2XETA

Conserved hydrophobic clusters on the surface of the caf1a usher c-terminal domain are important for f1 antigen assembly
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
89
structure length
89
Chain Sequence
GGRLFLHLKRSDNKPVPFGSIVTIEGQSSSSGIVGDNSGVYLTGLPKKSKILVKWGRDKNQSCSSNVVLPEKTDISGAYRLSTTCILNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords F1 CAPSULE-ANCHORING PROTEIN
publication title Conserved Hydrophobic Clusters on the Surface of the Caf1A Usher C-Terminal Domain are Important for F1 Antigen Assembly.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Transport protein
total genus 20
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13953 PapC_C PapC C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2070 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2xetA00
4J3OD 2XETA 2KT6A 3RFZB 3L48A
chains in the Genus database with same CATH superfamily
1I3RA 1SJEA 3FW6A 3FSZA 1A6AB 1OAKH 2XG4A 5IQ7H 3MCLL 4PYGA 4Z95L 4JFED 3D85B 1ACXA 3MMEB 4RNRB 4G6FB 4F33B 4K7PY 3FO0H 1T2XA 5D1QC 3O45B 4WGWB 1S7XA 4OVVA 3MV7E 4Y2DC 1A9EB 3O6FA 3O6KH 3S3BB 1KCLA 1AR1D 3PLYA 1U8QB 2NY1D 4MQXD 4LRIC 5D1QB 5D2NA 5I8CB 3AM8A 1MG3C 1U8JA 4Y2DB 2J1WA 1EEZA 4JW3A 1NEZG 3K8MA 5PAZA 1AD0B 2QTVA 3L81A 1OWRM 3HNTH 2PCXA 4CMMB 5KZCD 1ED3B 1EHNA 3I50H 3VMNA 4GRLD 2VWEE 4PB9H 1MCFA 3NYKA 4NM4L 2CBQA 4X2UA 2NCEA 2VL5B 4JDEB 1PDKB 2V2TA 3Q6GL 1OAYL 3HG1D 4FQIH 2VSMB 1HILB 2XC8A 4HUCA 4QRSA 1MPAH 4GP5B 3T77A 5CEZE 3MYZA 3QUXA 3CBRA 2Y7SA 3BN9D 2Q7YB 43CAA 1ZSHA 1OE3A 4LHUA 1JZ7A 5D7IB 5IFHL 4E5XG 1WPCA 1G6RB 1SZNA 4NO2A 2YD4A 2WVTA 1WIUA 4DP8X 3OB0H 4LLDA 2BINA 4L1DA 1UOKA 2YC1B 4HEME 4IYKA 2F7IA 4FLOA 1BQ5A 1DDTA 3BP6B 2HX9A 4W9DC 5DJ0B 1FJ1A 4GXVH 3PXHA 1J88A 3O3AB 4CW1B 4N8PA 2IANA 4BUHA 4NKDB 5E1GA 4XN4A 5HDRA 4FP8H 2NMSA 2EVHA 1U6AH 1VZGA 3BGMA 3EYOB 3GSWA 4GP8B 5E6RB 4GINA 1T5XB 3BUYB 2XVGA 3FU5A 3SE3C 4IS6B 4XX1E 2AKRB 4B7LA 2R0ZH 3CQPA 1IT9L 1RFDH 1UXLA 4LCIL 3VGHA 1OK8A 4LCWE 2HA1A 4E41D 2ZOKB 2XV6B 3SDXE 3D0LA 3GM0A 1AQKL 3FOMA 5D1XC 1GSMA 2ARJB 4ODHH 1KCSL 1MHCB 1EDYA 4W93A 3QWRA 4OD1H 3HE6A 1UGNA 3IJ9A 5AZEH 2EVJA 4P9MH 4Z7WE 2IQAA 1FE8L 3C5ZA 5D1XB 3WU1A 2VZOA 4YQXH 3GSXB 1J8HD 4WO4A 4NUMA 4YJZL 1XGZA 2EH7L 5B1KA 3FS9A 5IJCC 4QTIH 2IQ9L 3UTSA 1AHMA 1TTUA 2FRGP 1CU4H 5T3XL 3S5YA 3WIFA 2GTQA 4M1CD 2GT9A 4IHOA 2FQGA 5D1ZD 1IM9A 3NA9L 1S5IL 4HSQA 1TFPA 3U79A 3A6OA 5JUEL 2AEOA 2W0FA 1HOCB 3RVVC 5IQOA 2GJZB 5CD3A 5DVNA 4P57B 4UTAA 3RIFF 1KB5H 4F5CE 4L8CA 2G75A 3ILDA 3L08A 4OJFL 1BFTA 1WG3A 3R0MA 3CN2A 3RPIA 2F5AL 2AJYH 1DLFH 4DQOH 5D6CB 1KXHA 4N6QA 1B6DA 2FSDA 4Y9EA 4OLXL 1FORL 3SDAA 1F6FB 4A2GA 1KGCE 5DDHA 1WFUA 2P5EB 5C07D 3ZIYA 1CDYA 1KJ2L 2NTSP 3B5HA 2JCCA 1F90L 4D7PA 2VDKB 5FECA 3UIZA 4NI3A 1FFOB 4LARL 4HWNA 2G5RA 4XC3L 5L2JA 2MPAH 2WBJA 3AAZA 1C5BL 3MRQB 4G8FA 4NHUA 1Z32X 3OQ3B 3T0WA 5B39B 5BO1H 1KXVA 2YRPA 3B7TA 3PHAA 5LLIC 1OAXL 5C0DA 2K6YA 1Q9OA 3FN9A 5E8OA 3MUGB 2PYEE 1L4IA 4F1ZA 4FQXA 3RX5A 2X4QB 1MQ8A 5IW6B 4NZJA 5IROD 1K6QL 3E7JA 2G2RB 4UM9A 3ARVA 3HRPA 5I2IB 1UM4H 2CRYA 1KGYE 3LHPH 1CI5A 4P3CL 4MAZA 4I9WE 3UPRA 5E2TL 2W9EL 2B59A 2ZX8A 4MSWB 1CBJA 4KI5D 2Y3NA 4G8EB 4M6AA 3GZQA 4AQAB 3BEVA 1K4CA 3MROA 1YYMH 4LFHD 1QHQA 3ARTA 4F9LA 1SBSH 4XNDA 5L2KB 3TN0A 1K5NB 4YNYA 3RL2B 2AV7A 4MJIA 3WKYA 2BMKB 3OLIA 4X6CB 1T0MB 2CR3A 3BT0A 1IRAY 4DJMA 4EIZC 2BNRE 3GS7A 1N19A 3N6YA 1FNAA 4Z7VE 4I0PD 5HGDA 4UQDA 5TK4A 1PAZA 1DQDL 5KSVB 1A4JB 1QKZH 3ZW3A 4YHZH 4BUQA 5GGUB 1XBRA 4HPOL 5BZXA 1CGXA 1UT9A 5KSBF 3D4YA 2FO4A 4WSKA 1JN6A 5HYJE 3SBWA 2F54A 1MXDA 4IRSA 3BIAX 4F7PA 3CFCH 1ORQB 2QPUA 4KJQD 4ZOCA 5LNEA 1ZLVH 3D5OF 5CJXA 1P6FA 2WNWA 4P5KA 4AEHL 5IF0A 4JNXA 2Y6SD 2QADC 4NO5A 1G1OA 1AFVH 1IE5A 2RQEA 3ARXA 4NXSA 2MCMA 4U1JA 1HZHH 2BJMH 2KZKA 4JFEA 4LOVA 2QADB 4LT7A 1MLCB 2BNUA 3EJYC 2XG5B 5FM8A 2HG5A 4E9QA 5JOFB 4TUKH 1N3NB 3CE1A 4PS7A 4EUPH 2ED6A 5EEUA 4O02L 1RVFH 3PREA 4LAQL 3RWCB 3C6SA 3OXRB 1LD9A 5CP3A 4HJGA 2OXGB 1B4LA 3LZFL 4NZUH 4HIJA 1QSVA 2P7TB 4FTVB 1JRHI 6PAZA 2HZHA 2HJLA 3VFRA 4B9CA 5F9OL 5HJ3A 4ZNEE 4TQEL 5F7LB 3S35X 4Z76B 4XBGA 3OKNA 4BQBA 5EOTB 2DQGL 2VJ8A 2B77A 4GRLA 4TOYH 4LSTL 1N7MH 1QLFB 1MCOH 4CNIB 5TE7H 1OT4A 3T2NL 4Q97A 3HG1A 1HC1A 5CEZL 5D7KD 1QUNB 3QJQB 4AQ1A 2MTAA 2ZKWA 4FQQB 5DD6A 4A7VA 3PWPB 4GAJH 3KGSA 3TA4D 1S9VB 4HOZA 4HJEA 4FZEL 4M5ZH 3BUBA 4KNSA 5AALA 3F7LA 1V55B 3VD1A 4GEJA 2EABA 2O72A 1EFXB 2W59A 3ZDYB 5C0BE 1T1ZA 2VDMH 4Q9QL 1VFBB 3IDMA 3C9NB 3KPPB 1GVIA 1OLZA 1RL1A 3C75A 4NKMB 3LQAC 4JRYB 1TQVA 4PRNA 4GIPD 5FO8B 5KBNC 1I9RH 1G1KA 3FQWA 5HGHB 4M7LH 4XNMA 5JORA 1CD8A 2F1AA 3MRNB 4UT7H 4Z7NB 4H88L 5DD3L 5CSZB 4G11A 1YEHL 4N0FB 3A3YB 5BVPH 3MV8E 4V33A 3J27A 1NMAL 4WTXA 4Y5YA 4E41A 4XNBA 5DJAB 1KCVL 1BOYA 4KV5F 1LDPL 5HVFB 3QCTH 1UC6A 3MACL 4IBTA 1L9PA 2KQNA 2QMJA 2HN7A 1SY6L 2BP3A 1OZTG 4WFED 1A7BA 1AE6L 1HE8A 4ZD3H 4BA0A 2XPGB 2ZKHL 4R8WH 1QFPA 1J8HA 5TDPA 4HS8L 2GEQA 4QGTA 5HI3C 1OM3L 2UWEB 1M3IA 2DBLL 2QPFA 1YEFL 4AG4H 5EEVA 1X9RA 4L8SC 3ZHLA 4LPWA 5EZOL 5ADOL 2EDXA 4AW7A 4FMKA 4MVBC 1M53A 4NZ8A 2QSQA 4P3DA 2V5TA 4YFLF 5H4YA 1PY4A 1XCQA 