4B 4AKOA 2PCYA 2CAKA 5I6KA 2XXGA 1ASOA 1J9QA 1JXDA 2TSBA 4CSZA 4E9WA 1JZHA 3T71A 1SJMA 2GIMA 2XX1A 3PAUA 2RACA 5F7AA 2EIJB 2EILB 1V55B 2UXTA 1WA1X 1PLCA 1RZPA 4NAJA 1AG0A 1GS8A 2CUAA 2ZONA 1J9SA 4QLWA 2GC7C 2EIMB 2EIKB 4G7SB 3U25A 3S8GB 4A2GA 2I7OA 2ZWNA 1X9RA 4GP8B 2BHFA 2PPDA 5B1JC 2VM4A 7PAZA 3RYMA 1J9RA 1M9WA 3T6ZA 3UABA 6PCYA 7PCYA 4HIPA 4KO6A 1ZDSA 2BWDA 3H4FA 2J5WA 1MZZA 3NSCA 4A2EA 1SFDA 1XB6A 3ABLB 4UF7C 3FSVA 2WO3B 2GBAA 3FT0A 4N8UA 1N70A 4A66A 2XXFA 4YSQA 1FA4A 3QJQB 1NINA 3QQXA 2FQFA 1N68A 2BP0A 1A4AA 3DKHA 1KDJA 1E65A 3AG3B 1JZIA 3IN2A 1A4BA 1J5DA 4DP4X 4W9ZA 2HX8A 2AZAA 1NIBA 3PAVA 1URIA 2HRGA 3NP4A 3EH3B 2YQBA 1QHQA 4DPBX 4WKXA 2YAQA 1ZPUA 1DZ0A 3D12B 3NSYA 1ET8A 2FQGA 1FWXA 2CJ3A 2XV2A 3NJFA 3QJVB 2BP8B 4GYBA 2PPCA 6PAZA 1AIZA 1B3IA 2IH8A 2AANA 1ID2A 4G7RB 1L9QA 1CC3A 1SDDB 2JFCA 4W1TA 4KO9A 1ASQA 3S8FB 3IEAA 4AKPA 3MBWB 2QPDB 5B1KA 3S3DB 1OOWA 3NYKA 1SF3A 3NSFA 3EHBB 2GI0A 1E5ZA 4JHUA 3V9CA 2IWKA 1JXGA 1ETJA 1MZYA 1JVOA 3FQYA 2NRDA 1NWOA 1RCYA 3TU6A 5B3SB 3EH4B 2IAAC 4DP2X 4BWUA 1KCBA 3KW8A 5D4JA 2QDVA 1SNRA 3TBCA 1JZJA 1XB3A 1ILSA 3X1GA 2PPEA 1NZRA 4GXFA 1MG3C 2OCCB 1HAWA 4DP6X 2DWSA 4AX3A 2OJ1A 1TEFA 1AQ8A 1R1CA 2VMJA 4FA7B 1V54B 3QJUB 1ADWA 2H47C 2QT6A 3H4HA 1AZRA 1V10A 4HCIA 3CVCA 1SFHA 1ET7A 1KBWA 1OE3A 4Q89A 2FT6A 1MG2C 2PP8A 5ANHA 4YSOA 1TEGA 2PPFA 4BXSV 2H3XC 3JTBA 5F7BA 3EF4A 1ILUA 4UAHA 3AG2B 4BDVB 4G7QB 3TA4D 3FSZA 1AS6A 5TK4A 1AG6A 3FU8A 4G71B 1BYOA 3QPKA 1NTDA 1SF5A 2J56A 3CDZA 4A67A 4YSUA 2AZUA 3T6WA 4DP7X 2YAFA 3QJTB 5A7EA 2A3TA 2XU9A 1BQKA 1J9TA 1AZUA 2R7EA 1BXVA 1AZCA 2BP0B 2CALA 1BEXA 2WSDA 1JZFA 2ZOOA 4JKNA 1GYCA 2IWFA 1CYWA 1X9UA 4WTQA 4F2FA 1EZLA 1E5YA 1MDAA 2BW4A 4DP9X 2FQEA 3ABGA 4BDVA 2PCFA 2YAOA 3JT2A 3UAAA 4RH4A 2W8CA 4YL4A 3ABKB 3FSWA 1JERA 9PCYA 2VSMB 4PAZA 5I6NA 2IDTA 4YSSA 4MFHA 4KOBA 5I5IA
chains in the Genus database with same CATH superfamily
4Z0XB 4EN3D 4L8SB 1WEJH 3QUYB 2FX9H 4ZUSA 1CU4H 3FO0L 4G6KL 2HTLC 1NGPH 3QAZC 2VAAA 5C8JA 2AABL 5E08H 2AEWA 1QWUA 2WXIA 1A6VH 3U1SH 4HUXB 4ODBD 3ZE0E 2QQLH 2WD0A 5IB5B 1CGWA 1KFGA 2XVGA 4YBQD 5LGJA 2ZAIA 4OGXL 1JGVL 4ZQTA 3OTTA 2OR8A 4AYID 1AJ7L 2J71A 5JXEA 2FEEL 1G4MA 2C4FT 2QV4A 2EYRA 4EDXA 4OGZA 2WC7A 3OQ3B 3DIFB 1QBLL 5GISH 1MQ8A 5B7FA 1MCJA 1QR1B 1F6AB 2WVUA 5FKPA 3ARUA 3GS7A 4Z3HA 5K59F 5FYKU 1KCVL 1QTYT 2LU4A 2OCFD 1SOXA 2BWIA 4FQQA 4IMLB 1OLZA 5ESQB 3B2MA 3NCJL 5I8CA 3CN1A 4UILH 1J8SA 4ZPVA 4NEHB 4KZDL 3AU1A 1SQMA 1CR9L 1KGXA 2HFTA 4KXDA 2ZOLB 3GS4A 2XRAL 4QAMB 4H20H 3FU9A 4EDWH 4CN1A 4Q6IB 1A4CA 2AJZA 4Y89A 4P2CG 4UMSA 4C56E 1IKNA 1G9MH 3CCHA 2VIRB 4HUNB 5F44A 3BH8A 4PB9H 1RZKC 4Y9FA 3IU3A 3MR9B 5AKRA 2EH8H 1KENH 2X6AA 3D0VB 5B1JA 5D1QB 4PP2B 4CVXB 4HT1L 4XXCA 2AJVH 4FQ1H 4MNQD 2C7UA 3B9DA 4J3BA 5JLZA 1YRKA 2FH8A 5D7IB 3Q48A 2GJZA 5BRZE 3I9GL 4NQCB 1U8HA 4F7PA 3EJYD 3BD4A 4QYOA 3FFCE 4XPGL 4OJCA 3D07A 3HG2A 3LV3B 4I4WA 2Z92B 4TV3A 2EYTB 4OLUH 1J1PH 1M7UA 2IBBA 1MKFA 4OZHA 1LO5A 3WHE0 1BX2A 4PJGB 3SDCA 1C5BH 2D4FA 2F8IA 4MVBD 1JZEA 2MQ0A 4MJJA 2ZKHH 1CWVA 4TUOB 4XAKE 5KSBB 5IB1A 3G6AA 1JNLL 4YUEL 1XZ0B 4O58H 4NN5B 4O51B 1E28B 3V0DA 4F5CE 1DQLH 3A0OA 4P2RB 2GJ6A 4RGNB 5T5FA 4XCEB 3WJMA 3ZTEA 2YK1L 4R97B 1ERNA 2YIHA 3NH7H 1GZHA 4MYPA 4LNRA 4J3OG 3VD7A 1BA9A 3MRPB 4OIFA 4EQ2A 4GH7B 5TH2B 1PMYA 2NY3C 5FGSA 8FABB 1MWOA 3RDJA 4E9LA 1S78D 2X2YA 4PVLA 1IARB 5IHUL 1QABA 4MXVF 1E5BA 1AD0A 1TETL 4I9WD 1U91B 5ILTH 2LVCA 3OAUL 3G08B 5DHYB 2VW7A 1O5DT 1AXIB 4JHBA 3OSKA 4I8DA 1RAMA 5KBMA 4JFDA 3CFUA 1CD1A 3UTSA 4ES8A 3N41F 3BAXA 4NRXA 4U1JA 4YL9A 4UZSA 1FYTD 1NAKH 3NESA 2FYVA 4KDVA 3EGSA 3UTZB 3V5HB 4IRSD 3WUWA 5HYQB 2D9CA 4LLQB 1BVNT 5GRJH 1YSOA 3KJ4B 3SZ6A 5JW4Q 5K9JH 2OZNA 3FUDA 4AENA 3ESVF 2VXTH 4P23C 4UANA 4RISH 1FZJB 2V37A 3PV6A 4KDTA 2R2BB 4OCMC 5DK0B 3QI9D 4GG6B 4CVZA 3LNDA 5DR5L 5JDSA 2HZHA 2Z3FA 3WNIA 4OCWH 2D9QB 2B8OT 4FG6C 2EUVA 1AANA 1WITA 2CCWA 4XPFH 3SPVB 4WQOA 4J3OH 4JREC 5FLUA 4GIOA 1TIUA 3FPXA 3NGBC 5JIIA 2BVTA 5K9OA 2VM3A 2J88H 1DSFH 3BESR 1DO6A 2GSGA 3M17B 4GI8A 3VA6A 1UOKA 2IANA 2XXCB 1JWSA 4BSJA 1R9FA 3BUIA 1RUMH 2RA1A 5JOFA 2XY1A 4EI5A 4JFZL 1SPDA 1ZTXH 2WOYA 1CYXA 1RUKH 3CFEA 5B4MC 3BZ4A 3I3BA 4AH2A 4WTZG 1O9WA 2BK8A 3RX9A 1RZFH 2QEJA 3Q2NA 5IW6A 4R2GD 3BH4A 4V2CB 2YXVA 1CDHA 1CXKA 3NIDB 5I1GL 3AQYA 4PJ5D 1FRGH 4UV4H 5J3HC 2OV0A 3QHZH 4L18A 1T6VN 2NXYC 4FFYL 4NZ8A 5E6IA 3EJTA 5E1AB 5I73B 4DFIA 5GJSL 1JK8A 5ID1B 1AMYA 3MXWH 3E38A 4PRPD 5KVGE 3CFKB 1SN2A 4HFWA 4PR5B 3SODB 1G6RH 4XHJD 5HHMD 4B5EA 4JFEE 4DCQB 3MNZA 1XF2A 4ZMWA 4JPVH 2EDYA 1OLLA 2B59A 4A2DA 3HW7A 5I1AA 1ECZA 5IBTL 4RAHA 3OKDB 5D1XC 3WJJA 3MJGX 3VXOB 1GZPA 4GAGL 4Y7OC 1Y7VA 2XFXA 