2IIJA

Structure of human asf1a in complex with histone h3
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
156
structure length
156
Chain Sequence
MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHINWEDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASF1A protein
publication title Structure of the histone chaperone asf1 bound to the histone h3 C-terminal helix and functional insights.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 30
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2006-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04729 ASF1_hist_chap ASF1 like histone chaperone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 2iijA00
4ZBJA 2YGVA 2I32A 3AADB 4EO5A 1TEYA 2DZEA 2IO5A 4RRPM 2Z3FA 2IIJA 5BNXD 5BO0D 1ROCA 2Z34A 5EIIG 2HUEA 2CU9A 5C3IA 2IDCA 1WG3A
chains in the Genus database with same CATH superfamily
2E7MA 2Z1PA 4GQ9H 3ATEA 4PLNC 3CCHA 4PTTA 3OR7A 2V3DA 2AF2A 2CHDA 2BY3A 2ITEA 2BVQB 3LVEA 5IFAH 5IWLA 1GHFH 2FQFA 2OMTA 3QEQB 2XTJD 4CNIB 5K59F 1LJMA 1XGTA 4I77L 4U6XA 4ZMZA 5FHBL 1JXFA 2LOEA 3QZWB 4WW1A 2QZQA 1FI8C 3FQ4A 4G7VL 2A77H 1V8HA 5HYFA 2ENSA 2CHNA 3BP6B 5LGHH 3OAYH 1WGVA 4RFEA 4S1QH 5JW3L 3MUUA 3MRDA 3QPKA 2XPGA 4F3FB 4NI6A 3X14B 1U8MA 1F1DA 5E00B 5I1AA 2EVJA 5A3IC 2YA2A 1OIOA 3T8MA 5GRYA 2XG5B 2ZCKL 1UACH 2R0LH 4X2UA 4ZS6C 3KZ8A 1TZ8A 2GFBA 3EFOB 4BFGA 1Z9SB 4QD2E 2Y69B 3T4YA 3UEQA 3BQVA 4F15B 4HLEA 3KMDA 1EWHA 4X7EC 4FKEA 2CDGA 3NSDA 3FOMA 5ETUB 4XOBA 3RDTA 5DC4B 1FHGA 1EZLA 1U2CA 2ZPKL 4NPYB 2Z65C 5CD5D 4P3WA 4P0DA 1Q9WA 4BEIA 1ITBB 2ESVD 2XJLA 1L7TL 2XWRA 3L3JB 3ZYIA 3I75A 2KC0A 1JGUH 3GZPA 4FMFA 4O2CB 4M1GL 4MAUL 4NHCL 3X3GH 5HJGA 5SV4A 2DQCL 4MVBC 5ICZA 2WYHA 1K2DA 3OX8A 3MRCA 4G7YH 3QHFH 1NGWA 1TTAA 3IFOB 3F6JA 4L4VE 1UWEL 2GYSA 1TPXC 3S4SG 3UJJH 2WNXA 3SCMD 4OJYA 3HAEG 4QHPA 4PRBB 5L4JA 1IFGA 1AOHA 4HQQL 1KV7A 1J7VR 2WBJD 3HN3A 1B2YA 5DVOA 4IKKA 2NQCA 3QQDA 4LL1A 5I8KH 2PO6B 1J87A 5HGBA 4WUUD 4G42A 2M2DA 1JPTL 5JA9A 3KEHA 2YRLA 4WFHE 1ZLSH 2ZUTA 3RB7A 3ILPB 3E2HB 5CZVL 3SE3A 3WMQA 1T1ZB 4MDIB 1OLLA 4X5QA 3M1CA 1XZ0B 5T3ZD 2VLKE 5FF6B 3MNVA 5D5MB 4OF8A 3TNMB 5KG9B 4XN7A 1TJGL 3GQFA 1NIEA 2E46A 3FF8A 1YYMH 1OB1A 4APXA 3MJWA 1ZE3C 3RWEB 4QHKI 2ITFA 2C9VA 4ERSL 4U1IB 5E7BA 1S5HA 2OSLB 3HBZA 4LPYA 3CZLA 3ZZSA 2O61B 1IM3A 3IDUA 4I8DA 1BM7A 1WWAX 2AV7B 4P23A 2Y2WA 5L8JB 4H0HB 4QXWA 3ZU8A 3L3OB 3O6FD 3S88L 1J9QA 1IKNA 2ZJSH 3TJHD 5I6MA 2G3NA 3ORJA 2QQQA 3HRZC 4U1MB 3QNYA 5ANHA 4AIEA 1CPUA 3AWGA 3MV9D 5I1LA 1AHWA 3ZT6A 3WY1A 5IJDC 2BZ7A 2E47A 4OLUH 3EIFA 1C1EH 1GMEA 2EEXA 2ZKWA 4HLJA 3T0ED 1IGJA 4ZFOA 3SE8H 3K6OA 4ORGB 1AR1D 2VABB 1YEEL 4JPIA 4JO8A 4JW3A 1T2XA 2X12A 1SFHA 3O8XB 4KXZI 2VLJD 3CGTA 4WW2B 3ZBMA 4B41A 2UX7A 1HCVA 4TF4A 1KB5H 1T0NA 1YUHA 3L3HA 5FIEA 1I8LA 1BXUA 3EYOB 3JT2A 1H6TA 4I88A 4WNQB 5IB1A 2JJUA 4HK3N 5BRPA 5IREA 4QO1B 2F9BT 4E5XA 3MGOA 1I1AB 3T0AA 2ZAHA 1ADQL 35C8H 3JTBA 3PV6A 2BNQE 1P69B 4ALAL 1OHZA 2V7NB 3TX4A 4UM9B 4Z7OB 3OKEB 1NC4D 4ZNEE 3TEXA 1YG9A 1GS7A 2ZOKA 3SDYH 3V0AC 2AJVL 4XB7A 5AAMA 5C0ND 4NQTA 4UTCA 2XDHA 1NDGB 4IIQB 1MCSA 2P5PA 4HC1L 5E0QA 4E36A 4HD5A 2BWIA 3VGEA 4G8EA 1KN4L 1CDUA 1UWXH 3RIAF 1OAJA 4PD4J 3GLZA 3RVVD 2ZG2A 2XWXA 4RX4A 9PCYA 4UT6L 4BFJA 1BBJA 2VOTA 1MFDL 3EFDH 4S1SL 3V0DA 5JHLH 3MLRL 3JSSA 5AZUA 4JR9H 3HE6B 1AZVA 4D7BA 4NQCA 3VI3E 1OK8A 3IXAB 4XCFL 4DKDC 4NZTH 5I73C 4QYAA 5MEPB 1TNMA 1JFHA 3K8LA 4GUCA 1ASOA 1ZVSA 4J3BA 1QOKA 3FUHA 5IOPB 3QXAB 3PGCB 3V0FA 3DYOA 1XMWA 5BO1H 2YS4A 2IADB 3AT9A 1FGVH 2VDLH 2WLKA 1VADB 1UZGA 3BKJL 3ZN6A 2JH2A 3DTXA 5EWIL 4ESKA 1AACA 4KTEL 4ICXA 3G5WA 3QEQD 4IOIB 3OLGA 4ENZA 3L4WA 4MAYC 4P46B 4LL4A 1WS7A 5AZEL 5FFOA 4X8JB 4D9LL 5LNGA 2O6PA 2YD2A 1BQSA 3IU3B 4N25A 1YJDH 1ZVHA 2ZKYA 5D70H 5AYTA 4Y1AB 3CLFL 3T0VA 3DI2B 4FNSA 2IDTA 4CDHA 5DK0B 1JP5A 1P4LB 1C5DA 2HPOA 5F6IC 1BCIA 1UTDA 1U41A 2P49B 1OQXA 1B4JH 2AXJA 2CNYA 5B7EA 3THMH 1Z9MA 2EVHA 4PYHA 4P3DB 5HDBF 5ALCH 2XLLA 1T20A 3OAWA 5D2NB 5DUMH 2WZPA 5KEZA 1XR8B 4U4BA 1ILSA 1NFAA 2G9HB 4OFPA 5DURD 2Y1AA 4UIMA 3RZCA 1E42A 1HNGA 5DJXB 5E1AB 4EI6A 4JRXA 3SGKC 3N44F 3WTWA 4DP5X 4HK3J 2DWEB 4MA7L 1EO8H 3B56A 3NG5A 1E4KA 2B9AA 4FN0A 4Q0XH 4HXAH 3R7RA 3DIFB 5CLYA 5CD3A 4JRYE 3ISWA 3Q8EA 4TNVK 1URZA 2NTFB 4KNQA 2P45B 2WXKA 2OK0L 5AG9A 4PRIE 2EXYC 3LS4L 3B83A 4FMKA 3ZMRA 2KI6A 3C6LB 2OX5B 5E2TL 2BRQA 1IGTA 3OHXB 2GBVA 1TYJA 3BYTA 1MCPH 5C3TA 2I5YL 5TDOB 3L4XA 2FL5B 2FX9L 2QSCL 5EU4B 3UBXG 5EN2A 1T22B 1JZIA 4KY2A 2UWEF 1UVQB 4WTWA 5EBGA 2DTSA 1KCSH 2DN7A 3VXQA 3Q8AA 1ZHLA 3GHEL 3ET9F 4U1SB 4HJSA 1C5BL 5KJRL 4PTTB 4YSTA 3UIZA 3OR7B 3CN0A 5JQIB 4G6ML 3QO1A 3AC0A 4R7LA 4Z7UA 4IKJA 2PO6D 4P4RA 4F7MB 5A2KH 1SDAB 2OMTB 3LIZL 1JD9A 3WIHL 4XXCC 3CLEH 5IVNA 2NLJA 1J1XH 3DGGA 4RAUB 4EI0A 4I7ZC 1UWGL 2MWCA 1A9BA 3VD5A 3FU8A 1V7NH 3MRGA 2QLYA 1FFTB 3FO9A 4AGPA 5EORL 2NYYD 3LH8A 4NX0A 4QY8A 4NCC1 3OPZH 1XZWA 5HPOA 1J18A 2XPGB 4ZOCA 1VLXA 2FCBA 4LOUD 5DRNB 3FU7A 3TH3T 2XQYK 3DPBB 4DGWC 4QPEA 2VXQL 1BQHB 2QQLH 4RMVA 4W9DC 5LXGH 2A5UA 4LEXL 4N8VA 5DHVH 3WEMA 3TBSA 4NOFA 3ZX1A 2I7OA 2GSGB 3T4YB 