2XETA

Conserved hydrophobic clusters on the surface of the caf1a usher c-terminal domain are important for f1 antigen assembly
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
89
structure length
89
Chain Sequence
GGRLFLHLKRSDNKPVPFGSIVTIEGQSSSSGIVGDNSGVYLTGLPKKSKILVKWGRDKNQSCSSNVVLPEKTDISGAYRLSTTCILNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords F1 CAPSULE-ANCHORING PROTEIN
publication title Conserved Hydrophobic Clusters on the Surface of the Caf1A Usher C-Terminal Domain are Important for F1 Antigen Assembly.
pubmed doi rcsb
source organism Yersinia pestis
total genus 20
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13953 PapC_C PapC C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2070 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2xetA00
4J3OD 3L48A 2KT6A 2XETA 3RFZB
chains in the Genus database with same CATH superfamily
3D4CA 4KZDL 1NOLA 4U3CA 1OANA 3M17B 1CR9H 4HFWA 3G6JF 2XZZA 1S3KL 4NQCE 3REVB 4PRBB 3VD2A 4HKBB 5LBSL 1BVKB 1AR2A 1QLRB 1TZOA 5JHDB 4BSVA 1KBGH 2G5UA 4NQSB 4OIBA 3NSCA 3MLZH 4KMTL 1T20B 5BV7C 5CGMA 3E6HA 5CJQH 2UXFA 3SZ6A 3UBXG 1QX1A 1DQVA 4FQIH 3WUWA 1AD0B 4DETA 3GLEA 4K3EL 4G9DA 2NXZC 3WIFB 4HS6A 2GB2A 4XCFL 2NDGA 3HUJF 4LLMB 4AW4A 1ICTA 4JFZL 1A3ZA 2XIBA 4JO1L 2SEBB 4M9PA 2C9QA 2FX7L 3U36A 5IJVB 4Y4FC 5E4IA 3F84A 1DVXA 2IH3A 4ONHA 1UOWA 2GBUA 5GS0C 4PCYA 5KJ4A 3VI3E 4A2MA 4QHNA 2OSLA 4ZS6D 3U0PA 3WKQA 4N3UA 3PGFL 5T3XL 1BXAA 3DHMA 2IADA 3MRMA 3ULUL 3ULAB 2WV3A 4W6XB 3CC5A 1CJYA 1NGXA 3GNML 2WP3O 3RWEA 4NQDD 3RNQB 5BRQA 3TNMA 1XGZA 2B4CH 1JNLH 1L0YA 2UY7A 4LBEA 4N85A 1SJEB 3VGAB 2CIKA 3OKLA 3V95A 1ZT1A 1P5VB 3RPKA 15C8H 4L8SA 5FO8A 3WNIA 2CR3A 3RDTC 4YIQA 4BA8A 4N8VG 3OAYK 4IBLT 1VFAB 2FT6A 1IAIL 1FFNA 1PCSA 1R3JA 2ENJA 3X1NA 3VE0B 2YPLE 5T5FL 3UTSA 3LIZA 4LCIH 4MNGB 2RQ8A 4YSSA 1QTPA 2FX9L 2QLVB 5I6KA 3CFEB 4FFWD 4HDIA 4EUPB 1TQUA 5DGRA 