2FQFA

Crystal structures of e. coli laccase cueo under different copper binding situations
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
486
structure length
465
Chain Sequence
RPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of E. coli laccase CueO at different copper concentrations.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords Blue copper oxidase cueO
total genus 133
structure length 465
sequence length 486
ec nomenclature ec 1.-.-.-:
pdb deposition date 2006-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2fqfA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2fqfA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2fqfA03
4GXFA 1A4AA 1CYWA 3UGEA 4BWWA 4YVNA 3D12B 1JZIA 4EF3A 1PLAA 4DP2X 1BAWA 1E30A 2IWEA 3HB3B 3FT0A 1SDDB 4YSQA 1OF0A 1CC3A 1ASQA 2MTAA 2MRYA 1T5KA 1NIAA 3SBPA 1ZDQA 1NIDA 2ZONA 4DP8X 2E86A 4RH4A 1OCOB 1WA1X 5ANHA 5E9NA 4QLWA 1ILSA 3T6XA 2CALA 1WS7A 2CBPA 2GSMB 4KOBA 4E9YA 2UXVA 3QJSB 2ZWNA 1MG2C 1J9SA 3FQ2A 3N2JA 4JHUA 5I5JA 2IDTA 3MBWB 1TKWA 4G7SB 1L9PA 1JXGA 4HCIA 1KGYE 1X9UA 1L9RA 3TA4D 3JT2A 5IY5B 1RKRA 1OE1A 5B7EA 4E9RA 2EIJB 1AIZA 2TSAA 1SF3A 1E67A 2A3TA 4PAZA 1JVOA 3S3BB 3WKQA 3PLYA 5TK4A 2CJ3A 4BWTA 1E5ZA 1AS6A 2IDSA 3UABA 2FQGA 3PXLA 3NJNA 1WA2X 3FU7B 4W9ZA 4E9TA 2IDFA 4YL4A 2DV6A 3NP4A 4AKQA 2OCCB 2AZUA 3WNIA 1OCCB 4BWUA 3IN0A 3NSYA 1HFUA 4A2EA 2GHZA 1A3ZA 1PZCA 2BP8A 3EH5B 1SHXA 2BZ7A 1IUZA 2IDQA 1VLXA 1ZIBA 4AX3A 5I6OA 3JTBA 4JHVA 1CUOA 1WAEA 3ABKB 1E5YA 4HALA 2AFNA 2CCWA 3ASNB 1FWXA 3WG7B 3NJKA 1KV7A 3TU6A 8PAZA 2PP9A 4YVUA 3N55A 1AR1B 3X1NA 1ASPA 1IC0A 4G70B 2BW4A 1MG3C 1TEGA 2Y1AA 2IAAC 4G7QB 3U25A 3QJTB 2UXFA 3IBOA 1GY2A 5D4JA 2RACA 3FYEB 4DP4X 2LLNA 3OMNB 2VW6A 3FU9A 4YSDA 2X88A 2VSMB 3CDZA 1HAWA 4L0PB 3FSAA 3FSVA 1V10A 1UATA 2TSBA 5AFAA 2X87A 2IDUA 4UF7C 1AZUA 3BVDB 4AZUA 3GYRA 2PPCA 4W1TA 2B3IA 4A2DA 3ZBMA 1AQ8A 3OQRA 1AOZA 2PP7A 4YSAA 1ASOA 1AG0A 3CVBA 3T6VA 2HX9A 4YSTA 2R7EB 2YAOA 4FAAB 1XB3A 5PCYA 3ABMB 1JZHA 4DP0X 2XUWA 3QJQB 7PAZA 1BXUA 2VSKB 4YSOA 1ET7A 2PCYA 3H4FA 2QPDB 2DYSB 2J55A 5FC9A 1QNIA 4DP5X 1QHQA 2XYBA 3EF4A 1RCYA 1JXFA 2GC7C 1L9TA 3CDZB 3NP3A 1M57B 5B7MA 3NJHA 4TXVB 3V9EA 2FWLB 2YAFA 2ZOOA 1L9QA 4HHGA 1MZYA 3ERXA 2VM3A 5F7AA 1FFTB 4HZ1A 3H56A 1KDJA 1A8ZA 5D4HA 1IBYA 3FQYA 3AW5A 2PPAA 1MDAA 2I7SA 1JOIA 2EIKB 3CG8A 1CURA 3X1EA 4AKPA 2GIMA 2UXTA 4N4YB 4F7KA 1BXAA 3X2QB 4GP4B 4FA7B 1ET5A 4KNTA 4YSCA 1OOWA 3S8FB 2WO2B 1JZJA 1XMEB 4K9JA 3PAUA 4X4KA 1ID2A 3ABGA 3CZUB 2AZAA 4P5RA 2FQDA 2FTAA 2XX0A 2FJSA 1BQKA 2BP0A 2B08A 2HLEB 5B1JA 3NJIA 1BQRA 3G5WA 4E9XA 1A4CA 2EINB 1AANA 1AACA 3OD3A 1V55B 2GC4C 1PLCA 2N0MA 3AG4B 5PAZA 2Y69B 3EHBB 4GP5B 3AG1B 3KW7A 1AAJA 2WSDA 2HRGA 1NIFA 1SHWA 2IWKA 4KNUA 4NERA 3OM3B 5I6NA 1NWOA 1AS8A 3PCYA 1OE2A 1NZRA 3WIAA 1ETJA 3GDCA 3V9CA 2FT8A 1EZLA 2JKWA 2BP8B 2XU9A 1TU2A 1JXDA 3C75A 2HX7A 1M56B 5B1JC 1NPNA 4A2GA 1URIA 2H3XC 3IEAA 2DYRB 4F2EA 1PNCA 4DP6X 3X1GA 3S3DB 4BDVB 1NICA 1PNDA 4YSRA 1DZ0A 2BP0B 1A4BA 3H4HA 4HCGA 3ASOB 1PMYA 3PAZA 7PCYA 1GS8A 4HIPA 5B1BB 1WS8A 3FSWA 3X1FA 3FU8A 2XX1A 2Q5BA 1TEFA 4PCYA 3FU7A 4E9QA 2GI0A 3FYIB 4WTQA 4DP1X 1W6WA 1BQ5A 1ZIAA 5TK2A 3QJUB 2BW5A 2QDVA 1JERA 4HCFA 4YSPA 4DPCX 1KYAA 4Q89A 4KO5A 3TBBA 3L45A 1ADWA 4ENZA 2PPFA 1OCRB 2IH8A 3FPXA 4A2HA 1R1CA 1KBWA 1SNRA 2P80A 4A68A 1F56A 2FQEA 2H47C 2BZCA 1GW0A 2YQBA 4E9WA 1ET8A 2XV0A 1DYZA 2GB2A 2YAMA 1RZPA 1W8EA 2I85A 3KW8A 2PPDA 2VW7A 1NDTA 1NPJA 2CAKA 1J9TA 1KCWA 1V54B 4GYBA 5AZUA 3NT0A 2OV0A 1J9QA 5I6MA 2QPEB 1KDIA 1ZV2A 2VMJA 2XWZA 1OCZB 2FQFA 2PLTA 3CVCA 4G72B 5I28A 3AG3B 3X1BA 4NAJA 2J56A 3NSFA 2CUAA 3NJGA 5D4IA 1PF3A 1QLEB 3EH3B 3MX0B 1SDDA 1PAZA 2YAPA 2QDWA 1AS7A 2IH9A 1N70A 2XXGA 2YARA 3QPKA 4Q8BA 1IBZA 1JZEA 2YAQA 2J57A 4G71B 3NSCA 3FPYA 4BXVA 3NJLA 3UAAA 3WI9A 1PLBA 5B1KA 3NYKA 5I26A 5LDUA 4M3HA 3T6WA 3CVDA 3FS9A 3TASA 4HAKA 2W88A 2J5WA 5F7BA 1PZAA 3NJJA 1NTDA 1YLBB 2IWFA 2YAEA 1AZCA 1FA4A 1PY0A 1GR7A 3DTUB 3UADA 2OJ1A 3DKHA 2FNWA 3PAVA 5I5IA 4P5SA 2BWDA 3WNJA 1XB6A 1GS7A 3SQRA 3S3CB 3NSDA 4DP9X 2HX8A 5I6KA 2BHFA 9PCYA 1SFDA 1CYXA 3GXUB 1KBVA 4G7RB 2XV2A 4UANA 1NIEA 2HRHA 1L9SA 3OMAB 3SBRA 2AVFA 2XLLA 4KOCA 1M9WA 4KNSA 1EHKB 2W8CA 3QJVB 1W6LA 1NWPA 4A2FA 2HXAA 3ZX1A 4CSZA 4M4RB 6PAZA 5B3SB 1AZRA 1BEXA 3ZDWA 3T9WA 3T71A 1SF5A 2BWIA 1B3IA 3FQ1A 1GSKA 4DPAX 3NJFA 3IN2A 4WKXA 2NRDA 4AKOA 1SJMA 1RZQA 2ZXWB 5I5MA 5I6PA 1BYPA 1AZBA 1BXVA 2P80D 2JXMA 4GP8B 3WKPA 3AY2A 4CSPA 5B7FA 3UACA 3IE9A 3PPSA 2H5UA 3ABLB 1J9RA 2YXWA 3FSZA 3TBCA 3SBQA 3T6ZA 3HEIB 3RYMA 1GS6X 1JZFA 2VW4A 1PZBA 1L9OA 3EH4B 3ZIYA 1E65A 1AG6A 3BQVA 4UAHA 1WA0X 4BXSV 1HAUA 4DPBX 1ZDSA 1I53A 1BYOA 4E9VA 5AKRA 2GBAA 2UX7A 2DY2A 4YSUA 2YXVA 1OV8A 3OMIB 4N8UA 5B1AB 1J5DA 4KO9A 3QJRB 4A67A 2HZHA 4BK5C 1PCSA 2UX6A 1ZPUA 2XV3A 2FT7A 2PCFA 3NJMA 4ZK8A 4GY4A 3DIVA 2JFCA 4KO7A 4NB7A 1SFHA 5EHFA 1JVLA 4QKTA 1ILUA 2VN3A 2XVBA 1MZZA 4JKNA 1J5CA 2QT6A 2FT6A 4F2FA 2I7OA 1IKOP 1N68A 4DP7X 5A7EA 2R7EA 2YAHA 2PPEA 3QQXA 4E9SA 1AZNA 1GY1A 1A65A 2DWSA 3AG2B 3UAEA 5I6LA 2WO3B 6PCYA 3S8GB 2EIMB 4KO6A 2DWTA 4AI7A 1GYCA 2EILB 4YSSA 2Q9OA 2AANA 2PP8A 1KCBA 2XXFA 2VM4A 2UXGA 4A66A 1XB8A 4MFHA 1OE3A 4BDVA 1NIBA 2BO0A 1NINA 4YSEA 4HHWA 1X9RA 1JZGA 3AZUA