1YDPB 1OSPL 1J5CA 3V0WH 4HPOH 3JWOH 5DTFA 1DVYA 1HL5A 4AGNA 2VISA 1ZJBA 4QRRE 5C0JB 4FKHA 2WO2B 4KUZL 1BQ5A 1D6EA 2APFA 3PFQA 1LK2A 3A24A 5IVZB 3TS8A 4JMNA 1U8MB 2LE9A 1XXFC 3PDGA 1IC1A 1JPSH 4L4VD 3T3ME 1XSIA 4JFXA 1C1EL 3GD1C 4LSVL 3ILPA 2FEJA 4MQ7B 3T5WA 1XBRA 3S35X 2P52A 3NBNA 3IDMB 2OPCA 3CHQA 4JQVA 2YAMA 3A6BL 2F2HA 2R0WH 3GBLA 4UZGA 5L0QB 1MW0A 4B7IA 3DI2B 3TBSA 1FVCB 2DWTA 2NQDA 3HNTH 3CLEH 1XGZA 3MJ9H 4GMSL 2V8MA 1F0LA 4JAMA 4MJID 4KXCA 3VFVB 3HMXA 1RK1B 2HVJB 5ALCH 3RWJA 4Z7WF 1NGYA 3QNZA 4F80A 2CLVA 4OSUL 3FB5A 4QAWA 1QI5A 4XP1L 2OCJA 5MP6H 2GIMA 2OR9H 4FGMA 3REWB 5IHZB 4IIZA 1HILB 1OGAA 1HHKA 2OTWA 4JFPA 3MJWA 3SJVE 5I75B 1J5OL 3QFJB 4AXWA 5IMLB 1X6LA 1ANUA 3QZWG 2VABB 2VXQH 5C86A 3WYRA 4X42A 2JCCE 3KPOB 1K5WA 5K9QG 4YGAB 1AG0A 2BC4B 4Y16D 3VVVA 1IAKA 3DI3B 5HHPB 4Z3GA 3D85D 3FOMB 2VLJA 3CZGA 3BHBB 5CGBA 1DANT 2YJLA 4FXLA 4JFSA 3GSQB 4LDEB 5JNYB 2R56H 3B2VH 5D7HA 3JVFC 5A16A 4RMVA 3WEXA 1GGUA 3ULSB 5K5YA 1FLRL 3HR5B 4JFYA 3Q8BA 4GKNB 3WXVH 2EIZA 2X4QA 3VFSA 3COOA 2WP3O 2NR6A 4KI5F 4P49A 4X5XB 5T1DH 4LMQE 1O6SA 1OW0A 3HG4A 4W9LC 1UM5H 1FA4A 1ZE3H 3D3VE 4A66A 3GIZH 4F8OA 5TD4A 3GSXB 1A6AA 4Z7UB 2RAMA 1H8OA 2JLPA 3IGUA 3INOA 3HG3A 3MJ8B 3VXRA 3MYJB 3PIQA 3VFPB 1AHWB 2NNCA 2AGJL 2DDQH 2HN7B 3F64A 1OIOA 1J05B 2H0EA 3B1TA 2YRBA 5C0BE 5CU5A 4ZSOB 1XGQA 2YQBA 2EE2A 4OKDA 1KIPA 5DD6B 4GIPD 4MZIA 4Q9RH 3FB8A 3JV0A 5I0WA 1BIIA 3M88A 4MTMA 3QUYD 5TQ0H 1X5IA 4PJBA 2CWRA 1Z7JA 2VUKA 3GMPA 1CC3A 3P9LB 3VFOA 2LW3A 1TPXB 2FLBT 5J8OA 3RGVD 4UIKL 1DBML 1S9XA 4GIAA 1KGUA 5DJ0A 4ZPTB 1DP0A 4BFOA 4Z7VA 4L1SA 4G1MA 3S6CA 2R29H 4JPSA 2WXMA 5HJ3B 4Z77B 3V9FA 1V05A 2C3HA 2CUMA 1HC1A 3WHXA 5FO8B 3M7FB 2IGTA 5IB3B 1ZGLP 2DQUL 5FW8A 2YQ2A 1B88A 1D5XB 2P42B 2PR9A 3CE1A 3O81A 1KCBA 5TDOA 4JQIH 4DERA 4EOWH 4EN3C 1XB3A 4MMZA 1HN1A 1U2HA 3G9AB 3ZE1B 3WTVA 1SJVA 1MG3C 4TOYH 5GS1C 3IDNA 2Q0ZX 2J12B 2E7DA 1A6UH 3GSNH 3MOBL 3O3EA 2HP4A 1MWAB 3EJJX 5BO1H 4GW5B 4BKLA 2GTQA 4JY4B 4JB9H 1NFIA 1P4BL 4YBQC 1L5GA 5HI5D 4BUHA 1HYSC 1MIML 3DDFA 3V5KA 2YUVA 1UURA 2X0VA 3TYGH 4DTGH 3U46B 5AOLA 1JD7A 5KBKA 1RIHL 1HDMA 2QHLA 1H6UA 4IU2B 3TBWB 3CMGA 2VZOA 4IDJH 3MRGA 2I9LB 3ZHLA 3HVNA 4FS0A 1QMUA 2VRQA 4MA3B 3D39A 5F89B 4GAJL 4DESA 1YEIL 1KJ2H 3PGDA 4HK0B 3G5ZB 1Q0YL 1NLBH 4XBPA 3WMSA 4U1IA 1TCRA 1QLFB 5HHOA 4NDMA 1MCEA 3BZEA 2VITA 3BWSA 1KGCD 1AGDB 1HZHL 5HPMA 4FE9A 1MRFL 1V3JA 1X5HA 3GLAA 3K5RA 4MQSB 3KDMA 3ARTA 4LAQL 4TNGA 1BEXA 3DO7B 4XWGL 5D1ZA 1CXHA 1ZA3A 3V4LA 1E2ZA 1Y18A 1YEJL 4DP9X 3CFBA 1W8OA 2OW7A 5LGJB 1IGMH 1R3IL 1KLFB 1ZY9A 5CMAB 2IH3A 4ZD3H 4JO4L 3UIZA 3DPDA 5TF1H 1SOSA 2CO6A 1WPCA 3WN5B 4FLQA 3DK0A 3R8BB 2VCOA 4I18A 3TV3L 3PHQA 4RWYH 3NFSH 2F7QA 1NEPA 4AQ8C 1DQTA 4P2RD 4P2YA 1HSAB 3DGDA 1ACXA 3OWRA 3KPLB 1DBKL 1YMMD 3EJYC 4PV1C 6FABH 1UCBH 4M5ZL 2EUZA 4TRPH 4AYEC 5FUCE 3AG4B 4NCDA 5DVPA 4ZNEA 2BERA 2ZCZA 4KVNH 4MVBC 1G7PA 4OBRA 2BVEA 3JQOB 2F9BT 3AU1B 5BVPH 1T2XA 1UA6L 5FKAA 4UU9A 1MPAH 5EEXA 3EHBC 2ZX6A 4PBWD 1U93A 4HDIB 3BFQG 3RWHB 2F54A 3H3PL 4OUOA 3C9NA 4GAYA 5DRNA 1ZEAH 3D52A 3L5XH 1AKJA 3TA3A 1D7BA 3FQ1A 4JM0A 1HH6A 3L4XA 3IJEB 4XN9A 3LRGA 1LILA 1EO8H 3S97C 1JE6A 3C5SA 3HAEG 5HGHA 4W6XB 4G9FB 2RQEA 4I7ZC 4X99A 5BZZA 3WV0A 4P3CL 3P11L 2CGRH 2VR5A 1S78C 3QHFL 5JQ6L 3GSOB 1E9PA 5C7XH 2C7UB 4HWBL 1H0DB 2NY2B 3C09C 2YGPA 4XR8C 3EYSH 3LQZB 1WWAX 4XOCA 3WEAA 1XF5B 2UYLA 3UC0H 2W9DL 1BXUA 4TNVK 1IQWH 3BUQA 5ALBL 5AZEL 1LO5B 1XL6A 2Q8AH 5EA0L 1XL4A 4XN2A 3RHWF 5I6MA 5FYJD 2IG2H 2V2XB 3NZUA 3ECBA 4NC1E 1KPVB 4KUCF 2QQNH 4ZQKB 4A6YA 2JIXD 3MKGA 4NQDA 3NCWA 2E9IA 4HZ1A 3ZRFC 4URKA 5IB1B 3E2HC 3VXPA 5EOTB 1K2DA 1DFBL 5IY5B 1ES0B 2D03L 2IBZY 2PYEE 4E9YA 1IL1A 4FJZA 4DFHA 4EUPA 3KPSB 3O2DA 1UJ3C 4L2YA 1WZAA 3HAEH 2R7EB 4LNRB 4URTB 3T0EE 1GYAA 3Q2LA 5FC9A 3AS2A 3BDBA 5F88B 5H2BB 3JV6B 3T04D 2XWRA 2ZIDA 3TWCH 1MFAL 1SHSA 2NUTB 4HJJL 3KPMB 4KRPD 3VE0B 1YN7A 3WIHH 7FABL 1UWGL 3GK8H 5GGVL 3VD2A 2NOYA 4C83B 3B56A 3TBVA 3CQQA 3C5ZB 3M07A 4M4PA 4XBGB 3O3BB 2A0LD 1L6ZA 3WELA 1RZKL 1XGTA 1CD1B 4YHML 3FO9B 1H5BA 2XLLA 4AT6B 4U1JB 4R2GC 3RY4A 5F1KC 1IM3B 3PL6A 4UNTA 2ZKWA 2ZWLT 1N4XL 2YGNA 5AVVB 5HTSA 4ZW6A 2P5EA 4RFEA 5F96L 4XCCH 4CVZB 5I1EL 4L9LA 1SYSB 2CKBH 2EC9T 2VC2B 5JDSB 4RIRA 3UBFA 4XHJC 5ISZB 1LDPL 1QEWA 3M8OL 1UD6A 2FWOA 2FYYB 5D2NE 1LDSA 3FYEB 4DK3A 5E2UH 2HG0A 3AVEA 2BHZA 5DJDB 2GCYA 2PUQT 2UY7B 5J1SC 4S0HA 4CUCA 4KZ0A 1S5IL 4RAVA 3HCVA 1I3UA 4IBVA 4PJXB 3X2QB 1CF1A 4YXHL 4LB8A 2V6HA 3KNBA 4NLAA 5DLML 5HBBA 1TNMA 2EH7L 1JBJA 2WYIA 1ZK5A 2YXFA 5G55A 5TDNA 1DQVA 4FQPA 1BYPA 3RBGA 1QYGH 3VYPA 2EABA 3U7AA 5I19L 4YE4H 1EXGA 4JDZA 4MJ5A 5IW6B 3CZFA 4G8IB 1CLVA 1GC1C 3MNMA 3Q6FA 