4L8SB 4ODXA 5D1ZA 2BVUA 2XVBA 3CDCA 1DBBL 1TETL 5BO0D 4N2OA 3QZNA 1WA1X 1D3CA 4QUOA 2DIAA 1T89A 3RYMA 2BXZA 2D9QB 2EVGA 1F86A 3NTCH 4MWFB 4Z7IA 1L9MA 1IC4L 2XICA 3HCVB 4NQEB 4WO0A 1T3FA 5DTFB 3ULUD 2VM9A 3LRSA 4U3SA 4XO3A 3PNWB 3PS6A 4XI5D 3QIUC 1JZ3A 3MLYH 1N68A 2XJKA 1KBGH 3ASWA 3LPWA 4QT5A 4FKKA 4LOFA 4ZUVB 5C07A 1FRGL 2BIHA 4NWTH 4RAVA 3SCMD 3GUTA 2D4FA 2OJEA 2V17L 4N1EA 2WXKA 3QIUB 3VI3F 4RA0C 3CDZA 3HI6L 3MLZL 3S4SB 3U6RB 4MBRA 2YPLB 3PWUA 3VO0A 2K0RA 1QI4A 1XR8A 3V4VA 2Z8RA 4ZS7L 5DYFA 3N55A 3TBYB 4WTZA 4M7KH 1D6EB 4NPYB 1TEFA 4WV1A 4L0YA 4ZNCD 5IQ7L 2DI8A 1T6BX 3QS3A 1AANA 3ZYJA 4JREC 1FC1A 2YQBA 5IQMA 1T1WB 2MCPH 3B7UX 2DQMA 1GY2A 2CO6A 3FO0L 4WHCA 2CZNA 3ILPB 5IROA 4EBQL 2V7NA 1KXQA 3QEHA 4JREB 3IJ7A 1E9PB 3CFQA 1VFAA 3QXWA 3O6KL 2JJVA 2DMGA 1T4KB 5BRPA 4XHJC 4IBVA 3QDJD 3ZT7A 2BS8A 4UTAH 1VCBC 3N42F 4QGYA 4X80H 2HT4D 4GUOA 2VMCA 4LMQE 3U6XS 4OCXH 3HNTL 3LNGA 4WY7H 1JS4A 1ZS8A 1T1YA 3FO2B 3ROLB 1ILSA 3I50L 2NW3A 4I0PA 5ETUB 1P4LA 4OBSA 3D34A 4PB9L 5I17B 5IIEA 1QFWM 4XMZA 5LAXB 1FFPA 1PSKH 1I8LC 2VO8A 2JJWA 2WQSA 3PFUA 5FUCE 4KRNA 4DVBA 2XWTA 2AQSA 4FQIL 1MPAL 4KY1H 3L3HA 1UGKA 1M2VB 1U21A 1VACB 1A1OB 3R7QA 4G83A 1MJUH 1CDUA 2JMRA 4JGNA 5AW1B 2Y7OA 2EUWA 3QZWG 2OMBA 1KIRB 3BEWA 2ZIDA 2ZCZA 3S48A 2IJ0C 2X6AA 3WY1A 3RGVD 5B1CA 4U4BA 3GMRB 4GXVL 3VXSB 4O2FB 3DJTA 1VESA 4HXAH 4NUJB 5BVJB 1LYQA 4FYTA 4CAGA 1F11B 4FP8L 1JI2A 1U6AL 4MS8D 3ECBB 2WLJA 5D2NE 1IIIA 3X12A 1GYUA 3AW5A 3S3CB 3FDWA 2A6JA 1S7TA 1GMIA 1WFMA 2R0ZL 3C8HA 5CZKA 1EPFA 1RFDL 3EUDA 3FXIC 5FO9A 5EV7A 3KLAB 1RV6X 4MXQD 4OFDA 3B2UD 4ELMB 1LQSR 2EH8H 4G6KH 1KG0A 5TDNB 3VXPB 4ODHL 4RMBA 3IBEA 5IBTH 1R4XA 2YEZB 1C8PA 4G7RB 4KUZH 4OD1L 2X4NB 4UNIA 5AZEL 5GRWA 2D31B 3ZN6A 3RNQB 3KPMB 3P77A 4L4TD 4YQXL 2ZSVB 5JR1H 1PZBA 2PWHA 1MAMH 1IMHC 4LLUB 3QDHA 1Z5HA 4JR9L 5KVDE 1ECZA 3MKKA 4L5FH 2W60B 1S6NA 2I9LB 4OZHB 5SX4H 5HDQH 3HZVA 3EUUA 2FX7H 2AJZA 2PR9A 5DK0A 3FHEA 3H7BA 1CU4L 3S0PA 2IXQB 5F1NB 5C0EA 1E8YA 2SEBB 3JT2A 4N2NA 5FUZH 4FULA 3VE0A 4D94A 1RQ5A 1D5BA 4RSYA 3MRFB 2IANE 4NKQB 3LMJH 1HXKA 4GRWH 5KYUA 2ISDA 3AU1A 1KB5L 2RAMA 3QIWD 3AGWA 5AW8B 2B3IA 5BNXD 2UXVA 1MI5B 1FAIH 5CP3H 4DQOL 2VDNB 2VLRB 1GTFA 3GM8A 4Z7UB 2CD0A 2D73A 4KX7A 4BJLA 1RP9A 3QFJD 2K4AA 1I7RA 5DWPA 3BLBA 3D52A 2KMWA 2P8LB 3FU7B 5D7LB 1RMFL 4FXTA 2MNUA 3ZE0B 5HGBA 3PWLB 1MFAH 3MV9D 5K69A 4NWUH 4P2CG 3L1EA 2Y2YA 2JQZA 4PJAF 3WLWD 3GBEA 3P4OA 2MPAL 4LF3A 2RD0A 1EEYA 3LKSA 4GQ9H 2Z93A 1M05B 2F1BA 2ALWA 5BO1L 2Z1KA 1UWXK 3FQUA 1F4WH 3VB8A 3ARED 5EOCJ 1SDDB 3I02A 4N9GA 3QQ9D 3WLBB 3H4HA 1RJZA 4TSAH 1X9LA 3UACA 4CKVX 3UTSE 2WJ7A 1E3ZA 2OCCB 4ALAC 3OL2A 3K6FA 2BPBA 2NYYC 1QRND 3GB7B 4WCYH 3ZL4H 2EC8A 2G0LA 4YSOA 4Z1PA 1UM4L 2PLTA 3TYGH 4MNQD 3OJMB 1AD9A 1U92A 3LHPL 3MGOA 2EADA 2DQJH 3H9SB 3DA0A 5TDOA 3DGCR 3CU1A 3LX9A 1PX3A 4GO6B 3RURA 1SEQH 2UVEA 1YYML 5F89B 3BUDA 1SBSL 2HKHH 1QO3B 3H53A 2NUTB 3RIAK 4F91B 3O6LH 5F72S 2FHBA 5IKCB 1WAAA 3IMVA 4G7VH 1ZPUA 3RNKA 1XGUA 2DOCA 3BPLC 4YSRA 5I1AB 4F58H 1VADB 2QZ5A 2K70A 4MHHG 3VXOB 3RWGA 4Y8DC 1QKZL 2NXZC 4NKOB 3V5DA 3HPJA 2DQFA 1UATA 3BPLB 4JZOB 4YHZL 3SCMA 5B8CC 4G82A 3BIKB 4QHKI 2HVKB 1HSBB 4WFGD 1EX0A 2NXZB 5I6LA 3UOAB 5B8CB 3CFCL 3UDWA 3U4BH 4IEFB 1A66A 2J2ZB 4YIQA 4CKQA 2NY3C 1UQSA 1AFVL 3BAEH 5AB1A 1IM3D 3G9AB 3D6GA 1HZHL 2FJFA 1KTBA 2Y36H 3GSUA 4OD2B 5IUSA 2N56A 2NY3B 5GS0D 4QXGH 2L3BA 3JTTB 4U1NA 1KC5H 1NQBA 3NP3A 5DJ8B 4KK5C 1IC1A 4JRWA 1Q0EA 2I9TA 4QJ5B 4I1NB 4TUKL 1KBKA 3SE4C 3ZE1E 1RVFL 2AV1A 2WLZA 3F6IA 4TRPH 3VA2C 1ECYA 1NUGA 4NZUL 2ADIB 1GIGH 4J4PD 1MIEH 5E8PA 3QDJA 4AYID 5LVEA 4YSUA 4MJIE 5DJXB 1S7VB 3FQ4A 5EC1B 1HWGB 1AO7B 2ZUYA 3RLSA 4R6UA 5CILH 2Z9TA 4TOYL 2PPEA 3F62A 1N7ML 1I8KA 4XN7A 4X50A 1IAKB 1MCOL 5TE7L 3U2SA 3QDGD 3DOIA 3P0YH 3SKJH 5KSAC 5CS7A 3QJHA 4GH7B 5IV2A 2F54E 1KV7A 2RCSH 2EAEA 4PJGA 3F64A 3R8BB 3V4VH 4GAJL 3KPRB 2GBUA 4TN9A 4NRYB 3NCWA 2YJLA 2X53A 5KSAB 4M5ZL 4MAYC 1DUYB 1KTDB 3S9DB 3DO4A 5KS9F 4U1SA 1X5ZA 2VDML 4JFEE 1K2DB 4HUXA 4MAYB 3DLQR 3R8QA 3WE1A 3UYPB 3QDMB 1NDGB 1RZJC 3MYJB 1DLHB 3F01A 3RGVA 5I82A 4GT0A 2A77H 1UVQA 4G59C 2BP8A 4GRWE 3RVTC 1JK8B 4NQQA 1I9RL 3WNIA 3BAWA 4PWHA 4BRJA 5KW9H 4DESA 4A2LA 5DI8B 3RE0A 4M7LL 3VXUB 2JXMA 2WW8A 3P3YA 1BV8A 4UT7L 3ELAT 5DUBB 3VFWB 2DQ6A 1RZ7H 4MB1A 3GMMB 4RRPA 5BVPL 2P8PA 3NJKA 1MCKA 3NJHA 3WD5H 4U1MA 3EJQA 3KGTA 5DVMA 1OHZA 3JYBA 3NIDB 4UV7L 2JKLA 3ENEA 3UO8B 4NGHH 1UXMA 5I75C 3ZKSD 4PV9B 4Z5RA 4P2QD 5SWQB 3OJDB 5FGSA 3UYRH 5HYEA 5I75B 1KDJA 2FHFA 2TSAA 1KNOB 4PBXA 3HG1E 2YN5A 4L4TA 2HTKC 1AYRA 1N59A 4ZD3L 2CLRA 1XVSA 4R8WL 3KXFB 5IB5B 5KVDL 1MQKH 5T5NF 3IE4A 4AG4L 1BQSA 3IWVA 5G55A 3D85D 3D1MC 3US9A 3UG3A 3J8F7 1INQA 4G6FD 4UBDC 5DVKA 4PI0A 3WELA 1DUZA 3W2DH 1EZUA 1QPPA 5H37G 3ATEA 7PAZA 3Q5YA 1E5BA 2EECA 5D1QD 3AABA 3FONA 2RTTA 5ADPH 2FB4H 5I1KH 3NTCL 1HXYA 5I1CH 3QIWA 3WJLA 3GMOB 2BOCA 3GIZH 1JD9A 4UUJA 4YSAA 4URKA 1WYJA 3A6CL 3F5WB 1NCUA 3GTNA 4QYOA 5K9JH 4PYHA 2ZAIA 4PG2A 1ZSDB 2PWDA 3OAWA 1SVBA 4PS4H 4DGVH 4DQAA 3MLYL 4EF3A 1KBGL 3CSFA 1U2YA 3N91A 3QFJA 4M9OA 2FAUA 4WDIB 1ONQA 3PDOB 4NWTL 4E41E 5IVXA 5EBWA 5HD8C 5DYOA 