2XETA

Conserved hydrophobic clusters on the surface of the caf1a usher c-terminal domain are important for f1 antigen assembly
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
89
structure length
89
Chain Sequence
b'GGRLFLHLKRSDNKPVPFGSIVTIEGQSSSSGIVGDNSGVYLTGLPKKSKILVKWGRDKNQSCSSNVVLPEKTDISGAYRLSTTCILNN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords F1 CAPSULE-ANCHORING PROTEIN
molecule tags Transport protein
source organism Yersinia pestis
publication title Conserved Hydrophobic Clusters on the Surface of the Caf1A Usher C-Terminal Domain are Important for F1 Antigen Assembly.
pubmed doi rcsb
total genus 20
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13953 PapC_C PapC C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2070 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2xetA00
4J3OD 3L48A 2XETA 3RFZB 2KT6A
chains in the Genus database with same CATH superfamily
1AZCA 1NGXB 1RJLB 4EI5A 3O11A 4LCCA 2X09A 1ILUA 2BJMH 1AS6A 5FYKL 1FYTA 3KXFA 2GB2A 2VDLB 4FFZH 4ODTH 5LVEA 5HYQB 2BDNH 2VXTH 3HMWH 4FKKA 4X83A 5K9JL 2ZUQB 3IXTB 1PZDA 5DK0A 3VG9B 3T3MB 1YEFL 4Q6KA 3DSFL 3POHA 3PV6A 4MRBA 1N59A 4YIQA 2NLJB 3DUHA 5BZWA 2Z65C 3OX8B 2J5WA 4JFUA 4ANXA 2ITCA 1GGCH 2ZF8A 4FTVA 1YMHB 4M7JH 4NP9A 3KL3A 4WK0B 3UJJH 3H1ZA 1T04A 4ATWA 1WBZA 4UCFA 5L4FA 4O00A 1JTOA 5IJVA 4B9IA 1JWUA 4FLQA 1Y07A 2P46B 1DEDA 2KKQA 3IGLA 1IL1B 3J07A 3BSZL 3PXLA 3V8CA 4Z8FL 3ZLQC 2G0KA 1EEZA 3BJ91 5ESQB 1MRFH 5IM7B 4Z7NE 3PGFH 3H9HB 4NNPL 3T2NH 3HPLA 4GSDL 2G75A 2JB6A 3BRDA 5FKPB 4GRWB 4YDKL 1EFXD 1VA9A 3QFDA 5HDWA 4E5XA 3GHEH 4O02A 3NSDA 4M5ZH 5J1SC 4PS4H 1NPNA 3VVVA 1MCKA 4MMZA 4NUMA 3CVHA 3MYZA 3HI1B 1GAFL 1W8EA 3GLAA 3QEGL 1OV8A 4J2XA 5AKRA 5IB3B 3DA0A 3SQOH 2AXFA 4OGXL 3QUXC 3T8XB 4M7ZC 3I6LD 2PABA 3BGMB 3O6FD 4DW2L 4JFDA 1OLLA 1MG3C 1VFAB 5DRWA 3TF7C 3QZPA 1FIGL 2FJUB 4XMLH 4U1SA 4XMZA 2ADYA 5KANI 2EEFA 4JR9H 5I1HH 3QJUB 1R47A 4CMMB 2H0EA 1T21A 3VFUB 2CCVA 1OAQL 1YMHA 2DYPD 3NTCH 3P4OB 2ITCB 4OU3A 1A6TB 1JGVH 3I9GL 4FI7A 4PJ6A 2CO7B 4IOFD 1KWGA 3NRFA 2ADIB 1I9RL 4OD2A 5E4AA 4Z7OE 4M43L 2NX5E 1R24A 4GAYB 4YGAB 1O7DC 5K9QI 4G3YH 2DQJH 3P0YL 3EF7A 5FOBA 4D8PA 3MR9A 3LRSA 3QNYA 3M6DA 3GSQB 2EYRB 1JXFA 1AQMA 3P11H 1UT2A 1BBDL 5TD4A 5HGGS 4PVLA 4P2CG 2OZ4L 2K7QA 2NNAA 1WZ1H 3ZO9A 5AVXB 4RMVA 3AU1A 3KH3A 1GW0A 1C5CH 3HBGA 2FX7H 4QRUB 4Y2OB 2AZUA 2EILB 2FWOB 5D7EA 3ULVH 2LE9A 2OCCB 4A6YH 5GS0L 2UX7A 3QNFA 5F3BB 2HT2D 4TF4A 3QIUB 1JNJA 3QIWA 1E4JA 2DPKA 1BZ8A 4NQVA 1MFCH 1FGVL 4TSCL 4D0BB 4F57H 2NNCA 4CW1B 1D5BA 5HDQH 4WF7A 3QUYD 1CGXA 3CLWA 1JGUH 2B15A 4NO0B 3JTSA 2DW5A 4A2EA 3V5KB 3GLEA 3JWDL 5H37A 3WHE0 3LKPB 4X5XA 1FJ1A 4A67A 3NH7L 5EU6B 4ENED 5FPIA 1U8QB 4C4UA 5KANG 2VB5A 1FE8H 4MFHA 4OCSL 2BS71 3MJ9L 2AC0A 3RYMA 1ORQB 2KZ1B 3BVUA 4F33A 1MJ7L 3VFGH 1OCCB 2WZPA 3L9RB 4XPFL 3MHZA 2XVBA 5JPMA 2VR3A 2BZDA 4MXWH 4JFOA 5E2TL 2QVFB 2MHAB 2MNWA 3GSOA 2APTA 3MJ7B 3RTLA 4AXWA 4OI7A 1J1OH 1Y6MR 3QK0A 4FQIH 1S9YA 5KOVC 3S3DB 1R3IL 4WUUB 3T04D 4A7TA 1W72L 3LZRA 5CLYA 3TCLA 2ZWNA 4GXUM 3KJ6H 4MCZA 4WV1B 4HUUA 4AZ8B 3FB5A 1BX2A 5I6LA 2A3TA 1MI5D 1ZVSA 2XVKA 4W68A 5FHBH 3NEXA 2VMDA 2GUYA 3HS0C 3TO2A 4K3EL 2HUHA 2XBDA 4F15C 5SX5K 1YEKL 4HJJH 4E41E 1OPGL 3IPBA 4HBCH 1A3ZA 1XGPB 4RA3A 3UAAA 3CHOA 5L88H 2OZ4H 2FATL 1SMAA 2PP7A 2X5PA 4Y5YC 5C0IA 3TZVD 1YPZB 2XPZA 2ZWLT 1D5ZB 2XPYA 1G9NC 4QTIL 4B3EA 4LSRH 1K5NB 1F3JA 3DTUB 3OXSB 4M8VA 2XA3A 4R0LC 3S5ZA 3Q2WA 1MCWW 4M48H 9CGTA 1X9UA 5KVFE 4LCIL 1DVUA 4UTBH 4RGNE 3E6FB 3ENEA 2X4SA 3WFHB 1P4LB 1EMTH 2HVKB 1MPAL 3GI9H 1PFOA 4UM9A 2VZ1A 3O6FC 2GJZB 4S0HA 4NZTH 5LB1A 1GA2A 5E8NB 5GSRA 1F4XL 1HT6A 2BSBA 2EDBA 2KH2B 4FNSA 3NZUA 2K4WA 2VLJB 1OE3A 4U6HA 4YBLB 3OLIA 4MS8C 3KCWA 3CQQA 4W9ZA 3N6YA 3IMBA 2JKRM 1UYWL 1WUNT 1JTPA 3ULUF 2I26N 5B4MC 1A6AB 2ICEC 5I30L 1WS8A 2H2SC 1DVSA 4XAWL 4XMPH 4XPHL 1V3KA 3F5WA 5JPNC 4L4TE 4R7DA 4YR6B 1XGUB 1AS7A 2WTPA 1NH6A 4N0FB 4APQC 3FSVA 2CNYA 2VC2L 3W82A 2HJKB 3WMSA 1YEHL 3BMWA 4X50A 3OZKA 3VO0A 1ZS8A 2BVQA 2XXGA 4R97B 2BH0A 1IZKA 5IWLC 5EIIA 2QLYA 2I25N 3IT8D 4PJHB 1E9PA 4RQQB 3APFA 4PS4L 1IARB 4ONGH 3D33A 2E9WA 1ZDQA 3PP4H 4FERA 2QV2A 4G6FB 4NB7A 5FAAA 4JZJA 4BQ9A 3TPUB 1E8YA 5I1LB 3MU3A 4N90E 1BQHA 1FH5H 4QO1B 4ZUSB 1O6SB 1T4WA 5KJ4A 4DQAA 1C8PA 4AM0B 2VITB 4QXTA 4NZDA 3EH5B 1AGBA 2X4UB 4WY7H 4F7PB 4TQEH 2Z31B 1F1DA 3MV01 5IQOA 25C8L 2XV6B 1TZHA 4BFFA 1QBML 1P2CB 5K93A 5E5MA 3P3UA 4I4WB 5E08H 4ISVB 2WIIB 1MCWM 1OD9A 3G5XB 5DUBB 1JOIA 4IBSA 3LDBC 1J05A 5ICXA 1FZOA 4HPOL 4M1CC 4I2XE 2X6BA 3MBEB 1T03H 1B3IA 3QULA 4P2RA 1AZUA 1AZZC 2N7BA 4W9DC 5KSBF 4JFSA 5F7EL 4J8QA 1K4CA 3RQ3A 2ZWZA 4V11A 4NRXB 4HKBB 4QT5B 2EVHA 4HLZH 2JJSC 4KO9A 1D2OA 2NY4D 2EDFA 2V33A 1XH2A 2GJ6B 2XBTA 3IDIB 3KPRE 1KCSL 3P0VL 4DKDC 5C0AE 5LGJA 1TNMA 3ZHNA 4PR5A 4N28A 5E1AA 3IJYA 4WHTA 5I0VA 3QQ3A 1FNEB 3DXAB 2CXKA 4FLRA 3A6BL 2BP8A 3QORD 2ZNXA 4N0UB 2E9JA 2KQMA 3L3GA 1NDTA 5DS8B 1P7QD 4WNQA 2R1WB 1U3JA 4AENB 3PWUA 3RJDA 4L29B 3T71A 1SF3A 2HP4A 2W60A 3N0AA 2NDGA 1UD6A 5CEXA 3LKSA 1XH3A 3GXIA 1P9MA 3HZYB 3KPRA 2WUBH 3T77B 2VDKL 4GIOA 4NPKA 5AKSA 4GFTB 4DVRL 