4Z7WE 4U7MA 3C8DA 2CA3A 3ERXA 1BLIA 3AXLB 2EZ0D 4Z7AA 2CDGB 3GFUA 4Z0XB 3DHJA 4OF3A 1L0PA 4KITB 4H40A 1KCKA 3EG9A 1H3WM 2HH0L 3U7WL 4Q6IA 1X4ZA 4CGUB 3HI5L 1QLEL 1Q1PA 1MFAH 3FJTA 4F7PB 5EIIA 1ECYA 1XR9B 1AYOA 2VXSH 3MZTA 4XPTH 3V4VL 5BJTA 5KYYA 4J2QA 4FS0A 3HG2A 3IKKA 5JXAL 5GJSH 3QRFM 2F7PA 1CZ8L 1JPGA 1SVBA 2CIKA 3T2LA 3ZDYE 3MYZA 2XY2A 3L9EA 1RIVL 2IAND 4H13C 3F7KA 3CJJA 3BPLC 5LO7A 2ZUXA 1II4E 2WINA 2Z8VC 2XN0A 2WQWA 3HG4A 1K2DB 3OX8B 3PPEA 4ZUUB 3MRCB 2A6IB 5KVEL 1OAZL 1ZTMA 5DMGD 3S7GA 1I1AD 2IWGA 1QMUA 1T2QH 4XP6H 4NM8H 1Y1UA 4PCSA 1KJ3L 2ICEC 4PJHB 4UM9D 4FHKA 1OP3K 4AZ8B 1FAIH 4L9DA 2WO3B 2CQVA 2DQHH 3MX0A 3O0RL 4K23L 4ZO8A 3VD3A 4ZUSA 5ICYB 3D7PA 5IHWA 5D96C 4W6WB 3BE1H 1HZHL 3BSHA 3LD8B 1MEXL 1XHHA 4KUCD 4OCLC 3P11L 3TWYA 4PJCE 4N8UA 3EGXA 4ECNA 4G8GE 4J12A 1J0IA 1MN4A 2QSVA 4G42B 3T0DA 2UY7A 2WM0A 3F12A 2CBTA 4N2MA 3Q05A 1IFHL 4XE5B 4JZJC 5AW2B 2YRPA 5C2BL 1U0QA 4M7LL 5KS9A 2ERJC 4HUNB 5F9OL 3QHTC 1A47A 5T3ZH 4ZMXA 2JKXA 5KBMA 4PJFE 3QHZL 5IFHL 3MJ9L 1GC1L 4GBXD 3KPPB 5CWSA 2DLTA 3HE6D 1QSFE 3L7FB 5IHBA 2YR3A 4K2UH 3GSWB 2C3HA 4A2FA 3IE4A 3B9KD 3EHBC 4N8CL 4F2MB 1S5HB 3CQQA 1X5HA 2O6EA 1MFMA 1X44A 2XIBA 1IM3B 2H32H 5KSAB 3KCPB 3ZHDA 1F3JB 2WP3O 4P23B 4YHOH 4NZDA 1NOAA 2DTMH 5I82A 2IMNA 1CVSC 3INUL 4AIOA 3QGVA 3WXWL 1LP9E 4PVBA 1ZHKA 2FNWA 4KK8C 4PRPA 5A16B 5IHZA 2MTPA 2L0DA 4WI6A 2A9DA 4BZ2L 4PGCA 5HHVL 4Q9QL 4W6XB 4HGWA 4WO4A 4H8WC 4X6DA 4P46D 4FFZL 3ZDZB 1AHWB 5BQ7A 3S36L 1NUGA 1HCFX 2JJSC 3ZW3A 1IGJB 4MA1C 1U8HA 4E9SA 1HHKB 4Y1AD 1YQVL 5SWZE 5D7KE 4K9JA 4JPIB 2ZF8A 3B9VA 5C7XH 2JI3A 5I6LA 3SDCA 1MCOH 5JZ7D 1XF5A 5SX4I 4OZIA 5EC1A 2W91A 4D0BA 1DFBH 1QNZH 2P5WE 1MLCB 1XWVA 1MCDA 4CSSA 5E1IA 1S9YA 3T04D 1ZV5A 1XL4A 1YEJL 5T1LA 4K5OA 4JMXA 4NSKA 5IB1B 3HR5A 1JSYA 1W80A 3MGOB 4J8RB 1KV3A 3S34L 1RULH 4LOVA 4DP1X 2ZYHA 2Y1ZA 2ZOKB 5FFGA 4POYA 3VXSA 2E6JA 3N0AA 4D94A 2VDOL 3U0TB 2JMRA 3A6BH 1HOCA 2R1XB 4QXUL 4P59L 5I24A 2ZX5A 4RISH 4D0CA 4OCWH 1WYJA 4A7SA 4LNRA 4OM0H 4G8EB 4ABWA 3EYUH 5IB2A 3WFHA 4AGQA 3RGBA 4Y16B 5F3BA 3IJ9A 2X6VA 4BFKA 4LCIH 1BGXL 1S5IH 3IETB 2F74A 4R4FH 1BBJB 2SODB 1X5AA 1GCFA 1VPOL 1MHPL 2NY4B 1N8ZA 4XO3A 2AJZB 3C6LD 4TV3A 3MROA 1BEYH 3N55A 4P5SA 4X9HA 2O93L 3BSZL 3OWRA 4MD5A 5E5MB 5EZPA 1PMYA 3U46A 4Y5YC 1AQDB 2VITB 2Q86B 4JL1A 1ZSDA 4F57H 1ZVSB 2BH0A 3DMMC 2VUKA 2QHRH 4UIKL 5HVGB 1KJ2A 4F7TA 1HCYA 4N2LA 4I2XB 3ABZA 2DEXX 3GB7A 4R7DA 5ESVA 1F1GA 5TQ2H 4UOZA 5B1JA 5CSGA 4KKRA 5C08A 4RGMC 1KCVH 2FEDC 2JKJA 4GRWB 2AKRA 4XPFL 3FONB 5A43C 5BUAA 5EO9A 5T5FL 4FQJH 2QFPA 4J6RH 1G9NH 4ILDA 1FFOA 3WDJA 2NUTB 4PJAE 1UZ6F 3ZKSD 2YJQA 3RP1A 3BD3A 2H2PC 3GSUA 5DMKA 1N67A 5LGJA 1T20B 3APNA 1EBAA 4HSAC 2H1LM 4BINA 1HINL 3DX3A 2YPVA 5E70A 4A67A 5GRVL 1ML0A 5ENWB 4ABUA 4UIMB 3E1F1 4E9LA 3RZCB 2AANA 3WKPA 4LGRB 1D5ZA 1CLCA 1D6VL 1RZGB 1U91A 2EH8L 5AOIA 1YECL 2B4CC 6CGTA 4U2ZA 3UACA 4EI6B 5MEOA 1I7TA 4QWWD 1NFDF 3BFWA 4HFWA 4LGPB 4BE5A 1TCRB 3VQ2C 3VXUB 1U8CB 1KF9B 2QGDA 4EN2A 3F7PC 3CG8A 3TO4A 3TF4A 1V10A 2WXFA 3BO8B 4AEIL 1BF5A 3K72B 1KEGL 5GGTL 2UZIH 2AK1L 5KUMA 2QVTA 4TSAH 5DVLA 3D3VA 5E6SB 3OD3A 5E6UB 4Y4KD 4CJ1A 4HHGA 5J13B 2LGNA 1TVBA 3HZVA 4EKXA 3CN1A 3NEEA 4OAWB 3MOQA 5DHYB 4MMYA 3RAJH 5AENA 3PDOA 1IGTB 1OPOA 2RMNA 2AEIT 3V0EA 4XPBL 1AR2A 1SXNA 2ZTBA 1UD5A 2WKOF 1A9VA 5KUKA 3GO1H 3LTVA 3I02B 1FAKT 1UD4A 4KY1H 5I5RA 1S7WB 1EAJA 2JKTM 3VXQB 1DVTA 1FORH 1PAZA 5FM5M 2OI9B 4DGYH 1OP3H 3I84A 1G7IA 4X6CF 2EDOA 4KDTC 3SE4A 5J5EA 1T1YA 3H6AA 2P5EB 1G0DA 3N3EA 1K3IA 1JPST 3NRQA 4P4RB 4KK5D 3WAKA 1YAIA 2J56A 1TZAA 3GBNH 4NKQB 5J8OA 4UM8B 3E6HA 4KI5C 2NLJB 2Y06L 2ZXDA 3HUJF 5T8IA 1FHNA 2DQEH 3WAJA 3EJUA 2V33A 4HT1H 3Q8BA 4NQEB 2WYIA 1MXDA 2DQTH 1A9BB 1XD0A 3MRGB 3RKPA 1L6ZA 3KPOA 4FGMA 1A7QH 4L1BA 3T09A 2LTQB 4IS6B 4QY8B 5FO2A 2D0HA 1I9RL 4OB5H 4P3CH 5JIPA 1RURH 5B3JE 4E9WA 4PJIA 3FU7B 1NCCH 1BZ7A 2HFGH 5CJQH 2WQVA 4PMEA 2Z8RA 3BXNA 1ZS2A 1KELL 5KSAD 3ZTJG 4O5LH 4P23D 4X7SH 3TBSB 4XNXL 2AQ2A 2A73B 4GEJA 1H3VA 2MQCA 2F5BL 4B0MB 2D7TL 2G0LA 4PI2A 2EIEA 2VXVL 2X9XA 4FFWC 3OL2A 4JPVH 3EG9B 1OHQA 4PWJA 5CCKL 4XNUH 1JV2B 4PRHA 2Q8AL 1U8NB 5TTRA 3GRWH 2X0VA 4QR7A 3I6LE 5EIIB 4H5SA 2BLFA 1WC7B 2GJJA 5BJTB 1JDDA 3FSVA 3QIBC 3G6JF 2V2WB 3FTUA 1JPGB 2CIKB 4YVNA 1FZMA 3OF6D 3WXVL 1BIIA 1CK0L 2CMRH 5DJCA 5HHPB 5KANG 4HX1B 1G1KA 4TPRL 5JOFB 1IVLA 5TE4L 4P57A 3K4AA 3VXOA 1X3DA 4MHHI 3BH8A 4OQTA 5D8JL 1LM8V 2HB0A 1NM4A 1R3LB 1RJCA 2APSA 1DDTA 4BQ6A 4MJHA 32C2A 3QUXB 3MX0B 4GXVH 4ODHL 4ZUSB 3VQMA 4XN1A 4XO4A 1HESA 1FNFA 2NOYA 1FVEA 4X7FC 1K4CA 3EGXB 1MOEA 5LLIC 2BVEA 2UY7B 3P0YL 3F12B 2JIXD 5IQOA 1FFQA 4XPHH 1T03L 4Y16D 3A6CH 4Y4FA 5KS9B 2CO1A 3MNWA 4MCNA 4K5LA 4KDWA 3KPLA 3OZKA 2NY4D 1RJZB 1VF5C 4GY4A 4N28A 4NUJA 5CWSB 1TTGA 3I6SA 5CKGA 5FK9A 4L29A 4GRLA 4IRJA 1M1XA 1RZKL 5EEWA 2X3BA 5KSBA 1KPRB 3WS6C 3W5MA 3LQAL 4WKZA 5CUSH 3KVPA 1FYTB 4P4KC 1OGAE 2BIPA 3I9GH 3CFCH 1PLBA 2GEEA 3HLKA 5FW7A 5CLWA 4O00A 3MRPA 1U8KA 4ZJ9A 1QABA 3D6GA 5EUOA 2VSKB 1EZVX 5KYXA 5IHZB 2C9PA 1GGCH 5BO0D 2FJHA 4PGCB 2HLAA 4HGWB 2D2CC 5HVWA 5BQ7B 4HOWA 5IR1A 5LHDA 1NEZA 4DN3L 3K5SA 1E28B 