4YSDA 5K59E 4JO1L 1ZSHA 4O2FB 4DOHE 4YDLB 2LAGB 3O2VL 2DLHA 1S7QA 4UT6A 5I5JA 5FLVA 2F6AA 1NIAA 2IQAB 3UDWC 1JK8B 1USZA 2VDKL 2AK4A 3DYOA 5IJVA 4AQZA 5GGTL 4HFWB 1HWGB 4WI6A 3ASNB 4KKCD 3RFZB 3SCMC 1K5NB 4JKPH 5DFWH 5J06A 1A21A 3FQWA 2A6KB 4PIBA 1YYMH 3LPOA 2Y2WA 3KPPB 2WLJA 2G3ZA 2PABA 3PGFH 1MCOH 3P0VL 1M1XB 4QY8A 2H7WA 1UM4H 1E4KA 2ICWA 2F58H 4OCRH 5E6YA 4Y4FB 1GY2A 2VJ8A 2X70B 2EC8A 2J6WA 1T4KB 5CUSL 2XN9B 4QTHA 1KJMA 4YR6B 3WEOA 1KMGA 1IVTA 1RURL 3TBYA 1D6EB 4BE5A 1P6AB 3O4OC 5AW1B 2ZCHH 1LK2B 2ZWZA 4Y16C 2MQCA 3W5MA 1FH2A 4R7XA 5BRPA 4FZEH 5C6TL 3BUBA 5EZJB 1KLGB 4ZFZB 2BIHA 4V1DD 4GBXD 1HXYB 1CQYA 1DO5A 4Q2ZB 2DN7A 3S5LG 4PRID 5B38G 1AGFB 5FV2A 2AKRB 2B2XL 1JNHA 3BMWA 1FJ1A 3DUSB 3Q9PA 4UOQA 4JAMB 2WZ5A 3LQAH 5EORL 4ICWA 2X0WA 4HIEB 4HJSA 4G59C 5DUPL 2ZSVB 4U1KA 2O5YL 3MRFA 2DEXX 3GBEA 4H8QA 3ARVA 4PVNA 3WIAA 5G4OA 4F9PC 3A6CL 4B9CA 1E5UI 3QO0B 3LN4A 5MHSD 1W6LA 4I2XE 3PF2A 4FFZL 5CEZL 4MNGE 3HC4L 4NZTL 2VW4A 5DJ2A 2FSEA 4JKKA 4MXVE 4XMKH 1KB5L 5DEFA 1A7QH 1PY0A 2J8UF 4P5RA 1FVDB 4OLWH 3US9A 1I3GL 2DMCA 3JTTA 1DQML 1F2QA 1ZIBA 1IAKB 1HL8A 5IMKA 5SWSD 5I66B 4I48A 3HG5A 1YNLH 2V9UA 4N3UA 4OUUB 3IWUA 3U2JA 3HNVL 2JI2A 1OPGL 4PGCB 2K8QA 4ZT1A 1NC4A 4M02A 1AP2B 2K45A 3RGVC 1UGKA 1XO8A 1TYRA 3ZT5A 1XCTA 1OHZA 2X4QB 1U33A 4JO3L 2E8ZA 2Q86B 2W92A 1JGUL 3EBAA 1NAML 5LN4A 1U2CA 3SE4C 2VWEC 5EU4B 3WENA 1Q90A 1SBSL 5DD3L 3ZZ1A 2WWNA 5E56A 5DJXA 3C8KA 2NTFA 4QJ3B 3VTAA 1RZGA 3F5WA 5SX5K 3V0AC 1CLOL 2H6UA 4IGBA 1IEAA 4F1SA 4NM4L 1EHXA 3FTZA 3DBXA 4BA0A 4XCFL 3RNKA 2EIMB 3MRMA 3VAEA 1MLBA 3QG6A 3IM1A 3PWPE 3X11A 4UTAH 3NCFB 5AAMA 3TTSA 5FYKE 1FFPB 3MBXH 1H8SA 5CN1A 4FXKA 1Q72L 4P2QE 4G43B 2BHFA 2Z1PA 4M62L 1FGNL 1I8IB 3N9GH 5I0VA 5C09B 4PRHE 5DXWA 3Q2VA 3PNWB 4LKXA 4DVBB 1IBGH 3F7LA 3RPBA 1D9KA 1MI5E 3BP6A 2D7OA 2NTSP 4OCSH 3SGJC 4UF7C 1XB6A 1FNEB 2WBJA 5CSZB 3RIFK 3QQXA 2JNZA 2CZNA 4QXGL 5IFHH 2OJZH 3QORA 1SXBA 3DUUB 3EBGA 3ALPA 4PMEA 5CINH 5F9JA 1SUHA 4LPWA 4OLXL 1GYWA 3IN2A 3AWFA 4I3SH 4Y5XA 4XP5H 5E8EB 1WIUA 3F7YB 5IEKA 1A9BA 2VQUA 1CXFA 3QE5A 5IESL 5K9QI 4R26L 4LHUA 3EH3B 3WTSA 4KY1L 1FFQA 2PTTA 4AJWA 5J11C 5JXED 1MHCA 1G9NC 4N2DA 5DD5L 2DS4A 4KGJA 1UXWB 3MFFB 4UMGA 5KYUB 3DJ9A 2ZTBA 3LOWA 5CCKL 2XV2A 3G6JF 1SLVA 3OXSB 5F93C 2CJUL 3N0PB 1IKFL 4YS4A 5AVXB 1SDDB 1NFDA 3CVHH 1UA3A 4OKVA 4PJ7B 2EDRA 3V95A 2IMNA 4QCIB 1CTNA 1GTFA 5C70A 4M8QB 3QULB 3S3DB 2QTEA 3NA9L 1HHHA 3TEUA 4F33A 2OZ4A 3BI9X 2A9CA 4NPYB 4LSTH 4RETB 1XH0A 1XR9B 3TT1L 4DEUA 4X7TB 4HS8L 1A4JA 4NN5C 3HRZC 2MCG1 4PTTA 3PWUA 4QTIH 1MVUA 3VD9A 5DYFA 5KJRL 1BBDH 5IV2A 3NAAH 2QDVA 3I6LD 1KCLA 1T6WA 3O4LA 3FBQA 4JZNB 3LNGA 1U6AL 3BVTA 3RWDA 4YZWA 3GM8A 3T8XB 1IC4L 4JG9A 1MREH 3LHPH 1CFTA 1HQRB 2AQ3A 1LE9A 1TCRB 1S6NA 4KXZH 4UV7H 1T83C 4YHOL 2H1XA 3MUZ1 3QJUB 4ZYKB 4F9LA 5KN5A 2DKSA 1KTKE 1BVNP 1T7XA 1XF4B 4Z7WE 3QEHB 2NY2D 1AZRA 1H3UA 4ONHB 1W72A 2AC0A 2ZPKH 5ENWA 2KZBA 4XGZB 5ABDE 1FL5A 1QFWM 2X12A 3CZKA 3KDMB 4Q89A 1OCWL 1J0JA 1MG2C 4QRSA 4WK4B 3BPLB 2Y5QA 4IOSA 4NJ9H 3UPCA 3QYNA 2ZXDA 4FQCL 5I1IH 1AE6L 1M6OA 1DJIA 3SDCD 3O3DA 1QATA 2OMYA 4IMKA 4F58L 3GUTA 5DZPA 3OXRA 3LHAA 3LVEA 1FCGA 3H7BA 3O45A 3P2TA 4HISA 3HZVB 3MTXA 3FXIC 1MHEB 2IAMB 5C08B 3AC0A 3JV4B 2DLFL 4NUPA 4R7DB 2XWBB 1DHKA 2OL3B 2NNAB 2OYPA 4WWID 3PJLA 2IXQA 4K9EH 4KI5E 1P7KB 3RTQB 2ED9A 1RHFA 1CICA 1XGYL 4MDJA 4YIQB 4ODWA 4RCAA 2WBXA 4NKMB 4BK8A 2BW4A 3PDDA 5D7LE 3KLHD 3ABGA 2PCFA 4U31A 3HI5H 2DRUA 4W68A 5GIRB 3LIUA 1GIGH 5FKAB 1UH4A 4JJOA 4WEBL 4M6ML 1FZOB 1HHIB 3H53A 4N28A 4A38A 4GSQA 4I1NB 4JFDD 2DQCH 5EBMA 1UADC 3GRGA 4LRNL 3KL0A 4U3SA 1E6JL 2FJFB 3TA3B 2J20A 4YSSA 3PU7A 4YDNA 3DSNA 5I30L 2AF2A 4HIJA 4GSUA 2Q3ZA 1A9EB 1NCCH 3DSFL 3BPNC 3QUMB 5HGHB 2DIEA 3NIFE 4X99B 4YXKH 3NZ8B 4DKAA 4OLZH 2XPGB 3HA0A 4I5BA 5JIDA 4N9GB 1ETZA 2VN7A 4KRPC 1RJLA 2BIQA 2QKIB 2ADYA 1BVOA 2DOCA 1FZKA 4XXWC 5CIPH 2FECL 4KVCL 1H3WM 1MXGA 1YEGH 3L3HB 3N43F 4U1GB 3GBML 5BW7C 1QBML 3RPIA 1IE5A 4NAMA 1CFNA 4LVHB 3RWEA 3OAWA 3ML9A 1LMIA 3QP3A 3MLWH 2FO4A 4FULA 3PYCA 2J4WL 2EE9A 2FL5A 4NWUL 2IH1B 3ATAA 1UWXK 1K4DA 4EI5D 4J6RH 4PI2A 3NCXA 1ZVSA 3P69A 4Q74A 1JHLH 4NWTL 1IKOP 1JG9A 1YYLL 1OP3K 5ADOL 5KVEL 4QRUA 1M56B 5E2JA 1IL1B 4UQBA 1NM4A 5DA4A 5LQBH 4U1NA 4G7VH 4OM1L 5LDUA 1BQLH 1J5HA 3X14A 5JOEA 1P5VA 1MJ8L 1CG9A 4BXVA 5DQDL 3CVDA 1NA8A 4X9HA 1QNZL 3UCQA 1RZJL 1U8KB 3FW6A 4NCC2 4OM0H 4X6BA 3VRJA 1BV8A 4N2BA 4BELD 7CGTA 1FBIH 1RU9L 2MNUA 4JHAH 5I8KH 1BDYA 2FT8A 5AD0A 4CA4A 4FADA 1UQSA 4FZ8L 4Y9BA 1EVUA 3SKJH 3SGEI 3X1BA 5IM7A 2PXYA 1L0YA 3AGWA 4XO8A 3EOAA 3U4AA 1XGTB 3OF6A 3OJVC 3GKWL 2I7SA 5CJXA 3LXUX 2BSBA 3PL6B 2ENSA 4Y4FD 1HT6A 2C1PB 5IF0A 3P0GB 