chains in the Genus database with same CATH superfamily
3ZZLA 3T4AB 4AUYA 2YIHA 4MMZB 3POCA 1JV5B 2VDRB 2ZAHA 3PF2A 4UZGA 3CZFA 1MCOL 1TF4A 3HIZA 2V3FA 3MA7B 1YY8A 1AYOA 3L3OC 1IM3D 2ZKXA 4J6RH 1E4XI 1URLA 2PTTA 3MRQB 1PG7H 4UT6L 3RZCB 4Y2DA 5C07B 2EH7L 5D96B 2W9EH 3RQ3A 4U1IA 2SEBA 4WW1A 1E7VA 4CVZA 2ZONA 4CW1A 3E3QE 2J21A 5CJ8A 1NGZB 3X12B 2Y7OA 3IFPB 4QXVA 3X14B 4KVPA 4OM1L 1A6VL 1FYTE 3RPKA 3T6XA 2GITB 4RGNB 2GY5A 2DQUH 1U95A 1WS7A 3Q6GL 1A6UH 4WEBH 3GD1C 4AGMA 5B4MC 2C7UB 3QXUA 3BWUF 3FTYA 3CSYB 4N2AA 1W91A 4ZXBB 4N8CL 3QULA 4XTRD 5GGVY 2XXMB 3TVMC 2C9VA 4Y8AA 3E9TA 3WO4C 5FK9B 5LKNA 2EH8L 3KM2A 1L9PA 4ONHB 3U0TA 5LBSH 4DQAA 3GHPA 2X44D 3UBXA 3A4EA 2CO3A 4XP1L 3BAEH 2EECA 1A6ZA 2O4EA 4JL2A 4M5ZL 3X13B 5T33L 4U1NB 3F62A 5B7EA 2XQ0A 3D18A 2IH3B 3CX5K 3PWPB 3S3BB 1E67A 1IMHC 3WFBL 1C5DA 4ZX4A 4JBSA 2FAUA 4QRPE 2Y6TE 4BFNA 4EDWH 2WWNA 3HG0A 4GG6F 3FAXA 3Q3GA 4YBLB 3BP6A 4XP1H 3KGTA 3RTQA 3PXLA 2ZCLH 3B3BA 3KEHA 3NJNA 5EU4B 1EK3A 1VFAB 1R24B 2O1AA 5FHAL 3RWFA 4HULB 1FGVH 3RLSA 1XR9B 4Z95L 4XN9A 4B9YA 3WU1A 3ESPA 3MRCB 4A2EA 1PZCA 1CGYA 1GZHA 4YDJB 3EH5B 1SHXA 2NX5E 3B9AA 5HDRA 1A3QA 2BXZA 1OM3L 2BRRH 2A9MH 4BQCA 1IQWH 5FK9A 5HHQA 1PW3A 3HZKA 2QQLL 1MN4A 3X14A 3E1ZA 4AGPA 4J5VA 2EC9U 1XGPB 1AR1B 3WJJC 1NEZB 3VXNB 4OCXL 3ZHNA 1TEGA 1BD2B 3CSYA 2J1YA 1O6SA 1I75A 3CN4A 1UTDA 1KG0A 1EJ6A 1EO5A 2BMKA 4WQOA 4ZZFA 3X12A 3ARDA 2CZNA 2ITDB 4R84A 1QEXA 1E4KC 3GHBL 4AEFA 5HHVH 1NLDH 3E9UA 3Q8BA 5CNHA 1DFBH 1D5BB 1IM3B 1D6EA 3OB8A 5ENWB 5A2LH 5CLZA 1QBMH 3FRPG 3ULVD 3D39E 1QYGL 1TTGA 5E4OA 1IAOB 3QZBA 3RIKA 1JV5A 2WQAA 3GMOA 1MCQA 4L3ED 3TJPA 3GYRA 4LSUH 1NGYB 2WXKA 3HE6A 3BZDA 3BFQG 1TNNA 3KPSE 4J3SA 5I16B 3NIDB 2R0LH 4GBXC 1GGCH 4KTDH 4TSCL 1K85A 1M53A 3NSJA 4TQIA 4ODSL 1AG0A 1S7UB 3O3AA 4ZDHB 3SQOH 3O11B 4QGTA 1F4XL 4UB0H 2YAOA 1SXSA 5KVEE 1D5IL 4B9FA 2XN2A 3NCMA 1XO8A 1BXUA 1CDCA 3MJ8A 3PGFH 3DX3A 3BZ4B 2QPDB 3HLAA 4N2LA 1XGTA 1RZ7H 2JK5A 4NNPH 5ABZA 3O9WD 1I4FB 1OAQH 3HRZC 5AVTB 4DCQB 4K0OA 3NEOA 4TVPD 2PO6B 5CJXA 3MBWA 3QCUH 1QFWM 1LTXA 1M57B 3HI6L 4JRYA 1UEYA 1MAML 2OL3B 4UTAH 3GLZA 2BXYA 3KG5A 1RIHH 1OM3H 1A6TB 4HEME 2X4PB 3Q0HA 3LQZA 4N0YL 4NQSA 2AK4B 3D48R 5I76B 1RFDL 5HYQA 5IMOB 4BQ8A 1GZQA 1EUUA 2L7UA 5HHOB 1Q72L 1JYXA 4KBPA 4DK5A 1OWRM 1IM9D 2GJ6D 2MCAA 2N4IA 2R2EA 3D0LB 4HPYH 3QG7L 2XV6B 3AT8A 3JTTB 4O02B 5E70A 2FE0A 4AYBA 3MBED 3LV3A 4JREC 3HLKA 3M1BA 5DD1L 3UAFA 5K39B 3VJ6B 4ODWB 3GHEH 2GAZA 2X89A 4X4KA 5E8PA 4MRCA 5DYOB 3SKMA 4DOHB 2WNXA 4M7LL 6CGTA 5IWLC 2R0ZH 3CHPA 2FTAA 3ISWA 4QIRA 2F8IA 4HWZA 1YEDA 1BQRA 5I1DB 4JJ5B 2XTJE 3IMRA 4OBSA 3G7TA 5CEXB 2HKFL 2EDDA 2C4FU 3CX2A 1K6QH 4PRNB 3WL9B 3EO1B 4A6YL 5J1TC 5E24E 3FBKA 1CD1B 4JGUA 1MLCB 1I8LA 5I6NA 4KZDL 1YPZF 3KHQA 1Z2KA 3RBSA 3OHXA 4U3HA 2C9SA 5INDB 2AQTA 2F53E 3MREA 3RU8L 3WD5L 3DVNA 3P77B 3UTTE 2WQXA 4FQ1L 4WENB 1YYLL 1MFBH 4P2RB 2HX7A 1LP9F 1NPNA 5AYQA 1S2EA 1SEBA 4HLZG 2EDYA 2A6KB 3GXMA 3QFDA 4G2AA 3X1GA 3VG9B 1QW9A 4YQXH 4YFEA 4OT1H 5JYMA 4H2AA 3TJHC 3DTDA 1BYNA 1P7QA 3VGDA 4MA8H 4P5MA 4WF7A 3FN3A 4POYA 1ECZA 3S88L 1G6RL 4JFXB 5E8EA 2A77L 5JDJA 1TSHA 4KDTC 4XN7A 4KH2A 1RIUH 3U2IA 3L6FA 4DK6A 3X1FA 1S7RB 4EZMA 4HFWB 1KJ2A 1J87A 4PV8A 3OKOA 4DP1X 1ES0B 1M7DA 4OZIE 1LL1A 5L4FA 1BPLB 4NUMA 3ZDYF 1W0VB 3GHBH 3FTGB 3MYZA 3QO1A 4JM4H 1CGXA 4X5XB 5FKAB 3VFGL 4Z6AT 1KIRA 2YOAA 4TSBL 1U58B 1GA2A 2NY5H 4OU3A 1P7HL 5ICUA 2WNKA 3ROOA 2APTA 1C08A 2J1WA 3NFSL 2VRQA 5D6DC 2DLEA 4F7CA 3RB5A 4KRMB 1TQVA 3DUSA 5ID0B 3MV8B 4KZEH 4Y1AD 3WXWH 1OF2B 3VI3A 4CN4A 5KSBB 3H8NA 4TUJB 4DGVL 5JNYA 1E6JH 4PJGA 3B9KC 3UCQA 5H94A 1DJWA 5KVDE 4M3KB 1PLGL 4LEOA 4M7KH 1J9QA 1D7CA 2QPEB 3BVNB 3IJYA 3Q05A 1VKXB 4GB9A 4LE8A 5JTWA 2ZOLB 1O9WA 5D5MB 5IB2A 5F70A 1X5GA 2VRKA 3ILDA 3IFNL 1YYLH 3N43B 5FHAH 5BJTA 4HS6A 2QJDA 3VACA 4XMUA 3I85A 2XTJD 4ZMNA 4R5XA 1UWGL 4LLVB 4NZ8A 4Y5VA 3SDDB 4RMWA 1JZ3A 2CDGB 4YHYC 3KBHE 4UDTB 4F5CE 2ERJB 3L3IA 3BWSA 2WWKT 5BQ7A 3K72B 3QDGA 5D2NB 3CPLB 3V4LA 3AWEA 4DERA 5LDUA 2X89D 3ARDB 1A14H 3TASA 5F9WC 4FMVA 2L3BA 4CADA 5DMIL 1EXUB 4KK8C 4XN5A 3RPBA 2J5WA 3K4ZA 4QYOA 5CJOL 3D69B 4UIKL 5D7KD 4ADIA 2Y4SA 1L9MA 1IC5H 1YMMA 3TPUB 5BOPA 5I5IA 1QZ1A 2B2XL 4EI5D 1Z1WA 4GSXA 5ESVB 4LSRL 3ARPA 1CYXA 4F58H 4WIQA 3F7VA 3PJSA 4H13C 4P5KB 2LU7A 3WJLC 2OMYA 3SGEI 2GJ6E 4GRWE 3L95B 1TQCB 5CILH 5JO5B 3UTSD 1R5WA 4JLRB 2VUKA 2MCPL 4ICWA 1NFDE 2BVPB 4JKWA 1SXBA 2H4EA 1KCSH 3DRQA 5C86A 4L1TA 2HFFB 4JFXA 2V9QA 3QJVB 4XMVA 4I18A 2BVQA 2EE2A 1I9IH 4YDLB 1FNAA 3LZPA 5E0QA 4H8WL 4U1KA 1BBJB 4N5UA 2NY2D 1PLGH 2G5RA 1I1AD 1Z9OA 2F54D 3C6SB 4OCLC 4XNZB 4XWGL 3VXPB 4AIZB 4DPAX 3BGFC 4ZFQA 2E5EA 1RUPH 3QIBB 1QP1A 4WTXA 4LCWB 1OHQA 5I5MA 1E6OH 2F1AA 4FEMA 3QXTA 4RGMC 2QADB 4GP8B 2G4GA 3ZL1A 3AY2A 2A7BA 4WHYH 5ICYB 5I8EA 2HKAA 2FBJL 2HJKB 4HISA 4ZOBA 5J1AA 3IE9A 1YRKA 3QHTC 5E00B 4ENEC 2Z4QB 4N0FA 4CADB 3SBQA 1A2YB 3R4RA 5E1AB 3T6ZA 2X38A 4X99B 5DQDH 5TFSL 1G7IA 1JZFA 