4RGND

Structure of staphylococcal enterotoxin b bound to two neutralizing antibodies, 14g8 and 6d3
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
217
structure length
210
Chain Sequence
VQLQQSGAELVKPGASVKLSCKASGYTFTSHWMHWVKQRPGQGLEWIGEIDPSDSYINYNQIFEGKATLTVDKSSTTAYLQLSSLTSEDSAVYYCARTAGLLAPMDYWGQGTSVTVSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanisms mediating enhanced neutralization efficacy of staphylococcal enterotoxin B by combinations of monoclonal antibodies.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin/immune system
molecule keywords Enterotoxin type B
total genus 36
structure length 210
sequence length 217
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rgnD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rgnD02
1DR9A 4PV9A 4JKLA 4MD0A 4WO4D 5MERB 3S5LB 1XR8A 2W07A 1U42A 3KPRE 1QSZA 2IH1A 3BYTA 3WMSA 4NZUH 3VFTA 1T3FA 5ELIA 4GG6F 4P23D 4NKIH 4KWUA 4KMQA 4A6YH 35C8L 3ARDB 3OXRA 3DX8B 2GT9A 5A3ID 3B3IA 3VE0B 1A7BA 3VRIB 2VDQH 4L4TA 3SCMA 3CMOH 1PKQA 3MV8E 4NRYA 4NT6B 5HI3D 3D85A 5KTEL 3PL6D 1CGSH 1VDGA 3NIGE 1AP2A 3PNWA 4Z95H 5A40E 1FZKA 1FGNH 5IEKB 3AVEA 2GTWB 4KK9C 4OFYA 4X99B 3F7PC 3SE8H 4YBQC 1T0PB 4YK4B 1WWAX 2GSIA 3D9AH 1XGPB 5EOQL 1QBLH 2P48B 2C4XA 4KUZL 3MV8D 3WFBL 4JM2D 4GW1A 4OGAC 2BCKB 2Y72A 3BVNA 5ISZD 4DW2H 5D7KD 1FZKB 3K4DA 2L7UA 2BMKA 4URTB 4ZXBC 2PCPB 4YFLI 2NY6C 1D5MA 1Y18A 4FP8L 5CCKH 4XMKL 5D1XC 4YO0A 2MCG1 3AC0A 3GB7A 1KJ3L 2VLMD 2W65A 2P24A 4LLWA 4ZOEA 5HHXH 1T3FB 5L7XH 4LHUB 1YMMD 4NQSA 5TF1H 2WBJB 4EI6A 2ADIB 2EIDA 3DI2B 4G6FB 5JOFB 2AEQL 2LTQB 3ZTNH 3UROR 1P84J 2J88L 1Q72L 5MENE 4M5ZH 1NGXA 2NZ9D 2O5ZL 4XCEB 5GGVL 3U7YH 5E5RB 4JFXA 2VLME 3FZUC 4U1IB 4QOKB 4HCRH 5CBAA 5ENWB 1RJYA 3IAGC 4BUHA 1OAYL 3I50H 5EORH 3UO1H 4PIRF 4X98A 1TQCC 3GHEH 4PJ9C 4EVNA 1IEBB 3SDYH 4G6KL 4EUPB 4KI5E 5KS9F 3CX5J 4QRSB 1MCPL 1XFPA 4JO3H 5L2KA 2OX5A 1NANI 2CLRA 1PLGL 2QQKH 3I9GL 3VXUE 4PJFF 2XZCL 4K3HA 3IJSA 4G9FB 4LPCA 1UZ6E 4RA0C 1MCKA 3QEGH 2R0WH 5FA4B 3VXRB 3QO0B 3MQIA 1HDMA 3U0PB 3HG1E 3BIAX 4KDTA 1DUYA 1AR1C 2B20A 4QRQB 1BBDL 2N7BA 3S37X 3S3PA 5CSZB 3BPCA 1I1AD 1CGUA 1KB9J 1Z5LB 4WFHD 5CHNB 5D70L 4APQB 4H25A 2IBGA 3MUGA 2K7QA 2GIYA 1YMMA 4C4KO 4ZAKB 4UTBH 1JMZA 1QSFE 3SGEH 2NY0B 3V7MA 1FGVH 5GS3A 4IDLA 5GRWA 1ZHNB 1I1CA 2FX9L 1U3HC 2V5MA 1LDPL 3ULUC 1A3RH 1W0VA 2EC9U 2DTML 2FECI 4AG4H 5IM7A 3CDYA 4KQ3H 5DXWA 4JN1L 2JJSC 2YD5A 2VXSL 5E8OA 3FQUB 1M7DB 3CFEB 4Y4FD 1G7JB 2IALA 4F3FB 4W68A 3VFWB 2RJMA 5F7YC 2HWZH 1CE6A 2NY3C 3ARGC 3DETC 3TEUA 2YC1B 4YDKL 1KLUA 3P9LB 4G6MH 1KELH 1CFVL 1RIHH 2FB4H 2ZJSH 4YBHA 4L4TD 1JGLH 2EIBA 2E9IA 4XH2B 2A77H 4I18C 5J06A 5CINL 1JNHA 3AFLA 4HWNA 2R29L 3NTCL 2CRIA 2YZ1A 4JHZA 1IEAB 1F00I 2OJZL 5I73B 3TC9A 5HHVH 5IW1A 3MBXL 4WO4A 5C0EA 2A6KB 5KVMC 5L2KE 5JHDE 1NL0H 4Z7OF 3CFKB 3NIDF 2R15A 4LSPL 4L4TE 4LBEB 2HJKA 4EDXA 1ED3B 4GKZA 4CADA 4OZFH 2V5TA 1FH5H 1Z9OA 3C2AH 4NUJB 5TQ2L 3LSOB 4OB5H 3MUJA 3CH8A 4XTRD 4KK6D 3TT1L 5L2KD 2YXFA 1RZGA 1X5AA 3SY0A 3VD4A 4JQIL 3GM8A 3W9DB 4LCWA 1CD9B 1IAII 1JFQH 3BDYH 4UBDC 2YMXH 4G43A 4JM2B 1DUZB 1ONQB 2NTFB 3EYQD 4GKNB 4M4PA 2VQUA 3ARFA 1U92B 1IEHA 2OSLA 3MRDB 2BSRA 4JFEE 4P59H 5K9QI 3RKPA 1K5NB 3GJEB 3BWAB 1VFMA 3GMRB 3PWUB 5CZKA 5C0CB 2WWMC 5INCB 3TCXA 4CW1B 2Q8AH 3B4NA 2X1OA 3GRWH 5C86A 3WS3B 2QSCH 4MQ7B 2P8MA 4ZUWA 3LKRB 2A83B 4NBZB 3G5VA 1J86A 3PF2A 2NYYD 3BKJL 4RMQA 4PJBA 1AXTH 1GIGL 2VLRD 3F7QA 2PYEE 5EIQA 3MO1A 4DTGL 4DGIH 3F62A 4M1DH 4I77H 4UNVA 3MLXL 1FO0H 4ZUWB 5F7KC 4HWBA 2I9LA 3QQ9C 2VLKA 5C08D 4GG6B 2UY7A 2Q86B 5FGCB 3BWAA 5ACMA 1QFOA 3PGDB 1EZVX 2COQA 1J5OH 4L4VB 1G7MB 4X5WB 4Q9BA 2PYED 1IE5A 3UTSE 4RDQG 4PRIE 1GRWA 1R3JA 4PGCA 5TQ0L 1VADB 3HUJE 2FH8A 4MJ2A 1NMAH 1GZQB 3MLSL 3JTTB 2IBZY 2R8SH 2HJLA 4R6UA 1OLZA 3BD4A 2PW2B 1FH5L 4QRTB 1J12A 3TV3L 5FFLA 2Y6SD 4IHOB 4N0CC 4G9FD 4NYLB 4I3GA 1SYSB 2ITDA 3B2UC 1BIIA 4UDUB 3TBTB 4CMMA 2OJZH 4GKZB 4CADB 5DC4B 1IAOA 1IGFH 2MWCA 3FN3A 3P0YL 3PDOB 1IARB 2Q7NA 5SWSA 4FN0A 3OXSA 2QSTA 1CL7H 5IW1B 3BYYA 3JV6A 3HC3H 4NQEE 3P4MA 2XG5A 1HKFA 5E7FA 3F7YA 1URLA 3MRQB 4OD3L 4PJEA 4O2EB 4O58L 5FYKH 5BS0A 3U4EA 2EYTB 4G42B 2VC2L 1IAIL 4HH8A 5IW6A 5DEFB 4E41E 2XFXA 3Q5TA 4GH7B 4ELME 43C9B 1A8JH 4NQED 3I3BA 2CUHA 1H0DB 3GSUA 3HUJF 2VXSH 2C1OB 1CE6B 4FMKA 1C5BH 3ARGB 3E8UL 3V52L 4S0SD 5FUOH 5BCAA 5F6IB 1KFAL 2BSTB 4MA1B 4GRMB 4Z7VA 4E42B 5EZIH 3DARA 5C07D 4HG4J 3EO0B 3QZWB 4L8SA 1FNEA 4P2QE 2I60L 3U7WH 3ZYZA 1FVDA 4MJID 1VFOA 5IV2B 1BD2E 2WUCL 2KL6A 4L8BA 2IH3B 1TJHL 4MAYB 3WNPA 1IT9L 3AREB 5EZJA 1U3ZA 1KPVB 3QIBC 4OSUL 5EO1A 2R2BA 3D25B 5C0CE 3MOBL 4Q74A 5C07E 3VFOA 4ZAKC 3BMWA 4BFIB 1A47A 1OP5K 3CUPB 5C0FB 5CHNA 4HKZB 1H3TA 4NUGL 4N0UE 5CJXA 2DQEH 2Y06L 3ULVF 1CFQA 2ED8A 4OKVA 4UQ3B 3MZGB 3QDMA 5KVFL 3DO3A 4PB0H 5K59E 4LCYB 1B2WL 4W70A 1EHLH 2EYSA 4XXCC 4IOSD 1ULVA 2P5EB 4N8VG 1AHWC 4HFUH 3JWNC 5KSAB 5F88B 4WGVB 2CKBH 5DK2A 4LAQH 2DD8H 4NP4H 4JO3L 1ERNA 3B2UD 1D5XB 5DZNA 1KXQE 4N0CD 2Y6SC 5I0DA 3OSKA 3SO5A 5L2KB 2QQLL 4XBPA 1NDMA 2ZCKH 4MNGE 2CKBB 4OZ4B 4W4OA 3FN9A 1I8KA 3IT8D 1F4WL 2HJFA 1ZGLM 4HCRL 