4RGND

Structure of staphylococcal enterotoxin b bound to two neutralizing antibodies, 14g8 and 6d3
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
217
structure length
210
Chain Sequence
VQLQQSGAELVKPGASVKLSCKASGYTFTSHWMHWVKQRPGQGLEWIGEIDPSDSYINYNQIFEGKATLTVDKSSTTAYLQLSSLTSEDSAVYYCARTAGLLAPMDYWGQGTSVTVSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin/immune system
molecule keywords Enterotoxin type B
publication title Mechanisms mediating enhanced neutralization efficacy of staphylococcal enterotoxin B by combinations of monoclonal antibodies.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 36
structure length 210
sequence length 217
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rgnD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rgnD02
3MV01 2YA2A 2VITB 3F7YB 2F19H 5D5MF 1KV3A 3U6RA 4S2SA 1KJMA 2HH0H 2EDRA 3NBNA 4JZJB 4Y4KA 2HFEA 2XQBH 4ODWA 5ICZB 1Z9LA 4KVCH 4R2GD 3GIVB 1CFQB 3O45B 3HZYB 4P3CH 3T0XA 4XB7A 3QDJE 5D72H 5IMMA 4MJIE 3E8UL 3D2UB 4JRXA 5HD8C 4O9HH 5F88B 3BRGC 5DFTA 2IH1B 1Q9KB 4LASH 4OGZA 5T3XH 3NCCB 1XF5B 4PJ9D 5DJ2B 1NGXA 2W9DL 4U6VH 3JZ7A 4WHYH 2P42B 1A6VH 2X4SB 5J11C 5ICXA 2XN9E 4O2EA 1EERB 1S7QB 1FZJB 4POUB 2XKNA 3ZKSD 1FVDA 4N5UA 4NQTA 4DK3A 5IK3A 4NQVA 4RFEA 1NCCH 4Q0XL 2BSRA 3KPQB 2DQJL 4AK1A 1AO7B 3VG0L 3OB0H 1M1SA 1T1WB 4QXTA 5IFHH 4CL7A 4WY7L 4MZ2A 5SWZA 2DQCH 2PTVA 4O51A 4XP4H 4K71B 3K1KC 3BE1H 3RIAF 4X7DC 2MPAL 2XQYG 2XTJC 3IVKB 1ND0A 2M8XA 3EKCA 2EKSB 1DN2A 1MI5B 3TO4A 3H3PL 1FNGB 4LLWA 3MRBA 5HI3D 5C0GA 1EO5A 1J1XL 4OZ4A 1FPTL 1ZA3A 2HJKB 4EIGB 3CFKA 3ULVF 4FMKA 1A3QA 3U7AA 4XPBH 4EDWH 5HYFA 2YS4A 4MXQC 4K7PY 1I8KA 5GRWA 4K23H 4JQXC 3WJJC 3VFOB 4D94A 3ESVF 4ZNCD 1NLBL 2F58H 1AGFA 5EBGA 4S1SH 1I8IB 2JELL 2BY0A 1CXHA 5CD3B 3SPVA 5JZ7D 1TZHA 3EDFA 3KPRA 1RULH 3EDJA 3QJFB 1DLHB 3ZT6A 3WS3B 1HIMH 4KFZC 4J7RA 3H0TB 1S7SA 4ZPTB 1G7LB 1FYTA 3H6JA 2DWDB 4NN5B 1VFMA 5C08D 5FB8B 3GSRB 5F7YC 3ZTNL 3NIFE 3MRDA 2NXYD 3S34H 4XC1H 1QHOA 3RZCC 4Y0GA 4JKKA 1XGTA 4RAVB 3QH3B 1F58L 4JDZA 1JPGB 1BVZA 4DK6A 2R23A 1FBIL 2HA1A 5ALCL 5AZ2H 2W1NA 3ZO0A 4EZMA 4ZNEE 1RHHB 4GMTL 4JFHD 5BVJB 2AJZA 4PY7B 3EJJX 3BAEH 4WW1A 3WUWA 2EIZB 4WTWA 2Q86B 4CVZB 2Z35A 3ZYIA 5FKAA 2BRRL 5JUEL 1R0AL 4NQCB 5I8KH 5ELIA 1RUQL 1WZ1L 1VGKB 1BQLL 3KGRA 2VSCA 1INQB 4P9ML 1I75A 4QRTB 5ACMA 2BVPB 5KVDH 4YHNB 3FQNB 2FATL 5DLML 5TDPB 5BMFL 4FQIL 5HYJD 4G43B 4M5YL 4M61A 2Z93B 5CINH 3X11A 1O7SA 5JOEA 5T3ZH 5C07B 4V1DE 3V6OE 3LRHA 2AJYH 3VE0A 5DZOA 1IFHH 3BGMB 2B4CC 2DMBA 3V4VH 4UTBL 5IW1B 1QOKA 2W0PA 2AV1B 2R9HD 1WWAX 1FLRL 4LIQL 3QEQD 4FNLL 1IVLA 5FO8A 3O8XA 5EORH 4I13B 5I71B 1HXMA 1Z9SA 4PUBH 4LCWA 1O0VA 4XT1C 4U1GB 4XVTL 1IAIL 1I4FA 1NBQA 1MCLA 1SEBA 2VE6B 3RPIA 2Z91A 1U8MA 25C8H 1UXSB 3PWVA 2A74B 3V0VB 3VXRE 1UFUA 4P2QE 4NQED 3MJ9L 1I9JL 1GIGL 4GUPB 4HC1A 4JFYA 4ZO6A 5ID1A 3PG2A 5I2IA 1D6VL 3QHZH 1IKNA 4HKXB 5FGRA 3WXWL 2E7LC 3PL6D 4G6ML 2GEEA 2ZKHL 3QB7C 4LLQB 4PP2A 4FRWA 4PJAE 3K4ZA 4G8GD 4HIIB 5DD3L 2BVYA 2YKLL 3KHQA 3GGWA 5MHSD 5C09E 2IH3A 2GAZA 2E7BA 1FDLL 4AQ1B 4TTDC 5TDNB 4GRWF 4JFFA 5I15H 4MNQE 5HPOA 3B6SB 1FZMA 1ONQA 1S3KH 2BC4A 4L4VA 4RIRA 4PJEF 4GKSA 4LHUD 1OAKH 3E2HB 1P4BH 4YQXL 1EIBA 5IBTH 1JNJA 1U8PA 4M43L 3G9VA 2NY3B 3PNWA 2NZ9D 1DQDL 4U7MA 4M7LH 4R7DA 3U9PL 1A3RL 5GRUH 3C5JA 3DV4A 1ORSA 1AD9B 1SY6L 2QSCH 3RA7L 1H3UA 1JNLL 4X6CF 2Q20A 1AXIB 4Z7VE 4A2MA 5IP4A 1OY3B 3G5VA 1WIOA 3W0WD 4AL8H 2ARJB 4J6RL 4AJ0A 1AGDB 4QRRA 3DXAA 3MV7A 4P0DA 3GK8H 4R2GB 4XNUH 1T1YB 3EYOA 3O3EA 3PWUB 1Y6KR 3EJZC 2Y36L 5DQ9A 4PJ7B 5C6WH 4OLWH 4HK0B 1CCZA 3S6CA 2H32B 3QI9D 4HIJB 4PIRF 4QO1A 3RWGB 4F9LA 2EICA 4TUKH 4ODUB 2GTZB 4JFED 1Q9OB 1WCBA 3AROA 4PJ9B 1QRNA 1G7QB 1FRGL 3LPFA 3T2OA 1ZT4B 3D9AH 4J3TA 2UWEB 5CAYB 3RTQC 3BZ4A 5BRZA 3MGOB 1IEAB 3G5XA 2VR5A 1A2YA 4P5KB 5A2LH 1A7PL 3QUXD 4OJFL 4LSPL 2FEEI 4IRSC 4B7LA 5DK2B 5CFHA 3NABL 4WHDA 4OLUL 1E4JA 3V7AE 2EC9T 1YNKH 2OJZH 3G04B 2LVCA 5IR1B 3STLB 4K3DH 3UYRH 2VL5A 3FRUB 2WNGA 2AEPH 3PWPE 5K59F 4I4WA 4LRNH 1NFIB 1N7MH 1JVKA 3RL2A 2R0LL 4EKXA 5GHWH 1NAKH 3U83A 1JUFB 3WNOA 1O5DT 4EOWL 4JKPH 5SV3A 3NCJL 3TGXA 3NCEB 4R9HA 4E0RB 3DVGA 3GMPB 3O11B 4O5LL 3M45A 4S10A 4MS8C 1UACH 2DBJA 1YDPA 4JFPB 3HHRB 1WC7A 3QEGH 4U1HB 1TIUA 5E8DL 3IFOB 5CZXC 2IBGA 5CSBA 1YEDB 5IBLD 1B2WL 1T2QH 3RWFB 3TN0A 4CJ1A 1UQSB 4XC3H 5FDWB 2EZ0D 2CKBH 4MA3A 1RZ8A 1X4ZA 5FA3A 5GS2H 1VFUA 4OCWH 3VXUA 2Y25A 1A7RL 4H1LB 3V4PL 1MLBA 3O0RH 2MHAA 2R2CA 5KANG 5TPWH 3ARGA 1LK3H 1RIUH 2YC1B 1EFXA 5L9DH 4PR5B 2VZSA 3MCG1 4OFPA 4KJQC 1A6UH 2EH7H 1X6LA 1HHKA 4CVUA 5C08B 5MERB 3CVHL 4OAWA 2IQAA 4GRWB 4E5XB 4A6YA 3FFDB 4HBQA 1QFPA 2NXYB 1IAOA 4NWUL 2VLMD 3T0ED 3TBWB 2DTSA 4PJEB 5JXAL 1JTPA 1EH9A 4U1NA 3PJSB 3VMNA 3SO3C 1BOGA 4ONFH 3MRQB 1QSED 1HHHA 3WFHA 4CKVX 3A6CL 4N5EC 3MYJA 3WLWC 1NCAH 1N5YH 5E99H 4CN1A 2OR8A 5GGTH 1YY8B 3U7WL 4ZTOH 4X6CB 5GSVB 2X05A 3DUSB 4YJZL 4GG8A 4Z77B 4YIQB 5DO2D 1ZA6B 5FUZH 2UUDK 1G7JA 1W0WB 4NGHH 8FABA 4ZS7L 3BZFA 1UM5L 5DJYA 3V2AR 4K3HA 4YK4C 3HI6H 4IRZL 2VLJE 4LCIL 4QRUB 4X9HA 3D85B 1A1OB 2A6KB 3I6LE 5EC2A 1OT2A 3RWIA 3QEHA 