3IGLA 1I1YB 2NQCA 3GLEA 1GYVA 4G8IB 5AKVA 2HMIC 2DICA 2W65A 1ADQA 1BD2B 1X3DA 3FN0H 4AMXA 3MV9A 4KKRA 3ISWA 1I7UA 1BZ7B 5JMRA 3ZTNH 3U0TA 2X2YA 5IHHA 1DR9A 4M7KL 4OZFA 3DVNB 4Y1AB 5ALBH 3TT3H 1J8HE 2GSIA 3KS0J 3MJ7A 4AGPA 3ARBD 3WG7B 3AREA 5I1LB 2A7BA 5AVWB 3H0TA 2MCPL 1U95B 1YN6A 1N67A 2VR5A 2R9HD 2OL3A 1QRNA 4PCYA 3GMQA 4PJIA 3IF1A 3Q01A 2VDQB 3JUYA 4JDVA 4MNQA 1B0RB 2BWQA 4X4XB 5AG8A 1ASOA 3QQDB 1DJZA 2K7PA 1RZPA 5F3BB 5E8EA 3U7YL 1B2YA 4PGBB 4PWGA 3V4PB 2B20A 4YO0B 5FGBA 4WHDA 2HFFA 4UTAL 4X7TA 3OKLA 4X80L 3GI8H 3L4UA 4PV8B 3Q5TA 1LEKA 4UTBA 4WY7L 1PCSA 4GI9A 3SPGA 4FFYA 2H0PA 3HC2A 2CO1A 1G7IB 4W6WB 2GCYB 1VFUA 4RVBA 1XFPA 3MOAH 3MJ6A 1BM7A 1YN7B 5EBGA 4KTDH 1ZLSH 3ZE2F 4OGYH 5D1XD 2BSTB 1H8LA 2CIKB 2WO4A 3UMTA 4QI3A 2X9YA 4NQCD 4ODTH 4KY1L 3WSQH 2BSCA 3CHQA 1MFUA 1NBZA 1JYWA 5A6MA 1MWOA 5D2LA 5KBMA 4HMDA 5JPNC 1D5IH 3EH1A 1A2YA 3L6FB 1IM3A 2HJFA 4NCC1 4PGJA 5JPNB 2PPDA 1O7VA 2J57A 3DIFB 5H94A 1YEDB 4Q2ZA 2FGZA 5F6HI 3CC1A 1H5BC 1G7JB 4AVIA 5BZWB 4HXAL 4K3HA 4KOCA 1KXQE 4QHUB 2BHFA 2DH2A 1RP8A 2EUXA 1OTSC 1EAJA 3WY2A 4AC4A 1AYOA 2VB5A 1H5BB 2VE6A 1M4KA 4N8VA 3QO0B 3DUSA 4KI5E 4HS6A 4MB5A 4PJFA 3SDDC 3WNPA 4Z7OF 3RVVD 5C8JB 3BSZA 4Z3TA 4M8QA 1ZV5A 4J4PA 1TZHB 3L3DA 3SN6N 1SMAA 3SDDB 1VAHA 5JLZA 3KWWA 5T5NG 2P5ED 1UWXH 3ULUH 2EH8L 4G6KL 4CN1A 2WWKT 4LEBA 1X7TA 2JKSA 1GXEA 4KUZL 3QYNA 5JHBA 6CGTA 4EDWH 3REVB 4HIIA 3L9BA 2WP3O 1QQDB 1E3FA 1RERA 5E1IA 5AAPA 4FL4C 1N5YH 1MY5A 1TVHB 3DHMA 5JR1L 3QDGA 1DJWA 2J72A 2FWUA 1MAML 4Z8FH 3HUJA 2XYBA 4FL4B 5IG7A 1RPQA 2OR9H 1SXBA 1XF5A 2CGZA 2CR0A 2QLYA 5HDQL 1Z5LB 2FX7L 1FL6A 4Y89A 4Q6IC 2PCFA 4NCDA 4PRIB 1ERNA 4FOMA 3W11C 5KUKA 2ZSWB 2ENJA 3EFDH 3L7EA 4B9KC 1CLYH 1ZDQA 4FF9A 2YUVA 2O4EA 3L3IA 3FT4A 5FUZL 4Q6IB 4HWZA 3RWDB 5JIIA 2IALB 1DVQA 4JFTA 3IJYA 2A2QT 3AITA 2DLTA 1AKPA 4OZ4A 4ZW5A 3LMJL 1EO8H 1TF4A 4W9CC 3DDGA 3DMMC 4X8CA 5L2KD 1A9VA 4PJBF 4WUKH 1FAIL 1TJIH 1EAOA 1EVTC 1CGUA 4ONGH 2WTOA 3DMMB 5CNHA 3VWJC 4RZCB 5K59E 2X40A 3LHAA 4YHIA 2GJ6D 3MV01 1ORSB 3E6FB 1FCCA 4PBWD 5E00B 4ZJ9A 1ZVHA 3VWJB 3N85H 4J8RA 2K7QA 5C2BH 4MTMA 1QSEB 3CVHA 1MFAL 1E9OB 3NCXA 3P54A 4NWUL 5FWQA 5F93C 4IJTA 3Q3GB 4P2QA 4Y4KC 4K5OA 2Z7ZA 4ADJA 5L0QC 5LNGA 1YEIH 4Q89A 3DSNA 2JF1A 2D0GA 2J73A 1AJ7H 4GQ9L 2EIEA 2UX7A 5F3HB 4XMUA 3QXTA 4HPYL 5D7KE 4Y4KB 5L0QB 1F4WL 1A6AA 5DRWB 3B8YA 1TEYA 2WIIB 4TSAL 4G6AD 1EVUA 3D85A 2QADD 3I6KB 3MMEA 4RNRA 3NESA 1LVEA 4WCYL 3V6BR 4B97A 3ATAA 2WQRA 1RK1A 5ID0B 2EQDA 2NY2D 4I88A 2DQJL 1A9EA 3BVVA 1IJNA 4ZW8A 4DP2X 5B1AB 5I1DA 1SEQL 3MCG1 5I8CA 5D1QA 2GY5A 2HKHL 2BIPA 4GW5B 1DSFH 1E40A 1HOEA 3O6LL 1AIZA 4RLDA 3BP5B 2C5DC 1AVAA 4Q7DA 4LRIA 3AROA 1VFOA 4G7VL 3NJIA 4PJ7F 4F58L 4YSSA 1GKOA 4JEGB 1LP9B 3FO1B 1ED3A 2QLVB 3X13B 3GD1C 4F1SA 1FG2B 2VL5A 2A74C 4JDEA 1PDKA 1PF3A 5ANMA 43C9A 1IGJA 3EOAA 4BELD 2FT8A 4B9JA 3TPUB 4N2CA 4XVTH 3T8VA 2A74B 3KLSA 4Q52A 3NPSC 3PWPD 1NEUA 1WS8A 4YHLH 2KZBA 3HIZA 1DO6A 2Q7YA 3MHZA 2R2EB 2VR7A 3CFKB 3CZLA 1JZIA 4OQTA 4WFEE 3BAEL 5D7IA 5IK3B 3H55A 4RBPK 2HFTA 3VXQB 4K7PX 3ARBA 2Y36L 3NPSB 3T9WA 2RA1A 1EFXD 1MF2H 4QXGL 5BPPA 5E6SB 3FU3A 2G3MA 3BP6A 2A6KB 4WAFA 2UV3A 2IADA 1NMBH 5DJ0A 3VGFA 4JRYD 4KZDH 1NGPH 3O3AA 5E0FA 4I3RH 4CW1A 1N10A 2BRRH 4LLVA 3VTAA 4NKDA 4TRPL 3IJHB 5D4HA 3L3OC 2KL6A 2BHUA 2A38A 5EO9B 3EYOA 3RP1A 1GIGL 1T5XA 3BUYA 1MIEL 3EG9B 2M2DA 2AKRA 3L3OB 3MFFB 4L1TA 3PE9A 3WEXB 2BVQB 1WAAE 2FQEA 3ULUE 2EXSA 1CI3M 1JGDB 4LP5A 1M6OB 1MOEA 5GPRA 4P5RA 4Y16D 1BVKB 5CILL 4BINA 1IGYB 2ZT9C 35C8H 3AUWB 3MZGB 3P0YL 4NKIH 5D1XA 1JI1A 3SKJL 2WUCH 4RGOH 1ADQH 2JI2A 2RCSL 3GSXA 4NQCA 1DJHA 2DKSA 5DK2B 5EO1B 1JPFB 1WVZA 1A8JH 3OKMB 4NDMB 3V4VL 1RZQA 3S3PA 3VH8G 4BFEA 4QRQB 2XZQH 4G2AA 4OZFH 3WUWA 4R0LC 1R3LA 2ZOUA 1NOAA 5SX5K 3JXAA 4IBYA 1DHKA 1XX9C 1A64A 2OL3H 2A77L 4R0LB 4MVBD 3BPCB 3KL0A 4JM4H 5E4IA 3WFBH 1SQ2N 3PCYA 3D69B 1UH3A 5I6XC 4JK0D 5AVVB 4P57A 1SJMA 4BFIB 4WI7A 4NQED 5I6XB 1RZ7L 3QDJE 3FCTB 3EGSB 2QPDB 5E8NA 1HHGB 1DSWA 3WD5L 2E9JA 3CZEA 2PXYC 5GJTH 4BZ1H 2X4RA 4UTBH 1CXEA 2P5EA 4PY8I 3ZYOA 4NGHL 3DX7B 5E2UH 3QIUD 4FFYH 4J23A 4AEEA 4KZEH 3TLRA 4BQ6A 2PXYB 4N0UB 3TEYA 1NPJA 1ZGLP 1FFOA 3UYRL 3Q8AA 2DIEA 2IO5A 1LO5B 2GIMA 2X4SB 1GC1H 3MRLB 3CXHJ 5CINH 1FZJB 4HSCX 3MRQA 2D7PA 5GS1C 1MQKL 2AW2A 2J56A 1L9NA 2OM5A 2PPFA 1Q9WB 4W4NA 1BX2B 3NCYS 1QHPA 3M17A 2H0FA 3MUGA 3GS0A 3OVUB 5GS1B 2V9UA 2X4QA 1C16B 4FADA 5IW6A 2UYLA 3ALWA 1CVRA 1HHIB 3W2DL 2G2RA 5JHLA 2VDOL 1NM4A 2BY1A 5I2IA 5GS0H 4YXLH 4E9WA 2AQ2A 4MJ6B 4MSWA 5LBGA 1KCWA 1KCRH 1NWPA 3IFOB 4AQAA 5I1KL 5ADPL 2AJ3A 2FB4L 3FRPG 5I1CL 2HWZL 3CZFB 4DETA 5L2KA 3VFUB 3F7QA 1XSKA 2N3JA 3GIZL 5AYTA 3RL2A 2QTEA 2VN4A 1A14H 1G94A 3QISA 3BSZH 1SBBA 5K9JL 4X6CA 2DQCH 3M86A 4MDIA 4PS4L 4DGVL 4NO0A 4KBPA 4MLIA 4NC0B 1FVCB 2GBVA 2GJ6A 4R3SB 1XF4A 2CHXA 4EI5D 5AKTA 2F53B 4GRMB 4ELKB 1INDH 1WHPA 2WM0A 2WZ6A 3FN0L 4UT9H 4ZMQA 2FTAA 2VKWA 1EFQA 1J12A 1DBAL 3CZNA 5JTWA 1XGTB 1NUFA 3EHBC 3R06A 4F37F 5AUMB 4NIYE 3ZTNL 1ORQA 1NBCA 3NJLA 3VGGA 4L4TE 1ZT1B 3TT3L 5ALBL 2VITB 1P4BH 5DHVB 2HYMA 3EHBB 5EIIB 4OW6A 5JW4Q 2XXCB 1P7HL 4UI2A 2YUWA 3D3VD 1E6JH 4IU3B 5H4ZA 