2IMNA 2KZ1B 2I24N 4DGYL 5GGVH 2P5EA 3DSNA 1F97A 4L4JA 1NCUA 3P40A 3NZHL 4HFUL 3OV6A 3QDMB 4BSJA 5D8JL 1T83A 3I85A 3IRZA 1MHHA 3QQ9D 5CWSA 1JGVH 3ULVE 1QOKA 5ETUB 3L9RB 2VSCA 2W9EH 3L95A 2J8HA 2BP3A 3QFJE 4QKXB 4AJ0A 1C5DB 2VH5H 2N1KA 4PJBE 4YHLL 4DGVH 1M6OA 4ZUUA 2Z8VC 2W92A 2A1WL 4QHLA 4U1NB 5B3JE 4CGTA 3JVGA 3FOMA 2NY6B 4RAUA 1OAZH 4N1EA 5EOQH 4MX7A 4QXGH 4LHQB 4X7SL 2X4NB 3BJ91 5IEHA 1ND0A 3ALXA 5BZWB 1LE9A 5DMKA 5DYOA 4UBDD 3KXFD 1ROWA 3LKNB 1HHHB 3BP7B 2ZUQB 4ZOAA 3UTPD 1H0DA 3TZVD 4JPIA 5IOPB 5HYSA 5I66A 1A4KB 3VWKC 5J12B 1QFWI 3C5ZA 3VE0A 5MEOB 3GI8L 1HZHL 4DN4H 3RI5F 4ZTOL 1DANU 3L3HB 5IF0B 3NCMA 2J12B 4HJJH 3HNTH 5HI5C 1FJ1B 3V6BR 4XCNB 1DQLH 3GK8L 2XWJA 5D1ZC 4EI5B 4OF3A 4UT9L 4N8CL 5FB8B 1A4KA 4GAGL 3U79A 4JG1L 2XYCA 3KLHD 4ALAL 4PP1D 2EDWA 3DVGB 3GMNB 3PHOB 5SWZA 5BRZD 1N2RA 3ARGD 3QUZB 5DMYA 4CN6A 1NGQL 3QQ3B 4L1HA 3CGTA 3EYFA 1KULA 2ZNWA 4Y4FC 4G7YL 1PKOA 3QQ4B 1ZHBA 2ITCA 4J4PA 1IQDA 3MLSH 4Q7DA 5E2UH 1KNOA 2OQJB 1JPFA 4CUCA 3FTGA 3GKWH 4WHDA 1S7WA 4FTVE 3EBAA 1A0QH 1C5CL 1U3HD 5HPOA 3SN6N 4C56D 5LBSH 4KZEH 4XC1L 1MEXH 1H5BA 1OAXL 2R56L 4Q6IA 1AGBB 4YR6B 5FKAB 1FZJA 5D1XA 1J1XH 2AJXL 3EYVA 4Y5XA 4CBPA 5T33L 5DTFB 4P23A 3RWGB 4PJCB 4DN3L 5C3LD 1GOFA 4RX4A 1VPOH 1Q94A 1QSFA 3X11B 5LWYL 3AMKA 4NZDA 5E6IB 1OF2B 3FCTB 3UX9B 2RQ8A 3MLRH 3WIHL 1YDPB 4ONFH 5DVNA 1I1AC 5LCVH 1XT5A 1BF8A 3WFCL 2DYPB 4RQQA 5I16B 1FORL 4M9PA 4BKLB 1IC1A 1MRDL 2I25N 1WCQA 4UILL 3B2VH 1Q9LB 4GKNA 1R3LA 2DQDL 5GJSH 5J13C 2V7NB 2NW2B 3VJ6B 2AJVL 4FQIL 1VB9A 4PY8J 5DRNB 4TRPH 3V6FA 4XBGB 3NPSC 3SDAA 2CDFB 1MRFH 5CLWA 2Y5EA 3M17B 3UCRA 3MJ8A 5D5MF 4G8EA 3W5NA 4PGEA 3KNBB 2VXUL 1A6UL 3SDCC 2DRUA 3TT1H 5IKCA 4PJ9D 4WGWB 4XAWH 1EEUA 5HVWA 1CD1A 2AEWA 3GFUA 1YEEL 4G8GA 3EOYG 2Q1EA 2WM0A 4BZ1L 1ZGLB 4NRZA 3MROB 5HYJD 3O0RL 1Z6JT 2NZ9C 1JNHB 1F90H 4YLQT 3TESA 4OCNC 3F12B 1IQWH 1RZJC 4UOJA 1P4LB 3BGAA 4H0GA 4HAFA 5GJTL 1YEIL 4U6TA 1KIQB 1P4IL 5JIKA 4AIZA 1RUAL 1TJIL 4XP4L 1EEYA 4GRWB 4XNZB 5GHWH 1K4CB 1B0GA 2AQ3A 5E4IA 4HWBL 3P9LA 5FGBA 4EN3D 1WIOA 1LD9A 4ZUVA 4PJGF 1DQMH 3MA9H 3MMEA 1YEJL 1MJ7H 1OQOA 3IDNA 5FECB 1U3HA 5B4MD 3PXHA 2NY6D 3IFLH 3P4LA 4ZXBD 4D3CH 3GSVB 1CXKA 3I6KA 5E5MA 4P4KA 4XBEL 4ODBD 4JREC 3N06B 4OZGE 2OZ4H 4JREB 1V7ML 4FZEH 4OGAD 12E8H 2K1MA 5C09D 4H1LB 2UV3A 2OZ4A 4K07A 4M00A 2H32H 1RIUH 1JHTB 4KK9D 3U36A 2VZTA 3WO4B 4PJXB 4DZ8A 3ELAT 5F7NC 5LQBL 3FFDB 1KBGH 3DGGA 3PL6C 5B39A 1YMMB 5HI3C 2YRLA 1I8MB 1Y6KR 5EDXA 3QRFM 4XB7A 5A16A 1IM3B 4MAUL 1OP5H 4RBPH 4KJYB 2Z92A 3TNMA 5HDOA 2GY5A 1J8HD 1ZS8A 3L5XL 4E5XB 3PE9A 5K9KB 4YE4L 2YHGA 1T4KB 4WO4C 3OGCB 3G6AA 3MRNA 4J8RA 3DMMB 2BRQA 1H8OA 1TXKA 3TBSA 5J57B 3O11B 1FVEA 5DQDL 3UBXA 4ENEC 5C0AD 3TO4A 3ZT7A 3IJSB 4P0DA 1I75A 3WKMH 1I1YA 2O61A 5GZNC 4OFKA 4QRRE 4WUKH 2XG4A 3LS4L 3OKKB 3WLBB 2FR4B 3QIWC 3T0EC 4PTUB 1BX2A 1OAQH 2UUDK 1MCPH 3WJJA 4AK1A 1U8MB 4C83B 5J13B 4GRLB 3MV8B 4NJ9H 4TVSa 4LDOB 1R0AH 3IS0X 3VXRD 3UTZA 1F3JA 1D5IL 5CBAB 3QRGL 2R2CA 5EORL 2VE6A 1BP3B 3SJVE 1BGXH 5D7SH 3H7BA 4HC1H 4OFDA 1MHCA 5J9PA 1DEEA 4R4NC 5I9QC 2VLKB 4WNQB 4HJGB 1E4XI 3REVA 3EFDL 4NM8H 1KBGL 5GS0H 3S4SA 1QA9B 4PLKD 1A6VL 4WWKA 2A6IA 4F2MB 2PXYC 3KDMA 4N5EC 3D48R 3QDGD 5ITFA 5I1JL 3V5DB 4PJBB 5IMMA 2YPKB 4D9LH 2X89D 3ARBB 3MZTA 1D6VL 1CLYL 4CVZB 5FYJU 4FQQB 4JHAH 3VI3E 3HMXA 1JTTA 4GLRH 1LEGA 4YJZL 3JWOC 1D9KD 1T03H 1K5NA 5T1LD 3TYGH 1E6JH 3RDTC 4QHUA 2ESVA 3IU4L 4MA8L 4HGWB 3GZKA 3FMGL 4M48L 4M62H 3L7EA 3WFBH 3QUZC 5C6TH 5C6PB 2FH6A 4UT7L 3D9AL 1ZHLB 3SKNA 1FYTE 2BXZA 4YNYA 1RUAH 1TJIH 2DDQL 1AE6H 3EOTH 4PJEF 4UDTB 5DVMA 4NUJA 1AXSA 3T08A 3WDHA 1HYSD 1N64H 4L4TB 2WBWB 4LFHD 1JVKA 3KPPB 4CMHC 5BVPH 3DSFH 1A14L 4OLZH 4RGNE 2O93L 1JYXA 2VDQL 1VEOA 4KJQD 3UTSB 4BZ1H 1TZHB 3ZKND 4TNVF 1X5JA 3G04A 3NZ8A 4NC2B 2AXGA 1YY8B 2J2ZA 2X4SA 3Q6FB 4E41B 3H8NA 1QHPA 1MAKA 3DUUB 5DSCB 1JN6A 3QEUA 5D93B 4Z7VE 1FNLA 4BZYA 2F54B 4TTDC 5IVNA 1ZEAL 1X6NA 4ONHB 2CJUL 3K4ZA 3U0WL 5KN5B 4JHWH 3TIDB 4EZMA 3NCEB 3P0VH 4NN7C 5TDPA 4PYHA 4RGMB 1AJ7L 3VG9B 2FCBA 3VRJA 2VUOA 3GEWB 4IRZH 1MCJA 4KGJA 3G9AB 1E27A 1J87A 1EUTA 4TQEL 1G7LB 4JJHA 3MJ7A 2QQNH 1DDHA 1B3JA 1YC7A 2GK0A 2PW1B 2PYFA 3O2VH 3VXSA 5I1LB 2F58L 5EPMB 5HGBB 3VW3H 2HFTA 3QWOA 4ONOA 1AQKL 3N1QC 4KMTL 1ZVSB 1EEZA 2WLYA 5LWYH 2VXQH 4JPVH 3ULSA 5JXEA 5AD0B 2CK0H 1MHEB 1YNKL 3MXWL 5HJ3B 3WN5A 3GGWA 4K3JL 4QXTA 2BFVL 4FXGA 3VXQA 4TOYH 1LE5A 1OAXH 1MEXL 2NY2C 2ZKHL 5IBTL 1AFVL 1OAUL 2R4RH 2R0ZH 5DA0B 4APQA 1MY7A 3BEVB 2JJWA 4QXUL 4NPYA 5JOPD 4ODWA 1T04B 3H3PL 2VMFA 3SQOH 1HHKA 4L5FH 4XXCA 1N3NA 4ETYA 4DUVA 1AC6A 3U0PA 3D39D 1M1SA 3PWNA 1P7HL 1CGXA 1S5HA 4HT1H 3C6LC 3UBXG 5I1DA 5JOPE 4K23L 3T3ME 3FQWA 2VYRE 5IB4B 3JWDL 1C12A 1NC4A 4IRZL 4KHXL 3INUH 3O3DA 4GXUM 2H1PH 1UXWB 5JPMA 4JHWL 3KPLB 3HE6C 5BMFH 2MQ0A 5JO5A 1BQSA 1EJ6A 4GAFB 4EVNB 3WHXB 5E7BA 5KSAC 3VGAB 1RUML 3RGVC 4J3OC 1DTUA 5EZLB 1M71A 1ZT4A 3QIUB 1S9KC 4CVUA 5IHZB 2UWEA 1LP9E 3UPRA 2ZSVB 4RMSA 5BO1H 3CK0H 1UCBL 3HNVH 4PRPA 4Y16D 1S78C 4M6ML 1KPUA 1P53A 5CILL 1WCBA 4L3ED 5KSBE 4Q58C 3DYPA 3KJ6H 3IVKA 2B0SL 5GGUB 3ZTJG 2VLRA 5ID0A 1SEQL 3WXWL 1CLOH 