3RX5A 3EO0B 3L3OA 4X80H 2DQFB 3OGOE 4P2RD 2A83A 5BS0E 1CWVA 5EOTB 5AZEL 4JFDA 3OGCB 3R0NA 2AJVL 3SDCC 4KKAD 4LEXH 2PETA 2OQJB 5I1CL 3ZKQD 3D39E 3TIEB 3EFFA 2FBJL 4ZMAT 5SWSA 3C08H 1P1ZB 2YD3A 3QEQB 4LRIC 5HYQB 3B83A 4HUNB 2R4RH 3SE8L 3RWJB 4LGPB 2O5ZH 4FFYH 4KK9D 5F96H 3X14A 2Z4QB 2VZTA 2QEJA 1VSCA 5FA4A 5ESVA 4MB4A 2A0LC 3KNBA 4MD5B 1EAJA 1GAFL 4ZXBA 3FQTA 3LQAL 3ARXA 4PB0L 1JWSA 3H3KA 2OYPA 1QBLH 3M07A 2ZCKL 3RGVC 4H20H 2PN5A 4OZHB 5IB2A 3UJIH 5D70L 3RY5A 1QSFB 2GY5A 3CU1A 1C5DA 4WUUE 5BQ7B 4FFWD 5E9DE 2OTWA 3MNVB 5DVNA 1R3HA 1ZLUK 3BXNB 3AM8A 1YUHA 4G8GB 4PTUB 1GYAA 3L3DB 4BQBA 1PBYA 4GG6F 1D5MA 4H25A 1XIWD 4BSWA 1BGXL 4QXWA 4ISVB 2NY6C 3KPMB 1FNEA 4X0KB 1YJDH 4R96B 3KYNB 3TFKC 4PRBA 4DZBA 2PW1A 4S0SD 1FFPA 3GSUA 3JWDL 4IJ3C 5DR5L 3WV0A 5IVNA 1F02I 1TCMA 2QHLA 4L3EA 4Y8AA 3INUH 1OTTC 3BQUC 1JWMB 3WIFB 1Q94A 5KSVB 1OAYL 4HKJA 1G1YA 5GJSL 1CDBA 1CDIA 3STZB 2JF1A 1VENA 2LVEA 4EN3A 3F5WB 3DO7A 5D2LA 4U6YA 3PDOA 2Q6WA 4U3XA 4OSUL 5L7XH 5IW6B 4QRSB 3HUJA 3DMMA 3GMQB 2VIRA 3MLTA 1QFOA 3OR6B 5DTFA 3BH8B 4Z5RB 3N9GL 2BNUB 5FUOL 3HB3C 4O4YL 2EDBA 3CDGB 2IFFL 5T1DL 4RAHA 1GGIH 1Q9LA 4Q2ZA 4XCYB 5JXEA 4BFIB 4S11A 4HXAL 4WW2A 3U0TB 5HVHC 3JXAA 2PTTB 2VXUH 2XRAH 1A4JA 4RGMB 3QI9B 4U1MA 1IZKA 5F97E 3SGDI 3VFTA 1H3WM 1T21A 1NFDE 4JFEB 3N06B 5DEFB 1ZSDA 4MJ5A 3OG4B 3QBTB 4OF8A 2CUMA 2I9LB 4ZFZB 1BZ9B 5DJ8B 1Q1JL 4Y5VA 1C1EL 4E41D 4FZ8L 4RNRA 2ADJB 5HHME 1IT9H 3BRFA 3JVGC 4D9QD 3OAUL 3QUXB 3BESR 5CILL 5D1QD 3SBWC 2BVQB 3MBEB 4OF3A 3NA9L 3IB4A 4M4PA 4J1UB 4Y5XB 1BZ7A 2DLHA 2NY5H 2ED9A 1M6OB 3QWQB 1RZIB 4XMLH 1AGCA 4AEEA 3L7EA 2VXVH 2R4SH 4HUKB 2VC2H 1XCTB 1P4IH 1RMFH 3HFMH 3LQZB 1OD9A 4MQXC 2CO6B 4ZUTA 2V2XB 1L7TH 4Q6IA 3BPNC 5CIPA 3GI9H 3PHOA 1Q9WB 3HE6D 3QEUB 5ISZA 3QIBC 4KI5F 4G7YH 4XI5D 5DEGA 4M5ZL 4L4JA 5CUSH 3MFFB 2BNQE 4LKXA 4HD9A 5FYJU 2ZUWA 1B90A 3LKPA 2IANA 3OKMB 1N8ZA 3MRJB 1U8NA 3D87B 1OW0C 4X5LA 4KXZI 1QBAA 5IMKA 1NBVL 3UX9B 1BECA 4MJ4A 4YHMH 4ODSL 1CN4A 1UEMA 1G9ML 5EU3A 1V7NL 1D9KD 1YN7B 4JKMA 3MRNA 1HN1A 2EE9A 4KKCC 2UY6A 4BUHA 5JOFA 1MCCA 1ZLVK 2VLKE 5DMIL 3T0EB 4YDVB 2HTKD 1IJ9A 2Z0BA 4YHKH 4WUKH 1YNLL 2AK4E 3RIFK 1ZHKB 4HX1B 1QUNA 5I1LB 4NM8H 5D9SA 1GH7A 1JZ5A 3GB7B 4AIZA 1QSEB 3MLRH 2Z8VC 4HXBL 4ELMF 2FZ3A 2XWTA 5EU6E 2HRPH 3WSQL 4K07A 5H37H 1BVLB 3HAEH 5LGJB 1LWRA 4LVOC 2DKUA 2DQUL 4KVNH 4XPTH 3OAYH 1BMGA 1JFQH 5HHOA 3UTTA 4RFOL 5BV7C 3FAXA 4BZYA 4X6DE 1B4JL 1TNMA 2B39A 1TQBC 1M7IB 1KF9B 4J3UA 1BQHB 3IDIA 5HY9A 3ZDXE 4Y1AB 4TQEH 15C8H 1QBML 4HSQA 1H5BB 3FT3B 2VZ1A 3LMJL 4QY8A 3CVHB 4P2RB 1KG0A 3P11L 1UB6B 1YEHL 1T66D 5F6HJ 4PJBA 4C58B 1JHKH 1I1RA 5IVXA 2HN7A 5FKPB 3CAFA 2Q8AL 2HFGH 5INDB 5L6YL 3JWOC 2Y06L 4RWYL 4ZS6D 1TQCB 1QVOB 4Z7WE 1REIA 3U0PA 1ADQA 2AK1H 3I50L 2Q3ZA 3RWHA 4Q9QL 2HLAA 2PUQT 1CQKA 1J0HA 1RJYA 3BIAX 3BPOB 4HAGA 2BERA 3KPLB 5F8RC 4QTHB 4ZO9A 2W65A 2A6DA 4MNGE 4NJAL 5DI8A 3SKOB 4R90L 5D5ME 1QFUH 4TULL 4Y88A 3NMEA 3JV4A 3M1BB 4KHTH 3BMVA 4X99A 4I0PC 1F4XL 1A02N 3ZT7A 5EO9B 1K9TA 1AHWA 2X4NA 4NRZB 5D1ZA 4R0LB 3W9EB 2YK1H 5LQBH 1XIWB 3MR9B 4NKIL 5TQ2L 3CFEA 2X42A 3GRWA 3S88H 3VD5A 1G0DA 4RSVA 4Y4FA 4HF5H 3QCTL 4GMSH 3WFZA 1EZVY 1MJ7L 1NPUA 4PJ5A 3SDDA 3VGHA 3LEXA 5IIEB 1MJJA 1Z6JT 2J8UA 3CZFA 3LS4L 2YPVL 4QXUL 2DDQH 4UIKH 4OZIB 2OTUA 3ARDD 2WBJD 1S5IL 1W8OA 2G5RA 5E24E 1ES0A 3ORJA 4QEGA 1JPTL 3RZWA 3ARFD 1AJ7H 2PYEA 4XX1G 1F90L 4YWGH 3HE7A 4X5XA 5BJTB 3TBVA 1MRDL 1PGRB 3MOQA 5I1KL 3H9SB 1ZGLB 2FL5A 4P23A 4O58L 2FHFA 3MRFA 2BFVL 1DL7H 5JPNB 5AYQA 1JF5A 1TJHL 2GJZB 2VAAA 3MNZA 1U8KA 3ESUF 2X4UA 4DOHB 1XGRB 4ELMB 2GSIA 4J3VA 5LKNA 3QUKB 2N56A 5ENWA 5C86A 4BFGA 1FNAA 1R5IA 3FB5A 3ULVE 1VFAA 4M3KB 4IS6B 1A6ZA 4NO2A 3K0WA 1DBJL 4E41B 4Z76A 3K3QA 4N8VG 1NSNL 4CAGA 1BAFH 1IGIH 1P7KB 3B8YA 3CFBB 5F1IA 5T1MB 3V5KA 5D1QB 1NEZA 5E2WL 4YFDB 4HUUB 4PJIA 4XCNA 2FO1A 3OSKA 3L6FA 3QCUL 3QP3A 2FX8H 3QXWA 5E8NA 1JGLL 4Y16D 2ZOKB 2BVTA 3G6JF 1RIVL 3MLWL 3RDTA 3BP4B 5IV2A 1C5BL 4NO0B 5IFJA 2DYPD 1INEH 4NSKB 3BEVB 1RZ7H 2G2RA 5DYOA 5GGUA 2ITDA 3ARRA 3MODL 4WEBL 1MFEL 2H2PC 2GQHA 5FYKL 4APQC 1AR1D 1T1XB 3VWJD 1JN6A 4ZPVB 2KUTA 1FFQA 4L8DA 4OZGA 1S9WA 1WEJL 3MACH 2MKLC 3HE6B 1HZHL 3QDGE 4G8EB 4DEPB 1FL5B 4AEHH 1VEOA 1J5OL 1BBJB 4NPYA 4DWHA 4GW1A 2ZPKL 4OI7A 4JHWH 1ACYL 3V5DA 5LCVH 1EK3A 4PRAB 5HHQB 3HR5B 4BH7B 1EHNA 4WI7A 2X44D 1JPSH 3DECA 1YZZA 4I48B 2A1WH 2PXYB 2X5PA 2L4OA 3SQOH 3ECBB 3O6FC 2MNUA 3OKYA 2Z31C 1DDHA 1OARH 4RFNC 4DN4L 4R4FH 3NGBC 2P47B 3ARTA 3LN4B 3REWA 1KLUA 4UUJB 2KQNA 4P46B 3V5HA 4Y5YA 3V0WH 1YPZA 3BKCL 2ITCA 2Q8BL 4FQXA 4DTGL 2LV4A 4G6JH 1FJ1B 5L8JB 1NGWA 3DV6A 1OQOA 5C0CA 5C8JA 3IU3A 1HH6A 3L3IB 4LU5H 2FJFA 2AJXH 2IAMD 3TYGL 1GL4B 2DS4A 2CKNA 4P5MA 5DD5L 4LLDB 1FG2A 2BNRB 1B6DA 1UCTA 1CFTA 2EEBA 4OD3L 4AG4H 4JLRB 1CZ8H 4OIIL 4OLZH 5IB5B 2V9RA 2FWOB 2EO1A 3ZE1F 5C9JA 2VUOA 1X5AA 3B9KA 3V0AC 4X98A 1OTUC 4HC1L 1YQVL 5EO0A 1LEKB 3RVVD 4X7SH 2Q7YB 4O02H 1P53A 4YXLH 3D0VB 1U91B 1JYNA 2F8VA 2IJ0C 1KCLA 5D6CB 3ZDYE 1I85A 2ICCA 4JPKH 1IAMA 1J12A 1PKQA 2BSSB 1MIEL 3QIUA 4F7TA 5JW5B 5IKCA 4HCRA 5E6ID 5FIEA 4KU1A 5DJXB 4YE4H 2J5LC 3CFCL 1UA6H 1YY9D 