3RL1A 3GZOA 1WV7T 3EH4B 3MJ9H 1E65A 2VQ4A 43CAB 4BXSV 1MHCB 1P53A 3WEOA 1M6OB 4H8VA 3OLGA 4OFDA 3UO1L 5JYLA 4ALAL 4O51A 5IBLC 4M6MH 4LEOB 1X7TA 4YN3A 1M05A 1JL8A 4F2MB 2DLFH 4EI6B 3WELA 1EBAA 2D2OA 4XB7A 3F5WA 1W0WB 1VB9A 1C16B 1H3VA 4GSDH 5CMAA 1XVSA 3V6BR 3GQFA 4K7FB 4XB3A 3DIVA 3O3DA 4PRIB 4EUPH 1ILUA 1A6UL 1EJFA 4WEBL 1ZGLP 2J5LC 1AKJD 3FO0L 4R7NB 3K81A 4PRAB 1UJTA 4DP7X 2HVKA 4NHCL 5B3JF 5IFHH 3QI9B 4WV1B 4P48A 2Y5QA 1RJZB 2X4PA 3POHA 5JMOC 2CIIA 4QXWA 3CJJA 2WXJA 2YK1L 5FHBH 4U3CA 4GRLC 2YGNA 3N1QC 2Z7UA 3GJFB 2RD0A 4YO0B 4BBWA 4OM0L 3LVTA 1SVZA 4XXDA 4OV6F 5D1QD 1VIWA 3LKSA 1XF1A 4FGMA 1A6WH 4O2CA 3MV7A 4N24A 5LWYH 1PX3A 5I1JL 1DQJB 4KMLB 4W6WB 3B8SA 3WUWA 3PHSA 2VKWA 4AK1A 1UOWA 1GC1H 1JZIA 4ZTEA 4L8BB 1ZLVH 1T2QL 1BAWA 1HHGA 4LEBA 5GGTH 5DZ9A 3BPLC 2FEDC 3JUYA 4WNSA 2DQ6A 3S5LG 2CSPA 3ETBJ 4K3JH 3FUDA 2UVEA 3MRFA 1XDTT 2QVTA 3V0VB 2VLRB 5ERWA 3PWNB 1T7ZA 5AD0A 2WKOF 3TOPA 1FL5A 1DQIA 3N04A 1PQZA 2D7TH 2AQ3A 1ZEAL 3HC0A 3L7FA 4IBVA 4OIBA 2E86A 3DMMC 1S5HA 4XH2B 2CALA 1PKQA 4X6BB 1JNLH 1ETZB 2P8LA 4L8CA 3HHSA 3DDGA 3VUAA 1IO4C 1X4ZA 2A73B 2HUEA 4UQBA 2A9BA 3UP1A 3KD4A 4F8PA 2F8VA 4P3DB 4RAVA 5D2LE 3LPGA 2YKLL 1GOGA 5I8CA 3N6YA 4TS6A 5DRXA 1BG1A 4K8RH 4IEFA 4AE0A 5GS1A 1WZKA 3QT2A 4LRNH 4ODHL 1AXTH 4NHCH 3SJVD 1F4WL 5IFHL 2RTTA 4MJ6A 2Q8AH 4CVUA 3G5VB 3BRGC 1CI3M 2AJXH 4QXUL 4NZFA 5IGXL 4CJ1A 1AQDA 4NCC2 5K69A 4W9ZA 3V6OC 1UEMA 4HJ0C 2IQAA 1QASA 2MSPA 1XGUA 1FQ9C 3FU6A 1CZ8H 1HKLH 4HWEL 3VWKB 4WK2B 5IOPB 4JO2L 2AZUA 3TVMB 5KUKA 1T0MB 4WI8A 2YN5A 5D6DA 1PKQB 4X6BA 4Z3JA 4FL4B 4W9DC 2W65A 1A3ZA 2UZIL 4M8QA 5IBLD 2V6HA 3IAGC 4MDJA 5HDLA 3QDJA 4OF6A 3O0LA 1DBAH 3F6JA 4I9WE 3ULUD 3UG4A 4W9FC 3VM5A 1TKWB 3VQMA 3MU3A 5DRNB 5HHPA 5IJCC 4WKZB 5HHOE 5GZNC 2UWEA 5FYKU 2LAGB 2VL5A 1A25A 1QACA 1ONQA 1T83C 2X4QB 1UT9A 2OR9H 3IWUA 4N8CH 4PWEA 3UOAB 1PS3A 4JM2C 4KKAC 1U3HB 4PGDA 2WP3O 4N2DA 1T66D 3QIUA 2CRZA 3QCTH 4WUKL 3IXAA 4XNDA 2EE0A 3ESNA 4NO3B 4IU2A 5DRWB 4ZFOL 5DUML 1RZIB 3VXTB 5JDSB 2VW6A 5CLYA 1LO2H 5F72S 4IGBC 4MBRA 5E8DL 3CDZA 1JIBA 4ZRGA 5IVXE 4L0PB 2H26B 5DVNA 1MWAA 3FCGA 4F57L 3N42F 1VZGA 3VH8A 4BQ6A 3QXVA 2H1PH 3MRIB 4IDJL 4JG0L 4KDVA 2W0PA 2K3HA 1CK0H 2P52A 4UQDA 3TO4D 4JG0H 1JGLH 4HA1A 3SJVE 2PPCA 3WN5B 3SE8H 4H25A 4JPVH 3NCFB 5FHBL 4FQXB 2OTPA 2MCPH 4FG6D 2R9HD 3UTOA 3WKYA 3BISA 1DO5A 4GLRI 2QV4A 1KXTB 4R90H 5ISZD 4YSTA 2VSCA 2AMGA 4FQXA 1PPIA 3AAZB 5F1IA 2VSKB 3RVXD 1GW6A 3KJ6H 1L5GA 2JKRM 4Y4HD 1MCSA 2CQVA 4QXTB 1R3HB 4XPTH 2ZXEB 4N2CA 5B39B 3FT2A 2X12A 4MQXC 2VOTA 3WJLA 1G94A 3VI4F 1XXFC 3B9DA 1L9TA 2V3DA 3EO9L 4MD5A 3UPAA 4YUEL 3EZ8A 5EBWB 3VGAB 3QYCA 3BPLB 1CE1L 3CDZB 5LBVA 3SPGA 3O4OC 2P8MA 3SDAA 2UY6A 3FT4B 3LH8A 5AVQB 1GYVA 4FKKA 1WAAE 2ZJSH 2ZNXA 4LO9A 3TYGH 4I5BB 2AXJA 3MRGB 2VM3A 4G6MH 3VXUB 3TN0D 4KVNL 1BXXA 3CMOL 3ZK0A 4APXB 1MNNA 1IBYA 1WT5A 4AYID 2J6EA 5JIKA 4Z0BH 4PJ7B 3E6FB 4PRDA 3WEAA 5HDBB 2QLVB 4PJ5E 5TFSH 4HJ1A 2P5WA 4JY5H 3GMNB 4HLEA 5KBPA 3EO0A 1NCDL 3QQ3B 3VI3B 4HQQH 2F74B 3AU1A 1I9JL 4JFQB 4LCVA 3KPSA 2WGXA 2YA1A 1IIKA 4XVOA 2ISDA 3MRCA 4PJHA 2GBVA 4RWHA 3S36L 2F53A 2C3HA 5F44A 5AG8A 3EOTH 5F97E 5DJXA 1FPTH 2VDMB 1GGCL 4TSCH 4JFDD 1CDYA 2PMZA 1AGEB 5C0JA 1QHOA 2HLEB 4XN2A 3C6LC 2P7TA 3G6AB 3PNWA 4AQ1B 3GSNH 2V3EA 3I6KA 2OTUB 5DEFA 3QZPA 5ANMB 4BGDA 2YD7A 5AW1B 4ZZKA 2V5SA 2EE9A 3FL7A 1I1CA 3QULB 2EACA 4GINA 4MCZA 1XEDA 1T20B 5IFJB 2BVPA 2XZCH 2BIIA 1T7YA 4KK5C 4LU5L 3VI4A 3QZOA 3NZUA 5FYJL 3VSUA 4RLDA 2BHUA 4JN2A 3O4LA 1QLEH 2V2TB 3ORJA 4PJ7A 5CZXD 4HXAH 4Y89A 4GFTB 4OLEA 1S6NA 4YDIH 2GPZA 3P11L 4JR9H 5I75C 4F37K 1MPAL 1YMMB 3TPUA 1OTTD 1C1EH 1SJHB 3WKNA 3V7MA 1BX2B 4JRFA 4OFVA 1EXUA 4OSUH 3EOBA 1FYTB 2I9LA 4IRSB 3T0EB 4PJAF 1F6LL 5FA3B 5TE6H 3RNKA 2QQLH 1A4BA 3D4ZA 4TMPA 4U1IB 3P3UA 4NO0B 4WW1B 4EUPG 1MCPL 5B1BB 3IDGA 4NI6A 2ADGB 4Z78A 4HK0A 1HN1A 1RZKC 1RK1A 4K5NA 3T8XB 4N0YH 1G9NH 1BGXL 3MODL 3HKFA 1D2PA 2BS9A 2P43B 1QQDA 4N3TA 3UZQB 1HNYA 4KKNA 3LZQA 2H32B 4IJ3B 2DYPD 1WISA 3LNEA 4NQCB 4Q6IA 2XTSA 3LMJH 4JY5L 5GS3A 4MLIA 1UA6H 1WAAF 4KKBD 4LLDB 2AVGA 1H9DA 4MJIE 3K2IA 3JZ7A 3K74B 1LD9B 2R4RH 3VI4E 2DD8L 4AWJC 3EG9A 4HUWA 4FYSA 4LVOB 1OAZH 3SDAD 5GGVH 2C1OA 4WJ5B 3M7FB 4XMKH 4Z5RA 3QRFM 3O41A 1LMIA 2A4CA 3BAEL 3M45A 3LQZB 2Y5TA 4N0UB 5MEQA 2IOIA 4KQ0A 1OXYA 1S78D 2V2WA 4ZPVB 3CNKA 3GRGA 2YSSB 3U7WH 4HAGA 5GGQH 5DJ0A 3FMGL 5GHWH 2ZCHL 1OK0A 3CSPA 4PD4J 3WFZA 5IEKA 3IDXL 3ALPA 3T6QC 3BUYA 4IMLB 2WIIA 1ZT1A 2VMJA 1U8NB 1OCZB 3FNKA 3ZRCC 3X1BA 2XN9D 2QSTA 3BUYB 4WFGE 3WV0A 4LBEB 5KZCD 3UEQA 4MAYB 2GUOA 1T7VA 4YUEH 3DK0A 1PF3A 3BW9A 2OYKA 4OZGF 4Y9EA 5C09E 2HVJB 3B37A 4NO2A 2A9NH 3IMSA 3JT0A 3OPZH 1FN4A 5GGUA 1HL5A 4AH2A 1QPXA 4YE4L 2IPTH 3BQUD 2P46B 5DZPA 1NGYA 3GMPA 1XIWC 2HPTA 3NJLA 3QK0A 4LOFA 1MCOH 1VENA 3AU0A 5HGHB 2HUHA 1SLXA 1HNFA 3BZEA 4ZDHA 2W80C 2E3VA 1MRCH 2W88A 4D9RE 1J1PL 4HK0B 3ZRFC 2R69L 5IT2L 4QHLA 2NY7H 1ZA3B 3GLEA 3IS1X 2QVMA 4NBYB 1X3DA 5EU7C 3MUGB 3V5KA 1GR7A 4L3EB 5DJCB 4KY2A 1U8MA 3HG2A 2Z34A 5GS1B 3MQIA 4U2YA 1WWCA 1TO4A 4IIZA 1U36A 4HXBH 4RSYA 4FLOA 1A7QL 1K5WA 4KJWC 4G7RB 4UV4H 