2IIJA

Structure of human asf1a in complex with histone h3
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
156
structure length
156
Chain Sequence
b'MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHINWEDN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASF1A protein
molecule tags Chaperone
source organism Homo sapiens
publication title Structure of the histone chaperone asf1 bound to the histone h3 C-terminal helix and functional insights.
pubmed doi rcsb
total genus 30
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2006-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04729 ASF1_hist_chap ASF1 like histone chaperone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 2iijA00
5C3IA 1WG3A 2IIJA 2Z34A 2I32A 2DZEA 2IDCA 1TEYA 3AADB 2YGVA 4EO5A 2CU9A 5BO0D 4RRPM 2IO5A 2Z3FA 4ZBJA 5EIIG 1ROCA 5BNXD 2HUEA
chains in the Genus database with same CATH superfamily
5C07E 1QSEB 5FLVA 2MCMA 2FWLB 3KBHE 2XFGB 1O6VA 1NC4A 2J25A 1MDTA 1EWHA 3AQDA 4LGSB 4PV9A 5IHWA 3BZ4A 1J0HA 4EI5A 4JHBA 4P04A 2DQGL 2QTVA 4X42A 4UOJA 3VFGL 3VI3B 5C8JB 2NX5D 1VEOA 5TE7L 4IIQA 4QKTA 2FLMA 1TITA 3HMXA 1K8IB 1AD9B 2PYFB 4XCEA 3DBXB 3OR7A 4TULH 5D7KD 2GVYA 5JO5B 1ZDQA 3DSNA 4NQED 4QF1A 3TIEB 1J9CT 1SVCP 4IM8A 4NCC1 1UTDA 4ISVA 2FHBA 4HEMA 2A74C 1YJDC 3I6LD 4GAGH 2FJGB 4KXDA 1KGIA 3HFMH 1T7VA 1PF3A 3WFCL 3FU7B 4RRPG 3FQ1A 4Y5VA 4TUUA 4HZAA 5EC2A 1NGZB 2DEWX 4WY7H 2AK1L 4Y1AD 3B8YA 1PZSA 4GBXD 5TQ0L 1E30A 2E86A 3TASA 1O7VA 2E4TA 4DZ8A 2BP3A 1AIFA 4GOSA 4YSTA 1YUHA 4HXBL 3PABA 3KW8A 2E7LC 4Q9QL 1IGYA 2P5EA 2VB5A 1UM4L 5D55A 3AQXA 3BVVA 4GKSB 1NLBL 1NGYA 5EPMA 5DRZB 5AWNH 1CBJA 5F9OL 2ZWKA 4ADIA 1LE5B 5F44A 1FYTD 4LCWB 4MQXD 3QI9B 2P7TB 4V11A 3LXAA 4R5TA 2CJTA 3NGBB 1WBXA 4ZO9A 5DMIL 2AK4E 3GXMA 5EBWB 5I75B 5DJZA 2L04A 1VDGA 2JK5A 2ZKHH 5DJ8B 2ERJB 4X0KA 3WLBB 3KS0J 5A2JH 3PUUA 3D18B 4WO4D 5DJDA 5FGCE 3NFPA 2AQSA 2D8KA 4U6XA 5K39A 1AD0A 1YEEL 1PZBA 3ZK0A 4MNGB 1GSKA 4PCTA 3SJVB 1S7SB 3UBXG 4M03A 1E5YA 1A7OL 4ZFOB 5H37H 3GZKA 3IE4A 5IROD 4Z3HA 4JX0A 1QO3B 3G08B 3U7WL 1CU4H 1NBVH 5DDHB 5FYJE 3D0VA 4Y4KC 1TTAA 3PHOB 3PGDB 3DKHA 4WHDA 5BPPA 1FIGH 2OX5A 2FECL 4BKLB 5A16B 2ARJQ 1P2CB 2OCCB 1JN6A 4CC1A 3WU1A 5FW6A 1G7MB 4KTYA 4FQIH 5C07D 5HXMA 2AQ2A 2XPGA 4EN3A 4LEOB 5ANHA 3WD5H 4GMSH 1HI6B 4D0DB 1AKJA 1RY7B 1N9PA 2J56A 2Z8WC 4PGCB 1DSFL 2C9UA 1JDDA 2C7UA 3ASWA 4TVPH 2C4FU 4CBPA 3AAZB 1H3XA 4LPCA 2F53B 2JIXA 5DD5L 2J5LC 3O6KH 1LWRA 3PWPD 1EJ8A 1MCQA 3QDMD 3B7TA 1PPIA 5EU6E 3IFNH 4K9EH 4GYBA 5MHSD 1JFQH 2WWMD 5B3SB 2A2QT 3QJSB 4AC4A 3JXAA 4IBTA 1NMBH 1DVQA 1NUFA 1NDTA 4ODSH 2YA2A 4YBHA 2AI0L 2I07A 2A6IB 1JV2A 3DX7A 3LZQA 4QRPD 5DJ6A 1CLZH 1J48A 1CL7L 2R2BA 3GC3A 4XB8A 1SMAA 2WGNB 3GMOB 5ID1A 2HLFD 3D33A 2FX7L 4MS8D 2P5EE 3ULUL 2ZCHL 1AQKL 4KC3B 2P44B 2JWYA 5DHVA 5LXGH 4HZ1A 3HB3B 3OMZA 3MYJB 1R5WA 1QBAA 4H1LH 3HI1B 5FCUL 2J4WL 3A6CL 2BS8A 4UM8B 4N8UA 3DUSA 2WTRA 5D93C 1GZPB 4F8QA 1JUFB 5E8EA 2FZ3A 2BVTA 1Q9LA 4IGBB 4LHUA 4O51A 3EH4B 5EO0B 1RZFL 2XG5A 1FYTE 3ARFC 4CVZA 3ULVD 2C9XA 1KFAL 1MHCA 4XOBA 1GZQB 4ZUUA 1KB5H 5ACMA 1CGVA 2E4FA 4Q6IB 1THCA 1KBVA 3S0PA 5CZVL 2XKUA 1MCOH 2LU7A 5ERWB 1KXTA 2VRQA 2ZUUA 4WI0A 4FFZA 3P3YA 2H32A 3L4UA 1NCDL 1ZT1A 2FWOA 4GNKB 4XP5H 3L5XL 5A6LA 2CGRL 1IGTB 4P2QA 2ADIA 1INEL 4EIZC 3X1BA 3QQ4A 2OMZB 4BCZA 4P48A 3P0VL 1I9RH 1QTYT 8CGTA 1MHHA 3Q6FA 2Y7MA 3K0YA 4HJUA 4HWEH 2WWKT 4FC3E 3LD8C 5I16B 2AEWA 2HFEA 1N5YL 1RUMH 2Z8RA 4M7KH 1K8DA 2OCFD 3QAZB 4B3VA 1DBKL 1HK6A 1GZHA 1UC6A 5I76B 5DJYA 1UJ3C 1PZ2A 2YLKA 3DROA 3UZVA 4R4NC 2ZX7A 4DOHE 3LSOA 5DZAA 4Y19B 4Y5VC 2XRAL 2K6WA 1A7BA 3VFMA 3AS0A 3H9SA 4NO0A 4OJYA 4MQSB 3SJVA 3QCTL 2YA1A 1IAIL 1QBBA 2ETWA 2EEXA 2GY7B 4JFDB 3QRLA 5E5MB 4PJ5E 1KJ3L 3GSWB 4M6MH 3TBTA 5AAMA 2MOGA 2R2BB 4PJBA 1YAZA 2W07A 3A47A 4P07A 1AHKA 4Y4FC 4P2OD 2I9TA 3RVWC 4LCIH 2EC8A 3N42F 1C12B 5EU3A 3GYRA 4UILH 3T0VA 1ZS8B 2V4LA 2MNUA 1KC5L 1YMMB 1XR9A 3TZVD 4BV1A 1KN4H 1R4XA 2XZQH 2N1KA 1YMMD 3SCMC 4M5YH 3SJVD 2CO6A 5KSBF 4P06A 4JM4L 4P4KA 3ZQWA 1WV7T 5H94B 4KQ3L 1XGRA 3FS9A 1QFUL 3CX5K 5I1HH 2DLTA 5DJ2A 2DKUA 1SLWA 3PQYE 3EDDA 1KXQA 1Q1JH 1I7RA 2HJKB 3AG4B 3ATEA 3LZOA 3VSVA 5IB3B 1TZIA 1WA1X 3MV9E 3R8BB 3UIZA 3TA3B 1RV6X 2NQCA 3DX8B 1A6ZA 2QHRH 3M6DA 1EEZB 2AVFA 2VR8A 4FF9A 1VPOL 3VH8A 4BKLA 4BSJA 2BWDA 5EHFA 4UU9A 3ZKSD 2XJKA 2A6DB 3ZQXA 2CPUA 5JDJA 2M83A 1JGLH 3I6KB 5IWLA 3S3BB 15C8L 4IKIA 5CCKH 3FT9A 3QUXB 4TRPL 1GCYA 2V33A 4L4TB 4GI6A 3IKKA 3OAZK 2YRPA 4IBSA 2Z64C 4KK6D 2J1XA 4O2CB 4H8HA 3ZUCA 2LFEA 3EHBB 1HL9A 4QRSB 2F58L 1NBYA 4X98B 2BZCA 5ACZA 4P2RE 1OGAB 2H2SD 3NSYA 1FFPB 1SGKA 1EHLH 2Y1YA 3QXVA 3ZGHA 4JGNA 3RBSA 2EDBA 1GJWA 1ITBB 2E9BA 4RISL 4AMKL 1JZDC 4NLHA 4Z7VA 1NCCH 3V7AE 4KKBD 3TCLB 4NENA 1OF2A 3MTXA 4L9LB 5CJOL 3OQRA 4LFHD 3V8OA 2CUAA 4Z7AA 4CL7A 5T1LD 2IDTA 2R39A 2E8ZA 5IUCA 3SGEH 3LRMA 1HKLL 5IR1B 2CLVB 3MRHB 3I6SA 4KAQL 3L16A 3DGGA 1ITCA 2DQJH 2CCWA 4NIKB 4NM4L 7FABL 1ZSDB 4AV5A 4OQTL 3RB5A 1BA9A 1UQSB 3MRNB 4JHWH 1ES0B 4CSZA 4K7PH 1A9EB 5ILTL 2QGBA 3PWJA 4WV1B 5D7LB 1FNLA 1T1XB 4DWHA 1XVSA 3IFOB 4XHJC 1EAOA 4BK4A 