3VXOA 1S7UB 2FR4A 2JCCB 4QHUA 1CGSH 1HE7A 4NUGL 3CLFL 2EYSA 2XPGA 4GRWE 3TV3L 1AE6H 4YUEH 3GHBL 4ENED 1DVFD 5L0QC 3PGFH 1NEZG 1EO8L 2LABA 4IEFB 1U8LB 2YEZB 3PE9A 5L2KA 4PJEE 3TNNB 3VW3L 1JF6A 1OM3L 3MRCA 4UAOC 3BP6B 5CBEB 2PKDA 5F6HI 3RY6A 3H9ZA 5KSAA 1OSZA 2IBZX 1GC1C 3MUJA 2AABL 3G6JB 3LN9A 3DRTA 5B8CC 4JANA 2FB4L 2XWJB 1FGNL 1PYWB 3GKWH 4XAWH 5JDSA 2L0DA 3SGKA 1TVHB 1FVEB 4KAQH 2FH6A 2GYSA 3QDAA 1YN6B 1XEDA 4JHZA 1DR9A 3L3HA 1KJVB 3QQ4A 3RVWD 3B3IA 2BCKA 5E8EB 5MP6H 5FO7B 4Z7UA 5CP3A 3I84A 1WAAA 3GJEA 4U1IA 4UBDD 3TZVD 5T5FH 5SV4A 3LD8C 5I19H 3LVEA 2E6JA 1HQ4A 2DWEB 4JRYD 4M62L 2DQEH 5D96B 5HI4D 4LKCA 4YLQT 3MA9L 4HGWA 2NR6C 5DUBB 5ADOH 3MREA 3QR2A 3MRGB 3QQ3B 1F2XK 1WTGT 3PGDB 1EVUA 4EUPH 4KUCF 1ZS8A 1TJIL 1E6OL 1OOAA 3GI8H 3ARDA 4TSBL 3T3PF 1B88A 2WBJB 3BO8A 4LVHB 5HPMB 1RZJH 1CK0H 3ARFB 3RAJH 5JHDD 4DKEH 2QR0A 3IDXL 4TOYL 4Y4HC 3VFPA 1H8NA 3T3MF 2Y07L 1KJMB 4KQ4H 5GGRB 4OFVA 2HFEB 5I75C 2VDML 3SJVA 4JM4L 4HIXL 1MVUA 4YDKL 2X89A 3MRRA 2A9NL 4HJGB 4M6OH 2XN9A 1MH5A 3HA0A 1A8JH 1OAUL 5EIVA 2XZQH 4OFDA 4BQ8A 3HG1E 3S96B 4ELKA 4URTB 4PBXA 5K59E 1R3LA 5IMMB 4PREA 3L3KB 3OZ9L 2VLRA 3KLSA 4X4ME 3AU1B 4TNVF 2CDGB 4M03A 3UZVB 5IOPA 3RUGE 1R5WB 4JRXB 3LEVH 3RBSA 4OCXH 2IWGA 3LDBB 1QSFE 2EH8L 2R39A 2YMXL 3RKDD 1W72A 1IE5A 1F42A 4P5TC 1LP9A 1NGXB 5E5MA 1IAKA 3P4NB 3WE6B 4KHXH 2A6IA 5FGBC 5JORA 2ZUUA 3O4LE 3LS5L 1OAQH 3RWDB 3WFBL 3X3GL 3MV8E 2WW8A 5DHVA 5FYLL 4Z0XA 4RFEB 2NY2D 2I27N 3TVMD 3ZMRA 2F5BL 4LIQE 4WNQA 1WBZB 4Y16B 5AWNH 3QO1A 5LBSH 5A2JH 4A6YL 4L9DA 2K9UA 3OXRA 5SWZB 5E56A 2HT3D 3GBNH 1R3IL 2HG5B 1H3PL 3FN9A 2CUHA 1XGPA 3DX7B 4XHJC 2RHEA 4XP1L 5I16B 2VAJA 3DETD 3WFEL 2BZDA 4NQDA 1G7MB 4ALAL 4DW2H 2R56H 5EN2B 1KSRA 3BHBA 1TDQA 2BSED 1ZLWH 4M6MH 3WN5A 1ZA3B 3L5HA 3VWJB 4WWKA 3HC4L 4XVJL 5F7NC 3TBTA 4PJFA 2QKIA 3C5ZA 1P7HL 5C0EB 1TVBA 3O2VH 5DJCB 1I8KB 1IQDA 2NX5D 4OIAA 4G9FA 5IM7A 1H3VA 2YPLD 1TPXB 5GGRY 1AGFB 4C83B 5CJOL 1KIRB 2DOCA 5T1LA 1JCKA 4K7PH 2VXSL 4NOFA 3KJ6H 4S1DC 4XPGH 4HKZB 1Q72L 3KPRB 4UU9A 4O2FA 1FNLA 2CJUL 1AP2A 5EUOA 2ZCHH 3TA3D 1S7VA 4H0IA 4U1KB 5IJVB 2GFBB 4UQ2A 3O41B 4GO6B 2X70A 3V9FA 2YHGA 3CXHJ 1X4YA 3DROA 3VD7A 3AAZB 4M7LT 2CR3A 2DQHL 3I3BA 1FN4A 4WEMB 1ZWIB 2RB8A 4X7CC 1XGTB 1MAMH 3O9WD 1CICA 1HXYB 3GSWB 2X4TA 4JQIL 4ZSOA 3RBGA 2HKHH 2IAMB 4LVNC 2QHRH 1IAII 5GRXG 1CXFA 2WWMC 5FO9A 3X17A 3VXNB 3SDXA 4WFED 3IDGA 1F97A 3FO1A 3ULSA 5ABDE 4HT1H 3FRPA 2HH0L 2Z35B 2E9BA 1EEZB 3VXMD 1JRHI 2D7QA 1HNGA 5DMKA 2VXQH 4LFHD 3UPAA 2ED8A 3TWCH 2P5EA 5H35A 3OAZK 5GGVY 4DVBB 5KS9E 4IRJD 3IKCA 2OSLB 5TFSH 2Y23A 3DX9A 2JLLA 1I7UA 3FB7B 5FUCE 3I02B 4JO1L 4LASL 1JGDA 3KYMA 3CVIH 3PQYE 5T3XL 4G80A 2R0WH 3RJQB 2FHBA 4U6VL 4M61B 2ICEA 1F4YH 1JWUB 3X11B 1HHIB 1A6VL 4OT1L 5E6IB 1R3KA 4WHTA 3WUZA 4BSVA 3VA6A 4GG6E 1DCLA 1PD6A 1J8HD 3UPRB 1KJ2H 1DVFB 4PRPD 2E6QA 1HH9A 2NY0C 3O8XB 4OCSH 4XBEH 5E2UH 3L5JA 3T4YA 1K3ZA 4Y2DD 3UTZB 3GSXB 5IFHL 2XZZA 1K4CB 4MJ6B 5JQHC 2PNDA 1SEBB 3MROA 2AEWA 2DQCL 3RPIB 3UCRA 4IOFD 3AMLA 4I3SL 4J4PC 2F8XC 4BKLA 1P84J 3BE1L 2J6EH 2ZUQB 3BN3B 4RISH 4DGVH 4NKOA 3IGAA 4GQPH 5J9PA 1WFOA 5ID1B 1EHXA 1CT8B 2BK8A 5D1XC 4HIEA 4UOW0 1KLGB 4NP4L 2C3VB 1C08A 3VXPB 4EDWL 2J4WH 2ZUTA 4CW1B 2APTA 3UP1A 3GGWB 4JDVA 1NC2D 3TZVB 1NUDA 2P44B 5ALBH 5MI0C 4N90D 5DQDL 4S1SL 5IB1B 4LOUC 4Y1AE 1IMHC 1FZMB 2FJHA 1AR2A 1CIUA 4XNXH 1D5IH 3H9HB 4G9DB 3SDAC 3W11C 1RULL 4C56D 5JQ6L 4X4XA 3QUYD 2Y5TB 3E6HA 1YA5A 1FZKA 3PNWB 3P4LA 1CLZL 2FSEA 4KDVA 3PIQB 3F6LA 2Y1VA 3DV4B 3L5WB 3HMXH 5EWIH 4WV1C 1KIQB 4FFVD 4KK6C 4JQXA 3S34L 3WJJA 4LEOA 1YEGH 5GS0C 3HZMA 2ENYA 4K3JH 4HW6A 4PG2C 2H1PH 1XF2B 1DUYA 5GRYA 3QIWD 1EJOL 4B53A 4Q9RL 5BZDA 1CFVH 3L5XH 3QCVL 5AAMA 3NN8B 1T3FA 3MYZA 5GGQH 4HS8H 5AZ2L 3UJTL 5TF0A 5JDJA 4EVNA 3BAEL 4NN6C 4UMGA 3O4OC 5F7DB 2MMXA 3IETA 5DUMH 1W0VA 1OT1A 3AGVA 4KKNA 1MCHA 3RZCA 3BSZH 3EGSA 3TT1H 4EXPX 1HNFA 2QL1A 3VMOA 3RL1A 4KI5E 4KPHH 4DGIH 1U3YA 4JFQB 4F7CB 5TH2B 3QXVA 1ETZA 1DBAH 1PW3A 2ZOLB 2EO9A 1DQMH 3NZHH 1CDYA 2VDKH 5DD1H 1XH3A 3ULUC 3FZUC 4P4KD 5GRZA 2NY2B 1BREA 1QACA 5CINL 3H8NA 5IW3A 4A2LA 3WJLC 1UB5A 4Q58C 1A9BA 2P8MA 3BZEB 2VL5B 1OAXH 4UQ3A 4JY5L 3G5YA 1XGQA 2OI9B 3QUMH 4M7ZC 3ULVH 2GUOB 1TZGH 2CLZA 4PRHA 3RL2B 1YEFL 5I17B 5EORL 1ZHBA 3H9SE 5D7JD 3VGAC 4PUBL 5DRWA 3DVGB 4X7TB 3ROLA 1ZT7B 4ORGA 1J8KA 4D9RE 25C8L 3AY4C 3H7BA 4JPIA 1AXTH 1YDPB 2X7LB 5IHZA 4JCMA 3WNNA 3TT3H 4E9LA 1A1MB 3CH8A 4QRPA 4ELME 2YPLB 4OCRL 3QHZL 2Q76B 4MA3B 1X5LA 4LPVA 5LVEA 43C9B 4Z6AT 2VSDA 1N64H 1QA9A 1MQKL 3RVXC 3VXUB 1I3RB 1MHHB 4PJGB 3TO2A 2BOBA 2MHAB 2DL9A 4ZO8A 3ARGB 2X4OB 2YZ8A 2CDFA 1EFXB 4PRID 3NFNA 1RUMH 5E00A 2P8PB 3IS1X 4RGNC 5T3ZD 3THMH 5I15L 5D2LF 1S3KL 4KTDH 4A6YB 1S7WB 1IAOB 5LAXB 3BDYH 3HUJF 4QF1A 1OAKL 2ID5A 1P4BL 5D7LD 3K4DA 3NFPA 2N4IA 1DN0A 3ISWA 1SJHA 1A1NB 1NCDL 3O9WB 4NHCL 4I77H 3SGEH 4M7LL 1KT2A 4GJTB 4ZYKB 4U6XA 5GRUL 2GW5A 4WW2F 2Y7QA 1BOGB 3MYJB 3CDCA 1GOFA 1KXQE 2IGFL 4JDTH 1KJ3H 1NMBH 2FRGP 4ODBD 1NQBA 4QHMA 5J13B 1EUUA 3WO4C 3BDBA 2DD8H 4HH9A 4DGYL 1F4WL 2MCPL 1BFVH 4IIQB 2H26A 5L2JA 3VXMB 1FGVH 3D0LB 3QAZB 1V7MH 5HYSG 2AGJH 1DEEA 