4UQIM 3LN5A 5GGRY 3RVWD 2AQSA 4G43B 1MFDH 1L9SA 3OMAB 4RESB 3D85D 4PRNA 3RUGE 4DFIA 1AMYA 4YHKH 3SGKC 2GTZB 4ETQB 1INQA 1IKNA 3MTXA 1I1AC 4K15A 1WZ1L 2BVOB 1S7SA 2VDPL 4M5ZH 5T33H 3AT0A 3HPLA 4Y1AE 1S9XB 5FYLH 3U2SA 1YEDB 3W0WE 2EKJA 5IHWA 3INUL 3CIQA 2APXA 4E0RB 1DQQB 3UYRL 2R83A 3MVSA 4Q9RL 1BSIA 1DQML 1T1ZB 1UHVA 3HE6C 3LXUX 2BWIA 4JR9L 3T71A 2Q86A 1JMZA 5IB5A 1I3UA 3FB5B 3IBEA 1N3NB 4R4BA 2HWZL 3IN2A 4AKOA 2PW1B 4M3JA 3VFVB 4I9WD 2MOGA 4R2GB 5EZJB 3SDYL 5BS0B 4YE0A 3MV11 3JV4B 4OT1L 4DKEL 1Q9KA 3NIFE 4YQXL 1IE4A 2AXGA 5HI4C 4ZMTA 4GAFB 3GB7B 3P3TA 2WJ7A 3ABLB 4AQEB 5H2BA 3FQUA 1A9VA 1UCBL 3QGVA 3QDJE 3S34H 3TTSA 5EZPA 3RWIA 4DN4H 3CVHB 3ZDZB 1N12A 4J3BA 1SVBA 2X9ZA 5C0FB 4M6OL 1P7QD 4E9VA 5E94A 4FXKC 2I60H 3SIKA 3T77B 1JV2B 5C8JB 4M56A 4JGMA 3QORC 4NKOB 3SO3C 3FTZA 4GRLA 4AC4A 3BT2H 1DBJL 1MRDH 1YN6A 2K6ZA 3ARGB 3OXSA 4KO9A 2OMXB 4XZUB 5KBKA 3RBGA 3HMXH 3OR6B 4RQQA 5D9SA 1EGJA 2HB0A 4ZUSA 3IFPA 4XCCL 1AD0B 2MOQA 1OARL 3VSTA 4ZK8A 3BC9A 2YRLA 4HSCX 1NGWB 4BUQA 4AIEA 5J3HD 5E2TL 3GMQB 3QS3A 4ZW8A 1H19A 1CD8A 2FT6A 3CUPA 1KYOJ 2DKSA 1HS6A 3F7RA 5ACMA 5A7EA 1E9PA 1AZNA 2IBZX 3PJNA 2Z31A 3P02A 5TDPA 2DEXX 2AK1H 1WD9A 4L3FA 4N8VG 2YZ8A 1TLMA 4J28A 4Q2ZB 4BGLA 2W9LA 1RZKH 2EDTA 4LF3A 4ORGB 5C08B 3LXCA 1OE3A 3NUKA 4K3EL 1ACXA 2A5UA 4NDMB 5IMLB 3UJJL 1S46A 1Z66A 2ZQKA 1A1NB 4JPIA 4GS7B 2B1AL 4W6YB 5E2WL 3RY6A 5ID0A 4QRTB 2ZWZA 4F7EB 3PL6B 4MJIA 4QEGA 3FDWA 3D39B 4EN3B 3NQKA 3TH2T 2Z6FA 3KXFD 1E50A 1ZTXE 3DSFL 2H6PA 4FI7A 3VFMB 4HD9A 4YBHA 4PGCA 3CXFA 4Z7UE 2F1BA 1DQDL 2NMSA 3SB3A 3K2MC 4GT7A 4RH4A 1BJ1H 1JN6B 2J8UA 2UY7B 4Y16D 3C5JB 2FJGA 4TRPH 3O8XB 4XCNB 4JFED 4H4NA 1QSFB 2B2XH 4FE9A 3QJSB 4KK9C 5KSVA 2UY7A 4PGZA 1PYWA 1WSST 3H6JA 5CEZH 3K71B 3FQ2A 3K7UA 2ADYA 3IDMB 4XOCA 4L29A 4QJ5B 5T3ZL 4HYTB 1QI5A 2JJTA 4F33A 3GSQB 3FUMA 4X5PA 5C09A 3CVHH 3KE0A 2K3TA 2X41A 4P2QB 1J0YA 2X3BA 3BP4B 4LP5A 1VADB 1INDL 3VD1A 4LDEB 1PJ9A 4FXKA 1P6WA 3HZ3A 4X7SH 3Q48A 3WKQA 1YMHB 3A21A 1SMDA 4PAZA 1D7DA 3CAFA 4YPGA 4UNIA 3HG1D 1OD7A 1T6VN 1JWSA 3BDYH 5KANG 2NW3A 1AMXA 4LSQL 5CEYA 1BIIA 5DMGC 3ARBD 3G9VA 2XXCB 4QRUA 5I1EH 3SKNA 3WXVL 3STLA 4EI5C 4BWUA 1N4XH 2AQPA 1IBBA 1HTYA 1Z3RA 5FGRA 3JVGC 3OVUB 5TE4L 3FQ4A 4AM0A 3ZVVA 1UT2A 1NANH 4IRJA 2IDQA 1VLXA 1TJXA 2E7LC 3MRKB 1X5AA 4JFYA 5CLTA 5L7XL 3CUPB 1ZA3A 1DBBL 5KOVC 2GFBA 4OFYD 4YGVB 1OANA 2FLRT 1J8RA 4FXKB 1NAMH 2WW8A 3WKML 5I0XA 5HDQL 4L8CB 3ZN6A 3DUUA 3H55A 4X9FA 5JHBA 2CHZA 4P4KD 1R3KA 2RCSH 3T3MB 4KHXH 3BN9C 3TWCH 3LZFH 2P44B 1HHGB 4NCDA 2JLPA 1KT2A 4WFFD 5JW5A 2CK2A 4PG9B 1MFNA 4DP4X 2NZ9C 3RP1A 5JW3H 4HWBA 2F7OA 4LVNC 4HK3J 1Y07A 4F58L 3T77A 2YBRA 2VKXA 2J8UE 3JTSA 3LQAL 3PDGA 2IIJA 2MIZA 1UATA 1DSWA 3IDNB 4DH2A 1NMAL 1F1GA 2XETA 2JJSC 3AQDA 3HRPA 4PSRA 5IF0A 3TS8A 4AMWA 2EEFA 4PJCE 3ZHKA 3D34A 4K73A 5C0ND 5HYJA 1LO0L 3MOQA 4JZJB 3B9KD 4NP4L 5BCAA 1AIFB 3KLQA 1IC1A 1E28B 3B2PA 4OI9A 1G9NC 5HYJB 1A47A 5HJBA 3TYFA 1P5UA 2GYSA 2NNAA 2BY2A 4K71B 4XXDB 3P9LA 2OAAA 2R7EB 1Z9NA 3L3KB 3GS7A 2AQ1A 4GRWB 3H2WA 3PG2A 2PR4H 4OY9A 1X5ZA 4ZFZB 4ELDA 4FQIL 1T1ZA 4JQXA 1KTLB 1WD8A 2E47A 5GJSL 5CBAB 5MHSE 3T8XA 3EDFA 1B3JA 3WS3A 1VGKA 3QW9A 3CSFA 5FGCE 3ZHLA 4C56E 3FCBA 2K4WA 4Y1TA 3U1QA 3RZCC 3VG0H 1G7MB 3DUUB 1GGYA 3EOAA 5L88L 5KSAA 5EC1B 4FA8A 3V52L 2BC4B 2H8PA 2MPVA 3EFFA 1BX2A 4M48L 2OMVA 2YPLA 5F9JA 1MI5B 3KPOB 1Z32X 1NAMB 3WYRA 3F5WB 5DO2D 3ULVF 1GL4B 2DLFL 3QC5X 3LOWA 2ZWLT 3FT1A 3AS0A 5HDBE 5HGGS 4X9IA 1TZHA 2E7LA 1KIPA 1IU1A 1M6OA 3VGAC 4EDWL 1N59A 4LPVA 4JJ5A 1IGJB 2E7DA 1ORSA 3ZQ9A 1V7NL 1K5NB 1X9QA 2VLKA 3MV9A 4PTUA 5JXAL 1BQKA 4OLYL 1CF8H 3IFOA 2OK0L 2Z8WC 2JNZA 4GW5A 1CICA 1XGQB 3EGXA 3ZDYB 5KVEL 3ROLA 4OZGA 3B4NA 2Q7YB 3GZKA 2ZKYA 1AGEA 2KL6A 6TAAA 1YEWA 4QTIL 1WZMA 2A99A 1BQLL 5SWSA 5JA8B 2WSDA 2B1HL 3MBXL 1SEQL 3SPCA 1OE2A 3NSXA 4FTVD 1IL1B 1OSPH 3OPUA 4D7PA 2HFEB 5ESAA 4F7TA 2PYEB 4QCIA 3R7RA 3S96A 1AQKL 2Y1VA 1S4IA 1N3NA 1AI1H 2B7DT 3P4MB 3TNNA 4IOFD 4NNYA 5T3XL 5HHNB 4Z7WA 5E4AA 4HV8A 2ZTBA 4JANA 1QO3B 5BOJA 3BH8A 4DESA 2BP0B 3N9GL 4X5QA 3RJOA 5SWSD 2F9BT 1SUJA 5HYJD 1DDHA 1ZLWH 3RHWF 5J06A 3HG4A 4U1SA 5DZNA 2IANA 1QTYT 4X6EB 5FUCC 5D93B 2H6PB 3JWOH 2FZ3B 1XL4A 2HKHH 4KKBC 4OBRA 1W6WA 2YC1B 4PD4K 3L3IB 4NXSA 2V5YA 3AAZA 5F1IB 1RZJH 3U4BL 2P8PB 3J27A 3Q7JA 4TNWF 3TBYB 2PPFA 2P42B 2W59A 5EU6E 1DCLA 5D70L 4EVNA 1R1CA 4ODUB 4QHPA 4A68A 3I02B 1JS4A 2X4SB 3K0WA 3U0WL 2Q8AL 3VI3F 1SM3H 2BSRA 1P1ZB 4MA7L 1AQHA 1ET8A 3L7EA 4KXCA 1B0RA 2YPKA 4PJGF 4TQPA 5BXFB 3KNBA 1KIQA 3CBJB 2W60A 3VXMD 2IV8A 3T2QA 2AP2A 3K91A 1HL8A 1OPGH 4RISL 4AVJA 4I88A 1DVXA 3VE0A 1GIGH 1A02N 2YEQA 5JNYB 3HZMA 2B1HH 2H9GB 1TXKA 4DZBB 3MLXL 4NO2B 4FQIH 5JW4N 1FZMB 3SKOA 3VRLF 2DM4A 5EBLB 5E08H 2CUAA 2HN7A 1FNEB 4QT5B 1GIGL 2VAAA 4U1MB 2H26A 5KSAD 3MX0B 4RX4A 2Q76B 3S3JA 1VERA 1INEL 5ESAB 2P9RA 4YDMA 4F7TB 1VCBC 2ZXQA 1ROCA 4XPGH 1H0DB 3HA0A 3FB6A 1IZJA 1DJXA 1WFUA 3VDCA 1I1YA 5D2LB 3SQBA 4HHAA 2NY4B 2EDJA 2F7RA 1U6AH 4R4NC 5IB1A 3GHEL 4KVNH 3ZKND 1ES0A 1T2QH 1U3HA 4PGDB 5GGTL 5BS0A 4HIIA 4JGNA 4G1EA 5D4QA 3QEHB 3L9YA 1QBML 1IJNA 3FS9A 