3A6BL 2DQUH 1II4E 4N0YL 4P46C 2ICES 1IAKA 5HDQH 4NGHL 3SGKA 2IJ0C 3LKQB 4KC3B 5TDNB 4LCWE 5C08B 3RVTC 1AE6L 1NGYA 3HA0A 3JVGC 3OJMB 5HGGS 3MCLL 2HT4D 2BHUA 4YDLB 4U31A 1MH5B 5DR5H 5C6TL 1YEKL 3QAZB 4M93B 4MA1C 4JR9H 4GQPH 2BCKA 2A1WH 2ZCHH 1R5IB 5KOMC 1IKNC 3MLTA 1ZLUH 3QXAB 4TULL 3MUY1 3MBED 3NPZB 2NLJB 4MAYD 3IVKB 5B3NA 1QO3B 4HBCH 2YEZB 3BP6A 4GBXA 3S35H 1MJUH 1V3LA 4GSDL 4X9BA 1JMXA 5AZEL 4OT1H 1PYWB 1U58B 4JM2F 3D85B 2H8PA 5DO2D 2PNDA 1INQA 4HIJA 2E5EA 1UA6H 4BH7B 1PG7H 2X4OA 3OF6D 4NQCA 4XNQB 2FX8H 3V95A 2FEEL 4ZFOA 4JFPA 3RL2B 1X44A 2PTTB 4HIXH 3HS0A 2IH1B 1OTUC 3PJSB 5JO5B 1XR8B 3GSNH 3VRLE 4PJFA 5MENB 1BGXL 5D7SL 5T1DH 3P9MA 1UXWA 1MCIA 5DJ0A 1XR9A 3LZFL 1PX3A 1FZMB 1GH7A 2VZ3A 3A0OA 1MI5B 2XN9D 2DLFH 4PJBF 2DWEA 3QO1A 4CDHA 2RR3A 4U1KA 3EDEA 4U1LA 4XC3L 4NP4L 1DSFH 4X4XA 1IGMH 5CJBA 4YH6A 1NBZB 1I7UA 1MHPL 1QNZL 3Q5OA 5JPNB 2CPCA 1S8DA 2AEPH 4WUKL 3DHJA 3QI9A 4MDIB 5IESL 3OKMB 1ITBB 4JLRA 1B9ZA 3HRPA 1DE4B 2ZOLA 3VXUB 1FPTL 4M1GL 1V8HA 1Z3GH 3OG6B 2Y06H 3BZDA 3N9GL 1X7QB 4JFFB 2F53E 3GSOA 3V4UL 3OB0H 1XCQA 5GRZA 4LF3A 2PO6B 3GIVB 4IDJH 3UJJH 5SWZE 5J11B 3BWUC 5B21A 3TJHD 5L2JB 5GS0C 1UVQB 3DWTA 2VTFA 3GMPB 2A9NH 4DQOL 5EOTA 1RUPH 3F8UB 4PJIE 4XXDB 4DCQB 2H3NA 3EYOB 2F53D 5AYUH 1EUUA 2YUZA 1G9NL 2AK4D 1A7NH 2GITB 5LQBH 3VRJB 3S3JA 4KZDH 1Y6NR 2J8UA 2R4SH 1UFUA 3BMVA 3DVNA 4C4KT 4TSCL 1NFDE 5IT2L 3OKDA 3AS2A 4HG4K 3O8XB 4P9HL 5E8DH 4C57C 1W72A 1LEKB 4NZTH 5I74C 4MCYB 4KTDL 1MCLA 3DXAD 1F6FB 3D3VE 4HS3B 3KXFB 1BWMA 4LVOC 4N0FB 3EDKA 2OZ4L 3D2UD 4LVHB 4MXQC 4P5KA 1HINL 1JCKA 3F5WA 4NQXB 1QFWH 1L0XA 2FX7L 4ESKA 3KPQA 4ZDHB 3WNLA 1A6AB 3OGOE 4WI9A 2GTZA 4OBSA 4MS8D 1MFBH 1NANH 1SY6H 4M1CC 1F4XH 3O3UN 4WHTA 5FO8B 2IBBA 4K8RH 1JHLL 1G9EA 4JFDB 3FT2B 5CFHA 4POZD 5IGXH 4X0KA 1FFPB 2AKRA 4Y19D 1TVBB 3KYKL 4LPUA 1NUFA 5IB5B 2ARJA 2DQTH 4OGXL 5FYLH 3VH8A 3FFCD 2WWKO 1XF3A 1F90L 2EYRB 5FHBH 3P3YA 2R0KH 1KEML 2VKXA 4LASH 3RPIA 3GJFH 3H3KA 3WHE1 4UMGA 5EOCL 1UM6H 4UAOC 4CVXB 4U1MB 2OP4L 1CF8L 3CFCH 5L0QB 5AUMB 4OD1L 1N8ZB 1EFXB 5LXGL 4HGWA 5IFAH 3RBSA 4NNYA 2IAMC 1YN6A 3ZZ1A 5CGMA 3MFGB 4PJFE 1I9JL 3RA7H 3KLDA 1L9NA 1JF1B 2APXA 4MWFA 4EEEA 4LCCA 1NMCC 1UZ6F 3O45B 3WUWG 2R9HC 3SDDB 5DFVC 4F7EB 2VDKH 3EJZC 4TRPL 3O3AA 1WZKA 4W81A 1F8TL 4X4YA 1RUQH 3O3EB 1YNLL 2K3TA 2NW3B 5ICZB 4PJHB 2XWTA 3MBEB 5DMIH 3B2VL 1AGDA 3WS6C 4HUVB 3MC0A 4FG6C 1BMGA 2HKFH 2ZG2A 4FXKB 1GIGH 1FL6B 2ADGA 1H15B 3PL6A 4R3SA 3TZVB 4XPGH 3C5SB 4G8IB 4L9LB 4G8IA 5CKAA 2G5BB 3WIIL 5E9DE 1HQRA 2AXFA 4Z7QE 1EO8H 5JUEH 1T1XB 1RK1B 1B4JH 4AM0A 4OJFL 2JB5L 4R4BA 3U4AA 1RUQL 1B0RA 3G6JB 2XWTB 3MBEA 4KY1H 2Z31B 5F7LB 5FYJD 4NDMB 1G0DA 4U6HB 3ULUF 4XWOD 3O3EA 1XIWA 4OI8A 3A6OA 3KPSD 2YWZA 4XMLH 4ZS6D 2WIMA 3ZL4H 3B5TA 4LCCB 1S5IL 4PRIB 4YX2H 2DQFB 4P4RA 4G7YH 3RGHA 4FZ8L 4OD1H 3ZDXF 3W0WB 5JW3L 9CGTA 3D3VA 4S0TD 2XWBA 3FB7A 1A6WH 3IDGA 3WJJC 1NL0L 1TQCB 2G2RB 3QBTB 2VLJD 1KTRL 5EUOE 2EDQA 1OAKL 3RNQB 4ALAH 4FQPA 5IMLA 1ZT7B 4KJYA 2J6EH 1NBVH 4NO0B 3MRJA 4X80H 2DI7A 5CINH 3SPVB 3NBNA 3RY6A 1U9KA 3JV0A 5F96L 4Y16A 1G7IB 1VGKA 1MWAB 2LQRA 3CFIC 4L9LC 3KYKH 3S7GA 2B4CL 2LTQC 1VKXA 5F71A 1N5AB 4JRYE 1WICA 1RULH 4HPYL 1MCRA 2DI9A 3DV4A 2AKRB 4MSWB 4MD4B 4M61A 2XICA 4MVBC 1PG7W 5KOVC 4K7PH 4P2QB 2G2RA 4YDKH 2DMCA 2VISA 1NUNB 1WBYA 4WV1B 4HULB 5SX5H 3WKNA 1H3UA 2XACC 4AIOA 4LSRH 2PTUA 4KV5E 4JRYD 4PY7B 4NZTL 5D7KE 4P5KB 1I9IH 4XP5L 3F65A 3KVQA 3QXVA 4KMLB 4ODXA 3OKNB 4P3DB 5TE4H 2XKNB 1IM9A 7CGTA 4DKFL 4JQXC 5EUOF 4BSWA 5DJ8A 1JE6A 2QTEA 2YR3A 5L0QC 5EU4A 1TIUA 1ZAGA 1A7OL 4H1LG 2IQAB 1K9TA 2DLHA 1NCWL 4WU7A 1MOEA 2DM7A 3VXPB 1UVQA 4DGVL 1U91A 3ARZA 3I2CL 1DL7L 2PF6A 1BBDH 5DDHA 3FB5A 1ZGLA 3A6CL 4R2GB 4OLWH 1FHGA 1MCQA 2X5PA 4KGLA 4HKBA 1NGPH 3U2SB 5HYJB 3DRQB 4WI6A 1SBBA 2E7BA 4M8QA 5GGVY 4EKXA 4D9RD 4KV5F 4P5MB 3VXSD 1A9BB 3BIKB 2QQKL 3I9GH 4JAMB 4PJ8D 1DZBA 1QACA 1HH9A 3NN8A 5IQ7H 4LVOB 2VZSA 4XC3H 2K7PA 3E6FB 5I74B 1JF1A 3FO2A 5F7WC 2OTWB 1XIWD 2DLFL 1IVLA 2VDPL 3OJDA 4PJIB 4PG2C 3FQRA 1T20A 4JCLA 3HFML 3LN5B 2J4WL 2ZUSA 4NKOA 1KN2L 5KVGL 3J7HA 5HY9A 1NPUA 1PBYA 5MENA 5EN2B 2GCYA 4LNRA 1WT5A 4XMPH 1WFUA 2VERN 3IDMB 1XF3B 2EYRA 1BVZA 1KTDB 3HLAA 2BNQD 1GC1C 5CD3B 3BHBA 3IGAA 5JXEC 5IB5A 3WFDL 3G6DH 2WLZA 4NQCB 5FUZH 4HIJB 3Q48A 4BH7A 1YEGH 3TO2B 1LK2B 1RUKL 2EDXA 4XMKH 2H8PB 4FQXA 4JGMA 2FHFA 2MPAH 1S9WA 3IDUA 3FTGB 1QRNB 1YQVL 2BNQE 1IJ9A 4HK3N 4MHHG 5ITBL 3QXDB 3IDXH 1KCKA 3WDIA 1J8HB 2NY4B 4YHZL 5JLZA 1EPFA 1QPPA 5GSRB 2C1PB 5L9DL 4D9QE 3Q6GL 2GSGB 3KHQA 3O8XA 3SO3C 1YNTB 4LHJB 4WFGE 1FVCB 4KKBD 4UUJA 2HYMA 4YC2B 1KIPB 4R4FH 3CFJA 2LV4A 5DS8A 5DRXB 1I3GL 5DQ9B 4XCNA 1FCGA 1IGYA 2GAZB 1R24B 4ZO6A 2NMSA 1WC7B 3QDGA 5L2JA 4UINH 3RGVA 2FGZA 3BAEL 4NN6C 4WCYL 4U1SA 3SE9H 2CMRH 1U8PB 1D7FA 4I13B 1WTGT 3LD8B 5JHDD 1MJ8H 3ALPA 4LGSB 3IDJB 2CLVA 3UPRB 1R3HB 4Y2DD 2X40A 5J6GA 5T3XH 3MJ6A 4FQXD 1CICC 3QIUA 5IBUB 1OP3K 3QJFB 3QCUL 1DE4A 2AQ1A 2ZOLB 1HWHB 4ZSOE 5C0IA 1UWXH 4HLZG 3ZHKA 2WWKT 1LO2H 5DK0B 3INUL 1U41A 4P46A 1R24A 1UACH 3GO1H 2OBGA 1J0JA 4HIHA 3PQYE 4N1CA 5LGHH 1PQZA 3DUHA 2Q7YA 1WEJL 4YDLC 3WFEH 2QADB 