1RIHL 3MNWA 4GW5A 1HKLH 2NTFB 3LH2L 4QT5A 1GCFA 3JWOH 5HGDA 1U92B 4IRJB 4YPGA 3QULA 2NLJA 3FHQA 1Q0YH 4KJYB 4PYGA 1NH6A 3V7AG 2KZ1B 3LKOB 3V8CA 3FHAA 2CIIB 1HWHB 3C8KA 2YD1A 3GRWL 4K9EL 1B3JA 2EDFA 3K81A 4JFDB 4XGZB 4ZOCA 4D0DB 2YRPA 1F6AA 4ZOBA 3QT2A 3OHXA 3BX7C 4F15B 3J8F7 2APXA 1J8HB 2XA8L 4N0FB 1RSFA 4PRPB 4G6KH 4MZ3A 2D31B 1NGQH 5DJ6A 1RU9H 4K71C 5E4IA 1OGTB 4HMCA 4LBEA 3S36X 1YNKL 2OJZL 2WLYA 1L4IA 4Y2DB 4F80A 5ITBH 4JM2C 4K3DL 3UYRL 1K4DB 5HHXL 1D5ZB 1DLFL 3CSGA 2AEPL 4IHOA 3DGGB 3RTQA 2G9HA 4LRNL 1KEGH 4U6TA 3VRLE 2LU7A 2VKXA 3FQTB 4PJHB 3R06A 5GHWL 2DQJH 3T4AB 1JWSB 3VWKD 1Z9OA 1GPOL 2YXMA 4IRSA 3KLHC 1T03L 2ED7A 5IB2B 1M71A 1OB1A 2P5WD 4Q7DA 4GRWH 4YGVA 3WL9B 1UACL 3U9UA 3BMWA 2GJ6D 1IM9A 3U30B 1T2QL 3S4SA 2P45B 4YHLH 2BVUA 3EO1B 3H3PH 2CKBL 3DX6B 3CFDA 4G42A 4N9GB 1J1XH 4PRBB 1HEZA 1FFPB 4OCWL 5HGAA 4N9OB 3O0RL 5TPWL 4L3EB 3FB6A 4C56B 4NN5C 1RIUL 3O3AB 1DQLL 1A6TA 1G6VK 3QUYB 4BFBD 5F21B 2BX5A 5CGYC 2XIDA 2EH7L 1G9EA 1Q94B 2RR3A 1NLBH 4ZUSB 3PWNA 4HIHB 1SYSA 1U8OA 2JELH 5DSCA 2RFXA 1G9NH 1VACA 1F45A 4RX4D 4GFTB 3VFNB 4U6YB 1NFDA 1L6XA 1MUJA 1UG9A 2D7PA 3VXQA 5I76B 3CXDL 4NQXB 2EIBA 5DXWA 3QIWB 3U2SA 1IEBA 2VIRB 3MLTB 4C4KO 4KMQA 1NCTA 4PJ8D 3MA7A 3BPLB 4UT6H 5FK9B 1ZAGA 4ONFL 3ZTNH 4Q2ZB 1AQKL 1NCAL 1N5YL 5E99L 4G3YL 1UADC 3T77A 4NNPH 4F7PA 4ZTOL 3DTXA 3KS0H 1HHJA 1ZSDB 1A9EA 5FUZL 5EOCH 4NGHL 5FV1L 1FBIH 4PJBF 1HCFX 1YECL 5GS2D 4Y5VB 3K4AA 1I1AD 1H15B 3HI6L 5IVXF 3LKQB 4HUVB 5DF0A 4POZC 4FTVD 4PP1D 4P4KB 2AV7A 5F3HA 1FFNB 5IJKC 1Z9MA 1R0AH 4JGMA 1BZ7B 1S9YB 5D2NB 1RUQH 3HPJB 5BZWA 2HLFD 4LEXL 1AGCB 4PGDA 4NZRH 4ZODA 4H5SB 5I71C 4TSCH 1JZ7A 5EIIB 4P9MH 4NBZB 3EOAB 4EUPG 4FQHB 1FV1A 1UEYA 2BMKA 2CUIA 2FATH 2VQUA 3MJGX 4FQIH 4L3CB 5J1AA 4PJCB 3S3JA 2R4RL 5D7JB 3V6FB 3WDHA 2EDKA 1IL1A 1JMXA 3F7VB 3PGCB 2UYLB 1R3JA 3P0VH 5J3HC 4JO4L 1P5UA 3QDMD 1J05B 3PHOB 4HUMB 5HHNB 1IKNC 4OD2B 5DEGB 3SDCA 4LIQH 4IMKC 9CGTA 1QBLL 2E8ZA 5F1NA 4F58H 3UTSD 1UH3A 3EZ8A 4LKXB 2WP3O 3C60D 4LRIA 4WDIB 3JV6B 4PB9L 1JK8B 3O2DA 5EBWA 5IMKB 3RWCB 3RIAK 4UIMA 1V3JA 1F8TH 3KLAA 1LO0L 4NKQB 3MJ9H 1U42A 4HCRL 2EIDA 1YJDL 3AUVA 5AG8A 5J57B 5BW7C 5JW4M 4G6MH 2NY3C 1N5AA 3VDCA 2ZKHH 1LO5A 4G6AD 3RGVA 5D7LB 1G7HA 5SWZE 3EYFB 5JW4Q 1D6EB 1FDLH 3SKMB 4XAKE 3KWWA 3OKNB 3OWEA 4WJ5B 3B2UC 4PY8J 5F3BB 3OJVC 5F7WC 4F8QA 3A67L 4R2GC 4M7JL 5HYEA 5F6IB 1JGEA 2P8LB 2CXKA 1MCPH 4YQXH 2JB5L 4M43H 1KB5A 4JQVC 4QWWD 5I8EB 2EDJA 4LPCA 3BQUA 1A3RH 3DBXB 3UTTB 4FQPA 1GGIL 1BIIB 4JPVH 4N1CA 1JNLH 2IPKA 3PP3K 2XRAL 1H0DB 5IF0A 4C55A 5IHUH 4PJ9C 4N8VB 1FSKC 4J6RH 5D7KD 3IDIB 2ZG2A 4LPUA 4KQ3L 4YZFF 1NDGB 2CMRH 1MCIA 4C4KT 5HY9B 3MV9D 1NBZA 3OKDA 1T0PB 3BKMH 1GC1H 1NCBH 2CRZA 2XZAH 1CR9H 1WFTA 4QY8B 3FT2A 1PG7H 1FYTE 1BVKA 3EDEA 4I8DA 1C16B 2EDHA 5MEPA 3TBYA 3K8LA 1OP3H 1PKOA 5IVXB 5GSRB 1DUZB 1XF4A 1V3KA 2A6JA 3BP7B 3CNKA 3MCLH 3L7FA 3QG7H 4P57A 4OBSA 4DVRL 4LMQE 4OZGF 2IG2L 1T20A 5EFIA 1RJYB 5FYKE 3T3PE 2R4SL 4HWBH 4OJFH 2NPLX 5HI3C 3FQWB 2A6DB 2VC2L 3FT4A 1N4XL 3RVTD 3PHQB 1P4IL 3JVGA 1SMAA 4AIXA 3NABH 4QYOB 1T83C 2ESVD 3TH4T 4J8RA 4OLUH 4X99B 3DURA 3SBWA 1B0GB 4JJ5A 2H2SC 2P5WB 4HMDA 1RUKH 3WHE1 3TN0C 1EEYA 1L7TL 1ZVYA 2GJ6B 4G7YL 2VDOH 1EGJH 5SX4I 3WFDH 1JPST 4JGJA 4N8PA 5CWSB 5JZ7C 1MCRA 5CUSL 4EOWH 3ARUA 4FXGB 4AM0A 4HHAB 4BUGA 1ZK9A 5CMAA 4NQUA 1GZQA 2B5IB 3VI4F 4K8RL 4M93B 4O5LH 4PJ5B 5ITFB 2G5BB 3BVNA 3LEXB 2ATPA 4F7EB 5E8DH 4YHML 4XWOD 1WBYA 3CZFB 1Y0LA 3QDJD 3QZWA 4W6XB 4TYUA 1AKJD 1B2WH 3GMLA 2NXYC 1CDJA 4MJID 2OCFD 2A2QT 2WP3T 3QIBA 2W60A 1QR1A 2NMSA 5BXFB 4P2OD 5IGXH 4YAQA 4LLUA 1KCUL 2ZNXA 4LCWE 1A3LL 4QHKI 1QYGL 4ZOEA 1IC1A 3KYAA 4YHKL 5EU5B 4WUKL 1OW0A 4NQSB 4P23B 4NM8L 3B9DA 1ZVSB 4PJ8B 4UT7H 1MHEA 1NGYA 1WIUA 3CVHH 2NY1D 3MLRL 4KRPD 5IFAH 2F54E 3B5GA 1OGAA 1EJ6A 4CVXB 2HRPL 2F53A 3DYPA 5JXAH 4NT6B 4MAYD 2GSIB 4JB9H 2NNAA 3MUY1 2PO6D 5JR1L 1R5IB 3FB5B 4XPTL 1JFQL 1VFAB 2CKBB 5KOVC 1CVRA 4M1GL 5KVEH 1WBXB 1XCQB 4HS6B 5MENA 3UXFA 4JFFE 4Z76B 3S5LA 3IJSA 4KK8D 2CLVA 5K9QG 2C3HA 3LB6D 4L4VE 3NVQA 5DVMA 3V5KB 5KN5A 1NEZB 2D0HA 1NKOA 2VDNL 4P48A 4QNPF 4LQ1A 1JI2A 2LAAA 3B9AA 3KPNA 4ZS7H 2X9XA 5E8NB 3D3VA 2ICWA 2WMPA 3IAGC 3RDTB 2BHYA 1U41A 2R9HC 4MDIA 1LE9A 5IV2B 4LCIH 1NANH 3AFLA 5F9AC 5DYOB 5LGHH 4JFOB 4QRRE 3DXAE 3MV7E 1DE4A 1ERNA 2AK1L 1IM3A 4IOIB 4MNHA 4U0RB 4P3DB 5I1DB 1GZPB 4Y19A 3LKSA 1WAAF 5EA0H 1P69B 4LF3A 4OZGB 1AI1L 3QDMB 5I1CH 4NCDA 3U4AA 2FBJH 1QFUL 2DJUA 3PL6C 2I60H 4IMLA 1P7QA 3PV7A 4NPYB 2I9TB 4GW1B 1FL3A 3SE8H 3UTSB 2IADB 1QRNE 5HGHB 3C60B 1I9EA 4Z95H 3S37X 3ALPA 4GT7A 4YC2C 5BRZE 3CK0H 3GO1L 5KANI 2OK0L 1U95A 1BIHA 1CFSA 1KPRA 6CGTA 2C4XA 5LQBL 1NMCB 3I9GL 3S88L 3REWB 2ZCKH 1G84A 2ZNWA 1J10A 4M8QA 3UTQB 4HF5L 4OLXH 1KLUB 5D70H 3OF6D 1I8LC 2L7UA 4ODHH 3UTOA 2NZ9C 4GLRH 4I0PA 4Y5YB 3FN3A 3DX8A 1NKRA 5T1KD 1DQQA 1FO0A 1IILE 3DV6B 2EC9U 5C8JB 3IU3B 1BJ8A 1T89C 2FJFB 4H0HB 4XB8A 3L95A 1BGXH 3C2AH 2R1YA 5J6GA 4HKBA 1AJ7L 4YWGL 5I66B 2D0FA 1FG2B 1LE5A 1AGBB 3F7PC 1LP9F 1I1YB 2X4QB 4OQTA 4PGEB 5C9JB 4QHNB 4V1DD 1JNHB 1VEMA 4ODXB 5CP7B 5HVWA 4RGMC 3QI9C 3VCLA 4LARL 4HH8A 2WZPD 