3PCYA 1HHIB 3AROA 1WO2A 4G43A 1I8LA 1TU2A 1G6RL 9CGTA 2WBWB 5J0BA 1TSRA 2YWZA 2ZJSH 4H5SB 1ZLUH 3S36X 5IF0A 2JELL 1UD8A 4KMLB 4Q9RL 4NZTL 2FQEA 5DFVC 4ZUUB 1LILA 2OMVA 3RWCA 2DQUH 2NCMA 3RWEB 1QYGL 2W60A 4W9HC 2J2ZA 4MXQC 2OJZL 3FTSA 2VGLM 4OCYL 5B38B 4QHKJ 1ODAA 4HF5L 3QORC 1BHGA 1F3DH 1KCBA 1MCKA 5FO9A 3RYMA 5I24A 1JL8A 5CN1A 3QH3A 1P9MC 3QWRA 5IFAH 1NMAH 2OP4L 2B1OA 1HJCA 3QEUA 2YSSA 4NP9A 4E2OA 1NAMH 1HT6A 1CGSL 2PO6D 3DVNB 3IMWA 4M61A 1HHGA 1S5IL 5FDWA 1P7KB 3QR0A 1IKFL 3RQ3A 3FQYA 2OK0H 5GGRA 3W0WA 4QOKB 4HHAB 4ONHB 2YPLA 3QXUA 4PJ8B 4HCRL 4KJQD 1PNCA 1LK3L 3QDJA 1OAYH 4ZZFA 5I6LA 1SJHB 1X9RA 5CIPB 1QP1A 2QLYA 5HVWA 1QSFA 4MVBC 4RFNC 1ZRUA 5CCKL 5MEPA 5IHZB 4PV1C 1RK7A 3ZMEA 3BDBA 1S7UB 2LOEA 4U2YA 2OMWB 2R29H 4EZLA 4G70B 3CMOL 3LEYL 4K8RL 4PJ5D 1ADQA 5L8LB 5I8CA 3MHZA 2WK2A 2RBLA 2WGXA 2E8YA 1WIOA 4U1IA 4YE4L 1JRHL 2E7BA 5MI0C 1J5OH 1BFTA 4WI8A 1PG7L 4FLSA 5CWSB 5EU5B 3FCGA 5F0MB 1CJYA 3R1GL 2YQBA 2EIBA 5FM4A 1MWAA 4B3EA 4L8CA 3F64A 1UG9A 1S6NA 3K5RA 5GGQH 1D7FA 4XNUL 3RL2B 4JDEA 5CILH 3EADA 1UD6A 3HOGA 4FTVA 4E0RB 1FNAA 1NFDA 3GSUA 4RAUA 4OZHA 4XO3A 4QPEA 2R1XB 1I8LC 1Z1WA 1YPZE 3PWNA 2Q7YB 4G2AA 1YNKL 2F54D 1G7LB 1IBGL 1IEAB 1Y0LA 2EVHA 3ZVVA 5FYKL 4PG2C 3DX0A 4TUOA 4Y89A 5IW1A 4AYFA 2NCEA 4AT6B 1PJWA 3CVHH 3UFIA 4M5TA 3RVVD 1BXXA 3N3EA 4FQQA 1W0WB 3KPOA 3LXBA 3JWOH 4HUVA 5CLYA 1GYVA 3BPCB 5LHDA 2J72A 2ZG2A 4CVWA 4XMPH 3AMLA 3AQYA 3MRLB 2FB4L 1Q94B 1T03L 5AW9B 3SD2A 4Z1PA 5J3HD 3BGFC 3QFJD 3QH3B 4LLMA 3D7PA 4R84A 3IAQA 5I73C 4WUUB 3A4DA 1G7JA 3G5WA 4APXA 3D5OF 3LH8A 1NPJA 2XKNA 2FO4A 3KYKL 2X4QA 5CEYB 2QKIA 4FA8A 5AVVB 2HJLB 1AKJB 5DYOA 3SDDA 4OGAD 4PJ8D 3D07A 3S34H 4MCZA 1H5BA 2NQDA 6CGTA 3HG1E 2B3RA 1OTTD 2YZ8A 1UCTA 4PQXA 1VESA 3ESPA 5C0RL 2EDNA 2OZ4A 5CBEB 3WIFB 4GQRA 3T0XA 5LCVL 2EE3A 4IMKC 3X1GA 4WW2B 1VA9A 3ZE1B 2VAJA 3QO0B 5DHXB 3P4OA 1CS6A 1MCPH 3S5LG 3ZZLA 3K74B 5IVZA 2V0AA 1GS6X 2A83B 3D39E 3MPCA 4FQHB 4UQBA 1WEJH 1LVEA 2APTA 2BHFA 1BXVA 4Z0BL 2GTQA 1RSFA 3K4ZA 1EJOH 2CIIA 2HRPH 4MJ4A 5I1EL 3PWVA 3NCJL 2UZPA 3SDCA 1XIWD 4J3OG 1QRNE 4FFZH 3R0NA 3AWFA 2UXVA 4KDTA 2HN7A 2PCYA 3I3DA 1TZOA 4IRJB 5DJZB 3ROLA 3VA2C 5JQIB 3W81A 3IDJB 3QJFB 3UEZA 3EOTH 2Z35B 5HGBA 4YUEH 1J0JA 5BQ7B 1SHMA 1F90L 5AL0A 1XEUA 1ORSA 4XVUD 4GP8B 3TBBA 1X5XA 2CLRA 5AOMA 2K6ZA 3O4OB 4OZFB 5EWIL 4KUZH 2FBRA 1BOYA 4JANA 3QHFH 4KXAA 3A24A 2X2HA 1UA6L 1A0QL 1C5BH 4O2CA 5C0BE 5ESQB 4DFHA 3V0WH 3V4PH 3J27A 3PAUA 3KXFA 2F8VA 2WWMC 5DHDA 5F93C 3US1A 4OZGB 5KBNC 4XGZB 2VZ3A 1FVCA 4PJIE 4CUCA 3DHJA 4WEMB 1KBWA 4WK4B 3DETD 4E9TA 4HUVB 1F58L 2YBRB 3K5SA 5JOFA 4PJFB 1RZ7H 3QA3A 2L4OA 3DGCR 3V79C 2SODB 1SBBA 1PY4A 1UEYA 5B1KA 1S7VA 1TPXB 1I9IL 3BGMA 3BP4B 3VWKB 2QVFB 3ZT7A 5EA0H 3I9AA 2YUWA 3HBPA 5FFOA 3GSUB 4OZ4A 4M7JH 4X4KA 4CNIB 3GMRA 1MPAH 1BZEA 4O02B 3RP1A 3PLYA 3FQUB 2XIIA 3AC0A 3KLAA 2R0KL 1MCWM 3OKYA 4H1LG 3RZCA 1GY2A 4S1QH 1B0IA 2I32A 5K59F 1I8IB 1RVFL 2B2XH 2DDQH 3T3PE 1G84A 3QPXL 2FZ3B 3LH2L 4GINA 1YMHA 1XF5B 1DVZA 2OMNA 3CXDL 3S88H 5GZNC 1J1XH 2EYRB 3V95A 5IREA 4GY4A 3I02B 2GQHA 3WJJC 3TEWA 3O3AA 2ZWZA 4UTAL 5FR3A 4R96A 1KDJA 1W72L 3ME0A 5IW6A 2CGYA 2XFXA 3HG5A 2P26A 1AJ7L 5MI0B 2ZUWA 4NS0A 3P9MA 4PUBL 3ABGA 1AAJA 5LNGA 3BWAB 4IBUA 3N85L 2AANA 5JW4M 2ZOUA 2J3SA 1OSPL 5C09A 5KVEL 5BMFH 4YBQD 3JZYA 2I26N 4HV8B 2WKOA 4JLRB 3B3IB 2X5PA 4DNLA 3MLUL 4LIQL 1FVDB 4HS6B 2F7PA 1F4XH 1NAMA 5EC1A 2YHGA 2PYEA 4NZRH 4WI2A 5BJTA 4B53A 4M1CD 3EJSA 3QQNA 4KKBC 1N8OE 3RPIA 3L3IB 3RKDC 3Q13A 4OLUL 3LRGA 5EEUA 3HZ3A 4POZD 4QHUB 4DPCX 5IJKA 4PREA 1N6VA 3DX8A 5KSBB 4G9FB 5CGYD 1R3JB 3V0GA 5CINH 5E03A 1I31A 2I27N 4HU2A 1RL1A 3WDHA 2E56A 2G0LA 3G6JB 3ZT5A 2YD7A 1GIGL 5A1AA 3M1OA 3RVWD 2Y07L 4U1IB 5G2NA 1G94A 2DQTH 4E9RA 5LKNA 1U3ZA 5EUOE 4UT6A 3P73A 5B39G 3QEGL 1D7DA 5HYSG 2V7NA 5HHPB 3AREB 1OCZB 3MRQB 1AS6A 1CTNA 3ZKXC 1QBML 5IVXB 1MCIA 4L4VB 2NT1A 3FAXA 1I8MA 4HOZA 4POYA 4QDGA 3CXHJ 4ANWA 4OI8A 4MBOA 5DFVD 3O3DB 1YYLL 4NCDA 1T6VN 1XGTB 2DH3A 3L5WB 3QIWD 4FFVD 3B2UC 4DGIL 1GC1C 1Q9LB 3ARGD 1U8OB 1J8SA 3LD8B 1XH1A 4ZUWA 4XO9A 4Y1AB 1P1ZA 2HKAA 5A2BA 1B0GB 1IBGH 3O8XD 4I1RA 4Y5XC 3OHXA 3QIBB 4O02H 3GSRB 4DQAA 3ZKNC 1IO4C 3TTYA 3VGGA 1ED3A 1BYOA 3UAEA 2I60L 1IAIH 1Z9SA 2AZUA 3FQNB 4N0UB 2OMUB 3I3BA 2Y7OA 3CPLA 3QQDB 5HYJA 1G7HA 5JW4Q 4HJJL 3W5MA 4DFIA 4IRJC 5ABAA 1I75A 1PQZA 5JHDD 3MLZH 1MG3C 2B1AH 5LG6A 2JKIS 5SWQA 4F2EA 3GLZA 5C6PB 4OM0H 3VU1A 4ZNCD 1R0AH 3KPSB 1MELA 1NTDA 4GPVA 1IJ9A 4FQ2L 3GSNB 4U1NB 5CHNB 1GGBL 4UT6L 5I8KL 4E36A 2VM3A 4AZ8B 4XAKD 2JB5L 2NY0B 5E1AB 5HHMD 1ZXKA 1EZVY 2CA3A 4F3FA 1E43A 3FJTA 1YYMH 3PHOA 1A2YA 4NUGL 1KXHA 3B2MA 1FRGH 3APFA 3E8UL 4KH2A 3TGXA 2VUYA 1O9VA 5DHYB 2H3NB 2ALAA 5AYUL 5TQ0H 4DN3L 4ZUSA 5GS1B 1K8IA 4I77H 3UZQB 1KPUA 3ABZA 3MXWL 1CURA 3D50A 1YN6B 2EDFA 2F5BH 1GS7A 1SF3A 4J4PA 3JWNH 5EZJB 5DLLA 4HWBL 2XN9A 4IIQC 5GRWA 5C6WH 3GMLA 4G5ZH 3QW9A 1U8IB 1LD9B 1EVUA 4OCRH 3QULA 3CFBA 2BXYA 1JF5A 4MAUH 3FQTA 4XCYB 3N40F 1UQSA 2ENSA 2FATH 3MRNA 2BNQB 4JPQA 4Q6KA 3MACH 1FFOB 2IAMB 2UWEB 4YK4C 1PKQB 5HGDA 4PRBA 4AMWA 2A7BA 4M6AA 2VSMB 3L95A 4HLJA 2CHDA 1JP5A 3I9GH 