4JO1H 5I1KH 2V7HA 4NWUH 2V2TB 1D9KB 4HZLB 4QHLB 4TSBH 5DJ0B 1U6AH 3MGOA 3RTQA 2BOCB 3C08L 5HGAA 4HC1A 5FYKU 2GSGA 3T3MF 4TPRL 3PQYD 1IKNA 4LIQE 5EFIB 5MP6H 1IZJA 5HVFB 3WE6A 4P3WA 4ZO7A 1JNLH 4WWID 1F6LL 4OCXL 1VACB 5IBTH 2J8UE 4ZFOB 3L95B 2XA3A 2JCCB 32C2B 4XVTH 4GMSL 3UDWC 5EO9A 1YNKH 2BDNH 1MIEH 4I0PA 4PJAB 1YY9C 1MY5A 2D7TH 3UYPA 1LK2A 3T8XB 2P1YA 4MB4A 3BP6B 3QCTH 5F7EL 5J89A 1BOGB 3UTSD 3VGAC 2BDNL 2A9MH 4P3CH 3BHBB 4U0RB 2HJFB 5IHUH 2QSCL 1CDJA 3K74B 1C7SA 1Q0XH 1G7LA 25C8H 4QGTA 5EN2A 3P0VL 3MRCA 4ODUB 1CIUA 4MXWL 4X4ZA 3RKDD 2LU3A 3CIQA 5TDNA 4KKLD 4PJ5D 2RIKA 3BDYL 3BN9D 4PJ5A 5H8DA 4D0BB 1K85A 1IM9D 2X89A 4XP9L 5JIIA 2VZ1A 4NQTA 4KU1A 1LO0L 1DBKL 1Q0YL 3SE4C 2NY4C 4RMTA 2B7DT 4MA7L 3NABH 4LPXA 2ZPKL 4M7LT 5L6YL 2E9WA 1N6UA 2NY2B 3GMQA 5C0FA 2BNQB 4F8QA 4GW5A 3MGTB 1G6VK 4NIKB 3RWFB 3BDXA 3UTSA 1R5WA 4K3GA 3LKSB 3NGBC 1N64L 5HYJA 2EDEA 4KVNH 5DZOA 3RZCC 2AJSL 3ECBB 4WW2C 1BQUA 4NQCE 3RJQB 3O4LD 4XNYL 3WUWA 4I0PD 4K71B 5JR1H 4OI7A 1FVDB 2CMRL 3F7VB 2DQIL 1MCFA 4XI5C 5DQ9A 3PGFL 1MCOL 1JF6A 4NKDB 2Z93B 1P5UA 3TJEL 3VG9C 4M5YH 4LARH 3VXTA 3EO1A 4AL8L 2WV3A 3FRUA 3PQYA 2X9WA 2C1OA 3PWNB 1RU9H 3ZT6A 3VXNA 1J1PL 1KOAA 3VFUA 5C92A 1FZOB 1VHPA 4JN1H 4MZ2A 8FABB 5FCUH 1QBBA 2HVKA 1BZQK 3BUYA 3RX7A 4AG4L 1T80A 4L3EA 2VDLH 3TBVB 3D18B 4P2RE 3RVWD 1I9RH 5CEXA 1J8HA 1CU4H 3QXDA 1A6VH 4M7ZB 2H32A 5IROC 1ZANL 3KDMB 4S2SA 5DHXB 2VISB 3L3JA 1FC1A 5GISL 1RZ7H 2EDHA 3IJHB 4UTBL 1F45A 2KZWA 4YBLC 2BZDA 5KSBA 1NFIA 3K8KA 5I1IL 4HKJA 1VKXB 5T3ZH 2V9TA 4YDJA 2OTPA 3WFDH 5JHDA 4Y16B 2DMKA 5KJRH 4JRXB 5I30H 1F3JB 4LP5A 1IFHH 2L7JA 4XHJC 3N50A 2JJTC 1TQBB 4PY8I 3DLQR 4J4PD 1F58H 1CFTB 1C08A 4EUPG 5ICYA 2E27L 4K94L 3LS4H 2BXYA 1FLRH 2IAMA 1JL8A 4QNPE 2EDYA 4ONHA 4LPYA 1KN2H 5KVGH 5FM8A 1V5JA 1PLGH 2HG5A 3MV9D 4L4VA 2DQFA 2YSSA 4L1DA 2DBLH 4HX1B 4TUOB 4FNLH 3DJ9A 2JLLA 5I1AA 1FN4B 3NFSH 3WFHA 3GHEL 1P6FA 3ULVD 2BHYA 5M94B 3V5KB 4NDMA 1ZLWH 1MNUH 1NLBL 4YWGH 3WD5L 3QFJD 2G60L 3MV9E 4F9LA 1NMBL 3V9FA 2UYLA 4UOW1 4JFEA 4LU5L 5DA4A 2R1YA 1RK1A 4PGDA 3SKJL 3RWJA 3KYAA 1YUHA 4G8FB 2P7TB 1V05A 5HI4D 2G5BA 1HHIA 1FV1A 3FFDA 2X09A 4B7IA 1I3VA 4WU7B 3D69B 4JO2H 2V5YA 4R3SB 3BUTA 2ADGB 1QKZH 3MLWL 5HHXL 1TVHA 5E6ZA 2VNCA 2EIZA 4ZPTA 3SDAD 43CAB 4QNPF 5T5FH 1V3KA 5CCKL 1LILA 4XBEH 3T0EB 4BSWB 4J7RA 3CLEL 5ICZA 1DBJL 3LKPA 1I7ZB 1YEFL 2VDOL 2ED9A 5TFSH 4UT6L 2LABA 3LSOA 4ODXB 3HG1A 1WVZA 2QV2A 1T1YB 1GHFL 4PY7A 4MWFB 4OIAA 4WI8A 3DMMC 4PLJD 1ORQB 5CGYC 1BQLH 4Z95L 5GRUH 43CAA 3N1MC 4J3SA 3ZDYE 4M61B 3C60B 4PGJA 3F12A 5J3HC 2OR8A 3QNXA 2D4FA 3D69A 1FIGH 1UYWL 1BWWA 2OL3H 2HRPL 2HLFD 3RP1A 2Y36L 2DQCL 5HHOD 5J1SC 2GHWB 5BXFA 4NRZB 2EE9A 1RJCA 4K7PY 2DF3A 2XPGA 4X5XB 1I8LC 2HTLD 1QYGL 3H9ZA 3T77A 5HSFA 4LCIH 1FBIL 2UYLB 1QTYT 1H3GA 5F72S 1TVBA 4J3XA 5F9JA 3ZKQD 3IYLW 1EFXD 4X80L 1MRFL 1BX2B 4JFDA 4QRPD 3QUXC 4NWTL 1KCLA 4G8EB 5HHOE 4LVNB 4Z78B 1E6OL 2Q6WA 3IKKA 4BFBD 4NHCH 5I1AB 2EE2A 3MSPA 4HH9B 3PHSA 5A2KH 3CVIH 4X9HA 1CE1L 5C0GA 2AABL 3O11A 2KKQA 1N0XH 1Q9LA 2IANA 3BI9X 3N1PC 1U8QB 2X7LA 2ZNXA 3P77A 5DEZA 2A74B 2UUDH 2Z31A 3D2UB 2VZOA 3BPNC 3LRHA 5C0BA 4JRYA 5L88H 3LMJL 5MEPA 1RMFH 4NC1C 2CXKA 5D2NA 2HMID 3JWOL 3REWA 1FNHA 2AJXH 3NAAH 2JB5H 2EXYC 5GRJL 1Q94B 3X11A 2R56H 3STBA 3QWRA 3E1F1 4DFHA 3R0MA 1H15A 5FA4A 3VXRA 1H5BB 4Q6IB 2DM4A 5IVXE 1IBGH 3L3JB 2F5BH 3AXLB 4CN4A 4M7KL 1AGDB 4HUVA 1C1EH 4LSQL 4JKMA 3SJVA 1N0XL 4PJHA 3LQAH 3BD5A 3AU1A 3R1GH 2IQ9L 4M6OH 5M7QA 1EVUA 2P44B 4O9HL 4PJ7A 3I6KB 2HVKB 1QQDA 3BUYB 4NHCL 4KI5C 3SDDA 2GQHA 1G7PA 4P2OC 2QJDA 2YS4A 4JB9H 4JG1H 2ADFH 2DWDB 2FGWL 2D9QB 4PJEE 5ISZB 2OYPA 2NXYB 3TVMD 3UPAA 4QOKA 5J6HA 4XPFL 1UJ3A 3QWQB 4PLNC 4Q9QL 3V4PL 1W72H 3AY4C 2HRLA 4RMUA 3HNTL 4XAKE 4PJ8A 5CEZE 4OZIB 1HILB 4RNRA 3PWVA 3UTTD 4PRPE 2VL5B 3ETBF 4PJFB 1LP9A 2NY1B 4PRDA 1JIBA 1K8DB 4OZHA 3OPZL 4NQSB 2FEEI 3P4NB 3CSPA 4YFDB 1T2QL 2IGFH 3PWPD 5CEZD 2RCSH 1RIVH 2W0KA 4HIIA 1OSPL 2VDRH 5CP7A 2PO6C 4Z7VF 4PRPD 3CC5B 3EYSH 1D5MB 4LAJH 3TPUB 4LQ1A 4YZFF 4IMKA 2EDDA 1DQQA 1K6QL 4WHTB 2OS7A 3ARPA 3LEXA 4WHYG 4N8PA 5DJXA 3BVNB 1Q1JL 1H8SA 5F9OH 1XGPA 4WU5A 2VAAA 1MFBL 5C09E 4NSKB 4NO2B 4Y4KA 1ZGLP 2NQCA 4MCYA 3UEZA 1GOGA 1QSVA 1MRCL 1G7HB 4KJWD 3QULA 4A6YA 1KJ2L 1S7UA 1ADQL 1A1NA 1J05A 5GS1B 4M43H 3G9VA 4IRSC 2P8PA 4X5LA 1NGYB 3HE7A 2VH5L 5DD5H 4PP2B 3LKQA 3DX8A 1OW0C 1BPVA 3LN4B 3SDXA 2H9GB 5GS2D 3GMPA 1HSBB 4MNQA 4P2RA 3C60D 4H0HB 1BOGA 3WCYA 3OX8B 4KHTL 3EYVB 1HYRC 2G60H 5ADPH 3KYMA 3OHXB 2CGRH 4P5TA 4XVUD 3PHQA 4YZFE 4CNIB 1UWGL 1JPGB 4FQCL 3RVVC 3MTRA 4ERSL 1I8IA 3O6MH 1QLEL 3EW3B 5EC2B 1FFNA 1JPFB 3HC0B 4UIKL 3VFPB 3NA9L 4N8VB 4DKEL 3UZQA 2ZCKL 4DUXA 4LPWA 5B38G 1N2RB 3I75A 3MJGX 3AUVA 4WEMB 5IESH 1GC1H 1NDMB 3U1SL 1MCEA 1AD9A 3DBXA 5D1QA 1DFBL 3VXRE 4NCC2 3O3DB 2V7HB 5H2BA 3U6RA 5DJ2A 4HUMB 1DLFH 1IC7L 3P4OA 3T0EE 4EOWH 4JFHE 4P57B 3VD5A 1EMTL 3LZFH 2KDGA 3WV0A 4ETQB 3P30L 4X7TA 2PTTA 4DKDC 1MLCA 1T04A 3GSNL 3QJFA 1ZKAA 2YPVL 4JPIB 3SEPA 2CGRL 1IT9H 5BV7B 5F7MC 5EU3A 4ODTL 3BP7A 3MPCA 3WSQH 4U1SB 5FCUL 5DJDB 1UEYA 1QO3A 5AZEH 4HJ0D 5E95B 4G7VL 5E4EB 3MRIA 