3OJDB 2VL5A 3HS0A 1BPLB 2GK2A 4S1SH 1NM9A 2XN9D 1G1KA 1Q1JL 3F7RA 4X9YA 3Q5TA 3CVBA 4PJ8A 5EB9A 2X28A 4KTEH 4RFEB 1EJFA 3MNDA 1NICA 1BQSA 3EG9A 2VDQB 1HWWA 2UX6A 2E7LC 2B1OA 4PGBA 3LRKA 2QDWA 5SWZB 2HJKA 4UNUA 4D9LH 4Y8AA 1OARL 2D0HA 3R19A 1FIGL 5JIMA 2QPEB 2X6MA 1FGVL 2BDNL 5CP7A 1PG7H 4ELDA 4BHUI 1AD9B 3SO5A 1VGKA 4JZJA 3A6OA 4JPKL 4XVTL 1DR9A 3H9HA 3KNBB 2C9RA 4YNYA 1SY6H 1KGJA 1KN2L 2D31A 3CX5K 4OZGF 2X4RA 3D18B 1DDHB 1N6QH 2B16A 2JKJA 4Z95L 2A9MH 5TDNB 4NENB 5FHAH 5BV7C 4XC1H 1U3NA 3BGAA 2X1XR 1BFTA 4K07A 4MJ5B 1HAUA 4AYFA 4I13B 4GQRA 2VH5H 1A7PH 3BLPX 3KLAA 3RFRA 2YQ3A 4UQDA 1OGAD 1S7QB 4L1BA 1RD6A 4GBXC 5I1CL 4K0OA 1W0VB 2H6PA 5IJVB 2VW6A 3BJLA 5GGRA 2Y2TA 3MV11 5DZVA 5B1BB 3ZUCA 1I9RL 4AQ1B 3NZSA 2LFEA 4AEEA 1JPST 3QDMB 3VMOA 1OPOA 3U6XS 2VLJD 2ORBH 3UGEA 4UB0H 5F6IB 4ZTEA 1NCOA 1C8QA 2F7PA 1C5DB 3F85A 1PNDA 4KHTH 1NKRA 5GZNA 2ICWB 2NDFA 3GI9H 1M1SA 1AXSA 2BMKA 1QAWA 1BZ7A 3ZGIA 4LESA 3KMDA 1JD9A 4WUUE 3FRPA 3MCLH 4ERSH 2XTJD 1LLAA 5ITFA 1VSCA 3EH1A 3TBYB 2QTVA 4FG4A 3GS0A 4A7VA 1B4LA 3BSZH 2HWZL 4OZFB 3S9DB 3VXRD 1KC5L 4TM9A 2V33A 1G6VK 1PIGA 3CSGA 5HY9A 5T33L 4RMUA 4NYLA 1IFHL 2P24A 4GS7C 5DUMH 4Z0BL 3PHAA 1W9XA 4ZTOL 2EDEA 1TVBA 2HFFA 3PWNA 4JFFB 2DH3A 4UTBA 2DYPA 4PCTA 2ODIA 3GSUB 2R4RH 1COBA 2APXA 4L1HA 4PJ6A 1IC5L 1NPUA 2P5WB 2X4SA 5C09D 4ZMAT 1MLCA 3MC0A 4G3YH 2E86A 3E1F1 2C4FU 1DN0A 3ZQ9A 3L3DA 3MA7A 4KO7A 4WWOA 3TJEH 3VH8G 3ILQD 4G7YL 3WEBA 1J8HB 4M03A 2NY7H 4F91B 3O3UN 3DTXB 2KPNA 3IJYB 4NUQA 3RHWK 5F7UA 1ZWIB 3LN4B 3FUMA 4WI9A 1QVOA 1NCBH 2Z6FA 2FIKA 2NPLX 1UATA 1QFWH 1PU0A 3C2AL 1JRHL 5DEFB 1RUAH 3V0EA 4Y1AA 4F15C 1NLDH 3SBWC 3DIDA 4BJLA 1JZGA 1T0MB 1M05A 2OMBA 1O7DE 4M6OL 3OKOA 3RUGE 5DK3A 5JIHA 3ZRSA 3CX5J 2LABA 3IFPA 4WI2A 2WNGA 3L54A 4KKAC 1O7VA 1NC4B 4HIXL 3FT3A 1P53A 4PRDB 1LD9B 3MUGB 4G9DB 5J12B 1ZD6A 2YMXL 3OM3B 3JYBA 3EGXA 4JHWL 1T0NB 5EU6E 2EDJA 3K2UH 4PJFA 2YQGA 1HINL 5KZCD 4Z9KB 1QTPA 2WHVA 5B22A 4KK5D 5JXEC 3WFEH 1G7LB 2IADA 2AXGB 2XYBA 1J0ZA 4IKKA 1UFUA 4U6VL 4LU5H 2YLHA 4IGBB 1GHFH 4X6FA 1L0XA 4XBMA 3WNLA 3RVXD 3D39D 4OLVL 5F7KC 4IS6A 1XGPA 2Z4QA 3FDWA 2XZAL 4WW2F 1PEWA 3BZFB 2ESVE 4PGZA 4JFOB 1MJJA 2E9WA 4UOZA 5I6KA 1KCRL 2EKSB 4LKXB 5IHLB 2CJSA 1D9KB 1FG2B 1PJWA 3VQ2C 1I8LA 2XX1A 3MRNB 4LMQI 2WBJB 4LLVB 4Q4EA 4MGXA 3HRPA 3BEWA 1QW8A 1ITBB 3D05A 3MLZL 1IAIL 1FO0L 5D1ZD 2V2TA 3VXMB 5F9JB 5H8DA 2CK2A 5DQJA 1IKNC 2BNQE 4JFHE 3HFML 4MD4A 5LBVA 2ZONA 3OKMA 5HHQB 1FAIH 1OAYH 2Y1ZA 1M7XA 4L8BA 2ZUQC 2E6JA 2C1OB 2PTTB 1UYWH 1X9RA 1MHCB 4MWFA 5DJCA 5B1JC 3B8SA 1HNGA 3F62A 5INCB 1I7RA 2W94A 5FM4A 4XXCC 1E8ZA 4FMFA 2COVD 2BSSA 5E99H 4E5XA 1J5IA 2I5YH 1XX9C 1WICA 1GJWA 3V6ZA 4Z76B 1ZXKA 2VDRH 4GKZA 1MW1A 3NPSC 5AKTA 5DS8A 5I1HL 1E5CA 5HGBA 1A4AA 3N40P 2BVQA 3JWNE 3SDCC 1E65A 1JZIA 5CFHA 4MCZB 2QQQA 4P4RA 3MGAA 3ZGHA 1A4KA 4GKLA 4LCCA 4DP4X 4F33B 3V0IA 4JKWA 1C08B 4X6CA 1A4JB 2F54D 3EAKA 4ZFQA 4RFOH 3S3SA 5FEBA 2E27L 3TA3D 1AKJD 4Y5VB 2ZXEB 5DC0A 3VXUE 4K3EL 1E42A 4K8RD 5CGYD 4GG8B 2E7CA 1MHPL 4YBLC 1GZHC 4GEJA 2PPCA 1VGEH 3TH3T 2M2DA 2O93L 2PW2B 1NCGA 4NNYB 1ORQA 4DVRL 1YECH 5FFOA 1LE9B 3O3AA 2BS9A 2HLFD 3KLHC 1HHGA 3ARYA 4N0UB 1AGEB 4TSCL 4AIXA 1PZ3A 2JLLA 1NMBL 4KHXL 1BD2E 4EZLA 2K9FB 2QPFA 4G80B 2GI0A 5CLYA 3ZQWA 2IPKB 1N0LA 1DBBL 1I1YB 5I8EB 5IJKA 2H4EA 2RBLA 3FZUD 4TLKA 1MUJA 3U2IA 1UWFA 4AJVA 3LRHA 5EZOL 1E9OB 4HU8A 1ILSA 3OXRB 3UG4A 4UQIM 4B96A 1MJ7H 2OMXA 4NQDD 4KDTC 4OQTH 2FJHB 3Q43A 3MV8A 1GZQB 1MCNA 3WFBH 2DMGA 1AQ8A 1F1AA 1JV5A 4XVUD 5F1IB 3ULVE 3AJ7A 3BDXA 3QDJB 3U4BL 3UTPE 3ZMEA 3IXTA 4K3DL 3MV01 2D0FA 1V10A 5LXGL 1N3NB 2M26A 3QFDB 4EAEA 2QZQA 2XQBH 5E9DE 1KBWA 3FT2A 4FHJA 2C3XA 1Q9KB 1G9HA 4G8GB 4JQXA 3B9KC 5DD1H 3EZ8A 4YSOA 2Y07L 1GYVA 4ODWB 3QWOA 1OVZA 3U2SA 1D5MA 4EI5C 4UT9H 2BVPA 3HBPA 4I3RL 4Q52A 1FNLA 4WWPA 3TYFA 1EHLL 3U4EB 3L6FB 3BFWA 1DVFB 2DLGA 4ODHL 2WLLA 1YUHA 3BIBX 2CH8A 5TDPB 3WL9A 5BS0B 4BQCA 4X8JB 3DSNB 4K55A 3PL6D 1A14H 1CBVL 3M1OA 3L5HA 3F01A 3BLBA 5E6IC 1GPOL 3KM1A 4O2EA 2P5ED 1KY6A 1KTBA 5AW8B 2HT4D 2LU3A 1ETZB 5EUKA 1QW9A 4O4YH 5C0FB 4RQQA 5C07A 5C0CA 1A0QH 3DOHA 1FZKB 3OLGA 1JZ8A 3RJDA 1FH5H 1WFNA 5SWZD 1SM3H 1BIHA 1DZBA 4HEME 4W4NA 1D5BB 1TTBA 3OKEA 2DBJA 4JRXB 2F5BL 1S46A 2VDOH 4WTXA 3TTYA 5I15L 4XPBL 1UWXH 2G0KA 4C56A 2HFEA 3NFPB 1A25A 2XWEA 5TPWH 3BUTA 3FN0L 3R0MA 4FI6A 4JRYE 2FO4B 5EOQH 4YWGH 3WJJC 1H9VA 3VGBA 4PLNC 4M7LH 1YEHL 4GKSA 5LNGA 4N1CA 1Z3RA 3BGFC 5CEXB 4KNSA 1KCSH 4J39A 4HQQH 4GFTB 4LLAA 2DZEA 1HHJA 3G6JE 1U36A 4IEFA 3O0RL 4DP8X 3GPEA 1XGRA 1KEMH 4PY7A 1VHPA 2R1YA 2ZXBA 2E6QA 3DGGB 2DLEA 5FYJL 3G5WA 1CG9B 2BFVL 3W2DL 3SE3A 2EO1A 2YPLA 4JQVC 4C55A 1NPNA 2WQUA 5IFJA 2AK4D 