3BH8B 5CU5A 1A8JH 3NZUA 3LKPA 3NCWA 4YE0A 3QXVA 2NY4D 2Q20A 3RVTC 1I53A 3L3OC 3T0BA 3S98A 3MZGB 4G5AA 4UYPA 2ZCKH 4DHLA 1NGPL 2FYYA 1EEQA 4AIOA 4Y4FA 2A9DA 3JTSA 4QXVA 1NUFA 4WY7L 5KS9B 1U8CA 3I9AA 3MRIB 4ZX3A 1MRCL 1FUNA 1CFQB 1WITA 1M9SA 2BC4B 3L2NA 2GAZA 2DYPB 3ZE0F 2AJSL 2EYRB 3WIHH 3KL5A 1CGWA 5IIEA 2EH8L 5C2BH 4HGWA 4ZS6C 2D7TL 5AEAA 2EE2A 1ZAGA 3QYCA 1WV7T 3QZLA 1UT2A 2NSMA 3PJSB 3H9SE 3OZLA 1Y6NR 4JVWA 3WOVA 2HKFH 2BSSB 1P4LB 2LR4A 2Z92B 5HHXH 1DJWA 2B15A 3RDTA 1ADQH 1D9KD 1ACCA 2YBRA 1J0KA 1Y1DA 3DARA 2XQYK 1EHKB 4CN6A 1R47A 4IQHA 1BBDL 3AJ7A 4X8CA 1TTCA 1V55B 3DDFA 5F7BA 4WW2B 1TVHA 2NTFB 2VDOH 1DQLH 5DD0H 4HMEA 4WO4B 3WSQL 4EMZA 4ZMZA 4DK6A 3EF7A 4AGOA 4FFWC 5IB5A 1FCGA 3IMSA 3BKCH 3L3OA 4D3CL 4BZ2L 1TTGA 5KSBF 3BN9D 1MFUA 4M7KL 3U6RA 2DYSB 2NY4C 4BZ1A 1AIZA 3IFPA 2D7NA 4OLXL 4JFOB 2OCFD 1W0VB 2LU4A 4YR6B 1D6VL 3R7RA 5HDWA 1J5OL 1DFBL 2R9HD 4IGBB 3KYOA 2B1AL 2XXGA 5CJ5A 3QUHA 1Z5YD 4BBWA 1G0DA 2D9QB 4DCQA 4QRRE 1N59B 1MUJA 1T2QL 5EFIB 3ZK0A 4P06A 3ZL1A 2HTKD 1PY0A 1BOYA 5AW8B 4I48A 5LG1A 2ZWNA 4TQPA 5SX4H 4MA8H 5C0EB 5T1LD 4K3HA 1YEEL 3RIFF 4YLCA 1KG0A 2PETA 3HBPA 4P0DA 3IXTA 2Z6FA 2IH8A 3N2JA 1NEUA 4NQDA 5E0FA 4GAGL 3CE1A 3MOQA 2EDFA 2WVVA 5T1KD 2OA9A 2ZUUA 3SJVD 4F8TA 2N7AA 4D9RE 1T22A 2QGDA 3PV6B 3F6IA 3FO0L 4XNBA 5E4EC 2A73A 2Q86B 5K9OA 4PGCB 3P11L 1W8EA 4NXKA 4GO8A 3K3QA 5IEHA 2DD8H 3LNDA 3MFGB 5C2UB 4ZQKB 4EQ3A 1BM7A 4LRNL 1XGTB 4H8VA 3FQ1A 4B9ZA 1JPEA 2CKBH 4FD0A 5E2JA 4AEHL 3C9NB 1KCSH 4Q2ZA 2VLME 4HJIA 4U1SA 3VVWA 1GCFA 1Y1UA 2HT3D 1NJ9B 4E42A 3TONA 3IXAA 1WBYA 3L2MA 1BQUA 5GRYA 3V0IA 2AMUA 2YD9A 3CSGA 1DBMH 1U8MA 4KI5E 2Q6WB 4EN3D 5ACZB 1QP1A 2FQDA 1IARB 5DJ8A 2EE9A 2X1XR 5AVTB 3DRQA 1OPGL 4OCSH 3Q2CA 4N4YB 2WBWB 1D5IL 2R9HC 4X7FC 3B8YA 2O61B 4KVPA 4H8UA 4P5TB 3ESPA 4YHMH 4AQ1C 1JNLL 2GUOB 1QEWA 1J1XL 1MDTA 3B9KD 4L8CB 3OR6B 1MWAL 2R0WH 3GM8A 5I1HH 2HTKC 3QQ9D 5C0RL 3QZNA 3U0WH 