4IMKC 3FQ4A 2A9BA 4JZJB 1QBBA 5I1LA 1F4HA 4Z5RA 5JQIB 1MWAL 3HR5A 3VFMB 3LHPH 5DWUL 3DRTA 3VFPA 1OGTB 2VLLA 1WP6A 1NM4A 2XWTA 5EU6D 4B9YA 3SYAA 2BVQB 4I2XA 4JM2C 3V52H 3L54A 2JELH 5C0GB 1MOEA 4CJ1A 2JJTA 2NQDA 1JPGA 4ZUUA 1KG0B 2VISB 3FTZA 3OKNA 4HUXB 3SDDD 3UFIA 3J8F7 3MUGB 4HT1L 4G6FD 4Q9CA 3NCEB 3NZHH 3W39B 5MP6L 1RZ8A 4ZX5A 5EBGA 1MWAB 2H2SD 4JPIB 1NMBL 4CAGA 1U93B 1A7PL 3H55A 4KPHH 4K8RL 2X40A 2D7QA 3DURB 2G60L 4ETQB 3OMAB 3PWNB 1YPZF 3RY6C 5B3JE 4OJCA 3BUYA 4EI0A 2XWXA 2EH8L 1FVEA 3MREB 4AK1A 1ZEAL 4RMTA 2ATPA 5KSUB 1LHZA 2ZJSH 4I1PA 1GW6A 3O81A 4AYEC 4E9VA 4B97A 3MNDA 4NZRH 5DZPA 1CBVL 3SO3B 3B3IB 3UYPB 4OIIH 5BPPA 5GGRA 1RZKC 4XNBA 1T22B 3VGHA 2X9YA 1YO4A 2QSCH 4YNYA 5DO8A 4MB5A 3THML 3DLQR 3CU7A 2EE3A 1M2VA 4NQQA 2A6DB 4X98B 4YHZH 3IJSA 3OMNB 3QR0A 1QFUH 2VL5B 3EHBC 4MHHI 4OF0A 4LDCA 1TLKA 5G4MA 5AAMA 3IGKA 3ILPA 2BMKA 3KLSA 4GAGL 4PWJA 4XOEA 4O51A 3C08L 1ZLSH 5IWLA 3OBAA 4M93B 1UA6H 3PDOB 4ONGL 4XNUH 1MDTA 1MW1A 2MCAA 2KZKA 4E5XG 3RWHB 5DMKB 3BP5B 4KKNA 3BWAA 1DQML 3HS8A 3MRKB 3PS6A 3NJGA 3WD5L 2F74A 3GBMH 4I5BB 2MKLC 1N64H 3TA3D 4JY4B 2Q8BL 3NZSA 4TVPE 3CFMA 1LO3L 4GUOA 1T0MB 7FABL 2XG5A 3G5VB 3BXNB 4P2YA 1KJ2L 1QKZL 4A04A 1UZ6F 1A02N 1T0MA 1NSNH 1CYXA 4JG9A 1HE7A 4GRLD 4Z7VB 5D70H 3RE0A 1WHPA 2AAAA 4U4IA 3UJIL 4I8DA 4KKCD 2A9NH 4FXTA 3OKDB 3HZMA 3VYPA 1K9TA 3RWDB 4XVUD 3T0VA 1R5WA 1AXTH 3DVIA 3HEIB 4KQ4H 1OSYA 5GS0D 3ARXA 1KGUA 1YJDL 2J6EA 1XSJA 4O51B 4KXCA 1WHOA 3BN9C 5DHVH 3TJEL 1ORSB 1J8RA 3CFJA 1BJ1H 2HX7A 2NY2C 3IB4A 1MH5A 5DHYB 5FK9B 5GS2D 2VRKA 3LIZL 5HPMA 4L3EE 3WMPA 5KVFL 3CZNA 3GSXB 3ILQD 3VD4A 1IVTA 1RZ7H 3O41A 3WN5A 1PSKH 5LBSA 2I5YH 5CSGA 4JQXC 5I1KL 1QWHA 4O2CA 3LSOB 1AE6L 3RL1B 1EANA 4QMEA 1SXSA 4RGND 12E8H 4LLQA 5C0CA 3X3GH 1ZANH 2HLFC 4O58H 4PJ8D 3WIFA 1D9KD 4QTIH 3SE8L 2MPVA 1H3PH 1A0QL 4C4KO 2AJZB 2FT7A 3RWGB 3TBTB 1FNGB 5DD3L 1K8DB 1YEKH 4RMSA 1EHAA 1IBYA 1NFDE 5FA4A 1ZLDA 3BKCH 5DD6B 3U0WL 3K72A 1EIBA 3WMQA 3C5JB 4KFZC 1ONQA 4LGPB 4AUJA 5KVDL 3PP3H 3P73A 4G5ZL 4W9CC 2R56L 4ZO7A 3T2QA 3C60D 4W6YB 1S7WB 5KBMA 3UC0H 5D1QA 4JFXB 2RBLA 5F93C 2B4CC 4TLSA 2FYYA 4N9GB 5EWIL 4URKA 4RMRA 2DQIL 1U8NB 4NAMA 3UAJD 4HVBA 5ALBH 4HIJB 4QRQB 4K5MA 1ZD6A 4IJ3C 2DMGA 5C2BH 5C7XH 1QFHA 1HQ4A 4JBSA 5KYXA 3WLBB 3UTZB 1N0LB 2DIAA 3VGAC 3ZK0A 1KZQA 1KTCA 3MLXH 2BXYA 3BGMA 3BP4B 4RH4A 2CQVA 4UNUA 4G7QB 2BMKB 5C6TL 5EU6E 5T5FA 1I1FB 3V4VB 5FYJH 4HKZB 7TAAA 4L4VA 3QJFB 4KK5C 5EA0H 2OSYA 3FO1B 3S9DB 4UANA 1ZWIA 2GBVA 3UL4A 1RFDH 1K5WA 1NCCL 3UIYA 4ADJA 2DH3A 4HUNB 3TV8A 1BQLH 3WUWB 3ARDC 3I02A 4XAKE 4AIEA 2E5EA 3B2VL 3MV8B 3I50L 1T0NB 4C58B 2GJRA 3O0LA 2VUOA 4B0MM 3TEYA 4IQHA 5DJYA 2NYYD 5C8JA 2R1WA 2QLVB 3GKWH 4BFIA 1E90A 3CVDA 3FU7A 3GBNH 2ZSWA 1AY1H 3TNMA 5J6SA 5C0RL 3CSBA 1A1OB 5I0DA 2CDFA 4N0UA 2ZKMX 4XP5L 2UXGA 1YNTF 1Z9LA 1V7NH 5JQHC 4PIBA 2HAZA 1LP9A 5IB2B 4F9PA 4QHKI 5FYLH 4G11A 4JFDE 1IO4C 4ONHB 5AW6B 4ODUA 4X7SH 3AACA 2QADC 3EZJB 3TT3H 2VWEC 3UTSD 3KPSB 2AKRA 2J1WA 4RGMB 3MA7B 1UCBH 4O4YL 2NMSA 4HMEA 1FFNA 4ZI8A 2O72A 4QTHB 5I19H 4HPYL 3CXDL 3P2DA 4HW6A 1Z0MA 4FQ2L 2DWEB 5DCCA 2XX1A 2P44B 1NPJA 2VZOA 4AIXA 2JSFA 4XWGH 4FEMA 1DANT 3C8KA 2JJUA 2VN7A 5L4MA 1CE6A 5FCUH 4M02A 5C0GA 3B9DA 3JUYA 2WN3A 4F2FA 3EOTL 1YEWA 3ZBMA 4YGVB 4JO2H 5K59F 5A2LH 3ECVA 3D4ZA 5AALA 3EGSA 3LVTA 4UTCA 4X6DB 1DVFA 2NUPA 2WWKT 1QTSA 2EDHA 4HWBA 5I2IB 1MJUH 1T2XA 3RLSA 4MZIA 3LQZB 2IIJA 2WSPA 4UOZA 5J12C 3TNMB 1C7TA 4ZW7A 3S36H 4YXHH 4ZYKB 4KRNA 1ET8A 1ZJAA 3EYSL 3UROR 4P57B 4OJFL 3FTGA 5I1AB 5IFAH 5DEGA 5LG6A 2ZYIA 2VLRA 5CEXB 2G3ZA 4Y19E 4X8GA 2D7NA 4PB0H 3OHMB 2XTLA 5ERWB 5F0PB 1ZWIB 1ZE3C 1PCSA 2JH2A 2YFOA 4GYBA 2BCKA 1DBMH 1UOVA 2Y07H 2FEJA 5IEHB 1FNAA 3KLQA 4YSTA 3SN6N 1R5VA 3SYPA 1FNEA 2E86A 4ES8A 4FZEH 1HHJB 5CUSL 2NY7H 3B1TA 3JV5A 4TSAH 1AXSB 4U1MB 4YEEA 5CAYB 3EF4A 4FD0A 5FCSH 3L08A 1F2QA 4Z7NB 4NT6B 5A40E 4P2OA 1UZ8A 3US1A 3T9WA 5TPWH 4YSOA 2ICWI 4MD5B 1L3NA 5DUPH 4MJIB 1G9NH 3ES6B 4ZX3A 2R69L 3B6SA 4E41A 4IBWA 2YD1A 2H32A 1MXDA 4XNQA 2YUXA 1XR8B 3CZSA 1MY7A 4NCC1 5T8IA 4JRLA 4XCYA 5T5FL 3MBEA 1PCXA 4JY5H 1FZOB 5C86A 5CCKH 1I31A 3E2HB 2O6PA 4MA7L 1WSST 2O6FA 2GIXA 2EXTA 5AVSB 4J3OC 3QNZA 3VFWA 1H19A 3PAUA 4FFZA 4DVBB 1I7UA 2OR9H 3IXAA 4KH2A 5LLIC 5B1JA 2H1LM 2B4CL 3WJMB 5I17B 3PRZA 3R1GL 2GUOB 2JF1A 4NNXB 4Y7MA 2VJ8A 3VU1A 5MEOA 3RUGB 2KQNA 3UPCA 3D39A 1KT2B 1BZ7A 2IF7A 3L9YA 1HHKA 1UVQB 2Y1AA 5HYSA 3WDJA 1OT4A 4YHOL 5AVYB 3I6SA 4QXTB 4GRMB 4AUYA 4Y5XA 3O2WH 1PKOA 2Q6WA 5E51A 4EZJA 4LIQE 5D7KD 2UZIH 3E6HB 4JO3L 4FFVD 4CC1A 2R9HC 1AS8A 1GMEA 1ADQL 3EYQC 1KDJA 1U8LB 3GM0A 4ICXA 4R2GC 3INUH 3ESVF 4LHUB 3TO2B 4PAZA 2EVGA 4XWOC 3MBXL 3HNSL 4NN7B 3CFJB 2ZTBA 3ZYIA 3VFTB 2CDEB 1F2XK 1WA2X 4NM4H 2FB4H 2I24N 2JWYA 3KPPA 3TX4A 4RMQA 2VDRB 3HG1E 4P5MA 1FG2B 2RFXA 5ALCH 3ULVD 4IRSC 2XJLA 3ZVVA 4K23L 4U1NA 4WJ5B 2BINA 2WBWB 4GT0A 1N9PA 1IBBA 3C6SB 1F11A 1OWWA 3QPKA 1DLFL 4X6BB 3FSOA 4NN5C 3QQDB 1BAWA 3LMJL 3QDJB 3KNBB 4Q89A 3CFQA 3RBSA 1BM7A 1UQSA 1PW3A 2Z3FA 3GMMB 2FQGA 1JK9A 1OGAE 3D25B 4XPGL 1NCWL 4JL2A 3U9UB 4YSUA 1TQBC 1CLCA 3TVMD 3H3BC 4O9HH 5EZPA 2PWEA 3BAYA 2G5UA 2MQGA 3LN5A 