1W8NA 2J8OA 3QNZA 2K7PA 1K2DA 1Z3GL 3R0MA 5CEZE 4LNRA 1VERA 5CHNA 3ZE0F 2VZOA 3A0OA 4OKVA 3QWRA 1FNSL 3LRGA 2M26A 2I26N 3U36A 3B5HA 5T1DH 4WI6A 1MFBH 3QUXC 4HXAH 3VXOB 1CL7I 3VXRD 4B50A 1BAFL 1IGIL 3O3BA 4P2QD 4G8FA 4I9WE 2EYSB 2XPGB 1E27B 1M05B 2VNCA 3RPKA 5FOBB 2DAVA 4Y5XC 4B41A 3H3BC 5GISH 5EBMB 2FX8L 3QFDA 3MRCB 2YR3A 1Q1JH 4RMRA 4LSVL 3BW9A 4FZ8H 4KRNA 4PJFF 4ETQB 3LKNA 3SE3C 1PQZB 5C09D 5IHBA 2EDLA 3K8MA 3VGEA 1KPUA 3NIFF 3OAUH 3U79A 1NMAL 4MNQD 5CILH 4ZQKB 4UZGA 4L8BA 4X4ZA 3ARBD 5D7IA 2QQLH 2ESVA 5I1IH 1T5WA 4RMSA 4R97B 5CJXA 1S7TA 3S7GA 2FLBT 6FABH 4GSDL 4ZFOA 5EZJB 1LHZA 3GZKA 3D18B 5IBLC 3B3IB 1VB9A 5EUOF 5DEZA 1ZLSL 2AQ3A 3MACL 4HGKC 1S8DA 2QQNH 5B38G 2EZ0C 1XR8A 1QFWH 3GJEB 3VI3F 3BUYB 3WIIL 1RJLA 2E27L 3ZL4L 1LNUA 3TLRA 5ERWA 4JHWL 5HYJE 5LCVL 1HQ4B 1T1ZB 3HNSH 4F33B 4TN9A 1I7RA 4LKCB 1MIMH 4HGWB 5DURB 1JPSL 1UZ8A 4UDTB 1B0RB 4NC1E 3R8BB 2GK2A 4JFDE 4PV8B 4UTAL 3SQOL 3VG9B 4APQA 5C2BH 2DQGL 2R1XA 3CH1A 2JK5A 3QDJB 3KLDA 2VJXA 1LO4H 1OARL 3FOMB 1AKJB 2W0LA 2BHUA 4R4FL 3SDXF 4M5ZH 3T0EC 5SWSE 2XICA 3MRHA 3MLUH 4WIQA 4OF7A 4P2OB 1PG7W 3CC5A 5I0ZA 5HGBB 4QOKA 3V0WL 4YO0B 5HSFA 1NBVH 1IKFL 1MVUB 2XN9B 4LU5L 1MWAA 3NIGE 3HPLB 4EIZC 2AJXL 3O4LA 3ILPA 4DAGH 1G9MH 2MOVA 2B8OT 3P77B 2YPKA 3O6FA 2C9AA 2Z31A 4PREB 1BD2A 2VLRB 2NY1B 5IOPB 4KRPB 4MHHG 5DO2C 1F3DH 4AG4L 4U33A 1CZ8L 5DMIH 4OLZL 2WINA 5FEBA 4M1CD 1GGCH 3I6KB 4NWTL 4WU5B 5IB3B 5E5MB 2DF3A 2ZUSA 2B4CL 2PO6B 4QHLA 3PWPD 4X7SL 2AJ3A 3IDJA 4O02L 3IJYA 3NCYS 3UBXG 5M7QA 2ERJC 2DIAA 1ZT1A 1H5BC 3BWAB 3KYKL 5DVKA 3WSQH 2GTWA 5DHVB 4JPKL 4YXKH 2W0FA 3DVNB 1QFWM 2DQUH 4PJAF 1NAMA 1KEMH 4KKAC 3PXHA 5LWYH 3ZLQC 3FQUB 1UA6L 3T65B 5JW3H 3QO1B 3SQBA 1CGSL 1K5NB 1ZHLB 4ZD3L 1PFCA 1YNTA 1U93B 4HLJA 1AE6L 4YUEL 1F5WA 4WI3A 3PGFL 5DJ0A 4XXDA 3IDNB 5D2LE 1XGPB 3W0WE 1YMMA 2CH8A 1QBMH 4KK9C 5CJQH 3ETBF 3HUJE 3WLBA 2RGSA 3BPOC 3P11H 1YEHH 3VDAA 3KPTA 1J0IA 4X6BA 3RU8H 1OP9A 3W9DA 4PJFB 4LP5A 3C5ZB 1RURL 4XAWL 1IQDB 1MRCL 3PABB 5L6YH 1UVQB 3W2DL 4KAQL 4RWYH 1INDH 1S9XA 5JPMB 4FFWC 3I50H 4KMTL 5FCUH 3GJFK 4R0LC 3VFMB 5KVFL 2C7UB 4UU9B 3MRIA 1J1OH 4FFZH 3D25A 5EULV 5EUOB 4NJAH 4R3SA 3LAFA 4PG9A 4WU7B 2NW3A 5I19L 4S1QH 4CDGC 2XKSA 5B8CA 4CMHC 3KPOA 1UCBL 4BYHA 4UQ2B 1F4XH 3LOWA 2DQEL 5E8PB 5GS3A 1A7BA 2NTSP 4LLMA 3GHEH 4M8VA 3Q5OA 4N0YL 2R1WB 1GHFH 5JNYA 5T1KB 5IHLB 3BEWB 2QQQA 3TNMA 1A22B 1U3HD 3GI8L 5TQ2H 1SJEA 4Z8FL 2VLJD 3OR7A 2JB6B 1CK0L 3GKZA 5FO9B 4GRMA 3RAJL 3I6LD 3FO1B 3LQAC 5CEYB 3UYPA 1FVCA 1JZ2A 1JHTA 2YD2A 1Q38A 1BX2A 5J12B 5BS0D 2C5DC 2NW2A 5ISZE 3MJ6A 2XZQL 5D71L 3CXHK 3FONA 1F90H 3D39D 4U6HA 4XBPA 3IKCB 3LEVL 3OPZL 4OCXL 1T04A 1I7UB 3GMOA 3MSPA 2HWZL 1JZ4A 4GAYB 2IANE 5I1KH 1NDMA 3Q6FA 4Y4HA 3BPCB 3D69A 4FABL 3TBSA 3JWDC 5GGVH 2PR4H 3FOLA 4O58H 2ICEB 3VFVB 1R3KB 4WHTB 4BSVB 5GIRA 3FFCA 3LPGA 4HG4J 1OAQL 5D1QC 1U6AH 3VXRB 4ZAKD 5CJ8A 4P2QB 1P2CB 4X8JA 1G7IA 2HAZA 1DSFH 4JY4B 4DUXA 4WUUD 3Q3GA 2H3NB 3O2WL 2D3VA 5E9DD 3C09B 3OL2A 4P5TA 5AWNL 2WLZA 3EUUA 2UVEA 1DBKL 4PJAB 5LBSL 4Q97A 2GK0B 1FFOA 2DIBA 3IFPA 1FZOA 1NSNH 5J11B 5F1KC 5C09B 5FGBA 3IFNH 4QGYA 4MNQB 5ANMA 2C1PA 3IXAA 1LK2B 4U49A 3ARBB 4YH6A 1OLZA 1JGLH 4UDUA 5E95B 3HE6C 4M6ML 1WITA 3UTTE 5HHOE 1HHGB 4FQQA 4EI5D 2VDPL 4FQ1H 3O2VL 5IG7B 2DM4A 3QFJA 1QSZA 2BSTA 5MEQB 4NFDA 4K7PL 3KPSA 3FL7A 5FYKH 3HMWL 4XPGL 1P84K 3RX7A 4XRCB 3MUGB 1KFAL 3KPPA 1TTFA 4PJBE 2B20A 5HHPA 3IRZA 1HCVA 1D9KC 1HZHH 1RJCA 2VLLA 2ZCHL 4HQQL 5IVXE 1L7IH 1J5OH 2FSEB 2FJGB 2ZP0T 4J23A 2ZPKH 5AUMB 1EHLH 1I9RH 1MY7A 3ROOB 1F4AA 4LEOB 3P4OB 3I6GB 3FKUS 5I9QC 1D5BA 1T0MA 4GRLD 3EYUH 1MAML 3K80A 4G8IB 1KXVC 3N85H 1T3FB 4R7NA 5HHMD 2HKHL 4DN4H 3SY0A 3S98A 1ZHNB 2ZJSH 5HYSB 1PY9A 1FC1A 3W39A 5A3ID 3I2CH 3WEXA 3KXFA 5ETUB 4EVNB 2ADIA 3GSQA 1CGXA 4NO3A 4DTGH 4OFYD 1C5CL 4FXLA 3MPCA 3RZCB 4ORZC 3EGSB 3TWCL 5GGSA 5DC9B 4DUVA 3RL1B 3PWPB 5DD5H 1BFSA 4AEIH 4F8TA 5D93B 2J3SA 2XV6B 5C0BA 4RQQA 4BK4A 4L8CB 3O2DL 1NCWL 3CVIL 3LHPH 2I07A 4S1RH 4PJ5E 1XH3B 1X5ZA 1T66C 4L9LC 4HC1H 2J8UE 5KSUA 1YQVH 3L5IA 3RNKA 1SQ2N 2P49B 1A9BB 5F70A 3D2UD 1SJVA 3L3JA 2PYEE 43CAA 4XCEB 5ADPH 4ZS6C 5IEHA 5EU4B 5T33H 1KENH 3LSOA 5IEKA 2BNQD 3QHTC 3FCTB 2IQ9H 2VZVA 2FECL 3HN3A 4U0QB 4RMTA 3OJMB 5E2UL 4IM8A 4PRNB 4PGCB 2DLIA 3ROLB 3HC3L 2DTML 4J3OC 4NUGH 3G6DH 3HRZB 2CGRL 3CLFH 1T0NA 3TV3H 2XQYK 3GHBH 4C54A 4CN6A 4ACPA 1KB5L 1EO8H 4DGVL 2H45A 4J2XA 2VLKD 4O2CA 1KELH 3U4EB 5AAWA 3HZKA 4D8PB 1G6RH 2AK4D 1RJZB 5IROC 1JGUL 2YRLA 2J4WL 2BOBB 3HLAA 4U7KA 5D4QA 5LG1A 5E94A 1MI5D 3GSOA 1FGNH 3NFNB 5D96C 4ZUVB 4J4PA 5ALBL 1P4LA 4R26H 1T7ZA 3ZKMD 4U31A 3UZEA 2PCPB 4YZFE 5EU6D 1NFDF 1OWWA 4PJIE 4ESKA 4XNXL 2WWKO 1D5IL 4UNUA 3MGTA 4JZOB 5D1XA 1YC8A 4ZFFA 5E5UB 1DN0B 3ARDC 2WBJC 4LVHC 3FTGA 5H94B 2QADD 1RZGA 3V52L 3ARFC 2B1AL 2UZIL 4LAQH 2EDQA 2YWYA 4M48H 4U6XB 1U3HB 3KDMA 3HR6A 4MAUH 1I1FA 2PW2A 1DBBL 3HMXL 5EWIL 1MHPH 4YHIA 4M62H 1YEGL 2LFGA 4LQFH 3MA9H 4K3JL 3WBDA 5CSZB 4OI9A 2H1PL 3AB0C 3ARED 4L5FH 2WSKA 4M00A 4PJXA 3SKJL 3NH7H 5FGSA 3MLVL 3RWEA 3L5XL 4NHUA 2H26B 4ZTPH 3GDBA 5BS0B 5C1MB 1TJIH 3SDAA 5GGQL 1XT5A 1DEEB 5F93C 