4UM9B 5DJXB 1E27A 4POZD 2K7QA 4IJTA 3S6CA 3GWJA 4KH9A 3DURA 4TQEH 3SGDH 4MNQA 3DX7B 1HSBA 4Y4HC 5DEGA 1FO0B 1MWAH 5HPMA 2VDML 4G5ZH 1ESOA 3TBTB 3MGOA 3WTSA 4K5OA 3SYAA 5FS5A 4XMTA 2ESVD 3FTXA 3VW3H 3D05A 1E43A 3GSNL 1NFDA 3EOYG 3DX9B 3GXIA 2VERN 2YQ3A 3O4LD 4N6RB 2RAMA 4U1HA 2ICCA 4X6DE 3SBRA 5E1GA 1WK0A 2P45B 4JPVL 4KJQD 3MCLL 4XMKL 1SYVA 1IBHA 2XVGA 1WBXA 2GJZA 4X0NA 5IJKA 1U8HA 3SD2A 1Y0LB 3D0VA 4BFJA 1TCRA 1RJLA 2APBA 1BZOA 2JQZA 5KVDL 3FT2B 3ILPB 2JKIS 1BLIA 2E59A 4X5RA 3V4VH 3B9VA 3L2LA 2F1EA 4LCUA 1MNUL 3QQ9D 1M7IA 5KVDH 3LRMA 3MMEB 5FXCH 1XQ4A 4UBDC 4LASH 1NGQH 4OQTL 3S4SB 4P06A 1JRHI 3IPBA 3L1GA 3QQNA 1D9KC 5B7FA 3IRZA 3KL5A 3RY5A 2X2YA 1I1AB 2F54B 1MCPH 3MFFB 4JQVA 4DKTA 2VDLB 3L5IA 4PS4L 1NC4D 2X0WA 2DQMA 5JOPD 3AQXA 1DVYA 3MNVB 5TPWH 3QUKB 2X1QA 1FCGA 3F12A 1UUNA 1TJGH 3M1CA 3MBEC 2OMBA 2I27N 2Z31C 3ZLQC 2DL9A 1RZJL 5AKRA 5DD1H 5HYQB 4FNTA 4IMLA 2DEYX 1HXMA 1P84J 4JPSA 1ZSHA 1A6PA 3O6FB 2HG5A 3OAUH 1B0WA 3BDBA 2HZHA 2R2EB 3D0LA 4NQDA 4TQEL 1TJIL 3HNSH 3IJEA 3TGXA 2XV3A 4FZEH 4L4TA 3SY0A 4NRZB 4K9EC 2UZPA 1OB0A 4NUGL 2UWEF 2WLIA 2J44A 3OZ9H 4Y5YB 4R97B 4NC1C 2XZCL 4LU5H 2XVBA 4FQHA 1F42A 5DD3L 2YA2A 5FM5M 3DGCR 1CU4L 2EUVA 1TDQA 4ZFFB 3L4CA 1U8PB 4PRIA 2YWYA 3BKJH 1ZXQA 5E99H 1BF5A 5KAQG 3DHUA 5I6LA 1G1OA 2APWA 3RU8H 3S8GB 2C1OB 3UPCA 4GBXA 3H7BA 4XCEB 1R3KB 4AW7A 2QV2A 1WTGT 4BSWB 4N87A 1KB9K 4OIAA 3O11A 4O51B 4MFHA 4DJMA 1BLNA 4Y2NA 1LNUA 2KUTA 4BD4A 4BDVA 2Y36H 4LLUB 5FW8A 3C8HA 2VDKB 4I2XA 1RIVL 4Z76A 1S9VB 2DF3A 1KCRH 3SPVB 4DUVA 3PXHA 2BOBA 4NO0A 3MRBB 1RLBA 2ZXCA 3QWRD 4BZYA 4LSQH 1BIIB 1XMWA 1F18A 3P9MA 4XP5H 4XX5A 5GQBA 2D31B 1DANU 2ARJQ 4N1HB 3ELAT 1IAOA 1E30A 4QRBA 1J88A 3OG6B 4LSSH 3MLZL 4LL1A 2C3VA 4UILH 4WHCA 5AL0A 4H25B 2IAMD 4YIQA 3V10A 3FUHA 4UILL 2YMXL 3O3UN 4V1DB 4IOIA 4XP4H 4OFQA 1NC2D 2G0KA 3QUZB 3RL1B 4JVUA 4O2FB 4CNIA 3L3OA 2XZZA 2R39A 5A3IC 5CGTA 1T21B 5F7YC 3VNZA 4L8DA 4Q0XL 1DJSA 2ILLA 4N86A 3B1UA 5DVLA 4R7LA 4ZMAT 5MENA 4PY7A 5EN2A 4U7KA 5G4NA 1VSCA 1BJ1J 3BX7C 3BD4A 5IHLB 1U8IA 2B15A 3IXAB 1KOAA 3BJ91 4IDJH 3PHOA 3O8XA 1NC4B 3P4MA 4LLMA 4Y0GA 1HILA 5DT1H 3DXAE 1PG7X 4JN2B 3MGOB 4PJDE 1FVCB 4L8BA 5IJBC 1RKRA 5E6IA 2HT3D 1DVFC 2EIJB 5A43C 1PSKL 2YMOA 3MRDB 5TK4A 2CJ3A 3CIAA 3IGAB 5LCVA 5E9DD 4BWTA 4ZFGL 1A4JA 2QADC 4G1MB 4OUUB 5FFLA 4LPCA 4NC0B 5F7DA 1J1XL 4M8QB 5EU6D 5C97A 2HMID 4B5EA 3L8QA 5JQIB 3BVXA 1KBKA 4L8DB 3STZB 4GT0A 5FPIA 1NCOA 1RP9A 4K3EH 2EQDA 5IOPA 4QRAA 3V6ZA 2B5IC 2BP8A 2YD9A 1NM4A 4PTUB 3QDGB 4UIKH 5EUOB 5KJRL 4X98B 2ROXA 2DJMA 2VE6B 3V0IA 2DWEB 1VEOA 2Q76A 1SVCP 2X9XA 1CUOA 3LD8B 2K4AA 2VJ0A 2JJSA 5F7HA 4I89A 3H9SA 3GPEA 5TDPB 1DBAL 4YBLC 3SOBL 1SY6H 5M94B 3G5ZA 3V4UH 2V9TA 4XP4L 3P2BA 3T0BA 4TUUA 1MXDA 1GY2A 4EZKA 4YHIA 3V5HA 4GAYA 4LAQH 4OZFG 1FBIH 1CB4A 1GJUA 1FYTD 1THCA 3GTNA 4IYKA 3MCYA 4GI8A 4R5VA 3SZ6A 1MH5B 1DJHA 2H0PA 2F7IA 3UGXA 5CJBA 3CZNA 4P9HC 4UTAA 3NACL 5DD3H 3VMPA 3RDTB 4GRLB 4YDVB 5D1XC 2JCCF 4EVNB 2IDUA 1T1WA 1UGNA 4N85A 4PR5B 2DAVA 4UT7H 1K3IA 4WLCA 2VDNH 5L2KB 3UTSA 2LABA 4YXLL 2YN3A 3UYOD 4APQA 3BKCH 2HJLA 4FFZH 3G3LA 3CFUA 4OIFA 5CP7B 2UV3A 5FUZL 5KBLA 1DQMH 5I74B 3SGKA 4UQ3A 4PP1D 1ETA1 3VDAA 5IESH 3QUYD 3L9RB 2XWEA 1E42A 2EJ1A 2OMUA 3ABMB 3PGFL 5DI8B 4DKEH 2WPGA 3LKRA 2O5XH 3ZMEA 3I50L 1TTRA 1NSNH 2PKDA 2WUCL 4FABL 2IDCA 3D3VE 3ECVA 1KUMA 1JXFA 3GJFK 4JJOA 1S3KH 2CNZA 3CFTA 1FSKB 4G9FB 2NUPA 4ZNEE 3A22A 5E6IC 1NC4A 1A7OH 5T5FL 5IW1A 4GKSA 4QPEA 4RCAA 4HHGA 1MZYA 2OCJA 4YX2H 1N2RA 1NOAA 1P84K 2A4EA 2P49B 2PTVA 3KCPA 4OGZA 4Q14A 5F8QC 3UO1H 4EKJA 5I0YA 1OTSD 4G8GD 4MVBD 3T3PE 5TH2A 2DEWX 3LQAH 4KRPB 5CFHA 3HMXL 5ESVA 2DQUL 1ZJBA 2BX5A 1CF1A 4TRPL 4F7KA 3WCYA 1XF2A 3GKWH 1R3IL 5TDNA 3GINA 1BZEA 5L8JB 4WO4A 3S8FB 3C9NA 3GIVB 3IJHA 3LZFL 2GSGA 3PWLB 3QWOA 4FNPA 1EX0A 3BCFA 2PETA 1W2KT 5I5RA 3FO0H 2H1XA 3OJDB 4NFCA 3QUGA 4JFEA 2UZYA 4LGSB 1JYNA 4PH8A 5J56B 2A38A 4WCYL 1SN0A 5DVKA 2GT9A 1ZHKA 2ICEC 1N59B 3MC0A 2NNXA 3D50A 1PLCA 2RJMA 2ZIDA 5GRYA 2DKUA 1A3LL 1IC7L 5F89A 5IHUH 3AG1B 2R4SL 5AVVB 4CVXA 3ZE2E 2ADJA 1JFQL 35C8L 3LPFA 3TCXA 2HRGA 2VLLB 1A64A 1M2VA 1RZKL 2Y1ZA 2A1WL 1YG9A 4IKIA 3PCYA 4ZX5A 2ZOTA 3SPVA 4MMXC 4FL4C 4OF0A 1VEMA 2P5EB 5DEGB 4GH7B 1EZLA 4PS4H 2D7TL 2DPKA 2WQUA 3HPJB 3VFUA 1RPUA 1BP3B 1G87A 1DQLL 5J57B 3RUGB 2F68X 2DYRB 5DFAA 1Y18A 1PNDA 3G6JF 4JFFD 1MIEL 2BSSA 4Z7VF 1QTPA 2WLIB 4RRPG 3ZYJA 3C60C 4K23H 2V7NB 1M7UA 1PMYA 3ZTCC 1AFVL 5DJ0B 1R3LB 5FF6A 1JYVA 5E8OA 4E41D 1RFDH 4J8RA 5EC2A 2Z0UA 5TDOA 4BUGA 1JGUH 1QFHA 4PUBH 5K1NA 1F3JB 3FYIB 3EOTL 2WIIB 3DI2B 3MV8D 4EXPX 4HF5L 5F6IB 4A2MA 1YEHH 3LIZA 3RX5A 3VRJB 1D5RA 4NP9A 1KYAA 3UBXI 1SMOA 3PABB 5AW3B 5FDWA 1H6EA 4U6XA 3Q2CA 4O02H 1ZTMA 2G9HB 2OXHB 4ODVL 4RWYL 1WAPA 4OD1L 4V11A 1PCXA 4M6NL 4PY8I 4JDTH 5DJ6B 4OVUA 4XGZA 1SNRA 4LT7A 2FSEA 3L4UA 2Q3XA 3BQUA 5E99L 4AG4L 4AZ8B 4ELKA 4BE6A 2WTOA 2YQBA 4N0CD 2VDRL 5F1KC 1KCSL 5KUMA 1TPXB 1F90H 5INCB 2DBLL 4G5ZL 2BDNH 4N26A 4N2HA 3G6JB 3WY1A 1WVZA 4A7UA 1S8DB 1NKRA 1NDTA 1NPJA 3RPIB 3P73A 4ZXBD 2BY1A 2V5RA 1KELL 3IDGB 1WBYB 3I6LE 1HX0A 4P2RA 1KY6A 1V54B 2XWJB 