4D0DB 5IQMA 5DHEA 1SDDA 5GRZA 1HI6B 5KWYC 4KK5D 5F70A 4ONFH 5JIKA 3NDYE 3KL0A 3B2MA 3P4NA 2OMXB 1XWVA 1ODAA 3BHBA 4IDJH 4BRJA 3HBQA 1QI5A 3AW5A 3C9NB 1AGCA 1NGZA 4Y1AD 5D1QD 1IC7L 2GITB 6FABH 4JN1L 5HDBB 1YRKA 2AXWA 1IC7H 3ZKMC 5L2KD 1KN4H 2IAMC 4MDRA 1DQMH 1I4FB 3OHXC 1JDCA 3P0GB 1J7VR 3PABB 4ZOAA 3WTXA 3DV4B 4LSPL 2X4RA 3NCXA 2OZNA 1I9JL 2Z8WC 3GXTA 3QIWC 4EUPB 2QZQA 4WUKH 1KGYE 1OGAB 4MJID 3JUZA 2FO8A 5E56A 3N44F 5AVUB 5SV3A 3FRUB 3GMOA 3KR3H 2HB0A 1KBGL 1GZHA 1G9ML 2Z91A 3D48R 3KEDA 4PJEA 1E4HA 5G55A 2ZKWA 1LK2B 1U8OB 2XTJD 4MJHA 2YD8A 2F15A 3BZDA 1T21B 3UCQA 4C56E 2BZ7A 1A1MB 4O5LL 2JV6A 3MUGA 5CGBA 2GSIB 3BPNC 3P4MB 1FAIH 1INEH 4PJ9D 4G1EA 3FQTA 3W2DL 5I73B 4YBHA 5CJ8A 1JF1B 1H8SA 2WTRA 3GIVA 4Z3FA 5CGMA 1NCHA 1C12B 1R4XA 4P9MH 1H6TA 3E8VA 4OLYH 1ZEAH 3QHTC 2AABH 2AXFB 2V7NA 1QTYT 4W81A 1H6FA 5F89B 3MBEC 3L5WB 4KKZA 1UB5B 1KIUB 2FWOA 3H3PL 3HI1A 3EYVB 2OLDA 2Z0UA 4WCYH 2MIZA 4P2AA 3PQYD 1KBPA 2K7PA 1A7PH 4APXA 3IBEA 2ZKHH 3GJEA 3PL6A 3AU1B 3ARTA 4PJFF 2R0KH 3D0VA 5FO7B 1EJFA 2AGJL 3L1EA 4F7TB 1MFBH 4XC1H 1U6AH 2MCPL 4Z78B 1E3ZA 1U92B 2ZUYA 2DM2A 1T7WA 3ATDA 1TR7A 2XI9A 3FO9A 2YO3A 3OJ2C 2YD7A 3ETTA 2QVIA 1EZLA 3RVWD 1BZDA 2BRRH 4GAYA 1DJSA 4AEHH 1H3GA 4PJDB 3IJYB 4OBRA 1JZDC 4C47A 2CGZA 5EU7E 1WITA 1CL7L 1E50A 1L9QA 2CO7A 3NESA 4IRJC 4ZW8A 3FT3A 1WIUA 2CGRH 3KLAB 1NEUA 1UACL 3LEXA 3L7EA 1JPEA 3HN3A 1FBIH 1ZA6A 1RK1B 2NZ9C 4JPSA 1BOGB 4HAGA 4KOCA 5C7ZA 4DP0X 3N41F 2NY4B 4J3OG 1ZSDA 2UXVA 2YD2A 5LGHH 1TZOA 3BPNB 3HVNA 1NC4D 4XX1E 3I3DA 4N2NA 1FCGA 4MWFB 1S6NA 2FX8H 4XHJC 1GPOH 4NGHL 5AKVA 3G5XA 5DUBA 2EO1A 5ITFA 2AP2A 3EJRA 4UDUA 3KWXA 2QHRH 1FYTB 2ZXDA 3A6BH 4H1LH 2EEXA 1EZVX 1QFWH 3MBWA 1G7MB 4UQ3B 4XXDA 1P6FA 1H3UA 5IR1A 5JHLL 2WP3O 4AIOA 2WUCH 5HYJD 1F4YL 2VDNB 3FU9A 1AGBB 3QPXH 1OM3L 2IPTH 2J88L 4NENA 4ZT1A 3M1BB 3LH2H 2Z31D 1GL4B 4QO1A 5L7XL 3IDNB 3QUGA 3MJ6A 3ZKSD 1OEZW 1HEJC 4MAYA 1UB6B 2LGNA 3KDMA 3HA0A 3L7EB 3OAYK 1COBA 1UENA 2VDML 3KLAA 1K3IA 5I71B 1F90L 4N86A 1MW3A 2FK9A 1P4BL 2Z4QA 3T4AA 1FO0A 1Q4NX 5F9AC 5IVXA 4P2QA 5HJ3B 5HGDB 4E68A 3DYPA 3ISYA 4TQHA 2P5WA 1KIRB 4U1GC 2DLFL 3A24A 4PJFE 5IY5B 2MPAL 2P80A 3C8HA 5EFIB 5DRZB 2FLRT 3DX9A 3MFFA 4QXWA 1SHSA 3UZQA 3AWGA 2Z6FA 4X7CC 3V6OE 3ECQA 3GS4A 4LSUH 2CUMA 3U7WL 3D0VB 1UM5L 1EEYB 4PJXF 4UAOC 3V4VH 4A7GF 5D7LD 3PV6B 1UJ3C 5CINH 5JXEA 1SOXA 1ZHLB 4HGWA 3AXLA 2FO4B 4YDLB 1JV5B 5D7IB 5I8OL 3VXRD 1VSCA 3F7VB 5MERB 1OB1B 3SJVD 4GMSL 2BHYA 3A22A 2WLLB 3VXUE 3WY4A 1I1RA 3FCSA 2APXA 1UOKA 5DFTA 5D1XD 4DP5X 1F3JB 3OXSA 4D0CA 5DYFA 3KYKH 4DAGH 4TVPH 4N2FA 1NICA 3SGEI 4FJZA 4FG6C 2W07B 2VE6B 3VXSE 5JW5A 3V5DB 3HJ0A 1EZVY 4Q9RL 4ZFZB 4YUEL 1A1MA 1K6QH 3D85B 2X4OA 4KO7A 2YGOA 4ZUVA 2H1PH 3R0NA 2NTSP 5D4IA 3S7GA 1NIBA 2QQLL 1ZHNA 1Z9SA 2MOVA 2VGLM 3MUY1 1E6JH 4JGUA 5HHOE 5FM5O 4CDGC 3QHFH 3FRUA 3JVGC 2FNWA 5HGHB 1RD6A 3RB5A 3CAFA 1ADQA 3LV3A 4KGJA 4YLQT 3GJFK 4JL1A 1SN5A 2J1YA 2XXFA 2IAND 4EUPA 1KIRA 2CIIB 4PG9A 3UH8A 3ZE1E 5B3NA 2HLAA 1QSVA 2F58L 5KVGL 1GGBH 1ITCA 3PWPD 5KUKA 4EOWL 5J11C 3V79C 4WFFE 4L8DA 4K9EH 1SLUA 3MODH 1L0YA 2OJEB 5E94A 4DKTA 4RSVA 3VWJC 2V9TA 5I76B 3WFCL 5EU6A 3PWLB 3AUWB 2ED7A 5E99L 4PJ5B 1MVUB 4I13B 4QHNB 4KITB 1USQA 3MX0B 4PGEB 2KPNA 2ZIDA 3UACA 3X3FH 1JN6A 1KGJA 5C9KA 4UQ9A 5D1XE 2X4PB 4JJOA 1M71B 1TVBB 2QKIB 5A1AA 2IQAB 1LTXA 4AQAB 3MV9D 3TV3H 3TYFA 3W56A 4U2ZA 2AS5M 5EEUA 4XTRD 4QRUA 4KK9C 4QXVA 5IOPB 1E4KA 4OD1L 1IAII 4ZPVA 5GISL 3HNVL 3L6FA 4IGBD 1ZGLB 1QO3B 2Y5EA 5DC9B 2ZAHA 3CBRA 1LO5A 4NSKB 4OZHA 4WZ9A 3RL2B 4DO5A 4OCSH 3CFBB 1HCZA 1HX0A 3G04A 1KJMB 1KTLA 2RD0A 3ARED 3NA4A 1ODUA 2Y5TA 2X2YA 2QSTA 2Y7QA 4OFYA 5T1MA 2NW2B 1EEQA 5FO8B 1S7QA 5CINL 1TJHH 5ETUB 1G4MA 1TSHA 5IESL 3SDDB 4IHBA 4AJYV 1SYVB 1I1AB 2LFGA 1JPTL 5B39G 2Z34A 4HOXA 4RRPG 1NTDA 2JI3A 2VH5H 1IT9L 1S5IH 2CDEA 4WQOA 4ZMPA 4R5TA 1KMGA 5BMFL 3VFVA 4PWHA 4RNRA 3MUJA 5PAZA 4FG4A 1TT6A 5DYOB 3IVKA 1NGPH 5SWSA 1J0KA 3RIFK 1G6RB 1JWSB 2WZ6A 5L4IA 1OAKH 3D0LA 3TYFB 2EDXA 4GRWH 3ASWA 3B2UC 1NCIA 4QI3A 5EUOF 4OV5B 5FDWB 4H7VA 5AAWA 3C5SA 4GMSH 1KPUA 1RUPL 2J43A 4AVJA 5A2JH 4JDTL 1JN6B 5J1AB 1BJMA 4XNUL 3IAGC 1AQHA 1HKLH 3MMEA 3VUAA 5CLWA 5MI0C 2FDBP 4PGCB 1OY3B 4WI9A 2BO0A 2H8PA 2CK0L 4OGYL 2Z31C 1MVUA 5CFHA 5I0ZA 2JKNA 3L48A 2AEPL 4YVUA 1MCOH 2J2ZB 4LVOC 2EKJA 3MRBA 2V7NB 4HHWA 3FN0L 1YMMD 1LM8V 4XNZC 3ZYJA 5JHLH 4XPAH 1A64A 2FHBA 3ARSA 4M6OL 1B0WA 3GHBL 2JB5H 3VXOB 4H25A 3ZR5A 1MLCB 4LLDB 3SCMD 3TO4C 4FA6A 2JB6B 4JR9L 5I1HL 4XCYB 1CLZL 3SE4A 3ELQA 1J9RA 2QADB 4RA0C 3RGBA 1IFRA 1N6VA 3F05A 3MRCB 5I15H 4MD4B 5C08A 5JHDB 3B56A 4Z0XA 2C9RA 1JZFA 3UBXA 4E2OA 3CVHL 3RKPA 3RHWF 2IH1A 4P8QA 1IGML 1JZ6A 1D3CA 3CZFB 1I8UA 3GEWB 2IG2H 5BZDA 2KZBA 2XZAL 5MENA 7PCYA 3VI4B 4PJ8B 2IDUA 1J9QA 2VZSA 4PJ7B 3BLPX 3LNGA 3WTUA 5CKGA 4F37F 1QRNB 3D50A 1S7VA 3TVMB 4X99A 1W80A 4KKAC 2YQ3A 2R0WH 3ZE1F 1PZ5A 3PABA 4KRPD 3FUHA 2IOMA 3K81A 4HCFA 4QYOB 5CKAA 3ERXA 2V2XA 3A4FA 2HFEA 3H9SB 3NZHL 3EFFB 1A4AA 2BIIA 3Q6FB 3ZKXB 4AQOA 4G2AA 4Y2DA 6PCYA 3G08B 4HIIA 4R7NB 4ZO9A 1A4CA 1G1CA 1TVHB 1P84J 5IKCB 1KYOK 4UAHA 4OJDH 5FYLL 4R4NC 2YK1H 4LSVL 3UTQB 3DI2B 4HK0A 2WLLA 