1AD0B 3RFZB 2ID5A 2PWGA 1TJIH 3Q1EA 5T3XD 3FFCE 5M7QA 5D7EA 3MKKA 2Q2EB 1AMXA 5T1LA 1P5UA 2A6JB 2VERN 2VLLA 3CZKA 3BYYA 4HUXA 3OAWA 1A4CA 3KWWA 3BKYL 2VZVA 3Q9QA 3ZDZE 3A67H 1BD2E 3RDJA 4XVJL 5D1XA 5DJCB 5KW9L 1FZJB 4J7RA 3VWKC 1KZYA 3MUZ1 3RGVA 4TUJA 5A2KH 2ZTBA 3IU3B 2ZCZA 3UPCA 2GUYA 4P2QD 2J8UE 4YO0B 2JV6A 5D5MF 3HI5H 4X8JB 2OSLB 3IDMB 5KYXA 3B83A 4QF1B 1DQLL 4HUWA 1TETL 3DX9B 1HH9A 4HCGA 1IM9A 3MLXH 3VXME 3O6MH 4AK1A 4DPBX 4IMKA 1UYWL 5IQ7H 2VABB 1MREH 5IF0B 5SX4I 2AV1A 1GAFL 4BSWB 2BHZA 1H3WM 1OGAA 5IB4B 3IF1B 4GLRH 5CN3A 3VDAA 1E9OB 3LYRA 3F12B 4FG6C 4YHYC 4L9DA 5ICXB 3PL6D 2QSCL 1KULA 3RIAK 3BAWA 2BHYA 5F3BB 3ZTJG 4F7MB 1NBZA 5E0FA 4HYTB 2D3VA 1FFQA 3HRZB 1GW6A 4R90H 1A65A 1I8KA 5HPMB 4XN9A 2CLVA 4W1TA 2XVBA 3DETC 3GRBA 4LEEA 3QJOA 1SDDA 2ZF9A 2MQCA 1UACL 2IDQA 1QBLL 3L2LA 3PNWA 4H2AA 4KTEH 4XC1H 4AH2B 3TCXA 2AXGA 1OTUC 5BUGA 1KLFB 2E59A 4DP6X 1TZGH 4HJIA 5JR1L 1U8JA 2Y2TA 4XPHH 2XN9E 2Q10A 2R56L 1NJ9A 2ZXEB 2AQ3A 3FQRB 3SPJA 2DWEB 4HGKC 4JFZH 3QUKB 2DM7A 1PGRB 1I1CA 4Y19D 1QSFD 4G72B 4OVUA 4MD0B 2X88A 4XPFL 2Z31B 3RY6C 2DQIL 2CR0A 4XBGA 3QIBC 1UM4H 1BG1A 3B1TA 3WMPA 5KVGE 3ZX1A 2LTQC 4EXPX 2Y25A 2D7PA 4KZCA 1F97A 3U30B 4N2FA 3F7LA 1BQSA 3N43B 1DL7L 5FW7A 3DMMC 5MEND 5FO8B 1MFAH 1QI3A 1MCOL 4TSAL 2YAFA 3BGFB 3IT8D 1MLBB 5FKPB 2CKBA 3FB6B 1F42A 1G7JB 1PZ5A 2DRUA 2PF6A 2G9HA 4F8OA 1GPOL 4Y5YC 1YY8A 2VDLL 3BPOB 3TYGL 1AGCB 4GB9A 2YMXL 1TDQA 5GGRB 5HYQA 1A14H 5H37A 5JXEC 4Z7UE 1JMXA 5AOLA 1FA4A 3U1PA 4D0BB 4PGBB 5GGUB 1CDHA 3TBSB 3A4FA 2FDBP 1OAZH 3CSYB 5ANME 1JK8B 3MRRB 4P3DA 5D7JA 3QXAA 2E7CA 2Q6WB 5ERWA 4R7NA 3DO7A 3BPLC 1CB4A 4BZ1A 2HVKB 5BW7C 3FB7B 3HAEH 4OD2B 2VZ1A 1HCYA 2YAHA 3QRFM 3KD4A 4JDVA 2X6UA 3QCUH 2QZ5A 3CUPB 2OJEA 2NLJB 4GQQA 1QFPA 3QDMA 4AI7A 2WUCL 3II1A 1D7BA 1MAML 1UWFA 4KRPB 2ADJB 5JA8B 1E3XA 4UDTB 2WZPA 1JJUA 1HEJC 3I2CL 4WFFE 4WO4C 1QTPA 4QXGH 1DSFH 2RFXA 5A3IC 4EUPH 3EO9H 4PJXA 4LHJB 1FNEB 3OR6A 1OAQH 4NUPA 1FH5L 2WB7A 3BP6A 3HA0A 3QQ4B 2R7EA 1X7SA 3HI1A 5KN5A 4M1CC 1DVYA 4RIRA 5CD5C 4I0PA 1MQKH 2NQ3A 3WFCH 1MQ8A 3L4XA 4RAUB 5FGRA 1NJ9B 4AYSA 5D8JH 3NGBC 3IDYB 3W9EB 3EOBB 4YHIA 4ZMXA 3GMPB 4MDIA 2JCCE 2CDFA 1ID2A 4J23A 3T1FB 2VXUL 4PWEA 2EVFA 4ZDHA 2VW6A 4NKOA 5CEZE 5BO1L 4A6YL 3ECQA 1IGCH 4FXGA 1TXKA 3UC0L 5J06A 2XXFA 2V3FA 3FCUB 3ARGC 3GKZA 1OD9A 1MJUL 2VDLB 4YHOL 4DO4A 4AL8C 5L7XL 4NQQA 3PWPA 5DHYA 1P4BH 5DQJA 5ITFA 5B8CA 2AFNA 2ESVA 5LDSA 2WNKA 3G5ZB 5MENE 4NP4L 1NC2A 5ANMA 2ZKHL 1INQB 5FKPA 1UURA 2EEBA 4NGHH 4FFYA 4PD4K 1MUJB 4X9YA 1T1XA 5GQBA 3JWDL 3R06A 1ETA1 1IGJB 2COQA 3U0TA 1D5IL 3O8XC 1GGCH 2ED6A 3CFDB 5F1NA 4O58L 1DUZA 5C0NC 4AKPA 2VN5A 5JPMA 3VW3H 5D1QC 1TCMA 3GXTA 1S7SA 3DK2A 2LU5A 4GXVL 1C5CL 4LPXA 5E9DA 2UUDH 2DLIA 3S2AA 3VXSE 2AJVH 3DRTA 1OSYA 4XP9H 1E7VA 4QYOB 2QMJA 3MGTA 3UYRH 5D2LB 5ID0B 3DGDA 3C2SA 1V05A 4Z7VB 5ALCL 3TYGH 2UXFA 2J1WA 3BCDA 4MWFB 1A1MA 3C2AH 32C2B 3O3AB 3QVAA 2IAMD 5LBVA 3BKYH 1KN2H 1KIUB 4EOWL 3GIVA 4HUKB 1DANT 4JE4B 4NQVB 2J73A 5KG9B 1GYCA 3G04A 4HD5A 3MKGA 4IIZA 3MV8A 1XDTT 2CKBB 4OV5A 3QEQD 4ELMB 3TO2B 3B7SA 4L8DA 4EZJA 4W9IC 4QNPF 1U8MA 1HX0A 2UVFA 3FT0A 3C5SB 3HE6C 2ICCA 2ZPKL 5EC2B 5IEHB 2X9WA 5DWUH 4ZUVA 3GMPA 4MDIB 5CFAA 3KGTA 1W8OA 4OLWL 4RMUA 1Y6KR 3FMGH 3V4VH 2WVTA 3B9KB 3PABB 3ZZSA 2HH0L 1A8ZA 5D1ZB 3K6FA 3NRQA 4WKXA 4FQXC 1DDHA 2OTWB 1V5JA 5EIVA 2VLRB 4I2XA 2BP8A 5BZXA 1DDTA 3SY0A 2VLRD 2JVUA 4IBYA 2VN4A 3RY4A 3U30C 3UG5A 4OQ1A 1AP2A 5KVFL 3N1MC 4PP1C 1PCSA 2RFXB 4L2YA 5I8OH 3WO4C 3REWA 1RXLA 4D94A 5JDSA 3AFLA 3BT2L 1S5HB 2BSCA 1CQYA 4JDZA 4UT7L 5KVFE 4BWTA 5IHHA 3ZL1A 5IMMB 3PS6A 1SBSH 4LLDB 1CO1A 4Z6AT 5DD0H 4XP1L 3NG5A 4X8GA 2XSKA 1RIHH 1OQOA 4Y2OB 1A3ZA 3L1OH 1ADWA 4AJ0A 4AIZA 2NY3B 4HUUB 5ESVA 3PIQA 3TO4B 3MJ9H 2QQNH 3BZEA 3LQAL 1P5UC 4GI9A 2DIEA 3EYUH 2CUIA 3HPLA 4X6DB 4C83B 4LSQH 4FLRA 3OB8A 2GJZA 1T7ZA 3VD7A 1V7ML 3P0YH 4WI7A 2HKHL 4WI4A 4C4KO 1NCWH 5DRWA 1AGEB 5EUOF 5SWSE 1YSOA 4HIJB 3L1EA 4JRLA 15C8H 1L5GA 1CUOA 1E8XA 1QRKA 1D5XB 4XNMA 5GISL 4HWEL 1Z9NA 2GYSA 4DP7X 3EJYD 4ATWA 1TUPA 2V9QA 5IW3A 2F19L 4XZ4A 5EU5A 1J10A 5FYLH 3RNQB 3RPKA 2YD4A 2ZYSA 1XF4A 1U3JA 4XI5C 4D9RE 1LO5B 3KPTA 2Y5EA 1I9EA 2K7QA 3W9DA 1UH4A 2X42A 4R7DA 5FV1L 5SWSD 3ARED 2EO9A 25C8L 2F8XC 3CPUA 1WBZB 2ZE0A 1WICA 4XTRD 4EQ2A 1R3LB 4OBSA 4LOUC 4QO1B 5I6XB 2BY0A 3K3QA 2P5PA 4LAQH 3WDJA 2HLAB 4R8WH 2OLDA 3WN5C 5DD3H 4YSSA 2PPCA 1G5GA 5B7EA 3PP4H 1NIDA 2R0ZL 5DWPA 5J6GB 1DLFH 5DT1H 3RDTD 5CUSH 4OAWB 3Q0HA 3KLLA 3WFEL 4XWGL 4RBPH 3ALWA 3TFKC 1JZ7A 1UOWA 3CXHK 1LDPH 3BN3B 4OZHE 4AGLA 3ZHNA 4Z8FH 3E1F1 4H8WC 4M6OL 1TLKA 2XN2A 4JFDD 4ODUA 2NY5H 1KJ2B 1DBJL 4HC1A 3MBEB 5FM5O 4MJIE 4RMQA 4XXWA 5IJKC 3BUPA 1JZ6A 3O0RH 3C09C 3GIZL 4TVUA 5G4MA 3PAVA 4P2OB 7FABH 5BVPH 3V4LA 4N1HB 3KEHA 2DWYA 4GXUM 4ZSOB 1UGNA 3ZBMA 3BSGA 2F1BA 5LCVA 1M7IB 2J6EL 4JFOB 3GPSA 1ZJBA 4HJEA 2L0DA 2WLMA 5E5RB 3MZTA 5I1CL 2A74B 4EDWH 2GK2A 1U93A 2P8MA 4JN2A 3OAZH 2J4WH 3LEXA 4XXWC 2QR0B 4IHOB 2VDRL 1LP9A 1XGQA 1H6EA 2XU9A 2J1KA 2DL2A 4WF7A 1AGDA 3AXIA 1LDSA 2ZKYA 2X6BA 5E08H 3IFPB 4PJGB 5A7EA 2LAAA 5D72H 3O6LL 2YWYA 3DBSA 1KIPB 1ZIAA 