3ML8A 3TYGL 3R19A 1JXKA 4FCHA 3EYSH 1NSNL 1QQDB 2UZIH 3CVCA 1XSOA 2J2ZA 3J7HA 4NAJA 4PRHD 5FM4A 2J6WA 4LOUD 1T22B 1T3FA 4Q9QH 4ZPTB 2VN6A 3KYMA 1U6AL 1PAZA 2PYFA 2I07A 3HMWH 4Y1AA 4ZW7A 2FDBP 2NY3C 1AS7A 4AYDC 2YARA 4M02A 4H44C 3H7LA 4IIQC 3DXAB 3ULSA 2F58H 4ZAKB 5GZOA 2CD0A 5IIEA 3ISRA 4KAQH 4KKAD 3UAAA 3RVUC 1O6SB 4EI5B 1I9JH 3DPBA 2L7JA 4JZNB 4MMXA 3CK0H 1T20A 5IFJA 5E1QA 4XNAA 1UWXH 2DJ4A 5DUBB 4LLQA 2L04A 5ID1A 2C9PA 2WN2A 3G08B 4D9RD 4Y4FB 1OOAA 1P4IL 5D7SH 5EU5B 1FA4A 3FO9B 3I2CL 5I66B 1UASA 1ZA6B 4W9CC 4UNVA 5D6CA 3N5AA 5J9PA 5G5DB 2IEPA 3IXTB 1KTBA 3LKPB 3BGMB 5C0CE 4Z95H 4PWJA 2AJYL 4RZCB 4F8QA 1CJYA 5JW4Q 4FNRA 1QR1A 4YHYB 2WGNB 4N0CC 3FH8A 5J9PB 3PNRB 1FIGH 2LVCA 4QRQB 3FRUA 3JV6B 4AQ8C 5I76A 4BKSC 3N85L 2Y5EA 4FQJH 3QXDB 4KOCA 3WXWL 2ICWI 4GG6B 3V6FA 1BQLH 4U6VL 2NNFA 5CKAA 4K94H 4Z3HA 1J0IA 4KTYA 1ORQA 3DYMA 3BD5A 4MMXB 4F8LA 2JKJA 1BJ8A 3QFDB 4M62L 3T3PB 5TTRA 1QA9B 1KIPB 2MQGA 3KPRE 4ZAKA 4C56B 4FHBD 5CR8A 3UC2A 1Q72H 3NIFB 5I0VA 4NC2B 5EZOL 2B0SH 2FR4B 4P3CH 4R83A 2JB6A 4MBOA 3U7AA 5EEXA 1EJOL 3OZKA 1YPZE 1CO1A 1UM6L 5JQ6H 3EFFB 3UZEC 2A77H 5IMLA 2QVIA 4MD5B 3H9ZA 2OKMA 5FDYA 4CMMA 2ZOUA 4B6ZA 1MAKA 3P4OA 2CKBA 1M2OA 4CC1A 3D4GA 4MMZA 4JFSA 3U48A 2BOBB 4L48A 5FCSH 1GH7A 3RI5K 3OC8A 3VO0A 1E4HA 4M03A 4NIYE 3EW3B 5MP6H 5I1AA 4Z8FL 2R8SH 4UWQB 4LLVA 3MN8A 3BVNA 3FZUD 4IS6B 4M4RA 3QHFL 3MJ9A 5SWZE 3SKMB 4HUUA 5D1QC 3VRIB 3W9DA 4XI5D 2KPWA 2UX6A 3DXAD 2RQ8A 4P5TB 2AEIT 3Q1EA 1HESA 4NQQA 2YC1A 2WBJC 2FR4A 1OF2A 3NIFF 2KBGA 1CDUA 4F20A 4Q0XH 1MZZA 3AWFA 4JM2D 3FKUS 1LE5B 3MXVH 4XO5A 2I7OA 3AROA 3HBQA 3ARGD 2MCMA 4N9GA 3WSQH 5J89A 5IP4A 1BF8A 4HBQA 3DVIA 1K2DA 3WSQL 1FL6B 4KZCA 4AVHA 1T5XA 1EWHA 2V33A 5J12C 4YXHH 5C3IA 2FSDA 4WUUB 2CBQA 3SSGA 2PP8A 2V2WB 2YRZA 4HIEA 3NPSC 4WI2A 2XXFA 3VWJB 3DGGA 4BH7B 2BSSB 3BKYL 1IB5A 2QZ5A 3I6LD 2Z65C 3FQUB 5HHMB 1LDPL 4WU7A 3HS0C 1JZGA 4BK4A 1N0XH 2KLRA 4KGJA 4OM1H 3UG5A 4BWWA 1D5MA 4DVRL 5L7XH 2AGJH 3WLWC 1U9KA 1CXIA 2AKRA 3QA3A 4N8VB 2A4ZA 4PRPE 3AQZA 2A6IB 2GFBB 2IWEA 1JWUB 1KMGA 1SDDB 3P40A 1OKEA 2D7NA 3BKMH 4FADA 1MJUH 1G5AA 1N7ML 2W65B 4PJHE 5EOQL 3SE3A 2H32A 4KXDA 2AEOA 2GSIB 1UYWL 3BPNC 2WYTA 2I24N 2NPLX 4XMXA 3S36H 1UWYA 2WOYA 3JQOB 4NJ9L 3IDYC 1ZDQA 4YHPB 12E8L 1KN4H 2V17L 4HQQL 4XVTL 2B4CL 2VWEE 1PGRB 4EN3D 1ORSB 3AMLA 3KXFB 4A55A 4FYTA 3WNPA 5H35A 2IPUK 2BS8A 1HQRB 1YEHL 3MMEA 4RBPK 4HIHB 3I75A 3GSNB 4XHJD 5I24A 5FLUA 2B3RA 1U8HB 5FO7B 3RTLA 1MCKA 1H8LA 4PLNC 2EVHA 2FL5B 3QWRA 2FK9A 3F65A 3GEWB 3M17B 4WGWB 4PJXE 2Y07H 4LHUD 5KVMC 4K94L 1A7PH 4Y9BA 4XNQA 1KGIA 2DB8A 3OGCB 1S9WB 1SXCA 3VXQA 1CLZH 4OZIA 4JFDA 5SX5H 4JZOA 4POZC 1K8DB 1OSYA 3NAAH 5LGJB 3QDMD 4G6FB 1C1EL 3FU7B 2NQCA 1INEH 1YC7A 4FFYL 1EBPA 4OAWA 2YEZA 3QIWB 5TJWK 1CICC 4LEXL 3NSYA 2OR8A 3CFQA 4AIXA 2CRYA 4JCLA 5C0DB 3FU5A 5SV3A 2A9CA 5I18H 1BGXH 5GS0C 1JGUL 3OKYA 4CDGC 2H0JA 3GJFA 3Q8CA 4MNHA 4XPFL 1OAJA 5CIPH 3S5ZA 2E7MA 2EDLA 3AWGA 32C2A 3KMDA 1UJ3B 3S35X 1AIFA 1E5YA 4P0DA 5DEJA 1QRNE 3VFSA 2E4TA 4JO3L 3ELQA 4HWBL 5FGSA 3WG7B 2IO5A 2ARJA 1C12B 2VDPB 2I69A 3BD3A 1QLFB 4G70B 2BW4A 1K4DA 3RKPA 1BZ9A 1UM4H 2WD0A 5FFGA 3FQXB 4OJFH 4TYUA 1I3RB 5IEKB 3D33A 4LLWB 4WUUA 1P4BL 1XF3A 5DHVH 2R2BB 4WNJA 3FHAA 5D7JD 1S7WB 2NY0D 3AUVA 3IM1A 4G80A 2ZP8A 4WDIB 1HZLA 2Y5TB 2C9AA 2CDFA 3D07A 2OI9B 2YSTA 3H9YA 1OGAD 5A2JH 5LBSL 4ZMZA 3KPRB 1N6UA 2FATH 2XZAH 5I15L 1R0AH 1RQ5A 4BCXA 4Z3TA 4DKAA 4JNXA 4G6KL 5F9DC 5I1LA 3V8CA 4LCIL 4WO0A 4DNLA 4KQ3H 3EH1A 3Q8FA 4Y4HB 2ZUQB 5BZWB 4ZMPA 2A0LD 1QTSA 1R0AL 3UAJD 4W1TA 4TUOB 3GMQA 4LOVA 1G4MA 1J8HA 4PJAE 1GCYA 4BCZA 4TL4A 4JE4B 4QOKB 1U33A 4M7ZB 3Q1SL 3BH4A 4OQTH 3QC6X 2MWCA 3QR0A 2W07A 3VYOA 1HVXA 2OP4L 2NXYD 5IJVB 1LEIB 2FYVA 2YZ1A 3PXJA 5EO1A 5EIIG 1B6DA 1CBVH 2F54E 3LS5H 5GIRB 5D96C 1EO7A 2WVVB 1QVOB 1UCBH 1I8KA 4AJ0A 3JWNG 1PD0A 4UOQA 3V6OE 5FECB 4PJ5D 4FCAA 3M8OL 1VFBA 3G6DH 4XE0A 4KHTH 3SDCC 5EOQH 2CHNA 4G6ML 1IE5A 5L0QB 4XNZC 1F1AA 1BZQK 3A67L 1IC5L 3QUXB 4HV8B 4U6HB 2PPAA 3HZKB 5C3LD 1SBBA 1ACYH 3A5VA 5AKSA 3X1EA 1ZGLB 3D5OF 3WJJA 2EDRA 4XCYA 3KCPB 2CLZB 3RTQB 1KCUL 2WYZA 1GPOH 4Y7MA 2WBXA 2XTLA 2WO2B 1Q0EA 3U46B 3G5YB 1NEUA 4A39A 3MYJB 4NM8L 3TNNB 3PHOB 2C1PA 3CQPA 3C5ZD 4MSWB 3DOHA 3NH7L 3ARDC 4L8SC 5ANMA 4PVLA 5FYJD 3M6DA 4NKMB 3W2DH 1AH1A 5MERB 3UTZB 5JMRA 4H0HB 5DXWA 4FQQB 4YHKL 5FUZH 1ZRUA 3UZEA 3ZIMA 3TVMD 3D52A 3GRWA 4CGUB 3LNGA 1J5HA 1TQSA 2FEEL 2F19L 1PBYA 2WCPA 1FFOB 1UKTA 3LDBB 2EINB 4B97A 4P4RA 3WNLA 1EAPB 2WQSA 2XRAH 1PVHA 1CK0L 2FBJH 5J8OA 3IFOB 1J12A 5I1JH 1IZKA 3L16A 3RDJA 4EUPB 4HOZA 3MLUL 3DPBB 4GP5B 4JZNA 5HHXH 1AAJA 3F64A 1AD9B 4AV0A 5D1QA 4OZFH 3KVQA 4DN3L 1OAQL 1NL0L 4X8XA 5DJCA 2FO8A 4Y2OA 2FT8A 3KYOA 2ENSA 4HS6B 4WO4D 1SEQH 3HZMB 2WBJA 1YJDL 4LF3B 5C08A 4U05A 5HVHC 1XTLA 3DA0A 2H3XC 3WLBB 1PG7L 2MPAH 2WMPA 3D06A 4PJIE 1FJ1A 4UT6H 1T80A 1DLHA 4NAQA 3TX4A 1AXSB 2E8YA 2XPGA 3Q2VA 1DVSA 3MXWH 4YC2C 5B39A 1T5WB 3BYTA 2KDYA 2KZWA 3OXSB 1S5HB 4RMRA 3NJXA 4XRCA 1FN4B 4JRYE 1VFOA 4O5LH 3UP6A 4M7LH 4I9XA 4XOAA 3V55A 2YR3A 4AOFA 4WTQA 3LNDA 1MWAL 1OSEA 2ALWA 3HRZA 2A0LC 