3MNWB 4GH7B 3AVEA 4GW5B 3L9RA 3OKLB 3QRGH 3VXSA 4YPJA 3D39B 3IDXH 3REVA 2DN7A 4MQ7A 3QULB 2NLJB 5DUML 4WV1A 3S35H 2V7HB 2H6PB 4JM4H 2FGZA 3O6KL 3S3PA 2A9NH 4PG2A 1IC4L 1NBYA 5KJRH 1KC5L 3TT1L 1X7QA 4PS4H 2ZUXA 5KVMC 4KPHL 4DGIL 4NO5A 3DUUA 4XP6H 1YMHA 4ZAKB 2P7TB 1DQML 2EH8H 4Y16C 4EUPB 4X4YB 5DS8B 1YPZE 3VFSB 5H2BA 3VI4E 3CMOL 4NQCD 5DJ6B 4WUUB 5C0CE 4CRPA 1MEXL 1CFNA 3LS5H 5KTEL 1KIPB 5C0AA 2HKFH 5CEZH 4LSDA 5C0DA 3X3GH 4UT9L 2OL3H 1TZGL 1KYOJ 3R06B 3U82B 3C5SA 1AR1C 5HVGB 2BY2A 1UYWH 3VWJC 3DRQA 5C07D 5JO5A 2BVOA 1MFDH 1U8HA 4YGVB 3MLSH 2FO4A 5EB9A 3WJLA 1TPXC 2H8PB 3TT3L 4XTRC 1IM9B 1H3PH 2B1HH 4EI5B 3SGJC 2WIIB 4LCYB 5DDHA 3MXWH 3ARPA 4PJDA 2A73A 4XP1H 4YBQD 1K8DA 1JE6A 3CFDB 4ALAH 1UWXH 1PKQE 4FQLH 5ICYB 1B6UA 1JF1A 2P48B 3RI5F 4M9OA 2D7TH 3U46A 3M8OH 3FB6B 4X6DF 2DLFH 3E6FB 1I8MB 3WCYA 1KCKA 3OMZA 1RUML 2VDRL 3AY4A 3T0DA 3THML 2BY3A 3PWNB 4UOW1 4GBXD 5DSCB 2RFXB 5L2KE 3C9NA 3ZDXF 2VXSH 3BDYL 5BV7L 3UZQA 1NFDB 4QNPE 3G6AB 3F6IA 2IAMC 3ULVD 4L4TA 2OX5A 2CJUH 4I2XA 3O6MH 4I77L 1KPVA 3RHWK 4NZUH 5HHMB 4LVEA 4XMPH 5DRXB 2YA0A 2DM7A 3U7YH 5DMYA 2R2HA 1QLRB 1BQUA 4DZ8A 4YBLC 4ONHA 4ZO7A 4KI1A 3T77B 4HDIB 2K1MA 2DQHH 3LKRB 2DQIH 4R4NC 5FECA 1BFVL 2W9LA 4QXGH 1FGVL 1X5XA 3RVVC 3UC0L 4Z7UE 4JQIH 1WAAE 1I3GH 1JGVH 2AGJL 4W81A 4H8WC 1HKLL 2VITA 3F7YA 1DZBA 4MD0B 3JWOL 2EYTB 3SO3B 4JZJA 1Q0YL 2VR4A 5ICZA 5E6IC 4QTIL 1U3ZA 3GIVA 4DKDC 2N7BA 2KDGA 1YY9C 3HZYA 1BWMA 1F4HA 2AAVA 1U58B 3MLXL 1AIFB 4ENEC 1DVFC 4XBGA 1CG9B 3DVIA 5BZWB 3QDGD 5DFVD 2IH1A 1Q9KA 4JO1H 1KOAA 4YK4B 2BMKB 5DJ2A 4G6KL 2BNQB 4YFLI 3B2VH 3SJVE 1NGQL 2X4SA 1NC4D 1RU9L 2B0SH 1YYMH 4OT1H 5HJ3A 1S7QA 3QNYB 5ITBL 4WTXA 2VABB 5EO1A 2ZUQC 2EE3A 1QTYT 1NGZB 4OBRA 1MCSA 3N0PB 1HILB 1XF3B 1KNOB 2VLRE 1KEGL 5CCKL 2M2DA 3KPQA 3SDCB 1AO7A 2AXGB 3T8XA 3CZJA 3RVWC 2V9QA 5F1NB 1LP9E 1T1WA 5INCA 2VLKB 3BH9B 4GS7B 1BJ1H 4UBDC 3TZVC 3ZTJH 2AK4B 4I3SH 2OMNA 5IMOB 4JM2A 2CXGA 3IVKA 2EKSA 1MI5A 3KLAB 4YHLL 1FNGA 5DHYB 1CTOA 4CN4A 1UM4H 5EU6B 5C0IA 1T4KB 2HJKA 3ZE0E 3MOAH 4NP4H 3WD5H 1KJ2B 5M94B 4ODTL 3RIFF 2QADB 4X6DB 3VFOA 2HJLB 5DQDH 1A7OL 1I8IA 2F5AL 4YGAB 4XNZB 1G9NL 2FX9H 3IXTB 3K8KA 4YR6B 4NQDE 3MUZ1 5JQ6H 3AREB 4KKLD 3QJFA 1DLHA 3QRFM 3WS3A 1KB5B 4NC2B 3H0TA 3MRPB 1VGEH 4ZPTA 1G7LA 1CLZH 4PJFE 4UT6L 4OM1L 2DWDA 5H8DA 4G9FE 5E5RB 2IPKB 3RKDC 2W92A 4ZFOL 5IF0B 4NNPL 3T1FB 4RAVA 3UYOD 3QH3A 2V7NB 4RRPA 1EJOH 4Q9RH 4Z7WB 3QCVH 2BY1A 5EOCL 5FHAH 2RCSH 3DVFA 5EUOE 3UJTH 1RHHA 1VDGA 1U8IA 1BVKB 3EOBA 3QUZD 4H88L 5HDOA 4PY7A 3VI3E 4OCMC 1CD1B 2NY2C 4MX7B 4MDJA 4MNGB 3TVMC 5D5MB 2Q86A 5CIPH 3OKKB 1NUNB 1XF4B 3LEYL 3ZKXC 4YHPA 3OX8A 2FCBA 4M7KL 3C6SB 3L7FB 2HT3C 5DRNB 1EV2E 4P9HC 3MRMB 2OI9C 1CF8L 4ZSOE 1T20B 4HJ0D 3JWNC 2Z92B 3ARVA 5D7SH 4NZRL 1INQA 4TSCL 4NKDA 3D85D 3SDXE 4QRTA 3WIHA 4Y89A 4F7MA 3FQNA 5TDPA 5JTWA 3VU2A 5FF6B 2AS5M 1RHFA 1MWAL 5IESH 1MSPA 4Z9KB 1VFOA 1J1PL 3DURB 2CO7B 1N59B 3CJJA 3P0VL 2P5EE 5IJKA 4GKNB 3BGMA 4JY5H 3PWLB 3AXLA 5ESAB 1YEFH 4CMMB 1C12A 4F58L 1EMTH 4AM0B 4GAJL 3BGFC 4TVPL 4Q9CA 2VE6A 1VADB 3TA3C 4Z7QF 1UXSA 5I1JL 2ATPB 4WO4D 2A74A 3V0VA 4AT6A 3HG1D 1Y0LB 4K94C 1F8TL 4NBXB 4W68A 3F8UB 5E8OA 1WJ3A 1NAML 5IWLC 4OCRH 5DD6A 2F54A 3VXTB 1M7XA 2R2EB 2W60B 3ZDYF 4H26B 2GCYB 2L7JA 2R69H 3EIFA 1IZJA 4GBXB 2IALB 1QSFD 4IMKA 3U48A 3O9WC 4LLQA 4NOBA 1MQKH 3CX2A 2GI7A 1S9VB 5HGGS 4HIIA 3QUMB 5EPMB 4Z7NF 5ACZB 5A2FA 5J13C 2V2WA 1NGYB 5GZND 3MV8D 3UO1H 3QAZC 1MCPL 2LQRA 2F53B 4NNYB 2X9YA 3F62A 5BW7A 1NCDH 4R8WH 4NHCH 1PX3A 1HYSD 1OLLA 3QG6A 2JJUA 1FP5A 1EBAA 3NACL 4W6WB 4JPVL 5CJBA 2UZXB 2AXFB 1ADQH 3BP5A 3X12B 1G6RA 1L0XA 2XTJE 3C87A 2ARJA 3N50A 3IJSB 2IGFH 5IHUL 3OXSB 2CLVB 2EEAA 1UJTA 3B8SA 4V2BA 2CMRL 3P3YA 4GAFB 3T09A 4DGYH 1F4WH 2MCPH 2NXZD 5DRZB 1CIDA 1SYVB 1T1YA 1B0WA 3BKML 1GC1L 3KPNB 1NCBL 2XZAL 1CD9B 1CR9L 1VPOH 1PG7L 1RIHH 4PJ7A 4X6FB 4JQVA 4HK0A 4LVOB 3LH2H 2ZG3A 2H32A 4UB0H 2ICWB 4MXVE 4EDXB 3QDGB 3WUWG 5DUPH 3RWGA 2VDQL 5ESQB 4Y2DC 1Q9OA 5FYJL 2VB5A 4PJ9A 1G7QA 2GT9B 2ZSWB 2AXHA 3MCLL 3QG7L 3AMKA 1PAMA 3UPCA 1ZT4A 1NC4B 4IOFC 3GRWH 1YYLL 2UWEA 4K9EH 1KGCD 3MGOA 4WTZA 4Y19B 1QBBA 1DFBL 1X6NA 3GUTB 3MZTA 1GGYA 1SJXA 4HWBL 3UJJH 1U8JA 5DK2A 4K7FB 2XA8H 1ACZA 5B38B 3MBED 2ATKB 1RZKC 4WEUD 5GS1C 4TNWK 3C6LD 3G04A 4ZUWB 3STLA 5IR1A 5F9WB 3U30C 3FRUA 5HHXH 1RUKL 1DLFH 1R5VB 1J87A 2X4RB 1NFIA 2VDOL 1KPRB 1EGJL 4PBWD 3RUGF 3WFDL 1WTLA 1JUFA 1GPOH 3RRQA 5FM5M 4CDHA 1T03H 4HPOL 5I18H 4E0RA 3TJHD 1ITBB 3QUYC 4Q9BA 1KCSL 1M7DB 3O11A 1T83A 4JFPA 4U1HA 2I24N 3IFOA 5LXGH 1S7XB 1YEDA 2VTFA 4FFVC 1UQSA 5E2VL 4PRHE 4HKBB 3JBG7 3FO2B 3VDBA 3QIWC 5IGXL 3PQYD 2IMNA 3BPLC 3NAAL 1JYVA 2YC1A 1DQLH 2BHZA 2OL3A 5CEXB 2FEEL 1ED3B 3OB0K 1Q0XH 1WZLA 4UT7L 1IBGH 5F71A 5C08A 5MERA 3FMGH 4KZDH 1IGTB 2NX5E 4MSWA 4E5XA 4AYFA 5I8CB 1V5JA 4NFCA 4QRPE 5IFAL 4LSTH 3TBWA 2O61A 3UBXB 3IS0X 5GRJL 3CXDH 3QNZB 1K2DB 4JB9L 3PJSA 3L3GB 5F9JB 5CHNB 1YEJL 7CGTA 3SCMD 5KVEL 5I0DA 3V95A 1QEWB 1AQKH 3QUZB 4G3YH 2R2BB 4P4KC 4X6CA 5GSVA 1LD9B 4JRWA 3DUSA 5HYIA 4Z77A 1QG3A 1MRFL 1CXEA 1ZA6A 4JEGB 5D2NC 1W0WA 1X3DA 3IT8D 3CUPB 3QFDB 1HSBB 