1RJLB 5K9OB 3SGKA 3U0WH 4F2MB 2A9MH 3R18A 3P73B 2XG5A 3POCA 3QR1A 3VXSD 2DYSB 3HI1B 4K8RC 1ZTMA 1EA9C 1N3NA 1UB6B 5B22A 3WY3A 2EP6A 4AMWA 4ADGA 2ZXDA 3SJVB 2Y1AA 4HJ0C 3RWCA 2NRDA 3CZUB 4HKZB 2ZXAA 4GW1B 2OXGA 3E38A 5K33A 2GUYA 4GG6F 4ZPVB 2XY1A 3UCQA 4FNLH 4KTGA 4YE0A 2AI0H 1U8MA 2ZAHA 3CD4A 3QHZH 4AQ8C 3L45A 3BX7C 2OV0A 5A16B 4Z76A 4EIUA 5I8OH 2E9GA 1WZMA 2R2HA 3ARGC 1S5HB 2N1KA 3QFJE 5IVXE 2OXHA 3MOAL 1AMXA 1KIUB 1ZLSL 4KTDL 3P3TA 4TNGA 4OGYL 4FA6A 1Q38A 3ARGB 3CVHH 1QLFA 4ODTL 3MV9E 3N0PB 3WSQL 2O93L 1QUNA 4I9XA 3EKCA 4IKJA 4FQQA 2AEQH 1D5IL 2XWXA 2AXGB 2G9HB 3PWPA 5HHXH 1S9VA 1H9VA 5F7YC 2EDKA 4XOBA 1BIIB 4JVUA 4IGBC 1G7PB 4YL9A 3KWUA 3KPLB 4OBRA 1EFXA 1UD6A 2O1AA 2ZXEB 1VFBA 2FZ3B 4J3BA 1C5DB 3OB8A 1QRNE 2X5PA 1NCOA 3C9NA 4IGBB 4LCUB 5DEZA 3CH1B 3LKQB 4JRYA 4NKMA 4PJIE 3WEMA 5FO8A 4MNQE 5HHOB 3TX4A 2ZQKA 1U8CA 2WXRA 3CMOH 5LGJB 1MI5D 3F05A 3N43B 3MNWB 3ISYA 1A1NB 4J12A 4CDHA 4L4VE 2LLNA 2VLRD 3EDEA 3Q2WA 1X4ZA 3ZDXF 4YPGB 4BSVA 3ULUL 1EWHA 1GCYA 5D7LD 2Z35B 2CLVB 4N3TA 4C83B 5I23A 1IJ9A 4Y16A 2HPOA 3T0EC 2CXGA 4EDWL 1U3NA 1XF1A 4D2NA 1N5YL 3BWSA 4FHBD 1YYLH 5G4NA 1BVNT 3HE7C 3F65A 5EF3A 2Y1VA 1EGJH 4HUKB 5IWLC 3T0EB 4Z8FL 3AACA 1YY8B 1U42A 4X6DA 2YD7A 2XPGA 3GRBA 3B37A 5D2LE 2ITDB 2OR9L 3HS0A 3HE7B 4O4YH 3GDBA 4PJHA 4DOHB 2W0PA 3MZTA 4U0QB 2UWEA 4MCYA 4J8QA 4OQTH 5EZJA 4LCYB 1Z9OA 1VEOA 2YD3A 4AI7A 2N4IA 4IJ3C 3EFDL 1R5WB 1CLYL 4RX4D 4ZO6A 1XDTT 3KH3A 3UXFA 5L8LB 1AQDB 5ECJE 1U4FA 2ICES 2WSKA 3H9SD 1PG7W 4IJ3B 4ACTA 3DECA 1NBYA 4KUCF 1EO8L 2IGFH 4OF6A 2K3TA 5KAQF 5AVTB 1F3RB 5KYNA 3OKKB 1OSZB 4MWFA 4PJFE 4WUKL 3TZVC 1TJIL 1TZGH 3DHUA 2B0SH 3ZQXA 2FR4A 3HCVA 1Q90A 4NQEA 4HU8A 5DTFA 4MD4A 4LLYB 5FCSH 4J2QA 3TZVB 5I26A 2CHNA 5ITFA 3BRDA 3MA9H 1M3JA 3KM2A 4ZUVA 3BVNB 2J43A 3N85L 3QEUB 4RBPH 5C2BL 1WFOA 3MRPB 3FTYA 5FV1L 3ZKXC 4G8AC 3QIUA 2ZKXA 4EI0A 1KLFB 2J4WH 4I7ZC 4QD2E 3S4SA 1F3JB 4KTYA 4UCFA 4ZTOH 3TFBA 3U6RA 4ZMWA 2NXZD 3L1OH 1I1RA 1U8LA 5DVLA 1GKEA 1TCRB 1UUSA 1YEIL 2VR9A 4ATTA 3ZKXB 4GAFB 1AJ7L 3QDGE 1XIWD 1IGMH 3UX9B 1YPZF 4UZSA 1BLNB 3TBYA 2XIIA 5FFLA 4MQSB 1D6EA 3LEVH 4YZWA 5HGGS 4PJXF 4GUQA 2WAHA 3U36B 1A9BB 1PNDA 4QHNB 2I5YH 2NY3D 1T1WA 2WBWB 2QV2A 2E27H 1WWCA 3HN5A 2BWIA 4B5EA 1E9PA 4N2DA 2CK2A 4IKKA 3NEOA 3DUUB 4KK5D 4F27A 3QJVB 1U8HB 4WWKC 1QLEB 1ZHLB 1URZA 3DI3B 1JNNH 1T4KA 1DSFL 3RB5A 3JWNC 1TDQA 4JRLA 1SEBB 3UBXG 2CHDA 4MQ7A 4WWKB 1JF5A 3IDNA 4E9TA 3WE6B 5FS5A 2ZCKH 1ZT4B 4JE0A 3V8CA 3FO2A 3ROLA 1AO7D 2FIRT 5BXFA 1J8KA 4OZIB 5GRVK 4XVUC 5D7HA 4PSRA 4UMGA 5I17A 4EI5A 2VZVA 3ARQA 3MBWB 5JPMC 2VDKH 5PCYA 4P2QE 1DN0B 4AYBA 4XVTL 1M2VA 1VACA 4YHLL 1I8LA 1A1OA 4NLAA 1E9QB 4P9HC 3GSQB 5KSAD 5JPMB 1DBJH 3BP4B 4S1RH 2GITA 2K8QA 2X1QA 2GUOA 3OLDA 1MF2L 3D3VA 4MAYD 2P24B 3L54A 2CU9A 2D0HA 3QDMD 4JPQA 3UC2A 5L4MA 5F7KC 4ONOA 3BVXA 2Q2LA 1IZJA 5FOJA 1NGPL 3VXSA 2AK4D 4O2FA 4KZDL 4PP1C 4MMXC 4I3RL 3VFTA 4HLZG 4NUJA 5BVJA 2BRRL 3LEXB 1OARL 5JHLH 1F11A 2FECI 3IN2A 4DF9A 4ZRGA 4MMXB 5D1QE 3VXUD 5ESQB 1C9SA 3RVTD 4FG4A 1WBZB 5HYFA 4LSSH 3EFFB 5GGQL 3HZMB 4ZW3A 1ZLDA 4MJ4A 1T04B 2D3JA 1JHKH 2BIQA 2BOBA 1A4AA 2FT7A 4ELMA 4WKZA 1HHJB 4XPAH 3Q2CA 5TDNA 3VXPA 2NXYC 1KTLB 1RUQH 1TJXA 2FGWH 5T5FL 3MODH 1EJ8A 2D31A 1E5AA 5ANME 4NKIL 4EMZA 3OR7B 2NXYB 3RNQA 2WUCL 2WKGA 1ADQL 4RGOL 3JV6A 3VRJA 3TL5A 4LLUA 3NIFE 3L5XL 1PD6A 3KL5A 3KXFD 2E74C 4OFPA 5KAQG 4UQ9A 4OZHA 2I9LA 2XZQL 4J6IA 1QG3A 3V9EA 5D7IE 1DQIA 3H2QA 4WTQA 1CGWA 2IXQA 5DJYA 5F1NA 4GKNB 1JXFA 2VOTA 2OL3L 2W5PA 4JM4L 3C6LC 1IAII 4X5LA 3WFBL 4QDGA 3NSYA 4S0HA 2X70A 3MRFA 4OSUH 1A7QH 1GR7A 3C6LB 3NCEB 1MI5A 3RIKA 2A4ZA 3HI5L 1KT2B 1Q9KB 2VLRA 1GGIH 4Z7UA 2UY7B 4BYHA 4DP4X 4XNXH 3QUGA 1Q9LB 5GJTL 2F15A 1JZGA 4UTBL 3EO1B 3GZPA 1T7YA 2OLDA 3BUPA 4BSJA 2P8LA 3FU7A 5D7LA 5E2UL 4FFYL 3PWLA 3QH3B 4KZEL 3M45A 1JNJA 2C9AA 1BD2D 1SOSA 4XAKD 4XHQA 2JKJA 1IC0A 1I1FB 4NHCH 3V0HA 1GC1L 1OE1A 1TZIB 1Z7JA 1J0ZA 2IV8A 4NUGH 5CINL 5D1XE 2Z8VC 4NQCE 4JFSA 4XMPH 3T5WA 5DJ6A 1M05A 1P7BA 1QPXA 2E46A 4GKOA 4ZXBC 3KAAA 3OG6B 4LKXB 2G0KA 4R26H 3GHPA 3GB7A 5C0CB 4ZXBB 4KXAA 4RX4A 1E8ZA 1KFAL 4NC1C 3EGDB 5GS0L 3BQUC 3LRGA 1UXWB 1J10A 3CHPA 4HU2A 4IRZA 5INCB 4YXLL 4FNSA 3H9SA 5FGRA 3CFDA 2WAQA 4PJCF 3T8MA 5AD0A 4PGEB 4P04A 4MYPA 1ML0A 3BQUB 1P4IH 1DQJB 1PG7H 5F89A 3WFCH 4EZJA 3AC0A 3E3QC 2R2CA 1QO3A 1CO1A 2NUTA 3RWFB 1HEJC 1CS6A 1A14L 1I4FB 3LQAH 4P2OC 4X5XA 5E1QA 4GXUM 5KBDA 3BSZL 5IKCA 3N1PC 4U1LB 2DQCL 1CR9H 2ATKB 2FATL 4Z78B 4GIAA 4HD9A 1VADA 2WLHA 2ITCB 5E70A 5EPMB 4P2OB 3VXOA 1KGUA 4MA1C 2P5EE 2W07B 3LRLA 4LSPH 1INDL 4AJWA 3CVCA 2H9GB 3SKMB 3KYNB 1QR4A 5JXEC 2HVKA 2OULB 2OMZB 1JCVA 1HAWA 1HSBA 1VF5C 1E8WA 2G2NA 4MA1B 4EI6B 5B8CA 3QJUB 2QKSA 1WF5A 2XWJA 1VCAA 1XIWA 3LSOB 1P4BL 2XFGB 3BI9X 4GKLA 4UIKH 2IMMA 1GYCA 3K74B 4PJEF 1PZ2A 1ZCRA 1E6JL 2Y5QA 3OGCB 5CUSH 1QTYT 3JTTA 3MLXH 1YLBB 5IFJB 2A9ML 4QHPA 5DJ8A 3WAJA 1G7MB 3LXAA 1JG9A 2RR3A 2VTFA 3T1FB 1N0LB 1IFHH 4FXGC 3S8FB 4FKHA 4X6EB 2JQMA 1S3KH 1CLCA 3UG5A 5JA8B 2X88A 4KX8A 4W4OC 3B9KA 5CWSB 2O30A 4M4RB 3QRGH 4DAGH 4MKTA 4LLQB 5DZVA 1SPDA 4U7SA 4FXGB 4HMCA 3SE4A 2ADIA 4RGND 3WHE1 1S46A 1KJ2B 2ZCLH 