4X6BB 4DUWA 2AJSH 4R4ND 5LBSH 4ADIA 2VXSL 2IC2A 3LKRA 5FYLD 5GJTH 2XA3A 3C6LB 3D5OF 5C0AB 3EO1B 5E0FA 4LCYA 4XVSL 4JG0L 3EOAB 4BFKA 4PCYA 4KQ3H 2VERA 3RNQA 5KYWB 1JTOA 2H6OA 3HI6L 2VN4A 3KH3A 5FAAA 2IO5A 4MDIA 4IK7A 2VN5A 3S3BB 4XMUA 3ORJA 5KYXB 1L9MA 2ZYRA 3HC3H 1X4XA 2GQHA 4IYKA 2KZWA 3HS0B 2R1XB 3ZN6A 4PJ8B 3DTUB 3SBQA 3VA2C 5JW5A 2CKNA 2VDLH 4V33A 3DX3A 1TSHA 1NEZA 1PCSA 4FI8A 1IGFH 1MJUL 4JEGB 5GXBB 5CLXA 5T1JA 4A7GF 1N19A 1UXSA 2Y06L 2F1BA 3QDGE 1A2YA 1KTLA 4PBXA 2HX7A 2H2SC 2FB4H 1BBJB 3EFFA 3VTTA 2NR6C 4DQOL 2H1LM 5DJZA 1OW0C 3O6LL 3ZIYA 2X44D 2Y7QA 3X13B 3BE1L 2XTJC 5EUOF 2FX7H 3LH2L 43C9A 2WWKT 3MRQA 2VDNH 2J44A 2J6EH 3HZMB 4JDVB 1ZMYA 2O30A 1ROCA 1QACA 1EVTC 2FJSA 4AYFB 4KROB 3CH1A 3T6XA 4NO5B 1XIWB 4E41E 4HPHA 2Y1YA 2C8NA 3KLAB 3VI3F 3WJLA 4MB4A 2NSXA 2YN5A 3S34H 1FNSL 1ZANH 2R4SL 1KYOJ 2D7MA 4HAFA 3ARFB 3VTMA 2Z8VC 4FN0A 1F5WA 3PWVA 1G5GA 3L8QA 2LLNA 4GG6E 4YC2B 2OTUA 2WXHA 3P9MB 4QHNA 5CJOH 5J57B 1MFNA 1I9JL 1TU2A 1NC4D 2WSPA 1LJMA 1T80A 1BM3H 3ILQC 3IAPA 3MCKB 3L3GA 1YY9D 1LEKB 2WLKA 3F8UB 3MOAH 3D8MA 3AUVA 4PJAF 5ES4B 1F41A 2GJRA 1KELL 2ZX9A 1GCFA 4Q58C 4YSRA 5HVGB 5IQMA 3ZO0A 1FE8L 4ONGL 3EJCA 1OGTA 1MRCH 1JZ2A 3N2JA 3OQRA 3UAJA 2W65A 3AXLB 3NP3A 4OVVA 4WU7A 4LARL 2IDCA 4R5TA 4YVUA 1WWBX 2N1KA 4IGBD 4FAAB 2NY6D 1IIKA 3QJZA 1XAUA 4MMZC 3SYAA 3ESNA 3DX2A 1OAXH 4YHZH 1JFQH 4R83A 4JZOA 1T1ZA 4S1RL 5F8RC 4YLBA 5DJAB 4X8XA 2EEAA 1JCKA 3NIDE 3FB6A 1T03H 1SXCA 5E4IA 1D5RA 3PXJA 2HG5B 4OD2B 5D5MB 5DJYB 2B4CC 5CF3A 3C75A 3MNVA 2BCKA 1D9KD 2DMKA 1RERA 1CIDA 3GTTA 3UO1L 3WU1A 3BVWA 2HA1A 4QRRA 3X1EA 1KIRA 1KYAA 2WBJD 3C8DA 1WBZA 4NERA 4WFFD 2BZ7A 5GS0H 4KK5C 5JO5B 2BRQA 3FOLA 5TE7H 4M1DH 5DRZB 3QORD 1BOGA 1DEEA 4HSCX 3NCYS 2XHNA 4N24A 3X3GL 5AZUA 1C8PA 4LLMA 1UCTA 3DJZA 4QXTA 3NJLA 3RVXC 3KL3A 1KPRB 2XG4B 4HKZA 2ERJB 4LHUD 4MMYA 4PD4K 4TPRH 4BFIA 3ZE2B 2JQAA 4Z7NB 2CM6A 2O6FA 3PJSA 2FR4A 1ZTMA 4ZUWA 2XIDA 2GSMB 5AVRB 1AHMA 3V5DA 4DZBA 3OKOB 2CM5A 3QJHA 3MLRH 4WLCA 2X4TA 4XO4A 3I3DA 1NL0L 3IFPB 4JPIB 3TZVA 2KLSA 1TZAA 2AXFA 4GUOA 5D1ZC 5IJCC 3GUFA 2ISDA 5BZWA 2TRHA 1QFWI 1GMIA 1XMWA 5I6XC 5J1AB 3BKJL 2V3EA 3THML 4Y5YA 1QA9A 4I0CC 4S2SB 3MMEA 3HMWH 4LEOA 1PZ5B 2L04A 1CF8L 4I18C 2IADB 2BO0A 1B0GA 4WY7H 3VI4F 5DWUL 2QQKL 1V3KA 2WKLA 2BH0A 1MWAL 2Z31B 4QO1B 1FL3A 3W3BA 1A1NB 2IBZX 4X6FB 3O4LD 4YBHA 2PKDA 4GINA 1KXHA 2ATPB 3DV6A 3CLFL 3V6OA 3S35L 2XQYK 5IVNA 3GO1H 3MLVH 3DRQB 1IFRA 1XEUA 4OZGE 3N85L 3QFJE 1RK0B 2FTAA 1F3JA 4HGKC 3TXAA 1WISA 4AYBA 3F6IA 4NCC1 1R75A 4XE0A 1D7FA 1TZIB 2APVA 2JXMB 5AVWB 2KERA 5I1KL 3JWNG 4YSTA 3RB5A 2W0LA 1DFXA 1UD4A 2CBOA 3UZQA 1F11A 3DJTA 4FTDA 4K8RC 1LP9A 1YAZA 2B1AL 1PJ9A 2FWLB 1BWWA 2VLKE 1QEXA 5CGYC 2KDGA 5C0BA 2WUBL 1L9OA 1WAAA 2XWJA 3CXDL 4H88H 4R5XA 2WO4A 3QIUA 4K4KA 3U9PL 1NCHA 3FT9A 4P59H 4PG2C 4OIIL 5DJCB 1FF5A 3ZVVA 4GSDH 1ETB1 4ETQA 3RU8H 2H0JA 2PCYA 2CRYA 1AQHA 3VXNA 3B5GA 2F74B 2FD6L 3N50A 2BSSB 4E5XB 1N2RB 4JG1L 1LYQA 3BFOA 3SQBA 2D7TH 1SMDA 1FN4B 5F7AA 2YBGA 1F90L 4MAUH 4PWJA 4EO5A 2WINA 4P46A 1CICD 2XKSA 3TP4A 3QA3A 5HGBB 3M1CA 4XBEH 3BO8B 2BVQB 5KW9L 1AFVL 2DWDA 4F8TA 1VFMA 3D9AH 4ONFH 3CGTA 2G0LA 3MRDA 2EC9U 2FGWH 5DEZA 3KYKL 2QVMA 3LZLA 4PD4J 1JPFA 3JWNH 1B0RA 1DVFD 1QBAA 1CD8A 3V4UH 3QZOA 3GMOA 2CDFA 4WO4A 4XVUC 5I17A 3MV9B 4F1ZA 4QD2E 3KEHA 5JOPE 5LWYL 3WFDH 3RB7A 1JUFA 2OQJA 1MZZA 5CILL 2BVOA 2XQYA 2WP3T 4WEMB 3CXFA 3QXWA 4JM4H 4YHPA 4KTDH 4I87A 2XXFA 5KVFL 3CDGB 5MEQA 2APSA 3BN3B 3VMNA 1MFUA 1UT1A 4QHUA 4K9EC 3A5VA 1FNAA 4KH9A 4N90E 1XBDA 4H8VA 2F08A 1KDJA 4LAJH 3L4VA 2C3VB 2CO7B 2RCSH 2A9NL 3OKLB 4HMCA 3WLBA 5DJ8A 2Z35A 5ERWA 4AIEA 4KITB 4HUUB 5D96C 4B9GA 1C7SA 1PW3A 2Z64C 3V8OA 4KJYB 1H5BC 2BSRA 5DHVH 5IB2B 3EDJA 2H0PA 3ABZA 5ESAA 1MUJB 3Q3GB 4HZLA 3B8YA 2CRMA 2EDWA 2FQGA 1W0WB 3N44B 3D06A 1LEIA 1B3IA 1UB6A 2IH8A 4OAWA 3MODL 2JFCA 1A7RL 4L9LC 4NO0B 4IBSA 1NEZG 2JSFA 4M5YL 2XBDA 1F4XH 3K71A 2V3DA 4OV5B 4YFLI 3T0DA 1LL1A 2W0KA 1UT2A 3ULUF 1MFBL 4UYQA 2CLRA 3HUJF 4JHUA 4XPHL 5KSUA 2RD0A 5JORB 1KZQA 5F6HJ 3TU6A 4NGHH 1PCXA 3K8LA 3N6YA 2YO3A 2DQJH 2F19H 5F0LB 2H9GA 4ZS7L 1VENA 3LRSA 3TT3H 2R0LL 2BVPB 3ARXA 3ILEA 5T5FL 2PXYD 4ZNCD 3ZLQC 2GSIA 4U33A 5CGTA 5EOCH 3PREA 4Y19B 5FA3B 3WL9B 3FO0H 4G6KH 4AUYA 1F86A 2AABH 5E5MB 3C6SA 4D94A 3BUYA 4K23L 2X4UB 4PJ8D 1EUTA 3H9SB 3JWDL 4U1LA 4N6QA 1BF2A 5ANHA 2G9HA 4J8QA 4DKEL 4OGXH 1JGVH 2PPFA 4R4NC 2ZUSA 1ADQH 1NQBA 4WGWB 4BCZA 3RRQA 3BUDA 4MA8L 1H3VA 1IEBA 4DKFL 4QPEA 3U79A 2NLJA 4KV5F 4G7QB 4MMXB 3T1FB 5AW4B 4C56B 3LKPA 2HFEB 4YFDB 3VD5A 4DGYL 2IV9A 1PDKA 1SF5A 2J56A 1E4KC 2AJYL 4PSRA 3DX9B 2J1ZA 2GK0A 5I0ZA 5LCVH 4I0PA 2EIEA 1KCVH 1ZCRA 2EAEA 4X6DF 