2HUHA 1TJIH 3Q5OA 4PS4L 3IF1A 1OAKH 4BKLA 6FABL 3LY6A 3SDCB 1TITA 3CFIC 3SDAA 1DBJH 3S3PA 4OZIB 3L3IA 4D0BB 4J3TA 2O6CA 3FUMA 1F5WA 3RVTD 2PWHA 5T1LB 4JPKH 5EDXA 4NSKB 4BH8A 5I1DA 3HR5B 3UX9B 5J1TC 2VMJA 1UCBL 5E2WL 1V55B 3RZCD 1YYLH 4WFGD 1BA9A 3RWCB 4QRPE 2H2SD 3R1GH 4GIAA 3SY6A 3NA9L 3QRGL 4UQ9A 3HG1A 4AMWA 2E8YA 2WB7A 5FYKD 1MRDH 2NNFA 2YAFA 2HCZX 3VXUD 3LZPA 2EDHA 4HCRL 4X9BA 3ULUD 4D0CB 2RALA 1CFSB 1HHJA 1RCYA 5ADPH 4LNRB 5J1AA 3SOBH 2ZKHL 5I1KL 2FE0A 3HS8A 5FCUL 5SWQA 4WWKA 1GIGL 4J3UA 5F3BB 4HFUL 2DH2A 3PUUA 3WJLC 2R8SL 2F74B 3IDIB 1ASPA 2R27A 5CIPA 1N8ZB 3BGMB 2OJEB 4KNSA 3BAKA 5AW9B 5GZNA 1WAAE 4XBGA 2BIMA 4XMLH 1IE4A 4XP4H 4MD5B 1MFEH 1NC2A 3UP6A 5T3XL 4JG1H 1I1FA 4M7ZC 3CC5B 1ZSDB 3BT2L 3CQFA 3QVAA 4NIKB 2VDQL 1CL7L 4AGOA 5E08L 3ULVC 4AQAB 1X6NA 2CXGA 3WG7B 2IAAC 4U3SB 1MI5E 2P5ED 4ATTA 1D6EB 4A2EA 3BEVA 2CR0A 1LTXA 4FP8H 3MV7A 5ESVB 3VRIA 3TVMC 2BHFA 5EIQA 2ROXA 5HI3C 4MDJA 2H8PA 3BH9A 3O2VL 2YQ3A 1TVHA 3GWJA 4NQED 2CGRL 3SPGA 2VDNB 4EIUA 3P0VL 2Y0SA 1F13A 3N9GL 3LZFL 4A7QA 3OAZK 3IGKA 2VW6A 1FFOB 5EFIA 4F9LC 3NAAH 4M6ML 4KRLB 4YC2B 1A5FH 4HJ1A 4UWQB 2PCYA 15C8H 2WN3A 3RA7L 5DD3L 3GZKA 1DBML 3GSUB 5LGJB 1P4IH 1YEIL 4XAWL 2EDBA 5DZAA 3LS5H 3H2QA 4CSPA 2XETA 2ZT9C 4P5TB 1K6QH 3VGHA 1BQRA 1D5ZB 1U91B 3D25A 2C1OB 5MEOB 2FUQA 4ADJA 3VXRE 4JY6A 5GSVA 4HFWB 1WD9A 3BX7C 4HISA 1R34A 1NAKH 4TLKA 4KROB 4JM4H 4TUJA 4YXKL 1BHGA 1RU9H 2N7AA 1JPSH 4HK0B 3WELA 2VAAB 1E9OA 4UCFA 1X7SA 2FJUB 2WXGA 2I07A 5JR1H 3D0VA 2WKLA 5JHAA 1M71A 3D39A 4HYTB 1URIA 4Q97A 3NABH 3HZVB 3HNTH 3KWTA 2FEEL 3G6DH 3MV8E 4MMYB 3PDOB 3GJFB 3G5VA 2VR6A 2ZCHH 2BM3A 4BGLA 1IC4H 1VJSA 1R24B 4G6AC 5BW7C 7CGTA 3LQZA 4AZUA 3BISA 1I3RA 3QIWA 3O9WC 3QUXD 4NT6A 4NFDA 2DIAA 1G7IB 2Z34A 2GI7A 4FYRA 2ZE0A 1T1YB 5DJ6B 3KXFA 4ODBD 1LO3H 5GISL 3RVUC 1EHNA 4LHJB 4LPXA 2DM2A 3MUZ1 1R5IA 3CFJA 3QPQC 5JDSB 1JNLL 1I1RA 2X53A 3E6HB 4PV9A 1QKZH 1M9WA 1VFAA 2VMFA 3UTSA 1HHGB 2FUTA 3RI5K 1S3RA 3B9AA 3KPOB 3FT3A 4HUCA 4LFHG 5DR5H 2YN5A 4IOFD 4M62H 2V5RA 4WW2F 5IVXE 1ADQA 2VN6A 1WEJH 3ZE2F 4YHZL 1G5AA 2FK9A 4V11A 1CE1L 3FSWA 2EEAA 5IMOA 4UDUA 5CCHE 3GDCA 3TJEH 3UZEC 1QEXA 3ZTNH 1RMFL 5T1MA 2VM9A 1SUJA 1FYTD 2WMPA 1K5NA 4NKIH 1ZT1A 1A3RL 1MJ7L 4DGIL 2E86A 3LEYL 4TSBH 3FT2A 3ZO9A 1B3JA 1ZLVK 4HC1A 5DD0H 2GAZB 4LBAA 5FECA 2FO4A 4EIGB 5J3HD 2CBOA 4DGVH 1NCAL 2BNUA 4RDQF 4UT6A 1BF8A 2J8UA 4MXQC 2XOTA 4PRHB 2WUBL 1F4XH 5HI5C 2BXZA 2O6DA 2B14A 4BK8A 4OR1A 4LARL 1VAHA 3RY6A 2ZP8A 3PWLB 3SDCD 1KYAA 3AITA 3HE7A 4WSKA 2XXCB 3CFKA 1EZUA 1AANA 1MWAL 3BD5A 5D1XE 1GAFH 2W60A 4G3YL 1P7BA 1BIIB 5B1CA 5DJCB 1KGCD 3QORA 4W9FC 3UOAB 3BCFA 4K3DH 5BZDB 1HKLL 1MAKA 1DQDL 3REWA 2YQGA 4KTDH 1RZJC 3QAQA 3VXOB 4LSRL 4JN2B 4PJ7B 1FJ1A 3BH8B 2KYIA 3VI4A 5I1GH 1BYNA 2GJ6E 3LAFA 3U30C 5EU5A 2NXZC 2OMWA 3K1DA 1A7OL 4TQPA 2OJ1A 2OYPA 1QACA 2VN5A 5JW5B 3DOIA 2LLGA 3FO0L 3FFCD 4K55A 5ECJE 4OZHE 3WE6A 1B0WA 3EDEA 3UADA 4JFDB 1ZV2A 1K4CB 3QIUA 5KJ4A 3MRHB 5C0DA 5JPMA 2OW7A 2KL6A 4JFHE 2XWEA 1N6VA 3OKOA 2X6MA 1V7ML 1YC7A 1M7DA 2GBAA 3RWHB 3TPUB 4EDWL 2R56L 4K7PY 3D08A 4U05A 2ZXBA 1T0MA 4LSSL 1KPUA 1A7BA 2TRHA 3QARA 5I17B 3BUBA 4ONFL 4NUJB 1GSMA 1W8EA 3IDYB 4XO9A 3RHWK 1S2EA 2KS0A 4IRJB 3SO3C 4FYQA 2OMNA 3CBKB 4P06A 2C9RA 3FB6B 4GEIA 2GSMB 4UDTA 4EN3A 5KSBB 2X5PA 2DQFB 1HKFA 3QCUH 4NN5C 5EEUA 3WCYA 1TETH 2AP2A 2GHWB 4NZJA 4YHML 3A22A 3LH2H 2HX8A 2XX0A 2ZXWB 1U8QB 4HKZA 3UH8A 2B2XL 4L0PB 5EUOB 5AVZB 2ED6A 3R8QA 1ZK9A 4E41A 5KYXB 5CN2A 4PB9H 2FJHB 3MKKA 4RLDA 4AH2A 1JNHA 2HLAB 1PD6A 1U3HB 3P3SA 5D7LA 4D3CL 4AT6A 4N2HA 4F91B 2G4GA 1C8QA 1NFKA 4RQQA 4OCSL 4NQSA 2UYLB 4KAQH 5IR1B 4BFIB 3EF7A 3UTQA 1BVLB 1N59A 4GLRH 1T89C 1J11A 3KLHD 5I2IB 5DJ0A 4FE9A 4IJ3C 2G2NA 2OBGA 3OAZH 1XCTA 1TFHA 1A9EB 3FTXA 3H4HA 2ICCA 1YLBB 4IMKA 5IBTH 4ONGL 3GI8L 1LMKA 2Y7LA 4R83A 1JWUB 2L04A 4BH8B 3BEWB 3JVGC 3RUGE 1NLBL 1TYEB 3DBXB 5HJ3B 5ID1A 2R2CA 4P5TD 3LIZA 1NCUA 2MNUA 1GGBH 5JOPE 4YK4B 5TE6H 1A14L 3WIHA 4M1DH 2QJDA 1PQZA 4FNPA 3HG1B 5FAAA 5FYKH 3NZHL 3PP4H 4N6RA 4CN1A 3KVDD 4UILH 4XVSH 5DGQA 3CE1A 4J3OC 3ULUH 4H1LB 4KROD 1D5RA 4XN9A 1DQMH 5K59E 4M6OL 1HOEA 1HHJB 4XP9H 3T5WA 1E3XA 3WDHA 1OTTC 3NRPA 3K4ZA 3MUGA 3MCLL 4KWUA 1KFAH 4R2GC 3T8XB 3OMZA 4P99A 3QFJE 4WWKB 1BM3H 4KKBD 1G6RB 2UZYA 3ILEA 2VXQA 3RTQD 4N5ED 3UAJC 2F54E 3Q6GL 2FB4H 2MCMA 2QADC 4L8SC 2D0GA 3H7LA 5CIPB 3F3HA 3FUEA 3OJMB 5EU7E 1FL6A 2LU7A 3GSOA 2QV2A 4MJ6B 2A4ZA 2HTLC 1NANH 1MCBA 1NC2B 3MC0A 5FC9A 1E8WA 2MPAH 1UM6H 4DERA 1I1FB 1SHXA 4OIIH 4MLIA 5GJTL 4GW1A 2PETA 3I50L 1JZ6A 4G8FA 1RZIB 1S4IA 2VJ8A 4GSDH 1EUTA 2HLFD 4UI2A 5IKCB 4XWOD 1KTDA 4LLYA 5D7JC 1WCQA 3QUZD 1DQQA 1F2XK 1O7DE 4DGUA 3SQBB 3V4VA 3KLLA 3MV7B 4XRCA 4R97C 2WW8A 3N06B 3C9NA 3QG6A 4FQLL 4KZCA 5AKSA 3WI9A 2H8PB 3BH9B 1PLGL 4LVNC 3GXNA 4AYDC 1HYRC 1LLAA 4H88H 3FTWA 2FX7L 4FABH 4UF7C 4OCRH 1VGKA 2FSEB 4M43H 4FAAB 2HFFB 1C7SA 5EFIB 3F7LA 2BVPA 4KVNH 3MNZA 2EE2A 1XF2A 2A9AA 1WHPA 3BWUF 1WZ1H 2VERN 3FOLB 1FE8L 2BDNL 4NO0D 1IC1A 2IQAB 4RGOH 3D9AL 2X1WL 1KTRL 4BV1A 4JFYA 3D25B 4RESB 3MLUL 4QUOA 2X3AA 3K2UH 4IKNA 2E56A 4I0KA 1ZLVH 5GSVB 3BN3B 