3MROA 4XVTH 5B39A 3DX3A 4NRXB 4UB0L 5E6IA 5C86A 4GKZA 1I3RA 5CO1A 2DM3A 1FWXA 1BF5A 2A9NL 4HXAL 1B0RA 4JFEA 4Y19A 5EO0A 3I02A 4GRMB 3MRMB 5LNEA 4YGVA 3NFSH 1OF0A 5H4YA 3HUJE 4XXCA 4KAQH 5D1QE 4MKMA 2A6IA 5LN8A 4M7LT 4MB4A 4YLBA 3EHBD 1P6WA 4KHXH 4F37F 2CO7A 1CXIA 3BKMH 4UMGA 5TJWK 2HTKD 2J1YA 1TG8A 3L7FB 2NNAA 1TTRA 1CXLA 2R4RH 2VDNB 4YFLI 5JMOC 2VLME 5GRVK 2QELA 1OP5K 3HW7A 3T77B 4PG9B 5AW7B 4PJAF 1VRSA 2DI9A 3GKWL 4ZPVB 5IV2B 1Z7JA 5E4EC 4PRPB 1T1YA 3IFLH 4XN8A 4A7QA 3WNNA 2IAND 1IKNA 4Z95H 4LMQE 1SDAB 3IJYA 4OCYH 1NMCB 3MLSH 4NQDB 2BW5A 3SOBH 1CVRA 2E6QA 2AGJH 4CN6A 1IC0A 4FQ1H 4K15A 3IXTB 2XWEA 3ERXA 4JKKA 3FMGL 5AVYB 5D4JA 4AQ8C 1AIFB 4HHWA 2PXYA 4NZ8A 3CDCA 4XGZA 3MAWA 2H7WA 2ZX8A 2HP4A 4XAKE 4CGTA 1S7XB 1YA5A 5DVOA 4XP6H 4AQOA 2J20A 3NESA 3ZYZA 2J5LB 4K23L 1A6WH 2ZOKB 5DJAB 5DS8B 4ALAH 5C0RH 1MRDH 4HIEB 5HGBB 3VWKA 5E2VH 1DHKA 1S9VA 2NRDA 3T0EE 1ROWA 3KW7A 2OTUA 5JO5A 3VYOA 4PP2A 3MA7A 2DMCA 5D7HA 2QBWA 2IDUA 1BJ1J 2DIBA 4DHLA 4K3JH 2ZUVA 4JRYB 3V6ZA 2V9TA 5FC9A 3ZDYE 4WUUD 4XBPB 2H2SC 5IJVB 5ACZB 3EAKA 3T0BA 5D71L 2FVNA 2RJMA 5KSAB 2P80D 4UAOC 4AVHA 1B0WA 4FZEL 5DUMH 5TE4L 3DXAA 1UWYA 1XZ0B 3T4YA 4ZFFB 4DJMA 3S3PA 3G3LA 3K2IA 2XV2A 4PJ7A 4YQXH 5DJ0A 1F4WL 4AK2A 3KLKA 4KK8C 2XC8A 2VC2L 5I1IL 1L7TH 2IF7A 3I6KA 4BFRA 3OJMB 2PCXA 3ILQC 4AENB 1CD0A 4HP5A 4KUCF 4U1KA 1FBIL 1SEBA 4K07A 4Z3TA 3GMRB 2VE6B 1X7QB 3L9BA 4JCWA 4NYLB 2YQGA 4Y8AA 5LAPA 5T3ZD 4WCYL 1JHLL 5IV2A 1N7ML 5C0CD 4WHYG 4BZ2A 4IOSA 3UDWA 2E9WA 5E9AA 3ZZQA 2CO1A 3VXNA 3LJ3A 1Z9MA 2WVSA 2XETA 5F88B 4PP1D 5DZJA 2Q8BL 3ESVF 1BQHA 1NBCA 3VFNB 2HXAA 5IIEB 3G9AB 5MENA 4HDIA 4K0OA 4Z7VF 1KYOK 1I9IH 4FXGB 3K7UA 3FPXA 4YHNB 3SE6A 1JTPA 3QORD 4JG0H 1RCYA 1XB6A 5GGRY 3TO4D 2UZXB 3U6RB 2EO1A 3QNFA 4P59H 5D93B 5EZOL 4DVRL 1XXDC 4YWGH 1FPTH 3NJIA 2JJWA 4FRWA 4J3OC 4Y7MA 4ZTPL 1IE4A 1ZV5A 2X4QB 1MF2L 4U1JB 4IJ3C 3CLFH 3O4LD 1F56A 3Q8AA 4JY5L 1I1YA 1FDLH 1XGUA 4J39A 2WQ8A 2JCCF 2PO6C 4ZOCA 5KSUB 2EDOA 4PJ8A 2YMOA 1OTSD 3NEXA 4HJGA 2R2EB 2Z91B 3SDCC 2P9RA 5AB9A 2RACA 1JWUA 4MB1A 2WY3B 2ZICA 4GRLB 5F7KC 1CGXA 2Z92B 3HZKB 4TKWA 1M6OA 5B8CC 3ZIMA 3UTTE 4PJCF 1AYOA 3KM2A 2CDEB 2O72A 5HSFA 4HWZA 5BRZD 5IMLA 2P49B 3U7YH 2XHNA 1NGZA 4NRYB 5ICYB 2VRAA 2GI7A 2VLKE 3CG8A 2MNWA 5IVZB 4LVEA 3MRGA 3LRHA 4C58B 2PR9A 3MLTB 4BELD 2XYCA 5E24E 2Q3XA 4XNYL 4QRQB 3BUTA 4ABVA 3A22A 4BK8A 1OV8A 3N85H 1MJUH 1XHHA 2A1WL 4RVBA 1PAMA 2ZXDA 4AXWA 1XGYL 5L7XH 1XF2B 1BVLB 3IJEA 2WQSA 1BVZA 1A6PA 3HNSL 4EKXA 2ATAA 3S48A 4J3SA 4I77L 1RKRA 4KK9C 3OC5A 4NUQA 5TGBB 1B9ZA 5SV4A 4DEUA 5HHQA 1YEFL 2EAEA 2L7UA 2VL4A 3GRWH 1XCQA 3K6NA 3MR9B 4YDIL 4YHMH 1VHPA 3LN4B 3DX6A 4O51B 4RQQB 2IMMA 2FT7A 2WWNA 2Z9TA 4XTRC 4JFYB 1A21A 3C60B 2J8HA 4MA7H 4TM9A 4AZ8A 2CGRH 2JJTA 2WTRB 1INEH 3QXDA 4M5ZL 5ETUB 3FRPA 3OGCA 4YDLC 1F4WH 4HBQA 3REVB 1M1SA 1UWGH 2LLGA 4WFFD 1AR2A 3HS8A 1ZAGA 3BHBB 4P2QE 4E5XG 4K3EL 4ODVH 2X1WL 1CYXA 2DTSA 3S5LA 4BQ6A 2V8LA 4DKEH 2VQ4A 2L8AA 2QGEA 5HHXL 4A7GA 5T1LB 4ZMNA 5IQMA 3NCFB 3QDJD 3CTTA 2KI6A 4G8GE 5ID1B 5I0WA 1N6UA 2BS9A 2X6AA 1RJLA 2MIZA 3D34A 3SKJL 1KIUA 2V5SA 2XWJB 4OLUH 5IGXL 4F2MB 1BZ9A 2ERJC 3HE6A 3M1BA 3QNXB 4AIOA 4WW1A 1M2VA 4FADA 2G9KA 2ZOOA 2WXFA 4NO5B 5DZPA 4U0RB 1U8JB 1CD1A 4I3SL 3MNMA 2L3BA 4G59C 3UMNA 4R7DB 5C08B 4APQC 3BD4A 4F9PC 2ITCB 1RH8A 3BOVA 5GIRA 5KYYB 1SFDA 1SOQA 4OCWH 3Q7JA 4ZS7L 3JYBA 4OI9A 3LZLA 1YQVL 4KKCC 4MMXC 4YPGB 4F8PA 1KV7A 2XVGA 3A21A 5DA4A 3IJYB 3MRDB 4NHCL 5ADPL 5DU7A 3U4BH 3POHA 1QSZA 5EO1A 5MEPB 5CZRA 2MCPH 4NJ9L 4FQ1L 4RZCA 1I1FB 3KCWA 1YEWA 4P46D 3VH8B 4MWFA 5IWLC 1QFUH 1T2JA 2FSEB 3MBWB 4HD9A 1BX2B 5FCSH 5IEKB 1G9MC 1IL1B 5T5FA 1E9PA 1JBJA 2JKTM 4EN3D 4W68A 5LB1A 5C9JB 5K9JL 3KDMB 5JPMC 1WGOA 3VTTA 5I1KH 1E4KC 1XFPA 2VAAA 4KTGA 1TJGL 1TTBA 3AG3B 2Z3FA 4HV8A 4WFHD 4LPYA 3RU8H 4JKPL 5FWRA 1XH3B 2DMKA 4UT6H 3OKMA 5I6PA 4F37K 4HU8A 4L9LC 1J8HE 1PYWB 2I5YH 5AW6B 3AREC 2HG5B 3QDGE 1SLXA 1ND0B 3QR1A 5INCA 4F7TA 5FYKD 3KYMB 5HVFB 3FAWA 5IQOA 5FYKU 1LP9E 1D2OA 4NFCA 3M8OH 3MJ9L 4K71B 3NFNB 4FKKA 2EDWA 1T2QL 4NSKA 4QXTA 4TULL 5IJCC 4HF5H 2E47A 3V4UH 1UXSA 1WS8A 2UY6B 5BS0D 1P4UA 3RDTC 4FCAA 1V7MH 3P0YL 4GXUN 2WZ5A 1N0LA 4G5ZL 3GB7A 2KHAA 1A3RL 3D2TA 4FL4C 1JV5A 2WNXA 4NAQA 1MOEA 1VEPA 2FE0A 4UTBL 5LBGA 5JIQA 1GMEA 1F90H 3GBLA 1WHOA 1IFHH 2AKRB 4AGPA 1I8MB 3ZDXF 4EI5C 2JCWA 4K3DH 5B38G 2AEQH 3EYVB 3ECBB 2J6WA 2R27A 1M9SA 2QKIC 4AEEA 5F9WB 1C08B 1FGVH 3IRZA 3ARZA 4JREB 3LN4A 3CVDA 3LRSA 4RWYL 5KVDL 4FA6A 1RURL 2NXYB 2NY4B 5CBEA 2WQAA 2BOCB 3QSKB 2W9LA 4L9LA 1QD0A 2A4EA 3CDYA 2AQPA 5AKVA 5E51A 1RPKA 4QUOA 1PFCA 3UIYA 5DRWB 4JN1L 4AG4H 4JDVB 3SO5A 1S7VB 5C0AA 2W1NA 4LK4A 3WFDL 4PWJA 1EIBA 4WFEE 1DFXA 2YAPA 3K81A 2K3HA 5L2JB 3T2NH 1BCIA 3X11B 3ZDZF 1YMMA 1C1EH 3B3IA 3NA9H 2YAOA 1BYPA 1DUYB 5CM1A 1BLNA 2Y7LA 1U8CB 4J3OF 4LRIC 1MCBA 5DMGC 4PGBA 5F1NB 1CXHA 1AFVH 2V2WA 3KLDA 3L45A 3TIDA 2R2EA 4TUKH 2OQJB 4L5FH 1KJVB 1YY8B 4NI3A 5L4JA 2R0WL 1WIPA 4MD0A 1RFDH 2X1PA 2XWXA 4R0LB 2GAZA 4HS8L 4G43B 1JPEA 4QT5B 4NUGH 2JMRA 4PY7B 4WAFA 2NW3A 4J3UA 3ARPA 4FEIA 5T5NG 5T5NF 3S36L 3U7YL 1HH6B 4K3HA 1IU1A 