1YECH 3LCYA 3GSNH 3LKNB 4QRUA 2P43B 2YUVA 1D3CA 3CSYA 2F9BT 2A6KA 3ILQD 5D7JC 4Y1AD 5HYJA 5DVLA 5LGHL 3EO0A 4IOSD 2DQFA 1N2RB 1MFCH 4UINH 5EOTA 4WTZG 5I1GL 3OGCA 2WUBH 4OGYH 5EA0L 3X3FL 5HXMA 1VEPA 2OQJA 1YEKH 3TIEA 3VGDA 1Z5LA 4MQTB 3DWTA 3DGCR 3WHE0 1P1ZA 1RJLB 2AKRA 2HVJA 1FCCA 2I60L 3QEQA 2DI7A 4HWZB 4XVSL 2MFNA 2GSGA 1ZMYA 5ERWB 3RWJA 4XHJD 4JFXB 1I7RB 3IFLL 4Z95L 4JO4H 3CK0L 3Q6GL 3UEZA 2ZWLT 4WO4B 4I0KA 4M02A 2R1XB 4CU7A 5KS9F 1Z0NA 3HG1B 5CD5D 4NQEA 4X9GA 4OKDA 2K7QA 3TYFB 3KAAA 3RUGB 2XY2A 4OZHA 1E28B 1OP5H 1U2HA 4OLXL 3SDYH 3PL6A 4ODHL 3BYYA 1AQDB 1PSKL 4PB9H 1HDMB 3ZYOA 4MCYB 5DD0L 2EXWD 1O7VA 1WUNT 4G8GA 1QRKA 5C7XH 4PTUA 4OCNC 5MEOB 1R24B 3SHSA 1MWAB 4TUOA 4KI5D 1LO0H 4UILL 4ISVA 1MCOH 3O4LB 1HI6B 3C2AL 3KPMA 4X0KA 1AY1H 4HCRH 3KYNA 4EJ1C 2MCG1 2VR9A 2Z31B 1CGWA 3MV8B 5B39A 4LHUA 1PZ5A 3IU4L 4X5WA 1E4WL 4EI6B 2A9ML 1EEQA 4N0CD 1UKTA 1JWMA 1I8LA 3WIFA 5KSVA 1WZMA 4ZUUB 5AG9A 1KCRH 1IGYB 4NIKB 3F5WA 1T89A 2AJ3B 2JIXD 3A67H 2D0GA 4M7JH 2NY7L 3W0WA 1P9MA 1WT5C 32C2A 2WWMD 5IW6A 3H9SD 1T6VN 4F2MB 1KTLB 2JB5H 3OR6A 3DJ9A 5JW4N 3BIKB 4LLVA 4TRPH 2NXZB 4GOSA 1NAMB 3CDGA 2APWA 2YN5A 4D9RD 1AFVH 4OB5L 1MFBL 1RZFH 4JGUA 2PTTA 3ZE2F 3QI9A 3AS1A 4KQ3H 5CP3H 2XWBA 5TGBA 4JFEA 5DEFA 1C8PA 1GOGA 3F58L 5GISL 1ZVHA 2XXCB 2I9LA 3MMEB 5F89B 4U3HA 4ZFZA 1BZ9A 5DJ8A 2HMID 2XKUA 4KY1L 4YHYB 4FXKB 1L0QA 4OGAD 1LEGB 5AD0A 4X9FA 3VWKC 4MCZB 3QUXA 4NRXB 4ONGL 5C0FB 3C2SA 2HT2D 2X4PB 1LILA 4L29B 2QQLL 4KJWD 3VMPA 5I1IL 1SY6A 5CGTA 1EAPA 4J1UA 4Y5XA 6FABL 3C6LB 4DVRH 5FCSH 1RZIA 3SOBH 2XFXB 2IG2H 5CJ5A 4NO0D 5DT1L 2CIKB 2HVKB 4B5EA 5SWQA 4JY6B 2RQ8A 5J7CC 4Q74A 4PGZA 3P73B 4UAOB 2QQNL 4F37K 1QFWL 3SE3A 1XCTA 1N4XH 4R3SB 3ZSTA 3TPKA 3VH8A 3RNQB 5SX5H 2COQA 3HNSL 3LQZA 3VRIB 4B0MM 3V6ZB 1MIML 5GJTH 5F9DC 5BOPA 1UXWB 2V2XA 1XGYH 1CBVH 1MCFA 3QEUA 5C2BL 4U2ZA 1CLCA 1W72H 5JIHA 1LO4L 5F7HA 1D5XB 2NY4C 4HZLB 3MFFA 5KS9B 3OR7B 3T1WA 2JJVA 2G75B 3MLUL 3U1SH 3OKMA 3ARSA 3MRJA 4K8RH 3GMMA 3PQYB 3DPBA 2I25N 2PXYD 3FQXB 1XGUB 4PJ8C 4PLJD 1BX2B 5DHVH 4ZFGL 4N0UA 4LGSB 1CXIA 4DAGL 4GG6B 1J11A 4P4RB 3UTPE 3BWUC 2IPTL 1T5XB 2FD6L 1X4XA 1DQTA 1A14L 3ULUL 5B39G 4P46D 1KCUH 4LHUG 3KR3H 3T0EA 3GMOB 1A3LH 4OUOA 4YDVA 1UT9A 1C7TA 1QYGH 4UI2A 1GGCL 1TETL 1ZHKA 1I1AC 4MA7H 4JHBA 4NDMA 5I1LA 5I75B 4QCIB 4N68A 4HUWB 4PRDA 3SCMB 1IC7L 1QSEA 1ORQA 3FFCB 3ZTJG 4RBPH 2BNRD 4XZUB 4GKZB 5JIKA 4PP1C 4XCCH 1N0XH 4I18C 4L8SB 3ES6A 1BVLA 1LDPL 5LGJA 3AC0A 1ZE3C 4YXKL 5BO1L 3ZHDA 3G5ZA 5DJDA 5JR1H 1KEML 2HLFC 1CGVA 2ARWA 3Q3GB 5LWYL 4M1GH 5JW3L 5DA0B 4P5TB 1OQXA 3IDMB 5TE7L 1M7IA 3P9MA 1FFOB 3P9LA 1BQHA 4XPAH 4J3XA 4FP8H 1ZGLP 1KN4H 4HMEA 5L8KB 4EEEA 5J6HB 4U0RC 2C1PB 4WI9A 1YEEH 2VDNH 2VKWA 1H5BA 5CJQL 3FT3A 3PHSA 2HRLA 3LIZH 4P2RA 3GBLA 4HG4K 1UB6A 3RU8L 4KDWA 5DZNA 1N3NB 5K9OB 3LY6A 2DQDH 3CPLB 3X13B 5FKPA 3D6GA 5INDA 1H8SA 3OKEB 5T5NG 5DWUL 3P40A 3C60C 1QO3B 1INDL 1QVOA 5ACLA 4P2CG 4UV7H 4YDIL 3NZ8B 5FCUL 5CBAB 1WISA 2ZSVB 3GJFA 1NMCC 3KPLA 1RPQA 1J1OL 1AI1H 4FFZL 2SEBB 4UV4H 3BN9D 1MOEA 3SKOA 5KG9B 5J4MA 4S1QL 2DKMA 2DM2A 3VH8G 1T22A 2HYMA 4NYLA 3TCLA 4CVWA 4LLYB 4G6AC 2XY1A 5ILTL 5I1AB 2ADGB 4AENA 4PJXF 1QP1A 3GHEL 4O00A 4WFHE 4H8WH 5B4MD 1GHFL 2OK0H 3GO1H 4NRZA 1VCAA 1I9IH 4R0LA 1KCVL 3HCVA 4HS3A 2MKWA 3W9EA 2FYYB 4EXKA 1XIWA 3MR9A 1BZQK 2UY7A 3I9GH 2GITB 3RP1A 1UKQA 5GZOD 4JZNB 4XP5L 4JHAL 3FO9B 3MLYH 3KXFB 2QV2A 2N7AA 1GGUA 2R0ZH 5F7EL 1FHGA 2APFA 4QWWC 3V79C 2D4DA 2BDNH 2ZZUT 5IIEA 3FB8B 1YC7A 5C3LD 4GW4B 4OZIA 5DHXB 5L88H 2ORBH 3VJ6A 4PLOB 3VRLF 1T2JA 4W70A 3TJEH 2JIXB 3IF1B 5CKAA 3L1OH 4LVNB 4Y4KD 5K9QI 3CU7A 1YJDC 4NUJB 5EU7C 1UZ6F 2I07B 1TCRB 4WHCA 2V2TA 5GGVL 2PR4L 1F3JB 3NPZB 1E4XL 3KYOA 5JPNA 4LARH 1U6AL 4HFWA 4JRXD 2GJZA 1E6JL 4AH2B 3L3JB 1T7VA 5J0BA 1RK0B 1Z3GH 5DA4A 3QUKA 5IEKB 1QNZH 1I3UA 1DSFL 3TESA 1E4KC 2IFGA 3ULUF 1VKXB 5F1SA 1FNSH 4IS6A 3TPUB 1JZ3A 4E41A 3MJ7A 1U8QB 3FAWA 1GRWA 3RVTC 5E08L 2EEDA 1P7KA 2E9JA 4RZCB 2GJJA 2YSSB 3CFBA 3IFNL 4PJDF 4R97C 4U1JB 5CJXC 4YDJA 3KS0J 5D1QA 1OGAE 1X5FA 2F53E 5EOCJ 4FG6D 4YEEA 3WNMA 3LV3B 3DNKA 1SHMA 4FMFA 4O2CB 1NJ9A 2X40A 4LSVH 3BP4A 5SWZD 4GXVH 2PYFA 1V8HA 4NO0A 4X6EB 3SEPA 1LEIB 4NSKA 5FGCB 3BEVA 5MENE 4XAKD 5K33A 4FQ1L 3HS0B 1NMAH 3TO4D 1WV7T 2VH5H 5I6XC 3T0VA 2O93L 2C4FT 3Q5TA 4GSDH 1A6AA 1KN2H 3VG9C 2IPUG 4D3CL 1T1XA 4U7SA 2YD6A 4ZPVA 4XNQB 3D3VE 1A47A 3MGTB 3QNXB 1ZLSH 1CDHA 4OF0A 3HE6A 2HFFB 3GMNB 4G8EA 4W4OC 5K9KA 2AP2A 5E6YA 2NY5C 1FL5A 4P2OC 3WIIH 2E27H 3ZL4H 1L7IL 5JLZB 1BBJA 2OTPA 4K3GA 1I1FB 1EHLL 4KDTC 1I9RL 3GSNA 3IJHB 4YHIB 4BH7A 1BFOA 2LTQB 4MD4B 4TUJA 3KPRD 3SN6N 3ZT5A 3IDYC 1BF2A 3EYUL 3ZSSA 4M6AA 3WIHL 4Y19E 5C9KA 4UTAH 3RWEB 3ECBA 4PLKD 2DQGH 1MJUH 3N85L 4JR9L 1FYTD 1CE6B 2NY1C 3SDAB 1UJ3B 4OV5B 1YEIL 4OLEA 4LP4A 2ZJSL 1BLNA 3I2CL 1D9KA 4UUJA 2XACC 4MAYC 4BZ1L 4MQ7B 2MQ3A 2PO6C 4BSJA 1FJ1A 3PV6A 1IKFH 4HLZH 3L3IA 4I5BB 2DM3A 1F6LL 1IQWL 5AYUL 4KUCD 4KK8C 1X7QB 3LB6C 5FYKD 4LLDA 2BP3A 2R15A 4AEIL 1X44A 1AXSB 1ZTXL 4JLRA 5IB5A 1YMHB 2FWOA 1NLDL 4YDLB 3LHPL 4S1RL 4X7FC 4NWTH 1MLCB 4NN6B 2FHCA 5H2BB 1G0YR 3O4OB 2EE2A 1EDQA 