1NPUA 3LKRA 3EGSB 3D2UA 1JF6A 1OB1A 2BVUA 3GHPA 5IQNA 5C0BD 4CGTA 2VDOL 1X5KA 5MHSD 5TGBB 3WO4C 1FBIL 3P40A 1S9VA 3QFJE 5IG7B 3QCVH 1X5AA 3C8KB 2CLRA 5ELIA 5ID1A 4ETYA 1BD2D 4QCIB 4ZO6A 1IC5H 3LB6C 3MO1A 5DJ6B 2EE9A 1WWCA 5HD8D 3KNBA 1JERA 2QT6A 3TJHC 1OTSD 2Y3AA 4AQEB 3ZSTA 3RNQB 1SXBA 3BD3A 4Y4KA 2NCMA 2BNRB 3BRFA 1UEYA 3VI3A 5CO1A 2I7SA 1QRKA 3RUGF 1A6UH 1RZJC 3Q2CA 5HP5A 4PJ8C 5EC1B 2ZKXA 4MDIB 3C6LA 4MZRA 3S4SG 3PNRB 3S3JA 5JOPD 1NLBL 3LH9A 1U9KA 4LEXH 5IV2B 1YUHB 1P1ZB 3TO4A 2HKFL 3WIHH 1TZIA 4EUPG 3R0MA 3N55A 1NFAA 1ES0B 3IU4L 5B1CA 2EUXA 3BZ5A 4XBMA 8FABA 4FLHA 2XX0A 3VG0L 3WS3B 4MYPA 2L3BA 5F7DB 3V0EA 1NCBL 1JYXA 1KNOB 1NFIB 4YHNA 5JYLA 1TJIL 4ZMYA 5H94B 2AQNA 3PJSA 1ACYH 1ERNA 4YDIH 4ORZC 3RNKA 3SEPA 1IJ9A 2Q3AA 5KVDH 4XRCA 1J8HD 3OMIB 4IIQC 4X6DF 1CI5A 4JQIH 1VGEH 1X5IA 3GTVA 2J8UE 3FTWA 1MHCB 4G7YH 3NJMA 1QATA 4EN3A 5DJDA 4JGNA 5TE7L 1A21A 2F8OA 1KT2A 3BWZA 3MSPA 5CEYB 3BVNB 4NN5B 4MAYD 2OYMA 5CIPB 5EU4A 1T1YA 1DTUA 4TQEL 1ZSDB 3O3BB 3RVVC 1HQ4B 2V5MA 4FI8A 4LL4A 5KYXB 2XICA 1Y18A 3OHXA 4P48A 3L4UA 4YHLL 4JFED 3E9TA 1U8NA 5AL8A 3SDYL 1MI5B 4EIBA 1CLYL 4LE8A 3MLWL 2FEEL 1RLBA 3MRFA 1EFXB 2J57A 1NFDF 1WLHA 2PXYC 3F3HA 5CR8A 3VI3E 4CVWA 4JM2F 3PPSA 4N2KA 3VFRB 5ABDE 4EZKA 1FVDB 3DETD 2YRLA 2Y6SD 4NZFA 3KYAA 5ICZA 2H45A 5DD6A 3GSRB 1YNTB 1YEHH 3CV5A 2WLHA 3NZ8A 4MKMA 3LD8C 3VH8G 4BXVA 1K6QL 3SYCA 3C60A 2YGNA 3OQRA 4WENB 3CFBA 1WJ3A 5KSBA 4H1LG 3TC9A 1T5KA 3VM7A 1A4KA 4UQ2B 1SLVA 3T4YA 1F4WH 2AQQA 2X0UA 3F04A 1DE4A 1U8KA 3BT2H 1X6LA 1A7OH 1N18A 2VR5A 4G9FB 4IS6A 1OCOB 4P46A 4TMPA 1TIUA 2HZHA 4Y4HC 4G9FE 1AZVA 2VLKA 2FE0A 1JXJA 5C0CD 5IMLB 4U1LA 3RGVA 1IM3D 1RK7A 3ESMA 5EB9A 3MRQA 1RUKH 1YQVL 3DOIA 4P46D 4D7PA 4B0MB 4B41A 2OR7A 4KXAA 4S1SH 3N3EA 5HHNB 3BRGC 3QUZD 2VQUA 5DMIL 2WPGA 4F80A 1EJOL 3RWDA 1K3ZA 1N8ZA 1MN4A 5FV2A 4ZOBA 1BBJB 4YSAA 5IW1B 3KBFA 1A4KB 1J1XL 1C7SA 2WCPA 4NO5A 1JFQH 1U3HA 3QDMA 4JFFB 1MZYA 1E3XA 2TSAA 4Q6YA 5KSBE 1HQRB 5SWSE 1RUML 3EYUH 3I6KA 2CHDA 3DI3B 3SQRA 4HJSA 4HJIA 4KJYA 4K3EH 5T5NF 5C70A 5JLZB 3KGUA 4GKNA 1FFNB 2GTWB 2QTEA 5E70A 4DP8X 4PJAB 2WZ0A 3DPDA 3MA7A 1DUYA 3RWHA 5C0ND 3DDFA 5J56B 5T33L 1HL5A 1U3HD 3N5AA 3S5LA 1UH3A 4R26L 4ZSOE 1H8NA 1MNUH 1FO0H 4Z9KB 4R90H 1W72H 2J4WH 2ORBL 1WFIA 3VNYA 1J1OL 4UQEA 1HEZA 1HHGB 4I18B 4PN6A 4QKXB 3ZZLA 5ICYA 3K1KC 4JHWH 5SWQA 4E42A 4M4RB 4YHOH 3HFFA 2FH6A 2QSQA 3X1BA 5E4EB 5ACZA 4JHUA 4GMTH 4BFIB 4DK3A 5LGKA 1XIWC 2WWKO 5BRQA 4MD0B 1OHZA 1WUZA 5D1XB 5DVPA 1YDPA 2R0WL 1D5XB 1DR9A 4DZ8B 4IKNA 2KLSA 2CG9X 2WBXA 3BIAX 2C3HA 1O7VA 2J8UA 3EXJA 3Q7JA 4PB0L 3LEYH 2VXSH 1T20A 1FNSH 5D7JA 3U2IA 5HHVL 3NJIA 4NIKB 2XZAH 2V7HA 5T5FH 1EK3A 3LZQA 4JG5A 3BAKA 5TDNB 4H8WL 4R97C 4Y7OC 2ZCKH 3U4EA 5F96L 4K94H 1VEMA 4PRPA 1Q0YH 4P23B 1G9NL 4PCTA 3ARWA 4HWUA 1MCHA 4NWUL 4MAYC 2YBRB 2ZXWB 1PD0A 3MFFB 3NIGB 3WHXA 4ECNA 4YSSA 1DN2A 4LAQL 5J1TC 3BESR 3HZKB 3VI3B 2BRRL 3QDHA 1MRCL 3KPLA 1C08A 3W9DB 2FYYB 2Y7OA 5M7QA 3S35X 4TLUA 4PB9L 4N26A 1D7BA 3V5HA 3QG7H 1CFBA 1FO0B 2X4QA 5FYKU 4S1QH 1AR1C 3Q5OA 2VXVL 3AS3A 4AC2A 5FUZH 5GRYA 2YHGA 2I9LB 1LO4H 2DM7A 1I7RB 4RETB 2FL5A 1F8TL 3FKUS 4PRDA 3UAEA 5BOZG 4B9KC 4H13C 4PWEA 4WJG3 4LEEA 3OAWA 2AI0H 2J8UB 3CQPA 4FXGB 1AR2A 2HFGL 3BKMH 3CK0H 3GLDA 1TYJA 5IB5B 3AM8C 3T1FB 1JVOA 1GYWA 2L0DA 2A5UA 4L29A 4P2RE 5D1XA 5DU7A 3SQBB 2A77L 4L8SB 3AM8A 2IFGA 3HR6A 4PRPE 5I6XB 1KYUA 5I17A 1M7IA 1KENL 3MLUL 4LSQH 3HAEH 3HCVA 4HX1B 4M8QA 3GSXA 3LS4H 1I7ZB 2OMZA 2F7RA 2JMRA 4NYLB 1DJYA 3GSNB 3UDWA 1QSEA 2DQDL 1M56B 1CE1H 1M1SA 3GSNH 1PZBA 4W1TA 1H5BB 3E2HC 3WIIH 2PXYD 2DQUH 4ODHH 4UOQA 4Y0GA 2TAAA 5LO7A 3RG1C 3TT3L 3RURA 2D7PA 4FQLH 3MRDA 5EZOH 1CT8B 3A0OA 4OGYH 3G5ZA 1NBYA 1FG9C 1Z5YD 2E9BA 4L3EA 4MZ2A 4ZMWA 5GGTH 3IEAA 3V6OA 1ED3B 3X12B 5ICXB 5C7XL 3LPGA 4ZAKA 4PY7A 5D1ZC 1N5YH 1XGQA 1AFVH 1SOKA 3MRKA 4NBZB 3EHBD 4F27A 5LXVA 4I4WA 3BP5A 2VSKB 2FRGP 3JVFC 1JHTB 5HHOB 2FZ3B 4C55A 1TTGA 2N56A 1VAHA 2X1WL 1PL3A 2D9CA 4V33A 2QVTA 2V6HA 4FNPA 3WFEH 3AB0B 4HJGB 4PV8A 4ZUWA 3US0A 3O3UN 4OFPA 4NQEA 1A3RL 4JO4L 4N2LA 5L8KB 1XGRB 3IN0A 3TFKC 4JLRB 1NAKL 1IT9H 1UXSA 2GG1A 5EULV 1H8OA 1IC4L 4G8EB 3L2LA 4PGCA 2YRBA 4V1DB 5D93B 5HGAB 4UIKH 5AOZA 4ODTL 2Y36L 2XQBL 1U91A 3L7FA 5TE4L 3VQ1C 1T0OA 2R39A 3X2QB 2YBGA 2YD5A 2XN9E 1NCWH 3JT0A 2XTJC 4XPGH 4LCYB 3IDUA 4BK5A 5BUPA 4NUQA 2DQIH 1F4AA 4KZDH 2X4TA 2FJSA 2WWOA 2B9AA 1ZT7A 2QV4A 1E7VA 4WI4A 4CJ0A 1MCPH 4XC3H 3IVKB 2ATKA 2NQ3A 4ZMAT 3U9PH 2IH9A 3FFCB 2B20A 5DMJB 2H3NB 3OV6A 4ETQA 3LRKA 3NEEA 2H1PL 1IGYB 1DQTA 2OMBA 2DEXX 1BYNA 4MQXD 4ZFOL 4JB9L 3L3KA 2GI7A 1LXMA 2FB4L 2Z91B 4DN4L 5JPMC 4MAUH 5IHLB 4H8WC 4JB9H 4TVPD 1G7IB 1IBZA 2BIHA 2EAEA 3SD2A 5JO5A 3CFCL 4P06A 3BEVA 1R9FA 2KL6A 1QRND 4I77L 1FZJB 2XACC 3MROA 4QHPA 4HAKA 5FO8A 3S88H 4B53A 2VISA 2J8UF 3U6RB 3W5NA 3F7KA 4DKFL 4DEWA 4LSDA 3WXVH 5GZND 5C0EA 2DTML 3IMVA 3HB3B 1T66C 2HH0L 4XBGA 4JZOA 1HOCB 2HUEA 4NN6B 5EO1B 3D3VB 5JW4R 4IU2B 2WINA 4ZNEE 2V17H 2ZE0A 2VQTA 1RSFA 3AB0C 1CDYA 5ANMB 4PJXB 3TOPA 3Q8BA 4AT6A 4ANWA 5AQ0A 1THAA 4U1IB 3VXQB 4AT6B 4PJIE 3TCTA 4JRWA 1B2YA 1KPVA 1Q72L 3CVCA 4YDVB 5DJDB 3O3AB 1I1FA 4KK9D 