1GKOA 3LQAC 3GI9L 4GKSA 2WCSA 5K5YA 4NKQB 1BJ1H 3QDAA 4GUOA 3WIHL 4HKXA 4Z9KB 4LPTA 1NCGA 3WYRA 2DL9A 4FZ8H 1OAYL 3H3BC 2RB8A 4KOBA 5KG9A 2VCOA 3D3VB 5F9OH 2H1XA 3AABA 1N6QH 5E2TH 1JFQL 3PL6B 4G8GA 4XR8C 1A6AB 3TVMB 3GJFK 1L0XA 3ZE2B 5FUOH 4XPFH 3ESOA 3IWUA 5I1DB 1SFHA 4TSCL 1VGKA 1YJDH 2G5BA 1SJHA 2ZSWA 2BERA 3GBMH 2KS0A 3BWSA 3MC0A 1S7WB 2CQVA 5C3LD 4OFIA 4YSPA 3KHQA 1PTZA 4FN0A 2VN6A 3HHRB 2D31A 2C1PA 2EKSA 3QG7L 4FJYA 2GT9B 1MHCB 1OP9A 2DB8A 1Q72H 5CGMA 5E9DB 2ZOLA 4XXDB 3GJEA 4G6ML 3TNNA 1DJZA 3HNTH 3NPSB 4YXLH 5I1GH 3QQ3A 4IDJL 4AVJA 2KL6A 3NJXA 4R2GB 1JPGA 3ULUD 3EJTA 3MUGB 1NBVL 1U36A 1XZ0A 3FONA 3T4YB 1QVOB 2CMRH 1G7PB 1LL1A 2XWZA 1URLA 2E27H 2Q1EA 2FJUB 4RSYA 5CP7B 4RDQG 1FORL 1K5NB 4JFVA 4HFUL 2B8OT 3C6SB 3NJVA 1FO0A 3D1MC 3VWJA 5IMMA 2IAAC 3ZKQD 3LS5L 4W9ZA 5DD1H 1M2VB 4KITB 2GEEA 5DO2C 4IRSB 3AM8C 4TTGA 4FHJA 4OVVA 3QNZB 4K9JA 4X6FA 2R4RL 4TLSA 1N68A 2VABA 4KKAD 4OD1L 1FL6A 5CZVH 2EKJA 3FT4A 4NZDA 3QHFL 3MRFA 2VERA 4MMXB 1RLWA 4DT2A 3PWNB 5K33A 2DWSA 1O6SA 2YBGA 1QRND 2FX8L 3IGAA 1WAAA 3KJ4C 4G80B 4QRPE 4Y16C 4QRRA 4GBXB 4JO2L 1VIWA 1NM9A 1OW0A 3QIWA 4KVCL 4WI5A 1U8LB 1H3GA 2D7TL 1E5AA 1KBKA 4N2DA 3AACA 1AFVL 4X6CB 2E6JA 4DZBA 3T0EA 1S9KC 4DTGL 5ESAA 2VW4A 4TLTA 2XWTB 4B7LA 5MP6H 2X2JA 4XX1G 1FO0H 3NZHL 3GI8H 3U25A 4E5XB 2JELH 3LNDA 3D52A 4HBCL 3BFQG 3OKEB 4W6WB 2F5AL 3GZPA 5FYJU 4RRPM 2O61A 3GSNH 1AZZC 3QBTB 5I1LA 5I9QC 4OKDA 4PLKC 2QKIB 3W0WD 4GT0A 3VNYA 4E9LA 4Q0XH 3B2PA 1FCGA 5B1JC 1U3HA 3AU1A 3DTXB 2D3JA 3VXUD 2HG5A 5IHBA 3D09A 2NY2B 4IGBD 4PTTA 5TH2B 2VQ1B 3RVTC 1O6TA 5F7EL 1H0DB 1UOVA 1U8QA 4NRYA 2R8SL 1ML0A 1A3LH 4F20A 4FGMA 1CK0L 5BV7B 4HAGA 1JCKA 3VFNA 2XPZA 2UUDK 2EXTA 3MXWH 4ZUSB 2Q86A 1NKOA 3QWRD 5EMYA 2AEPH 3ARXA 5CP7A 1AZRA 5EZLA 1XF2A 3K1DA 1BGXH 2YKKA 4LEXL 3T6ZA 4QXUH 3V5DA 1DQTA 2CIKA 4XHJD 3UJTH 2N59A 1ACYH 2D7QA 2N01B 5C9KA 4WEEA 1EXUA 1GGCL 4PJIA 1MH5A 5KBDA 3QUMA 4G83A 4KKQA 3DXAE 4RAVA 1ILSA 3RTQB 1JZFA 2VO5A 3QUML 4IRJA 3ROLB 3T2OA 5HYQB 2F19H 3JT0A 4KJWD 3T5WA 4BZ2L 1Q90A 1S9YA 4L4JA 3AQZA 1ERNA 2KZ1B 3OJVC 3NCMA 1RIVL 3RJOA 2ZSWB 1Y6NR 4JO1H 5GHWL 1FG2A 3FFDA 3WY1A 4XBGB 4GO6B 3RX8A 2A83A 2VMJA 2QZQA 5ICYA 1OALA 1GJUA 4ZJ9A 3KMDA 1RK0B 4BD4A 5I2IA 5JIMA 3HE7D 4YHPB 5HYEA 1BMZA 2AJZA 2P1YA 4NHUB 5F89B 1R33A 3SPCA 4ZZKA 5AENA 2OKMA 4MA1C 4NQSB 1JD7A 1YEEH 2VL5B 3OR7B 5E94A 3MCG1 4FTVD 2G2NA 1DE4B 4GKNA 2HJLA 3RVXD 3WTTA 4GW5A 4PJ9B 3WD5L 2B1HH 1YYLH 2IAMA 2IPUG 1PZAA 3A23A 3D0LA 3T0DA 2OMBA 4R0LC 3SQOH 2R59A 2OQJA 5CR8A 1JF1A 2MNJB 2FHFA 3X14A 4DUXA 2H47C 2OL3B 2CO4A 3F12A 1SMOA 1X6LA 3CZUB 4FJ6A 5KVFH 4DP1X 3VD2A 5CZXD 3WELA 1SM3H 5FOBB 3JVFC 3PU7A 1QABA 3TA3D 3MLUH 3QJHA 4UT9A 2F74B 4C56E 1ASOA 4K3GA 1DZ0A 1G4MA 3F2LA 4WTZA 2IBGA 3EFDH 1IL1A 3RWFB 4L8BB 3TFKD 3BRDA 4HXBH 2WSDA 2D3NA 3BLKA 2XUWA 3WFHA 5KANG 4JZOB 5HDBF 1NICA 4QHMA 2MEJB 5DD0L 3TXAA 4D0CA 1X6NA 5AOIA 3P02A 4Q9RH 1UKTA 4LOFA 2PMZA 4WI9A 5MEOB 2BLFA 3OKEA 5J13B 5IMOA 3B7RL 2W91A 1GC1L 2XIDA 3UPRB 3DX9A 1U0QA 4MA8L 4JO5A 2FIKB 1ET5A 3UERA 4JLRA 2VMEA 3H42H 2ZONA 3HZKA 4TSCH 1K4CB 2ROXA 5I1JL 1OQXA 2ITCA 2RAMA 1WP6A 3KCPA 4KBPA 4FXTA 4LBAA 4JJ5B 3SDAA 2CHNA 4ODTL 2ALWA 3S8FB 1KFAH 3IE9A 43C9A 1J0IA 2VSDA 3WEAA 4I5BB 5E8NA 5IBLD 3B5TA 4KQ4L 3CK0L 3ZYOA 1DBBL 1QUNB 3MRKA 4PJHB 3JTTB 3IJSA 4DAGH 4FXLA 1LQBC 4X9FA 5E2UL 1QSVA 1SDDB 2WXLA 3KZ8A 2NNAB 4WZ9A 2HYMA 3VAEA 4IRSA 4J8QA 1D6EA 2G0KA 3LS5H 4NQXA 5DWUL 2DKMA 3UJJH 5DK0A 2HT2D 3D30A 1I4FB 1SVBA 1KFGA 2BS71 3QCVL 4YVUA 1JPFA 4DCQB 1IARB 4XPTL 3QXDB 2YD0A 4PYHA 5HPOA 4HJJH 5EA0L 3L9RB 3RI5F 4ODWB 4BFBD 4G80A 3KPMB 1ZS2A 5C6TL 3U4KA 3Q1SL 4G1MA 2EDJA 2IFFL 2A77L 2GJ6A 4UCFA 5E6IC 3MROB 3WIHA 4E41E 3H7BB 3NZ8B 4M4PA 3E3QE 1ACZA 3FKUS 3D05A 4LLQB 3SGJC 3S35L 3TESA 4HK0B 3SDYL 2WO3B 4PTUA 2YD1A 2YO3A 2Z0BA 3QJVB 5C9JA 1MI5B 3H53A 4JO8A 5DJ0B 32C2A 4F8LA 4PV8A 3SKNB 3DYMA 1ORQA 2IQAB 2R0LH 5D6DC 3U0WH 1N5AA 1CFBA 4N2MA 2EIJB 3N0AA 5E00B 1LO2L 4XP1H 2F1AA 2BY2A 3PWJB 4WV1A 5CHNA 5EB9A 4RMWA 3IMSA 4U3SA 1CD1B 1EMTL 5E7BA 5DC0A 4TOYL 2FIRT 4Y2DD 4FQIL 3R4DA 1LMIA 2ZSVB 3QHZL 4H8UA 4LU5H 5IZ7A 3AXHA 4L8DB 1S2EA 2IOMA 1R5IA 3LKNA 2OK0L 2ZWNA 4GS7C 4MNQA 3UPAA 1V3LA 1JXFA 2Y06L 4M6ML 1WCQA 4LHUD 4EI6A 2ZAIA 3VJ6B 5F7UA 3PPEA 1UASA 5KSVA 3L3OC 2VITA 5GISH 4LLUA 4ZMLA 5KBKA 3OMNB 1WC7A 1D9KA 3PHQB 3P40A 4HMDA 2DJSA 2CIIB 4I5BA 4U2ZA 2GJPA 3S34L 2F08A 4LLWB 4R90L 2AK1H 1P4IL 1PLBA 3Q2NA 2VWEC 5JYMA 3AT8A 4XMLH 4AIEA 3RUGF 5I1AB 1S7XA 1AI1H 1TJMA 3OWEA 2DYSB 3UTSD 5GZOD 1EFXB 3QUZD 4LP4A 5JIDA 4PB0L 2FJHA 3V4VA 3R1GH 5BXFB 2X7LB 5G55A 1E5CA 4UIKH 3O9WA 3DARA 4Z23A 3CFDA 5JPMB 5A2AA 5E4IA 4CC0A 5MEOA 2GFBB 2ZX6A 1R46A 2R9HC 2XDHA 3DHMA 2Y23A 5DUBB 3HNVH 1B3IA 4PJDE 2Z1PA 3ZDXB 2MPVA 4EKJA 1NGXA 2Q0ZX 4JFWA 4I1NB 4JFPB 2YAMA 4CW1B 3C6LC 3DVFA 2GJZB 4NQEB 1DQIA 3X1EA 2NXZB 3C12A 5EBGA 1TSHA 4M7ZC 3T2QA 4Y5YB 2P8PA 3FXIC 4MFHA 4FA7B 1H3UA 3H7LA 5CJOH 1DJYA 2GBVA 4BFEA 1D3CA 2VDNH 4ZFFA 4WJ5B 3RIKA 1SDYA 4GRWE 4GIOA 1NIEA 3SDXE 3VGBA 5KS9E 1KJ2A 5ALBH 2JI2A 2WLNA 5E0QA 1FIGL 4HFWA 3T4AA 3DX4A 1U8KA 3T65A 3WDIA 5MEQB 1AYRA 