2IIJA

Structure of human asf1a in complex with histone h3
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
156
structure length
156
Chain Sequence
MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHINWEDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords ASF1A protein
publication title Structure of the histone chaperone asf1 bound to the histone h3 C-terminal helix and functional insights.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2006-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04729 ASF1_hist_chap ASF1 like histone chaperone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 2iijA00
2HUEA 5BO0D 2Z3FA 2YGVA 2I32A 5BNXD 1TEYA 4RRPM 2Z34A 3AADB 2DZEA 5EIIG 2CU9A 4ZBJA 1ROCA 2IDCA 5C3IA 4EO5A 1WG3A 2IO5A 2IIJA
chains in the Genus database with same CATH superfamily
4UDTB 4KX7A 1Q9WB 4PRHA 2R23A 3QHFH 1U2CA 5CU5A 1ZOXA 2UZYA 5KSBA 1KV7A 1Q9OB 5KYWB 4OLUL 2DQFB 1MJUL 4P5TB 3M7OA 4LHUG 4KXZI 3TYFB 5KEZA 1YYML 5I5MA 2Y7SA 1LDPH 3BRDA 3E9TA 1NBYA 3QNXB 2ITFA 3G04B 5HJDA 4ECNA 1FFNA 1M7UA 3MLVL 4DP9X 1VGEH 5GGUB 4Z7AA 5IB1B 4G8FA 5ICYB 1DQIA 4V1DB 4WKZA 3UTOA 3BXNB 3O8XC 3ZX1A 2WUBL 4KDVA 5CN1A 5JHLL 5HHVL 2OCFD 3U9UA 3LQAH 2Q7AA 4LGSB 1BJMA 3WD5L 4CA4A 2HLAA 1RK1B 3RX8A 1RZ7H 3KGSA 1MUJB 3LB6C 3T0VA 1CT8A 1GGTA 3MCKB 1O5DT 2CO3A 5HGHA 4W9EC 4OFIA 3V0HA 1T0NB 5T5FA 4DAGH 3MGAA 2EH7L 5CBEA 1JF6A 4XNQA 4M5TA 3TIDB 2ED8A 5AVTB 5CGBA 4DEPB 1SN0A 4KK9D 2FJHA 1U2HA 1QFUH 3F7QA 2GCYB 4Y4KD 5IG7A 2D0FA 4NXKA 3TBSA 3SQRA 1EJOH 3X11A 1WD8A 3QUZD 1I8KA 3X17A 1NPNA 5LUMA 1FYTA 3FFCE 2Q6WA 5CBAB 1VDGA 5IUSA 2BW4A 1XB3A 2KPWA 1AGBB 3BN9D 1FIGH 2OX5B 1BFOA 2P8MB 5FUOH 3BGAA 3FMGH 4U6HB 4C58B 4L29B 4UDUA 4WI3A 4UU9A 1PFCA 1ZGLP 3T09A 1TDQA 3FQ4A 2HRLA 4K5LA 2GB2A 5I9QB 1ZJBA 1FI8C 4JBSA 5JQIB 3KXFE 1KJ3L 1RU9L 1UB5A 3LIUA 4YR6A 4Z8FH 2WUCL 3ZKXB 3JWDL 4K8RH 4WSKA 2RD0A 3RFZA 1NCGA 3M1OA 4G7QB 3OKLB 1ZWIA 5D72L 4Q6KA 3OKKA 3IDYB 2OMWB 1OGAA 2Q2EB 3WO3B 5TDPA 1QR4A 3S37X 2VAAA 3NQIA 2Y1AA 3GJEB 3BLKA 2OL3H 2NTSP 5EDXA 4M1CD 4X4KA 1JWMA 1P1ZB 3L7EA 4ZMZA 3MX0A 1QLRA 3RGBA 5E8PB 4CVXA 1ZGLB 4PB9H 2CLZB 5FUZL 2Y06H 3DK2A 3MACL 4ANXA 2N7SA 3LY6A 2EVHA 2JCCA 3HC0B 3OR7B 1DP0A 1QLFB 5ADOL 4ATTA 3MBXH 5IMLA 3MRDA 1CDIA 5E00B 1HHJA 4LB8A 1QPXA 1G1OA 4NNXB 5CINL 1IQDB 2BOCA 5IROD 3BPNB 2BY3A 2PYFB 1IM3A 1D5XA 1NCTA 2V17H 4BUGA 5C3IA 3MLXL 3VI3F 4WWID 4U1IB 4XCYA 1OPOA 3GLEA 3MA9H 2D0GA 1PBYA 2NY0D 5DI8A 1YEEL 2FEEL 3DV4B 1V3JA 2DQGH 3HJ0A 4U1KA 3VB8A 1JS4A 4OFYD 4YXHH 4OZFA 4JRXA 5EU5A 5IB3A 2R0WH 3VFNA 4IIQC 2EADA 1AHWB 4HD9A 2GI7A 2VL4A 1TZGH 3O4OC 4LOUC 3ELQA 4DN4L 1E7VA 4C56E 2MPAL 5AALA 3QDJA 2EICA 4O2FA 3FT3B 4L8CA 2ZKWA 5CEYB 3DTUB 5BV7L 1SYVA 3RPIA 1QEWB 2ZOLA 4UUJB 2YAFA 1ANUA 2ZJSL 3AWEA 3X1BA 5IMKB 3EXLA 3IFLL 3RYMA 1A66A 2JI1A 3QUMB 4MXQC 3U1QA 1DJGA 1MFBH 1Q9LA 1AHMA 1OCZB 3VI3E 4MZ3A 1J8HA 3BKYL 1JIBA 4GLRI 1DVZA 4EZKA 2IPTL 3BRFA 5J12B 5DLML 1NGPL 1EO8H 4PP1D 1G1YA 4X0KA 3OWEA 5DQ9B 2WBJD 2GITA 3UPRB 4CGTA 4PUBH 4RRPG 1GCYA 3J27A 4LKXA 4C56D 4U6VH 3B9AA 1KBBA 2NW2A 3FU9A 5LAXB 3T8VA 3ORJA 2ZG3A 3MRKB 1FNEA 2BPBA 2QTEA 5EBMA 4OJEH 4PB0L 1ZANL 4G8EB 3MJGX 2VUOA 3CLFL 3MV7B 3WTVA 3B83A 1E65A 3MLUL 5EEYA 4GP4B 4ZFZA 3HZYB 4PRBA 2GY7B 3NRFA 4ZOCA 5KG9A 2AFNA 3M45A 4G83A 3IPFA 1CL7I 4XVSL 3RX9A 4KHXL 1HQRA 4UQ9A 4BK5C 2P49B 1EFQA 3LH9A 4I13B 3NIDB 4H0GA 4OF8A 1YLBB 3P4NA 2YBRA 4N6RA 1RUAH 4X98A 1HAWA 1NGZB 2OZ4A 4YX2H 3PWLB 3HG0A 4PLKC 1L6XA 5GISL 1XH2A 1ZVYA 2IXQB 2CKBB 3LXUX 1PZDA 2WBWB 4TPRL 5E2TL 3HUJF 3KCPA 4JCWA 1I82A 5G4NA 1FAIH 5E5RB 4GINA 4TRPH 1OF2A 5L88H 1HXYB 2P8PA 3FUHA 3N1QC 1XCQA 4ENZA 1YEKH 1V3LA 4H20L 3CWGA 3GS0A 5HDLA 1ZS8B 2X6VA 4AITA 4YNYA 1JFHA 4PWEA 1SHWA 4LHUB 3MNMA 5DRXB 4Y1AB 4HZ1A 1INDL 1YO4A 3VFUA 3FOLB 5CFHA 4G8IA 1IC5H 1UXSA 4Y1SA 3WYRA 3S5LB 4XP1L 2J1XA 2EE2A 1T5XB 3TV8A 5GZND 3MLYH 4OLWL 4LARH 2RBLA 4R7DB 5BS0B 5FLVA 4DPCX 5MI0C 3VI4A 15C8L 5ALCH 1EFXA 5GS1C 4MNQD 1MCKA 4Z5RB 2YUWA 3HUJE 3BAXA 4Z1PA 4XOCA 1UT1A 5IOPB 1NKRA 1OVZA 2CDFA 3C5SB 3FFDB 5KYYB 5JLZA 1NCCL 4OAWB 4WDIA 2PPDA 4ISVB 4PR5A 1VPOH 2O5YL 3IU3B 2AJYH 2E7MA 2YUVA 1F6FB 2NXZB 1K8DB 3FAWA 4OBRA 1BD2A 5SWZE 4AYMC 1N9PA 1FH2A 1HNGA 3FTGA 2NYKA 1ADQL 5IHUL 1IEHA 4KVCL 1DEDA 1KB9J 1YPZA 2HT2C 3SDXE 4AX3A 2IH8A 4AKQA 2H6PA 1MREL 1F4YL 4F2ME 5FFOA 1CTNA 2HH0L 3DGCR 1P7KB 2IG2H 1AY1H 4GI6A 5JOPE 2H0FA 3G6AB 4FFWD 2XN9E 5IB4B 5KOMC 2MTPA 1R34A 5DD0L 5EMYA 4HU2A 3RIAK 5TK2A 4KJPD 5E6IA 3WKPA 5DUML 1QEXA 3D30A 1P7BA 4JZOB 3TEZA 4BH7B 4JE0A 2P28B 4ZTOL 4PIRF 1WAPA 4AIOA 5IHLB 1PU0A 3VXOB 3N91A 2B39A 4H7VA 3HG1B 1YMME 3T2NH 5ENWA 3HMXL 1MF2L 2OI9C 5D7LA 5FHAL 1AD0B 3BZ4A 5CJQL 4AQEB 3QWRD 3JT0A 2FNWA 4NYLA 3CFEA 2C9RA 2N4IA 4KZ0A 1XDTT 3K4DA 3CG8A 3K46A 5CS7A 3U0PB 5JOPD 2EDFA 1NAMB 2P5WB 4K71C 4ZMNA 2QSTA 2XN9D 1AKJA 2WB1A 5EOCH 3ARQA 3AACA 3UDWC 3WI9A 3MCG1 3MJWA 4HH9B 4ONGH 4NJ9L 2ZXQA 3UERA 3VFOA 4YSOA 4LF3A 5F97E 4ZUWB 4Z7WF 5SX4I 4TVUA 1GCFA 2NUTB 5F89A 3VXUA 4YSAA 5I1KL 5I0WA 2HKFL 4ORZC 2VDRH 1MCFA 3BKCL 2NY4C 4XP9H 4NIKB 1BEYH 4IHOA 2ZXAA 