1ACZA 2L3BA 2CE6A 2K3TA 2XA8H 1G9MH 3S4SA 1HL4A 1ZPLA 3MJ9A 2V7HA 3HAEA 4AQ8C 4JQVA 1DFXA 1RUAL 5FLVA 1E9OB 2BNRA 1DSWA 2WSKA 3GGWB 3QC5X 5DD6A 4L3EA 3IKCA 5IG7B 3TV3L 2I07B 1OTSD 2AK4E 3D0VB 3GJFK 3UO1H 3B6SB 4ZMQA 2AS5M 3D39B 2E9WA 1RHHA 1DDHA 2PWEA 3D05A 1F4HA 4LAQL 3KJ6L 5C92A 1BX2A 1PDKB 2ZWKA 4GFTB 3ETBJ 2YD3A 2HPTA 3STBA 4BZ2A 1TUPA 3DUSA 3AAZA 4AJ0A 1DQKA 5H8DA 1ZEAL 2ZWNA 2F1AA 4L37A 3LQZB 3NH7H 1I3RB 3NCEB 3ARGB 3S0PA 3QIWB 4FFZA 1HJCA 4TXVB 3NOIA 1O0VA 4LK4A 3O4LA 1WO2A 4NT6B 2RACA 4RZCA 5DUPH 5IY5B 4ZRGA 2ZUVA 5FHAL 4ENED 4JCWA 4JFDD 1QSEE 1MCWW 1P7QA 2X88A 2NY5C 2Y23A 4ZYKB 1CLOH 5I1EH 2VLKB 4KNUA 2ADYA 3CFJB 4H2AA 4QCIA 3Q1SL 3CU7A 4PV9B 4Y9EA 3U2SB 1IVTA 3G9VA 1CQYA 4J3SA 1VFAB 3TN0C 4NJ9L 2NQ3A 1XXFC 2WIIB 2CUAA 4H25A 4GUOA 1SN5A 3PXLA 3LYRA 4YSQA 3IJ8A 1F0LA 3F7YB 2HRLA 1AS6A 4K8RD 1DJXA 2XN2A 3ABMB 5GXBB 2OTUA 1WIUA 4WI5A 4NRZB 4U0QB 3BD4A 4TN9A 3BIBX 2WMPB 3FW6A 3NDZE 4HJJH 4KKCC 5DF0A 2YD1A 4YLQT 1ZT1B 4XVJL 4P2QE 1A6VH 4NNYB 3FYIB 3OZ9H 4RNRA 3FT2B 2CUHA 1UD2A 4M1CD 4AOFA 3HMXA 1MIML 5ECGA 2A0LC 5CBEB 4OLZL 5JOEA 5FECB 2YMOA 1U3HD 2XZAH 4KV5F 3WY4A 2BNUB 7TAAA 2J8UB 2VL4A 4TL5A 4FFVD 3QCTH 5IMMB 2TSAA 4WJ5A 1G0YR 2E8ZA 4YGAB 2CHXA 3BSZA 3U0PA 2EICA 1FL5B 5AW4B 3GBDA 3B2VL 1IUZA 1CBJA 1YNKH 2VDPL 3MCKA 2DWYA 4JFSA 4XCNA 5GRZA 5GRWA 3CFKB 5A7EA 1DQJA 1YN6A 4DTGL 4OLEA 1IGIH 1F58L 3O2DL 1QAWA 4DKFL 1SVCP 2BNQB 1E2ZA 3P40A 4KC3B 4PH8A 2JV6A 4QAWA 3P9MA 1JIBA 2ADIA 5B8CA 2HT4C 1HHHA 1FZJA 1PS3A 3PHSA 4U6YB 3VI4B 1UH4A 4QRRD 2ENPA 5DJAB 5GZOA 2AI0L 5EU5B 3ARXA 3EXJA 3HG1D 2RCSL 3HG5A 3RNKB 4GFXA 3VFUB 2B8OT 2WY3B 2EYRA 4KX8A 4Y4HA 1I8AA 3KM1A 5T5FA 1HZKA 1C7TA 3VWKC 2APTA 3WE6B 4BWTA 5AB9A 4IYKA 3C5ZB 4ZFZB 3WO4B 4H7VA 3P9WB 5A2FA 1EK3A 1GZQA 5C0DB 3SPVB 3KH4A 3TC9A 3VFVA 2NNAB 2X1PA 4WWKD 1CVRA 2YKKA 2DIJA 3OKOB 4GRWF 4IHOA 2A74B 3GF8A 3V7AE 1MREH 5C6WH 1M7DB 1OXYA 2DICA 4GXUM 1A4BA 4PGZA 2QMKA 1KPUB 3ZY7A 3TURA 2C9UA 4LSTH 3MODL 3HHMA 4YUEH 3KYNA 1CI3M 4FEIA 5AWNH 3VFGL 3VXNB 4XC3L 3MCG1 5ICUA 5HDBE 4UANA 1OE2A 5T5NF 4EN3B 4K94C 1NC2D 2DQDL 4X5LA 2FWOB 3EOAA 5F1NB 2Q2EB 5IHUL 2Q20A 3SJVE 4G6JL 1S7XB 3D4ZA 3HN8A 4YZWA 1BFOA 4ZODA 2DOCA 3H7BA 4X4XA 2GCYA 2W38A 2IVFC 3QWQB 5GGTA 3KYMB 2PW1A 3IFNL 3MV7D 4Q58C 1QSZA 2FJSA 4KVCH 1JNHB 4AH2B 5AW5B 2WLLB 1WT5C 3EO1A 5D7LB 2JTDA 4K7PH 1Y6KR 3KDMB 2VDNH 1L9RA 2J2ZA 4RQQB 2K0RA 4Y89A 5GHWL 4N22A 4HIHA 3ULUF 3UTQB 5T33L 1H3XA 3P77B 4H8VA 4OF0A 1MNNA 1N59B 3LIUA 1KNOA 4RVBA 4BYHA 5L4FA 2VCOA 3EO0A 5INDA 2CCLA 5EF1A 5CFAA 1IAIL 2ICWA 2BS9A 2IPKA 1X5LA 5EG6C 4LFHD 1IB5A 1FVCA 4CBZA 4TUKH 3KNBB 1TJHH 4LOFA 4LU5H 3ZKMD 1MCLA 3MLVH 1QYGL 2VM4A 3ESOA 4EUPA 4OCXH 5DQDH 1Z9NA 4R4BB 5G4MA 5ID1B 2E7LC 2UWEE 2MH4A 3MCYA 1UA7A 2HXAA 2ITCA 3TBVB 3OBAA 4F27A 2DB8A 4OSUL 25C8H 1J12A 2FTAA 2EO7A 2WO2B 3IDXH 4JRYB 2MQ0A 4JZOB 5C09E 3UBXA 3LNHA 1OM3H 2X4TB 4M5ZL 3V5KA 1B4TA 4Z7UF 4Z3EA 2EDQA 5C0JA 4NO5B 1E2WA 1NGQH 3W2DH 4YDIH 2X4QA 3EBGA 4U6TA 4Z23A 1GGIH 3VFNA 2UZYB 1UJTA 2X28A 3D39D 1ZOXA 2H3KA 4L4VD 3KYOB 1MCIA 2V5YA 3JXAA 4JANA 3LKPA 5ADOL 3GJFH 1QFWL 3J27A 4KKAC 1FL6B 4HJTA 4Q2ZA 3GSOB 5CLZA 4Q89A 1HCZA 2OYKA 3KBPA 5E4OA 3KJ4B 4EXPX 3BKCL 1CT8A 3NJFA 3M8OH 1MY7A 1HSBA 4C83A 4ENEC 1U21A 4GW4B 4L3FA 4GW1B 5DD1L 5FXCH 4DW2L 3OKMA 3ARGD 1GS8A 3QIWD 1AKJA 1MJ8H 4WFHD 4HEME 4PJ5E 1DQQB 2VWEE 1KXVC 3NMEA 4HPOL 1XGQB 4X0NA 5IZ7A 2G2RA 3KGSA 4F24A 3V4VB 3HJ0A 4DAGH 4ETQB 2VLKD 2VLME 4QHMA 3GKWH 2EUWA 2LV4A 5FGCE 4PMFA 4FJ6A 3TCLA 4NJAH 1RUQL 3UBXI 4AXWB 2QTVA 2BWQA 1AZRA 1E6JH 2I60L 1TZGH 3IM1A 3MNZB 4J3WA 4OCYL 1XF2B 2YC1A 4KO6A 1SBSL 1EA9C 3TWCL 4DKAA 3FO2A 1L0QA 3GIZH 5HYIA 4F1ZA 1CYXA 2MNJB 4Z7WB 4GW5A 1BAGA 1BJMA 1WFTA 3IDGB 5BV7C 5CAYB 1P7HL 3CXFA 5F0MB 1TO4A 2NRDA 3NTCH 3D85A 3P73A 5MERB 2F53A 3V9EA 3W11C 4R0LA 4A2MA 1C5CH 1FF5A 4HA1A 5IV2A 2RH0A 5CJXC 5ILTL 3WJMB 4F93B 3CFTA 1G0XA 1LO0L 2YXFA 4UUJA 1JVLA 1VACA 4QHUA 5JXEA 1E90A 2OXGB 2VQ4A 3CDZA 2V7HB 3BPNC 3ZDYB 3VYPA 4KRMB 1XF1A 4MZRA 4L3EB 1WCBA 4NZ8A 3IJHB 3V0JA 4JLRA 5LWYH 3BZFA 4AL8L 5KS9F 1H9VA 2DQGH 3JWNE 4ZAKC 5H35A 3GXDA 3MXVL 1A3ZA 1RHHB 1DDHB 2A4CA 4JHWH 2BNQD 4DEPB 1BX2B 1MQKH 1HWWA 1F4WL 2KQMA 2ZSVA 2JJTC 4NUGH 1ZTXH 1N3NB 1CGVA 2AQRA 4OQTH 4ODUA 4PIRF 4ZQKA 2XN9A 2QVIA 1PX4A 3AAZB 3DUSB 4I4WA 4P2OB 3B2DC 5EU6E 1LL1A 4JKPH 1UOVA 4PLOB 3DKHA 4MB1A 3G3LA 1RI8A 1XGYH 1FCCA 3O4LB 4O58H 4RZCB 4XCCH 1KDIA 3ZDXB 4I0PA 1F41A 4KZEH 1S78C 2X2YA 3GD1C 4CC4A 1P7QB 3O6ML 3C5ZD 4PJFB 1E9QB 4QCIB 4X6DF 1GZPA 5IROC 5EULV 4F8TA 1QSFB 1XGPA 2B20A 5GGVY 3Q01A 4A66A 2VDRH 4FC3E 4NO3A 2AVFA 3IE9A 1A4JA 4H25B 1GZHA 4JN1H 2OAAA 4FQQB 1FNSH 3PGDA 4K8RH 4S1RH 3KL3A 5LUMA 4EN3D 4ANKA 4WWOA 4OZIF 3UROR 5KYUA 4LXFA 3AB0C 2J1WA 4FFYL 2P26A 1XBRA 4X5XB 5C0BE 3V6OC 1A8ZA 3E8UL 4IDJL 2WNGA 3PV7A 3PAYA 5AW7B 3GNML 4HCRA 3BKMH 4RNRB 2OSXA 2YA0A 4PLKD 4IBWA 3SQOH 4KZDL 4GKLA 1AXTH 1DQVA 1LVEA 4TTGA 1AGEB 2P8PB 4TLUA 2OCJA 4YHPA 3U36B 1AC6A 2JJVA 3ZRCC 5J9PA 1YJDC 4Z3TA 5MP6H 2WNKA 5HGAA 1Z0MA 3DV4B 3HHSA 2WOBA 2ZKXA 3DRTA 4LCWA 4OTXL 1BBDH 1O9VA 1R5WA 4M48H 3U1QA 5CGBA 4Z7NF 