4H1LA 3WS3A 4M6ML 4RESB 4PD4J 1RZKH 2VDNL 5INCB 3NIFE 4DN3H 4KQ3H 5BVJA 1YUHA 3FYIB 5C9JB 2JCCA 1KCLA 4M29A 3HZVB 3NJKA 2OI9C 5EEXA 3RX8A 4AG4H 2OJEA 3HE7A 1KUMA 3C5XA 4LRNL 1S9YB 3MOQA 1HIML 2E9IA 2OKMA 3N0PB 3QDGD 3SDDC 3QQDA 4MVBC 5EU5A 4X6BA 5CGTA 3C6SA 4OZFG 1WFUA 2B2XH 4FQJH 2VNCA 1ID5I 2GYSA 4B5ZA 2H32H 4TSAL 3MNVA 4X8JB 3I3BA 4FQHB 1JVLA 1BFVH 4FQXD 3NA9L 3WGUB 1JF5A 3QULB 1CQKA 1JK8B 2WUCL 3CCHB 2VQ1B 1CLYH 5C0AA 1RERA 1XTMA 3FB6B 4BA0A 1PZ2A 4U33A 2QL1A 1NCDL 3F7QA 4E9XA 3ZMNA 2SEBB 2OK0L 3U7WH 3NQIA 2YAFA 4JE4B 3KPOB 4JFYA 1TZHB 3GTNA 5E5LA 2F53D 3VXSA 1TVHA 4LARH 4MVBD 2I9TA 1KTDA 1RZIA 1IGCH 1FFOB 2WZ5A 4MMZC 2RR3A 1Q0EA 5ANME 3PQYA 1I7TA 2EH8H 1DZBA 2D31A 2B14A 2GSGA 3LZNA 1J5HA 2XZQH 5GGSB 3BD5A 2D4DA 1BZEA 4N8CH 2WUBL 1L9NA 3LRSB 4PJDF 5FOBB 1RHFA 3U9WA 1X7QA 3VG0H 4JM2A 3U4AA 2NR6D 4JRXB 4PJ8A 1HU8A 1D5IL 4YSEA 1L9RA 1MCRA 4WTQA 2SODB 2MJWA 2AV7A 3S0PA 4YR6A 5EC2A 3QPXL 2J5LC 2OQJB 4X5PA 1FHNA 4PYGA 3SOBH 4YZFF 3BIBX 4XNQB 3MRDB 3U1QA 4YDKH 3Q1SL 3B6SB 3N1MC 3DX3A 4KC3B 1U0QA 4CVUA 1JHLH 1RJYA 5AAPA 3BVDB 4WWKB 3GIZH 3NYKA 4F2MA 4P5RA 2JKWA 4M7LH 3G5ZB 2G3MA 4KX8A 4WEBL 1WFNA 5GPRA 3ARZA 4ORGB 5CP7B 2ENQA 1BREA 4L3CA 4LBEA 3U4KA 3TEXA 1PNDA 1C16A 2FJGA 1A25A 3NUKA 3P9LA 4WW2B 4BZYA 3NSYA 2IDFA 1UD5A 4R6UA 2R83A 2P5EE 2AXHA 1PVHA 2ZAIA 4LNRB 3T0EB 1JRHH 3NIGE 3T1FA 5FYJL 5HDBE 1KBBA 5DFVD 4P57A 5DSCA 2NPLX 5EUOB 1GZPA 3H42H 2P8MB 2XVGA 3Q44A 4L1BA 5IW3A 5SX4H 3CDYA 3H0TA 1J5CA 2VCOA 2BHZA 4IBLT 1FIEA 3TTSA 3UERA 3VI3F 1DVFB 3SGDI 5LGYA 1LDSA 2H3KA 4UUJB 1FUNA 4BUQA 1I3RA 3HRZB 3G5YB 3GD1C 3IBOA 1NGQH 1NLDL 2CMRH 3RVVD 1ZVSB 2AGJH 3QUYB 5DVNA 5CD3B 4NQDA 1ZT4B 5KS9B 3HG4A 4HF5H 4HKXB 3X14A 3RPBA 4FP8L 5G2NA 4YSCA 3SDCB 4AX3A 1O6TA 1DBKH 1AMXA 5FLVA 4X6CE 1QQDA 3AG3B 2RCSH 4FTVB 1RURL 1H0DB 4NWTH 1C5BL 1P5UC 1URIA 4AXWB 4P2QD 2O5ZH 3NSXA 4RAVA 3MXWH 1ZRUA 2HTLC 1YN7B 3CE1A 4ZFGH 2V5TA 1E9OA 5DD3H 2BSRA 1PD6A 3WKNA 1NAMA 3CZKA 5CGYC 5EPMB 5DR5H 2O61A 4NKIL 1T5WB 1YEEL 5ETUA 4WFGE 3HG1B 2ZXBA 5TK2A 4KO6A 3JTBA 3DARA 4WTWA 1S5HB 4TUKH 3X3GL 3QH3A 3CSTA 3GRGA 3LVEA 3OZLA 3QUMA 3T0XA 5GZOD 2X10A 4UV4L 2BIMA 2FR4A 3UGUA 1OE1A 1KXTB 5DJYB 3L6FB 4U6XB 3ZE0E 1MNNA 2AEPH 1KTJA 2HT2C 2OXHA 4K71C 4TUJA 3TXAA 4PGEA 1DBBL 2DYSB 2XV0A 5F7LB 1QWUA 4AMWA 1Q9WB 4A2DA 3NSFA 3ZYOA 3KGTA 5F72S 4YFEA 3PE9A 1DLFH 1JNHB 2PW2B 4JDTH 2BY2A 2BFVL 3CMOH 3NN8A 3O4LB 2A73A 4IBTA 5TF1H 4CC4A 4JPQA 1HIMH 3ZE0B 4G8AC 4PLNC 2XSKA 5CJQL 2P24B 1T80A 4XBGB 3TBVA 4AKQA 3GO1H 5HI5D 3GGWB 2F19H 2BS8A 2GCYB 3O6FA 3QS3A 5EBMB 4HS8L 2R4SH 4GG6B 1HYSD 2OMTB 2PO6A 3APDA 4KI5E 1YG9A 2PCPB 4DN3L 3BUBA 4WTZG 4KK6D 1Q9KA 3H6JA 4FNUA 4ZUTA 3IDMA 2LAAA 5JLZA 4YPJA 1BIIB 1EVUA 2LT9A 5D1QC 4IDJL 1S5IL 4LPTA 3CVIL 3S35L 4ELMA 2BVPB 2P8LA 3H85A 2X6MA 1L9MA 3L3KB 1I8LA 1LWHA 1TKWA 3O6MH 4ZAKD 2IALA 3S37X 2JQMA 2H26B 3D18A 3Q8AA 1GJUA 5DHDA 3QORA 3UO8B 3GRWH 5IW1A 3VD9A 1NJ9B 4B6ZA 5DHMC 3HS0A 4XP4L 3WJJC 3SCMC 3TBVB 3QPQC 3IFPA 1UWYA 2X4TB 4LPWA 4OGQC 4EBQL 4PW3A 5DQ9B 2F54D 4YHIA 2ZCHH 4D0CB 4KXZI 3S2CA 5C92A 1BW8A 3NRQA 4ATTA 1DJIA 1UH2A 2DQHH 3IJ9A 3ZT6A 5E6IB 4HUCA 5JW5B 2CHZA 4Q2ZA 1PKQE 1Q90A 1E4WL 4V1DA 2R1YA 5CWSA 5IFHH 4OV6F 3LZFL 1E42A 3X1EA 2EIMB 1P1VA 4H88L 3LS5H 1XCQB 3QFGA 1RY7B 3ZDZF 1UKTA 2G4GA 1F0LA 1ZHLA 4JVWA 3BKYH 5H8DA 4BZ2A 2IC2A 3WN6A 3OLEA 4HH9B 2AQ2A 4D0DA 1L7IH 1RV6X 1N10A 1ZS8B 1XQ4A 3MRIA 3VWJB 4CBPA 4NC1C 5J6GB 4PGDA 1SJHA 1DVZA 2DJSA 4L4VE 1S5HA 5TPWL 4CC4C 3D5OF 4BZ1L 4Y9CA 1A6VH 3NZ8B 4HCGA 1BD2A 4RDQG 3AS0A 1LK3L 1NLBH 1RIUH 5I74C 3WNMA 4ZS6C 5JQ6L 4DP7X 1D6EA 3TBWA 4Z3HA 5EN3A 1P4IL 2XFXB 5IROC 5KSAC 3S6CA 1L0QA 3C60B 1ED3A 2YQBA 3VSVA 1B3JA 1DDTA 1M4KA 3QWQB 3X12A 3GRWL 1KBVA 4YDJA 1OZTG 2Y0SA 1RZJH 1KCRH 2AXGB 2DTMH 4A55A 4OGAD 1WT5C 2WHVA 5CFAA 3CVIH 5F7WC 3S35H 5K69A 3IFLL 4PJDE 5IVXB 5D7LA 2HTLD 5BZZA 4MCNA 4PIRF 1QWNA 3G5YA 1LEKA 3SPIA 4JO1H 3WNOA 3MA9H 3SDAC 3L1GA 4MAUL 4M8QB 3HAEA 3WY3A 2RQEA 4RGOL 3RTQB 2NDFA 2PYFB 3ZZ1A 1BVKB 2IADB 5GS3A 2F19L 1ASPA 4Z7VF 4DPBX 3SDXE 2R8SL 5GZOC 1XGPA 2BPBA 2DI7A 4WUUD 3DK2A 3NJNA 3U9PL 5MEND 3PFUA 1HYRC 1R19A 2ZXGA 2Y24A 3F7YA 4LNRA 2FX9H 3V7MA 3T0EA 1KSRA 2JNZA 2EC8A 3UTPD 4LVOB 4R4FH 2M1KA 3ATFA 3U1SL 2VN5A 4F24A 2JKSA 3P9LB 4G6AD 3MV11 1KCKA 3MXVL 5I8CA 1G7MA 1I75A 2FSEB 5JMRA 1A6WL 2VWEE 3TWCL 4ORGA 5CP7A 4DVBA 4JGJA 5D2LF 3VXRE 4FGMA 1IKNC 3ARGC 3I9GH 4WKXA 5EC1A 5I1JH 1CU4L 2QTVA 2Y2YA 2UZYB 1NAKH 4GRLA 3PGFL 4L1DA 3U6XA 5DLML 5JPMB 5A2FA 5JYMA 1TZIB 1FYTD 1HZHL 5F1IA 5DJCB 3DKHA 1KLFB 2V9UA 4E41B 1NA8A 3GUTB 1SBBA 4NAQA 4IKJA 2K3HA 4JCWA 4N2CA 3MO1B 5DJ6A 4G7RB 3UBGA 4PJAE 1EJ8A 2E7CA 1FL3A 1BQLL 1SY6H 5H2BB 2IDCA 5AW9B 2GY5A 5EUKA 5JXAH 1VF5C 4UQCA 3RIAK 4U31A 3OR6A 2FVNA 4CSZA 5HDBF 3SE4C 3GDBA 4QXUL 3GHEL 1OQOA 5GGTL 1F6FB 2NY1B 4XZ4A 5ID1B 1CICD 1XZWA 3HMXH 1Y1DA 1ZV5A 5SWZA 4F7EB 1D9KA 2DS4A 5D4HA 4GG6F 2C7UB 2R59A 1X9LA 3LZLA 2NNAB 4MXQD 2L7EA 5CBEA 3EO0B 1IM3A 1WDAA 4U6YB 5IMMB 4HUVA 5GGQL 2BVOA 1UB5A 1YC8A 4OKDA 3VXUD 4ZMZA 2APFA 3QJOA 1RUQL 1E2WA 3ULUD 4DGIL 4Q52A 2BP8B 2WAQA 3NDZE 1D6VL 3DWTA 2R8SH 3AREB 1AY1L 5D6DC 