2FQFA 3E2HC 1INQA 2LU5A 1CFVH 1I4FA 4FNTA 1WHPA 3PAUA 2XA8L 3FB5A 4WWOA 5EU3A 4MCYB 3KPPA 4BCYA 4WRLA 4YN3A 4OGYH 4DVBA 4ONFL 4XX1E 1YDPB 4JQXA 5EUKB 4P46B 4QXTB 1I85A 3TJHD 1MFNA 5C0CA 4QJ3B 3OLGA 3IKKA 2GK0B 3WLBB 4MA3A 5BZDA 1KB5H 1TJHH 2YXWA 3VXRA 3H9HA 4NAQA 1YMHB 2EE3A 3GSWA 3H54A 4HF5H 2OMTB 3BGFB 4Z7WE 3FCSB 3P30L 2H0EA 1A0QL 1GSMA 1N10A 2DJSA 1TF4A 2V7NA 5AVZB 5GGTL 5I2IA 1O7DE 3UPAA 2O72A 3QNZB 3VUAA 5I8KL 2O6CA 2X4OA 4RQQA 3Q6GH 2ARJQ 1KJVB 2JB5H 2YKLL 5AAWC 3V0EA 1K5WA 4O00A 3JTSA 1UZ6F 1QFHA 4QXUH 1T5WB 3LZQA 4ERSL 1QLEL 1NC4B 4JR9H 4JFDE 4UILH 3BN9C 3DK0A 1JDAA 2HKAA 3WFDL 3T04D 3JWDC 3IDXH 4YHZL 2FBRA 1N0LA 4HBQA 4KJYB 2H5UA 1KBWA 3L1OH 3GI8H 5EG6C 3MKGA 4KH2A 1Q90A 4LSQH 3FQUA 3DV6B 4XRCA 1E27A 1PSKL 3KWWA 5CEZE 5I15H 3MA7A 1AXSA 3MUGA 2JI2A 2F8IA 2VDOH 4LKCB 2X4PA 4AJVA 4FQXD 3QXUA 1CXKA 1LWJA 2XG5B 3OL2A 4G8GB 4HIIA 4QAWA 4BSVB 2Z1KA 1MCPH 1HESA 2IDTA 4QAMB 4ATWA 3D25B 2XX1A 5D2NC 4ZQKA 1FL3A 2XV0A 3SBWA 2L3BA 4NJAH 2CIIA 3QEGL 2N56A 3H3PH 3Q2CA 4K3JH 1OE1A 1WC7A 1UZ6E 4XAKE 1MEXH 4JL1A 4L4VA 2V5RA 1RZJH 3EBIA 2IBZY 1A9EA 2WQ8A 1CXIA 2XLLA 3S4SG 1Y07A 2XCMC 3G5XA 4BFIA 1MWAA 5JW4R 2ZCLL 3L3GB 1AZNA 2A6DA 4K7PH 2IV9A 2OMVB 4LLAA 5CEZD 2NZIA 2IPUK 1AZCA 3K91A 4H8UA 2X89A 4Z7OF 4NQQA 4HKJA 1CG9A 1J05A 3PGDB 4OCWH 4LAQH 4XNMA 4GT0A 1DN2A 4MX7A 2WSDA 4OLZL 4OUUA 1V7ML 5EZPA 3FU7A 2BVOB 5BRQA 5JIQA 2V7HA 3LS4L 5C0FA 4M4RA 3D5OF 2H0JA 4AEHH 3C6EA 3OF6D 4PGCB 2TSBA 4XH2B 3EOBA 3K71B 4KZEH 1A6TB 2BJMH 5DD5H 4B95C 2UXGA 3RPBA 4ZW5A 5HXMA 4N2GA 3OHXB 4AL8L 1PG7W 1K4DA 1FVCB 3CBKB 1U3HC 3WHXB 3DOIA 1NGQH 3ZE0F 3BO8B 2YKKA 5BV7C 4JG9A 2JIXA 4MQ7B 1KT2A 4XVTL 5A2AA 2WXHA 5E6SB 5K9QG 1AXTH 1S7SA 5KVFH 3ATEA 1J9RA 1JNLL 2OR9L 4Z7OE 2R29L 2V9UA 1RK7A 5DS8B 2DQDL 2YSSA 3P11L 1WP6A 1XF4B 3E80A 1COBA 3CDZA 4WI9A 2FH6A 2FIKA 3HI6H 9PCYA 1ZE3C 4FGMA 1AS7A 4ZO6A 4UIKH 2NLJB 4YUEH 4DCQA 1NUNB 4XWGH 2GBAA 4FYSA 5F1NA 2HJLB 3ZJAA 3B7YA 4EIBA 3WJJC 4G6JH 4DJMA 5KUMA 4QHUB 1QATA 5KSUB 4IRZH 4XMKH 1MY5A 3ZE0E 3RGVB 4X83A 1H3WM 3R06A 1IKNC 3H1ZA 1IC0A 1A1OA 1R3LA 3LIZA 4AVIA 4OKVB 4AQOA 3NK3A 2WY3B 2X4QA 2IQAB 1ZA3A 1JYNA 2DIAA 2K0RA 3HVNA 3RUGA 1UD5A 4RVBA 5FA4B 1TQCC 5FX3A 4Z9KB 4U6YB 3KYOA 2VLME 2A4CA 3LKSB 2OL3B 3QIUD 2WBXA 5DGRA 4Z18A 3HFML 2A9MH 4N2KA 1MHPH 4NEHB 1IU1A 3BJLA 2XTLA 1MI5D 3LZNA 4UNUA 2R8SL 3F6JA 4TV3A 3ECWA 1I1AA 3ILPB 2UVEA 2OULB 2R2EA 1OP3K 2OYKA 4GRWB 2XV6B 2Y36L 3N9GH 1J1PL 4PV8B 2QSVA 4ZSOE 1JZ7A 3NJLA 2WXGA 5EUOA 1D6VH 5AW4B 4UT6H 2Y3NA 2VLRB 3H7BB 1HHIB 3KL3A 3VXPA 2AJ3B 4DUXA 1VADB 1Z9SA 4E5XG 1V54B 1U8PA 4MDJA 4NZFA 4HPOH 3OKNB 1PAZA 1SJHB 4I87A 5CZXD 4JFHE 4JM2D 3S36H 5B8CA 3WHE1 1CPUA 1N0XH 4OIFA 2NY3B 1TZ8A 1LILA 1T1WA 5I8EA 5DEGB 1JNHB 5IGXL 1ES0A 5D4HA 5D8JL 4EI5B 3DX0A 3GMMB 4YGVA 1DQML 3N40P 1SDDB 2F19H 4YHYB 3V6OA 1Y1DA 1WD9A 2JKJA 5DUPH 4K5NA 3WV0A 2ERJB 1UJ3C 2MCPH 2Y6TE 4OCYL 5A6MA 2FJGB 4ODVH 5AZ2L 1N5YH 4HCGA 2C3GA 4NBZB 4WO4B 1G5GA 2LFGA 3L4TA 3VMPA 4XBMA 4NM4H 2B7DT 4HLEA 1N2RB 3UGUA 3S35L 5C6PB 5E7BA 1AR2A 3OAUL 3ES6B 5DVLA 2VZOA 1EWHA 3B2VH 1J0JA 3LH2H 5AVRB 4YOKA 5I1IL 4TSAH 1DO5A 4IBLT 5E1GA 1R24B 4IRJB 3ROLB 4BKLA 2J1YA 1S6NA 1CLZH 3L9RA 1ZHKA 1ND0B 4OV6F 2P3YA 1HH9B 2KC0A 2BIHA 3OHMB 3RHWK 4Q9RL 4HCRA 4EEEA 1CLYL 2FQGA 5L2KA 3NJNA 1PLGH 4IOFD 1OT4A 5IFHH 5LGHL 2A4EA 2YGPA 3O2VH 5ILTH 5C0AE 1BIIB 5HDOA 5EOCJ 3NEXA 3VFWA 4OIIH 1MVYA 3D0LA 3GRWA 5CCKH 5BZWA 2CMRL 3TNNB 4CILA 5BO1H 3UEZA 4RMWA 4QXGL 1A4JA 1ET8A 3T4YB 2FWSA 2QSCH 1B2WH 3OMZA 4RMRA 5DFTA 4HLJA 5FW8A 3CXFA 2WOYA 1PZ5A 2GBTA 4HK0A 2QZQA 3OXRA 4U1JA 1DJHA 4LSPL 5GRJL 3C6LD 1DDHA 3ZDXF 3QXDB 1LEIB 1W0YT 2JXMB 2PP7A 4GSDH 3DYMA 3HE6D 3RA7H 4P23A 4GBXB 5GRVL 2VN5A 5C0AD 1G7HA 5T5NG 3QCUL 3X1GA 3WMPA 4JFZH 2NY2C 1A7PL 3RKPA 2RB8A 4WKXA 1ACYL 1BXAA 1H15B 1OLZA 4Y16D 1O6VA 4YSSA 4B50A 2AMGA 1UD3A 4UT9H 4IOIB 4J4PC 2L7JA 2PR9A 4EDXB 1EGJA 3ETSA 4LPXA 1HOCB 1RD6A 4Y9EA 5C2BH 2YPLA 4LSDA 5HDWA 3SDCB 5ICZB 3ABZA 2A77H 3Q8AA 1CDBA 3TJPA 2CALA 3SOTA 4FTDA 3FHEA 2JKNA 1RPKA 1Q9WA 4AE1A 1PL3A 4O58L 1J1XH 1AR1B 4NQCA 4BUQA 2DQFA 3ZDXE 2BMKB 1TNNA 5JR1L 5ID0B 3RJOA 1FORH 2E46A 2EP6A 3IDJB 3RLSA 4WO0A 4IBWA 4F80A 1Y6KR 4LCWD 2XWBB 3EYOB 1NMAH 4BFFA 3QQ9C 3ILDA 4X9BA 5I16B 2DTML 4HHAA 3VXSE 3T0EE 3FO1A 1IBFA 4EMZA 3QNXA 4OCRL 3WKMH 1ZHBB 5CCGE 5I0VA 3CFKB 2ESVE 5IB1A 4M5ZH 4L3CB 5GGUA 1A6UH 3NSCA 1CICD 1N18A 4HKBA 2DWDA 4PJAB 1F00I 4EBQL 5DMKB 2FLRT 1N26A 3NPZB 3LPOA 3BXNA 4FL4B 4YC2C 2PPAA 4U1LB 4YHOH 1B6UA 3OMNB 4OJYA 1MJ7H 4S0TD 3ALWA 3C5ZD 1JBJA 5IP4A 4WEUD 4P2RE 2EC8A 3ABGA 4IBQA 4PJFF 3QIBB 4CUCA 2W9DL 5HVFB 4RFOL 4DNLA 1RK1A 5K9JL 3BZDA 1MUJA 3WIHL 2VC2L 2F58H 3MCKA 1PQZA 4B6ZA 1J18A 3S9DB 3VXSD 5JHAA 1T0NA 3A24A 4XAWL 5EORL 3PGCB 2AQSA 3QFJB 4E41D 3O41A 3PABB 1LDSA 4PRPD 3D33A 1ZV2A 4YDKL 3TIDA 4TLKA 5F93C 3ARDA 4JX0A 4FZEL 5TE7L 1AP2A 3WD5H 6CGTA 3SDYH 3TEYA 2C1PB 2VOTA 2BIQA 2ZOOA 2CBQA 3LNDA 5EBLB 5C8JB 3TVMD 4N8CL 5C86A 3DYPA 1O7DC 1BXXA 3KM2A 5CBAA 5E6ZA 4KDWA 1FPTL 4R90L 1U0QA 2CWRA 5KN5B 3V0AC 2OX5A 4G7VH 4PJFE 2P8MA 4U6HA 4WI6A 1BG9A 1O5PA 4NRYB 