4QWWD 1MFEH 3OTTA 4MA3B 5HGDB 4KH2A 2EC8A 2ICEA 1R5IA 3C9NA 2OXGA 3HPLB 4U6YA 5BRZA 4GRMA 5HYIA 1C5BL 4UUJB 2A73A 4IOFD 1DVFA 1NDGA 2HAZA 3V7AG 4HBQA 1RVFL 4PJCF 4LSSL 2A2QT 4E9LA 1AHWB 4U2YA 4AMKL 5ISZE 4PRBA 2NY7H 3RVXC 4RGND 3D1MC 3HZKB 3M1BB 3QEUB 1MJJB 4O58H 5FYKL 5DSCA 2ICWJ 5GGUA 4OQTL 5ID0B 1TZGL 4XPAH 1WCBB 4LPVA 1SEQH 3VGEA 3O9WD 1YYLL 5HHPA 3MFFA 2B0SH 2B4CC 3U9PH 1FRGH 3NABL 2ERJB 2RCSL 1BFOB 4XNXH 5FOBA 1DBKH 1M71B 1ZT4B 3MRMB 5DD1H 4HGKC 2CQVA 3KPPA 1GGBL 4JKPH 3MRRA 1TCMA 3SGEI 4Q0XH 3LEYH 4D8PB 4L8DA 4OF8A 4YNYB 4MJ5A 5FM5M 2IF7A 2PR4L 1FC2D 2DM2A 5B8CB 4HUUA 4NJAL 3FQWB 2H1PL 4N0UB 2BVOA 3FQRB 1A6TB 3NA4A 4OLEA 5CJ8A 4WDIA 3RNKA 2DB8A 4XPHH 2EYSB 4OCYH 1J0KA 1FL3B 1CQKA 1TJGL 4I2XB 3AS1A 1HHKB 4LK4A 3B9KB 4DGIL 1J1OH 1JWSB 1BQHA 4OV5A 5EG6C 4PJHE 1C1EL 2Q20A 4LSQH 4ODWB 5E8PA 5HYFA 1YECL 4XP1L 4X6DB 1E28B 4QHNB 1NAMB 3ULUL 4BFIA 3HI6L 3MO1B 3QJHA 1E4WL 4MNHA 3FONB 4GMSH 1WZMA 4S11A 4TUJB 4DVBB 3G5YA 4QXTB 2A6IB 3EYUL 2M26A 4HWEH 5ESVA 5GZOD 5EZJB 4MQ7A 4XVJH 3D39E 4OCSL 3T4YA 4P59L 5D9SA 5KG9B 1KB9K 3L3KA 3NIDE 5I19H 3B6SA 2CK0L 1JK8A 1DVFD 3BGMB 3IRPX 2A0LD 3ROOA 1SYVB 3AM8A 3TPKA 3EOBB 2AJUL 3UPCA 3MJ9A 1PKQE 3MV8A 5JQ6L 2SEBA 1SJHB 3MLYL 5LGHL 4PJXF 4N90E 3RDTB 3MYJB 1IM9B 3HN3A 3VD7A 1KG0A 1I7RA 2Q8BL 1CXEA 3S34H 2J5LB 3NCYS 43C9A 2I5YL 4Z8FH 3G08B 3QDMD 1IKFH 2G75B 3HB3C 1Y6MR 15C8H 1A3LH 3BKYL 1WWCA 1BVKB 1WWWX 3WEXB 3SCMD 3VWJB 3UAJC 5T3XL 3FT3A 2A6KA 1U8LB 1RFDH 3K0WA 1VGEH 3KJ4B 5TPWL 1S7TA 2FSEA 3LH2H 1NC2D 3TA3D 2F8OA 3PXJA 2WP3T 3FT3B 2ADJA 3L5WA 5FGSA 1BM3L 5SWSB 3QHFH 3VFGL 4WVRA 3TIEB 2VZVA 2V2XB 3ZE0E 5BVJB 5I9QB 4YHNB 3IS1X 2G75A 4FQ1H 5F89A 3DSFL 1MWAA 4P9ML 4YIQB 3OAZK 2EDKA 4WW1B 3MNZA 4NO0A 1KG0B 2EKJA 4QRTA 4PJXA 1XF4A 1JUFA 2GKIA 2AQ2A 3W0WE 1G7JA 4M3KB 3TT3H 2BX5A 3OKLA 1R3JB 1H3PL 2XWBB 3BH9A 1OTTD 3FO0H 1VEMA 2OCFD 3QXTA 4MMXC 1KLGA 4UT7H 1G6RB 1X4YA 2DI8A 3W0WA 1KGCD 1A7RH 4P4RB 3G6JE 3BKCH 4KKAC 3LIZH 1OY3B 2VR5A 3TBYA 3PGCA 4BFEA 1YEFH 1EXUA 2HTKD 4FFWD 4RCAA 3DYOA 5D9SB 5H37H 4GG6A 1FDLL 4BK4A 1XGQA 3HAEA 2MOVA 5T5NG 4H26A 5T1KD 5BS0D 5E9DB 4WFED 4PG9B 2DLTA 3ES6A 5IMKA 5ABDE 1KGCE 1X5KA 4M7LL 3SKUD 3V7AE 1A21A 2IPTL 3MV7B 4D9LL 4MNQD 2O5XL 5EU6E 4JN2B 5I1JH 2VABA 3BPCB 3LEVH 4JANB 1JWSA 5H37G 5IBLC 2AXFB 1MF2L 1OQXA 1U8JB 5BS0E 1DEEB 5HYEA 3NCJH 5GGQH 5HHMD 3W82A 2VLRE 1ZV5A 3KYNB 4MNQE 3BESR 4Z7WB 1EO7A 2EZ0C 5EU5B 2GYSA 5FO9B 2R69L 4Y4KD 4HQQL 1NCBL 5IVZB 2RAMA 3GMMA 4HZAA 5IKCB 1N7MH 4WTXA 1ZLSL 4MGXA 4KRPD 3ILQC 3G6JF 1WBXB 3QPQC 3D5OF 4QTIH 5DQJA 5DI8B 3MV9B 2OR9H 3CH1A 1O0VA 1NAML 3PV7A 3MRRB 3ET9F 3RI5K 1KJMA 3GMMB 3RQ3A 4KRMB 1HHJB 5IVZA 1I1YB 1XH3A 2QQQA 3E3QC 3IFNH 4CN1A 1ED3A 2W9DH 2BVUA 3MRMA 3TBSB 3UZEA 4O4YH 1SBSL 4J3TA 5E03A 3KYNA 5SWZD 4BKLA 3B9KD 4NO3A 4G9FE 2DYPA 4RQQB 1DL7H 1X5GA 4XH2A 3SGJC 4P9HC 2OXHA 4YE4H 2F8XC 4G6FD 3K2UH 3R0NA 2E7MA 5K9JH 1FNGB 2XZAH 3GB7B 4YXHH 4QOKD 4PJCA 2FYYB 4S1QH 5F1SA 3ARDD 3STZB 4H26B 2VDMH 3LIZL 1S7RA 2BSSB 1DVFB 3I6LD 4DW2L 2VSDA 2ZG3A 3ZDZE 3U9UB 1A9EA 1JRHI 3QR2A 4LRIC 3C9NB 2YN3A 4QOKE 4D94A 2FHBA 1ACYL 4JZNA 3GMOA 4CU6A 1FGNL 4P2YA 3MCKA 1V7MH 3I6LE 2GTWA 2D9CA 5FECA 4I3RH 4R96A 1H8NA 2LVCA 4IMLA 4TVPD 4C58B 3ARFC 3IFLL 3BE1H 2MKLC 4K7PL 3W5MA 4NN5C 3C87A 3AY4A 4YIQA 3FFCE 4HD9A 1EV2E 4H25B 3VWJD 5DF0A 5E56A 5ANMA 1S3KH 1UB6B 3RJDA 1P4LA 2XWJB 5F44A 4ZNEA 2DQHH 4H20H 5TPWH 2NY5L 5DRWA 2WBJC 5F96H 4TVPE 5GGRA 2VWEC 3NOIA 2CDGB 4ETQA 3QFJB 3JUZA 2APVA 1HDMB 2XQBH 5C2BH 1OAKH 1A3LL 5F3HB 2FDBP 4PREA 3EFFB 2GUOA 1F6AA 4LF3B 5E2WH 4G6AC 4I3SL 4UI2A 3DX9A 1L7IL 2ZPKH 5E6YA 3VD9A 4OZGA 3OAZH 3IDIB 5AYQA 1FL5B 3X14B 4HIEB 4LPTA 1P7KB 2HT3C 3Q5YA 3ZL4L 1OPGH 3VFRB 4JY4A 5DHYB 3ILQD 5DUML 4KRPC 5C09B 5IHLB 4XMLL 3RZWA 2VIRB 4LRNH 4QRPA 4Y4FB 5DYOB 1LHZA 4Y4KC 5DMKB 5C8JB 5EB9A 3CAFA 1R3LB 3VFPA 1FFNB 3HC0A 2R2EB 4MX7B 5FK9B 4MHHI 1R3IH 1JK8B 2DQDH 2UY6A 3BGMA 3BP4A 4JFQB 4I8DA 5HHOA 25C8L 3NH7L 1ZOXA 5BOZG 5E9DD 1OW0A 3QUKB 3VFNB 2ZUVA 3IFOB 3WFCH 1UM5L 4X8XA 1OF2A 2BVEA 1HSBA 3FCTA 4LHUA 4MNQB 5E6IA 4Z18A 4TUJA 4DVBA 3FONA 2HKFL 1FAIL 2P43B 3PWJB 3QCTL 3SDXB 2ORBL 3RWEA 3VFNA 1S9VB 5C0AB 4WW2F 1RHFA 1UH4A 4FFWC 5HHMB 2BY3A 5HHOB 2HTKC 3BH8A 3GI9H 3NCCB 1CK0L 5I1EL 4LIQH 2VDKL 2FIRT 3PDGA 4F7CB 2VKWA 1VA9A 1OTTC 2NLJA 4F7TB 2CLZA 3U48A 3QDJE 1X5YA 5HXMA 3EYFB 1KTLA 4F7MA 4NQVB 2KUTA 5DFWH 2XOTA 1ZWIB 3PNWB 4HIEA 5CSGA 5DMJB 1RPQA 3VGGA 1NGQH 5JHLL 1U8KB 4GS7C 5DK2B 3B3IB 3S37L 3TBWA 2IFFH 3H9HA 3M45A 3ARDA 3OXRB 3Q3GA 4WW2B 1KPRB 3CXDH 1A7QH 4I3SH 5FGCE 1BFOA 4UT9H 5LJYH 1JPST 3BO8B 4Q2ZA 1D5BB 2VLRB 3EO9L 3PWPB 2HFGH 1TENA 5FYJH 5IJVB 3MFFB 3UAJD 4DZBA 4PRPB 3SCMC 1QRNE 3HB3D 4NN5B 1JZ5A 5ECJE 1I85A 3BAEH 3GI8H 4WCYH 4ZUTA 3KS0J 4L4VD 1QFWL 2AK1L 2E9BA 5EZLA 5D7JD 5T1LB 2YK1L 3KR3L 4HUWB 4J6RL 1K4DA 4KTDH 3WHXA 1NDGB 1QQDB 2AJZA 1PZ5B 4L8SB 3GMOB 1BQHG 1MCDA 4I3RL 2DKSA 2R4SL 4E42A 2A0LC 5GGTH 2ICEB 3UMTA 4UV4H 3U4BH 1DVFC 3CXHJ 3FOLA 3CFBB 2VXTH 2AW2A 1QEWA 4QXGL 1RUPL 1RHHB 3HNSH 1M6OB 4OM0L 5BJTA 5GZOC 5DD0L 1N3NB 4IM8A 4HUXA 3ZO0A 1NAKL 1T83C 4G3YL 1RAMA 