3VFOB 4QHLA 5JOEA 2VQ1A 2X2JA 2Y22A 1GC1L 1BVOA 5GRWA 2C5DC 2ZYRA 5SX5H 5BO1H 3JT2A 1HH6A 1DUZA 4GBXD 4LEOA 4X99B 1J8SA 1UHVA 1Q1JL 3IF1A 1L6PA 3T3MF 4N25A 1QRNA 5EF1A 3QYMA 4HK3N 3RZCA 3TESA 5AEAA 4PRNB 3ZZSA 2W9LA 1ESOA 2GI0A 3QNXA 4NC1E 1JG9A 3HNTH 2WN2A 1PGRB 2DD8H 4YWGH 2XXCB 1KCRL 5HXMA 1AE6H 1IVLA 3IDMB 3CZFA 3SY0B 5CZVL 4JZJC 1GVIA 1IBFA 4QTFA 1MF2H 4ISVA 2NX5B 3OTTA 4BUGA 1FF5A 2PO6B 5C9JA 2LU7A 3KBPA 2VO5A 2KMWA 3O6FB 4M1GL 1ETA1 2OW6A 1U36A 3MV9E 4MLIA 5AWNL 4DKEL 2VDKB 5FHAH 5G5DA 3S36X 4YXLH 5CBEB 1OSPL 4K8RC 4RFNC 2J73A 3V0VB 3VXMD 1CXHA 2WLIA 3CC5A 3V0HA 1EWHA 1SLWA 2EXWC 4Q4IA 3CSPA 4NQCD 3X1NA 1D5RA 5C07A 3LN5B 1M9SA 1RMFH 5I1EH 4N3UA 3HG3A 2WNGA 2G75B 1ZK5A 4FHJA 3V9EA 4PJGB 1ECYA 3IFLH 1SEQL 1KJ2H 3DXAD 2AQSA 2QVKA 4MJ6B 4WI0B 3MV7A 4LRIA 1T7ZA 3ATBA 3LS5L 1KPUB 5EO1A 3NPSB 1WYJA 4RWYH 3GBML 5CJBA 1A5FH 3K6SB 5JIDA 3QH3B 3MNMA 3QUMB 4FQPA 3ZMRA 3VXRB 1ACZA 3NFNB 3AT9A 5FGBA 5E1QA 5EORH 1Q1PA 4I9XA 5J7CC 4HFWA 4N22A 5HVGB 3QS2A 1H15B 2ZP8A 4IU3B 1MCDA 3L3HB 4GKOA 5KSAB 1ADWA 1KULA 1U8JA 2GBUA 1LK3H 4MJ4A 4HGMA 3GT6A 5IP4A 5I1KH 2ICWB 3DIVA 1A9VA 3CSFA 1F3RB 4BD4A 2IOOA 2EACA 4G72B 4XX5A 2ZX9A 3GS7A 2PCXA 3BISA 3PUUA 4GP5B 2NY3C 1MEXL 3AS1A 3U46A 2JTYA 2ZOLA 1QO3A 4Q9BA 3D05A 3UAJC 1PF3A 3AQYA 5IHWA 1FO0L 4XB7A 2YC1B 1K8IB 5GQBA 1SUJA 3GK8H 1QYGH 2G5RA 4C83A 4UM8A 1E2VA 2Y7QB 4PYHA 1CVSC 2Q7YA 3R7QA 5CD3A 1YY8A 5ENWA 2P3YA 1FYHB 1M3JA 4UF7C 1U8HB 3DHPA 3EJSA 5IVXF 3MV7B 1NSNL 3PLYA 1HHKB 4NAJA 3F58L 2NY5C 5D70L 2DQEH 1JDAA 3NAAH 1G4RA 1BM3H 4CN1A 2YD3A 4NZJA 4EKJA 1IBGL 1HZKA 3D2UD 3IFOB 1JUFA 1EUUA 3K0YA 3VRJB 4ALAC 1QPXA 3K5SA 2PYFA 1AQKL 2LABA 2YXWA 3TH2T 2W81C 2WLIB 3CC5B 2C1OB 2A6IB 1X6NA 1Z9NA 3P2TA 5DJZB 2ZXCA 4HZLA 4AMKL 1RUKL 3W0WD 4XBPB 1DBBH 4OFVA 4DEPB 4L3CB 3GMRB 3JWOL 3E0GA 3M45A 4FA8A 1U3NA 1WWWX 3EKCA 4Y4HB 3ZE2B 4Z7QB 3UPRA 3F64A 1AYRA 4AL8H 1T1XB 3QZOA 4EZLA 3T0ED 4Y4KD 3Q05A 5FW7A 1M42A 3G5VA 1MWAH 2CR6A 5TQ2L 1CGVA 3WS6A 1NIFA 2GBTA 5HVFB 4IHOB 1I3VA 3MRPB 4C57C 4WSGA 2PWFA 2V9RA 3OD3A 3EOAA 4KBPA 3SPVA 2VDMH 3PHQA 1TQBB 4QRRE 2XWBA 4GRWE 3B9EA 5J6GA 2L7UA 5EOCJ 4DKEH 3INUL 4I0PD 4OSUH 5KTEH 5CS7A 4ACTA 1NMAL 1AC0A 1HHJA 4K3DH 1XXFC 3GEFA 1I7ZA 1R5VB 4F8NA 1FFQA 1KYOJ 4GKZA 4JMXA 5LNDA 1UM4L 5ICUA 3RVUC 1KELL 3B9KD 5ITBL 1MHPH 1TLMA 3O2VH 5F9OL 2X2HA 5K9KA 4F58L 4HJ0D 2F7PA 4JPKL 2BNQB 1IM3B 3HNTL 3QSKB 1PNCA 1AP2B 1J11A 2YEZB 3BAEL 2WVSA 4PGJA 3A21A 4PJFA 1D9KB 4BE5A 2WXNA 1CGSL 3BEWB 4NXKA 3T6ZA 1LEIB 3O45A 2AJSH 4N2MA 4C4BA 2EUWA 3QNYB 3LN4A 3TBYA 1E9QB 2CDGA 4X8CA 4G83A 1U8IB 2YAQA 3Q06A 3QCVL 1U8CB 3OR6B 2Y9RT 5EUOE 3DVNB 4ZRGA 1OANA 2ZSVA 1ZLWH 5DQDH 4X9BA 1XEUA 5DEZA 3WLWD 3JWNH 4HPHA 4JHVA 1PLGH 3VQLA 4F5CE 1ND0B 3RIFF 1JK8A 5ESAA 1BVZA 3AJ7A 1MWAA 5T1JA 1IMHC 3EJQA 4X6FA 5D2NA 2BHUA 1GS7A 1VFOA 2VJXA 3IS0X 3OKNB 2YMTA 3ZHKA 1T0PB 4B7IA 5K9JH 1IGJB 1RP9A 1IEHA 4FMFA 1JHLL 2MH4A 1SYSB 2KLRA 3MUZ1 5AOJA 1QLFA 5FYKH 4QJ4B 3BVVA 3QZBA 3N44B 2DJMA 2CRYA 2G0LA 1WV7T 3I02B 4LCCC 1CN4A 3EJUA 3OAZK 3MRBB 2VW6A 2Q2EB 2JCCB 4E9TA 2YEVB 3AC0A 3FU7B 1SJMA 4FL4C 4L8SC 5IHBA 2X28A 1Q9WA 4OIFA 3GUFA 1T0NA 4H1LB 2XHNA 3EYSH 2G3NA 3G6JE 1DVFC 1IGMH 1KIQA 3MFGB 1EHXA 4MWFA 4WEBH 4XPHH 1ZXKA 1IX2A 3HB3D 3Q1EA 3UTZA 5D1ZB 5I8EB 2KERA 2B16A 2F7OA 3IRCA 4HJEA 3MLRL 4E42B 2BNUA 3X1FA 1NCAL 4DETA 5SWQB 5IM7A 2R0ZH 3VD5A 3WTVA 1INEL 1L9TA 5FGRA 1TXKA 1NDGB 2DQCH 5ITFB 4GSUA 5HDOA 1MJ8L 2YK1L 4JZOB 4LSVH 1JL8A 1ITBB 5TDOB 1DJXA 1CBJA 4MNQE 3EH3B 4JFXA 4NZTL 1JWUB 3ZKQD 3T1WA 4XN7A 5FC9A 4XP6L 5FFLA 3RX9A 1BXXA 1N3NA 2P4AB 3IPFA 3FJTA 2X88A 3QQ9D 2PLTA 4HLJA 2XNAA 4HPYH 4HKBA 4MX7B 4TNFA 1WBZB 1JBJA 3BW9A 1BFOA 2HKHL 4RBPH 1EX0A 4Q6IB 4X80H 4TNGA 3QG7L 4M4PA 5F88A 3ZUNC 3SDAA 4X7SL 3SDCA 2WYZA 2X1QA 1PG7H 5D55A 2DBLH 1XF4A 4Y16A 4F7TA 1YY9D 2DKSA 1S78D 3P1VA 4W9JC 1P4UA 4IRZL 3GMQA 1YC7A 4JJ5A 5E8OB 4NM8H 2WIIA 5I5JA 5F7FA 4UUJA 1OPGH 1A7BA 3GB7B 4ZPVB 5FS5A 2A6KB 1BD2B 4U49A 1QLRB 4UV7L 4ES9A 4IOIA 3B1UA 4X4XA 5ESVB 5AUMB 5D1QE 4LCCB 5HHNA 3H2QA 2CM5A 3HI5H 2DZEA 3H0TB 2FT8A 4PGDB 5FHBL 3O41B 1VGKA 2WYTA 3DX8A 3IFNL 4YZFE 5IEKB 1SQMA 4N3TA 1GY1A 2F61A 4MQSB 5IMLA 2VLKB 1UWFA 2EC9U 4IBZA 3AMLA 2P5ED 5FK9A 2K3TA 2IGLA 4UOW1 3QCTL 4I9WD 2PKDA 2E76C 5B4MD 3RGVC 5CMAB 2CCWA 1DQKA 3J7HA 4UYQA 4WW2A 3E1ZA 2Z7UA 5J3HD 1LLAA 1W6LA 2VN3A 2ZG2A 5E6IA 1W8NA 2O5XH 3HE7C 4A7QA 3HUJF 4JVPA 5EOTA 1BLNB 1KB5B 3ZYZA 4KRPB 3BD4A 3UZVA 1S7UA 4AYMC 3S8FB 3P02A 3VRIA 1JF1A 2VR8A 2WTRB 5AVQB 3RFZC 4YFLF 1QSED 1CMOA 4UDTA 1P7QB 4TVUA 5CJ5A 4CILA 1IC0A 3VSQA 1PZSA 2GSIA 4YMPA 4WKZB 4K23H 1F3DJ 2PPFA 1T1WA 3JV0A 4XNYH 4HOZA 4DKFH 1ETJA 4CADB 3ZHLA 4L8BB 4RRPA 3ULVL 3P3YA 1I9IL 5ID0A 5JPNB 2CLZA 3CZJA 4N8UA 3SCMA 1E4WH 2KDYA 1AG6A 3SKNA 2K4AA 3HPJA 5FM8A 3CD4A 4OCMC 1VLXA 4UT6A 4M6MH 3ROOA 4G8GA 2ZD0A 1TG8A 5FFOA 4AJWA 4GKSB 1ZT1A 1AAJA 1HC1A 1A0QH 3B9VA 4GG6A 2DWDA 2CHNA 2X4SB 4J27A 2VE6A 3TCXA 4BYHA 4H0GA 4V2BA 5I74B 1GH7A 1QW9A 3DUSB 2D3NA 3U7YL 5CR1A 2QFRA 3UC2A 4PLOB 1X3DA 2P49B 2VN4A 5DGRA 3ECWA 4DUWA 4X5QA 5D9SA 2HX8A 4OZFA 4XPFH 3PAVA 1HXMA 1KEGH 4QRPA 5CZVH 1JNHA 2OMNA 4XO8A 