3TWCL 4JG1H 3E1F1 1AG0A 3MV9D 3SPCA 3GM8A 3ETBF 2VDRB 4WFED 2WN2A 3GXMA 4R6UA 5DQJB 3HA0A 3TYGL 5H4ZA 4MA8H 4P5TD 1GYVA 3OGOE 4Z3JA 2DZEA 5E1AB 1BM3L 2WXQA 3DX2A 3RI5F 2WYHA 3OKLA 3HZKB 3MRMA 2OMWA 2VQ4A 1PF3A 2IWEA 4IKNA 2HWZL 4TMPA 2BIPA 4E9LA 1YRKA 4AL8C 2F8XC 3ZKMC 4HEME 1U21A 4L4TB 4QHNB 4E5XB 2W5PA 2A99A 3F3HA 4V1DD 5C07E 5D7KE 3WUWA 3DSFH 1GH7A 2WUCH 1P1ZA 2YC1B 5E8PA 1ZGLA 2JKIS 4ZMPA 2RCSL 3T6XA 3U7YH 1M1XB 5JIKA 5LGJB 1OCRB 3BGMB 1LO0L 1TLKA 2R4RH 3KWVA 5I82A 4X0NA 3OR7A 1QLFA 2FEJA 3AQXA 4LRIA 1AGDB 2KHAA 4MNGA 3TZVC 4Y2NA 3M07A 1KLFB 3VSVA 1CF8L 3KM1A 5F71A 3BP7B 3GSRB 4NNXA 6FABH 2B59A 1FGNH 1Q0YL 3NIGB 3S98A 3BVWA 2YFNA 3APMA 5D7SH 2FX7H 2X28A 5K93A 2BSRA 4PWGA 3QNFA 5F3HB 1NFIB 4DQOL 2A2QT 4FQQB 3A6BH 5C07D 1A6VH 4AW4A 1U8CB 4L3AA 2MOVA 4FXLA 4N0RA 3DV4A 4OSUH 5TDOB 2BY0A 2IMMA 5E24E 1TVHA 1GJUA 5HYEA 4YIQB 5I17A 3A67H 4U6XB 3NESA 4K9JA 1WWAX 1AHWA 3I9GL 4HXBL 1A7BA 1V05A 4M02A 5IM7B 4MD0A 2XZQL 4XOAA 3MRQB 1IVTA 1S7XB 3O81A 2GI0A 2R0LH 4K2UL 2VDOB 3FT3A 4WI5A 3ZKND 5LXGH 3VDBA 5CEYA 4M6OH 3LRMA 2W8CA 3C9NA 4NUMA 43C9A 4UUJA 5JIMA 1U8LB 3D07A 4X5RA 4I9WE 5IMKA 2KDYA 1N7ML 5IQ7H 3V5HB 1AFVH 2AJVL 4GUPB 3BH8A 2LU4A 4M62H 5FYJU 3PYCA 1T6BX 1U8NB 1XFPA 1WT5A 3LNGA 4IU3B 1G9MH 1RP8A 3K81A 3AGVA 4R83A 3ASWA 5DHXB 5DQ9A 2P80D 3I9AA 5FWQA 2AAVA 4N4YB 5F9DC 1CZ8H 4JO1H 1AKPA 5LAXA 4P3DB 4JN1H 4N2NA 4PJDB 4MRCA 3MRKA 5C08B 1HI6A 4JFEE 4X4YB 5E4EC 4HGWA 4ZPVB 3US1A 3BKYH 1DBMH 3CJJA 5KW9H 2J55A 3MV7A 4MAUL 4I9WD 5HP5A 1OP5K 1N64H 1JZGA 4NUQA 1NFKA 4OR1A 2Y23A 1MAMH 1OLLA 2Q9OA 3HZYA 4GAGH 2X38A 2BNQE 2WXOA 5AEAA 4APQB 4Z3GA 3GXDA 4BZ2L 3HVDA 3KLDA 5EFIB 4XODA 5FDWB 4CVZB 4NUGL 4C4KT 1U8IB 1FHNA 1A6AB 3O3AA 4GXUM 2NQ3A 4LFHD 4IGBB 4CN4A 4AUJA 1NGZA 2J43A 3A22A 3ARFD 3PWLA 2JB6B 5I6PA 2I5YL 1CBJA 1XF1A 1IBHA 2F7OA 3K2UL 1UM4H 3FF8A 4Z76B 3KDPB 2AF2A 1KY7A 2IXQA 2CKBA 2C9SA 2VMDA 4JFED 1MCWM 4WFGE 4Y4FB 4JLRA 3VMOA 3ZQ9A 3BHBB 3WO4B 3CCHB 4GIPD 4NCC1 4OFVA 2EEBA 4A2GA 3DIDA 3BOVA 5HI5D 3JTTA 3HB3C 3L16A 5C0RL 1H0DB 1TETH 3Q05A 4HWBL 2H1XA 1NMBH 4N0FA 4LDEB 4KTYA 5IF0B 4ZDHB 4L9LC 2ZP0T 2XN1A 3UBXI 1QRKA 3I6LE 3WDHA 1C5BL 2QR0A 2FJFB 2AK4A 2F6AA 4LQFH 1T80A 4LP5A 3S5LA 2XWZA 2DWEB 1UXWB 5LQBL 4WFGD 4PBXA 1FFOA 1LD9B 1M05B 3CDYA 3CVHA 5EU6B 2DDQL 1BHGA 5BS0A 2E9JA 4RA0C 4K3EH 3MLZH 1OSEA 1A25A 1L9TA 2YOAA 3BVUA 5IOPA 1KWGA 3FFDA 4OAWA 3WSQH 2KLTA 3TS8A 3GS7A 4B9FA 1DCLA 3EH3B 1MFEL 1K8DA 5ISZD 4AQ1B 5AYUL 4CSZA 1UGNA 2YAEA 3NPSB 1E9QB 3DIFB 4KQ4H 4JMXA 4FYTA 3UC0H 2LFEA 1MCSA 4CL7A 3GM0A 2C9UA 1CBVH 1DVYA 4BK4A 3D52A 3B9DA 2IGFL 5DJ8A 4DP6X 4KTDL 1P7KA 3CMGA 3UBXB 4OLEA 4PS7A 3QO1B 3MOQA 3ISRA 1OCWL 2DWSA 1XXDC 4W9LC 5IB4A 3C60B 2LAGB 4Q4EA 2QVKA 2ZXGA 3KPRE 3HE6C 4AJ0A 2WZPD 2AITA 4F15C 5HVHB 2VR9A 2C3XA 4GKNB 1YAZA 5A7BA 1XWVA 2TSAA 4LGRB 5AOMA 4X7TB 3NRQA 3FZUD 3KWTA 3HC3H 3VXOA 3HG1A 4PJ8B 2HKHL 5EIVA 1AD0A 1OAJA 1MNNA 5IBUB 4ZW3A 4L9DA 3DO7B 1FRGL 1I75A 1NQBA 1KJ2L 2LT9A 4LHUD 4UF7C 3U0PA 1MW3A 4LLMB 4PJHF 4Y1AD 4BZ1H 4EE2A 2P5WA 4PS4H 4EAEA 4EOWH 1SM3L 1YEFL 4OT1L 4AGMA 3MLRL 3KPRD 4JB9H 7CGTA 5CKGA 4HAFA 4NO0B 3JWNG 4UV4L 2WB7A 1XO8A 9CGTA 1NOLA 4ZUWA 4ZX4A 3SDAD 2NUTA 1JFQL 2VGLM 3VFSA 3DHMA 3CHPA 3IKCB 1NBZB 1MXDA 3EJRA 3NK4A 2Z8RA 2VM4A 4FNUA 3VQLA 2E56A 1T7XA 4DO6A 2XJLA 1HX0A 2C8NA 1BBJB 5DO2C 5FV2A 3B1TA 4OV5B 1ETJA 8PAZA 3NZUA 3ZE1B 4MCYA 3QIWB 1KPVB 2VN3A 3P9MB 3BW9A 4PJ9A 1CICC 4XP4L 4QRAA 2DQTL 1YDPA 4MBRA 5EUKA 5FYLD 3LVTA 4PJHE 4QXTA 5BJTB 3LXBA 3RWHB 3DWTA 2YJLA 3SPIA 3FQRB 1CU4L 3BKJH 3WLBA 3QBTB 4QTIL 4PI0A 2BZDA 3C5JA 3HE7C 1YMHA 3FN0L 4I0CC 1BG1A 2OMTA 3FCSA 5HHXL 1E8XA 3IT8D 5CP3H 3DVNB 2R1WA 2VLJE 5FCUL 3T0EC 4XWOD 4AV4A 2XWCA 5D5MB 3U2SA 5EB9A 4K5OA 1G7PA 3BN3B 2ZUTA 2FGZA 3ARVA 3GD1C 4P3CL 5D7JA 2MOGA 3QNZA 1MCLA 4HC1H 3II2A 4TVPH 2E4TA 1OB0A 5J56B 3OR6A 3MBEC 4ZD3L 4Y19E 3TVMC 3ARGC 3US9A 3OAZK 1BBDL 1T5WA 1X9QA 5F9JB 3B7SA 1H8LA 1NC4A 1OK8A 2VQTA 4KKBC 1V8HA 2EEAA 3T2OA 4KRNA 2KS0A 1EMTL 2VLJD 2DYPB 4KJYA 3SCMD 3EDJA 5DHVH 2CGZA 3GJFB 5D1XE 3IU4H 2JCWA 3N85L 1IRAY 1UH3A 1UA3A 1WFMA 4HXAL 4X80L 4YE4L 3FCUB 3LEVL 4LKCA 4FLSA 2IDQA 2XG5A 4G8GA 2Z65C 3BWZA 3CPLB 3OSKA 3D25A 4KMLB 3FW6A 4YHZH 2CR3A 4M43H 1ZPLA 4WK4B 1EZVY 4GMSH 5BRZB 3WU1A 5C0GB 4Y89A 2GQHA 1ZVNA 3MXVL 3GMPA 5JPMB 4PLJD 4P46D 3NSDA 3BWAA 1URLA 3L3GA 2VSCA 4KITB 3MOBL 4CRPA 2OMVA 1G9NH 1MHCA 4UM9D 4I89A 1JTTA 7PCYA 2WNXA 1QKZH 3APDA 2F5BH 4XTRD 3PGDA 3FN3A 5K69A 5DRZB 1TYJA 2R4SL 2BVOA 4JS7A 2YQBA 4MMXC 4KKQA 5IZ7A 4Y2LA 3S96B 5J4MA 1CR9H 4PGCA 4XH2A 3GDBA 3K71A 1A6TA 4U05A 5E03A 5FM8A 4PVBA 5GRUH 4GFXA 2DEYX 3OHXA 3B6SB 2CGYA 4X6CF 2JJTC 4LQ1A 4QD2E 2ZXDA 4Z95L 4M7KH 1E4XH 1MCDA 4NKOB 2Y2TA 3LZFL 2V4LA 4MQ7A 1XTLA 4U2ZA 2LTQB 3JV5A 3WXVH 2NY6B 4ANUA 2FB4H 2OQJB 4FZ8L 3TBCA 1NLBL 3RX5A 2Z7YA 2MPVA 5DDHB 4OTXH 5DS8A 3V0DA 2GYSA 3PHSA 3MUZ1 1XF4A 2H26B 3LN5B 3S3JA 4F58H 1EHAA 4OLVH 4NENB 3KH4A 4XVTH 3VQ2C 3PREA 4KRPB 1CDUA 2NLJA 5EU7E 4G8GD 4N8VG 2HJLA 1JNLH 2OW6A 3CLEL 4FHKA 1SEQL 4PJGB 2R29H 3WEXB 3VWJC 1JPTH 1PZ3A 4QHUA 4X6CE 2E27H 2I60H 1NSNL 5J7CC 