1DUYB 2ETWA 1D7FA 1SVZA 5I1HL 4XCNB 4U7SA 4LT7A 3H42H 1KGJA 5PAZA 1DQJB 3W39A 1C8PA 2PCFB 5G2NA 2V0AA 2J55A 1MHHA 2EIDA 5KVMC 2LVEA 5DLML 4JKWA 1L0YA 3VDCA 1A8JH 1DP0A 3TYGL 4OUUA 3FYEB 4MBOA 5DUBA 3L54A 4DPBX 1HHHB 3EJZC 1FZJB 2HKAA 3HCVB 3AS0A 3BZEA 3ARBA 4L1LA 1XH3B 1BP3B 4G7VH 4NIYE 4JRYD 2F1BA 1GOFA 3EH3B 4H1LH 4HCIA 3VAEA 3QI9A 2WPGA 4B9JA 4WFFE 2FGZA 5I71B 4B9ZA 5K9QG 1SQ2N 4ODSL 1J8HE 3GKZA 4IU3A 4EOWL 3IDJA 4AYID 1EJ6A 3MLWH 1G6RH 1T1WA 1SNRA 5JLZA 5CEXA 2BRRH 1KXQA 5DEFA 3LNEA 1Q38A 1SN0A 1UZ6E 4A63A 1CD8A 3KYNB 1U36A 3VX0A 2CKBA 3MA9H 1QHPA 5L2KA 1U8LB 1RP8A 4K3EH 4DT2A 3LKSA 2PPDA 1D5MA 1CG9A 5E6YA 5K9KB 2N56A 1ZIBA 1E27B 3FQNA 1WBYA 2NX5E 2XTJC 4NQDA 2R29L 1KMGA 2O5ZL 3P4NA 1X9RA 4KUZL 3VWJA 3H7BB 4X4XB 4ZFFB 4GXUN 2DS4A 2OMXA 1ACYL 1NFDE 2ALAA 2CO7B 3FN9A 3L81A 2PW1B 3CVIL 3QDGE 5SWSE 2OSWA 2GUOA 3WN5C 4NHUA 2LT9A 3X3FL 1OP5K 5AZ2L 1A3LH 4IJTA 1THAA 1HNFA 4PR5B 4M1GH 4MAUH 3QUKA 4P04A 3G5YA 3I9PA 3QJRB 4HIHB 4N3TA 5CN1A 5F2FA 5G4NA 3NCMA 1TT6A 3RPIA 3EO0B 3SKOA 4BFFA 3DUUB 5INDB 3WIFB 1D5IL 1JF6A 3G9AB 2ICWB 2IPKB 4OZGA 3HI6L 1JFQL 3AY4C 3L48A 1Q1JL 4LIQL 5EIVA 4KRNA 5C0AE 4CL7A 4HQQH 1M3JA 2A3TA 1FVDA 4C47A 2HVJB 1MH5B 1EJOH 3RG1C 3SE6A 2ZG1A 3EFFA 3Q2NA 5J0BA 1F6FB 2ITCB 3OQRA 5TGBB 5CZVH 3HBQA 3CHQA 2CA4A 4QEGA 4FEMA 2YPLA 4X6CE 3KBHE 1VFMA 4X7TA 2D7NA 3DXAE 3W9DA 1T21A 2BSBA 3DWTA 5CD5C 4Z77A 1SF3A 1IBHA 2BIHA 3V5KB 1BZ9A 4MKTA 3HUJE 4QTHB 1AGFA 1CLZL 3MUHL 2V9QA 3WHXA 5E6ZA 4JPWL 1H5BC 4DUVA 1I4FA 1J10A 4UNVA 5GSRA 3VFNB 1YEGL 3NN8B 4AQEA 4JG5A 5F0PB 2CLZB 1WHOA 1XEUA 4JHAL 2BJML 4JANB 3S5YA 2LU3A 1H3TA 4BH7B 3SCMC 3S88H 3FQRA 4HCFA 1HE7A 4JGJA 2VH5L 1CT8B 4PJIF 5IJKA 4P2OD 1S9XA 1JV5A 1P5VA 5AD0A 1IM9A 3MLSH 2P42B 1PF3A 2K6WA 3Q8CA 1F90L 1BQLH 4M7LT 3B9DA 4Q4IA 3O4LD 1AKJB 3MLPA 1R3HB 4PJ9A 1KLUA 4AY0A 1YEEH 1ZANH 3K8KA 5F1KC 4A37A 3W82A 3VNYA 2ADFL 1P7QD 1LWHA 3REVB 4GRMB 4YX2H 4MA8H 4QHMB 3WSQL 3H1ZA 4K3HA 2X4PB 3FQUA 5EMYA 1MWAA 1X9LA 3LPFA 2ISDA 1P9MC 1QSFD 5AALA 3IVKA 1J0ZA 1SQMA 4BKTC 1AZCA 1SHMA 1IBZA 4Y5VC 2Y7QB 4UTBL 3G6JE 4L9LB 3KS0H 5CXPA 2EIZA 5BZWA 1YY9C 3QEGH 2E27H 4JJOA 4QOKE 4R26L 1OL0A 4ALAH 5T3ZE 1UB5B 2YC1B 1D9KA 1I8IA 2VRKA 2E9IA 4C4KT 1JERA 3FO2B 1RZ7L 3KYKL 3O6FC 4N6QA 1TZHA 4PN6A 1U30A 4BWWA 1NBCA 4K15A 5DWUL 2AJVH 3ZT5A 3TJHC 1ZD6A 5CLXA 4HJGA 4AGNA 4JFQA 1WSST 5KN5B 4QMEA 4LP8A 3L9YA 1P5UC 3AJ7A 1PY4A 3ULSB 3VFWA 4JDEA 3P73B 2DMCA 1QTYT 5IV2B 3C6SA 4TSCL 1RHFA 3T0EC 2UXFA 5C0FB 5FWQA 5SWZD 1PFCA 5D7KD 3SBWC 1AR1C 4UUJB 5E6RB 1MFDH 1SXZA 1VACB 4N87A 3CDZB 2AXGB 1E3FA 3S3JA 4X6BA 5I28A 2GEQA 4KVPA 3HN5A 1HQ4A 2P5WD 3LOWA 2NSMA 3RX5A 4I3RL 4RWYL 1QUPA 2I9TA 1AGBA 1VCBC 4P9ML 3CSGA 4PTUA 4JLRB 3S2AA 3BZFB 1TFPA 5C86A 2PCPA 3FF7A 4JDVA 5H35B 3WJJA 3BKYH 1E50A 1N68A 1XF3B 5EWIH 2YD0A 4KTEH 4LOEA 2ZSVB 5CEZL 1NEUA 4DFHA 5TQ0L 3WYRA 5KSBF 5FOBA 1VZGA 1TZOA 3J2PA 4ODUB 4ZQKB 2Y36L 4WF7A 5ITBH 4FFTA 5AZEH 5C0NC 5CHNB 1UWFA 3NT0A 4HPYL 4PFEA 4X4ME 4X6FA 1CDCA 3RWFB 2HTKD 4K5PA 1CICA 3MOBH 4I0PB 3VMOA 5EUOF 3TO2B 5KANI 3RVVC 3K6DA 3RILA 1SJXA 4KZ0A 5D7IE 3TONA 1L9OA 1XB3A 2ZAGA 1J8RA 1I7ZA 3HLAB 5I8OL 4XHJD 4JG9A 3WNOA 5E94B 4C56A 4YDLB 3SPCA 1KXTA 5I26A 4AJVA 1TNNA 1XGPB 3RWGA 5MI0C 4ZOEA 1X5MA 4NO3B 2KLTA 2YK1L 1KBWA 5CMAA 4KMTL 4N0YL 3HC2A 3PGDB 4LPUA 3RNQA 5I19H 2UVEA 2YXWA 2CM5A 1I3GH 2YEZB 4MB3A 5KYUB 5EF2A 1BVZA 1G4RA 1FDLH 4WK2B 3RWJA 4MA7H 2OCFD 1AXSA 1ES0A 5KSVA 2MOVA 5EZIL 3LHAA 2UY6A 3AZUA 3ME0A 3RGVA 4TNWK 3VSQA 4ES9A 3ABLB 1IT9H 4PSPA 5AKRA 4FI6A 4M03A 3JTTA 4BUQA 1BV8A 3R0MA 1BZOA 5D7HA 1XGUA 4MNGE 5GGVH 4AM0B 1NIAA 3P54A 4XX5A 2OK0H 1UKSA 1G9NC 3LS4H 2PPFA 1SEBB 5AW8B 1DBAH 3LRLA 3EH1A 3CNKA 4LCWB 3DRTB 5E2TH 1A6UH 3O3EA 3ZTDC 2XICA 4QT5A 2I5YH 1U8OB 4WU7A 4XNMA 1RVFL 3O45A 3CZFA 2WXOA 4J1UB 5JPNA 3C60B 3B2UC 4LHUA 1TTCA 4NFCA 5GRJL 3S3DB 3BW9B 4UMSA 3GJEA 5TDNA 2ZOUA 1VHPA 3GHEH 3NPZB 3SGDH 3U48A 1L9QA 2VDQB 4QRPB 4F15C 2A9ML 1H8OA 2BCKA 4G6MH 4OUUB 3LNGA 3AUWB 3WIHH 2VQTA 5TE7L 2YUZA 3BZEB 5BOJA 5LKNA 5E8NB 4AX3A 3FQ2A 3ZKND 1F4YL 3SIKA 2P24B 3FHQA 4PBDA 1UXWB 3EOYG 1H3GA 2CKNA 2AEPH 5DZ9A 3RIKA 5IB4A 1PW3A 3ECBA 4R90L 3IDJB 4NKMA 4G5ZL 2WLHA 2RIKA 1MPAL 2VXQH 4BDVA 3S9DB 1ND0A 5JLZB 5CEXB 3DRQB 1U3NA 3L7EB 1LDPL 4YQXH 5CCJA 5DMIL 5I30L 4C58B 2PYFB 2H1PL 3B1UA 1MCNA 1JHLL 4NN7B 3VSUA 2Z8SA 3S96A 1T5WA 4YHLL 4Z0BH 5L2KB 1ZV9A 4AC4A 1CXIA 4GIPD 2CHZA 2WXJA 5E9NA 1MI5B 3U7WH 1ESOA 1CUOA 4LHQB 1BMWA 2PO6C 1AKJD 1WBYB 1SMAA 4OM1H 4FLQA 2CU9A 3TZVA 3P4NB 2ADJB 2FGWL 3X13A 3E2HC 3OKLA 5HYEA 3AFLA 2OMXB 3B4NA 5JXAH 1KYFA 2GC4C 2WV3A 4UNTA 2FYYA 1JGVL 2GUOB 1WDAA 4NHUB 1M7IA 4Y2OB 3QXWA 5B1BB 1MW1A 5L9DL 1UM5L 2NYYC 3PUCA 3HOGA 4YPGA 1X5ZA 1Q0YH 3BIKA 5E1HB 3FUDA 4LOUC 1E4JA 1M05B 3H2PA 2K6ZA 1BYPA 1HVXA 4GJTB 4I9XA 1UJ3A 1KJ3H 1Q72H 4K5NA 4N0UA 1R3JA 1X5KA 4NOBA 3L3OC 2DDQH 4XMVA 5LN8A 2XWJA 3S6CA 3UG4A 3PP3K 2BXYA 5ISZA 4R3SA 4BFNA 5DEGB 2EZ0C 1AMYA 4XVOA 3P11H 1P4BL 3HG0A 1NTDA 3EFFB 3VXMA 5B7MA 4PGDB 4GKSA 4XNYH 2BK8A 1IFHH 3F01A 1HIML 3MBXL 2YPLB 1FFNB 3IXTA 5F9OH 8FABA 3HFML 4J3OG 4HV8A 3US0A 2Q3ZA 