3AS3A 3GSRA 5FXCH 3R8BB 3QHTC 3V0WL 3STLA 1Z3GL 1KC5H 4EOWL 1RZKH 3G6DL 3B83A 4S1RL 3RIAK 1GL4B 3DROB 1T7WA 1W0YT 5D96B 1BJ1H 5AZ2H 5C0GB 1IAOB 4PJGE 4PJ9A 4JRXE 1XH3B 4O4YL 3X12A 5H2BB 3LV3A 2GK0B 2ATPA 3DI3B 3HC4L 3ILPB 5DK3A 2NXZB 1HXMA 5TE7H 1RZIB 2UZIH 2PW2A 4BA8A 5C07B 1MAML 2J3SA 5F1IA 1MVUB 2GJ6E 4MJIB 2W38A 3NA9H 1EEQA 3OMZA 4OQ1A 4OLYH 4LOUD 4LGPB 4Z7WA 2XPGB 2FJFB 4P99A 3T1WA 4JKKA 3QFDB 3CVHH 4LSVH 3DUUA 4J3WA 3T3PF 3WXVL 5ADPL 4U0QB 4OKVB 3K1KC 3BW9B 3C5ZC 3VGHA 4QEGA 4CKVX 4DFIA 3QDAA 2AS5M 3NACH 4YXKL 2L0DA 2VR9A 2Y5TA 3CUPA 3WFZA 3L1OH 3BT2L 2VDNH 3GUTB 2X4PA 1KB5B 3D25A 2EDNA 2R2BB 1BAFL 1KCVL 3A6CH 5EO1B 2ZSWB 3CX2A 4JJ5A 4S1DC 4D9QD 4PBVC 3O9WA 3AREA 4O02L 1GGIL 5D1ZA 2I9TA 1T1ZB 4FQLH 4IOFC 3HG1B 1QR4A 4K94C 4YC2C 1IGCH 5EA0H 1TJHH 1B0WA 4NQEB 1TETH 4XCFH 4NKMB 3MRDA 4R0LB 3MLVL 5IB2B 3MODL 1AC0A 5ESQB 3U46B 2BSTA 2JJSA 1NFDF 2Z35A 3BH9B 1RY7B 4QWWC 1CD8A 3U83A 2O5YL 3ARGA 5CD5C 3OKEB 5GGSB 3IF1A 4NKMA 4R0LA 4XP5H 3MNZB 2EDFA 5D7LB 1XGYH 3DX6A 5CJOL 1T1ZA 1YUHB 4A2MA 3VA6A 3HNVL 3CK0L 2GY7B 4RFNC 1DQJA 5DEFA 4KKNA 3TIEA 4I18A 5SV4A 2YPKA 2LAGB 4X83A 5IFHH 4I9WD 4NO5B 1OL0A 3F7YB 2XI9A 2YA2A 2Y5TB 1WIPA 2FD6H 4RZCA 3JV6B 1EO5A 1XCTB 3OXSB 3VWJA 1U8NA 4HS6A 4KPHL 3T1FA 1RFDL 5D71H 1CDGA 2YZ8A 5INDB 2DQGH 2HG5B 3VI3F 3ZKXC 2L4OA 3QA3A 2BSED 3P0YH 4K3DL 1S7SA 4L9DA 5DUPL 4ZNEE 2B1HL 1X6LA 4PJGB 1G7PB 1KCSL 2Q8BH 4F3FA 1RJLA 5C0AE 4AEHH 1C08B 1CFTA 1JP5A 4NQDB 4GQ9L 2UVFA 1S7SB 4YHIB 1CL7I 1NMAL 5F21B 3ILPA 5IM7B 1W8OA 4J23A 3PGDA 3SDCA 3KHOA 3RVVD 3WUZA 3Q1SL 4HS6B 1U8NB 3T1FB 4MD5B 1AFVH 1OAUH 3RX5A 1FVEB 3UBXB 3FO1B 3MA7A 4HKJB 2ZKHH 2I9LB 1J5OL 5JNYB 2B8OT 2Q3ZA 4BELD 3WJLA 5IR1B 4S2SB 3G5YB 1OLLA 1B4JL 1FYTA 1NQBA 2VZUA 5F3BB 4JPVL 3OR7B 5I6XC 1N26A 1ZA6B 1U3YA 2P8MB 1UB5A 1AGCB 4IRJA 4L3EB 1OVZA 1S7VA 5IFHL 1U2HA 2A74A 3DX6B 4FABH 5D7LA 4FMFA 1AI1H 3VXNB 5JIPA 1KT2B 2IANB 1MFCH 1EAPA 4U6VL 3T09A 1ONQA 2NTFA 3FRUB 1L6ZA 1QEWB 5EIIA 4G9FA 4G43B 3B9VA 2ZUUA 4HUUB 2IFGA 1O7SA 2NXZD 3ORJA 4QTHA 3W9DA 2D2OA 4J3VA 4NKDA 4P4KC 4PJDA 5LAXA 4NJAH 2X10A 2LAAA 4WJ5A 4KPHH 2PR4H 1PFCA 3ALWA 1U3HB 3GBMH 4ZG1A 4ISVA 2F9BT 2PO6D 2WAHA 1IGCL 4OFYD 2C3VA 2FD6L 1LGVA 5IG7A 4FFYH 3L3IA 1XGRA 3RHWF 1OWRM 5DC0A 5FOBB 2A38A 1ZTXL 2NY0C 4O02H 5FV2A 1J11A 1IEAA 4JFXB 2BNQA 3D85D 4JPWL 4B7LA 1NGZB 1KIQA 1MCBA 1BEYL 1HXYB 5GRUL 3RBGA 3L1OL 1T22A 3HHRB 4PUBH 5D6DC 5HDLA 5FYLL 3FJTA 2B5IC 2XKUA 5LVEA 3C8DA 3JV4A 1ORQA 1JGLL 4XPAL 5DURD 3WLWC 1GHFH 3X3FH 4YO0B 1AXIB 3H3BC 1YJDH 3TBWB 1QRKA 4P2OD 3VGFA 2OI9B 4G6ML 4EI5D 5BW7C 2Q3AA 1SY6L 3VFWA 1BJ1J 3K2MC 4P49A 1DBJH 4H88L 5CUSH 5C07A 4U1JB 2FIKB 4ORGB 2HWZL 4LRIA 4UTAL 6FABH 1RZIA 3OJVC 2CDFA 1W2KT 2DOCA 5HHNB 3WIHA 4M7JL 3X3GL 4JHAL 4L8SC 3MREA 5TE7L 3FQXA 2AI0L 4HGMA 2UWEE 4F7TA 4Y19B 4EXKA 4GFTB 1TVHB 4OFPA 2CH8A 3BT2H 3EUUA 5CP3A 2C4FU 3T8XA 1AP2B 1D5ZA 3FFCB 5I16A 5I18H 4ZAKA 5T5NF 2EXYD 3QUYA 4JFFD 6CGTA 4LU5H 5AYUL 1JHKH 1S9VA 4U05A 5D2NE 1PX4A 2XXMB 4Y2OA 5CJXC 1T0MA 3GSRB 1NLBH 2R1YB 1P1ZA 2B1AH 1VACA 3PWJA 4JRWA 3VDBA 4U6XA 2YD8A 3DIFB 4Q6YA 4WWKC 1JGEB 4GAJH 5F93C 3NFSL 4P57A 5SWSD 1BJ8A 1DJSA 4F9PA 1OAQL 2DBLL 4YR6A 4OZFB 4XRCB 4PRNA 3D0VA 3HE7D 3CFBA 5K33A 4XWGH 2FRGP 3U6RB 3CCHB 3V8OA 1FLRL 3BRGC 1Q9WA 3DRTA 5BQ7B 3QT2A 5TF0A 5C8JA 4O2CB 4KROC 5SWSE 4JFDE 4XCCH 3QUXD 5CLTA 4Y4FA 3ZLQC 2QKIA 3A67L 4YK4C 4ZFZB 4MXVF 5I8CB 3I84A 5I30L 3Q0HA 3VFRA 1LNUB 1CFSB 4UAOB 2HTLC 4N9GA 1KC5L 5DZLA 5T3ZL 2ID5A 4OIBA 1RZJH 5J6GB 1OAYH 4JFDD 4YDJB 4XCEA 5EWIH 5F7FA 1HI6A 4G3YH 4CNIA 1ZSDB 4ZPVB 5E8NB 5J3HD 4YUEL 4FS0A 2MMXA 3OX8A 4IIQA 4I5BA 3PWPA 1RV6X 2WIIA 1MFDH 2PETA 5DC9B 1CXIA 1I7TB 5EBGA 2ATKB 5D72L 4DAGL 3QUMA 5DFTA 3UTTA 5L7XL 4YHYC 4GW4A 2P8LB 3NIGF 4PP2A 5GGTL 12E8L 2EEDA 4HWZB 1J05B 1QFUL 5DD5L 1NCAH 4V2CB 3TVMA 3QULB 2VQ1B 1ZWIA 4OAWA 4D3CL 3KYOA 1HHHA 3I3EA 3DTXA 1CDUA 4KUCD 3F6LA 4J6RH 2Q76A 4LCWD 1VERA 3SDDD 2YK1H 5EO0A 2VAAB 4KRPB 3SDAC 2BNUB 2BVQA 1A9EB 4QY8A 5F9OL 1RQ5A 1X5XA 1XEDA 5HI4C 5KAQG 4EJ1C 3HCVB 3G5ZA 3VRIA 3WXWH 3JTSA 3DV6B 5J11C 2XNAB 2Z91A 1R5WB 4XNUH 1B6DA 5CILH 5I71B 3P4NA 1FNGA 3MXVL 3WN5C 4EBQH 1D6EA 1S9XB 4XPBL 4JG0L 4QRPE 1CR9H 3ULVC 5FUCE 2Z8SA 3RVUC 3BP4B 2DMBA 4U33A 3P73B 4OZIA 5C0BD 4JGUA 2NXYC 5FGBC 2WZPD 2EXWD 1PSKL 2BY0A 5KS9E 1BREA 5J56B 4MDJB 3TN0C 3AAZA 3S36X 4JVWA 4J4PC 3CH1B 4RFOH 4ZFOL 2E7CA 4PJ7B 4XHJD 2E9JA 3MRCB 1DBAH 3IDIA 3DHMA 4P3CL 4U1GC 2H6PB 4GXVH 3DX9B 5FHAL 1H5BC 4Q6IC 2AV1A 3LQAL 2BY1A 4GRLD 3EFFA 3MXVH 5F1NB 4EBQL 1FAIH 4POUB 2D7TL 3O6FC 1AD0B 5EUOB 1MPAH 5FKPA 2G9HB 5E2JA 3DX7B 2E6QA 4WI5A 1ZVHA 5JDSA 1QFPA 2F54E 1I1AA 5ERWB 4OCXH 5LBSL 1EA9C 1R3IL 5ANMB 1MVFA 3RVWC 2PUQT 2NY5H 2QLVB 1XAUA 3VXME 3IXAA 1JNJA 3AB0B 3D2UA 2VXQL 3RAJH 1U6AL 2KQNA 2VQTA 1KPVA 4Z77A 2XKNA 1OARH 2F54D 5E2TH 5HBBA 3TO4C 3MGOB 3RTQB 1QVOA 4GG8A 4L8BB 3W11C 5DUMH 4M93C 5IV2A 1JPTL 4X7FC 1T6WA 4HH9A 4PYGA 1BBJA 4L8CB 3RIFF 3QUXB 4KQ4H 4FQ2H 1G9MC 3UTTE 4OIIH 2WANA 5LGJA 4P46B 1WBYB 4WV1A 1FSKC 4P2QA 1WK0A 3FB6B 4K3DH 3RWHA 5HHQA 1JTPA 2JELH 5IB3B 1NGWA 1M7IA 2M2DA 3RZCD 1N5AA 