4XAWH 5L2KE 5IMOB 4FNLL 4EE2A 2W8CA 4TUJB 2NSQA 3SDDD 3SD5A 3N44B 2AI0L 5DJXA 1U3ZA 3QXUA 5I8OL 1NEZB 3G04A 2D3VA 5E4EC 3L2NA 3DX3A 2GJ6E 1AO7A 1UEMA 4X6FA 5CGYC 4XMWA 1U2CA 4HYTB 3RZCC 4CL7A 3ML8A 4M8VA 5E4EB 3WEBA 3CVHL 3MNMA 2KLSA 1WWWX 3RZCB 2GSGB 2HSIA 3ML9A 3NDZE 2C3VA 1OTUC 4AVJA 2FEEL 2H7WA 1RZIA 3GXIA 1AQ8A 5FUOH 4NRYA 3VNYA 5KSAA 3SGJC 2LE9A 2W91A 4HXBH 3MUJA 5FKAB 1DUYA 1KTDA 1VRSA 4PRID 2YZ8A 4PV1C 5IMKB 4EIGB 4PTTB 3FUDA 4WK2B 1K2DA 4MAYA 5F7AA 4E5XB 4X7EC 3UYPA 2GTZB 1NDGA 3MYJA 2A9CA 1DLHA 1YZZA 3RY5A 2VXUH 3W11D 2GAZB 3EAKA 2AK4A 4F57H 3ZUNC 4HKJA 4RAUB 4AV5A 5EFIB 1A3RH 5JQHC 5I1HH 1QSZA 2WC7A 2DRUA 4BDVB 2CUMA 5DI8A 1CTOA 3CMOL 4FJZA 2KDGA 1IKNA 2ZX5A 4YFLI 3VXUA 1T7VA 1XH1A 2LLGA 2OAAA 4KTEH 5DUBA 4LB8A 3DMMD 4ODUA 1NGQH 4K3JH 4U1GC 1DQTA 1I8MB 4XPFH 5AW7B 3JWDC 4XB3A 4TQPA 4E9YA 3F7KA 3VWJD 4U1GB 3BUQA 1QSED 4JG5A 3AQZA 1D5XA 2P9RA 2VR3A 3OMNB 3RKDC 4CBZA 3LNDA 3OJDA 5DA4A 4ENZA 1KNOA 3CFBB 2BVPB 4HALA 3CHRA 5I0YA 2RIKA 5FHAH 4GXUN 3KXFA 3QQ3A 4O4YL 4XCFH 3PWPE 5KJ7E 2V5SA 5DO2D 3PABB 4R97C 4OQTL 3ORJA 3CG8A 1UADC 3MV7B 1OPOA 2BZCA 1LHZA 4O02B 1ZA3B 4WQOA 5MEOB 3ZDYE 1JHTA 4N2BA 4R97B 1A7PH 4TUOA 3B56A 4GBXC 1CK0H 4M8UA 4ONFH 4W9KC 1RZFH 4PY7B 3O3EB 4U1IB 4JRYE 2OMXB 4HF5H 3LRHA 4TL5A 4W1TA 3IRPX 3UJTH 4GBXB 4DP0X 3REWB 1TZGL 1Z0NA 2B0SL 4HIQA 3PDDA 1X7QB 5HHPB 4EUPG 5CLTA 4BZ2L 4Z7NE 4ENED 3L3KB 3FCSA 1JJUA 1ZSDA 3MA9L 3H9ZA 4H0LC 4A37A 1WK0A 3S6CA 4WDIA 5IVOA 3VXNB 1NCDH 5KOMC 3X1NA 1JPEA 4JFYB 1I1YA 4G8IA 2J4WL 4NIKB 3KYKH 4CSPA 1SVCP 2MNWA 4ZTOL 1BD2A 5J9PB 4HK0B 1JFQH 5DZOA 3MUY1 4FQLH 3IMTA 3S2CA 4C4KT 1BZ7A 3GNMH 3QJTB 2YS4A 3QQXA 4DPCX 1IGML 4NQTA 3S3DB 3GPSA 3WN6A 4WNJA 1MW0A 4X6DE 3LEVL 3WKQA 5IOPB 4MNHB 4PJHE 3Q1EA 4PTUA 3CN1A 3MREB 2UWEE 2I5YL 5I1LA 3ZUCA 4MLSA 3M6DA 3IU3A 1U95A 4HUNB 3WENA 4EN3C 2E27L 3S88L 3OKOB 1UUNA 4MHHI 1B0RA 4X4XA 4EN3B 3QQDA 4NX0A 5I5MA 2B8OT 3WHXB 3BZFB 1XGRB 1O75A 2JCCF 3V4PA 5CGMA 4LCWB 3FQXB 2MJWA 4YO0A 5IQLA 4LASH 2OK0H 3JVGA 4NQEE 1U3HC 4FNPA 1VFMA 4JO2H 3CAFA 2ZXBA 2WB7A 2VDNH 2ZCKL 5AENA 3MKGA 5D70H 4ELDA 1S7RA 2EIDA 3PJNA 4NRZB 1U3HB 5HDBF 1G7IA 3AJ7A 2IDFA 4G7YH 2VW7A 4QTHB 2N59A 1WT5C 1YN7A 3QRLA 4H26B 4KGJA 3TA3C 2BSTA 4ZQKB 2VDKL 4X7CC 4MZRA 4ISVB 1FV1A 3EOTL 3V0DA 3TA3B 3TBSB 4PEEA 3U7WH 2PW1A 3ZDZF 3S36H 1U4EA 3SDCA 4AZ8B 4OD3H 1DBJL 3NZSA 1AXIB 4YC2C 4S1RL 3L6FA 1J8SA 4Y7MA 5JPNA 3UH8A 1W6LA 1YEDA 3SE9H 4YC2B 1G7LB 3C5JB 4UZGA 3BVWA 4MZIA 1I7TA 5F88B 4L3FA 2H3NB 4QHUA 5H2BB 3TCLB 5JHLL 1BFVL 4PCTA 4IRZH 1H5BA 1X9QA 3VW3H 2Q86B 3QO0A 2WXLA 4BFRA 3GTTA 1E42A 1BAGA 5C8JA 3INOA 2Y2WA 4LSSL 3UAFA 1B4RA 2WV3A 4U6TA 3H9YA 1JD7A 2EYRB 3TBVB 3ZR5A 3SDDA 3X1FA 3BZ5A 1BQHB 4GB9A 3TH2T 1AP2B 1Y0LA 4J3VA 3BE1H 4XPAL 3IS0X 1J05A 1PD1A 1OW0C 1RUQL 2DJ4A 2FGWL 3HBGA 1LK3H 3Q0HA 3UADA 2FBOJ 3MODL 1F1DA 1CFNB 1A6VH 1QQDA 2BLFA 1FYHB 3G3LA 1FG9C 1SLVA 1TVHA 3Q05A 4A7QA 4AQZA 2VISB 3IDXH 1JF1B 1UT1A 2J5WA 4MASA 1AXSA 3ELQA 4WI9A 1ZEAH 1Z5LA 2NYZA 1MJ7L 4OLZH 5TF0A 4PGCA 4PRIA 1VERA 1CG9B 2ZSWA 2X6CA 3D3VE 4ONHA 3CVIH 3ETSA 4IDJH 3N04A 4Q6IA 3MTXA 3RWDA 2IALA 2CO7B 2Q3AA 3VXSE 3T3PF 3OPUA 2ADGB 1NINA 4OSUL 1A7QL 1J87A 1OALA 2IDTA 2GBTA 4DERA 4HBCH 4HAGA 4YHNB 2ZNWA 1JWMB 4P46C 4X5WB 4JL2A 3II1A 4Q6KA 4XH2B 5ACZB 4KMTH 4X8JB 4PWKA 4FX5A 1GGIL 4V1DA 4DN3L 3DMMA 4RZCA 4BCXA 5EU7C 5F9WC 3RB7A 1JDAA 4S10A 1ORSA 4FJYA 4WW2F 4KKQA 5E00A 1E4KC 4ELME 3VWJA 3FB7A 1YC7A 1LILA 1RJCA 1FNSH 1QSEA 1E9OA 5F9WB 1R47A 4K7FA 2OKMA 3S8GB 3K3QA 3I6SA 3Q3GA 1QBAA 4NUGL 1WJ3A 5CEYB 5C0NC 4Q14A 4DZBB 4RETB 4XMPL 2B14A 4M3JA 3LH2H 3EHBD 2H4EA 1N5AB 3BJ91 3K81A 5DRWA 4OZHE 2YXVA 1KPRB 2X2JA 1Y1DA 1H19A 1JRHH 3LXUX 3I6KA 4B95C 3CN3A 4LBAA 4R26L 3HVNA 2C9PA 5ENWB 4A2DA 3BHBB 5ID0A 2X89D 5DZAA 3SJVD 2N7SA 3QT2A 1KUMA 4K8RD 2X1PA 5FM5M 4P48A 2ZUSA 5EN2B 1P4IL 1PG7L 3VI4A 3WFCL 3GBML 4QKXB 3ATBA 1AOHA 3LB6C 3QIBC 4PVNA 3W39A 1MI5E 3LQAL 2OW6A 1ACYH 2MH4A 3NCFB 4A68A 2VLRE 5KSBB 2AEWA 3FQNB 4Z7UE 3AMKA 3LJ3A 1VA9A 3O9WC 5BUGA 3QIBB 5E9DD 4XO8A 4PB0H 1LP9A 3FO1A 2KPWA 5LN4A 5F97E 5FKPB 3O9WB 1FG2A 3ARGD 2GPZA 1ESOA 3ULSB 3QG6B 2X9ZA 3VD9A 2WLNA 2XZAH 3TPUA 2A74A 1PEWA 2B1AH 4I8DA 1KSRA 1LM8V 3MLWH 5IB1B 1CDCA 2R2EA 3CFKA 2WN2A 3QI9C 4UIKL 2WOBA 5IM7B 3IFNL 2D7TH 1OCCB 5E94B 4FA7B 4LGRB 2AMUA 2J44A 3F7RA 5DA0B 1W2KT 3QI9B 2TRYA 2A6KA 4IOSD 4N2MA 2LFEA 2OCJA 3DX1A 1IFHL 5HHOD 4MCZB 4OJDH 1S3KL 2Y24A 1P84J 3H9SE 5FFGA 2CAKA 2VN3A 4DAGL 3QRGL 5IMLB 3IE9A 5DC4B 4M7JL 3MV8B 4XOEA 5EO9A 4ZAKA 3MJWA 4JKKA 3EG9A 2ZCLL 2AEPL 3N41B 2YPKB 3PGDB 1CXIA 1M1SA 4H8HA 4KK8D 3L3OA 3MFFA 4XAWL 3WEXA 3ZVVA 5CIPB 5CU9A 5HPOA 2AXJA 3ES6A 1NFDF 5B4MC 3MOBH 3NCMA 2PWGA 3VYNA 4XVSH 2ID5A 3UBGA 1M1XB 2QGBA 3GXMA 1BZEA 1M6OA 3CUPB 4IHBA 1CXHA 2BIIA 1PU0A 4L1HA 3NCCB 4N22A 3IXTB 1BVKA 1CIUA 4X7SH 3LN5B 1IGYA 3VFNB 4UYQA 5KN5A 4X9BA 3UC0H 1FL3A 1Z0MA 4YHOH 1WZ1H 4A7UA 3T0ED 1UXSA 4IIQC 1IZKA 4K9JA 5DK2A 5EO1A 4GFXA 4NDMA 3OKMA 4IOFD 3KYMB 4UINL 3WFHB 3HE7D 5FUOL 5IJKC 1IBYA 1X44A 4QRQA 4IIQB 2ZWLT 4TVPD 3RG1C 2BFVH 3KR3H 5ICZB 1ODUA 3K2MC 1CTMA 4QAWA 1WFTA 3P3SA 1ZGLM 5A7EA 3IM1A 