1BZQK 3T77B 1INEH 2Y9RT 1LGVA 2H2PD 3B4NA 1DVYA 4LHUG 4OTXL 1A4BA 2WTRB 4HFUH 2BWQA 4MB4A 4MAZA 1KTCA 5EH1A 2WXIA 5IW6B 3H9HB 4DJMA 4PB9L 4AIZB 3F7VB 5F6HI 5CSBA 1I9JH 4EOWH 3OZ9H 2JB5H 2XZCL 4LLWB 3PHOB 2KQNA 4LCIL 2VMCA 3SGKC 2ROYA 1CXHA 1E4XH 1U30A 4JN1L 1UCBH 1MFDL 3U2JA 1DBKL 5ABDE 2ATKA 1SJHA 2G60H 3CFDA 5ESAB 3RL2B 4QYOA 4UB0H 3GLAA 3IWUA 1P7KB 2OL3H 5EU5B 1FCCA 4GEJA 3BRDA 1SPDA 1NBYB 2ZYSA 5EBWB 2VM4A 3WD5H 4L1TA 4E9SA 1K5WA 4HZLA 3B37A 3CFNA 3FUFA 5KYUB 5GHWL 4NQCD 5GJSL 3BKJH 4DZBA 3QUYB 5IVXF 4MMZB 4V1DB 4V33A 5I6LA 2NCMA 2HT3C 2NY0B 1CO1A 5K9QI 5H37G 2A77H 4G80B 2FHBA 1CYXA 2ZYRA 4OY9A 1C7TA 4PREB 3I9IA 1TJIH 4PJXF 4FYTA 3LPOA 3WDJA 4XC1H 5T3ZH 5H2BB 3D85D 1S7VB 1AGFA 3P4NA 4KJQD 1N0LB 2N7SA 5IBTH 2CDEB 3U46A 4CGTA 4ZPVA 5IT2H 3HLAA 3BLBA 1MFCL 2QADD 3HAEA 4JS7A 2UWEF 2GSGB 2AGJL 5T1LA 3B9KC 1FVDB 2G5RA 1S9XA 2WQAA 1U8JB 1DHKA 5JHMA 3IT8D 3UGEA 3P40A 3QQ9C 3SO5A 3UMTA 1CGTA 1N18A 2NUPA 4TXVB 3UC2A 4TLUA 3U1QA 1ZOXA 2UY6A 4JO5A 5D7JD 4FNUA 1PKQB 3SGKA 5ERWA 1EERB 1LO4L 2ZWKA 5FGBC 3SJVA 3TN0D 4JLRB 4Q89A 1AP2B 4Z0XB 3H3PH 1TYJA 3FN0L 3FB5B 3FH8A 3GHBL 4Z7UE 5BUAA 1BYPA 1V3LA 1IFRA 4N2FA 5C0JB 2WNXA 1NSNH 4HZ1A 1SXAA 1MH5A 2CDGA 4YSRA 3OJ2C 4U3SA 4DN3L 1LE5B 2DEXX 2F19H 2YPLD 2ZCLL 4WK4B 3QZMA 5KVGE 4UT9A 1FVEB 2RGSA 2ARJA 3CDYA 4OZHA 5D9SB 1AO7E 3T09A 1AQ8A 3WGVB 5EBLB 1A4KA 4QXTB 4I2XB 3BJ91 1LK2A 3EUDA 5J9PB 4B9YA 2H1PL 3ARGB 1J1OH 3BKYH 1XIWB 2YD0A 3G6JB 1N2RB 4FZEH 1AD9B 3BUYA 2XVGA 2BWIA 5L2JA 1WAEA 5D7SL 1NCGA 1A4AA 1UADC 4FKEA 1AS6A 3OAUL 5EIIB 4X8JB 5L7XL 5E99L 3S3SA 1JSYA 4RNRA 1A6AB 4KJQC 3LEVL 4HMDA 1CI5A 3N9GH 1OK0A 2ESVE 2QADC 2UX7A 1J12A 5GRJH 4WTQA 3HUJB 6FABH 3NEOA 2MQGA 3VD7A 1F4XH 3EGXB 5FGBA 1TQBB 4N0CD 2ROXA 4LSSH 4R6UA 3QXAB 1UB6B 1RULL 3R06B 1RJLA 3H9SD 3KYMA 3OWEA 4X5WA 5E8NB 5I5JA 3IGAA 2I69A 3CZUB 3TN0C 2ALAA 4LLVB 2E9IA 4FCAA 4HSCX 4K94H 2NZ1A 1GZQB 3CQPA 1E8XA 