5FF6B 5H94A 5T3XH 5FLUA 4Y1AB 3VGAB 4N24A 1HCVA 1L3WA 1KNOA 2WJ5A 4AGLA 3MCKB 3BUYB 2ZUVA 4TUJB 4U2YA 3ISRA 4DFIA 3UBXI 4LP4A 3S98A 4MA3A 4WGVB 2A74A 2NXZB 3HIZA 4YUEH 5LKNA 5KSUA 3O9WC 4WJ5A 4MCZB 3K46A 2E46A 5IQ7H 1CXEA 2OCJA 3C60C 4MDIA 1QR1B 3BWSA 2P80D 1QRNE 4A6YL 1FG2A 2RFXB 1WA0X 4HUXA 2C9XA 4LCUA 2H0PA 1E43A 3G6AA 5E99H 2J20A 2VLRD 3RDTA 2DIBA 3FYEB 1BF2A 2EUZA 1ZLEA 4DP4X 3VFTA 4Y2NA 2YXFA 3KH4A 4ODXA 4QEGA 3VM5A 5DDHB 1NDMA 3M86A 1NUNB 2H3XC 5BW7C 1BMWA 4QCIA 2F5BL 5DT1H 1EAQA 4IOSA 3VFNB 2WLYA 3JTSB 2UX6A 2XPGA 4OAWB 4Y88A 5KVEE 4ZNEA 4YHLH 5LCVH 2HKHH 3LNIA 4RGMC 2QKIC 1S7XB 4XGZB 3UTTB 1P5UA 2DQUL 4ODHL 4W4NA 4POZC 2XOTA 1Z0NA 1BZ7B 5E03A 3X13B 1S3KH 3GMLB 1WZKA 2YOCA 3BSZH 1TZ8A 1UXWB 3DBSA 5DZ9A 1OAQH 1PU0A 3U48A 1GZPB 2Y6TE 4JRYD 2FHFA 4Z7UF 1NCAH 2FJHA 2WINB 1KENH 1FIGH 3QUMH 4MMYB 3BKJL 4QYOA 1I9EA 3BO8A 1OLZA 1BAGA 1PEZA 2VDOB 1HZHH 3LPFA 3PFQA 2XKSA 3PWVA 3WJMA 2MQ3A 1AGEA 4L37A 5F88B 1BOYA 3RAJH 1XR8A 5DD5H 1BQKA 4OB5H 1O5DT 5DWPA 5KUMA 2XZZA 3IN2A 1SMDA 4OJEH 3WYRA 3H2PA 1H8LA 4HZ1A 1E8WA 2W8CA 1PZCA 2V8LA 3CBKB 1XD0A 1KTBA 5BZDB 4OZGE 3ZDXE 5A43C 1VESA 3FFOA 1AXSA 2VDMB 4U1MA 5FUZL 1OW0C 4LOVA 1S9XB 4X4MA 1T89A 1NEPA 3EO1A 5IUCA 4J39A 4U6VH 4E9SA 1MHHA 5E6SB 1QNZL 2IBBA 4P9HH 4KKRA 1RSYA 4Y8AA 2FX9L 4HOWA 3JYBA 2UY6B 4N9OB 3WNIA 4D9RE 2D2OA 3VSUA 1CDIA 3P9MB 5IHUL 1MJJA 2W1NA 4GXVH 3QDMB 4ODWB 3EADA 3DIDA 1AHWB 1R17A 4GW5B 5EEVA 4AYSA 2A77H 2FJHB 3AWFA 4PI0A 5L0QB 4JM4H 1MREH 3VD3A 1O6SA 5L2KA 1WZMA 1TTRA 3ALPA 4LVNB 5HGAA 3EYVA 3QJSB 5GJSL 3CVHB 3GMLA 5LQBH 1SFHA 3MMEB 1FN4B 2HX9A 1OM9A 4F7PA 4RQQA 7CGTA 2J56A 1RP8A 3ZW3A 2GFBA 4M5YL 4F92B 1FFOA 2ZX5A 4PUBL 2DJ4A 3LEYL 1EZSA 3QJXA 1U3YA 2J88H 2IOIA 2VIRB 4WEUD 4YE0A 3TVMC 4Y4FC 4YBQC 2RA1A 3KYMB 2HVJA 4C56A 2BSDA 3CN1A 5I16A 2BDNL 1DJWA 2VXTL 3MRNA 4IEFB 4JRFA 4KMTL 1CTNA 5D7JD 2D9QB 2EO7A 5IVZA 3HC2A 4JFZH 3IU3B 3DOHA 1IL1A 4Q74A 3ZDZB 4F58H 2QR0B 3OR7B 4HSQA 8PAZA 3FQ1A 4HKJB 1HKFA 1JGLL 1ND0A 3WXWL 4XCEB 4PJEB 2YKLL 4K5NA 5C0NC 4HC1A 4FQ1H 4OR1A 3PCYA 5T1LB 4GEJA 3UC0L 32C2A 1ECZA 1RH8A 3OL2A 2GPZA 1A7QH 4IBUA 4JVUA 3UO1L 5EO0A 5EOCH 5FDYA 1HHIA 1OTUD 3MJ8A 2OTPA 2WGXA 5CXPA 3V0GA 2WKGA 3NPSC 2IWEA 1EXHA 4PJCF 2NW3B 1ZGLA 4M6AA 1RI8A 1WT5A 5DA0B 3PDDA 3MCG1 2WVUA 3L95B 2K8MA 1MFDL 2DQHL 3OKYA 2WXRA 3HCVB 4HX1A 4DPRA 5DI8A 43C9A 3M46A 4TSBH 3W0WE 1JZGA 2Y06L 2IDSA 1RK0B 3FN0H 5CLTA 4P2RD 1XB6A 4UNVA 1K5NA 4JFFE 4XXCA 1RULL 3L3OA 4BFRA 1GCYA 3VCLA 4JQXA 2FJFA 5AAWC 1WPCA 2JQAA 4WI7A 2BZCA 3LKOB 1UWXH 3KYNB 3MLYL 1ILSA 4LIQH 4MHHG 4OF8A 1S9WA 5FUCE 4G8GB 3PHQB 3WFDL 5DD1L 4BSVB 3HHSA 4CBZA 1Z2KA 2I27N 5B1AB 2EYTB 4LRNH 5ILTH 3V5HB 4F37K 1BM3L 1XF2A 3D7PA 4XMUA 1JXKA 2YMXH 1ZTMA 4FTVD 2CBMA 2QGCA 5D93C 4LSSH 5EZLB 3T65A 5FW8A 2NY5L 5K9OA 1HSAA 4ELKA 1IILE 1BEXA 2HT4C 4UB0L 2VH5L 1IAOA 3HC0B 2C9UA 3JYCA 3PXJA 5AG9A 4F33B 2XT1B 1FV1A 1WTGT 3BUQA 3HFMH 2YUVA 1UA6L 4IJ3B 4N2IA 4S1SL 4D0BA 4Y2DD 1NQBA 2ARJA 2YIHA 4OLWL 4X5LA 1MEXH 4JKKA 2R29L 1XX9C 4AC4A 4PJBE 1A65A 2NY6B 4MNGA 1ZLVH 5B21A 1M7UA 1BF8A 1G7PB 5D7JB 1INQA 4TNVF 4AGQA 2YD9A 1H3WM 3BUPA 4YBLC 2ZOKB 1S9VB 3FFCD 3SDYH 2PR4H 3H6AA 2OXGA 3GXDA 5F7KC 2AJ3A 3DGGA 3AROA 1P7KB 2EIBA 4AJVA 3BFWA 4KTDL 1U91B 3L7FB 1IIIA 4NKIH 2FATH 3OC8A 5ENWB 1OAUL 1KDIA 4MD0A 4DO6A 5I0WA 4RWYL 4GAAA 4G8EA 4HHAB 4QD2E 3GS0A 4KDTA 3CSYA 3LH8A 3UTOA 1E40A 2WY3B 5EDXA 3IXAB 2ZX6A 3VFWB 3OKDA 3SJVB 1WO2A 5EOCL 2AMUA 1O7SA 1C5BH 2RCSL 1X5FA 4QHUA 5DHYA 3E1F1 1MCPL 1GS6X 1ETZB 4GI8A 3RGVD 1NCBH 4K8RH 3VQ2C 2UZIL 3MJGX 1R3KB 3MOBH 3APNA 1BFOB 3OB0H 4BA8A 1CFQB 5C0DA 2RMNA 3U6XS 2OP4L 5HHQB 2HKFH 5DMKA 3RWEB 3AS2A 1A6PA 3NJLA 4NT6A 2OMWB 4HXBL 1NBVL 1F58H 5F9DC 1T1ZB 1PY9A 1CG9B 4X42A 1CT8A 2JELL 4TUOB 4ERSH 3DSNA 1OP3H 1QSFD 5AZEH 2BNUB 2WQRA 4AM0Q 4I3SL 4HYTB 4F91B 1KV7A 4GG6E 1A47A 1BYOA 5DWUH 1OB0A 3NVQA 3AGWA 4M1CD 4FAAB 3NCFB 2Q1EA 4NENB 3ARGB 4P59H 2YR3A 3T2OA 1ACYL 1FHGA 3T8XA 4JDEA 2YN3A 2HWZH 2EDNA 1TQCB 5DRNA 2MSPA 5DEGB 4QAMB 2XQ0A 1UM6L 1W9XA 4QIRA 5FKPA 4CSPA 5EN2A 3A23A 3WNLA 2YAEA 3FH8A 5BV7L 1QEWB 1E28A 2F0CA 3F12B 4GXVL 1C5CL 4FE9A 4HQQL 4HWBH 3RY4A 3U1PA 4NFDA 3LKNB 1KJ2B 5AW7B 3W38A 3QFDB 4E5XB 4UQ2A 4XCNA 5KW9H 4ABUA 1CF1A 2DQTL 3FUIA 2WJ7A 1ID2A 3NFSH 1A6UL 4GUPB 2ZX7A 4H20H 3HPLB 4KX7A 2BSSB 4Y16B 1MFEL 2IPUK 1W8OA 4EN3D 1UT9A 1OTSC 1GTFA 2Q10A 1NBCA 2X41A 4TM9A 2X9XA 5IHZA 3IF1B 1J86A 2WVVB 5DEFA 3L3JB 5LAXB 3MLUH 2I7OA 4LSQL 4Z7QF 1NOFA 3ZE2F 2PNDA 2NLJA 3VFOA 4BSJA 3TURA 2JCCF 1LP9E 2E6JA 2QR0A 3OR7A 1SYVA 3WU1A 3QRGH 1WCQA 2ZOTA 4LLVB 1HDMA 4DPCX 1SM3L 2O4EA 2OX5B 3BH8B 3CZLA 3OAUL 3KL5A 3QZWB 1A1NA 4IEFA 4X4ZA 5JW4M 4OM1H 1DJZA 1U92A 3BKML 5GRVL 1LEIA 5FUOH 5SV4A 4PGZA 3L9EA 5DVLA 4PJFB 5I9QB 2OFQA 3SGJA 3GJEB 1E3FA 5EIQA 4AL8C 3R06A 2YEZA 4R3SA 5C09A 5BJTB 2OK0H 4Q97A 2MOGA 2VXVH 1BVLA 2H9GA 4S1QL 4XZUA 1LWRA 2JB5L 2IPTL 2N59A 3WDIA 1OK8A 3G6JA 3MOAL 4JDVB 1NFIA 2XRAH 4YHNB 4GKZB 1NEZG 1F45A 3NA9H 1PYWA 3V0FA 2XA8L 1JV2A 3FL7A 3GIVB 1HINL 1NEZB 4LU5H 4DT2A 3FQTB 1GS8A 1KOAA 1QLFB 4XNMB 3REVA 5I76A 2FHCA 5E1HB 1XHHA 5GZNA 4TRPL 4RWHA 4HLEA 1IU1A 