1JPFB 2B4CH 5A43C 3CCHB 4Z7QE 1CLOL 4ERSL 1LEKA 2ICWI 3MCKB 1CFNB 3EAKA 5C0AB 1FH5H 1U91A 3D0VA 4RMQA 1JYXA 1ZXQA 1CQYA 2XT1B 3KYKH 5D6CA 3WNPA 4D0BA 5ADPL 5C0DB 1WLHA 5E1AA 5T33L 1KENL 1W0YT 4WI2A 3SGEI 2P24A 2YD4A 2BSSA 2IQ9L 2MTPA 1H3TA 5FM4A 5JW5A 1N6UA 4NZJA 5DJXA 5DK0B 1HQRA 3E1F1 1S7UA 1U8HB 2JCCA 4Z7NE 4JM2F 4L9LA 2W59A 1XF1A 3G6DL 4ZD3H 3MRLB 3CMGA 2FEDD 1U8LA 1IGJA 2H41A 2YEZA 4CNIB 3O8XD 1AGEA 4PV9A 2A73B 1SBSL 4LCWD 1KELL 3BP6A 3VD4A 2AJSH 1G6RL 3CIQA 1DQJB 3G6JA 2EYRA 3FQRB 4LPXA 3U46B 4PTTB 2XWJA 3M17B 4JO3H 4PGBB 1KYOK 1PYWA 1RURH 3WKML 1J0KA 1MRCH 5KW9L 3OAYK 1TVHA 4R26L 3W2DH 1FVEA 2W0KA 4EBQH 4ETYA 4LCUB 5EC1B 4NM4H 4MQSB 1YN6A 3DUHA 3VFUB 4KMTH 1KJVA 1A7QL 1H8OA 4CADB 2XZCL 5E8EA 5KVFH 5FO7A 4JG0H 4HV8B 3PUCA 5FM5O 4L4TB 4LAQL 5IROA 3QJHA 4M48L 4LCCC 1SM3L 4JFFD 1CU4H 4MAUL 1UCBH 2DWEA 1MHPL 2R2HB 4L4VD 5D7IE 1RI8A 4LQFL 2ESVE 5DJAB 1FNHA 5KOMC 4MHHI 5DC0A 3VFWB 3HZVA 4L5FL 4N0YH 4JCLA 3QQ3A 3NH7L 3CFJB 5FECB 1JTOA 4ZTPL 2VO5A 2CLRB 3SKNB 2WBJA 4XCFH 5I1EH 5HPMA 5JIIA 4Z8FH 5CS7A 3ARFA 3QRGL 5E2JA 3QXUA 3UBXI 3U6RB 4S2SB 3P4MA 5A16A 5GGRA 3B2UD 1UH2A 4Y4KB 1MFAH 1F11A 3S35L 4ODWB 4QRRD 3DXAD 3MV7D 4HJGA 3WO4B 5ECJE 5KJRL 5D71H 4PS4L 3S96A 3HNTL 5C0RH 3L3KA 3AU1A 2CDGA 4XBGB 1R5WA 2MQ0A 2OJEA 4IDLA 1RZKH 4OZFA 3OPZH 4XP6L 2FH8A 2QBWA 2HWZH 5HDLA 1SEQH 3C09C 4BH8A 4QOKE 1FAIL 4FABH 1QRND 3P4NA 3WE6A 3SE4C 2B7DT 5ICXB 5HJ3B 4O2EB 1T7XA 5BRZD 4PLNC 5EO1B 2XKNB 3F7QA 2C3GA 3RWDA 1EHAA 2HKFL 5CEZL 1FVDB 3H9YA 4FQCH 4P49A 3ARBC 1BD2E 3MJ8A 1KB9J 1GJIA 5IK3B 2OL3L 2IEPA 4NQVB 2BSRB 3WHXA 3T8XB 1UYWL 4B7IA 3EJYD 3O2WH 1WBZA 4Y16A 5INCB 4QXTB 1DBKH 1MFDL 1MF2L 4K3EH 3MLSL 4YXHH 4O51B 5HI5D 4TVPE 2DYPA 4JM2B 2HG5A 2B1HL 3DX7A 5HDBF 5TDOA 1ND0B 3MXWL 4JREC 2Q1EA 4LSUH 3TO4B 3CD4A 4LLWB 5I16A 3MRBB 3EZJB 1G7MA 5C0GB 4FQLL 5EN2A 4OZ4B 2D7TL 3BISA 5C0IB 3VD9A 3VWJA 3CFKB 1NUFA 3M8OL 2EDEA 1J0ZA 2DLFL 5C0EA 2H2SD 5JMRA 2VDPH 5DJCA 3TN0D 3BKYL 4W6YB 3HC0A 4KROD 3UAJD 4C83A 2UUDH 1KIRA 1WQVT 5FXCH 2J8HA 3SGJA 1YMME 3ELAT 2BJML 2VL4A 1WWBX 3SPVB 4U1SA 3VXUD 3HMWH 5CEZD 2CK2A 4HKZA 1TZHB 4DKAA 2D4FA 2D7NA 3ARGD 1EFXD 1KFAH 5FYLD 3T2QA 5KAQG 3O6ML 4NZUL 1S7SB 4LPYA 4HQQH 4U1KA 5IJVA 1FYTB 2V17L 3D48R 2GFBA 4XMPL 3EDDA 1Z2KA 3U7YL 3O41A 5C0ND 4S0TD 4I9WD 3MRDB 2DLGA 4M1CC 2V5RA 3AAZA 2NQCA 3S97C 1ZWIA 1RY7B 3TCXA 2DQIL 2EDYA 4PYHA 4JDZB 1LO2H 1NEUA 1HXYA 4QXGL 3GSWA 4OCLC 4PJ7F 4JG1H 1I3GL 1JGVL 2IAMA 2R23B 5D93C 1EXUA 3ZYZA 4GAGL 3VXNA 1U8IB 3EOBB 2E6PA 2AJZB 3VFGH 4MDJB 5E4EC 4WW1B 3WUWB 2CRIA 5HDQH 1EEZA 2FX7H 4RAUA 3T2PA 1C5CH 2O26U 2I5YL 5FKAB 1CGUA 2UWEF 4YHPB 3OX8B 2UZYB 5FYJE 3EO9H 5E0QA 3J7HA 4DVBA 1OL0A 5FV2A 4OZFG 2OSLA 3FB7A 4DFIA 3TC9A 1F13A 3I02A 2FGWL 4NKDB 5EOQH 2EDWA 3O2DH 1NCWH 4FZEH 4KUZL 4F7MB 4LSSL 1ZLUH 5LJYH 3B2VL 2J88H 1JWUA 1JNNH 1HHIA 2B0SL 3GM8A 5E6IA 1YYML 3NIDF 4JFDD 3VE0B 1RFDH 4PBVC 2HTLD 1ZEAH 1N26A 2ENSA 3UPRA 1DVFA 5SWSD 3AXLB 2V5SA 4KJPD 2AEQH 2BXYA 5I74B 5J1SC 2CR6A 1RVFL 4KTEH 5FO8B 3NCBB 3NCMA 1HXMB 1C12B 3UTZA 3GSXA 4LCWB 1K4CA 4MJ6A 2JJSC 1I4FB 3HC3H 2DTMH 2Z91B 1U8MB 3QQ9D 3R1GL 2CGRH 1FE8L 2AERT 3FFCE 3HNVH 1NCUA 3PWVB 2B2XH 4AT6B 4ZXBD 1KB5H 1HOCA 1JV5A 1CGYA 2YRZA 1JRHL 4N1HB 5C2UB 4FQJH 5E8OB 4JFYB 1CT8A 1UM4L 2F54B 5DD6B 5I2IB 5GRVL 3I85A 3BOVA 1KLGA 4PP2B 2C3VA 3MOAL 4OGXL 3VXPA 3WD5L 4OFKA 1U3HC 1JGUH 4CW1A 3VRJA 5T3XD 1URLA 1OF2A 5DC4B 7FABH 3TZVA 5A40E 1WSST 2IH3B 1PEWA 2GAZB 3ZE2E 3MUHL 5IB1A 2V2WB 4JFFB 5KVGH 5ANME 1QFHA 2FX9L 4JRYA 1MQ8A 1ONQB 3TM6A 2BC4B 4L4VB 4YHOH 4RIRB 5I8OL 4HFUH 4GKSB 3H9HA 1Y6NR 4G9DA 1T2XA 4L3ED 4TTGA 3PP4H 4J12A 2Y5TA 3N1MC 1U8PB 4XMKL 5DJZA 1VGEL 3IAQA 3V52H 1XAUA 2B1AH 2UZIH 4R7DB 3PIQA 2X1PA 3QG6B 3C5JB 3L5WA 1ORSB 1DBBH 5J56B 1KIQA 2YOCA 4OTXL 4EN3D 3QFJE 1XR9A 3BP5B 5JHDA 1CS6A 1G6RB 4L3AA 3G5VB 3KPSE 1XF2A 2EDXA 1L0YA 3DMMD 3SKJH 4QRRB 5TQ0H 3DXAB 1IGFH 3MLVH 3MV7B 3MOBL 5IQ7H 2J2ZA 3NN8A 5FHAL 2RCSL 3EYOB 1S78D 3O3EB 1ZOXA 4ZAKC 1YQ2A 5C6PB 5JXED 4DCQA 5DQ9B 1MCEA 2QQKL 3FRPG 3KVQA 2C1OA 4MMZC 5F7DA 2VZ3A 1JP5A 4P99A 2IC2A 1RZJC 3O6KH 3LRSA 1WCBB 2VQTA 1FSKB 1QRNB 1IC4H 1KC5H 2MWCA 3P30L 5BCAA 3BZ4B 5BRZB 5HBBA 4F7CA 4JFQA 5HVFB 5E2TL 5TH2A 2X1WL 2VERN 1F3DJ 5D7SL 3G5XB 5A2IH 1A2YB 2ZOLA 3KXFE 1U8JB 1IGCH 5I73B 3TVMA 4ZDHA 5IESL 5DK3A 3CMOH 1MEXH 1FORL 3PDGA 2OLDA 4EI5C 3NIGF 3BZEA 3DI2B 4LHJB 5KTEH 4TVSa 3NPSB 1ZLVH 2J7LA 4I4WB 3DLQR 2GUOA 3WNKA 4UT9H 5I17A 5C0BE 4OZHF 2O5XH 2FIKA 1F3RB 2EXYD 1EMTL 3OJDA 4X7TA 1ZT7A 3NCYP 3JTTA 3B5TA 3Q1SL 2X7LA 1WC7B 5ISZD 1A1MA 3DOSA 2NX5A 2EC8A 3TN0B 4Y7MA 2YPLA 5JIPA 2ZUVA 3EHBD 4KROB 2Q76A 2R69L 1RZ8B 2IAND 4GRLC 43C9A 5FA3B 4KV5F 2BVEA 1NANI 1I3RA 1MHHA 3EYVA 4M9PA 4PJGA 5TF1H 2AI0H 1MLBB 1F6FB 2X4OA 2DI9A 2DLEA 2VXTH 4N8CL 2OL3B 5A3IC 2P8PA 2VDRH 4RMUA 3TA3A 1HHKB 2ZG1A 2HP4A 5JOPE 4DN3L 5CZVL 3EFDH 4MSWB 4OAWB 2IQAB 1TVDA 4JFZL 1S7WA 5LAXA 4XVUD 3UO1L 5IWLA 2O61B 5BV7H 2RAMA 1A1NA 4U1NB 3O9WA 4R8WL 4OUUA 1CFBA 4ZYKA 5FGCE 4JZJC 1ZLWK 3QO0A 3OTTA 1MPAH 1ADQL 1HHHB 3WFHB 1SBBA 4YNYA 4PD4J 1XZ0A 2LAGB 4GG8B 4IIQA 3VXMA 3D0LA 3UC0H