4JKKA 4FCHA 5A3ID 1UH2A 1QMUA 5A6LA 1FFRA 2CRZA 3L3KB 1XCTB 1O6SB 2FLBT 2YD4A 5H94B 3PQYE 1JWSB 3MV8A 2AXFB 5IKCA 3GI9H 2EUXA 4NC1C 3W82A 1T89A 5FA4A 5DWPA 2JQMA 4ZMQA 4GW4B 1QNZH 4ONOA 3I50L 2JTYA 2E47A 2OL3A 3LKSA 5DEJA 4JQVC 1NPJA 4HS3B 2OSXA 1KENH 3BX7C 4TQIA 3UYOD 1P6WA 3ESUF 3HKFA 3WNLA 3FSAA 2IO5A 1ETZB 1Y0LB 3MJ9H 4QYAA 3HRZC 4N2IA 2FR4A 3VTMA 1XMEB 3LEXA 4PV8A 1FH5L 3STLB 2DIJA 2X05A 2VLRA 3H7BA 4R26L 4DP2X 5F0MB 3FONB 3NZHL 3P9WB 2AJ3A 1O6TA 1VADA 3MUY1 1A2YB 4ODHH 3V95A 2KZWA 5EZIL 1PKQB 2QPDB 2QVIA 4J2XA 3OKNA 3P40A 1SJHA 1CDGA 1T4WA 2E5EA 3PWPE 4GXVL 1JXGA 4NKDB 1MRDL 2Y36H 3VG9B 2X4NA 1XCXA 2BNRE 3PP3H 2TRYA 1U3JA 5KSBF 1JNHA 1ICTA 1MZYA 1L9QA 3IFNL 3I9PA 1A3LH 2IIJA 5AWNL 3BQUC 3LX9A 4EI5A 3MGTB 3GMMA 2ADJB 2N7BA 3OWRA 3M17B 4CC0A 4F1ZA 2JELH 5CF3A 2ORBL 1SDDA 4TTDC 5HI3D 5HHPB 5AB9A 1IM9D 3GF8A 3ZT7A 5I1CL 4EQ3A 4B9GA 3AY4A 1LEGB 1A47A 2FJGA 3B5GA 5AOJA 2Q87A 1A3RH 4Q52A 3KWUA 3EOYG 4NP4H 5HHOB 4PGBB 4JO4H 4L1TA 1J9TA 2QGBA 3PJSB 2VO5A 4WO4A 4LPVA 3RGVD 5JXEA 2QJDA 1QBLH 2EYTB 1J8SA 5GRYA 4JQIH 2XVKA 3JWOL 1EA9C 3ARRA 2DPKA 1DQMH 2BNRD 2UXFA 5SWSE 4RA3A 3X2QB 2E9GA 1II4E 3CD4A 1T04B 3T3PE 4QRSB 2WJ7A 3CXHJ 2IWKA 4OCYH 4GSXA 5KSBE 3JVGA 4NXSA 4R97C 2AV1B 4JPSA 4RMTA 4N2FA 5F6HJ 1R24A 4IRJA 3ROLA 4L5FE 5EC2B 1HH9A 3EJSA 5DFWH 1C7TA 2VMEA 1MFDL 2VLLB 2E7CA 3MODH 4JHUA 4I18A 1PGRB 1JPEA 1EEZA 3QUKB 4UBDC 4XPGL 4OQTH 2A6KB 4F3FA 4P2QE 1B4TA 2ZKMX 1CLYH 1IAKA 1F56A 5IVXF 4ODXB 3VX1A 1T6VN 3GIVB 1XBRA 4FQ2H 5DYOA 1E4HA 3QXDA 1DLFL 1LEIA 4D0DB 3VRLF 2JXMA 5DMIH 2LU3A 3NP3A 4GBXA 1TFPA 3MSPA 1PG7X 2XFGB 2DAVA 4GSQA 2AC0A 3OB0H 5JW4M 3NCJL 4L5FL 1KXVC 4P2QD 2HX8A 4EDXA 3G6DH 5T1DL 1HOCA 5I6OA 4JANB 3MNWA 5JXED 3N1GC 5ICZA 5IWLA 3J7HA 3B9KC 1PNDA 2BINA 3BVXA 5CSGA 5F6HI 5KUKA 2VTFA 1MAJA 4R7NB 4IOSD 4JRYE 3SGDH 5IVXE 2EVGA 3TO2B 3N6YA 4WF7A 3AB0C 3DRTB 5C0DB 1F41A 3X3GL 1BXVA 1Z6JT 2BMKA 1QP1A 3X3FL 5ID0A 2FQEA 3GIZL 3VRLE 3IDJA 3G5ZA 2WYIA 2XPZA 3U9PH 1Z3GH 3MNVB 2NYZA 3IXAB 4FNLH 2XWBA 3EYOA 4M48L 3ULVF 2J56A 1J88A 5I71C 5KAQF 1E40A 3MV01 1T20B 4H8HA 2YK1L 2DD8L 5IQ9A 3DMMB 3CFKA 4NT6B 4YE0A 4Y9FA 5I1JH 2QKSA 1HINL 4X8XA 5DMKA 4PJAA 1AJ7H 4HFWB 2PXYA 3EOTH 4XWOC 4N2AA 2XWTB 4G6KH 3RZCB 2VZVA 1KCLA 3GMRA 4U1LA 4WEMB 5I75B 1JZ5A 1PEZA 1XGTB 4HK3N 5C0BA 5ADPH 5CGMA 4Q0XH 2XA3A 3INOA 2JCCE 3QIBA 2HUHA 3PFUA 4XPBH 3UYPB 4OCRH 3B7UX 4QXWA 3I75B 5D1ZI 2ED7A 3PWUB 4MWFB 3WEOA 3MYZA 1UWXK 4JDTL 1OTTD 2BS71 1HEZB 2DKSA 3PGCA 2NYYC 3BIBX 3QFJA 3WOVA 3BSZL 3IFOA 4N8VB 2Y7QB 3LD8C 1RFDH 3ULVE 4CSPA 1L6ZA 2TRHA 2Z31B 3VFVB 1L9NA 2BCMA 3MLTB 3UBFA 3F62A 3D2UA 1TXKA 2W9DH 3SCMC 2HLFC 2C1PA 2I26N 3INUL 1HAUA 1B90A 4KY1L 1FBIL 5EBLA 5T3ZH 3RY4A 4ETYA 2VC2H 3F00A 2WXPA 1GYCA 2J72A 3VWKB 4TSCL 2DIBA 4XAWH 4FMKA 3SDCD 4WVRA 4BV1A 3RDTD 1LTXA 2YPVH 4LCCB 5JTWA 1TQBB 4LT7A 2AQPA 5I73C 3V52H 1UM5L 3AS3A 3GPSA 4CW1B 3H42L 1B0IA 4HUKB 3ULVD 3RU8H 1KTLB 1M7IB 5HSFA 4G6ML 2CNZA 4NSKB 1ZTXL 3EYFA 4BFRA 1YEHL 1ZVHA 3DDFA 3GBMH 1IO4C 5I6KA 5E9NA 5D1XC 1J8HE 3QARA 2H7WA 4LSTL 1FNLA 3TWCH 4NM8H 3FYEB 2KMWA 3ZGIA 8FABB 4XTRC 5D1ZB 1FA4A 3QUXB 4PJ7B 5FYKH 3MCLH 4HISA 4MVBC 3JT2A 2F53B 4L4TA 3GXPA 5HGDB 3TYGH 4A7QA 1RZGB 4JFVA 4E5XA 3SKNB 1KB5A 3TC9A 5E9DB 1YNTB 2A74A 4LNRB 5DRWB 1SXZA 1KPUB 2WXIA 3TA3C 5LVEA 2YC1A 2DM7A 5JIHA 3ZDYB 1M1XA 2NT0A 4YDIH 2FWLB 4N20A 2AI0L 4S1DD 4N2OA 5DJCA 1AGDA 1UG9A 1CLOH 2WN3A 1Q1PA 1KLFA 4P2OD 4RDQF 2J8HA 3BP7A 3GSRA 2XOTA 1TZOA 5BOPA 2V8LA 3VVWA 3NCFB 4N85A 3E8VA 3BEWA 3O6LL 3PP4H 2G60L 5HVWA 4N90E 3TH2T 4DGIL 4KKLC 4PU2A 2EDMA 5F3HA 5KVDE 2XZCL 1NFIA 1B0RB 2EXYD 1OZUA 5C0NC 2OAAA 3SYPA 1U8CA 2YOCA 4BBWA 3UZEC 4DGVL 2EYRB 5A6IA 1P4BL 1E5ZA 4LLQB 4O9HH 2H8PB 5C6TL 5DJZB 5E5UB 1X4ZA 1DANT 1Q0YH 5J1TC 4H13C 1XH1A 2DQMA 1RIUH 2L7EA 3MJ6A 4YBLC 2HPTA 3VCLA 5D2LB 3WMQA 3H56A 4YHPB 5DMJB 1E4XI 3T3MB 1S7XA 2IPKA 1FL5B 2MTAA 1KBVA 2EDOA 1L7IL 4YQXH 5I6MA 1KZYA 4N90D 4ANWA 4CJ1A 1KCSL 1AE6H 3WXWH 1LLAA 1SEBB 1ZD6A 5FA3B 3F01A 5I6NA 4M56A 3B2UC 2ZKHH 1NC2B 1F3JB 1U8JB 1VFMA 4IU3A 2VDNL 5DR5L 2OYPA 3B3IB 2AQ3A 5ESVA 4CJ0A 3NOIA 2OZ4L 4OD3L 4WWKB 3BRGC 4PJ5A 4DEWA 1XH3B 2YD2A 5GIRB 1Z9LA 2Z8VC 1AO7B 4P3DA 4PN6A 4IMKC 4QOKD 5C08A 1QASA 3C12A 3GK8H 2C9QA 3QUYD 4ZPVA 5E2WL 5C7XH 3NTCL 2PCXA 1IGTB 3EYSL 2IAMA 5F7LB 3G08B 3O6MH 1THAA 3WEBA 2XTJE 2Z93B 4IRSC 2VXVL 3UAJD 1KCUH 4Y4HA 1OAYH 5EFIA 1JPST 5FDWA 2XU9A 3DUSA 4CVZA 4DGUA 1C8PA 4G7YH 4B9JA 2IQ9L 4LDLB 5DUBB 4IGBA 1FSKC 4P99A 3H6JA 2JB6A 2VITB 2JJSC 3CZGA 1TQVA 1I9JL 4Z76A 1D3CA 4JCLA 5D1QB 2DLEA 4Y4FA 2VUYA 5T5NF 2YA0A 1J86A 3TJEL 3BHBA 2GJZB 2NPLX 3JWOC 3NSJA 1HC1A 2WQXA 4ZAKB 1N67A 4PJCF 3VFRB 4LIQL 3K5SA 4NQTA 1IQWL 4G9FD 2XTJD 1H0DA 4P9HH 3AUVA 2ATPA 4YVUA 3MOAH 1GGCL 4WK2B 5IF0A 1D5IH 3E9UA 4ZDHA 3N42F 1E6JL 5L4FA 4L8SC 1JDCA 3D69A 4FEIA 5K1VA 4ODTH 2P8LA 5D7LE 2FECI 4I88A 2VIRB 1ZCRA 2BFGA 4MAYC 2A9AA 1KB9K 4NZRL 1S9YB 5INCB 3CAFA 3NGBB 4IRZA 4DTGL 5DURD 4NDMB 1K5NB 1DL7H 5E2VL 3THMH 4J3OF 4JGJA 4XNYL 5BMFL 2DWEA 3SBQA 4JKPH 2O1AA 1ZVSA 3GMQB 4BQ9A 4R3SB 2XSKA 1L3WA 5EU6A 3FO9A 1PW3A 3TF4A 