4L37B 2GK0B 3P0GB 1WAEA 3QO1B 2VXUL 4F57L 4ZZKA 2ICCA 1HT6A 3D69A 1A3RL 5I1HL 2RACA 2VDQH 5AB2A 1ZV2A 4QRPB 1T83C 1G43A 4WWID 2IFFH 3VFPB 1JZDC 4H2CA 4PP2A 4R83A 5HY9A 1E43A 5SWSA 3U82B 3I9IA 3D12B 3V4PH 2BWDA 1NGQL 2QT6A 3D25B 3FCTA 4K3JL 3EGSA 4LKCA 2YPVA 1TTAA 3TZVD 4XPFL 3CC5B 2FX9H 2XBDA 5IHUH 3H56A 2IBBA 3TXAA 4JO8A 3DX7A 1AO7E 4XO4A 5M95B 1IC5L 4S0TD 3VGAC 4N0UA 2H3XC 2O6PA 2YAMA 4TL4A 4BH7B 2E7BA 2HLEB 1LO5A 5IB4B 3MRLA 1G0YR 1NFIA 2KC0A 4XO5A 4PHZA 5DUPH 5FHAL 4ZUWB 3VGAB 5A2FA 5BW7C 1YNTA 3LZNA 3ZX1A 3RA7L 4XCFL 2JKWA 3P1VA 3QORC 4JFFD 3HAEG 1WZAA 2NY7H 1XMEB 3MUHL 3W9DB 1T20B 1T66C 1QHOA 4JO4H 3QORB 4U6VH 1T5WB 2D0FA 1HHIA 3BCFA 3K2KA 4H40A 1A7PL 4ONFL 1CK0L 5F1SA 4JB9H 3UCRA 2A9NH 1RZFL 1WD9A 5JMOC 1J5IA 1J0JA 3HKFA 5GRVL 2AK4E 4HF5L 2PPAA 2ZOTA 5CN2A 2A83B 4LIQH 2FWOB 3UJTL 3U2IA 3IFOA 4PRAB 3DX4A 3QNXB 4LLMA 3DJ9A 3HG2A 4Q74A 3E8UH 2OQJB 2P1YA 4OJEH 5DZNA 3VFUA 5I1GH 4WWKD 3VXUE 1UJTA 2AXHA 4GLRH 4O51B 1GYAA 2YBRA 2ICWJ 2J8UB 2OSLB 1FZOA 3MRJB 2JIXB 3UO1H 2DL9A 2XXMB 4I18C 1F4YL 2WQWA 5EU4A 4GRMA 5GGTA 3CFJB 4CDGC 4ELKA 1M7DB 4KMQA 4Z6AT 1CGSH 3H3BC 5J6GB 3G6JF 5JW3H 1DANT 1LWJA 2PUQT 4JRXB 1JFQL 4I18B 4FQLL 2AJVH 3GNML 3ET9F 4YN3A 5AUMA 2VLJB 3QRFM 2VDMB 4PCKA 3UTZB 2VITA 5DHVA 3O6FC 5EIIA 3KXFE 2P80D 5D2NC 3DYMA 2UZIH 1HZLA 4IU3A 5K9OA 4JMXA 1Z66A 5GZOC 1X7SA 3O6FB 4KH2A 4E42B 3P73A 5D2NB 1C7SA 2V8LA 2ZP8A 3KPSB 2BH0A 3TFKC 4KNQA 1UB6A 2WANA 2Y1YA 2X89A 1EEZB 4BRVA 3OV6A 3SJVA 4HIEB 1J1XH 4HKZA 2DQHH 4YWGH 3DBXB 4LASL 2OK0L 1FPTH 1DE4B 5C70A 3DX2A 3FQ1A 2YUXA 4HEPA 4JO2L 4JPVH 4LRNH 5CJBA 4A67A 3K80A 1RSFA 4K3GA 2DWXA 2V0AA 3QUXC 3WIHA 5A16A 5EEYA 1F18A 5D70L 5E9DA 3S35H 3SY6A 1VJSA 4HISA 2J1XA 4G7YL 4QRSB 3T77B 1MW2A 5H35B 3QUXB 1FFRA 4CADA 2QQKH 2NXYD 3ARGA 3QYCA 5GGSA 1BD2E 3BD4A 4XAKE 2EC9T 3L48A 3FUKA 3SKUD 4BKSC 3FTXA 3U7WL 5CFHA 2DWEB 4CRPA 3S36L 2G9HA 4OD3L 4ZFFA 3G5ZB 4K3DH 5B38G 1BIIA 4QY8B 1HWHB 1LEGA 1M9WA 3KPLA 3IDGB 4B41A 5JW4M 4DEPC 1IVTA 2OZNA 3C2AL 5A3IC 2QQLH 2E4FA 3PXLA 4IOSA 2LU7A 4Z0XA 3CH1A 4W6YB 3ATDA 4DEPB 4L1LA 1JXKA 5HHOA 4AVHA 4IRZL 3SYCA 3VW3L 3DVGA 5I6MA 3C6LD 1EK3A 1P2CB 3NRQA 4P2YA 2EE3A 3HE6C 4JG0H 4HH8A 3C5ZC 2YKLL 4JN1H 5IB3A 3KYOA 3UTQA 4EQ2A 3EYVB 2FH6A 4YPGA 3QRBA 3BE1L 3HE6B 3HS8A 2Z35A 4QXVA 5CR1A 1Q8MA 2CLVA 3C5ZB 4L0PB 4C83A 1LK3L 4I2XB 3OLEA 4R90H 1A6VL 2QV4A 4CC4C 1UFUA 3IDXL 1DVZA 4DK5A 12E8H 5EUOF 2RJMA 3T0EA 5KSUB 1YY8A 1W15A 4AVKA 1ZKAA 3SYQA 3IEAA 3HE7A 4F7KA 1WGOA 3ZT6A 4GO9A 1ZEAL 2YIHA 3VCLB 5IWLA 2L0DA 4P23D 1ZVYA 4IHOB 4NJ9H 1EJFA 1IEHA 5C0CD 4ZXBD 4UTCA 5EBMB 3CVIL 4FHJA 4IDJL 2JQAA 4O58H 1AQDA 3O3UN 5FO7B 2V4LA 4L8CB 3K4ZA 3VD5A 4LIQE 3TC9A 4PGDB 3ZO0A 4DSYA 2W0LA 3BQUD 1OAZH 4HBCL 3WNMA 5I1EH 1WA0X 1OSZA 1GGTA 2WO3B 1K85A 1EHXA 2OYLA 4KMTL 2GIXA 5EZPA 1XMWA 1Y18B 4RGNE 3I6LD 3D8MA 1D2OA 3BGFC 4NB7A 3TZVA 2IH3B 2DKUA 3EJSA 2E76C 4N85A 4P2OD 4PJGF 3RKPA 1R19A 2R0WH 3BVNA 2P43B 3MRPA 1FNSL 3BGFB 2E9IA 4KO6A 1NBVH 2LLLA 4NHUB 2FSEA 3LPPA 2O5XH 4OLVL 4UOQA 2NZ1A 2FJSA 3D51A 3QJFB 1QNIA 2XQBH 2A3TA 4M48H 4OT1H 5F7UA 5JXED 1P5VB 3FT1A 5E8OB 1BLNA 3LEYH 5A2CA 2EXYC 3LH2L 1TIUA 4M43H 2I69A 4JFFA 1PX8A 3RHWK 3U36A 3NP4A 1JRHL 4QHNA 3LZQA 3RY6C 1P6AB 3T2QA 3ZE1B 5JHMA 4PRIE 1CF8H 2B59B 3TN0C 1MREH 2Z4TA 4EXPX 5HDOA 1BGXH 1J86A 3UPAA 3DUUA 3TN0B 4YNYB 3PJSB 1JVKA 2AV7B 1U8HA 5ALCH 4MJIB 4F8TA 2EIJB 2WHVA 1L0PA 4M7ZC 3VNZA 1HQRB 1WUZA 4BHUI 4WWKA 1ACYL 1WCBB 3X3GH 1EDQA 3EJUA 2IWGA 1AGFA 4IRSC 4M7ZB 1FLRH 4V1DE 2WKOA 5FO2A 1ZT4A 4PB0L 5CJXC 2YPVH 3WDHA 2FO4B 4OZIA 1UKQA 3O8XC 1V5JA 4IRSB 4EDXB 1SXNA 2B2XH 4PRDB 4XGZB 5FM5O 1QSEE 1AR2A 4P4KC 3SQOL 4ANXA 5C6TL 5CGYD 2GSMB 4N1CA 4FLHA 3O8XB 4DZ8B 3RZCD 4H20H 4P59H 2W9LA 1DN0A 4OZGF 4LDEB 1KEGL 2B1AL 3K6OA 4P4KB 2OTPA 3W3BA 3K4DA 3K46A 5JPMA 3GSQA 4QXWA 1OTUD 3TBTA 2D7TL 1KN2H 1F58H 2BNUB 4PJ5B 3BP4A 1KWGA 2Q5BA 2P80A 3APMA 3V7AE 1G5GA 4KZCA 2XETA 3MJ8B 3F7VB 1NUNB 3C6SB 4N24A 2XQYG 3VD0A 4MA7H 2CE6A 1RD6A 3V0GA 4ORGB 2DIJA 2ENPA 3D30A 3LEXA 4K94L 3VFRB 4HHAA 1XV8A 5BOZG 4MMXA 3VI4E 1O7SA 1E50A 1WBZA 3HTLX 3RFZC 3GF8A 3EFFA 3BOVA 2AJXH 4BHUA 1WUNT 3HZMA 3QE5A 2FHCA 1T04A 3MOBL 4W9EC 4XVSL 3RFZB 4TNVF 4HETA 3MNZA 2XN1A 2QMKA 1BQUA 4TTDC 1LP9E 3BN9C 4RDBA 1J9SA 4X7SL 4TNWK 4FI7A 3T04D 3UC0L 4DK6A 3FF8A 4YHOL 3VD3A 1WZ1L 4HZLB 5GGTH 1KOAA 3PV6B 1G4MA 5IBUB 4Z77B 1GAFH 1BXXA 15C8H 1CXLA 2ZYSA 2C9VA 1T1ZB 2OSYA 3CQQA 3HA0A 5IW3A 3IDMB 1MFBH 2BFVL 3KR3L 3QVAA 3MV7D 5DHVH 4ZFOA 2NSMA 3FT3A 4ZMNA 3TU6A 2YD8A 4MA8H 3QQ4B 4DGUA 1CL7I 4AH2A 3ZHDA 1DVYA 2RH0A 5MEPB 5I5JA 4YS4A 5LDUA 2PTTB 1TCMA 2IWKA 4BFNA 1K8DA 2E4TA 4GBXD 2VDQL 2GQHA 3AS1A 1RIVH 4M93C 4Y5YC 3SO5A 2O6FA 5EN3A 1IE4A 2R1WB 1HVXA 3CN4A 3Q48A 3C6LA 1TJHL 4KPHH 4K8RH 1SFDA 3V4PL 3MRBA 1KT2A 4M93B 1Q9KA 4Y5YB 1JZ2A 4GAYA 1X5FA 1Q4NX 1B0IA 5F0JB 4J3OG 3NJNA 4IBQA 2FX9L 4ZMZA 3EIFA 5IHUL 3DPDA 3LD8C 5IY5B 4CSSA 4L8BB 1T6VN 2NR6D 2B9AA 3QNFA 3WIHH 4ZI8A 5A2LH 3QH3A 3BC9A 3LAFA 1BZ8A 1W80A 3RWEA 3LD8B 5CAYB 5TDPB 1I1FA 4MD5B 5AVZB 1TZIA 4R4FH 3RZWA 5EU5B 4D9QD 1OY3B 5DUPL 2VZ1A 1EV2E 2J8HA 5AYUH 1HESA 3VMPA 2XTSA 5D1ZC 