1RHHB 2CR0A 4HXAL 3ASWA 4BSWA 3TT1H 3D39E 1WZ1L 4W9KC 5EN2A 5K9KB 5F7NC 4YDNA 3EJUA 1ITBB 1HHKB 3CXDH 3QFJA 3PL6C 5FFLA 1OAYL 4NQCA 3WHE0 1TENA 3VG9B 4IJTA 2VN3A 1NCWH 1JHTB 1K6QH 1T03H 3CPLA 2PO6B 3TIDA 1MJ8H 1ZT4A 1Z2KA 4X7TA 1KCKA 1DN2A 2W1NA 3S6CA 4EXKA 2UZIL 3MX0A 4FQXD 4UT6L 3AY2A 5ETUB 1CN4A 5IVZA 3L3KA 5B3JF 2DIEA 3D85A 3L4CA 2J6EL 3OTTA 3F5WB 1RMFH 1VEMA 2MPVA 1B2WL 5I1GH 3IF1B 4K5LA 5DI8B 3VXRE 5GSRB 3RPIA 4IEFB 2GSMB 3HNSH 4TUJA 2DN7A 4QTFA 1T4KB 3CZFA 3CCHA 3IU3B 5JZ7D 3QUKB 1X4YA 4WTZA 4G42B 1HILB 1MI5E 2APSA 3OVUB 2AW2A 5KANG 4EI5D 3WGUB 1DVSA 5H94A 4UQ3A 1YEHL 5E8OA 3KPNA 4KK8D 5F7DB 3KE0A 5FUCE 1JERA 4YQXL 5E9AA 3RB5A 3UP6A 3NEEA 4G1EA 3ZKQD 3TN0A 5HI4D 2VAAB 4G8GB 2BOCA 3MRGA 3QAQA 4IRJD 3BPCB 5F8RC 5AD0B 3ZE0B 5GIRB 3SPGA 2I32A 4FL4C 4H8PA 3DYPA 2ADFL 2C9RA 4WFGE 4L1DA 3RFZC 1P4IH 4ZX4A 4AKQA 4FQPA 5FCUL 1GZPA 5DQ9A 1JK8A 1K8DB 3EJQA 3PL6A 1C08B 4LNRA 2E4TA 5J6HB 3RG1C 4OJCA 2G75A 4Y19E 2NW3A 2YPLA 4CSSA 4JQIA 4HPOL 3CZNA 1ZA3B 1G7QB 3H53A 2A9CA 4NP4L 1VLXA 3RGHA 5D4HA 3QEUB 2VDPH 4DGUA 5KVEE 5ICXA 4X4ZA 1OP5H 3SPJA 4EN2A 4XXWC 1FH2A 1A22B 2K1MA 1L7TL 1ZHNB 4O9HH 1HFUA 1KTLB 1NCBH 3FT0A 1I3GH 2X53A 5HPMB 1U8OB 1S7TB 3K91A 4FQXC 4OAWB 5IGXH 3E8UL 1LXMA 4Q6KA 1YEDB 5BZWB 4KI5D 5I9QC 3HHSB 4L48A 4MQSB 3JZ7A 1YSOA 5A7EA 2RR3A 5KSBB 3WMQA 3QHFH 3CDGA 5DVLA 4Y0GA 5JZ7C 2NQ3A 2XG5B 4D2NA 4RH4A 2CKNA 4F8LA 4HHAB 4EI5C 2IFGA 3ZZSA 4KK8C 4Z7WE 1EHLH 1FSKB 3MRJB 3MA9L 5GGTH 3H9SA 4ONOA 1S7WB 4CSZA 5A16A 5GQBA 5BS0D 3OKOB 4BQ6A 5EWIH 3TEWA 2IC2A 5HI4C 3RFZA 3OM3B 3GSUB 4Z7NF 5HYJE 2PXYA 4JPSA 1EA9C 5EZIH 3ZT5A 4YHYC 1JI1A 5E6YA 3DK2A 3LIUA 5I17B 2P7TB 3LX9A 4M7ZB 3EO1A 3MDJA 1TCRB 3T0AA 5I6OA 4DGVH 4HEPA 4TSCL 3EJSA 5IVNA 3QUMA 1NLBH 4M6MH 4F93B 4XXWA 1W72L 4N90E 4KTEL 1ZGLA 4X5XB 1ACYH 3HR5B 3QEHA 3LNEA 1CDIA 1YG9A 3CZEA 2DLFL 2H3XC 4QHUA 3GHPA 1WFJA 3OKNA 4HIJA 2VMJA 3BIAX 4NKQB 4LAQL 2NXYD 