1AZUA 3MVSA 3K6IA 2GJJA 4OZIF 1X7QB 1HHJB 3MLTA 1UVQB 1CDIA 4WUKL 1CR9H 2XC8A 4IEFB 5D9SA 4KZDH 4N26A 1RH8A 5BRZB 2FJGB 2UZIH 4KROD 2XRAH 4H26B 1XIWD 3JZYA 2R1YB 3FFCB 4F7EB 1QSEB 5E7FA 1G7QA 4DW2L 2VR3A 3DRTA 3II1A 4LF3B 3KYMB 3N42F 2PYFB 1HIML 2I60L 2GUOB 4WNQB 2IDTA 2VYRE 3TN0B 1EK3A 4QF1B 2OMUB 9CGTA 2HLAB 3HAEB 4WJ5B 3WKML 4FTVB 2KUTA 3LZPA 1PLAA 2N7SA 2B5IC 3FONA 1W8EA 2P5PA 1HOCA 4HETA 1HCVA 3NIGF 2OA9A 5GZND 1IGCL 3KPRA 2AEQL 2WM0A 4UBDC 3U6RA 4XPGH 3OX8A 5D70H 4DK5A 3BQUA 5I71C 1E9QB 2OW6A 3L7EA 5E8PA 3ARRA 5F7EL 3VG0L 3BKML 3QB7C 5JW5B 2BNRE 3TONA 2VR6A 1AIFB 4WFED 3WGVB 1CS6A 2LLGA 2FH6A 4QOKB 1CN4A 2WK2A 3NFNB 4QHLA 3EJPA 3P73A 2Z7YA 5HVHC 2WBWB 4YUEH 3K1DA 1QSFE 3UYRL 2Q7NA 2DYPD 3KPSE 4HUMB 1FUNA 1I7ZB 1OAJA 1UXSB 5J12C 3T3PF 4H1LG 1A2YB 4GAAA 5EN2A 2CKBB 3SBPA 4HF5H 3F7PC 3VFNA 2A99A 25C8H 2WXJA 2OI9C 2XN2A 1P84J 3SY0B 4X6EB 2OLDA 4HIHA 4WVRA 1Q38A 1CGSL 5DJZB 4NO3B 5GSVA 4LVNC 5C92A 4IKIA 2GTZB 2LU7A 1NKGA 1KPUB 2KH2B 1TZGH 3MJ7A 4NFCA 5IHUH 1H3TA 43C9B 4AK2A 1PYWA 1T1XB 4U0QB 1TETH 4AJYV 4GW4B 4CADB 1XH1A 3OAUH 4UOJA 2NY6C 4XC3L 1D5IL 4QDGA 3US0A 5T3ZD 3T4YA 1MN4A 3CHOA 4EF3A 3A4AA 4I3GA 5AAMC 3LKNA 4U6HA 4XCNA 5J6HB 4PWEA 1GL4B 4FXKC 4NUJB 4Y1AD 2GBTA 4NQEA 3CVIL 3HMXL 3HG1A 1DVSA 3NCEB 5F3BA 1I85A 3K4DA 4WWNA 1BVLB 1KN4L 4DPAX 4LASL 2YS4A 2CHWA 1S7TA 4S11A 2WBJC 5BQDA 4IOFD 4KDWA 4CJ1A 5DR5H 5KAQG 1WAEA 1T20A 5C1MB 2A74A 4GI9A 4H1LH 2E47A 3QORC 3L3GB 2MEJB 5JPNB 4DWHA 3RI5F 1JYVA 4H5SB 1MCPL 1T3FA 1U8LA 3BGMB 4Y5XC 4JM2B 3N5AA 1YMHB 2XA8H 4I88A 2ODHA 3B3IB 2ED6A 4JANA 5HDLA 3VXQB 1NSNL 2F15A 5CGMA 1WE5A 4K3GA 4DJMA 1T04A 4JFEB 4K9JA 4R3SB 4EIUA 2W38A 2ADJA 5JR1L 2XNAA 3G5XA 5EC1A 4G6AD 5FGBA 4NZUH 3NPZB 1S3RA 1U3JA 3BUPA 2WVVA 3QQ4B 1CL7L 1HI6B 4Y4HA 1ZLWH 3WTUA 4LOEA 4Z3FA 1WTLA 43CAB 4I89A 2XV0A 3TNMB 1OCCB 5I1GH 4LCUB 1OANA 4EI6B 1WT5A 4G8AC 4IRJA 4HOXA 4UOW1 4BRJA 2QGDA 4FFYH 3VRIB 5HDWA 4QRRB 5GJSH 3EJRA 3QO1A 1HCZA 4NX0A 5HP5A 2NY5C 3FCSA 1M7IA 3T2NL 3S2AA 4YGVA 3NSDA 2WW8A 4PJ9B 1LK3L 3VX1A 5G5DB 3CX2A 3HE7A 2XQYG 2QSCL 4IBZA 4J5VA 2E75C 4RWHA 3P4OB 2H32A 5J9PB 2XDHA 4QXTB 5A43C 2VKXA 4HKZB 2EDLA 3ABMB 3ESMA 4N5UA 5IBTH 1OP9A 4GO9A 4H0GA 4GAGH 1L9NA 4QUOA 3SYPA 1XT5A 3NRFA 1MNNA 1OSPH 1P0SE 4F9LC 3W1ZA 3ZDYF 4DZBB 3ATFA 3EYVA 5IJBC 1G7JA 1G4RA 4HULB 2SEBA 2X4TB 4YEEA 4OH2A 5IVOA 4ABQA 1BAGA 4X5WA 3RE0A 1AO7B 2XG5A 3FFDB 3OB0K 4AE0A 5IOKA 5D6CB 3FTUA 4IMKC 1Z0MA 4MNGA 3S5YA 1QA9B 3SJVB 5HDQL 3MLPA 4N85A 4LSVH 5DMIL 2YZ8A 5IQOA 5I24A 4E0RB 1FP5A 3A6BH 3MMEB 2JCCB 1QPXA 1AZBA 5MEOB 1ZLVK 4BQ8A 2G60L 1RFDH 5B38B 1R24A 1PQZB 3MV9D 4GMSH 3D25B 5EU5A 3MU3A 3UADA 2F5AL 3NK4A 2B4CL 2EIDA 1M3IA 4NFBA 1K85A 4OGAD 1KB9K 4OSUH 2OSXA 5BMFL 2A6IB 4K5MA 2N7AA 4XP1H 4UQ3B 1JYXA 1QO3A 1CICC 4RX4A 5DRWB 1WC7A 2NSMA 1ZA6A 3ME0B 4JDTL 5LVEA 5EUOE 4W4OA 1J5OH 3H6JA 5D1XE 3D3VB 5DJ6A 4KKBC 2Y23A 3VRLF 2QMKA 2ZWSA 5L2JA 3DHJA 3KJ6H 3HN8A 4ANXA 1BWMA 3T08A 3NN8A 1FV1A 5E6ZA 4IK6A 3MO1B 5HHVL 1PZCA 3LKOB 3VI3E 3OGOE 3UZQB 3DHUA 1QSVA 3PWPA 1BFOA 5C0BB 3WS3A 1QLEH 2ROXA 2VT0A 4H8WC 4LCWE 1GOFA 1L9TA 1FI8C 4P2QA 4WI0A 1JF6A 2DEWX 4HSAC 4IW4C 2UWEF 4P48A 4RMRA 2H0FA 5D93C 4PMFA 1TUPA 2V3FA 4WSJA 3CV5A 4MRBA 2RTTA 3MDJA 5EZIL 4TNWF 5LAPA 4MB5A 4UTCA 4PJEA 3GDBA 3FF8A 3WXWH 4PJAE 3DXAE 5FR3A 2A9DA 2DQDL 3HZYA 3QRGL 3DX8A 5L8KB 2WINB 3QNXA 4P46B 2AGJH 5C0DB 3QC6X 5I2IA 2NYZA 4E42A 2I85A 4FQ2L 4QRQB 1OV8A 3QQDA 5SWQA 3SOBL 2IIJA 5CO1A 3P3YA 3EO0A 4X4XB 4N20A 3QNYB 1JPFB 3N1FC 4L4TE 3GMOB 4KZCA 4WO4B 5KVDE 1O6VA 3OR6A 3RZCC 4AKOA 1EBAA 3BJ91 2NY1B 3IFOB 1JXDA 3TO4A 3WFHA 4CSZA 1JUFB 5IK3B 4EKJA 4WHTA 1UH3A 1UWYA 1FNHA 2XKUA 4UIKH 1DBMH 4PIRF 2W0PA 4XNZC 5MEQB 3H42L 1RY7B 1M7DA 3K6SB 3WUZA 4G8FB 1RZPA 3NMEA 4OBSA 5C07D 5C0CD 1EGJA 2O6DA 1MCCA 1BLIA 1NBQA 4UINL 3O11B 3AROA 2XV6B 2PXYC 2EIKB 4K8RL 4WWKA 1R47A 2DQUH 2Z35B 5ERWB 4DZ8A 4APXA 4C56D 1KB5A 2CK0L 4LLYB 2A6DA 1QSZA 2XKNA 3FRUB 5CJXC 5CCHE 4BSVA 4WIQA 3C60B 4JFVA 3T6ZA 3O6FA 3TCLA 3CPLA 3MOBH 5EEWA 2BJML 2VE6A 2AJXL 1P4BH 1OD9A 2F0CA 1JGEA 1F58L 1S5HA 1IFGA 2BP0A 4GUPB 4Z7WA 1MIMH 1MY5A 4IOIA 3AG3B 1JDDA 4F8PA 4J23A 1NAMA 3BAEL 4M43H 1NCDL 5F9OL 2PTVA 2OSLA 1EAPB 4A6YL 4XX1G 4KXAA 4MA1B 2F61A 4MD5B 5IMOB 2WPGA 3IGLA 1V3MA 1XSJA 4JZJC 2YAQA 4PU2A 3ESPA 1S9VA 4GAJH 1YEIH 3TN0D 1AI1L 3LRSB 2P8PA 1OB0A 4K73A 3VI4E 3O2DL 4M7KL 5IQ9B 5BQ7A 3QISA 5D7JB 1BVZA 4G7RB 1URLA 2Y72A 2QADB 5H94B 1OB1B 2W1NA 4KMTL 4PP1D 1HZHH 3DROA 5IW1A 3MBWB 5GQBA 1MRFH 3U7WL 1ZV9A 4HYTB 2WXPA 4PTUA 4M7LT 1XZWA 4DKTA 2K6WA 4BFJA 4LLUB 4BH8B 5EDXA 4XWGH 2VO5A 5BZDA 3ZKMD 3BUYB 1E5ZA 3VXTB 3WS6A 4P2OB 2WYHA 2WZ0A 1YEJH 4OGYL 