3IGLA 1PU0A 5C0FA 1TCMA 5GISH 3TBSA 1YEKH 3L4YA 4OCMC 1JK9A 4JFZL 1ITCA 3SD5A 2F18A 3MROB 3TEXA 1ZCRA 4Z7QB 4WNQB 2XBDA 5BO0D 5EUOA 3VD5A 3MACH 3NH7H 3D3VD 4Q6IC 5E94B 4ADGA 5C8JA 2H47C 1J8KA 1FFNB 1FL3A 2AXGB 1L0QA 1YQVL 4OF7A 4D8PB 2R4SH 2IPKB 4DZ8B 4F7CB 1OP9A 1OAUH 4XN8A 4LQ1A 1W8EA 2I85A 3BKCL 4LP4A 5C0EA 5GGSB 2YS4A 4B9GA 1NANI 1JNHA 2E9IA 2VW7A 4HUWB 3GI9L 2CAKA 3QIUB 3UBHA 3L5WB 5DZOA 5AVSB 4WW2B 3VFOA 3JWNH 4NO5B 1YO4A 3HE6D 2CLZA 4ZO8A 5E5UB 1KCVL 4M5SA 4XNMA 3ZKXB 2VZUA 1V05A 4OZ4B 3S4SA 3TN0A 4HFUH 1QLEB 3EH3B 4KAQL 4K7FA 4BFIB 2VERA 3VXSE 2CG9X 4AGQA 1YDPB 4D8OA 1IGCH 4NQEB 4OSUL 1NDMA 1XBRA 2GCYB 3VFPA 2EVFA 3CDCA 4KU1A 1I8KB 1AXSA 1IGFL 2XPGB 5F89B 3OHXC 5CJQL 1HSAB 1KGXA 3C5ZA 3CVDA 2A6JB 3QH3A 5I82A 4BCYA 3RTQC 4X6FB 3APCA 1KGCD 4N2KA 3MNDA 1OCWH 5F7BA 4EBQH 1XT5A 2Y7SA 4XN1A 4UOJA 5DC9B 3PAYA 2ZG2A 3RWEA 1CF8L 2OK0H 2TAAA 2A6JA 3QH3B 1UXMA 3FO2A 4YBQD 3ZR6A 4G8IA 5T1DH 4HS3B 4UT9L 4PIRF 3SQRA 3OJMB 2AF2A 5E9AA 4ZAKC 2VDRH 3WY4A 2L7EA 1I9RH 3UFIA 2BOCB 2COVD 2EXYC 3FQNB 2GT9B 5BVJB 4NUQA 3W5NA 1EEQA 1RUAH 2R4RL 4MJID 4UCFA 3O2DA 1JHLH 4F2ME 3QQDA 2CRMA 4YDKL 2AVFA 2XLLA 3VRLE 2C7FA 4J6RL 2LV4A 3A4AA 3EJUA 3BIAX 5T3XH 1KBBA 1E5CA 3ULVC 1D5ZB 1H3PH 2D7OA 3K6NA 4ZSOB 4UINL 3PU7A 1YAZA 4H8HA 1JFHA 5JUEL 5T1MB 4ALAC 3GS4A 5B3SB 1YNKH 1AZRA 4D0DB 1KTLA 1D6VL 1HH9B 3DIFB 4IBLT 3ZDWA 2AKRB 3PFQA 1U8PA 5EZIL 5IFAL 1O75A 2GQHA 3SGDI 4AV5A 3LXAA 1MIMH 3BGAA 2YD2A 2C9UA 3GSVA 1ZLUK 1H5BC 4M43H 4RNRB 1FLTX 2B14A 2MHAA 2QL1A 5K59E 4PJ5A 3CHOA 3I9IA 1C12A 1AZBA 1MIEH 3LKRB 1K72A 4I4WA 4M1DH 4TQHA 3UJTL 2CMRH 5ISZB 3MLVL 1EV2E 2JKTM 1ND0B 3TJHD 3GUFA 3D25A 1XF5B 2XZQL 4GAGH 1ED3A 2YD0A 2GTWB 5IMMB 2WUBH 3OLIA 4MDIA 1U4FA 4NPYA 5LHDA 1VFBB 3UJTH 4IMKA 3TCTA 1M1XA 3HE6B 4PWIA 1A7NH 1QFPA 4F7MB 4F1SA 5GISL 2D0HA 3ZYIA 2V8LA 1NMAH 4WWNA 1PZ5B 1S7UA 4ZNCD 2BINA 3WENA 1FF5A 1FH5L 3QJRB 1FNSH 4EDXB 4YHZL 2X2IA 2WTRA 1K8IA 2FBOJ 4JKMA 2N01B 1IFHL 1MAJA 2EXYD 2PF6A 3ZJAA 1I9IL 4P4KA 1GOFA 5IW6B 3K4AA 1IC7H 5IHUL 1CVRA 5F0PB 2WKGA 4Y4KD 3K8KA 1D5BA 2N7SA 4H1LA 5ENWA 5T1KA 4F24A 2ADGA 2ED9A 4Y2DD 1N68A 2NR6D 1N67A 5FYLE 9CGTA 2IALA 1M71B 3RWDB 4E9SA 4L2YA 5EEZA 4UIMA 4XPGL 4I0PD 4AY0A 3FOMA 3QORA 2WO3B 4LZKA 5AOLA 4KO6A 2WXOA 5F93C 2EILB 3ENEA 4OGAD 3AXLA 1P5UC 4P3CL 4WWOA 5LCVH 3VI4B 3SDXA 5AW2B 1GKOA 2AGJL 1NAKL 3P4NB 4M8VA 3KPLB 1FVEB 4JDVA 5D7KE 4HCRA 3GIZH 4ZFOB 4PJBF 2XQBH 3G5XA 2VZTA 3KCWA 5KG9A 2UWEE 3S7GA 4YBQC 3H54A 4EIGB 5C0AB 4EF3A 4N22A 3NRPA 4DP2X 1SHMA 4NKOA 5AOZA 5CP3A 5DMYA 4Z7OB 2MTAA 3MRDA 1D5MB 1YMMD 4NZJA 3GBNL 3CFJA 5D1XD 2WUBL 4FXGB 2XBTA 2R1WB 4OZFB 1SOXA 4DP8X 3FBQA 3M7OA 2OXGA 3BUTA 1OCOB 1WA1X 3QDAA 3QNYB 5E03A 3L6FB 4B95C 1XF4B 1T0MA 2ZKMX 3QUHA 5HGAA 2GSMB 4AXWA 1NCIA 1RK0B 2ZWNA 4OJCA 3QHFH 2FVNA 1G1YA 4YEFA 2BOLA 2EDOA 2EZ0D 3NZSA 1BQHB 3H3KA 4F92B 2WWOA 3O9WB 3S5YA 2WQVA 4FLRA 1JXGA 3OJVC 5FYLD 4IJ3C 2XY2A 3CE1A 1L9RA 3VXUA 4NKQB 3BGFB 1H3PL 4JW3A 3SE9L 4DZBA 2X6BA 1ANUA 2DQTH 2FL5A 3B2UD 4PLJC 5JHDD 4A1RA 2BZDA 3R8BB 4Z7WF 1N4XL 2F7QA 3ZDXF 2LFEA 1PX8A 2HT2C 5JHAA 3FK3A 5G4OA 1I7ZB 1WFTA 2DV6A 4MVBC 5AB2A 2EO1A 2WTPA 3DRTB 4HJIA 1WBYA 4R26L 4R7DA 5C6TL 2CDGA 1MCRA 5F9WB 1URZA 2C3VB 1ZANH 5BOZG 1R33A 3JWOL 1NCNA 1GJIA 1IILE 3MBEB 4MXVE 4YHPA 4P4KB 4Y4FD 4GG8A 3GFUA 4FQ2L 1GYUA 1Q0XL 3SGJC 1U4EA 3ASNB 2P5WE 4C47A 3OAYK 5HHVL 4PPTA 4H2CA 2VQTA 1XSJA 2J71A 3CD4A 3US0A 5DRWA 1M6UA 2BSED 3QJOA 4KI5E 5EV7A 1V7ML 4IW4C 5CCHE 3B7RL 3TWCL 1CQKA 3BJLA 4IBQA 1T0NB 1H3TA 4GBXB 2VXSH 5IBTH 1MUJB 4YZFE 3TXAA 4IOFC 2X4QA 3BQUB 2G60H 2FHCA 5FAAA 4OCRH 3B6SB 3RVTC 3FYEB 1OARH 1U8KA 2LLNA 5EFIA 3HR6A 4JFFB 5C9KA 2Z8SA 1LEKA 2CWRA 3VFNA 4K8RL 1BBDL 3REVB 3UCRA 1BVKB 4QXUH 1BD2D 3FSVA 4PB0L 3MV01 3CFBB 3GUTA 3VA6A 2NY2B 2QEJA 2X87A 3S35L 5DRZB 4Y4FC 1FG9C 3KLSA 4UF7C 5AB1A 1AZUA 3S35H 1IL1A 4JM0A 3KJ4B 25C8L 1KBGH 3D08A 5E8OB 1EUTA 1YUKB 5AYTA 3PHQA 3ATFA 5GS1C 4C4KT 2GUYA 2AERT 1AQ8A 1S9YB 1EO8L 1AOZA 2AXHA 2VDNB 1HOEA 4LVOC 1UZ6E 2HX9A 5ECGA 4NCC1 3T6VA 4AENA 3PQYA 2YGOA 4UBDD 1D5ZA 4OZGB 1JZHA 4DP0X 1EJOH 4FI6A 3I6SA 1IEAB 2LAAA 1NPUA 4XNQB 2B0SL 2ITEA 2DYSB 3FO2B 4WGVB 4E0RA 1WEJL 2OR9L 1XZ0B 5CUSL 3UBFA 4XVUD 5BRZB 1Q1PA 3D3VA 4IBSA 5GS0L 1IARB 3MCKA 1JZ4A 1ZHKB 4M48H 1F41A 3OAUL 43CAA 4PCSA 4J3XA 3UPRB 4MQSB 1AGBB 2VZSA 3CHRA 2R15A 2QSCH 3OKMB 4K2UH 4CVWA 3DJZA 1X44A 3K80A 4QWWD 2O6EA 4M7ZC 1Q94B 3KYNB 4BZ2A 1SY6A 2XZAL 4PRHB 4U0RC 5J1SC 4ZYKA 1Z3GH 2AV1A 3L5JA 4HW6A 2BC4A 2J2ZB 5FWQA 1RJLB 5C0BB 1NFDB 4UV7H 1HQRA 4KNTA 5JPNA 4PLJD 3UTQB 2GSIA 4X7CC 1SXZA 4F9LA 3VXPA 4L37B 1U30A 1KTKE 3GXDA 5C2BL 5T1LB 1QFWI 1U8CA 4QHNA 3GKWL 4EN2A 1G7PB 1P6FA 1WGVA 1KYDA 1P9MC 5FW6A 4W4OC 5FX3A 4PJGE 3EDJA 3L5WA 5INCA 5I17A 3IFLH 4K9EL 1XH3A 3GMRA 2GAZB 1AACA 3OD3A 2QELA 3N91A 4BV1A 3S4SG 4I0PA 1EIBA 1XZWA 2VMDA 4PGEA 4TNFA 4JPKH 2VR4A 3UJJH 3O2WL 3UMTA 4D7BA 4LCWE 4F9PA 2XTJC 1VF5C 1N2RB 2Y7NA 4ZW3A 1GOHA 3F3HA 2BSEA 4P5KA 2IGTA 5DWUL 4P8QA 1AS8A 2R2HA 4LBEA 3ZT5A 2NZ1A 1A6ZB 3NCCB 4MJ5B 4WAFA 3HMWL 4Y8DC 2E76C 2L7QA 2WLJA 3HZYA 1JCVA 3MNWA 