1UA6L 4DUWA 3NFSH 4P3DB 4X8GA 1D7BA 1TZ8A 2NY7L 4Y9GA 1QFHA 4LKXA 1TSHA 4P23A 5G4MA 5D1ZB 2DZEA 4JO4L 1L9QA 2Y69B 5C0CA 4ZXBA 4TPRH 5IJDC 4N68A 4JB9L 3LOWA 2A9NL 3MRMB 5KVFH 3QWQB 1UXWA 5INCA 2C1OA 4EN3D 2J7LA 1CDGA 4LIQL 2MWCA 1T3FB 4HCGA 1D2PA 4JQIA 5DJCA 4PGEA 5HYSG 4WHYH 1RPKA 4KKAC 3LRSB 3BQUA 4Y88A 1DQJA 3E8UL 2A6DB 2CGRH 4Z7QE 5I1GL 3RWFA 3H54A 1I4FA 5SWSE 1GTNA 2WO2B 4U1LA 4LCCC 5CJOH 5KBPA 4RAVB 2OJEB 4Z78A 3K7UA 3HUJF 4JHUA 4OLYH 2ITCA 3NSDA 5EPMA 3UO1L 5EF2A 4P2OA 5IBLD 2VSKB 2W07A 2WLLA 3F8UB 4LCCB 1L7TH 1W0WB 1XR8B 3V4VB 1OZUA 1CGSL 2H9GA 5JW3L 1PLAA 4N0UE 2OMZA 2AJVL 5D71H 1J9QA 4EI6A 1TQCC 3TA3D 2TAAA 2B1OA 1PS3A 1QX1A 3NAAL 4JPKH 5JXEA 5CHNB 4AZUA 3HNSH 2SODB 1HHKB 4CU6A 1TQCB 2DLFH 2ZNXA 2UZIL 3HFFA 2V7NB 3QEHB 3EDFA 3UBXI 2IBGA 4OIIH 1VFAB 2WIMA 2YK1H 3LY6A 5DC0A 3T6WA 3IFLL 4WGKA 4AYGA 1G7MA 1Y1UA 2JVUA 4Z18A 3OF6D 5JQ6H 3FL7A 5I1JH 4IKIA 3T1FA 4ODWA 2YMTA 4KVNH 1J1XL 2C26A 2DQHL 2VQUA 4LLQA 4WI5A 2R15A 1W8NA 3L8QA 5AW4B 4FXGA 2R4RH 5IMOA 4JPVL 2NW3B 2P52A 4TUJA 1BZQK 1P4LB 2CDFA 4R96A 3UTTD 1AOZA 2Z7YA 2WBKA 3PWVB 1FFPB 1NEZA 3S35L 1HX0A 4KJQC 1FZMB 4KQ4L 2XWTB 4HOMA 3TJEL 4WHTB 3L3HB 5ACMA 4FNQA 4DHLA 2Q3XA 2QQKL 3ARDC 3IGAA 2F58H 5DZLA 1I3GH 3RZCA 2GSGA 5HI5C 1A7NH 5ABAA 3ARDB 5CBEB 1H3PH 4ZG1A 1GGBL 2VDOB 4JGUA 4K3DL 1JP5A 5FKAA 1ZJAA 3AG1B 5C9KA 1P84K 1BAFH 1G87A 3NABH 4S1DC 1V7MH 4PTTA 1B4TA 5LBSA 5F7HA 4E5XA 2QQLL 3SGJA 4YDJB 2NTFA 5HBBA 1AS8A 2GAZA 2GG1A 3PXJA 3X12B 1FNFA 3TS8A 3QFDB 5EFIA 2A6JB 1S7TB 5IGXH 1JMZA 3RWIB 3SJVE 3UTOA 4H1LG 1FFNA 1AGBB 2Z34A 4FXLA 1QLEH 1TEGA 1A3QA 1H6UA 5D5MA 4JG0L 4JN1L 4NI6A 3FUEA 2WK2A 4JX0A 4P46D 1I8MA 3PNRB 2V9TA 4WWOA 3RU8L 5LXGL 5E9DE 4N8VG 3TWCH 2IFGA 3NOIA 1SF5A 4R90L 4W6XB 4YSDA 4PVBA 1CFTA 2LOEA 5GGSY 3N1FC 2XKUA 12E8L 1ANUA 1CFQA 3L4XA 1UACH 4HGKC 3CFBA 2BVPA 2GKIA 4ERSH 3HZVB 2AJZB 2E7LC 5DK0B 3DBSA 3H7BB 2CIIB 5AWNH 2JJUA 1U8IA 5C0ND 1D7DA 1MLBB 2KI6A 1YRKA 4NJ9L 2YMOA 3S37H 2H0EA 3CVDA 3H8NA 5GISH 3VU2A 2GBAA 4KKCC 3ZBMA 1D5BB 5MEOA 4O58L 5JQIB 5KVFE 2EC9U 4P9HH 5KYUB 1Q0XL 4KC3B 5D7JD 3O3EA 4U1IA 3G5XA 2OMXA 2LW3A 1BREA 2XJLA 5HHOE 4LGPB 2G3ZA 2XRAH 4GBXA 1OAZL 3S5LG 5I1EL 4JO5A 3P2BA 5E08H 1AQMA 3T4YA 4ZX4A 3UEQA 3NIGF 3V5KA 4ZUSB 5HHPA 3SY0B 4KRPC 3TIDB 2ZP9A 4JHWH 2WKLA 3T4AC 3L3KA 3L4WA 3QK0A 4OGQC 3LB6D 3QIBD 3DTXB 5B3SB 2NW2B 5I8EB 2R0WL 3V0IA 4KRPB 5FDWB 3WCYA 5JW5B 3T4AB 3O9WD 3OR6B 1JZEA 2NR6A 4JFYA 3MCKB 3P2TA 2C9SA 4ZFGH 1NBVL 2O5XL 5J9PA 2WTPA 4HJSA 4HK0A 4P4RB 1G5AA 2XQBL 2YGQA 3H6AA 3I02B 4M48L 4OT1L 4ICXA 3T0EE 5E1AA 2VABA 2Z8SA 1AACA 2YGOA 3NUKA 1E4WH 4CU8A 5IOPA 5AW6B 4JDZA 2F7QA 3N40P 3J07A 3MREA 1MFCH 2GJJA 4TVPE 1U8OB 1U92B 4DCQB 4HWEH 3QI9D 1OANA 4ZW7A 3T6XA 3TTYA 1CF8L 1UWYA 1REIA 1MREL 4Y2LA 4JL1A 4LPCA 4ZMPA 1QW8A 1BGXL 2LU3A 2WLIA 4EN3A 4PJ7B 5ALCL 1UH2A 1Z3GH 3WHXA 1KLGB 3BZFA 7PCYA 1UA7A 3RNKB 1U93A 1XGUB 3FQXA 3KBFA 4Z3IA 2APVA 1E30A 5TPWH 4GSDH 5IHBA 2BW4A 3IBOA 3X3GL 3AB0C 4AIXA 2ITFA 3FFCD 2R7EA 3FRPB 2AS5M 2QZQA 3CIAA 2DQFB 3HPJB 2YPVL 1CFBA 3JVFC 3SOTA 5FB8A 3HG4A 3II2A 3AB0B 4NRZA 5B4MD 1CE1H 3V9FA 1R3IH 1SYSB 1FZKA 3VM5A 4QTHA 4PM1A 1I8IB 4JN2B 4JM0A 4W70A 3RDJA 5BRQA 4ZQKA 3JTBA 4YIQB 4H20L 1MZZA 1ZPLA 4P59L 4ISVA 4XP1H 3BT2H 5SV3A 1LMIA 4MRCA 1WT5A 2E5EA 4FE9A 3TA3A 1C7TA 3GSUB 1FO0A 2X9WA 3TBSA 2VDLH 2WY3B 3ARFC 4H0HB 4U1NB 4AZ8A 4F8NA 1KN2L 1F58L 2A9BA 1RLWA 4LPTA 4WJ5B 5LAPA 5HP5A 2OJ1A 1E7UA 4JFFE 4RQQA 2I9TB 1F42A 3QS2A 1F2QA 1WITA 3QQNA 1GS8A 2BY3A 5ITBH 3ARFB 5HPMB 5JYLA 2J6WA 1G7LA 4UNTA 3C5JA 4MA7L 1NGWB 4X6CF 4U31A 4ANVA 1R3JA 1XQ4A 2J1KA 1IQDB 2H3NA 3OF6A 3TCLA 1MJ8H 3K0WA 5E8PB 3QDJB 5E51A 4A6YA 4QRPD 3UZVB 2XN9D 4MCMA 4JQIH 3CMGA 2XTJC 3CCHB 3GPEA 4LAJH 3NPZB 2AJXL 4LL9A 4X7FC 1CDIA 2EYRA 2TSBA 3UTTA 3RIFK 1NOFA 1AP2A 2MOQA 2XTJB 1HI6B 3V95A 1ITBB 1NKRA 3U2SB 4OZIE 2G5BA 1W0VA 4W9ZA 2YD1A 2LV4A 3D50A 5GGTL 2WMPA 1K72A 1OW0A 2VISA 1LJMA 1L9OA 4M1GH 1BFSA 2AJSH 15C8L 1KBWA 3RGVC 2BRQA 4G8GB 3A22A 4EJ1C 3FHAA 4U49A 5L7XH 1MFBL 1N6QH 3BPOC 3RGVB 3D4CA 4H8WL 4ZOBA 3B2PA 4MJ5B 1CG9A 1UVQB 3QORD 4U2YA 2BP8B 2BY2A 4M56A 5J12C 1OP3K 4JFZL 5LKNA 1A4KB 3BPOB 4XCEB 3C08H 2COQA 4OF3A 1T66D 1UD8A 5IHWA 2CO7A 3T6VA 2ADGA 4J6RH 4N0RA 1RIVL 4LCVA 1AKJD 4WTWA 4KPHL 3WGVB 1FORH 4K8RL 3FAXA 4M6ML 4OU3A 1FHGA 4U1MB 4Y9FA 5HHVH 5ACZA 4C8XA 3Q6FA 3RWHA 4QRUB 1EO7A 4A63A 3RX7A 4PLNC 3D9AH 4Z5RB 2F8VA 4P46A 2V5YA 4W9JC 1ZIAA 3WIHL 3VQLA 2BCKB 1JGLH 1SM3H 4DP9X 4HZ1A 4N2KA 4JRXD 1D5RA 1G9EA 4DO4A 2NQ3A 4YLCA 4R4FL 1JXJA 4BGLA 4B5ZA 5CEYA 2VLJD 4Y19B 5AYUL 2ZKMX 4DZBA 4WUUB 4BQCA 4I48B 1N5AA 5I24A 3NFPB 5K39B 2MQ3A 3NFSL 3J2PA 2Q2EB 3X1EA 1R5IB 4PWEA 2VZTA 3QIWC 4TPRL 5ENWA 1PY0A 4Z7NF 3K71A 5LBSH 3BHBA 3KPSD 5KVFL 4JY5H 4ECNA 5GZOD 3T3ME 5B39G 3QIWB 1TZAA 3QR2A 5BJTB 5D7JA 4WVRA 4NBYB 5J6SA 3MXVH 1UENA 5EN2A 3D39B 3TFKD 1J9RA 1F4AA 4QYOB 3GUFA 4ZUTA 2CGRL 4EVNB 3PIQB 5TF1H 4I4WB 5MI0C 2CUAA 3DRQB 2QGCA 3QFJB 5CJOL 5KSBA 3QUKA 2XNAA 2WVUA 5MI0B 4OLYL 1PTZA 3QIBA 1T03H 4LSQL 4DFIA 4XMTA 2Y06H 1L7TL 1I7UB 2WWKO 3MX0B 2HKAA 3O9WA 3AREC 2X28A 3U0TB 3QQ9C 3ULSA 1CMOA 3QA3A 2EUVA 5D71L 