3OGOE 3DGGB 2MIZA 3IJHB 3QQ3B 2R0KH 4B95C 1N70A 4K07A 3MRDB 4JFDB 3RVXD 4BSJA 4NNYB 5EDSA 4KI5C 1KXTA 2EXYC 4X7DC 5DVKA 3O8XD 1RPQA 2APTA 4LSSL 1KDJA 4A7GA 3JUZA 3VFMA 4M8RA 2GKIA 4ZMNA 1HE8A 1FC2D 4WWKB 4OCRH 1MW1A 1F56A 4ODUA 1OD9A 3IMWA 2PYFA 1H6UA 4OCXL 4EI5A 3GPSA 5DEGA 4Q9QH 2D73A 5AW3B 3VFVA 2APXA 4ELKA 2BZ7A 1GGUA 1HOEA 2PWDA 1RI8A 4FG6D 5GGRB 4BH7A 5IUCA 1A2YA 4HHWA 2ID5A 1KN2H 2PYEB 2ZUVA 3CXDL 1VKXB 4BJLA 1I8IA 4DUXA 2Z31B 2GSIB 3AMLA 4AQZA 3WKPA 1X7QB 1YA5A 2N1KA 4J3OH 1AGDB 1U8IB 4BWWA 4LHQB 3WE6B 1JFHA 4PUBH 5GSVB 3T3MF 2IVFC 4HF5L 3WLBB 1BFVL 3MRLA 4UTAH 2QQKL 2F1BA 4XB3A 2XWBA 3QG7H 5D2LE 2B5IC 3GJFA 4HUWA 3B6SB 4JHAH 4PG9A 4ZRGA 1RURH 5DMIL 5AW5B 3DSFH 5IP4A 3DX3A 1YMMA 2MQ0A 2OMVA 3OKMA 4XCEB 2ZWYA 4L4VD 3BH9A 4LT7A 1X9UA 2V5MA 2F74B 2A9NL 4YZWA 1TETH 1XH0A 1W6WA 4MSWB 5F1SA 1F2XK 1NCCH 3WTTA 1JYWA 2EABA 5CN2A 2WC7A 1H3TA 1RPKA 3RTLA 2HLFD 3RVXC 3PGDB 4BFFA 1SEQH 2BDNL 2NY7H 3QNYB 5C0CD 3O8XC 3L95A 4L4TB 3TYFA 1YO4A 4H8WH 4H26B 4M9OA 4PJGE 2WB1A 4E9LA 2X6BA 3SDCD 3QG6B 4PJXB 5ACLA 4OB5L 3NGBC 2VERN 2YUWA 5CIPA 2ESVD 5EBGA 4XBGA 1MCNA 8CGTA 1WZMA 3ARZA 3WMPA 2VH5H 2ICEA 5ID1B 1AKJD 4X4MA 3SBRA 4JY5L 4WHYH 5GGVL 3T3PE 3UPCA 3DO7B 1Q1JL 4RIRA 3OKEB 5BS0A 3CFKB 3QP3A 2W07B 1GKEA 4WI0B 3BP7B 4FTVD 1ZHKB 2E75C 2CBMA 1L3WA 1HDMA 4JRXE 4OD2B 4AGMA 3O6LH 1TITA 4FN0A 1L9QA 2JLLA 2JJUA 3S2CA 4Z77B 3HNTL 2H0FA 3EDKA 1EBAA 1C5BL 4FQJH 5DJZB 4D9QE 3K72A 4WU7B 1CGVA 4TQIA 2FTAA 32C2A 1X7TA 4WNQA 5DEFA 5E00B 4DGYH 3FFCB 3L6FB 2XPZA 3A4FA 2IGTA 1XB8A 2QHRH 2XQYG 4F3FA 2AMGA 1U91A 5IJCC 5JYLA 1X44A 3G5YA 5CP7A 1KYDA 1X5IA 5DS1A 3IJ8A 1YYLH 4MA1B 3RJOA 3ZXAC 1TVBA 4P5MB 3AC0A 1UQSA 3OAYH 1NDMA 1LTXA 4WV1B 4OV5A 3LKRA 1MCOL 3QUGA 4MXVE 3G04A 3O8XA 3W9EB 3BQUD 1MCFA 2AEPH 2A83B 1QFWH 2HLFC 3M1BA 4JUTA 5ENWA 4PJHE 3UAJD 1H8SA 2FSEA 3GD1C 1TJMA 2HLEB 1PX3A 4FI8A 3SDCC 2ENYA 1ORSB 4O02A 1Q0YL 1MI5D 1WBXB 