2DQHL 1FO0H 1A1MB 1UKQA 4HPYH 4FTVD 1NM9A 2X4RB 3VXUE 3W2DH 3V10A 3A5VA 1TJMA 1XGPB 2EDDA 1AOHA 3O6FD 4PJCE 5IQLA 2VN7A 4MDRA 2WK2A 1G7IB 3U4BH 3IAGC 4A1RA 4AQ1A 4QJ5B 4ZUTB 1PD0A 1HL4A 2BVYA 1S5IL 4EI0A 4DUVA 3CSTA 4LHQB 2ZAIA 1E9QA 1MFCL 3DIFA 4APQD 3K4AA 4MZ2A 4XCCH 4R0LC 2V2TB 2P47B 3CC5B 2X4SA 5L7XH 1MFEH 1U8HA 3VXRE 3C08L 5K9OA 4PBDA 4I2XB 3UBXA 1EHLH 4P4KB 4WUKH 4EUPH 1EHXA 1JK9B 3QO1A 3EJZC 3HNSL 2VKWA 5CZVL 4NAJA 1IUZA 5H37G 1E90A 2H1PL 1KEGL 1ILUA 3L5WA 2F8OA 5JNYA 4GKNA 4G6FD 4L23A 1D9KB 3QG6A 1SF3A 1TPXC 4X7TA 2FK9A 3CZLA 3GZPA 3K6SB 1TEYA 3LZRA 3OG4B 4UQ2B 4Y5YB 4PJ8A 4J3OD 5DJXB 5AW1B 4QTHB 1G5AA 2GABA 2ED6A 4FQJL 1Q38A 4LMQE 3DO7A 4YAQB 1BF5A 4KK8D 4ZBJA 5I66B 1XAUA 4LLMA 1BFVH 1JSYA 4L8BB 1TSHA 4P59H 2XV3A 4UTBH 3GFUA 4XVJH 3VW3L 2AEPH 4ZYKB 2Q3AA 3ZUNC 2D03L 2PW1B 4XXWA 1ZLEA 1T7ZA 2DQCH 4XC3L 3HZ3A 4NQEA 1JE6A 4NO0A 3RWIB 4Q6IC 2NCMA 5ELIA 3DPDA 3LKNB 3BUYB 1QX1A 4PJIB 5DJAB 1FRGH 3IKCA 4YDNA 5FFGA 1CYGA 1KTBA 3OJ2C 3BZ5A 1I1FB 1CIDA 5CN3A 1BBJA 3U36A 4I3SL 1NDMB 1SM3H 2AK1H 4W9KC 4OT1H 1RIHL 2Y7OA 4YDVB 4X9IA 4HOZA 1X6NA 5I5JA 3QIWA 4L4VE 3P9MA 1HT6A 5G5DA 4HJJH 3SGDI 5HJGA 3H9SB 3V5DB 4F5CA 3DPBB 1QAWA 3KW8A 1EHNA 5BJTA 3RWHA 4MXWL 4ZXBD 4X6BA 2CUMA 5I1LB 1IBGL 2KERA 2P48B 1GPOH 1PX4A 1OTSC 1WTLA 1USZA 4MJJA 1P5UB 3EF4A 5GGVY 3BE1H 4ELMB 3QPXL 2XWEA 3DVNA 4E9YA 3C60D 2O6DA 4ENED 3UTTE 4K73A 5D5MA 2MCAA 4AG4L 3Q8EA 4MASA 4PJEB 2R0ZL 4K3DL 4RISL 4GS7B 2BSTA 4P8QA 4K3HA 5J13C 1UOVA 4LVNB 4C55A 4XCFL 3RWEB 2BRRL 1DQQB 1IGFL 3P4OA 1B4JL 2I07B 2NY1C 1EQWA 1HZHL 1OGTA 4FQLH 2Q3ZA 4M93B 2F9BT 3S5YA 3OPZL 4LOEA 5FCUH 4DKAA 5B38G 5F9JA 5C0JB 4LVHC 2VNCA 3RDTC 3RUGF 4UT9A 3V0JA 1MWAL 3CU7A 3LPFA 4OD1H 2DYPA 3UTTD 4U7SA 1QO3B 4LDCA 2DBJA 4HUMB 4XPTH 1JOIA 3VXMB 1AS8A 3GXNA 1Q8MA 4FE9A 4OJCA 5AVVB 2R7EA 1OTUD 1NFDA 3FUNA 4KK6D 4X7FC 4XX5A 1K85A 2CBTA 3US0A 25C8L 3O2DH 1VSCA 5BUPA 4AMXA 2YJQA 1H5BB 5HYSG 2I32A 3PWNB 4OJDH 2E3VA 2QBWA 5EUOF 4XO3A 2YQ3A 5BRZA 1MDAA 4E36A 3NZ8B 5C0GA 3C5XA 1TG8A 2JJVA 3FKUS 4GRLB 3ARBB 4BZYA 1DQTA 1S7TB 3CTTA 1HKLL 5JPMA 1I7TB 4ZNEA 4QRPB 3RUGE 3V4PB 1HXKA 4XVUD 4FABL 2QVMA 2QMJA 4GPVA 4RIRB 4KNSA 3U1SL 4RWYL 2R1YB 4JDZB 5CLYA 4AIZB 3GMOB 3V7AG 3WFBH 3EJYC 4P2OC 3GDCA 3CMOL 4O5LH 1TNMA 1KG0B 4KMTL 4DZ8B 1ZK9A 3S96A 1P84J 3ZZQA 3PWJB 2UZIH 3ZHLA 2LOEA 4HJ0C 3QHZL 4NN7B 5M7QA 4KTEH 3DXAB 4J1UB 5EUOE 1KB3A 3CFIC 4JAMB 3B6SA 1TITA 5CR8A 4UQBA 4PS8A 1WITA 3FN9A 4NKOA 4A63A 2MKLC 4PY8J 4MJIA 2FATH 5JHDE 4QRRE 4TQEH 1DVFB 1OSYA 3LIZL 4EN3B 2BZCA 5MEOB 3QNYB 4YLBA 3TV3L 2LU7A 3FBKA 3VM5A 1UFGA 1VIWA 2WGNB 2DYPD 4HGMA 2H26A 5ABDE 2QADD 1QHPA 3A0OA 3KPSE 3LN5A 4IK6A 4KOBA 2DBLH 4NENA 5FM4A 3ENEA 4LVOB 3N44F 2A9BA 1HNYA 3AC0A 1T21B 4FNRA 2IVFC 5E99L 2ZWNA 5GGRY 3V6OE 4FZ8H 2DJUA 1NINA 5DD6A 3Q8BA 1KPRB 3V0WL 2X70A 3KYKH 1MXGA 4PJGA 3P2DA 3WEXA 1I9RL 4BCZA 3QZWG 1OWRM 1DVSA 4HZAA 5JHDD 4QRRD 1NDTA 4JFFB 4GUQA 5EBWB 5BRZD 4A7GA 1ASQA 4Z7VF 1AHKA 3WNMA 1GZPB 3L3KA 1XCTA 3QZLA 4ZFGH 1O6SA 1HL5A 2ILLA 1MNUL 3LDBB 4ABVA 3E1ZA 3B4NA 3FQWA 4N2CA 3JQOB 5DC4B 1GIGH 4GW4A 4PY7B 2EVIA 1BMWA 4N0UA 1UT2A 2QGCA 4XPHL 5DHYB 3FU3A 4RGND 3HNVH 5MENB 1MRFH 4MGXA 3Q2WA 3R1GH 3VFTB 3VM7A 4PY8I 1P4IL 4UIMA 1GZHA 1ETZA 1Y0LA 4W9DC 4H0IA 3I2CL 5I1GL 4M61A 4J3UA 2CK0L 1VA9A 4Z7VE 2Q7NA 3FONA 3RTQD 5KYNA 3W11D 2VJ8A 4C4BA 4XT1C 3UYRL 1PKQA 3JYCA 4BRVA 5CEXA 2NY6D 4YHKH 4A67A 3IVKA 5LJYH 3EBAA 2CPUA 4NKDA 5HY9A 3HG5A 2XQBH 1I9IL 4AGOA 2V5TA 2WVTA 3TO4A 4B41A 3LQZB 2R51A 2VSDA 4JKWA 4R26H 1KBGL 1JTPA 2YA1A 3F58L 2ADJA 3HNTL 3LH8A 2IH1A 3DJRA 2Y69B 2DM4A 4NN6C 4JFUA 4LASL 5F70A 3ZYIA 4EDWH 3BD4A 2NW3B 4F8PA 5C97A 3WFHB 1BAGA 5E6IC 1LEGA 1C12B 4H88L 1INEH 1S9VB 4HCRL 4PGBA 5AW5B 5HHOA 2R56H 4RGMB 3PJSA 3ZL1A 2EIJB 4J5VA 1J5DA 2YPLE 2EYTA 3CN2A 4HMCA 3M6DA 4HUVB 2ORBH 2AJSL 4WSGA 1ML0A 1T04A 3P3UA 3SKJL 1X5IA 1N59B 4QRSA 3CIQA 4Y2DD 2ADFL 3GRWL 5DQDL 5DT1L 3VD0A 4NQCE 1U91A 4FHJA 2AV1A 3LXCA 4KKRA 4Q97A 4XR8C 3K6OA 3C87A 3JTBA 4TOYL 2VISB 1S7WB 2J57A 3OKMB 5EC2A 3ZL4H 3KLHC 1SJEB 4FP8L 3OQ3B 2AXGA 3V0GA 1CGTA 2X40A 5E5LA 1E2WA 4JCMA 4MA7L 4HIEB 1WVZA 2VDKL 4QCIB 1A65A 4XMZA 3QEQA 1IGCL 2LV4A 3QUKA 1S9WB 4N0CC 4BA0A 4YSEA 2G0KA 3REWB 5AW8B 2HFEB 3DTXB 5B38B 2ZCHH 3JSSA 1EGJL 2A1WL 2A6KA 3TTSA 3HI1B 1TJGL 4XMLL 4YFDB 4TTGA 3QDMA 2WIIB 4JQXC 4NHCL 1KN2H 4ODXA 3GIVA 1I85C 3SDDB 4JZJC 4PI2A 2HFTA 4AVKA 1EERB 3AT8A 4R2GD 1JPSH 2P5ED 4FQPA 5DD1L 2GW5A 2C1OB 4D0DA 4PW9A 4WW2B 2X2HA 4L48A 3NFPA 5HYSB 3IMUA 1L0YA 1ADWA 3FCGA 3R19A 1R3JB 1BJ8A 1JZ2A 3UO1L 3UTSB 3QVAA 2BW5A 2CHDA 2B08A 4ORGB 5DYFA 4G71B 3FT4B 4K7FA 1S7UB 3H85A 4MMYB 4XCNB 4E2OA 3RKDC 1SLUA 3RY6A 3SZ6A 2FT7A 3UPCA 3B2DC 4AQZA 2DI9A 2LVEA 1FO0B 1XIWA 3CLWA 3V55A 1YSOA 1DDTA 3L4UA 2F1EA 4NLHA 1WLHA 3RVXD 5EA0H 1W6LA 4J8RB 1LYQA 3WLWC 1OP3H 3KPMA 2KKQA 1X5JA 4X8GA 4UT7L 5DCCA 1QZNA 1U8KB 5CCHE 4FYRA 2YEZB 4BFKA 3DX6B 5TE4L 3MKKA 3UIYA 2FSEB 1KTCA 5L8KB 4PWKA 5T1LB 2EE0A 1ED3A 1T20A 2GKIA 2QVTA 3QHTC 4X9GA 2VXQH 3AQDA 5EN2B 2YWYA 2W38A 3DMMA 4NT6A 5CLTA 2B9AA 3RVWD 2OS7A 3CDFA 3GEWB 3O8XB 3GIZH 