4OZFB 2XACC 2BVTA 3JWDH 3FT9A 4HIPA 3MJ7B 4D0BA 3IK2A 2BHYA 3AREB 4JPKL 4RMVA 3H0TB 3HNSL 5IB1A 3VX0A 1YN6B 2P3YA 4JANA 5IM7A 2DLFL 2X2IA 2X10A 2WYHA 4Q0XH 5E94A 3PHSA 3ZDWA 5C3TA 1IARB 4K15A 3GMQB 4K7PH 1D7CA 4OIIL 3X17A 2LAAA 2YK1L 4TVPL 3QI9A 1CXKA 3GDCA 1R3KA 1SHMA 2PP7A 2WXMA 5C0CE 5JQ6L 2MOGA 4F7EB 5I1JL 4GG6B 5C0AB 2XPZA 4L4VB 4MCZA 3E1F1 5A3ID 3ARZA 2HFFB 4X7TB 3OKLB 1OCZB 4KVNL 3NRFA 4KQ0A 1MFDH 4E36A 4NC1E 1AAJA 4WI0B 1KYOJ 1LEKB 3X1BA 3P3UA 4BV1A 5B3JE 2R4RL 3WN5C 3PGDA 1OT1A 1WFIA 1GC1C 4RESB 3UIYA 1FNLA 5CKAA 5CIPA 4CC1A 1O9ZA 1TNNA 3FFCA 3I6LE 3WN5B 1Y7VA 3RUGF 4IDLA 3IDUA 1O6SB 5E2JA 1GY1A 2BNQB 4M8RA 3TEWA 2CRIA 3WDJA 4ZFZA 5JZ7D 3LN5A 1SHSA 5E6ZA 2F58L 1I3GL 1KJMA 4NBZB 4GQZA 1OK0A 5GS0C 3UG4A 1NM9A 1A7NL 3Q8EA 1A6PA 5C6PB 2A9DA 3KYMA 1H3PL 5H94B 4O2CA 1ZLWK 3TBWA 4IIQA 4YGAB 2RALA 1QTSA 3HC0A 1EHAA 3PAZA 5FCUH 5ICZA 3NABL 5IJKA 1V7ML 2JTYA 2AMGA 2GK0A 2E3VA 4FYQA 5AQ0A 2VE6B 1HINH 5C92A 3QZWA 4HS6B 3A24A 4PJFB 2WXJA 1A1MB 1T80A 4MD0A 4WI2A 4KFZC 3ALXA 5IGXL 1ZE3C 2EO7A 4H88H 2BSRA 2LU4A 3QUHA 4FI6A 4PAZA 4QRPA 2ED9A 2XN9A 1Z9SB 3MU3A 5JLZB 3KWWB 1NMAH 2P4AB 3DETC 4BIKA 3L9YA 3D25A 2QHLA 1JPSH 2BERA 2JKTM 2DWYA 1R46A 2J25A 4HIIB 3CC5A 1MCSA 3R4DA 1URIA 4HHGA 3TWCL 4L9LA 2W80C 3G6DH 3QDGB 4FI8A 4DUVA 3CFEB 1HQ4B 1QOKA 3BKYL 1IO4C 1AI1H 4BH7A 2QPSA 3ZHKA 1KMGA 4ERSL 1UACL 2DWTA 2PPCA 1OM3H 2CO3A 3ARWA 4NN6C 5IQNA 2ZX9A 3VRLE 4P5MB 3VMOA 5AWNL 3L7EB 2BSED 5E8DH 4QHLA 1FO0H 1XD0A 4YSQA 5BW7A 2FYVA 2EXTA 2EXYD 2OZ4A 4HWZB 4NN6B 1T20A 3S37L 3W9DA 5GISL 1QFUH 4D9RD 4PLKD 3QORA 4OZ4B 5ILTH 2FYYA 1BXAA 3KDPB 2XWEA 4ZMAT 3TN0D 2CJTA 1ADWA 5EH1A 4MJID 2A83A 4CBPA 1FBIH 2FWOA 3PFQA 2HT3C 4PRAA 3QNXA 5FIEA 5EZLB 4XCYB 2D8KA 1AKJA 3GYRA 4A6YH 4JKPH 1J5CA 5IHLB 4RRPM 2JFCA 4O51A 4JHWL 5D5ME 3VI3A 1TQUA 2VXQA 1FRGH 1KEMH 2DY2A 2IWFA 3CVHB 2ETWA 2J8UA 1TTFA 2OSLA 3HS9A 2XWBA 3HI6H 3MRJA 1PX4A 5GGVY 4KO5A 1EJ6A 3P0VH 3QXAB 3CFJA 4ZFGL 1M7DA 4AX3A 4QHMA 3O8XD 1A7RH 4JRXA 2B16A 4I18A 5JW4R 2D9CA 1XR9A 3EOBA 4P4KD 2OJZH 2VLJA 4BFBD 3GMNB 3V0VA 1UD4A 1UA3A 2ROYA 5BV7C 5EU6B 3UTZA 4U2ZA 4PJ5D 3BH9B 1E4WL 5CU5A 1NWOA 1TMCB 1YMMB 1MFCL 2W0KA 5KBKA 3OLGA 4HWEL 1RK1B 4EBQH 5BV7B 1O9VA 2X4OA 4ZFOL 5I1DB 4JM2F 2EDWA 3FQRB 4X4MA 4E42A 4AYFB 4DW2H 2QR0A 3KPSA 4LXFA 5E5MB 1DDHB 5GZOA 2CDGA 3JWOC 5CCGE 1GGUA 1Z3GL 4HIEA 1HHHB 2BFGA 3ARRA 1X5YA 3ZE0F 3TV8A 1ZMYA 3F85A 1GOHA 2W1NA 3DBXA 4LLAA 5TPWL 1ZD6A 5DXWA 4GSDL 1DE4A 1UH4A 4OCSH 1PCXA 4FNTA 3HLAB 1FFTB 1I7ZA 4OCRL 5ANMB 43C9B 2X3AA 1IGJB 2Y9RT 1CE1L 3EOAB 1X6LA 1R3IL 4KVCH 1BVOA 2O5ZL 3NIFB 5H35A 3ARBC 3QHFH 5JNYB 1MCHA 3OMZA 4TTDD 1OP3H 1ILUA 5GRYA 1N0XH 4XP1L 1SJHB 3BT2L 5DD0H 2R9HC 2NZIA 5BQDA 3ARBB 4D9QE 2IH8A 2VDLL 2DWEA 3HZKA 3ZK0A 1IC7L 3G5ZA 4JBSA 1QSFB 5K1JA 3SZ6A 2IADB 2KLRA 3QAQA 5EB9A 4QY8A 2YFNA 5ITBL 3IDGA 1A6WH 5DEGB 2D3NA 3LKNA 3NSFA 4LLVB 5IJBC 2HLFD 2VUKA 3AS3A 2DM2A 3UMNA 1RY7B 5J6HB 4OGAD 1MJ8L 3EJTA 4XZ4A 4RMSA 1N8OE 5SWZB 4EAEA 1G9MH 2PO6A 4JQIL 1NICA 1P2CA 1B88A 1ZLEA 2APWA 4XX5A 2VSCA 4BH8B 1GA2A 5SV4A 2IPTH 3HR5B 3CDFA 1I31A 2DLEA 3EYVA 3CNKA 1NCTA 3M07A 3II3A 3D2TA 1Y6KR 4XCCH 1NLBH 2W88A 4XP6H 5F0PB 1A4BA 3I9AA 1HAUA 3CSTA 4WSJA 4NQCB 4I2XA 5CCJA 3RI5K 4HUWA 4JR9H 3ETBJ 2R0LH 3MC0A 1EZSA 2GTWB 2YXMA 1E8XA 3VDAA 1WWBX 4M1GL 1SLUA 2AJSL 2WNGA 4GMTH 4AENB 3MCYA 5KSUA 2VERN 1ZVNA 3MR9A 5FW7A 3WUWB 4CC4A 1R3LB 5L7XL 3UJIH 3HBQA 3VCLA 3OXSB 1N6QL 1U8NA 3WUZA 3T2PA 3OAUH 1XEUA 2FO8A 5DR5H 3HHSA 4LLWA 2Q8BH 5EBMA 2YXWA 1YDPB 3C08L 5D4QA 3ABLB 4WW1A 1B0WA 1RXLA 4TMPA 5FO7A 2F74B 2FVNA 4J6RL 5D7SH 3QCUH 4PGDA 2EILB 3GMLA 4RMQA 4NQDB 1H8SA 1EUTA 5E8NB 1F2XK 2WBXA 4CN6A 5HHVL 4BFJA 2KPNA 3LYRA 4MJJA 2X4RB 4KKAD 4JJHA 1Y18A 3ILQC 4AK1A 4GP4B 2XZZA 1RMFH 4PLOB 1ZS2A 1PFCA 3D9AL 5CIPH 2IH3A 3UTTE 4PJAA 1MCLA 3LNEA 5DRNB 1SF3A 3FJTA 2H2SC 4BK5C 1JGLL 1SM3L 4UOJA 4C56B 1FYTD 3QUMA 2VXTH 4N8UA 4Z3EA 4ZOEA 3U6XA 3QJFA 3O4OC 4QLWA 1OF0A 1P5VA 3M17B 4R7DB 3T6ZA 4JKMA 3LS4H 3O4OB 1SYVB 2UYLB 4IM8A 4MMYA 2BSEA 4S1SH 4PREA 1BVZA 3DRTA 4PJCB 1V3MA 2D2OA 2CLZB 1IAMA 3FU9A 5LBSL 1ET5A 2AJ3B 3NMEA 4JY5L 3RY6A 2N01B 2ZX6A 3NQKA 3AY4C 2KUTA 5DJDB 4F8LA 3MAWA 3MXVL 3PJSA 3NIDF 5H37A 1M9SA 3KYAA 4PHXA 1VIWA 2YEVB 3A23A 3JV0A 2VR6A 4MDIB 4WU5A 5TF1L 3TCTA 4F80A 1MDAA 1HQRA 4NO0B 4U05A 3JUZA 3R1GH 1N26A 2GJ6B 1XF4B 1WCBA 3IXAB 5CR8A 1MVUB 2H45A 1ZAGA 3SZKC 3F3HA 1XAKA 1BA9A 1QABA 3TONA 5F1OB 1T03L 4X8XA 1GJWA 2Y5EA 4B9ZA 1ZLWH 4AKPA 2UX6A 3BSGA 4H8UA 2Y06L 4KDTC 4Y4FC 2QQNH 2F6AA 3BAIA 3R06B 5GGVL 3UAJC 4DTGH 4PRDA 4XGZA 4EDXA 5EU7E 4EN2A 2P42B 4G6AC 3SGKC 4DZ8A 3IPFA 3O8XA 3JWDL 4Y4FB 3B3BA 4G5AA 1KB9K 2EDBA 3ARDD 4L3ED 4P4KA 3QZLA 4IBLT 2ADYA 2QDVA 1YEJH 2NY2C 5HI5D 4LVHC 2DMHA 4PJ5A 4Q0XL 4K7PL 3WV0A 1E4JA 3IU4H 3HFMH 2NY2B 2OZ4H 3KEHA 5GHWH 4A2MA 4B6ZA 4LVHB 1H6TA 3MJ8A 3T0DA 3F7VA 4S1DD 4GYBA 2N7BA 4ORGA 2V37A 3GLDA 1MFDL 3VDCA 1XBDA 1PZ3A 4IRJC 3IKKA 4TYUA 1U8MB 1NCGA 1YUKB 4Y1SA 9CGTA 1BCIA 2V3DA 3NG5A 2R2HB 4RSVA 2QHRH 3VG0H 1M57B 1AZZC 3P3RA 4IRJB 5B7FA 5KSBE 2OXHB 3CLWA 3RFZA 5L4JA 2Z92A 2VXQH 1P5UC 3OQRA 3UABA 1EDHA 1BW8A 4Y5VC