4PFEA 4HUNB 2DJ4A 4JPKL 4OZIF 3BXNA 4YAQA 4ZTOH 4LCIL 2DAVA 4P48A 2NY5C 1PAMA 5EWIL 3O4LA 1A1MB 1E4JA 2FEDC 5EOCJ 4ZFGH 4JDZB 5F1KC 4I2XE 1Z9SA 3C60A 1HHGB 4OLZL 4Y5VA 3WIFA 3ZE0F 5I75C 5MI0B 4DOHE 3MV01 5E94A 3PWLA 3BN9C 3HR5B 4X6BB 2NR6D 3PABA 3T4AB 1ACYH 3CFJB 4DUWA 2X4UA 1EH9A 2DDQH 1GAFH 1U95A 3H9SA 1T0NA 2W9DL 3ARUA 2V17L 3MV9A 5DQJB 2BNRA 1OCWL 5DHVB 4LSUL 3T0AA 1RI8A 4KTEH 3SKMA 3HZYA 2CDEB 1I3RA 1FG2A 1VFBA 1QR1B 2SEBB 4PGCB 4R4BB 5K9QG 4ZS7H 1EBPA 1KJ2A 5EU5A 5FO9A 3VXMB 4CU7A 5EA0L 3F7RA 3B9DA 1E4XH 3QUML 5IFJA 1MELA 2CO6B 5CJQL 5KZCB 4HQQH 5T5FL 3FQNA 3ROOB 3CX5K 1S9WB 4JZJA 1YY9D 3VXOA 3L3KB 3MLWH 4Y4HC 3U0TA 2XQYG 1EHXA 1LWRA 4H1LH 4OBRA 2HH0L 4AIXA 1KTDA 3HLAB 3KJ4C 4Q9RH 2D7MA 3NCBB 3G5VB 1N59B 2QR0A 2X44D 2R2HB 4FQJL 3H0TA 4WY7L 3MOQA 3CVHL 3W39B 4PJXE 1EXUB 4G9DB 4NKOB 3TBYB 4RGOH 4HX1A 3E2HC 1CG9A 4O5LH 2DIAA 4Y8AA 2BSRB 1BHGA 1LVEA 3FL7A 1T20B 4O5LL 4FTVB 2YUXA 4LAQL 1BZ9A 2ICWB 4HK0A 2Z4QB 1YJDL 1MCHA 5BOPA 3F6IA 5I1HL 2V17H 3GSWA 4I4WA 3VI4F 2IWGA 1UZ8B 3SBWA 4X6EA 4L8DB 1KYOJ 2D7PA 2HH0H 4X7EC 3PP3K 4JRXA 3LQAC 1MF2H 1CICD 3MRBA 4KI1A 5AZ2L 4U3HA 4PRAA 4Y2DC 5FDYA 3SE3A 4YFEA 4OLWL 5BVJA 2H2SD 2AP2A 5C9JA 4WFFD 1RZKC 4QRRB 4RDQF 1CIDA 3QIUD 2PXYA 1KSRA 3VXOB 3EJYC 4M7ZC 5D2LB 4HSQA 4PJAE 1Q8MA 1NAKH 3NFNB 1RZ7L 1A6AA 4R90H 5IFJB 1VGEL 3WEXA 3D18A 1GSMA 1MJJA 1A22B 1MI5D 4TSAL 4UV7L 1OM3H 2VO5A 4NQUA 4M6AA 3HZYB 4YXLL 1IKFL 3MNWA 4BQ8A 3V52H 5ALBL 3RDTA 3D39A 4K8RD 3VI4E 4HLJA 2B2XL 2J8UB 3D87B 5E70A 4W6WB 4DK3A 2EH8H 4FABL 3T4AA 2JK5B 3HPLA 1RSFA 2VJXA 3HI5H 1ETZA 2VITB 3NFNA 3IXTA 4L3CB 3QHFL 4Y5VB 2FECL 4ZFFA 3WS6A 3EOAB 1AGFA 4Z5RB 4MD4A 1I4FB 2DKUA 3DV4B 2YPLE 3ECBA 5IJKA 4ODHH 3O2DA 3UJIH 3O4LB 3HTLX 3LKSA 5GJTH 4YGVB 1H3VA 2ERJC 4MNHB 5C0RL 3MUGB 2J6EA 1QLRA 4QHNA 4UNUA 1E4WH 3L5HA 3SKOB 3OKMA 4X6EB 1A6WL 1UZ8A 2YPLD 1UWXK 4FQ2L 3RNQA 5B38B 2RGSA 4I2XA 5JW3H 3T0DA 4OCWH 5HVHC 2Z4QA 5D6CB 1Z0MA 4R8WL 3D3VB 5FF6A 3ZKMD 3VXSE 1XIWC 5MEND 4XAWL 4U1LB 5BW7A 4IOIA 2DWEB 1DBAL 2ENYA 3HG1D 5B8CA 3MRFA 4G80B 1F4HA 2W60B 1FZMA 4XZUA 2CD0A 1FE8H 4OCRL 4LLYA 4GO6B 5I75B 3PJSA 3HS0B 4LQFH 4U0RC 1WF5A 5E4EC 3PP4H 5JUEL 4X98B 5D4QA 1MRDH 5D7IF 5JORA 4GBXC 4AM0B 3VXUD 4AEIL 4MJ4A 1JGUH 4U7KA 4U1IA 2J7LA 1DLHB 4IJ3B 5F7EH 5D7IA 3WNKA 2V6HA 3GJFK 4XNXL 4BQBA 3ESUF 4YPGA 3MRGB 4P5TB 3T2OA 3KYMB 3GHBL 1TZIB 5FHAH 4QF1A 2YEZA 1GZPA 3BIBX 2JCCA 1SHMA 4XNMA 1FRGL 4FOMA 1YYLH 2JIXD 3QXAA 5T33H 4Y7MA 1YPZB 1UH3A 2D7QA 2BY2A 2ESVD 5IVXF 2IAND 1CZ8L 4X7DC 2OL3A 5T1MB 5HGAB 2E6PA 1MQKH 1KN4H 1MLBB 2P8PB 2BJML 1T0NB 4LLMB 2AK4B 2DN7A 4WHYH 4OTXH 4JFYA 4LSSH 3AAZB 2XA8H 3LEYL 3QDME 2AAVA 1JRHH 1G7HA 2YXMA 4X6BA 4KKCC 4JY5H 2ESVE 5CJ5A 4HKXA 3O8XD 4JO1L 3CVHB 3V4VH 2OP4H 1YN6B 5HGDA 4NSKA 5D7IE 1WEJH 3UYOD 2RFXA 1JNNL 1UJTA 4P2CG 4RMRA 3AB0C 4QYOA 4OLXH 4WU5B 4XNZC 1JWMA 1KCVH 2WINA 3MJ9H 2ZOKB 2WQRA 5E1AB 5L8JB 4JDZA 1PGRB 1OGAD 4GAGH 5C71A 1CICB 4WHCA 5JXAL 3T0XA 2GJJA 5EU3B 1S9XA 2UWEF 3T0BA 2A77L 2DQTL 4ODTH 4YAQB 2E3VA 1DQLL 4F80A 3IDJA 1SM3H 2XNAA 3WXVH 4XPTH 1MFDL 3KWWA 3O6FB 1U8PA 2HT2D 3HCVA 1A2YB 1K8DA 4OZHB 4U1GB 1RURH 3DUSA 5E99H 5KSUA 2C9AA 5JOEA 1P7QA 5GIRA 1SEBA 3NPSB 2UZIL 1KIPA 1AIFB 1UJ3B 5I1DB 2HFEA 5JA9A 3IFPB 1KIRB 4JFOA 2AERT 4OZFG 4YEEA 4NFCA 1ODAA 1W72B 1TTFA 4R4FL 1C16A 4S1SL 2NNAB 3HMWH 4XWOC 4XCCL 1WQVT 3KS0H 3OKDB 1OGTB 3RUGF 1FAKT 3V79C 4R97B 3QNYB 4XWGL 4Z7UE 5DGRA 5EU6D 2MSPA 4MNGB 1HEZB 2X4TB 3SJVB 4XXDA 2VDML 3GBNH 4NNPL 1XF2B 3IDXL 3WN5B 5J1AB 3E6HB 1YQVH 4YXHL 3H9YA 1TTGA 2FL5B 3MRLB 1HKLH 4V1DB 1HI6B 2YBRB 4FG6D 2MFNA 4AY0A 1T66C 1KEGH 3REWB 3H42L 3VG0L 5KSBF 2DLEA 1EDQA 5E1HB 5D8JH 5I18L 3LN9A 4UV4L 3U4BL 1HN1A 3HE7B 3JXAA 4JRYB 3EJZD 4R97C 3CFDB 4S1SH 5TDPB 1WZLA 5DFVD 5ACZB 5DRZA 2R9HD 5JPNA 1N6QL 4MDJA 3LN5A 4M6NH 3SDYL 1A64A 1C16B 3BJLA 4M43L 5BQ7A 5F7HA 2C7UB 3LRSB 5C08E 4ELKB 1LMKA 1F4WH 3IFPA 3BP5B 2IAMD 4P2OB 4EN3A 2Z9TA 3KPSB 1RZ8B 3KR3H 5I8OL 4RRPG 2QQLH 3NN8B 1P7QB 3QG7H 4PRID 2ED7A 3LEXB 3Q6FA 2O5ZH 5IQ7L 4PJ5E 4C55A 1Q1JH 2B1AL 3IU3A 3G04B 3NZ8B 2AEQH 4YQXL 4OFVA 3X3FL 3CC5A 3WHE0 1SM3L 1PG7L 1WGOA 5JTWA 1UA6L 3EO9H 5DEGB 5GSVB 2DLIA 4NRXB 1T0MB 3TLRA 1NCDL 1RJZB 3W81A 3MR9A 5JXAH 4POZC 1EX0A 1AXSB 3BFOA 1PVHA 4KK8D 4HBCL 1KUMA 1JGDA 3VXPA 5A2LH 3PWVB 4JPWH 4M1CD 2I26N 2O5XH 4QY8B 3LS5H 5EU6A 1AQDA 2IQAA 3CDCA 4PJ8B 4OSUH 3X3GH 1WBZA 2A6JA 3OQ3B 4QYOB 1JRHL 4LP4A 3B9AA 4P2QD 5EU4B 6FABL 3CVHA 4ONGH 4WI2A 3V4PH 2EKSA 4LLUA 4F7PB 4UIMA 3PV6B 4L29B 4KDVA 4P3DA 3TVMB 3VFVA 1MIML 4E0RA 2FIKA 4ZYKA 1CXHA 4PRHB 4QCIA 2R0LL 4NGHH 1ADQA 3EGSA 5C0CD 5FDWB 4JB9L 2XY2A 5CIPA 3MRPA 3FO0L 1S7XA 3DXAA 3ROLA 3UTTB 5FYLD 3BZEB 3CMGA 2VDRL 4M6OL 5EBLA 4WWKB 5GS0D 3UJTL 2DTSA 1AI1L 4POYA 1BEYH 4RX4D 3TJHC 4Z7NE 4NKIL 1OGAB 1GZPB 3CPLB 4NZUL 1HQ4B 4YPGB 2F53A 5DVKA 4KK8C 5D7IB 3PIQB 5FYLE 2VC2H 4C56A 1G6RH 4G8FA 5EC1A 4ZTPL 1TNMA 4IJ3C 8CGTA 3PP4L 3GBML 2I07A 4ZSOA 4GRWH 3O3BA 5EUKB 3LH2L 1FNAA 3HC3L 5C0BB 2JB6A 5SWQA 1Z2KA 3D0LB 1FE8L 3LMJH 1IC4H 3BKYH 4B0MM 5M95B 1U8QA 3BZFA 4OLVH 3WFHB 5ICXA 5DD3H 4FQHA 4LCCC 1U0QA 5H94A 