3VGAB 2CRMA 1WT5A 4X5WA 5BVPL 1LO3H 5B1CA 1GGIL 1BIHA 1D6EB 4OGXH 2WXKA 2FK9A 2W0LA 3EOAB 1SYVA 1J87A 4N2AA 2R0LL 1IGFL 4KO9A 1UD2A 3S6CA 4LVOC 4NX0A 4OF7A 2APFA 2BOCA 4JKWA 1UHVA 1H15B 4L3EE 2AAAA 3GSWA 2DQEL 2WXJA 4G6KH 5JHBA 3B8SA 5C0CE 5EU6D 1BAFH 1Q4NX 5F0PB 1QFHA 4MCYA 5B1BB 1Q1JL 1N0XL 1AQKH 3PY9A 5LXGL 1A7QH 3GTTA 4ONFL 3IFNL 4K9EL 2WOBA 2PW1A 4F91B 2D0GA 1A6VL 3PWUB 3Q48A 4HAKA 4I18A 1NBZB 3MLSL 3SOBL 1T0OA 5BNXD 2AXGB 1KPRA 4P99A 1CICC 3EDKA 4RLDA 1MNUH 3B5HA 1ZSDA 1G1KA 2JJVA 1KOAA 2EIMB 3SCMB 4F7EA 3T8XA 5KUKA 4KPHL 2XNAA 5DO2D 3BMVA 1LYQA 1HL4A 3P9WB 1F3JA 5D7IE 3UTSE 2BSED 5HDWA 1BWWA 3B6SB 3IXAA 4OT1L 1X5IA 4HCFA 1F2XK 4O2FB 4QRTB 2W9DL 1H3PH 2OYPA 5KEZA 3ZKND 2KDGA 2CGZA 5AUMB 1GOHA 4HQQL 4U3XA 1T1WA 2AABH 2XXMB 4HIPA 1AANA 4YDVB 5D6DA 4HC1L 3FU0A 4P5TC 3BIAX 3FTGB 3MREA 5FK9B 5FO8A 3MACL 1NC4B 4YHOH 1PZDA 1AD9A 2PYFA 3G6AB 3VH8G 1B4LA 1EH9A 1OM3L 1E90A 4O00A 4TYUA 3N06B 1MWAH 2DN7A 3JUZA 2XBTA 3MJ8A 1PS3A 3D4ZA 4IHBA 4KTDH 3U4EA 5CP3A 1AH1A 1NUGA 3GWJA 2F1EA 3FCTA 1NQBA 2GTWA 3NJGA 1QKZH 4GAYB 4JMNA 3RDTA 4LLDA 2A6KB 2ZT9C 5EBWA 1DSYA 2Z93B 3QUKA 3D4GA 3ZE0F 3FFCD 2Y7QA 2BIQA 2FNBA 5I1DA 4W6YB 1CDBA 3CD4A 1M9WA 5FFGA 2AMGA 2OA9A 1U8PB 3WY2A 5HHNB 3TYFB 1Z3GL 2APVA 1N5YH 1SOSA 2WP3O 3EO9L 3Q8BA 1B0GA 4N0CC 2ADGB 5D4HA 2R2HA 2XTJB 1WS7A 1A6TB 1CFSB 2Z7YA 4R4FL 2WLLA 2PXYB 4LASH 3L3OA 1T7XA 2PXYD 4KUCD 1D5RA 1HJBC 4IOSD 1JXKA 5C0DB 2ZIDA 3CFIC 3WNLA 3IDIA 4KKLC 1CLYH 3RA7H 2OZNA 2Y6SD 5AQ0A 4HZLB 4DVBA 4X4ZA 3TCLA 5ITBH 3QYCA 1NCCL 4X6BB 5A2IH 3UACA 4IEFA 3TOPA 3EYOB 1CQKA 4MNQE 3NABL 1G7QB 5LNDA 2Z7WA 4Z7NE 1BZ9B 3M1BB 3BAKA 2HB0A 4JAMB 4ZQKB 1XV8A 1HILA 1YEKL 3MCLH 3VWKD 3W82A 3H85A 3GMMA 1XAUA 5HJDA 3V0FA 1ZLDA 4U6HA 3HFML 7PCYA 4L1LA 1M05A 2GI0A 3HJ0A 3NIGE 1A02N 3TJPA 2EIKB 4DUVA 4IJTA 2AV7B 3ULAB 4YSEA 5AFAA 2XCMC 5CU9A 3OHMB 2XN9D 4XOCA 3RIFF 2XV0A 1HTYA 1L3WA 1XSJA 4DEPC 4KRPD 5KSAA 4QYOA 4P9ML 2C3WA 4UOW0 2K3TA 1BYNA 1RZGB 1LGVA 1G9EA 1XCXA 1NC2B 3VG9B 4OFYD 2IPUK 3WENA 3VDBA 4EVNB 1IV8A 3HE6B 3QNXA 2X0VA 2VAAB 1YN7A 1LXMA 3BWAA 1F3RB 4ODSL 1R75A 2IH1B 2GB2A 3PWPE 1E9PB 5E9NA 1PZ5B 3Q6GL 4HLEA 2XNAB 3JZ7A 3IJ9A 3RGHA 3ML8A 3WGUB 2EDEA 1I3GL 3KNBA 1NFDB 5A2LH 3B43A 3SKOA 1ZHKB 3ATBA 4FCHA 2EUVA 2DQFA 4TVPE 2VDPB 2GFBA 3L3HA 3BVWA 1NOLA 2PO6A 3PPSA 2AEQL 5HDBB 3V55A 4XE0A 3ZGIA 4H44C 2JQMA 2N3JA 3ZOAA 3IMTA 1M71B 2HRPL 2WKGA 4W9KC 4ODXA 5GRJH 2WUBL 4Q6IC 4Q4EA 4B9KC 2BSBA 5D2NC 1UEMA 1OP4A 2GC4C 2VDRB 4NDMA 4X4XA 1T2XA 2D3LA 4PW9A 4LSVH 1N19A 2JKWA 1UWEL 1NEPA 3T8VA 2ZPKH 1S7UA 4G5AA 2EILB 4K7PL 4Q52A 1NLDL 2JXMB 2ADJA 3HTLX 2BW4A 4Y2DC 5KANI 4YDKH 2VMFA 3LPOA 1NIBA 1Z0MA 3K2UL 3L81A 3BEVB 3DUUB 5HGGS 2X9XA 4HFWB 4ZS7H 4LDOB 2PWFA 2HKFL 2ZCLL 3W0WB 2VZUA 1HSAA 4LDLB 5CGBA 1DJHA 3P3RA 4AQAB 4C55A 5D5MA 1OAUH 1EEYB 1PLAA 2NDFA 5E5UB 2XQ0A 4DK6A 2AV7A 2YOAA 1MCDA 3R4RA 4MNGA 1J18A 3H3PL 1F13A 2GHZA 4FTVE 3SQOL 3VCLB 1M53A 2B2XL 4IOIB 1OAQL 1A1NB 2P8LA 4LIQE 4Q9CA 4PLJD 5FK9A 4JPVH 2NW2A 3QJRB 4LLYA 3PWLA 3IJ7A 3QK0A 4J3OH 3QUYD 3BAYA 4XC3L 1SLVA 3CN0A 1IEBA 1N18A 2HAZA 5DRNB 8PAZA 3BUDA 1XSIA 5EZIH 2GY5A 3IYLW 3FUHA 4QTIL 2R0KH 1ZE3C 4YHML 4XMPL 2NXYD 4GMTH 4FYSA 3FYIB 1ANUA 5I6XC 3Q06A 1K6QL 3NZUA 4I4WA 4ZG1A 3ABKB 3JUYA 4MHHG 1X7TA 1ZMYA 2D4FA 2K9FB 1KG0B 1KY6A 2FATL 4AYID 1BBJB 3KPNB 4JJOA 2Z4QA 4F33A 2DQFB 2BP5M 1RUAH 1MW0A 1NCJA 1VGEH 5JOPE 2FQFA 3V4UL 3H42L 43CAA 2ZX5A 3WUZA 4KV5F 4R0LA 1KXVC 3TN0A 2AABL 4KQ3H 2CBQA 2VMDA 5A2CA 2NNRA 4WIQA 3ARBD 3D2UD 1PMYA 4J3WA 1ILUA 1EZSA 3P4NA 1R9FA 4NUJB 1JZEA 3OLIA 4IBVA 1JXGA 4M3HA 1XF1A 3ENEA 3IGUA 2EXYD 4JQVC 1WDAA 4NC1C 1WGVA 2B39A 1I8KB 3UG4A 2YN3A 1RUML 5BS0E 5J56B 4AM0A 4UQ9A 2HRGA 3GF8A 1L9RA 3KPRD 3QISA 3FRUA 2E76C 4QGYA 1UOLA 2DQIH 4HH9B 2RCSL 4P4KC 2G3MA 5J1TC 1B6UA 3GMQB 3LY6A 3VM5A 3O4OC 3PGFH 1VKXA 4TNVF 3MV11 2VUOA 5DC9B 1G6RA 2BO0A 4JFYA 3S37X 4PJ7E 4BUHA 3ARRA 3V10A 1UZ6E 5BZDB 5D5MB 4TNWK 5E9DD 1N64L 3P3UA 5T1DL 3U48A 2QPSA 5DMKB 5JZ7C 3EJQA 1A7OH 2DZEA 1U8QB 3RWEA 1OB0A 1A4KA 1CWVA 5CLXA 3S3SA 2NNXA 4JL1A 1KLGA 4XO4A 2O6FA 2BVPA 3V0VB 1CICD 1F8TH 2DV6A 2VLRA 1HVXA 2WWOA 4EMZA 4X6EA 2ATKB 4DVRH 3H9ZA 3ZYIA 4B9GA 1DVXA 1B2WL 1U3HC 3SDAC 3WCYA 4W4OA 1BEYH 3F7YA 3HN3A 3IU3A 2ZKXA 5DEGA 4Z7WE 3QA3B 3LEVL 4LSDA 1ZHNA 1LO5A 3HG1D 4YFDB 2PR4H 3GXIA 4IHOA 2W95A 1JZ4A 3WEXA 1ZLWK 3MNWB 5BZZA 5DJDB 4HPHA 3D39A 1BD2D 2F5AH 3HN8A 4MZIA 4U1LA 3U79A 1ZWIA 3TBVA 4MMZB 4F33B 3O3UN 4B9PA 4YDJB 1KCUL 3LX9A 3PFQA 1QSFB 1PZ3A 4NRXA 5AAWA 4NPYA 1GOFA 3V0AC 5ECJE 1W0YT 1URIA 4AV4A 4YDNA 4A66A 2D2CC 1S4IA 2RALA 2DYPA 4BXVA 1KCVH 1OAXL 2ICWB 3HMWL 4MLSA 4YHPA 3SE9H 4QRRE 1TQCC 4U31A 3JYCA 5HPMA 1J11A 3DTDA 3F7KA 1AR1D 2OMYB 4FXKC 5AOKA 2KDYA 1R0AL 2XZAH 2P3YA 2PPEA 3MLVH 2IXQB 2GK0B 4ALAL 4JN2B 1PFOA 4RGMC 2WVVB 1FGVL 1JGVH 2WZAA 3QWQB 5H8DA 4K8RC 3OZKA 1MXDA 3LDBB 3O45B 1F6AA 2EIZA 3VWJC 5EU7E 3T3MB 4M5ZH 4G7QB 3NEEA 1NIAA 1IKOP 2NY6B 4GAGL 4NCC2 1RPQA 3T0EC 5KSAC 1JYNA 3S3JA 3MV01 4IBWA 4K4KA 2IH8A 5GJTL 1NGPH 2J2ZB 4OJAA 1IBZA 5EO1B 4WU7A 2B0SL 2PCPB 5IG7B 3VI4E 5CAYB 1RZ7L 4HIXL 1I7RB 2HJKA 