4HFWA 3SBWC 2IH3B 3L1FA 3MPCA 1YQVH 4ZFOL 4ENEC 1NGYB 3MRCB 2XWTA 1PYWB 4NZ8A 3QQ4A 3RZCA 1KNOB 1YYLL 1BVNP 1HS6A 3LMJL 1XGTA 3R18A 1BYPA 5AOZA 4U3SB 5T5FH 5IQMA 5CWSB 1F8TL 1RMFL 4YH6A 4KUCF 1JV2B 4N87A 5LB1A 4LEBA 3IMSA 2NQDA 3UYPA 4MNGE 2OJZL 3EDEA 2PR4L 4MWFA 3PWUA 1P7QB 3RG1C 2F5AL 1HEZA 2VUKA 3EO0B 4N8VA 2Y7QA 1KYUA 2CGRH 3OGCA 2MIZA 3VFVA 3MLTA 3KLQA 1Z9PA 2PUQT 3QZWB 4Q9CA 2FT8A 2WXMA 4F9LA 1SJXA 2E7LC 4BZ1A 3QFDB 1ZGLM 4OGXH 4HKZB 2CA4A 4OJFL 1LQSR 4TLSA 2WP3T 5LO7A 3IPBA 4XMVA 1BXUA 3VWKA 4CAGA 2ICEC 3SJVE 2GJ6B 2M83A 5HDBB 2Q10A 1L9RA 3OM3B 2WMPA 3W0WA 1ROCA 3P69A 3V0IA 3INUH 5I6LA 1SYSB 2LAAA 1KTLA 1M7IA 3GXTA 3L1GA 1UWEH 2OXGB 2ZONA 3OKEB 1OPGH 4NSKA 3IJHB 4MJ4A 1L7TH 4Y7MA 3A6CH 2HRPL 5E8OB 1C16B 1NOAA 2WAQA 4XVUC 1I3UA 1NAKH 4S1SH 4O4YL 4WSJA 3SY0B 2D9CA 1UM5H 5ECJE 8FABA 5AUMB 3SJVD 5D1ZA 3UTPD 3QUXA 2D7TH 3T2LA 4MQXC 2R27A 1ZTXH 2KQNA 1RZGA 2VYRE 3ETTA 4UINL 5I74C 5J9PB 3SGKA 3SKNA 3IJYB 1YNTA 4FKKA 4JGUA 3RWFB 1WFUA 4LNRA 5DRWA 1KPUA 2P42B 1M4KA 2Z8WC 1VKXA 2Z64C 2C4FU 3MV7E 1T03H 2B1AH 1SLVA 1VENA 3GHPA 4KWUA 3VH8G 1E3FA 4ETQB 4BIKA 2PP8A 4N2HA 1P4UA 4HC1A 1UASA 3ZTCC 5CD3B 2VRKA 1IE5A 4OZFH 1SUJA 1E28A 2DQUH 3RVTC 2Z31D 5E08L 1B0RA 2X3AA 4A6YH 1NUDA 4NZTH 5EZOL 4NO3B 2GUOB 4U0RC 1IFHL 4X8JB 1Q72L 4LLQA 1RZIB 5C09B 2H8PA 2X0UA 4XB7A 5DJZA 4M6AA 4TNWK 1NCDL 3O4OB 3T6WA 2ADIB 1RIVH 5CILH 5DHVA 4POYA 3ZRSA 2WQUA 4M6NH 4RSYA 1O7VA 2VB5A 3T0DA 2BM3A 2RA1A 4GKLA 4LHJB 5B8CC 5I1AB 4PP2B 2AK4E 2F7RA 1EZVX 4UQ3B 4K94H 1SEBA 1AGEB 4JFOB 1P1VA 5FA3A 1IZKA 4B3VA 4BELD 1M6OB 3OLEA 5B1BB 2DJ4A 2O5NA 2COVD 4RETB 1NC2A 1F3JA 4B60A 1NTDA 5E2UL 3V6OC 1OE2A 1A7QH 4WWKA 2BNUB 2F53D 4H0LC 2BP8B 1XH3A 5GIRA 5SWQA 1XF5B 3LV3A 2CKBL 1KELH 3KJ4C 5DK2A 5E9DD 3MUHL 5HYJB 1K4CB 5CUSL 2E7DA 2GG1A 2APFA 3HN3A 3QORD 2K9UA 1GHFL 1VFOA 2JKRM 5KZCD 5KYUB 1CMOA 3KR3H 3EO9H 4P2AA 4RMBA 2Y2WA 3G08A 3IGFA 1SXSA 3NFSL 4M03A 3IAQA 2Z93A 1SXNA 4P5MA 3NABL 4OD3H 3GKZA 2V3DA 2O6FA 2VDMB 4HIHB 2EEFA 4FOMA 1DN0B 3KS0H 3DIVA 2CJSA 4DVRL 5FIEA 2GSIB 5D7IA 1WZLA 1ZRUA 5DUBA 12E8H 2HT3D 4OM0L 5CJOH 2VITA 3T0AA 1M56B 2Y2YA 6PCYA 1C5CH 5D1QA 3CVHL 3UO8B 1M3IA 3SQOH 3VD5A 1E67A 4PWFA 1L5GB 2GJZA 4N9GB 1EJ8A 1FNFA 4MRBA 1UVQB 2H4EA 5MHSE 2ZXEB 1CL7L 3AY2A 4X6DB 5GJSH 2DW5A 5C9JB 2CRIA 5IIEA 4JJOA 4YSTA 1J0KA 1WWBX 3VJ6B 5D93C 4PRIB 2VIRA 5JXAH 3BDYL 1KCKA 1XZ0A 2GEQA 1S9YA 5INCA 2LLNA 1M1SA 4KDTA 1CFNB 4L4JA 1K5NA 4NDMA 4LIQH 4MDIB 2WCGA 4Y2DC 2DN7A 1FNSH 2AV7A 4U31A 4R3SA 4Z7UF 1QSFD 2XYBA 4P23C 3V8CA 2EUWA 2VXTL 4X6EB 5GZOD 3DI3B 3V4LA 1A1MA 5L2JB 3OLDA 3P1VA 2X4RA 4JPVL 4KPHL 3WGUB 1BZQK 4U1SB 2D8KA 3ULSB 1XGPA 2HZHA 3H3BC 4E9WA 1AO7D 3FO0L 3M8OL 3UEQA 3MRFB 4AKPA 3KVDD 5I76B 43CAB 2K3HA 3K72A 3QXWA 4NPYB 1QBMH 4ZUTA 2UZPA 3ARSA 4M7ZC 4OCSH 2R0KL 2XJKA 1A4AA 1OOWA 3MJ9A 1OSPH 4CDHA 2NX5A 3I02B 3GNML 3RTLA 2OSLB 1DVQA 2VJXA 5FYKU 5C0IA 4QLRA 4L1DA 3CC5A 4NRZB 2V2TA 5MEQB 4OI7A 4Z7UE 1L0PA 4ZFQA 3FB8B 1J8RA 1UGKA 4LPCA 2IANA 3OC8A 2VDQL 3D4YA 1CFTA 1UA6H 3CVDA 3EZ8A 4I2XA 4BH8A 4Z7NB 4P4KA 3D3VE 4R4NC 4X7SH 1S5IH 5HGAB 2D2CC 3MBWB 4L1HA 2V5MA 3BAKA 4FG0A 2V33A 4HIXL 5SV3A 4ZMAT 4FQHB 4IBTA 2ZUQC 4G59C 5J0BA 4ZAKD 3SPGA 1D9KA 3QDGA 1T66D 2VN6A 3DETD 5MP6L 1SOXA 4UQ2A 4Y5YA 5E8DL 1HYSD 1WYJA 5DJXA 2X9XA 2VKXA 4QTHA 3QI9B 2GSMB 1VZGA 4Q6YA 4GMTH 3ARXA 5CSZB 3U82B 2GEEA 2FJSA 1DBKL 5AL8A 2D7OA 4K71B 1DQLL 2HP4A 2VJ0A 3U30C 5I66A 2DKMA 3B2PA 4L8BA 3D3VD 3EDFA 4DKEH 1MH5B 3BEVB 4NWUL 4QHPA 3WS3B 1YEJH 3HMWH 2D73A 2PW1A 1KFGA 2EDHA 5KANG 4LK4A 1S5HB 2R2HA 3RWIA 4IKLA 1YN6B 3LKNA 3BUYA 1BMGA 3ARDC 4DEPC 5I1DB 4PJIA 3S97C 1VEOA 3BT0A 4WWPA 1R0AH 3C8HA 4BWWA 1XR8B 3DUHA 3E2HB 1I3GL 5DWUL 3M1CA 4AJYV 4OIAA 2P24A 1NDMA 2D03H 4AQ8A 5DVKA 2NR6D 5CEZH 2IMNA 5CR1A 3RDJA 2XVBA 3RVWC 1RUMH 3HKZA 3BFQG 3VH8B 2G3XA 4HEPG 4OQ1A 3QPQD 3H9SA 3V5DA 5EOTA 4JFYA 1XGRB 4WHYH 5FYJD 4HLZH 4R84A 4RRPM 1KLGA 1EO5A 1KOAA 1XV8A 1OM3L 1OCCB 5C2UB 4XGZB 5INDA 4OZGA 1GS8A 4OB5H 3ZKXC 5E5MB 4OQTA 4ODSH 4NCDA 4P4KD 4KBPA 2UXTA 3FTVA 1BQLL 3QAZC 4ELMA 3H4FA 4G6AC 1DR9A 4JHVA 4WEBL 3IDYC 4PJEA 5DU7A 4D94A 1FFPB 3U6XA 1HCYA 3QHFL 3TESA 3WNJA 1R46A 5EO1B 4LDOB 4Y4KB 1U2YA 2V37A 5AKTA 3RWEA 4OZIB 2DMGA 1AH1A 1DQQA 3QUZB 4AH2B 2X4TB 2I07A 3VG0H 4EXPX 5GGVH 2FEEI 1F11B 4ZFFB 2YQGA 4H25B 3NCEB 2D7NA 2SODB 2J6EA 4LRIC 1LDPL 3L54A 4TQ8A 1U36A 2WWMC 2WINB 2VQ1B 4D9QD 3ULUF 1QO3A 1IGYA 2W1NA 1VGEL 5FO9A 4KKAC 4APXB 4JNXA 1NGWB 3UABA 2PO6D 3VXMA 1WFTA 3MO1B 5DTFB 1IX2A 3CIAA 3U9WA 1I31A 4WU5B 4X99B 1DBBL 2XPGB 3IGLA 1JNNH 3QRGH 1G0YR 3RNQB 3FT0A 1G43A 3LQAL 1H5BA 1GXEA 2WAHA 2J4WH 3QFGA 3LEYH 2QPFA 4PWHA 1RZ7L 1JJUA 5FHBH 1NJ9B 2AKRB 4PWJA 1OALA 4GRLA 3ARBA 3MJ8B 1S7TA 4DAGL 3N2JA 2HJFB 5D7HA 2WVUA 5KSAD 4QRPA 3MV8E 4ZNCD 2J6WA 4TUOB 1EK3A 1FDLH 2WNGA 4FFZH 4RIRA 3KXFB 3ULUE 4FQ1H 4F7CB 1QFUL 4AV5A 2OM5A 4JDZA 4OUOA 4AIZA 1ACCA 1TQWA 3K0YA 1EJOL 4JHAL 3RVUC 1UWGH 1IL1B 4W6YB 1BOGA 4MHHG 1HKLH 4DZ8A 5J12C 4XBEH 2K45A 5HPOA 1FIGL 1QACA 5FUOL 3TASA 3RRQA 2DQEH 3A47A 3DURB 5FC9A 2YZ1A 2FWUA 1ZHNB 1U3HB 3DXAA 4GW1B 1I53A 2NY0B 4J1UA 