3P1VA 4F7EA 5SX4I 4AQ8A 4I1RA 3MOBH 3C75A 4AVKA 1RD6A 3EYOA 1XBDA 1BVKA 3IEAA 3OQ3B 4F2EA 3MLPA 2NUTB 3QDGE 5TPWL 2K8MA 2IG2H 3IVKB 3SBWA 2W38A 2ZUYA 1D9KA 2VUOA 2P8MB 1JBJA 5C7ZA 3MX0A 3G9AB 1TENA 2VCOA 3D4YA 1UCTA 4U4BA 3UTSB 1MCHA 3FU8A 4NFBA 1BVNP 4ONFL 4P2RD 4PY8J 4X0KB 5T3ZH 4HXBL 5EEWA 2M83A 2IOOA 3EGSB 3IGFA 3WIIL 2O93L 3FFCD 2G9KA 3QJUB 2ZG3A 4LLDA 4N0UE 4OLWH 1JERA 4DGIL 4DPCX 2W95A 3DOSB 3EJCA 4WCYH 2Z7YA 3KLAB 3GRWL 1CD9B 4PRBA 2VLJB 3L45A 3TBBA 1WPCA 4NT6A 5CD5C 1MJ7H 4QJ4B 3PV6B 4GXVL 1NBVH 3TT3H 5DSCB 1OY3B 3JSSA 4NIKB 3RGVA 5BXFA 4XPHL 2VN5A 4DF9A 1NCTA 4FZ8L 1QFOA 4NQEE 2BZCA 4HKBB 5I8EB 1GW0A 5D7JA 3QFGA 3O6LL 2BERA 2VH5H 4RIRB 3SQOL 4M7JH 2FLBT 5HHXL 4NXKA 5ETUB 1MCCA 3KXFE 3ZKNC 2VDOH 4W70A 4JFEB 5IQ7L 1RZPA 3A23A 1MHEA 2CKBB 5FA3A 3RNKB 2JCCB 3I3BA 3QIBA 4WEUD 4PREA 4RAUA 5L2JA 3FQWB 1Y1UA 2B1AH 1R6VA 4D0CA 1X7QB 1AP2A 3BYYA 4KJYA 3G04A 5T1LD 2H2PC 4OF5A 2DJUA 1NJ9A 4G59C 3TLRA 3X11A 3AMKA 4NQDD 4D2NA 4EIZC 4EE2A 4KUCD 4L5FL 4E36A 1Q9KB 3U6XA 4FP8L 1WICA 3EO9H 3V0FA 4ANWA 3QO0A 4JM2B 3R0NA 3D7PA 4QF1B 2GIYA 4TSBH 4WKZA 5KAQF 2G0LA 1KJ2B 3TFBA 4ZUVB 3U36B 3US9A 4RFOL 1UOKA 4J8RB 4PJ9D 3QUMH 1CL7I 1CFSB 2WWMC 2XG5A 1UXSB 3RURA 4LLMB 3NSCA 3FPYA 3A67H 1RJYB 1MEXL 4Z7IA 2BJMH 3HBGA 4G9FA 4I48A 3SCMD 4YZFF 5E6RB 1UXLA 1PZDA 3H6AA 4CGTA 1GGUA 2XWDA 3CVIH 4XCYB 5DHDA 4YOKA 1TIUA 3FRPB 4X9GA 1HXYA 4AYMC 4N28A 4MX7B 5JW4M 4GW5B 3NPZB 3BESR 3BGMA 4MNQE 1HEZA 1SOQA 1VCAA 3AITA 2CA3A 3BEVA 3L3OB 3DKHA 4RRPA 5FOBA 3NACH 4A6YH 3WNJA 3ZUNC 1A1MB 3MLRH 3OLEA 4ZMLA 4Z7OE 2CHXA 2UYLB 3WXVH 2Q3ZA 4TLTA 4ZFOA 1I8UA 1G4RA 1S7QA 1U8MB 2JLLA 4UANA 3P3RA 1P7KB 3V0EA 5F7UA 3SDXF 2O6FA 2EYTB 5D7IA 5E0FA 3O8XC 2VDKH 1B4JL 4JM2F 3QISA 4H5SA 4U33A 4PW9A 4FQCH 2DIJA 4UU9B 2OL3H 3HG1E 5IM7A 4K3JL 1MI5A 3KPOA 2ZCZA 1A4KB 1A7PL 3QE5A 4J3OH 2ORBH 5DR5H 2JJUA 3U6RA 1E5BA 3BZEB 3O4OB 1N5AB 3VXUE 4QHKJ 2C9QA 2I07B 3B2DC 3QJXA 1B2YA 3C60B 1CVSC 3KWXA 1RIUL 3PGDA 3D0AA 1ZVSB 2R69A 1P2CA 1E9OB 2VAJA 4LOEA 1I85C 4XBEH 4M62H 2GJ6A 2I60L 3CDGB 3HHSB 3WE6B 2IQ9H 3EOAB 2JXMA 3WKPA 1AKJA 2VIRB 3TONA 3SKJL 4HZLA 3VXMB 4H88L 4Z7UA 4HC1A 5DVPA 3UJIL 1QRND 3QS2A 3KGUA 5ICZB 1IGML 4NJ9H 3HEIB 4ZUWA 4C56D 3RYMA 1BV8A 1KYOK 2NW2A 2WB7A 3GK8L 1ACYL 2BY3A 5IW1B 4UAHA 2NY6B 2WXRA 1J1OH 4DPBX 2JTDA 2NYYC 3DTXB 2OSXA 3CFNA 1QSEA 2H3NB 1PIFA 3H0TA 5CZXC 3BPCA 2YXVA 1NCDH 3QQ4A 1KXHA 1P4LA 4N8UA 3LRLA 2IPKA 1PEWA 4B5ZA 4NBZB 2FJFA 3HS8A 1MVUA 1TPXC 4A67A 1EEYB 4GEIA 4NYLA 3K0YA 1XIWD 2MEJB 3VWKD 3S37X 1MJ8H 4LVEA 1RZ7L 5FYLL 3BSGA 2NSMA 4JQIL 5CP7A 3HC4H 2V7HA 3TBSB 4LHJB 1J5CA 2H41A 3GJEA 1D5IH 3HTLX 1HHJA 3OF6D 2K1MA 4H8PA 1U3HD 1FFRA 4TOYH 1G9MH 2J3SA 4PR5A 5EB9A 3OKLB 3V4PH 1X5KA 1R17A 2EIMB 5EULV 3S37H 2BVOA 2ZUUA 1Q94A 2HVKB 2NY0B 4P2QE 3SYCA 3K6DA 4HBCL 1LK3H 4KKCC 1KCBA 1AKJB 3VXQB 3BMWA 3FOLA 1Y7VA 4RMUA 1MCNA 1XB8A 3TBVB 4GMTH 4L3AA 3VGBA 1KC5L 3T0EA 1KYFA 3BHBA 4WSGA 3R4DA 3V4VL 3PY9A 3RWCA 1NINA 5L88H 4R97C 1NC2B 5L2KE 1QNZH 3KGSA 1HL9A 3FQNA 5FFOA 3GBML 1H15A 2J1KA 2PW2B 3GBLA 3CFDB 3ILPA 3H9SE 1PLAA 4NX0A 3GNML 1NBQA 3SJVA 2XOTA 5EUKB 1ASQA 2HT3C 3OC5A 5FO9A 3VD7A 2DIEA 1U42A 3KEDA 4MLSA 4O02A 3PFUA 3NDYE 1HWGB 1RH8A 3U9PH 4MNQB 2E9JA 4KDTA 4JRXD 3VFPB 2VB5A 3KH3A 3N42B 4LPTA 3LZLA 4FG6C 2P7TB 4UT9H 3T5WA 3MBXH 1ZHLA 2CGZA 4PU2A 5F7MC 5D2NE 4FI8A 3VWKC 2CBMA 3N2JA 5JR1H 3IMBA 4PGBB 3ATBA 4DKFH 4GAJH 5I5JA 2F53B 3FUIA 3C08L 4WEMB 5I1EL 3DRQB 3CH8A 3FQRB 4RMVA 4PJDA 4Q74A 5EFIB 4HCIA 1FLRL 3OAWA 5DHMC 4ADJA 3ZO9A 3HN3A 4MAYD 1FHGA 4WW2A 3F7VB 1HILB 1CLCA 1ZTXH 5DU7A 1JVOA 3I9PA 4IBTA 4J3WA 3AXIA 1LEGB 1DQLH 4NN6B 1NMBL 5KBNC 5TGBB 1NM9A 4R26H 4PHXA 4ZD3H 3NVQA 4ZPVA 4EZJA 1WA2X 2MTPA 5C0EB 3PV7A 3GKZA 1XIWB 1Q90A 3NIGE 3QQ4B 3VXOA 2ZAIA 2WYIA 3KS0H 4YHML 4QJ3B 2C3GA 3EJTA 3T3PF 1NGQL 4RDQG 1JYWA 2OSLB 2EC9T 5HJGA 2ARWA 3GLDA 3QZWB 3JZYA 4OZHE 2FRGP 2R23A 3X11B 3ZTDC 1JDCA 3SKOB 1F45A 5DGRA 4HMCA 5IJVA 3CLWA 2VITA 4AQAB 5E6ID 4R7DB 4HKBA 1J1PH 2VR8A 3GK8H 1FGNL 2CPUA 5IKCA 1I7TA 2AFNA 4K5LA 4PJ8A 3OAZH 5CHNA 2QQQA 8PAZA 1KV7A 5JZ7D 5KSUA 2PP9A 3B9EA 4F93B 1ASPA 1IC0A 4J2QA 4LAQL 3UYPA 3WS6A 3MRBA 1I7TB 2IAAC 5FW7A 3WY3A 4AM0Q 5L9DH 1A22B 1FNGA 2CKBH 5F6HJ 1RHHB 1C16A 3SN6N 5I73C 3GDBA 1NEZA 2V0AA 2X4SA 5DFTA 3S0PA 3VXNA 3CXDL 3U0PA 4GO8A 3VXSA 4NUGH 5L2KD 3OMNB 3WFDH 5IK3B 1WLHA 4JVWA 2BMKB 2QGEA 2O5ZH 1RULH 1VACA 4FTDA 1KLFA 2TRHA 5EU7E 3SYQA 3Q13A 4PJGB 1PD1A 3MOAH 4XCFL 5AFAA 3I3EA 3BH8B 4X7SL 3KBFA 3QAZB 15C8L 1YNLL 3SZKC 3U82B 1M3JA 5TGBA 3BVDB 4WRLA 3RAJL 3W81A 5HY9B 2Z9TA 4U1SB 5HHQB 1NQBA 2OX5A 1MHHB 5F7EH 3NPSB 2EIEA 2PP7A 5AALA 4IBUA 3LH2L 4N1EA 2YUXA 5EF0A 5LCVL 4TNEA 4C83B 1W8NA 2W0LA 1UYWH 2VDQH 4YSOA 1FO0L 2CRIA 2WAHA 3SPHA 4G9DB 5ISZE 3KLHD 2DDQH 4KKLD 2J55A 5FC9A 4KI1A 3J07A 2DLIA 4HFUL 2YQGA 5BZXA 2R1WA 4FFTA 2XNAA 4HIQA 5A2AA 2WINA 3QUKA 2EDEA 3VX0A 4WJKB 4YX2L 4ERSH 5EIQA 2N59A 2I26N 5BV7C 4APQC 3LCYA 1J0KA 4PY7B 4PV8B 2WLNA 2A6KA 3NCYS 4JAMA 3W37A 2CJUH 3HZVB 3U0WH 1JOIA 1F13A 1UB6A 1T21A 2OX5B 4LSTH 5K1JA 2AV7B 2DQHH 4M29A 1TR7A 3EFOB 1B9KA