2CMRL 4XPAH 1N4XH 4QY8B 3UTZA 4YPGA 2D03L 1LMKA 2BHUA 2FSEA 1CFQA 1LO4L 3BUBA 3FQ2A 2YGPA 1BEXA 4HFUH 5AB1A 2MPAL 3WKYA 4JUSA 3V0WL 3V4PL 5KS9F 5K69A 4P46C 2V3DA 5FB8B 4Z7UA 3QG7H 2C3XA 1OE3A 4LSTH 3LQZA 1H3VA 4RA0C 2Q86B 4G6MH 2N7BA 3MRQA 5I1IH 1ZDSA 5LBSL 4R4BB 1EX0A 1X5KA 4PRHB 5HYJD 5CNHA 5CJ8A 3BEWB 1WFNA 4I4WB 3WN6A 3MV8B 1TKWB 4M62H 1MHEB 3M7FB 3QPXH 3KL3A 1GCFA 2AJSL 3NN8A 4ORGA 5HTSA 1FCCA 4X5QA 2CDFB 3G9VA 4ZTEA 4RRPA 2B1AL 1TETH 3AU1B 3DTXA 4KRPC 3RTQA 4AGNA 2CCVA 4IOFD 4I18C 5FAAA 1ZTMA 5GS1C 1HESA 5SX4H 4HJ1A 4XNUH 3GTVA 3VQMA 3WEMA 2Q8BH 1GAFH 1JFHA 1S78D 2IC2A 4KRLB 5LUMA 4FABH 4NAMA 1HZHL 5KJ4A 2QJDA 4OD2A 4XX5A 4KXZI 2RD0A 4NJAL 2VLJB 1L6XA 2BP0B 1G87A 3FFDB 2BNRD 4M6NH 5DK3A 2GIYA 5CWSA 5DEJA 2I07B 4UDUB 2MRYA 3NSXA 4GKOA 5FHAH 1N0XH 1QPKA 5D2NB 3W5NA 2WHVA 4LHQB 5I8CB 5AB0A 4HKZA 3DDFA 4V1DD 3P77B 3GFUA 3ZMRA 4OF8A 4ESKA 4HS3A 4F58H 2ITFA 3VI4A 1GOGA 5IQLA 4F24A 3WHE1 1G7LA 2SEBA 4LE8A 4Q89A 4Q9QH 2ITDB 4PJCB 1FNFA 3D3VD 2WZ0A 2FX9L 1F3DJ 4I48A 3NVQA 4U33A 2EE6A 1TNMA 3ARSA 4Y5XB 4Q6IA 5D6CA 4KRMB 1ZWIB 4H0IA 2C3GA 2Q5BA 4HA1A 1FBIH 1W15A 2Z7UA 5CZXC 4FQXD 4PCKA 1QLRA 3DECA 4I87A 2YJLA 2KZWA 3OAUH 3PDOA 2N7AA 1YG9A 4WWNA 4WHCA 4M8QA 1V7NL 4AW7A 1TVBB 3ZR6A 3UTTD 3VXUA 1FYHB 3H2QA 1M3JA 5HY9A 5DEGB 5HYJB 1F1DA 4FLOA 4H25A 3JV4A 4NEHB 4OZ4B 4XNAA 1SF5A 3JWDC 3Q5TA 1JNLH 2AF2A 4TSAH 4OV5B 3STLB 4F8NA 1YDPB 1DE4A 4QHLA 4KXZH 4YS4A 3RVTD 1ICTA 1KJVA 2X1OA 4PP2B 3A6BL 1ZLWH 3WUWB 5H4ZA 1K2DA 2LU4A 5CEZL 3MODH 4PLJC 5JHLA 1WFUA 3IGFA 2NTFA 4MHHI 2VXSH 3RAJH 4N0YL 3PIQB 3GMNB 3HKFA 1ETB1 1C16A 3VYPA 5TPWL 3WAKA 5DI8B 1U8LA 3SYCA 2UZXA 3U6RA 1R6VA 3GLDA 3MA9L 2WLZA 3LKPA 4MCNA 5DVMA 5AZEH 3P4OB 4QHKI 3U46B 3RWIA 5DA0B 4BKTC 1Q0XH 2OMTB 5DURD 3CBRA 3VMNA 3L5XH 4HUNB 2XX1A 4BM7A 4BFIA 3RBGA 4NNYA 4PS3A 5CEXA 3B9KC 3VFTB 3FO2B 3NH7H 3H9HB 3IVKA 3MRJA 1UM5H 4FLHA 4V1DE 1LWJA 1NCAH 1GH7A 2YC1A 2LR4A 2DAVA 1SMDA 3ECUA 4I3RL 4JQXA 3MMEA 3FU9A 2PTUA 2DQCH 4EAEA 5JIIA 4P4KB 1V8HA 1VEMA 5DUBA 4MQ7A 3JWNC 3QEQB 2APBA 4ZUVB 4TOYH 4GAAA 3NJJA 4JANB 1I4FA 3RY5A 2D2OA 1QNZL 1RZJH 5F72S 3BXNA 4HGWA 3CZJA 4M93C 1T04A 3J8F7 1MREL 3NYKA 4NJ9H 4TQHA 1E40A 3FUKA 5HGAA 4D8PB 5E95B 3MLRL 1JK9B 1WFMA 5T3XH 2GSIA 3QFGA 1TOXA 3VFRA 1NCOA 2IGTA 3GK8H 4G7SB 4LQFL 3ALXA 1TEYA 4X6DF 3JTTA 3EDFA 1CD8A 2OS7A 1XR9B 3BH9B 4G1EA 1I9JL 2E7HA 3QFJB 3SO3B 5JXAL 3E9UA 5DCCA 4EBQH 4HUMB 1UFUA 2M1KA 3HC4H 3W1ZA 3O6FD 5FO2A 1MNNA 1A6AA 1T21B 2NZ9D 4PJBE 1UA6H 3H6JA 4MA1B 1CBVH 3KHOA 1IBBA 3BI9X 4KDVA 4ONOA 4WWKA 2BVYA 3V9EA 2GBUA 1WE5A 1CR9L 4JRXE 3RZCB 4NKOB 5EEZA 2OXGA 4WJKB 3ZE0E 1QR1A 3GHBH 4LARH 4G7VL 3REVA 2HLFC 3C9NB 5D96C 2BVQB 3D69A 3SYOA 1T5WB 3MU3A 4WNQA 2EH8L 5DFWH 1PJ9A 5FA4A 4GBXA 3BVDB 1UXWA 1CLOH 1KYFA 4HIJA 2YRZA 4GKLA 1J9TA 3PYCA 1E6JH 1RUPH 2ICWI 4MJ6B 3WE6A 3G5ZA 3G6JA 3TWCL 2F54A 2X4UA 4NN5C 3N44B 5SWZE 2CDGB 4LEOA 3H2WA 2NXYC 2BIMA 3VXUE 3ZL2A 4L29A 4M61B 4MJID 1G0YR 1P5VB 4JQXC 2OAAA 1NM4A 3E6FB 3NK3A 1ZT7A 3HE7B 3LS4L 2VQ1A 3BZFA 3ABMB 4XPGH 3US9A 4AUYA 5DLML 5ALCH 1OHZA 4IOIA 1NAMB 2DKSA 2IWFA 3QNYA 3BPLB 1DQLH 2CDEA 3BJLA 2ZAGA 3M88A 5LO7A 1A14L 4DKTA 2BX5A 3ARFB 3E9TA 2OULB 3B7YA 5L2KB 3L3DB 5IESH 4XXDA 2P8PB 4EOWH 1N67A 3AU0A 1R3HA 3NJKA 4RMTA 2TRYA 4X5LA 2VLJA 1BOGA 1U91B 1T03H 1WRFA 2PYEE 1ZEAH 4Q7DA 3EH2A 1ONQB 5AOZA 4XC3H 5F96H 3UROR 1T4KB 1AG6A 2WANA 4QEGA 4QRPA 3ET9F 2FR4A 3O6KL 1MJ7L 2HT2C 3APCA 1RZJL 4E9SA 4EDWL 2OR7A 3U2SB 2VDPH 1H3TA 4ZMTA 1UCBH 2F61A 2EO7A 4L3EA 4E9XA 4Z7QB 4YHZL 1S3KL 4KDWA 4UF7C 4OLWH 1DEEB 4ELMF 3IDYC 4BH8B 4Y1AA 4KK5C 3C60A 1CGWA 3OKMB 1B6DA 5F7LB 1UACH 3QDME 2H26B 2X4TB 2NPLX 2JTDA 3CSYA 5DK2A 3NZSA 5LVEA 3BSZH 2R2HB 1JGLL 2W60B 1KCSL 4A7TA 1UXSB 2UY6A 2YUZA 3RWDA 1JS4A 4JFSA 4A6YB 4NQEA 2P52A 3ZY7A 4YEFA 4JPKH 1VADA 3S96B 3IB4A 3C08L 2YARA 5IEKA 4JRWA 5L8JB 1J8KA 2H32B 3BH9A 1DR9A 1U58B 2Y5TA 5CEZD 2FT6A 4PJAE 2C7FA 2YK1H 4KKZA 3GMOA 5C3IA 3P4MA 2AJUH 4OCLC 3VFTA 3HFFA 5AAWC 3WKMH 1HOCB 1E6OL 2YJQA 4XBEL 4F15B 4X7DC 4LO9A 1XH3A 4S0HA 4NQXB 5DEFB 1ZHBB 2EE2A 3ETSA 5C09B 4MAYD 4FQXB 2BSRB 3MRIA 4UQIM 4TUOB 3X14B 3HB3D 1YHPA 5IFHH 3CDZA 5C3TA 3QEQA 2R2CA 1JF6A 5GGSY 2ADYA 4GW4B 3NRPA 4H5SA 5ISZA 1LK3H 4MMZC 1U8PA 3QUGA 4YDVA 3ILPA 3OVUB 4A37A 1M56B 4O2EA 4GKZB 4OQTH 2FQGA 3TC9A 1L7TL 1BQLH 4S1DC 4HK0A 1CDCA 2JKJA 1EBPA 1WFJA 4WUKH 3TA3C 1NAKL 1SUHA 4IKNA 5AL8A 4I8DA 4P57B 2F6AA 2FD6L 5K9KA 4BHUA 3K8LA 3T04D 4UQ3B 4LESA 4P3CL 3EG9A 3RUGA 4CVXB 1ZHNB 4NZTH 3L5JA 1FFOA 1W8NA 2EYTA 3IAGC 1BJ8A 3DPDA 1P6FA 3KJ6L 1DZBA 4WW2F 4CBZA 4I0CC 4N6RB 1RJYB 3C5SA 3F85A 3MJ9A 3O2VH 2VXUH 4M1GH 3VDCA 2BFGA 3CJJA 1L4IA 3P3SA 5SX5H 2ZXQA 3AAZA 1KBGH 3D25A 4QT5A 1E9QB 2E9GA 1ZK9A 1U8HA 3LN5A 2GUOB 1KGYE 1A6TA 1CFSA 2NYZA 2OZ4L 1P7QA 1YYML 4KNQA 3INUH 5GS2H 3E8UH 3WFEH 1UCBL 1I1AD 2IWEA 4WENB 1A2YB 5HHNA 3TYFA 1OPGH 3VX1A 5D8JL 5AKTA 2GJ6B 3P9LA 3LIZH 4DTGH 2P5ED 2HFTA 1KY7A 3MOBH 5E2WH 4ZW7A 1EZLA 1K5NA 3FQWA 4V2BA 4J3OD 2QVIA 1GVIA 5DD5H 1FZJA 1NCBH 2BNRA 1VZIA 4A55A 2EUXA 5EBMA 1BSIA 1GGUA 4A1RA 3GSXB 1Z5YD 2AHIA 3SE8L 4LCUB 3DI3B 4QHNB 5HDQH 