1HS6A 4XMWA 3QO1A 3IE9A 4NZ8A 3RVUD 5BRZB 4OT1H 3DXAA 4P3CL 1QPPA 1J1PH 1XCWA 1T83C 3QXTA 4APQA 1LD9A 1KCVL 2X70B 4G7VL 4J3WA 4YDZA 4BZ2L 4EO5A 3OAUH 5C07D 2LTQB 3IGAA 3GMOB 4MQTB 4KQ3L 4K7FB 4MA1C 1G7LB 5ISZA 4GEIA 4JJHA 2ZSVB 3DVNA 5IK3A 4D9LH 1MQKL 1TCMA 1XF5A 4L5FL 3O9WA 3OKEA 2VT0A 5D4JA 1TQTA 2YPVL 3C5ZD 1MCOL 3MAWA 3FONB 5MEQB 4NN7C 5HI5C 1FNGA 4CC0A 3QAZC 4GMTL 1MLBA 3UCRA 2MRYA 4NO5B 4HUWA 2LW3A 3NJHA 1E4XL 3RFZB 2BY1A 4NZUL 1J0IA 3ZTNH 3HBZA 3VACA 2JK5B 2X1PA 3MKKA 4KKBD 5JQ6H 1AD9A 2EIDA 2VSMB 3DDGA 3A4EA 2BHFA 5J11B 1B4JH 5D2LA 3W81A 4KROB 4Z7UE 1HH9A 1XCTB 2WW8A 5DJAB 3BWUF 3GPSA 4XP5H 1B4RA 3K6IA 3PUCA 1XIWA 4TTDD 35C8H 1AZNA 4P46B 5BUAA 5FA3B 5B38B 3Q43A 2APBA 3H9SD 3SKUD 4ZMXA 1WVZA 4JY6B 1I9IH 4M93C 3U9UA 3VFNA 5A6IA 4QRRD 3DIFB 4OLYL 2NNXA 2FO4A 2K6WA 5IF0B 4H8VA 3ARYA 3HZMB 3D69B 3K6FA 3QDJA 2DQMA 1NDMB 1SRDA 4IBVA 5HYSG 4O2EB 2NTFA 1A7NH 3ILDA 1J1XH 3KLHC 1QP1A 2F1EA 2Y4SA 5C3LD 4MGXA 4NX0A 2Z7YA 5EA0L 2HJKA 3BXNA 4MNQD 5BRPA 4M8RA 2VM3A 2YA2A 3CLFL 1XGYL 2YLKA 1JS4A 1OAXH 5DMGD 4QR7A 3TBCA 2AV1A 3CH8A 3MLXL 1AGDB 1QR1A 4QLWA 2F58H 4Y9BA 5KVGH 1BP3B 3LIZH 1B6UA 2QGEA 2Y36H 3C87A 4NRZA 5HJ3A 5TE4H 2OYKA 4E9YA 5ABAA 4PVBA 4BQ6A 2VMCA 3BQUB 2WXGA 1I1YA 4MS6A 1G6RH 4R9HA 2EECA 3FF7A 4WUKL 3C09B 3MCLL 3PWPA 1M1XB 4N8VG 3ZQ9A 1MI5A 5HDQL 3QAZB 2GHZA 1A22B 1JXGA 1GRWA 1U8LA 2YGQA 4D94A 5C0FA 2OL3H 3E6HA 4Z3IA 4WU5B 2PTTB 1JFHA 1J48A 2ZICA 1J8HA 1HXKA 2DMBA 3NIFB 3OJDA 3V8OA 1T22A 1WZLA 3S48A 5JORB 2X9WA 2BWDA 2Z35B 4JW3A 4NDMB 4R4BA 7FABH 1JHKH 3Q8FA 4P3WA 2R2HB 5D2LB 2XQYK 3U83A 3D39B 4OGZA 4XTRC 3QUKA 1OAUH 2YPKB 3FT0A 4FFVC 4KK8C 4OLUL 4KTDH 4ZXBB 4J5VA 2F5AH 5AW2B 4I87A 2R7EA 3VDAA 3NPZB 2X1XR 5TDPA 1QLEB 5I6MA 3U82B 3HRPA 3O6KL 3L16A 4AVIA 3U46B 3KGSA 1OK0A 4X80L 5EMYA 3SBWC 3FPXA 1IV8A 1R0AL 2YLHA 1BZ9B 5E6IC 4LDLB 1BX2B 1NKOA 4QGTA 4KKPA 1OAXL 5CSBA 2CPUA 4HP5A 3HC3L 3LEXB 1UFGA 5DK2A 2OMTA 2PXYA 1CBVH 1FJ1B 5D7IF 2WMPB 3WV0A 1OP5H 1FSKB 2NSMA 4ZD3L 3I75A 1E6OL 4HUKB 4DEPC 1BQ5A 4FN0A 3GXNA 4ABQA 4UTAL 5E2VL 4Z7AA 4W70A 2R2CA 3T2PA 5F3BA 3ECBB 3LQAH 3G6JB 1CLOH 2PW2A 4FF9A 4Y9FA 1XO8A 2WKLA 3PAYA 5ERWA 4F1SA 2BVOB 1G1KA 5EBLA 1XIWD 4HV8B 4H5SA 2WLNA 4Z1PA 1FLRH 1CK0L 5DFVC 2IQAA 2V0AA 3ARBA 4Y89A 4K5LA 1XH3B 3EIFA 3OF6D 1WQVT 3ARDB 3QG6B 4FNTA 2LU3A 4HFUL 3RDJA 2L4OA 3GNMH 4FP8H 3EH4B 2DWTA 2BWQA 4DUXA 3D2UB 2ED6A 1WICA 3LKRB 3SZKC 4LAJH 1MFAL 4QHNA 3S37H 3GFUA 2Z93A 4N4YB 1YJDC 2OX5A 1CVRA 4LPVA 4JM2D 4N0CC 3RA7H 3I85A 2X0WA 5D6DA 2D3JA 4XHJD 3IAPA 2WXIA 4BFGA 2RIKA 2WXHA 4POUB 4GB9A 3ILEA 4P04A 4G1EB 5EU7C 1AI1H 2B1AH 1MCSA 4OCRH 1UG9A 4JFPA 1XF4B 3N42F 4Q9QL 5K39A 4DVRH 3MR9B 3O2DA 1U8MB 5EG6C 4IKIA 5DJCA 4NEHB 2IQ9H 5ECJE 5DVOA 4HDIA 1SJXA 4H0IA 3ULUL 3LNHA 4GG8A 1JI2A 5I1IL 1J05B 1CDHA 1QSFA 3HRZA 2CA3A 4WWKD 3CG8A 3B2PA 2ZYHA 4GH7B 2G60H 2BSED 1QABA 1CTMA 2OSXA 5A2BA 4DEUA 3U2JA 2R7EB 4Z7WE 4ZXBD 4NQSA 4ZS7H 4Y9GA 2Z1PA 1JGLH 1X7TA 4U1SB 3SBRA 2XA8H 3OSVA 2BJML 2IWKA 2E6QA 2BSEA 1HFUA 2OW7A 5HHXH 3RI5F 1IEAB 4B3VA 3QUZA 3TN0A 4B60A 1W0WB 2J25A 4PTTA 4OZFH 2ADJA 3DMMA 4JDZA 5CJOH 2ADFH 4AM0A 1SJEA 4BWTA 5AB0A 2QQNH 2FIKA 3BIKB 43CAB 2UUDK 4GKLA 4P4KA 4YE4L 1BQRA 3P69A 1RHHB 4WW1B 4PRHD 5BS0E 2YAHA 2AJXL 2WQSA 1JCKA 1EEZB 3DGDA 2IJ0C 4QRRB 3IPEA 1T1ZA 4O02B 2WVTA 2GTZA 3BUIA 5T1KB 1LEKB 4U1JB 3BQUA 3UBXG 3FFCE 3ZU8A 5IJCC 2DQGH 3FT1A 1QZ1A 4KJPC 5HI4D 2V5YA 3WLWC 1DVTA 2VYRE 4N87A 5E2VH 3KLHD 4AYFA 1YUKB 2IANE 1QSFE 3DSNB 1BWWA 3NG5A 1A4JB 2OQJA 4LHQB 1PIFA 1KLFA 3VRLE 1MFVA 2G9HA 1IM9A 1FYTE 1ZVYA 2AJUH 1FAIL 5A3IC 4MQXC 2YS4A 5T1LD 2YAMA 4XC1L 2C4FT 4BZ1A 4O2EA 3NIFF 1GY2A 2NZ9D 2FWSA 4K0OA 3RPKA 4P5MB 3QJZA 5EHFA 2Y1ZA 4LVEA 4LASL 2DDQH 2CM6A 5CD5D 3PJNA 3P2BA 1YECH 3HE6D 4HHAA 4MAYB 3BLBA 1AQKH 2JLPA 3IDNA 3GSVB 5LDSA 3GMNB 1AC6A 2F8XC 4M6NH 5TE6H 2GEQA 4NQXB 2AEQL 4I89A 1CLOL 3DMMB 2KHAA 1I9JH 4JDZB 5KYWA 4NXSA 3U2SA 5HYQA 2XYCA 3DO3A 3FO0L 3OGCA 4YXKH 1F42A 2CO6B 3CIQA 5DJXA 1CD9B 3RL1A 2R1YB 3CZUB 5CWSB 2G3XA 4GBXA 1B0GB 3UG3A 1RIVH 5F6HI 1E6OH 1N5AB 2FEEI 1S7TA 5KVDE 1SHXA 5E08L 1OCZB 1QYGL 3HAEB 3MGOA 2PUQT 4LOUC 1T2QL 1SEBB 3RVTC 4HCRL 3MJWA 3QVAA 1KCUL 4WFFD 3N85H 3LQMA 3LQAC 4FDWA 1MCJA 5C0AB 1FC2D 3SY6A 4QLRA 3PG2A 3PP3K 3STLA 4FNLL 4YSDA 1EMTL 4CL7A 3L9BA 2AK1L 3RFRA 4ZO8A 2AXGA 1G6RL 3LRLA 3TJHD 3FOMA 3QWRD 1Q9OA 2IBZX 3X1GA 1J5OL 1LEGA 1KY6A 4BH8A 3WN5C 5HYJB 3DROA 3R4DA 3K71A 1IKOP 4ZDHB 4I48A 3MVSA 5C2BL 4B9GA 4BM7A 4D3CH 2BM3A 1D6EB 4PGBB 2DRUA 2JKJA 2HH0H 2E27H 5IQ9A 5KS9F 5CF3A 3PGCB 5JR1H 1JHKL 2KPWA 2I60H 4CNIA 1G6VK 1H5BC 2DBJA 3ET9F 3KYNA 3CHRA 2OMVB 1Z66A 4KDTC 2R56H 3V7AG 3BUDA 4Z0BL 1B0RB 3L3OB 2NYZA 3V4LA 5I1CL 4OLXL 1N4XL 3HHSB 5EOQL 4P5TD 3LTVA 3QIWB 5DS1A 1DHKA 1OKEA 2HMID 3T2LA 2YOAA 4J3VA 4H5SB 4YNYB 4DP2X 5ISZD 1KIUA 1G9HA 2FGZA 5GGRB 1AOHA 2EVFA 1FZMA 3KJ4B 3L95A 2RH0A 1BFSA 3OLDA 1NFDB 3ZX1A 4N5ED 3EDJA 2EDJA 3B2UD 3MV7E 1X4ZA 1WS7A 1QNIA 2ZUSA 3FMGH 3W9EB 5D72H 2GK0B 5E0FA 3AY4C 2NR6A 5I73C 4NOFA 1KV3A 4YGVA 2EXYD 2OBGA 1EO8H 1IEBB 4RDQF 3HFML 3L17A 1DQDL 1KJVA 2B0SL 3CUPA 3QORB 4MA8L 5JO5B 3WUZA 1J10A 4WW2C 1NOLA