2VDML 2QLVB 3O8XC 4WW2C 4L4JA 5E6IB 4FFWD 1NCNA 2A6DB 2OR7A 2R0ZL 5E8OA 4OZFA 5EPMA 3MACL 5D71H 1MG2C 2CO4A 4QRUA 4TQHA 3ABGA 4F7KA 3UGUA 4PJXA 4AQEB 4Y9FA 5DMGC 4HS3B 4OV5B 4YIQA 1I1AC 2NQDA 2ZSWB 3VRLF 1E4XL 1LWRA 1XV8A 3ZE2E 2V2XB 2G75B 3QWRA 4XBPA 1FRGL 3GXFA 4YNYA 2XV3A 1H8LA 4BZ2H 1GKOA 2YAHA 2PYEE 3W0WA 1JV5B 1P5VB 2FH8A 1S8DA 3IPBA 1Z5LA 2W65B 1FFPB 4TKWA 3V4UH 4IIQC 5CGTA 1PX3A 3AM8A 1CDYA 3UYRL 1GYWA 1U4EA 2H47C 1OY3B 3PWPA 4I0PD 4P5MA 1QO3A 1MFBL 4KRPB 4H2CA 1OCCB 4NWUL 4Q9RH 3EUUA 3QEUA 1P2CA 4XAKE 3QULA 3FQUB 1F00I 2J8UF 3C12A 3GMRA 2XBZA 4NQUA 3HE6C 4W9GC 5IVXB 4E0RB 4CN6A 1VB9A 3C8KA 3DO7A 4HIJA 1MCCA 3O2DA 1WWWX 1ZJAA 3OJ2C 2WVUA 2DPKA 1EXUA 5I8EB 1CGXA 3ESVF 3OKNB 1OGAD 5GIRA 4XMUA 3S34H 2EIZB 1QLRA 2WANA 4GH7B 5BZWB 4XXWC 4AKPA 4R5VA 1D9KB 1UENA 2JVUA 3GSXB 1J9RA 2IH3B 2WQ8A 3CZNA 1FH5H 3EOTL 4M9OA 4M8QA 4QGYA 3KPSA 3FULA 4HJGB 3L3GB 4MLSA 1BXXA 4LSDA 4CMHB 4JB9L 3VFWB 4JDEB 4P4KD 4P46C 4AKOA 2CCWA 3VI4F 1TTBA 3FHAA 1DVQA 1A7PL 3C6SB 5LNEA 4X8GA 4HU8A 1BGXH 5KOVC 4IDLA 4UV7H 5IVZB 2G2PA 5HHNB 2P8LA 3GINA 4OW6A 4EIBA 5JZ7C 4LCWD 5ABDE 3M1BB 5E99H 4X6BB 1LD9B 5D1XB 3FPXA 3JV5A 1H15A 1YEDA 3N43B 3RWDA 2HG0A 1JHTA 5D2NC 2YZ8A 3WEXA 1AGBB 3C60D 4PTUB 3BDBA 4G6KH 3WNMA 1L9MA 4RRPA 5FO7A 4NAMA 4GS7B 1AS8A 3H3KA 4M6AA 1YMHA 3WFDL 4MA3B 4QRPD 4E41D 1EAQA 2FECI 4OLVL 5DZLA 4YDJA 2GJ6B 3VD4A 1FNEA 1A6TA 3QG7H 1QHOA 1JRHI 4GT7A 2WHVA 3KPRA 1RZ8A 3OKKA 5D2NE 5FOBB 2DQUL 1TQCB 3FBQA 5FYLE 2W9LA 4OZHB 4K73A 2ARWA 3AABA 4X6FB 4XPFH 1KB9K 1XSOA 3ELQA 5T5FH 4N5UA 3I6GA 5H94B 1CICB 4HUXA 3VYNA 2CD0A 3GBMH 1MRCL 5IUCA 1A4KA 1CFVL 4UQEA 1NJ9B 2L7UA 4BBWA 1I7ZB 5EOCL 1QBLL 4GMSH 3C6LC 4PBWD 5HYJA 1HEJC 3AXHA 1JCVA 1QRNA 3RWGB 5ID0A 1WBXA 3OHXC 4AMXA 3HRZA 3FNKA 3HC4L 3WNNA 2QFRA 1DVSA 1QFOA 1UCTA 2DYRB 5CMAB 1T6VN 3ZLQC 1TXKA 1BOGB 1YECH 5B22A 3QC6X 2X4NB 4NBXB 1GJIA 2IWFA 1TR7A 4F7EA 1T3FA 3N40F 4ZTEA 3K6IA 5E0FA 3RWJB 1MI5D 4ANUA 5KBNC 1AXSB 1ES0B 5KSVB 5IWLC 2CIIA 3ZIYA 1ACCA 4RAVA 2J6EL 2CO2A 3PHQB 4NZFA 3RGVB 5HDWA 5BMFH 1KEGH 5LN4A 1QZNA 4HBQA 5GGTH 3CFEB 4AMKH 4HXBL 3JTTB 4HZAA 3W9EB 1PZ2A 3GLEA 2ZUSA 3TTYA 1NMBH 2CBMA 3GSRA 4HMCA 2DMBA 1Y1DA 3B2PA 3BAJA 4AVHA 1BD2A 4FI8A 2CO3A 5KTEH 2COQA 1DJZA 4RGNB 3LZRA 5EZOL 4JM2B 1EFXA 4OF6A 2PTTA 4QT5B 4XPBH 2Y72A 1KYUA 1AQKH 2IH8A 4XNMB 1U6AL 3CFBA 5JPNB 4CAGA 2EDXA 2OMUB 1SXCA 1R5VA 3QDJA 3GJEB 2J88L 4N1EA 3RUGB 3S37X 3TM6A 3DX0A 4PY7B 3UJIL 4GUQA 3PWUA 1JGIA 4AENA 2BCKB 2BY1A 1BXAA 2BSSB 4DVBA 4BZYA 1KTKE 4XB8A 5L7XL 5JIHA 3O3UN 2YD4A 2YSSB 5IQNA 5DFWH 3EZJB 2B4CH 4YHIA 2H26A 3CTTA 4WUKH 4WU5A 3NJKA 4OFYA 4MMXB 2Q9OA 5E6ID 2Z3FA 4Y5XB 4ZD3L 4FCHA 1OE3A 1THCA 2F54B 3ECBB 2JK5A 1I3UA 5IBUB 5I9QB 3MV8D 1CGYA 1ND0B 1SXSA 3QEHB 2D7QA 5LQBH 4XNXH 1LEKB 1DL7H 1UFUA 3ARSA 4MAYA 2N59A 4EO5A 3QJQB 2AC0A 4APQA 3S96B 4H8QA 3SKJL 2HKFH 4PB0H 4CJ0A 4OT1L 3HNVH 3LD8C 3KPQA 4GO6B 5CILH 5CCKH 1G7JA 3LN4B 2FT7A 4KK5C 1J9TA 3EO9L 3BVNB 3CN3A 3TZVB 3X13B 4UV4L 2DF3A 2XWTB 4OFVA 4KRPD 4AEHH 3SE3C 3O9WD 3F6IA 3RL2A 2GBUA 2WKGA 3UTZA 4LP5A 3IU4H 1CK0H 4AVKA 4OZ4A 4YPGB 1V27A 1LK3L 5ACZA 3BIKB 4KX9A 3QPQD 3PNWA 3V2AR 2Z8WC 5C9JB 1WP6A 1TQUA 3B5TA 5HYSA 1UJ3B 1ILUA 5B3NA 5KSAC 2R0KL 3LHPL 4P23C 1BJ1H 3L9BA 1D9KD 1R3JB 4N0UB 5A2LH 4CA4A 4JPQA 2XWJB 2V17L 1IKNC 4W9JC 5ISZB 4HIIB 4AQOA 3FN3A 3EJPA 3V6ZA 1AG0A 1KBGL 4LLAA 2J4WL 1AHWC 2YEVB 1T03H 3SGDI 4JDZB 5JDJA 5D2LA 2WQSA 8FABB 5T1KA 1N5AB 4HV8B 3ZDXF 3GMNA 5B1KA 4XI5C 4FQ1H 2XU9A 5C7ZA 2DLFL 1L0XA 2B1AL 4HS6B 5D1XD 3S36X 5L0QB 1RZKH 4OZFB 4WV1B 1SXBA 1CF8L 1PIFA 4P2RA 3MRLA 1H8NA 4RSYA 3V6FB 1J5IA 4PJXB 1AJ7L 3SKNB 3OPUA 3S8FB 1PG7H 3ZTEA 3KLAA 2GJ6D 5DRZB 4A2GA 1A6AA 4OJEH 4YBQC 3CX2A 3IAPA 5EBWA 4KPHL 1LNUB 2GTZB 5CGYD 3W0WB 3TFBA 5DI8A 2FJGB 1MAJA 1Z5LB 3HS9A 3PRZA 3C5JA 4L1TA 1QBMH 3T2NH 1IIKA 5BS0A 3WY2A 1SLWA 3D30A 1CICD 4JUSA 6FABH 1QO3B 4WCYH 4Y16C 4TQIA 2R59A 3PYCA 5L2JB 4KV5E 5HVHB 5F1IA 2DKUA 2HRPL 2VDPB 2EE6A 5F7AA 4LVOC 3T0XA 1JXGA 3FCSA 2PABA 3NCJL 2NY4C 4MZ3A 3GMRB 2XI9A 4I3GA 1CFTA 3DA0A 4NWTL 3NJMA 3CXDL 5CCGE 4HJIA 4YDNA 5E2WH 5GGQH 1JK8A 4POZC 3PL6B 1CYWA 4JFZL 4KNTA 5GIRB 4DCQA 1J48A 4L05A 2XQBL 3NA9H 4P2QB 2AXWA 4P2CG 5D4HA 5DTFB 5AEAA 5DT1L 2ORBL 4M8QB 2EE9A 1OLZA 3KPSB 4Q6KA 5EZJB 3ROOA 2ZUWA 4NQCE 4HCRH 5IQ7H 5I6NA 5F96L 3RGVD 2Y1YA 5LAPA 2EYTB 4KJQD 4QTFA 3WTYA 4P5KA 2QELA 3CWGA 1FWXA 4HFUH 3DROB 3DNKA 3BDYL 4J3VA 5E8EA 2OFQA 1HX0A 3SKMA 1NLDL 2IAMA 2ICEA 2Z92A 1FL3A 1DJIA 2P8LB 2J44A 3VU2A 1FZKB 2WUCH 4L1HA 2XVLA 4G8IA 4JM2D 1HXMA 5IJVA 2KT6A 5G5DA 1H15B 1YEDB 4GRWE 3RWDB 3WEXB 3RVTC 1A0QH 3D48R 4EZLA 1N6QL 3BT2H 2JXMA 2EDJA 1AE6L 4KQ4H 1SM3L 3A0OA 3QDMA 2VDQH 1CL7H 3TJPA 5E08H 2EQDA 2CBQA 3RZCC 2EEBA 1YMHB 3TH2T 4JZJA 4NP4L 2EECA 3B37A 4V2CB 5JOPD 2H2SC 4YDJB 2XIDA 4BKSC 4DN4L 1FO0L 5A6LA 5B38A 1R3IL 3KPRB 1RZ8B 4WEBL 1PZUB 1R33A 3EDJA 4ZO6A 2N1KA 4ZDHB 3CDYA 1NA8A 1NL0H 2PW2A 3O2VH 4MS6A 4RZKA 1NIDA 3QUMH 1E4KC 2CGRH 3U9PH 3VXTB 3ULUC 1NDMA 4NUPA 4B9IA 1DBBL 4ISVA 3WFBL 3F6LA 2ZOLA 2YUXA 3I6GB 4NLHA 3QFJD 4HUXB 1DTUA 4JRXE 3DVGA 2NR6D 1MUJA 4M6MH 