3W0WA 1NWOA 1RCYA 2YEVB 3BWZA 5JTWA 3CBJB 5T1KB 1PKOA 3T77B 2VR4A 4YK4B 5LNDA 4YC2C 4D0BB 4J3OF 2J1WA 3DOIA 3UJJL 1IM9A 4YOKA 3WTTA 4LL4A 5K39A 3OPZL 4OB5L 1U3HB 1TEFA 4NNPL 3TCXA 2I07B 1DBKH 1OAUL 1IGYA 4K5PA 5C2BL 3H4HA 4NZJA 1DJGA 4AW4A 4M5ZH 4R7NA 3SGKA 3T09A 4JDEB 5F0JB 1Q94A 2CD0A 4DN4L 3SKOA 5JW3L 3GHEL 1BJ1H 2FEEI 4KMLB 4WJG3 4Y88A 4TSAL 1UEYA 2CIIA 2IQ9H 1UA6H 4L3FA 3LYRA 4MB1A 5D9SB 3SDXF 3ZYIA 1JHKL 1KLUB 5DSCA 3DVGA 4EIZC 4NC2B 3H3PH 4O5LL 4YJZL 1GGCL 1LTXA 2L7EA 1GSMA 1A1OA 4HJ1A 1FORH 1HOEA 1SVCP 3FMGL 3RVTC 3K6FA 2N56A 2BY1A 4L29A 3W38A 2R23B 1J9TA 1G7IB 1P4IL 2YKLL 3BOVA 3CDYA 3P11H 2B14A 3QHFH 2PYEB 5JQ6H 1MCQA 4PS8A 3FONB 5E00A 1WZ1H 1OM9A 4UT6L 1OGSA 3KPQA 3L1GA 4HWBH 3NRPA 3W5NA 2G75A 1IT9L 1VADB 2FQEA 3T0EB 3W9EA 3JT2A 4R0LC 3BRFA 1MW2A 4MNQE 5BCAA 5FYLL 4G6JH 4GMTL 1B4JL 32C2A 5ECJE 4ES9A 1SLXA 2W9DH 2WGNB 2ZCLL 3L7EB 4N0RA 5ALBH 3UAJD 5AZEH 3S96B 5EA0H 5FCUL 1MCIA 4GAFB 3LDBC 3QIBA 4WW1A 1OL0A 3PQYB 2HT3D 3V55A 1H15B 3VGGA 1DVTA 1UXMA 3FPYA 2VLLB 4IOFC 4QRPB 1DFBH 3UC2A 1DJWA 1LWJA 3QUXB 5DC2A 4P9HC 4LVOB 2PWFA 2BSEA 5KJ4A 5JHLH 4IIQB 2UUDK 4HIHB 3S88L 4LLDA 2VERN 3DURB 4WHYG 4N8PA 5SV3A 4XB7A 3U0PA 5GSVB 1ZSDB 1MHHA 4QRRD 3VG9C 1GS7A 3QXUA 4XRCA 4CSTA 1Y07A 5HGDB 4HJJH 1BPVA 1HXMA 3R8QA 2W88A 7FABH 1UWGH 5DCCA 5D2NB 2MNJB 4PJ9D 2E7BA 3GRWA 3ULUE 1CFVH 4PGDA 1IGJA 2CMRL 3HUJE 3MCYA 1WCBB 4U49A 2IBGA 4HALA 1RZKH 2WTRB 4YHMH 4I9WE 2BRRL 5A2IH 2B7DT 3VWJA 4L48A 1S8DB 4UIMA 1YNTA 1OALA 3GXPA 1I8LC 1G94A 1Y6KR 2QLYA 1NBVH 1S7TB 2DQGL 3CN0A 5I1EH 4GI6A 2N59A 3VD0A 3TZVD 1CVRA 5L4IA 5TTRA 4PJCF 2A74B 1L9RA 3GMMA 1LDPH 4MRCA 4YSAA 5CBAA 5GS0C 2VDPH 2AMGA 3PPSA 5EO1A 1HX0A 3L4ZA 4JK0D 5BPPA 4DOHB 1U8LB 3LRMA 3GSWA 2FSDA 4BGDA 2I24N 3TEXA 2G3NA 1YUKB 2AP2A 1PLBA 4X8CA 4YXHH 4M4RA 3G04B 1QRNA 1RZ8A 1N12A 2EH7H 3T65B 1DQJB 3O9WA 4CC0A 4PS3A 1J8RA 3LPGA 4Q9QL 2XNAB 3EDDA 2ZCKL 4PJIA 3N0AA 2X10A 4OI7A 3ZDZF 5EZLA 2WWMD 2WVVB 5I19H 4KKQA 3TH2T 4JVWA 1XGUA 1XF1A 2O6PA 2BSTB 3P3RA 2CCVA 1RULL 4GLRH 1FFNA 2J3SA 3L17A 1YPZF 1LE5B 3HPJA 5F71A 4S0SD 3S37H 4X6DE 3WE6B 5B8CB 3WKNA 4JR9L 2EDOA 4W81A 5DU7A 4OZIE 3D3VD 2B9BA 4LCCC 5DZAA 1HWHB 3INUL 4PJ5E 2FEDD 3UYOD 2VDKH 5J13B 3L3KB 5AWNL 5GGTH 2XTLA 2XZQL 3FCSB 3PXHA 1M7IB 1TR7A 3ZYJA 5GRUL 4XX5A 1IBZA 1ECYA 3CBRA 4JG5A 3PWLA 5C0BD 4ZZKA 5DUBA 1KJVB 2FK9A 5HHME 2XFGB 4OGAC 2JK5A 2DQHL 1HNYA 3CFDB 3QIUD 2YJQA 1A3ZA 1GJUA 5JMOC 4R90L 5EO9B 5GS2H 4HUCA 4AY0A 3F58H 4KKNA 2ENPA 5FUZL 4U7KA 3J7HA 5CUSH 4YHLL 3NEEA 3OB0H 1EAOA 1A1MA 1G7JB 4IHOA 2PCPA 4PEEA 1NEUA 4XAWL 4LCVA 4YHYB 2JI1A 3APCA 1RURH 5E1IA 4X5WB 5HD8D 2BPBA 1WRFA 3GBDA 2HT2D 5IJKC 4P46D 1CJYA 3KVPA 1IBBA 1THAA 4LLWA 2J57A 2YRZA 4I2XB 1ZLVH 3F7QA 3G5VB 3D6GA 4MNGB 1S9WB 1HK6A 5JW4R 3FQ2A 4TQEL 3BIAX 3SDAB 3EFOA 1NDMA 1W15A 2KDYA 2P5WE 2XX0A 2ZT9C 1R46A 4L4VE 4YDVA 3ZJAA 2QSTA 3OAYH 4LNVA 4WO4D 5CZXD 2B2XH 4M3HA 1M4KA 3RUGA 3FH8A 4Y2DB 2XACC 1M2VB 3N41B 5EU5B 3S36H 2WLIA 3E6HA 1T7WA 5EORH 4BZ2A 3WNKA 4BQ9A 1J8HE 4LP8A 2PPAA 2X38A 5E8OA 4Y4KB 1CDYA 4QJ5B 5DEJA 4J27A 4OFDA 2O5YH 2OZ4L 3VH8B 4D7BA 1O6TA 1WGOA 5MI0B 2Q3XA 4IBLT 3STLA 3A6CH 1AC6A 2NY5L 3CFTA 4ICXA 1TJIL 3GMNB 4Y2OB 2FBOJ 3E8UL 4FFZH 3AUWB 5C0IB 1U58B 1RKRA 3HC4H 3QH3B 4NZTH 5DJ6B 4D3CL 4MXQC 5H37H 4F8LA 5FK9B 1AAJA 2K70A 1INQB 4OZHF 3WCYA 1I3GH 4BFBD 4LZKA 1DQMH 2BLFA 4A2FA 1BF5A 3N04A 3WTXA 2WXRA 5B1AB 4ZG1A 1L3WA 4HKXB 1WBXA 3QQ3A 1HJBC 3PWPB 3ZZSA 2AAAA 2WCSA 3WS3B 3IVKA 1JPGB 2YBRB 4LE8A 4B5ZA 4PREB 4CBPA 1FQ9C 4RESB 4ZAKA 4AVIA 5CWSA 3ZKSD 5HSFA 3LEVH 4Q56A 4ETYA 1W72L 3LB6D 4PRHB 4RA0C 3EUDA 1U8PB 3DX7A 3PWJB 3BDYL 4LEBA 1MI5B 1AOZA 1UD3A 5I1DA 1ESOA 4JO3H 4KX7A 1WA0X 4A2LA 5J6GA 3US1A 5F9DC 1K72A 1BEYH 1E4WH 5AOKA 1BMWA 1SBSH 5DD3H 3UH8A 2E7MA 4AG4L 1ZK9A 4JKMA 1KXTB 3HZYB 2WZPA 4HAKA 1CLOH 2BNQA 1MCLA 2XY2A 4G70B 4NM4H 2FNBA 1CPUA 3RJOA 4XCFH 3U1SL 5T3XD 3QXAA 1AGBA 3QQDB 3WNJA 2R69A 2YOAA 1Q72H 4PI0A 4M62H 3FO2B 1FGNH 2WB1A 5D7JD 2VDRB 1KG0A 2VN3A 3I50L 3QSKB 2QADD 4P4KB 1U3ZA 1NBZA 3LPWA 4LQ1A 3QJOA 4P07A 3RI5K 3T2QA 3DMMB 4FP8H 3KZ8A 3VGHA 3B83A 4M5TA 2YSSA 4RMQA 2CO1A 3UCRA 2CR6A 1I31A 4X4KA 3UJTL 3SGDI 3WFHB 1DSWA 2AV7A 1U8IA 4A2MA 3L95A 5JIKA 1QNIA 4QXGH 2LOEA 1QHPA 3PY9A 3SE3C 4LFHD 3MREA 1KBBA 3S4SB 3T4AB 2WKOA 4WCYL 1M7DB 4OLXH 4HOZA 3FUEA 3MV7E 4N2NA 3SZKC 1SQ2N 5IESH 4UQ2B 4R26H 4ZBJA 3GJFK 3AITA 2QL1A 3T9WA 2HUEA 2R2EA 1N5AB 1T7ZA 3RWFB 1U9KA 4FNRA 4UUJA 2XWDA 5DD5H 4FXGA 4H8WL 5AAPA 4APXB 1OK8A 1NCWL 2Z0UA 4PP1C 1U3HD 2XKNB 3VXUA 1A6ZB 2VWEE 4BSVB 2BY0A 3ARGB 5KSAB 2CAKA 1XD0A 1JGLL 4BUGA 1JVKA 3IJ9A 1IKFH 3F65A 4LBEA 4LOVA 4I0PD 4YPGB 3U36B 4LL1A 3V4VA 3ZKMC 