4MCMA 4JAMA 3BP5B 5DA4A 2VLRE 2XFXB 4YBQD 4XHJC 5IW3A 1IKOP 1KIUB 3B5TA 5FM5M 3ULUD 4Z8FL 5AZEL 4UMSA 3UADA 4AIXA 2WV3A 3MFFA 4JFXB 2E8ZA 3Q6FB 4JZNB 4K8RL 4XX1G 4NWTL 5MEOA 3GSVB 3QNYA 3PAYA 4M9OA 1UWFA 1G87A 4ZO8A 5LNDA 4Q2ZB 4WUUA 1ZLVH 2Y5TB 2OL3L 4PBWD 4ODWB 5J1SC 2YPVA 4WWNA 2XQYA 5IVZB 1K8IB 3O3DA 1T21A 3MGOB 3CZSA 4F8NA 3CFDA 4PB9L 2BP3A 2Y06L 4FXKB 1KPRA 4QGTA 3O4LE 5IV2A 2DIEA 1I7RB 2EIDA 3MBXL 1DEEB 2WBJB 3KS0J 2Z7WA 4JFFA 4C56B 5EBWA 4HWNA 3PL6A 1S46A 4BQBA 4URKA 1JNJA 5JMRA 4FI7A 1GZPA 1QVOB 2YAQA 1ACXA 1MOEA 2G4GA 4GQ9H 3IBEA 3LKQB 3VD2A 1TQCB 2IEPA 1QPKA 5FKAB 3VGHA 4QO1A 1R75A 4JPKH 3QORC 4AYDC 2PWDA 4HW6A 1UURA 3MA9L 3VI3B 4EIGB 2PN5A 3FB6B 4J2QA 4N3TA 1OL0A 4NKMB 4I0PD 3O4LD 2K6WA 3VXNB 2R0WL 5MERA 5MENA 2QHLA 3ROOB 1TZIB 2FD6L 1FIEA 5EBGA 3VFTA 1TZGL 5LBVA 4S10A 2A0LD 3F65A 2WXLA 4J23A 3CH8A 3OAZH 2A83B 1MCRA 4M3JA 2ITCB 1DSWA 5DK3A 4D7PA 3QS3A 1SY6H 1LE5A 2GBVA 1G6VK 1PX8A 5CD5C 1F6AA 1OP4A 4A68A 3TEXA 2FBOJ 1JP5A 4KHTH 3AGWA 1LM8V 2EZ0C 1MFBL 3ZHFA 4A6YB 5DZ9A 5F6IB 1X44A 1DVFD 4XVOA 1OGPA 4EN3D 4P5KA 3ZTNH 3CXHK 2UY7B 3B1UA 1XGQA 1CD8A 1G7QB 1WAAA 4XC1H 5F1SA 1EO8L 4EZLA 3AREA 3IK2A 3ZQXA 4PUBL 4QMEA 1U58B 4YLCA 3BPOC 5I1HH 3E3QC 1B9ZA 1MCNA 2YXMA 1UJ3B 4CMMA 1KDJA 3ARTA 2YD1A 3WFHA 3GO1H 1C12A 4MNQB 4WIQA 1S9VA 2APXA 4WGWB 4D3CH 3SIKA 3S2CA 3Q3GB 1UM6H 1R5WB 1YEIH 2ED9A 4TXVB 5AKVA 4MBOA 2G4EA 3WNNA 4I3RH 1N59A 3EYQD 4DKDC 1X9LA 4HUUB 4YX2L 1RUAL 3O3EB 3U25A 2W60B 4H88H 3T2QA 4JVPA 4MB5A 4NCC2 1FAIL 2NT1A 2VISA 4WENB 1S7WA 1I1YB 5PAZA 5TTRA 2YQ2A 4UOW1 3OKMA 4TRPL 3HUJB 5L88L 1Z7JA 1SJEA 1YEKL 1J9QA 3EHBD 4DH2A 3AU0A 1TCMA 2G9HB 1IEAB 5D96C 2WZ0A 1OZTG 4O02H 1S9WA 1VEMA 4MD4B 3REWA 5B38A 2HFEA 1MDTA 5F1IB 1IC5L 3T0BA 2BXYA 2CIKB 5HJ3B 1JGDB 1P0SE 5EEVA 5C0BE 1I8LA 3HI1A 4PJ9C 3VNYA 3D8MA 4G5ZH 1VCBC 2K8QA 1I7UA 2AERT 2WIIA 4LARL 4W9CC 3RB7A 3GLZA 5LNEA 2QQLH 2WQWA 4MA7H 5C0EB 5ALCL 4R96A 4EI6B 5C9KA 5GS0D 2C1OA 4C4KO 1XB8A 1Z3RA 4UOW0 2AJYL 2XN9B 4YWGH 4XMLH 4AMKH 2EUZA 2OTWB 2Y6SC 4CNIB 1LJMA 5HYSA 3PV6A 1J9SA 3J8F7 4FF9A 4ACPA 2YLKA 4P4RB 3UTSA 2GTWB 5ABZA 4K9EH 4ORGA 1DBJH 4IEFB 3SB3A 2XRAH 2XXCB 5I1EH 4EO5A 1BZOA 5D7JC 1S7UA 4MMYA 4XCNA 3EFDH 5E56A 3FL7A 1HCFX 5DUJA 5BRPA 3FCBA 1FO0A 3Q8CA 1A9VA 2FQDA 4QGYA 5FAAA 4KVPA 2IG2L 1AY1L 4E42B 4J8RA 2YGNA 4GQRA 1IAIM 4JDEB 5IFJA 1SLXA 4X4MA 1U8KA 3D7PA 1CC3A 1UHVA 1VRSA 2ZNWA 2YEZA 4AVHA 5DD3H 1UADC 1GSKA 1BZ9B 3DX6A 3D50A 3L2LA 3MRGB 4QUOA 4V2BA 3HAEG 1YY9D 4ZO7A 3DKHA 3KHQA 4AZ8B 5T1LA 1RHHB 1QHQA 4ZW8A 3T2NL 1F6LL 1GMEA 2CR6A 3PIQB 2HN7B 4ZJ9A 5EN2A 3BYYA 1DO6A 2HUEA 4BE6A 2CDEB 3O8XA 1CDJA 3D09A 4W6WB 4YC2B 2IH3A 4HIPA 3QJFB 2ODIA 1PYWA 4FN0A 1H9VA 1KNOA 1QLEB 4E9RA 1S7QA 2J5LC 5EOCL 4EUPA 5J89A 4U3SA 2PCFA 2BOLA 1E8ZA 4TNVK 5CWSA 2QVFB 4P5RA 1JV2A 4PJXA 4ONGL 3SDDD 1HHKB 3UJIH 3A4FA 2W80C 4C4UA 3N43B 4JVUA 1A4KA 1MQKL 3L4YA 1P7QA 4D7BA 2OSYA 3RVVC 2VDRL 4XP9L 2E7BA 4Z7WB 3V7AE 1BEYL 2G30A 1XGZA 4EN2A 1CFVL 1OB1B 3LQAC 4WTXA 5IJVB 2XXFA 4KKNA 4OGYL 2FYVA 2RIKA 3QFDA 2VERA 4M00A 1NCHA 2ROYA 4UTBA 4PS3A 3G3LA 3FQTB 1EDHA 1DE4B 3OHXC 2FHFA 2BSEA 2GJ6A 4HJ1A 1USQA 1KB5L 1OWWA 1TJHL 2WBKA 4PJ6A 4YO0B 5J3HC 2WTRB 3W38A 5E8EA 1JF1B 2WSKA 4HF5L 3WG7B 2HVBA 3G6JA 4P2YA 3SE9H 4UQEA 1SYSA 4XNDA 1KTDB 4N25A 1MG3C 4QNPF 4KC3B 2OXGA 3CQPA 1JF5A 2YMTA 3JV0A 2JKTM 3IJHA 4YDZA 1PFOA 4CN1A 5E8OA 3H2QA 1C16A 4DO5A 5F7YC 2FSDA 1A14H 1LP9F 4D8OA 5AZUA 2YUZA 4X5WA 3NDYE 3Q6GL 3SY0A 2JB5L 4QTFA 4JO2H 4XNUH 5AUMA 5BQ7B 2AMUA 5EIIA 2J88H 4RFEB 2QQNH 1VACA 1LGVA 4QXUL 2ZSVB 3SE4C 2X44D 4PJ5E 5GQBA 2G2RB 1TMQA 4FAAB 2DEXX 4UILL 3IJYA 3RWFA 5I18H 4UQDA 4EZJA 5C08E 1QWUA 1B2YA 3L3OA 2VZ1A 4K8RC 5IBTH 2P46B 4Z3FA 1LK2B 3GI8L 3L1OL 3IDNB 4Y9CA 3S37H 4LSQL 3WEAA 3FBQA 2PYED 3LB6D 4QNPE 5TQ2H 5I15L 1T89C 5C92A 4XNAA 4LCIH 4ETQA 2BCKA 1B0GB 2VDOL 4U1HA 2CO2A 2YGQA 1MCPL 5CD3A 4H1LG 4NQVB 1LP9E 2KYIA 1EAPB 1O7SA 4NJAL 5CZRA 4XZUB 1Z1WA 3H3PL 4K3JL 1VJSA 5IMMB 1MG2C 1MEXL 4LNVA 1NWOA 5BW7C 1G84A 1RZJL 1TJXA 4NO3A 1EAOA 2B4CH 2R15A 4X8JA 4YSDA 5ICYA 4R9HA 4NERA 1RZIA 2GBUA 2JV6A 3D39A 5C09A 3LRLA 3PP3K 3KLAB 4AM0A 2QDVA 5LN4A 3PV7A 4K7PL 2APWA 2ADIA 1WRFA 2KDGA 3DOSB 2EDTA 5KJRL 3MXWH 5H8DA 2QKIC 1X7QA 4GKZB 5BVPH 3QUMH 3ZQWA 4OCWL 4LAQL 5J6SA 3Q1SH 2CHWA 4Q9BA 4Z7OB 1AS6A 3ZMEA 4TULH 3NCCB 4HZLB 5I1AA 1UCBL 1Y7VA 1H6EA 4UQ3A 2NY3C 4LLYB 1LO2H 1AGEA 1AQHA 4U3XA 1YUHB 2D0HA 3EGSB 2RALA 4MYWB 4AEHL 1ULVA 4QWWC 2Q8AH 3O9WA 1KYAA 2BJML 5DD5L 5JMOC 1C1EH 3QIUB 4YSPA 4EI5C 2PKDA 3GB7A 3Q5OA 5KVGE 5EU6E 2YSTA 2OMUB 4YHYC 4AEIH 1NGQL 1VGKB 4QF1B 1NBCA 4Q14A 4I0PC 1KYOJ 3CSFA 1JYWA 2EDNA 4YHIB 3AY4C 3ZE0B 1UQSB 1YC7A 2BP8A 3UAFA 5KVFL 1DQDL 1XF5A 1B3JA 3QJOA 4P57B 4WO4C 5E4EB 1RZKL 3NG5A 5HYJA 3QB7C 4NO2B 2Z4TA 5CGTA 2ID5A 1E5CA 3UMTA 2CJUH 1UEMA 1ZSHA 5KYUA 4A66A 2VDLH 4MKMA 4ZS7H 4MKTA 3HI6L 3W5MA 4GKSA 3S0PA 3S35X 5K1NA 2CLRB 3NJIA 4UIKL 4IDJH 1FLRH 2ENYA 2YARA 3JVGC 4YUEL 1D7BA 5T33H 4XWGL 3UJTH 4HIHA 3J2PA 1DN0A 2GSIA 5HYFA 4POUB 4G6JL 3RQ3A 3QSKB 4IRJC 4IRZL 4XMKL 1QHOA 4XBPB 4CDGC 3I74A 5E2UH 1RK0B 2WANA 