2F54D 5J13C 2IO5A 1DVFB 5DD3H 4Q52A 2W1NA 4M56A 4PVLA 4A04A 3ULUE 4XAWH 5AVVB 3B9EA 3L4VA 2ZNXA 2KUTA 5HDBB 1E7UA 4R7VA 2Y2TA 1J5OH 3P2BA 4A7TA 4P9HL 4CILA 3HB3B 5E95B 4ODWA 3ETBF 3FQ1A 1DLFL 5BVPL 1JZ2A 2VNCA 2JJSA 6TAAA 3UAJD 5C0EB 1KPVB 1PKOA 4O9HL 4AIXA 3CUPA 3DDFA 4F7EB 1OE1A 1T3FB 2OI9C 3TGXA 1GR7A 2NY5L 1TO5A 5IEHA 4IBZA 2GJZB 4TVPL 1OF2A 2QGBA 3IJ7A 1M6OA 1ID5I 1MCHA 3F83A 1VCAA 2ZOOA 2VXUH 2VLLA 1MVFA 3FTGB 2AITA 3IN0A 3CK0L 5KYWA 4KTGA 1BJ1J 2G5BB 1ZA6B 1G7LB 3MSPA 4XNDA 2EADA 2OA9A 2LTQC 5AVWB 1EAPA 2FLMA 2YD5A 3I2CH 4Z7UE 1BD2B 5DJZA 1I7RB 4AUJA 2UXTA 1JYNA 1U8JA 1I75A 5DFVD 2PTTB 4LLQA 2D7OA 3H0TA 3A3YB 4NUMA 2Q6WA 2GY5A 2W07A 1DCLA 2XPYA 1RLBA 3QDJB 1R5VB 3MBEB 2BS8A 3JUZA 3N1PC 2YMXL 3JTSA 2RFXA 3H3BC 2J7LA 3PWUB 3K2IA 4D0DB 3Q6FB 1KLGB 2YIHA 3LKNB 5DS1A 5BRZA 4O2FA 4DP6X 1JGLL 5FUZH 3SYOA 1UQSA 1ZWIA 5C09B 4LCUB 1G9MC 4Y5YA 5FLUA 4G11A 4YHIB 4Y9CA 2H26B 4YWGL 4WU5B 1JZHA 5F8QC 2APWA 4MYPA 3ZHLA 1LE5A 4NNXA 4YE4H 4UTBA 4H26A 3DI3B 1HWGB 3LNFA 2F8VA 2JK5B 4X9GA 2VZSA 1DSFL 1A1MA 5JORA 2C5DC 1RMFH 3A21A 4WY7L 2V2TA 4HH9A 3N85H 3NZSA 3N6YA 2F58H 1MJ7H 5ITFB 3VTTA 3OB0K 3EJTA 1AY1H 2CG9X 1T4KA 2IPUG 2R4SL 3AG2B 4X4KA 4DGIH 3EGSA 1KB9J 3QWRD 5L8LB 4APQB 1F11B 1EJFA 2X05A 3BP4B 1TVDA 1CD9B 3POCA 3QUXC 2AEQH 2YPKB 4PJ5B 3T0WA 2DRUA 1NCAH 3BLKA 4X4ZA 3DJZA 5T1DL 1PKQA 2A9CA 1G7JB 4C54A 1U58A 2WUBH 5E8DL 5K9JH 3MXWL 1NFIA 4YE0A 5EDSA 1BQ5A 4PJGA 4H4NA 4JGMA 2ARJA 3NSCA 3RL2B 1CBVH 1GYUA 2YGQA 3FQTA 4K7FA 2IMMA 3KGTA 3IMWA 4G3YH 3S2CA 3GS0A 3LN9A 3BDXA 1FPTL 3MKGA 1YNLL 1S7SA 3QQ4A 4OZ4B 4PP2A 3H85A 3AU0A 4GQ9L 1DQDH 3DV6A 2ZG3A 3RY4A 4Z7QF 4NENA 4LSRH 3L9RA 4IOSA 5KS9E 5HYSB 5IFAL 3PL6D 2I69A 1ZK5A 4P2QD 4HU2A 4M8VA 4ZMPA 1A7OH 2VR7A 1N4XH 1ZT7A 3LKRA 2D4DA 4PYGA 3D2UA 1O7SA 3KPSD 2XY1A 1WFOA 2VXTH 5LGHL 3EGDB 4AVJA 1IAOA 4WDIA 3V6ZB 5B7FA 4S1QL 5J3HC 3HJEA 1R4XA 3UAEA 4BSVB 5LCVH 3WGVB 1Y07A 5EOQH 4CRPA 3AS1A 4K3JH 1SJEB 1MFUA 4QLWA 5D2LB 3CVDA 1NCDL 2HJFB 5T1KB 1KCUH 2WQUA 1AFVL 5IW6A 4PRPE 4S11A 5E8PA 3SDCC 4ONFH 5D1ZB 4AQ1B 1XCQB 5IF0B 4X4YA 4PP1C 1OW0A 2TRYA 1ZHBA 2KQNA 2X2IA 4X6DE 2HZHA 4KKZA 2I24N 4KDTA 2BWDA 1WBZB 1J05B 4P2RB 2NYKA 3MRLB 3MRIA 4J8QA 1CD0A 4U1GB 1F1AA 2M8XA 1JUFA 3QUYB 1WFIA 1YUKB 3KLAB 5CU9A 5EN3A 4QRSA 4OZIE 1T4WA 4W9CC 1A6AB 1Q9LA 3P0GB 1TENA 2O4EA 3QH3A 3VE0A 5DJYB 2Q10A 3KPRD 4FERA 3WFZA 4CVXB 4EQ2A 3MN8A 1UOLA 2WVVB 2CDEB 3EJCA 4JFVA 1NDTA 1EV2E 1UG9A 3GUTB 4JK0D 1FV1A 1JGUL 4HG4K 3MO1B 5D7IA 3JVFC 3X3GL 2W9EH 4MXWH 5BS0B 4N0FB 1M42A 2BVOB 3WKML 2R2BB 1Q9KA 3QXDB 3QHFL 5H37G 4U1KA 5F1IB 2VT0A 2G9KA 2WBKA 1GJWA 3GPSA 3JV6A 5IMKA 1DVFD 1YCSA 1YY8A 3AQYA 2AQ1A 4RDBA 5DYOA 3SOTA 2QBWA 3VXSE 3MRJA 3CDCA 4JVWA 1O5DT 1CFTB 1NOLA 3GI8H 2W0PA 2EH7H 1E8YA 4WHYH 4Z7NE 2YWYA 1KBVA 4U1HA 2CLVB 2LFGA 3HB3D 4UNUA 5AVQB 1LO4L 3AACA 2B9BA 5DS8A 3RVWD 3QJUB 1JK8B 5JHDA 4DCQB 4DZBA 1EHXA 1S7RA 4FQ2H 5FA4B 2XWZA 1ZT4A 2D9QB 3ZQXA 4Y19A 2QVKA 3IDNA 1VFUA 2FATL 2FVNA 1Z9PA 4G9DA 3VTMA 4LQ1A 3GTVA 1IAKA 1YYML 1P1ZA 3RIAK 1GGYA 3MPCA 4ZUWB 4P5KB 2I25N 3FL7A 4KKPA 1CXEA 5DJDA 1UEMA 4DZ8A 3PWJA 5DS2A 2Z9TA 5E8EB 4PGBA 1UC6A 1HQRA 1IEBB 3I74A 3NZ8A 4RRPM 3U4BL 2EYSB 4Z5RB 4WLCA 2IAMB 2ZXCA 3K1KC 3GBLA 2KZ1B 4KQ3H 3ZYOA 1T66D 1HEZB 3A67L 4YC2C 2CWRA 4G8IB 5C08E 2X2UA 2C26A 2IXQA 5G5DB 1MVUB 4LLVA 2ZJSL 1M2VA 1ZXKA 2B3IA 3VFSA 4BJLA 3OR6B 1IGML 4KGLA 3P02A 2OMVA 1AXIB 5GJTH 2PKDA 3I50H 2BOCA 3MBED 3S3SA 1IILE 3OC5A 4LLWA 3QJFA 3QDMB 4HULB 3DYMA 2D0FA 4LCVA 4OLUL 1QSVA 4P5TC 1TU2A 1C1EL 2EXWD 3K0YA 3QRBA 1S9VB 6PCYA 4JBSA 5C0GA 1BECA 3NJVA 1OCWL 2X40A 1L4IA 3L2LA 5B38B 5JQ6H 2C34A 3O2WH 4RETB 3D07A 1HH9B 1IAIM 5F88B 5C09D 3TBTB 4KROC 1GYVA 4ZS7H 3OHMB 3WS6A 3HKFA 1L6PA 1J8HB 1NGYA 2AJUL 3GMMB 4AK1A 3O41B 1QI3A 2QKSA 3J07A 2MHAA 1W72H 3DVGB 3QQ9D 1MUJB 3MJ7A 3L4ZA 4KKBC 4OLWL 4PSRA 3IBEA 4WI7A 4DK3A 4JS7A 1K85A 5IEKA 1BREA 3ZO0A 3BJLA 5FV1L 3L8QA 4DO6A 4KK6D 4FNLH 3WTXA 3U79A 2GSIB 1WWBX 4YDKL 3BZDA 3SDYL 2VN4A 4LSQH 3D9AH 2BSTB 4HSQA 3D3VE 4ODWB 1O9WA 1PD0A 4FADA 3CSPA 3QS3A 1ETB1 3ZL2A 5HP5A 4KKNA 3CUPB 3MLUH 3DX6B 3S5LB 2EUVA 2NX5B 1EEYA 4OZGF 4XWOC 3T77A 4PJ5D 5K9QI 1G7MB 2F1EA 2TSBA 3Q3GA 3SE4C 3GRBA 4NN6B 5IEHB 1J9CT 2ZAIA 3BZ5A 3QDGB 3EFDL 1OF2B 1HT6A 1YMMA 2VLMD 1M6OB 1QFWM 2OM5A 3BUPA 3HBGA 2J72A 2PCXA 2WNWA 1RUAH 3MOAH 4IRSB 4JR9L 4M8UA 4OUOA 1IBGL 1I85A 1IV8A 3TV3H 2ID5A 4NZTL 5ICXB 9CGTA 3PPSA 4E2OA 1DBKH 3V52H 2DIBA 3OAYK 1EAPB 1AG6A 1JZFA 2AQQA 2CM6A 4R7XA 4OGAD 2PTUA 2L8AA 5BO1L 1FGVL 1FN4A 1YA5A 3BHBB 4K4KA 1JTTA 4LLQB 1W0WA 3ZRFC 2J12B 2RQ8A 2E3VA 3WNJA 3CFQA 3H0TB 5C0AB 4FNQA 3L2NA 1PBYA 3RVXC 4PWGA 1YQ2A 2W07B 2P4AB 1XCWA 3ZZQA 1R9FA 3LZNA 4ODXB 1YJDL 5MEQA 5FHAH 4PJIE 4X6CB 4JG0H 5BRZB 4O2FB 2BSRB 3TIEB 4IGBA 2CDFB 5E1QA 4GUPA 1KGYE 1UQSB 3THML 3TA3B 3OLDA 3T08A 3ARTA 1A6ZB 4HIEA 5DUML 5T1KD 4NJ9H 1HXKA 3SHSA 2F8XC 3H9HA 5D1ZD 2YLHA 3T4AA 2DYPB 2JLPA 4S0SD 3LXBA 4H26B 5FKPB 4LCCB 4BQ9A 3K71A 1MLBA 3NEXA 2BP8B 1A1MB 4PRHE 3E6FA 2V2TB 3C5SB 2V9RA 2X3CA 1ZKAA 1QPXA 1RKRA 4ZMNA 4XZ4A 3QUYD 2GPZA 4GSQA 2C9SA 1WVZA 1T4KB 5EU6D 4BZ1L 