1PQZB 5TF1H 3OXRA 3ZL4H 5JLZB 2FO1A 2EJ1A 3UPRA 3QJFA 3C08H 2ICEB 4Y4FA 3KXFB 4XMXA 5F7DB 3IMBA 3CQQA 2C1PB 2EKSB 2KLSA 4HJGB 4OIBA 3FU7A 4FYTA 5ICZB 2XOTA 3WS3B 4EI0A 5DTFA 2IV9A 4NZFA 4OZFA 1PG7H 1TJHL 4QLRA 1TZGL 4PJ9C 1R3LA 5HHMB 5DUJA 3WTVA 2BSEA 3WTYA 4PR5A 2EC9U 5TK4A 1QEXA 4JHAL 2V5RA 4ACPA 1C8PA 4UTBA 4KWUA 4HGMA 1UB6B 2MPAH 4BK5A 4PRNB 4H8WL 1L3NA 4E68A 4UDUA 1AHWA 3FN0H 5L4MA 3JQOB 1FF5A 2NY1D 4IK7A 2Q8AL 3CHPA 3UJTL 2BSTB 1FL3A 5I1AA 3G7TA 5C70A 4LSTL 1TT6A 1LO3L 1QLEB 4ADJA 3VA6A 3LB6D 4CNIA 2XQBH 4HMCA 1O6SB 3OPZH 4M62L 5HD8D 2D9QB 4PJGF 4Y9EA 4GIPD 3VSQA 4K5LA 3BT0A 3VVWA 1SOKA 1SXAA 3ZQ9A 4Z3JA 2VIRA 1S7RA 2WLIB 3EFOA 4N1CA 4WU7B 5C0GA 5F6HI 5EFIB 1WAPA 4EDXA 3ARFA 2CPCA 2WMPB 3H3PH 1TLMA 5L6YL 3HN5A 1F86A 2FH6A 1BZ7A 4NO3A 3C6SA 3V4VL 2YPVL 1TJXA 4XC1L 2XI9A 2OL3L 3IMVA 2NZ9C 3BW9A 1JG9A 1UKSA 2FRGP 3IDNB 1AGFA 3N41F 4YE0A 3AJ7A 2W59A 2A1WH 4PJIF 2EDKA 3VXRA 3MR9A 5DEFA 1OZUA 3WLWC 3HPJA 4UNIA 5CCJA 5F3HA 2Z35A 2BNRE 5GGUA 1RZKC 1MVUA 2ICES 4N0CD 2BWQA 5ADOL 4O2FA 4YBLC 3BAEL 3EDJA 3ES6B 3FSVA 2AGJL 3NN8B 4ORGB 1WSST 4Y5XA 1A8JH 1T20B 5DC4B 4IK6A 5CJQL 4ZMAT 3HCVA 5IKCA 1IBYA 1P84J 5GIRB 4CJ0A 2VLMD 1MHPH 4WLCA 4NXKA 3SZ6A 3WMQA 2LFGA 4RDBA 3GRWA 4B0MM 2ZCHH 2OMWA 5CS7A 4A39A 3EGXA 4MA3B 3IBOA 4AGQA 1F4YH 3O2DL 3QUYC 1MFAL 4FLQA 3ARTA 1EJ6A 1QI4A 3PDDA 4BUGA 5TDNA 1IKNC 4GFTB 4Y4HA 4WQOA 1AO7B 1DBML 3TT1H 3HUJF 4NFBA 1ACCA 1AO7D 4X7TB 4B6ZA 5A3ID 1VERA 5GS0C 3OD3A 4WSJA 3BFWA 3AG2B 1IC5H 1YUKB 4K9EC 4C4BA 1VCBC 1O5PA 3NCYP 3P54A 4KI5D 2A5UA 3QUMB 4V2CB 3MYZA 5CBAB 1KIPA 3CHSA 5KUMA 4RIRB 4YDJA 5JUEL 4IBLT 3FSOA 3UTOA 3CHXA 4OJFH 4H8WH 3ZHDA 3FSWA 3L6FB 2QT6A 3G08A 2V7HB 3RG1C 1FP5A 2ODHA 3VCLA 5B4MC 1H5BC 1UFGA 3NACH 2VISB 2XTSA 1I7ZA 2C3VA 3WHXA 1QUPA 4UTBH 4U7KA 2ARJA 2O5XH 4Z95L 1EAPA 5GGQL 4G8IA 1MFCH 1LK2A 2H3NA 2HT4C 5K9OA 3TJEL 3ULVH 2OCJA 5I6NA 3KDMA 1NL0H 4FNRA 4OD3H 1AKPA 1IJNA 1NAKH 1DBKH 2HTKC 3P73B 3D0AA 2WUBH 1OY3B 1ZLSH 3ULUC 2F18A 3L5HA 4PGCA 4ANUA 3M1CA 1J5CA 1J1XL 1DLFL 2C1OB 2G75B 3S2CA 4KQ0A 2PW2A 5I1KL 4F7PA 5KOVC 5LQBL 4NQDD 1M05B 1LP9F 3H8NA 2GIMA 4YNYA 5E99H 5DMKA 3T2PA 1E3ZA 3O4LE 5D1XE 4KDTC 1XT5A 4H88H 2HUHA 5IBTL 3RGVD 4IGBA 4LHUB 1G6RB 5C08D 3EKCA 5AYQA 3OF6A 4KI5E 1OCCB 3DOSB 3F58H 2ADGA 4NNPH 5HJ3A 1XR8A 5C0FA 1FNSH 4WI3A 4Q2ZA 2A77H 3OX8B 3MRMA 4CSTA 1LEGB 4UOW1 2NOYA 4ZTPH 3B2VL 3RWGB 1M3IA 1IM9D 1HHHA 3ETTA 4UANA 1D5MB 1PEZA 2X4NA 5I18L 4NZRL 4QHMB 1JV5B 3AB0C 2XV3A 1ZANH 3GRGA 1U4EA 4P5SA 2E75C 4GMTL 3CFUA 4UYQA 3G04B 2XIBA 1IQDB 2OMXB 3DDGA 2GTWB 4N8VG 4NQSA 2OPCA 4TSBL 1RHFA 2ENPA 4CSSA 1G6RH 5E6ZA 4ES9A 3U36B 2YS4A 4OCXH 2OTUB 2LE9A 4ZX4A 1ZVHA 1AE6L 4XMKL 3ZR5A 1HCFX 4LCUA 1WYJA 4Y9BA 3VXRB 4XVTL 5DHEA 4ZRGA 3VG0L 3UJIL 1U21A 2BNQA 2A6KA 3BQUA 3KDPB 5FCUH 3E1ZA 2FHCA 2YPKA 4HWNA 3V0IA 2X09A 2VMCA 3MNWA 3X17A 5C0IA 2XVKA 1RURH 1K4CA 2F58H 5FX3A 3DSFL 3VB9A 4JK0D 3LCYA 1T04B 3DMMB 3QQ3B 1BQHB 3IEAA 3ZMNA 3GHBL 4BQBA 3E0GA 1ADQL 3MV7E 7PAZA 4UQAA 4N2CA 4CDHA 1K4DB 4XZUB 4R97B 2JKLA 4L18A 4F80A 3OMIB 3BWUC 2NDGA 4KV5E 3TLRA 1AZCA 4GRLC 2OSLA 3IDMA 2FO4B 5CEYA 3PWVB 1ZT1B 1RUPL 1Z2KA 1T66C 1J9QA 1OP5H 3O45A 4YZFE 5D7LD 4PB0H 2MOVA 4GUPB 3O3EB 1JZ5A 2UVEA 3VB8A 4JGMA 1CL7I 1UWGL 1MXGA 4AENA 4XMTA 4S11A 2KT6A 3U82B 4HKJA 4TS6A 5JHDE 3T0ED 5BUPA 3BZEB 4WTWA 2KPNA 3DV6A 2NTSP 3UH8A 2OR8A 5CR1A 1CC3A 3LRSB 4RBPK 2Y0SA 3TONA 2GTZB 2C3VB 2W0FB 2Z92A 1YYCA 1SXNA 3VFUB 1CZ8L 4CC4A 5IW1B 3MQIA 4KJWC 1RFDL 1S7RB 3EFOB 4N24A 1B2WH 3L6FA 5EEVA 2NX5E 2H1LM 4AVIA 1OB1A 2OSXA 2D7NA 2HLAA 4KY1H 1KELH 4ENZA 3IFLL 3FUNA 3WIIH 1HHHB 4RGND 4PJ9D 1XSKA 1XB8A 4F2MA 3OKDB 1SQ2N 4JM2A 2UXGA 4LLMB 2HN7B 2XA3A 3EJYC 2OV0A 1YEKH 2YPVH 3HR6A 4FZ8L 2VT0A 2NYYD 2Y7SA 3QXWA 5ALBL 1XGQB 2P24A 3SYQA 1IT9L 1RZ8A 1WAAE 1R5IB 1DCEA 3LKNB 4FP8H 5JORB 4NQCB 5TDOB 5L9DL 3U0PA 3UTQA 1EGJL 5EF0A 1HYSC 2UWEA 4GG6B 4G6FB 3AS2A 1DSWA 4FYQA 3BQUC 5IQ7L 3S9DB 2HT3C 3F7RA 2J8UF 2NY7H 4PJXE 4FNPA 3ISYA 1D9KD 3BZFB 1XR8B 2OW7A 1U2HA 3D8MA 3GBML 4QCIA 3RZCD 3X3FL 1QTSA 3SDAD 2QQKL 4N2GA 4OZIE 3HIZA 4OF6A 3DYPA 3BN9D 1JVKA 1Q72L 4MJ5A 1A7QL 3TTSA 5JNYB 5I23A 2AQ1A 1BVLA 4R3SB 4JPVL 4TNEA 4AYGA 3ELQA 1FAKT 4LIQH 3HRPA 4L3ED 5DRNA 4P5MA 4QKXB 3RVXC 4NOBA 5J12C 3VI3A 2G3NA 5C7ZA 1U95A 1XO8A 1A66A 5C92A 2NY0D 3LZPA 4IEFB 3T4AC 1KMGA 3H9YA 2IJ0C 2WJ5A 3QZWG 1A9EA 4PLKD 1T3FB 1JE6A 3DPBB 4P23C 2FWSA 2FL5A 3L13A 1JNLL 4XMWA 1QFWI 5C09D 3TEXA 1WTGT 1KF9B 3QFDB 5E5LA 3QDJB 4LDCA 4GUCA 1KGUA 4WTXA 5MHSE 3VRJA 3LNFA 1PY9A 5E2UH 2VDRH 4D7BA 5KVDH 1OF2B 3OPUA 5D1ZI 4HC1H 4L3CB 3NA4A 1K9TA 1B0RB 4NC1E 3ZKMC 5MERA 1WWAX 2DIJA 1EAQA 1U92A 4R96B 4UM9D 5KYWA 2XWTA 1D5MA 2X4NB 1QBMH 2AVGA 3DV4A 4YUEL 1BFVL 4H25B 1LEIA 3MJWA 1YECH 2ESVB 3FTUA 2YPLE 2EUZA 2B5IB 4BHUI 1ES0A 1KTCA 5C71A 1SN0A 4H0LC 3KPQB 4KNUA 4U1GB 2JTYA 4OD3L 1DBJH 3EXLA 1J05B 3VRIA 3VGDA 1TQCB 3BAIA 1XCQB 5EORL 3GO1H 1NKRA 4GIAA 4KX7A 3LEXB 4ORZC 1FZKB 3SDDD 4NRZB 2GBTA 4D0BA 4APQD 5E7FA 1OAJA 1BQKA 4KKNA 1AHMA 1M4KA 3SKOB 1Z3GH 1HQ4B 2A73B 4PJEB 1JAEA 2XN1A 3D85B 4JFPA 3IGAB 3GEFA 3Q8CA 3QZBA 5LCVH 2BZDA