2UVEA 2W9LA 3I02B 4GQ9H 1IAIM 4HMDA 1TITA 5EU7C 3GJFB 2C3GA 4J3UA 3D0VB 3RWDA 1WZ1H 1YEHH 3FT4A 1WSST 2LVEA 4OCWL 5E8EA 3BZFB 4ZOCA 2F15A 4Z78A 1XIWB 1YN7B 2B1HH 1JGEA 2AJUH 1OTUD 5ESAA 2JB6B 4RIRA 2XQBL 5DWUH 1BZ7B 4TN9A 1YEDA 3T77B 1IM3A 3CSGA 3ZDYF 4JZJC 4F37F 5JHDB 4RWHA 4C56B 2VLKE 4N0RA 4OJFH 4YGVA 1QYGH 1T66D 2V5SA 4K7FB 4JZOA 3EYUH 1L7TL 3CPLA 2HRPH 3FO9A 3U36B 4XPGL 1JHTA 3BKML 4Y19A 4MAYC 3MBEC 4QHMA 4JEGB 2W0PA 3BZEA 3OAUH 2H26A 1GGCL 1QHOA 5HHNA 3ARTA 4OCLC 5CIPB 1XGYL 3K4AA 5CJOH 2X9XA 3EDDA 5E24E 3UTPE 5ALBH 4U1JA 4F57H 4F7EA 5BV7L 2GJZA 1J7VR 4RAVA 2V5RA 4E0RB 1F8TH 4PJGA 5SX4I 3VFUB 4NWTH 3VGBA 3O6KH 4PG2A 4DEPC 3RU8H 2F54A 1UT9A 5D71L 5K93A 1MIMH 4UQ2A 4HAGA 1K4CA 5A2IH 3JV4B 1EJOL 4Y5YA 3VXTB 5AUMA 2YPLA 3CLEH 4ZPTB 3K3QA 4U1MA 1GGYA 2Z93A 3RFZC 4K3EL 4CVXA 2WW8A 3ARWA 2WUBL 5ALCH 4Y16C 3K2UL 1FV1B 1GGIH 1GGBH 3KXFE 4RZCB 4Y2DA 3SE3C 2CIIB 4HHAA 5ACLA 4LSPH 5CSBA 2Y07H 5DJZB 2XY1A 3WUWB 3MR9B 1TZHA 5HHVL 1G9MH 2HT2C 3MNVA 4L4VE 2P5ED 3NACL 1DQJB 4YXKH 3RGVD 2EO1A 2C3VB 2X1PA 1NCDH 5IG7B 4D0CB 1FFRA 4GW5B 4WIQA 4WTZG 3V5KA 1Q9OA 5FO8A 1F3RB 4OQTH 3R8QA 4QXWA 3VCLA 4ODSH 4Z0XA 3V6FB 1V3MA 3OKEA 3KPQB 3C6SB 4I4WB 1X4ZA 3TYGL 2P5EE 4NQXA 4QTIL 2VDOH 3MLVH 2R1WA 3QG7L 3FRPA 4EN3B 1B6UA 4QHUB 1KB5L 3BP5A 3C6LD 4RGOL 3FN0H 3O8XC 4ZUSB 2C7UA 4KKCD 5IWLA 5KAQF 5T3XD 1CFBA 4FQJH 5DRZB 1FCCA 3DVNB 3E2HB 4KQ3L 5BRZE 3ABZA 1HH6A 5SX4H 2P42B 4CVZA 1A3RL 1A6ZB 3H0TB 3O9WB 1E4KA 1YDPA 2E27H 2IEPA 2VDNL 5F97E 5I1CH 5T3XE 3EFDH 4NM8L 5ITFB 3OB8A 4K71C 4DVRL 4XX1G 1G9NH 3VG0H 4S1RH 4HUKB 2Y9RT 3REVB 1NFIB 5JNYA 4JCMA 3NGBB 2YPVH 3V6ZB 1UXSB 2C4FT 1CI5A 4C56E 1T7ZA 3QUMH 1CGYA 4JFFA 4Y4HB 3ARVA 1A7PH 2MNUA 1R0AL 4N68A 1KXVC 4IBLT 3V4UH 4GBXD 1OP3H 3C8KB 1ZHBB 4KTEL 4C59B 5E5UB 4JFZL 4NQDA 4R26H 3ESVF 2IG2H 5CEZH 2CR6A 1U8MA 4RIRB 4M1GH 4C83A 2CDEA 3QDJA 1I9RL 2GJ6D 5EFIA 1P2CB 1EHAA 2VXTL 4X4XB 3U30C 1DLFL 4XVSL 4R9HA 5INDA 3LV3B 5HYJE 3SGDH 2GW5A 3UBXI 4EI5A 5HVGB 4YDVA 3ZKMC 1XCTA 3DMMA 2AVGA 3DROA 3KGRA 3DUSB 2IPKA 3QEHA 5K9KA 1ZLWK 1T89C 3HAEG 2YKLH 3O4OB 4KJQC 1JZ4A 4FXLA 4JFPB 4ELMA 5KZCD 4I18B 4L3AA 4XNYH 5E2VL 5A16B 5HYSB 1HYSC 4NFDA 4GOSA 4KVNL 1WUNT 3DVFA 3QEQA 3GMQB 4CDGC 2HFGL 5FYJL 3S97C 2I5YH 3IF1B 3S88L 3UP1A 4OIIL 1RHHA 2G5RA 4XT1C 4W4NA 2WINB 3CXDL 1NJ9A 1WC7A 3QDGB 1HOCA 1QLFA 4LLDB 2Z35B 3RDTD 4RMVA 1GYAA 4AL8H 2X4NA 1JNNH 1LO0H 5DRXA 5IEHB 5IB2A 1D9KC 5FAAA 1GGTA 3OKYA 3JV5A 1HNFA 2VAJA 4U1NA 1MCWM 4PRHA 1MLBA 4K9EH 4K8RC 5C08A 4TNWF 2X2YA 3MCLH 2EKSB 4F7PA 2BJMH 1DQDL 1G1YA 1MQKL 5F7UA 2KH2B 1IQWL 1XGTB 2PXYD 3IB4A 3SE4A 5HDQL 4PLKC 4XNMB 3OZ9L 5BZDA 4GXUN 3OL2A 1MHHB 5CWSB 3QSKB 4R4ND 3L6FB 3EJYD 1YECH 4K9EC 4XP1H 4PJAA 5TE6H 2NCMA 2MQCA 2ORBH 2IFFL 3QIUC 3V5HA 1NUGA 2DJSA 1UEMA 5JIHA 5F1OB 32C2A 4QRRD 3RZCA 3Q3GB 4WW2A 3T2NH 4F33B 1T2JA 3GM0A 1A6UH 3FAXA 2H2SC 4JQVC 4M9OA 3C5JA 4CU8A 4BQCA 4OF0A 3IU3B 5GXBB 3V6OC 3KNBA 4UU9A 5JPMB 2WSKA 2VB5A 4XPFH 1CFNA 1A4JB 5GZND 4CAGA 4W6YB 5IB4A 4RFEB 4EDWH 3C6LB 5I1EH 3EKCA 3GI9L 4P2OA 1DN0A 3LDBB 4JKPL 1VFUA 3FO2B 4HEPG 4LCYA 2X6MA 3T2NL 4HMEA 5B38A 1CR9L 5ACZA 1CFQB 3GO1L 3THMH 1MFAL 4GMTH 3WNNA 5C0AA 3KLAB 1TLKA 2JE8A 1PJ9A 2D31A 2XZQH 3OBAA 3LQZB 2C5DC 5T3ZE 4EIZC 4P5MA 2CRZA 1U8HA 4HS8L 1IBGL 4V2BA 3DOSA 3FAWA 2Z91B 3LPWA 2YBRA 2R4RL 3U2SA 3ZTJH 4V1DE 1VFAB 5BJTB 3QUKA 5D1XB 1FZJB 1EVTC 3FB5B 3K8MA 5J7CC 4AMKH 4Y4HD 5KS9A 3BSZH 1S3KL 1RVFH 4JFQA 2F19H 2GAZA 1P6AB 2JKXA 2BNRD 4MNGA 2DM3A 4NWUL 1E27B 4RWYL 1RD6A 3BE1L 4H5SB 3HI5L 3W9EB 2AJZB 1KYOK 3UC0L 5B4MC 3UTOA 3D39B 1UWEL 1MFEL 2QSVA 4RSVA 4N1HB 4D2NA 2VQ1A 4X8JA 1HIMH 5T1LA 4EN3C 5D93C 5SWZB 2HFEB 4OZGB 5FB8A 2NR6C 1OM3L 2EYTA 4G42A 5BS0B 5E2VH 1I7TA 4OLUH 4WENB 2Q87A 4DJMA 4R90L 2EO9A 4S1QL 1T7VA 4I5BB 2P47B 3T65A 5IF0A 4H0IA 4CMHB 3O6LL 1S7QA 1RZJL 4W6XB 2X42A 3L3DA 1EMTH 1ZSDA 2FEDD 4Z9KB 5IBUG 3UYRL 4UDUA 4PRAB 1KTKE 1G7IA 1VGKB 1I3GH 3SDCD 4IHOA 2GCYB 4LNRB 4AQOA 2O26U 3S36L 1CFSA 3S6CA 2RHEA 5IMLB 2HJLB 4IMLB 3SKNB 4G8GD 2JF1A 2ZP0T 1JWMB 1GC1L 3U1SH 2LFGA 2NX5A 1INEL 1CD0A 4HDIB 2ESVB 2CLZB 4O2CA 1ND0B 3OJDB 3O2DL 4M62L 2IG2L 5CEZL 4IS6B 3E6FA 4Y89A 2X9YA 1T2XA 1TFHA 1JJUA 2AK4A 3MLZH 4JFFE 3W11D 1QLEH 3TO4D 3GIZH 3JUYA 3BIKA 4ZUUB 3HZMB 3ARBA 4ERSH 4AENA 4X4ME 5A43C 4Q97A 1A9BA 4LNVA 5IROA 1ITCA 5K9JL 1YPZA 4WI3A 1S9YB 3DIFA 4XP6L 3VMOA 1TMCB 2HFFB 3FB8A 1FFOB 4GRWE 2ZWLT 4DVRH 5ETUA 1T5WB 2OTUA 4UB0L 3MRGA 4CW1A 5J9PB 1JPSH 1YYML 2YD1A 2VE6B 3V0AC 1I8LA 1DLHA 3VMPA 5FK9A 2R2EA 1U92A 3IFNL 3O6FD 2APWA 4KFZC 4M7LH 1MNUL 4GRLC 4YWGL 3WD5H 1SJEB 3HFMH 1KIUA 3ZT5A 4JM2A 3FHAA 1NAMH 4KRLB 2CSPA 3WBDA 1I3RB 1IRAY 3HUJA 4OZ4A 4ZS7L 4NJ9L 5DHYA 2FJGA 2ILLA 5DI8A 4KAQL 2FWOA 2YRZA 3WLBA 4ORGA 3OKNA 4X6CF 1WBXA 1NC4D 2CKBL 2GFBA 2R69H 3JSSA 4PP1C 4XZUB 3VFMA 2XN9A 3KLHC 3TN0D 5F6HI 2O61B 1I3UA 3KPNB 1ACZA 1H3PH 2OI9C 1BVLA 1GAFL 5D1ZD 4N90D 3TT3L 3IKCB 5F3HA 3WKML 5HI5D 2ICWI 2EXWC 3B5HA 2NXYD 1RIVL 1J0YA 2DQEL 1XZ0A 2AGJL 4E5XA 4F9LC 3VFSB 3RVUD 5GGRB 1NKOA 2Z92B 3H7LA 4GKOA 3TNMB 3UYRH 1G7QA 2GI7A 5ALCL 1NGZA 4GAYB 1NCWH 4PGBB 3VWKD