1F02I 4Q0XL 4HXAL 3SBQA 2A2QT 4ZBJA 1N0XL 1TTRA 2ZXGA 1KGIA 5HPMA 4OLZH 2XHNA 3DIVA 1NQBA 4KKLD 2R2EA 2W0LA 3TCTA 4TOYL 4MRCA 1VDGA 4F9LA 5MENA 2IBGA 1NCHA 5J6HB 3EYQD 1PKQB 3MRQA 1LEGB 1U58B 2FJFB 3V0WL 4XMTA 2WWKO 3NCWA 4AG4H 3FQXA 2V5MA 1TLKA 2NYZA 5D1QA 2XC8A 1HSAA 3G7TA 2DJMA 2APXA 3VRJA 1JN6A 2IGFH 3PIQB 5DSCA 2VDPH 2ARJB 1OP9A 3S35X 3FQTB 4K7FB 3RY5A 3PG2A 2PPAA 3II1A 4AKQA 4DTGH 3ARDB 3G6JB 3JWDH 1TKWA 3KCWA 1KCRH 2GT9A 4HZLA 4PP2B 1S7SB 4U2YA 3IDYC 2BCMA 5CSBA 3ZHFA 3PQYA 4IRJC 3FMGH 4QOKB 4K8RC 3ILDA 2NZ9D 3AW5A 4FNTA 3N43F 4ZOAA 1XVSA 1JPEA 3L9RB 4CVZA 5C0BD 4YO0B 3WEAA 3TP4A 1QPKA 2OTWB 3CLEL 3EYVA 4JPSA 4RH4A 1HWHB 4HKXA 1PU0A 1BVKA 4F1SA 3QYMA 2RCSH 4YDMA 4URKA 4K5MA 3LKRB 3IGAA 3D2UB 4M1CC 2WK2A 5CF3A 4HUUB 5IK3A 1G1YA 5C0CA 3IRPX 3H56A 3P3TA 4NZUH 3OPZL 1U3HC 2WLMA 2CH8A 1JMZA 4FMVA 2VO8A 4FFVC 3MR9A 4B95C 3V4PL 5LXGL 4YXHL 1MWOA 2QQLL 2VW7A 3D33A 4LGSB 5EUOE 1DQLL 4XO8A 5IW6B 3H9YA 5CO1A 5F89A 3MODH 3P9LB 3PDGA 5EO0A 2TAAA 3DX2A 2Z7ZA 1ZHBB 4E42A 4TULH 4PRNB 1B0RB 5DRWB 3D69A 1BZQK 4O51A 3NP3A 2HJLA 3HBPA 4F92B 1ETZA 4G6JH 5AVRB 5BOPA 3QDMD 4MJIA 4FQPA 4XNQB 2L7EA 2J6EA 1HILB 1L7IH 4YK4C 4QRSB 1MFAL 3KWXA 4R8WH 4XPTL 1Q9LB 3QH3B 3VE0B 4RDQG 1PX8A 3IFNH 4Y2DB 3W81A 5C07A 5GJSL 2VN3A 3N04A 1IO4C 1DUZA 4WFFD 3ASNB 4YSPA 4WSGA 1G87A 3AREB 5JNYB 1BEXA 1MHCA 3L5WB 5DVPA 4ANWA 5D7IB 5BZXA 3UZEA 3DX9A 1J8HD 5FDYA 4LSUH 1M7UA 4B9KC 1CXFA 4HIXL 4WWKC 1UWXK 2OL3B 3HG1E 4ZSOA 4CBPA 4KOCA 4X5RA 3L5XH 2XFGB 1KTLB 5AW1B 1T2QL 1EMTL 2P43B 1IAIH 4XP6L 4UYPA 1X5YA 5HGDA 4NM8L 3SDDA 2NZIA 1U8IB 1YY8B 5DYOB 3GMOA 2ICES 3IAQA 2EO9A 5DO8A 1CR9H 1FAIL 3MRJB 3ZMEA 4ZMOA 4O02L 7FABH 5GZNC 5J7CC 1Q8MA 2OP4H 2WYTA 5F7KC 3HIZA 3BE1L 3QQNA 3WKQA 1QYGH 3IDMA 4HF5H 3UYOD 4S2SA 5GPRA 3QJSB 1M1SA 2CRYA 5DS8B 5DDHB 3M45A 2VR9A 4OGYH 4R9HA 4UU9A 1AD9B 3AUVA 5JHDB 2JB5H 3ECUA 1AI1L 3G5ZB 3JZYA 4JZNA 4OSUH 4Z7VA 4YEFA 2NX5D 3IMTA 4FA8A 1E65A 2IGLA 3U4AA 5J56B 4GG6A 4N1CA 5IB5A 2J43A 4XCEA 5E56A 5SWSD 3IDNB 3QDGD 1OOAA 4IRSD 4MNGB 4J5VA 3V6BR 3KPNA 4K2UL 1P1ZB 1KC5H 3H3PH 4QRAA 3Q8FA 5DJDB 3PWJB 2F7OA 2FLRT 2OQJB 4LASL 5ESAA 3IMRA 3T8VA 4PGBB 1HQRB 2HKHL 3NZ8B 2O5YH 4YHOL 2DTML 3MV7E 1JGEA 4LDEB 5FO8B 1QFWH 2DL9A 3GM0A 3NGBB 2IXQB 4YHNA 4HVBA 1J5DA 4LLVB 4I3SL 4Z9KB 3O3AB 5C0AD 1HFUA 3ZMNA 1WQVT 3HZKA 3II2A 4DW2H 2PNDA 3DURB 1G5GA 3ZKMC 1T83C 4LLWB 3QJFB 1IJ9A 2MEJB 3JV0A 3BUYA 4IBUA 3NK3A 1KIQA 1ZSHA 1BW8A 1SEQH 2XIIA 5C0GB 4HPOH 1U4FA 12E8H 4KMLB 3WLWC 5C7XL 4W81A 5BRZD 1UXSA 3HC0B 2KH2B 1N8OE 4BSWA 3DXAD 1MCOL 3LN5A 4LLMB 4GAYA 4M7JH 1MDTA 4DK5A 1U3YA 3TA3D 1DFBL 1QNZL 1AD0B 3L17A 4U1LA 1RUQH 1CDBA 4RAHA 1NGYB 4TUOB 1T6WA 3QJXA 5A2AA 1DJHA 1WUZA 3ECQA 5D4JA 2DYPD 2F18A 2I60H 3I6KA 3ZUCA 3OSVA 4GAFB 3LPPA 4OCYH 4X5WA 1SBSH 3TWCH 2X0UA 4NQQA 4JKNA 4OKVB 4ZZFA 3LX9A 1D7DA 1D5XB 1QD0A 3RJDA 4MMZA 1H0DA 3SGEI 4RISL 4I9WE 2IPUK 4FQXB 1DLHB 5DD5L 2HX7A 5I5JA 3ARGC 4JY5L 3QIWC 3D39E 4HP5A 1U9KA 4QHNB 4S0HA 1LO0H 1T89A 2AQSA 3WD5H 1EEYB 2LFEA 1FZOA 3NIDB 3RFRA 4IRZH 3T77B 5JIMA 4LCIL 2JI2A 3IBOA 3BQUA 3LCYA 1KBPA 4R4FL 4JFEA 3BPCA 2X1QA 1DO5A 2VDMB 1UB6A 5GS0L 2VKWA 1CC3A 1PZSA 4HWBH 2Q76B 2JLLA 2AGJL 2X6BA 3VX1A 4ZMVA 4ZPVB 2Y5QA 2C9XA 1RZQA 1XQ4A 3IPEA 1JYWA 4UB0L 4WHTA 4OI8A 1JZGA 4AL8H 5HBBA 4JFOA 4LLDB 4OU3A 2NSQA 4PPTA 3ARDD 4XMPL 3KXFE 2G3XA 1EEQA 3TXAA 4CADB 2QHRL 4HGKC 5EZLA 4QOKD 4EVNA 5G4OA 2O30A 4UT9H 2JJWA 4FJYA 3BRDA 1FN4B 5KW9L 1GRWA 1DJYA 1BQHG 1W0WB 3ALWA 4JHBA 4ALAC 2HP4A 5CEZD 4BM7A 5TQ2L 4BSJA 5AVTB 3UTSE 4AYFA 2QQNH 3DARA 1EH9A 3GSQA 4PJXF 2CUIA 4XC1H 5GGUB 3VRLE 3CIAA 4YBLB 5C1MB 3V10A 3D2UD 1YY9D 2UZXA 3HEIB 4G80A 2OR9L 3F7VA 4WTZA 4J6RL 3RWIA 2CXKA 1NGZB 4L2LA 3MRBB 4L8SA 1BQUA 2MNWA 4IGBB 5BV7H 4EZJA 1BQKA 1JMXA 4GUPB 3UDWA 1E5AA 3MA7B 1E5ZA 4HIEB 3DOSA 1RV6X 1QEWB 4LSVL 4PGEB 4ADGA 4NP9A 2BERA 2P28B 3RY6C 2KDGA 3H9HB 5D72H 1JG9A 3JWNH 3T4AB 4HDIA 3M88A 4B9FA 3K71B 5D7JA 4UMGA 1NBZA 3ZL1A 1MLBB 1WRFA 3NIFB 3QPXH 4L4TA 3QQ3A 2J8UE 4MNQA 4N2GA 2K70A 1CXLA 3CMOL 3ZE2B 3SE9H 3E6FB 3LRSA 4FFYH 1FLRH 3FO1B 1V3MA 4IDJH 1B2WH 2ATKA 1MNUH 1QWHA 2PYEB 3GNMH 1M7XA 3U7YH 4QRFA 2FSDA 2DLGA 4LDOB 3LXAA 3QNZA 5BRQA 1LMIA 2XG4A 3NFSH 1K8DA 4Y2DD 3CX5K 4HUKB 4TSAL 1T1XA 2EINB 2R2EB 5JW4M 2JF1A 4XNBA 4N2AA 1ZHNA 5LDSA 1ZGLA 2PP7A 3SZKC 2WXPA 3MRQB 3ARUA 3ARED 4QNPF 1BLNA 2AQTA 1JF1B 1C12A 4MD4A 3C5ZC 3TU6A 3U1PA 3RAJL 4OTXH 5D1QB 3VI4E 3WO4C 1HSAB 2OYMA 3B7YA 2KZWA 4I48B 3VRJB 1JN6B 2KKQA 4ABQA 2AHIA 3MV01 2A74C 1GVIA 4YSCA 4JO4L 3GDBA 2VAJA 3ZXAC 3BVVA 3L3DB 3VH8A 4Z8FH 1TKWB 1XSKA 1QVOB 1FORL 1BMZA 4XNZB 1OAXL 3H4FA 3PQYB 3E8VA 2GIMA 2I27N 4NLAA 4EN3C 3TYGH 2M83A 1KGUA 4OKDA 3JWOL 1FO0A 1NGPH 2DY2A 5F7DA 2XNAA 3BVWA 1PY9A 5KBPA 3MRMB 4XP5H 3EYVB 3BWSA 3NCFB 4HKXB 5KZCB 1BVKB 2QQKL 2DQEL 2Y5EA 2KBGA 4HT1L 1GY1A 4PLKC 1PIGA 2DQTL 5B39A 3GS7A 3STLA 1KFGA 1INEH 5IK3B 5FW6A 4WI0A 1WAEA 2LVCA 4ODSH 1LO5B 1JZ4A 4BRJA 1P6WA 2FX8L 4OB5L 4MQ7B 1RURL 4WEEA 1NCCL 4ZMTA 3VM5A 1QUNA 2HFGL 3F7QA 3MR9B 2VMDA 4MX7A 1Z2KA 1JGDB 3J7HA 4O5LL 1BYOA 4E41E 4TUUA 3KLKA 5EO0B 1K72A 5D7LE