3NFSH 1R3HA 2Z91A 3F7VA 4ZSOB 1G0DA 1L5GA 4I18C 4N9GA 3HB3B 2CCVA 4LOUD 1UVQA 4DVRH 1BF8A 3S88H 4X6DA 3AXHA 4L9LB 2UYLA 2A9ML 2P1YA 5C70A 1MHPL 1QRND 5IREA 4PRIA 1KIQB 3QZMA 1ID5I 3GUTA 1JZ6A 3T08A 1IKFL 2ZSWB 5BXFB 3G5WA 3HAEB 5EOQH 1CFNA 4BKTC 3V4UH 3N9GL 1RXLA 1FLTX 4FJZA 1D6VL 3GSNB 4GBXC 3LS5H 4NQEE 4X6EA 1N5AB 5L2JA 1S7VA 4L8DB 3CFBA 4HPOL 4U1SA 3VXTB 3ULSA 4JM4H 1OY3B 4HQQH 3S36L 1XSKA 5FYLH 2IOOA 3MTXA 1N0XL 3IJSB 5B1JA 2JK5B 4DQAA 5I76A 5I0YA 1TIUA 2VR8A 4QRUB 2C3WA 5IWLC 4NPYA 4KXDA 2EVJA 1W2KT 4KPHH 4F5CE 1AR1C 2F19L 4UOQA 2OSLA 5L9DH 1SUHA 3PU7A 5DUPL 4UNIA 1CCZA 3FO0H 5MEQA 2X3CA 2MCPL 3ZTJG 4X7EC 2AS5M 4ODVL 3FB8A 1N5YL 3ATFA 2Z3FA 1DQJB 2BSDA 4PLKD 1T0PB 2X1WL 3U2IA 3MBWA 5FCSH 2B9BA 3HE6B 3C2AH 2PWFA 5C0AB 3ZSTA 3PDDA 4HGKC 1NFDF 2YD9A 3ZMNA 2OJEA 3VGAC 4WLCA 4LFHG 1F4XH 2PXYC 4Y16B 3QEHB 2MHAA 3ZO0A 2DLHA 3GSOB 4IS6B 3FRPG 1NAMH 2VR5A 4MJ5A 3B2VL 1F0LA 1YHPA 2WIMA 3LH2L 2N1TE 3QI9A 4JPIB 1RJYB 3QIBC 1JZ8A 2B16A 5CSZA 4MAZA 1CLZL 2DS4A 3NCBB 1KSRA 4GT7A 6TAAA 3L3JB 1TTAA 3FTSA 1MH5A 3HR5B 4Z7QF 2W0FB 1S2EA 1MVFA 2O6PA 5BQDA 3UDWA 3WS3A 1KJMB 5IFHL 3ARYA 2EXWC 5ILTL 2J21A 3O2VL 2BSSB 3W81A 1S5HA 3L3HB 3UH8A 1A6WH 2ZXWB 1F3RB 2XQYK 4OIIL 4LCWB 5JQ6H 1NFDE 3MNZA 4CC4C 5CCKL 4NN5B 1O9ZA 5BO1L 1B2WL 2B1HH 2JF1A 2WQVA 4MA1B 3QUHA 1DZ0A 3K1DA 3FQNB 2NXYC 3G9VA 1YA5A 1CICB 1SN5A 2BFVH 5I8CB 1LO5A 3QUGA 4RMVA 4GSDL 3RA7L 2HT2D 3C8DA 3KJ6H 4OIBA 4ZNEE 3ZDXB 2F1BA 3C5ZB 1XGRA 1JGEB 1PLAA 4H1LB 3VB9A 4Z7QE 1JUFB 1I3GH 1TQTA 4JFZL 4GG8A 4ES9A 1FP5A 1ZV5A 2QV4A 3HE7B 4UAHA 4XGZA 4UT9L 1NUGA 3RIFK 4LSVH 1S9XB 1T22A 2AQQA 2EILB 4N2DA 3T0EB 3VXSB 5C2BL 3TBTB 4YS4A 4FCAA 2A77L 2ESVB 1H3XA 3OBAA 2Y5QA 4LBAA 4QHLB 1SZNA 1RH8A 2J71A 3D87B 1FFPA 1J1XL 5EO1A 1HOEA 4Y4KA 2A74C 3ZHKA 3TVMB 5DHMC 4OZIA 2KI6A 4AH2A 3QUZA 4HWEH 4P2RB 1E9PB 4L0ZA 1FORL 2X4TA 1PJWA 1R3IH 1WA2X 1BQLH 1KIRB 3QJSB 4MJIE 3X1NA 4S1RH 4ZFFA 4H25A 2CM6A 1NMAL 4F37K 4NIYE 3T77B 3MV9B 3CVCA 1ZLUH 2WINA 3QZOA 1W15A 3WKML 4KI1A 2PTTA 4DKFH 4APXA 4M5ZL 1J10A 1CS6A 1A6UL 2KUTA 4RX4D 1EVUA 4PHZA 3I84A 4TUJA 3AXLB 3MO1A 4YHOL 4NKIH 4JL2A 4WU5A 2NY4D 1MJ7L 3OXSB 1P84K 2XPGA 3RNQA 1FAKT 2Q3XA 2PWEA 2YZ8A 4XXCA 3PAZA 3QWOA 2AEOA 3LN4A 2XYCA 1LXMA 4NUJB 3NA4A 4YXLH 2H2SC 5GHWH 4IU2B 1WBXB 4F57H 3U6RB 4PJFB 1Q1JH 2BWDA 1NJ9A 2F58L 5AAMA 1RLBA 2AKRA 1QTPA 2YN3A 5EULV 3MJ8A 4PJBA 4DK3A 1DBBH 3BPLC 5DJ0B 2VXQA 4TUOA 3A23A 3MZTA 3AFLA 4DPAX 3FK3A 3SDYL 4N0UE 2Y7LA 1HDMB 4AGLA 5I8OH 3C8KB 2PCPB 5IROA 1KYDA 3ZTEA 5ITBH 1KC5H 1RZJC 3PXJA 2XZAL 1NCBH 5H35B 3TONA 4S2SB 4G7VL 2NY5H 1T1YB 3DHJA 4A55A 2PABA 4L2LA 3DURA 4JG1L 5C07B 1YC8A 4D2NA 4GW1A 4DP5X 4FA8A 1L9SA 1WPCA 3BP5A 3STZB 2XFXA 4OFYA 5D2NE 4JHAH 4MA8L 1N70A 1JERA 4QEGA 1KIUA 1F2XK 1U3YA 1ZT4B 2IAMC 3C6SB 3OMAB 3E38A 5D6DC 4DP7X 5PCYA 4JFXA 4JZNA 4JJHA 4QYOB 3GSVA 1A5FH 2QLVB 2ZCKH 3NJHA 2V9RA 2OMBA 5EZJB 1SXAA 2F54E 3A3YB 2WLJA 4Y4HC 5F96L 1J5OH 5FKPB 5CJXA 4Q2ZA 2PPCA 4FQIH 4CU8A 3V0VB 4F2EA 5KS9F 3IPEA 3GBNH 2CD0A 4L3FA 2EEXA 5IVZA 1UUSA 2CO7B 2H3XC 3DSFL 4LSSH 5AZEH 1EXHA 2GC4C 2J1ZA 3MGOA 3WJJA 1J0IA 3U7YL 4NWTH 3VWJB 4Y4FC 2XIBA 4FXKA 4N2EA 3CDCA 3FFCD 4XNXL 2R4RL 3OJVC 3PCYA 3WO4C 2EYSB 3T6VA 1I7RA 4X2UA 3EGXB 5ANME 4R7LA 2WBJA 3RJDA 3LQMA 2BH0A 3FSWA 4C56A 1NCWH 5TQ0H 3ZDZF 6FABL 1RJLB 1UUNA 3R4DA 1QVOA 3CVIH 1FGNL 4OZHA 5D7SL 4QI3A 2FX7L 3LKQA 2ZOWA 4BD4A 1J0ZA 5FKAA 1JVOA 1RUKL 3C2SA 1SDYA 1PIGA 4HT1H 3EIFA 3TT3H 5IB5A 3IE4A 3RIKA 1KEMH 3A6BL 5FWRA 1A6VL 3KXFD 1D5RA 3RPKA 1IT9H 2B5IB 4DETA 1HEJC 3VI3A 4GRWH 4OSUL 3PUCA 3T8XB 5KS9E 4ILDA 3DBSA 4NKMA 4FC3E 2FBJH 5GJTH 3A67L 3VXNA 5E2JA 3VE0B 3SKMB 1CD1B 3D0AA 1U92B 4HJTA 2DQIH 2J44A 1C5DA 4BKSC 2NDFA 1NBVH 3ARFB 2A83A 4XO8A 4YHNB 2ITCA 2R0LL 5LXGL 3FRPB 3ZR5A 4DESA 4Z77A 4F8OA 2N01B 1U3HD 3NRPA 4M5YH 4M6OL 3SE3C 1PS3A 3QEQE 4JFEB 3ZDZE 5TDNB 2N1KA 2Q2LA 2V3EA 4LCUA 5AAPA 3TEUA 4UNTA 4LOFA 2FD6H 4AQ1C 1R5VB 5IQ7L 3BVVA 1AFVL 4A6YA 5E7FA 3ECBB 1CTMA 2H0PA 5E0FA 3QDME 1WZ1H 2X5PA 4LO9A 4M62L 3HEIB 1OF0A 3APFA 4R7VA 4TQPA 1G9ML 5B4MC 1Z5LB 4UAOB 1PZSA 3BQUB 1J0HA 3GMNB 4P0DA 2K78A 2MCMA 4AXWB 1U58A 1CZ8L 4JO1L 5G2NA 4JN1L 5FO8B 1JZJA 1BQHG 3I3EA 5GZNA 2EIEA 1DBML 5KW9L 1MELA 2OA9A 2CNYA 1N64L 3ZRCC 4LPUA 5EU4B 5AB0A 1ZT1A 1MAML 2PW2B 4MNQA 4GAGL 5HI4C 2H3NB 3ZE2B 1QA9B 1IAMA 3Q3GA 3SGJA 3DVGA 5FB8B 4JO8A 4PG2A 4PJ8C 3I3BA 1QOKA 1R5WA 2X87A 3ZZSA 2J12B 3POCA 5EWIH 3BAYA 4HFUH 4HUUA 5ISZB 4R97B 3O3EA 3L7FB 1A1NB 3ZZLA 1UM4L 3L3DB 3F83A 1FZKB 1BECA 2WLLA 1SN2A 1XAKA 3AAZB 4KXCA 2XHNA 3A6OA 3HUJA 2VDLB 2Y1YA 1TETL 4P9MH 4KQ0A 1NMBL 4PV9B 4IKKA 3CNKA 1HU8A 4S11A 1X5MA 4CGUB 1PEWA 5FF6B 2AABH 1IEAA 3RWDB 1HIMH 3ARUA 2ZUSA 2OMYA 3SY6A 1YEDB 4MD4A 1OD9A 1RQ5A 2A38A 2JTDA 4LQFL 4D9RE 1E3ZA 2DL2A 3QW9A 5F1IA 2ZE0A 3BVNB 2QSQA 2CIKA 2VLKE 3P73B 3QIWC 5HJ3A 3WN6A 1HSBB 3S3DB 5F7BA 3A21A 5C0EA 1CLVA 4K3EL 3MLZL 4RFNC 3QWRA 2IPUG 3HHRB 3FSZA 4BQ6A 5BOZG 2NY7H 3WSQL 4M1DH 4YHMH 2YGOA 1CLCA 4N1EA 4NQDE 4NAMA 2XN9A 5JOFB 2AHIA 3SDXF 1L6PA 3CX5J 2MCG1 2OCCB 1DJIA 1BOYA 3NAAL 1U8OB 3KPRB 1X5YA 1S3KH 4ZTPH