2ZOKA 3BKYL 2BIIA 4CGTA 3E6FB 3UL4A 2ADIB 2VE6B 1ZHBA 2Y0SA 4RDBA 3DPBB 2P26A 3ZDYE 1QX1A 4RA3A 5DK2A 4AMKL 3NA9H 3GMLB 4Z7WB 1ZKAA 1BD2A 1ULVA 3DK2A 2DJ4A 2J5LB 3TT1H 2AJVL 4RMBA 4LSDA 3D87B 4HS8H 4A7TA 3D85A 2NUPB 5EU7C 1HNFA 2AQPA 3Q1SH 5KJRH 4HWZB 4ELKA 1SGKA 3PG2A 1YEEL 5FA4A 1U30A 4G1EA 3CSFA 3UABA 4HBQA 1U6AH 2BWDA 1T1YA 3K72A 1C5BL 4BFGA 1WG3A 5BQ7B 3EOBA 3EOTH 4KTYA 1RMFL 5L9DL 4YHOH 1LVEA 2EO7A 3BVNB 1J88A 1CLZL 1I1AB 2FUTA 1N68A 3DUHA 3MLXL 4N2HA 4OIBA 5A2FA 4Z5RB 4O58L 5K9KA 5ANME 4QEGA 3IDXL 2APWA 4PTUB 3T0ED 1DQLL 2A6JA 3KPRD 5E9DA 4R7LA 2HTKD 1V27A 1OCWH 2NZ9C 3WJLC 4G42B 3BQUD 3K0WA 5E1GA 3NH7L 5LXVA 4FQCH 5EEUA 4RDQG 5LG1A 1AE6H 5AW9B 2DIBA 5D7LB 3KE0A 4YXLL 2X4OA 4KU1A 4WKXA 4F58H 3WLWD 4AM0A 2EACA 1PAMA 3VRLE 5I82A 3OKKA 5IIEA 2OFQA 5MENE 5JW4N 2NXZB 4Z0XA 4L8SA 1MCFA 1T5WB 3QUYA 3BN9D 1L9QA 3U6XA 4AGQA 1UENA 2DLFH 1VACA 1W16A 4AV0A 4KO9A 3IEAA 4HUXA 2XOTA 3PP3K 2UWEE 5IB5A 1NAKL 5IFAL 3EJZD 4GRLC 3BAYA 3MOQA 4LSPL 2VDOB 4N6RB 1XGYH 1E43A 4R7NB 2FHCA 3UAJC 1YMME 4M9OA 1QI3A 2O6CA 2I9TA 4HEMA 2HT3C 3ATEA 4WEBH 1F2XK 3DIFA 5DSCB 1SNRA 2X3CA 5LUMA 4LRNH 1F6AA 3O2WH 5BS0E 1E6JH 4JRYA 1UWEL 2A77H 5DZLA 1H3XA 1RVFL 2DI8A 2X9YA 5I30H 4NQED 5I74B 3DSFH 3MRCB 3HG1D 5IWLA 4G6FB 4NS0A 1UACL 4P5KA 5ESQA 4IMLA 5KSVB 4TNWK 3ECWA 1X5JA 4J4PA 3R18A 5AG9A 3OHMB 4X4ME 1RUML 4L29B 5A2LH 1VEMA 1IAIM 1HSBB 3G6JA 4TUJB 4ZMNA 3EFDL 2ZOLA 4PB0L 1L0PA 3B6SA 2HCZX 3KPQB 1CBJA 2HB0A 4JRXE 4KVCH 4Q6IA 1IV8A 1X9QA 4MZ2A 2CA4A 3GBMH 1KUMA 5CBEA 3W9EB 4JY6A 2XYCA 3QEQE 5KYNA 1QBMH 1SEQL 1R3LB 2MSPA 1ORSB 2VIRA 5IUSA 4TF4A 2CXKA 2A4EA 2J4WH 1G84A 2ZOTA 4NWUH 3MR9A 2NQCA 4WW1B 3D0VA 5DGRA 1N7ML 4KRMB 4FABH 3HKFA 4LO9A 1CFSB 4N8CL 3PRZA 5D1QA 4CVXA 3FQXB 2UUDH 1SLWA 4NWTH 3T6WA 1YYLH 5I0YA 5ADOH 2NX5B 5KVEH 5D7IA 1NCUA 4NN6B 1EZVY 4J28A 3TZVC 4Y4HD 4JVUA 4UM9B 4NQCA 3GSVB 1KACB 2CO2A 2NY0B 3I85A 3S3JA 2VDLB 2WV3A 3BPOB 1GVIA 4OM1H 2AW2A 4JKNA 2IWFA 4JJ5B 3LV3A 4IRJD 1A02N 2Z92A 2EYTA 4Y5YC 4PJBF 4LLDB 4Z7QF 4PS4H 5F7YC 1A3QA 3FB7A 1MJ8H 4PJGA 5DQDH 3UAAA 1RJCA 4AQAB 1NGZB 1QNZH 4XRCB 1RZJH 4L37A 2CNZA 4ZMQA 5CZVH 1Y0LA 3VSVA 1TLMA 1C12B 1RU9H 1TITA 1HXMB 5DS1A 4NUMA 4FZ8H 1XZ0A 4Z7VF 3IKCB 4BINA 3CFJB 4O51A 1E28A 3TVMB 4PGDB 3HE7D 1RUPL 1K9TA 3L16A 3LIZA 1JS4A 4AL8C 3AB0C 4XCEA 3KYNA 1N18A 4HG4J 3QDGA 3GKWH 3QUZA 1O9VA 3V6OC 4OFQA 1QUPA 1HL4A 2YPVA 4OD1L 5IBUG 2VDNB 5BOPA 4UIMB 3NQIA 4CKVX 5TH2A 8FABA 1S7UA 1Q1JH 3K3QA 1QHOA 3QQNA 3CLEL 2X88A 2FEDC 1U91A 5AB2A 3G08A 1D5ZB 5T3ZL 1EXUA 4N4YB 5HXMA 4DP1X 1JMZA 3GMRB 3DHMA 3JTSB 4Q0XL 5FO7B 1T1WB 5M95B 5KOVC 3CN3A 2NZIA 1DQDL 2XXMB 3UTTB 3P02A 3V5HA 3AREA 4WZ9A 3UTZA 4JO5A 3K1KC 5DMGC 5HYQA 1FIGH 4LLQA 5MP6L 1FGVH 3QIUC 4ZO6A 3IXAB 2WLZA 5HI4D 1R19A 4ORGB 1FZJA 4JPKH 4XVTH 2CXGA 1JZ5A 2R2BA 4P5TB 4GG6A 5DK0A 4Y2DD 4BE6A 4P9HL 1KN2H 4ELMF 2R0ZH 5ICXB 1GH7A 1E6OL 4C54A 4Z95H 4CMMA 5IJDC 1MAJA 4RFNB 1SDYA 1KDIA 3BCFA 3UPRB 1XTLA 2ARJB 3SPVA 1AR1B 2HT2C 5IEHB 1ZTXE 4RX4D 3CK0H 4PVMA 3V52L 4AV5A 3BZDA 3HPJB 3M17A 3ARDA 3ML8A 3OV6A 1M57B 2IGFL 3EADA 4WUUB 1E30A 4X0KB 1MCWW 4XH2B 5I1CH 3LD8B 4PFEA 3SDXE 4RGOL 3ZKXB 4CMHC 1SXAA 2WNXA 2H26B 4Y9EA 5HYJE 5KBPA 4WO4C 1I9RH 5CZXC 4YZFF 3PWPD 2YKKA 2DQMA 1YNKL 4GLRI 5DUBB 5FYKD 1AXTH 1RIUL 2DDQL 4NKOA 4P2QD 4RGMC 4WV1B 4HV8B 1KBVA 3TO2B 5I16A 2BHUA 4ENED 1ZGLM 5DFVD 1O0VA 2A2QT 5E1AA 4YMPA 1INDL 5ID1A 1HS6A 1NUFA 2R9HD 1AACA 3LZFL 4PR5A 1A1MB 4JNXA 3I6SA 4PLKD 3CZNA 4DCQA 4H8PA 1S7WB 5DT1H 3KBFA 4XP4H 4LIQL 3ROLA 3IETA 2HWZH 3ZHNA 1KC5H 4XNQB 1D2OA 4Z8FL 5D7KE 5T33H 2FLMA 1IFHH 2ALWA 1UM6H 2R8SL 3SPGA 4B9FA 2JJTA 4ZTOH 1SMAA 3QS3A 1PL3A 4BFFA 3R1GL 3HS8A 2ZG1A 3EF7A 1DJSA 1YDPA 1U8NB 3UX9B 1IC5H 3LB6C 4ZOEA 5I6LA 4U05A 2AV1B 3QWRA 2ADGB 1L9PA 2NYYD 1I9EA 4AE1A 5IVZA 3TO4D 1GC1H 4BV1A 4F2EA 1YAIA 5M94B 1U8MA 1KNOB 4EOWL 5CSGA 2CDEB 4QNPF 4G7YH 3UACA 2Z7UA 1VAHA 4W9EC 4MQ7A 1E50A 4HZAA 3WG7B 1OT1A 5EU6B 3OR7B 1FSKC 1KBGH 4FL4C 4DGWC 4Z7NE 3I3EA 5T1LB 3VQLA 1FVCA 2MFNA 1P9MA 3CFCL 4K94C 1OSEA 3C2AH 5C0EB 3ARBB 4WWKD 3PE9A 5FCSH 2BVYA 2RALA 4G72B 3VFVA 4M6OH 1RK1A 3RL2B 4M48L 1ZHKB 4PRBB 2DM3A 3ET9F 2L4OA 3O6FD 3CC1A 3IVKB 4ZMVA 1L0QA 4IDJL 2RFXA 5SWSE 2Z8SA 1QFUL 3REWA 1TZHA 2ESVB 2EXTA 2UXGA 5IHZA 3VDBA 1HILA 3QFJA 4X4YA 3PP4L 1PLGL 5IMLA 2VLRE 2VABA 4JHWH 4KPHH 5J6GB 5E03A 1HINH 1WFUA 3P4NB 3H7LA 1FIEA 2Y5EA 2BC4A 3A4EA 3UBXG 4CNIB 3V4PA 2I32A 4LQFH 1AY1H 5HHPA 5T8IA 3AM8A 4TL5A 4BZ1H 3FOMA 2IDFA 1NMAL 1UASA 3BXNB 3BHBA 3KPNA 1W6WA 3AG1B 3GSQA 1MW3A 1OAQL 3MLYL 4OLVH 3ULSA 1IU1A 3HR5A 1L3NA 5DHXB 4GKNA 4I0PC 2VGLM 4X5XA 1VFBB 1ZT7B 3OHXA 1KWGA 1A8JH 3TV8A 1S7XB 2X0UA 2XZAH <