4KNQA 1HQRB 3NA4A 3N1GC 1N8ZB 4UILH 5JXAH 1GW0A 3U2SA 1U6AH 4FZ8L 5BRZD 3QORD 3NEXA 1DQTA 4NRZA 4YLBA 4JJHA 4DGVL 3TO4C 4F7MB 3ZHFA 1AI1L 4UZUA 4MA3A 1U93A 3DTXA 3P0VL 2OTUB 3CFQA 1UYWL 3DJTA 3LMJL 5EF1A 4NM4L 3E2HC 4L5FL 1S7UB 4WFGD 1AFVL 2YAMA 2CPCA 5KOMC 2FK9A 3BVDB 3FMGL 1TQWA 3HC3H 1DL7L 2VSMB 5HHNA 3VD5A 2WZAA 5HDRA 2VLRA 4CILA 3SY0A 2AANA 5TGBB 3ULSA 1YEIL 3U9WA 1TKWA 3DETD 4L4VA 4K8RD 5CSGA 3OC8A 4NOBA 4QHPA 2H0EA 3ZMRA 4OR1A 4B0MM 4FRWA 2RBLA 4QY8A 4DN4L 4E5XA 1YEGL 4GS7B 1UTDA 8FABA 3VXOA 5AVSB 1TT6A 3CFMA 3VFSA 4AV5A 1ZLUK 5CLYA 3EBIA 1DQKA 1U9KA 4AMXA 2MMXA 5D7LE 1UXSB 4R2GD 5JQ6L 5C08E 1X5AA 3VCLA 3QULA 1CVSC 5C0CA 1WS7A 1FQ9C 3ARDD 4G83A 2CO7B 3S0PA 1AZVA 4H7VA 3RWJA 3SDCA 4HT1L 5FF6B 5DWUH 2L7EA 3J07A 3WG7B 2X9YA 1CFNB 1KXVC 3TM6A 3VGBA 1HXYA 2OJZH 3DIVA 3BP6B 4IYKA 5BQ7A 1QG3A 4YHKH 1AKJA 1A7RL 4FLHA 3ZTJH 1EJOL 1IBZA 2I25N 1OSPH 3IN2A 1GYWA 3TO4A 5DHEA 3WFHA 4YUEL 1OTTC 2IH9A 4FTVA 2OV0A 1G4MA 1TZGH 2JE8A 3F62A 3QORC 4MZIA 4MNQD 4TVUA 5L6YH 2AITA 2FJGA 4HCFA 1WICA 2IBZY 4DP7X 3UG5A 2A6DB 2BSEA 1KULA 5E6ZA 4ZTPH 1X5JA 1KZQA 2WVUA 3ROLA 2BRRL 4ODVH 3ZIYA 1F4AA 5HYJD 3SBWC 1I9RL 1V10A 3VXNA 3EBHA 4TL5A 4LGRB 2DOCA 4ZS7H 2G30A 5JO5A 3SDAB 5INDB 4L3AA 1SDYA 2OI9B 3B8SA 4TRPL 4OGZA 4EPSA 2E74C 2HYMA 4G8EB 1L9TA 2FJUB 5BZDB 4FFZA 1EIBA 5FO9B 3DETC 3JXAA 4K8RC 1H19A 1ASOA 1JWSB 4FQ1L 3QYMA 3BD3A 3NQKA 4N90D 1F5WA 2BY1A 2HG5A 5F9DC 1D5XB 3FB7B 2GT9A 2ZX6A 5IROD 1HQ4A 2ZXBA 5B3NA 4JFYB 3ZMNA 4MAUH 1HZKA 1IFHH 2DQEL 1T5XB 1UD6A 2XX0A 4B9CA 5KN5A 3GMLA 2IXQB 3FB6B 5PAZA 3WS3A 4U1LA 3FUNA 2FEDC 5DR5L 5FUOH 1JZ8A 3D9AL 2O5XL 3DPBB 4ZMXA 1KXVA 2H45A 1PLAA 2H26A 2VXSL 4QI3A 5EO9A 3TF7C 3QDJE 3C2AL 4NZDA 3US0A 4S1DD 1F8TL 3GBMH 4UU9A 4U31A 5AKTA 2ARJQ 4OM1L 4CADA 1TSHA 4FF9A 5HVHC 3VXTB 3QDME 2K6ZA 2YSSB 3FOLB 4JFSA 3QORA 5D1QD 5BRZA 2EVGA 1NGQH 1XF1A 4JHUA 5DZJA 4YN3A 2OMYA 3IFNL 2AV1B 1DVFB 2ITCB 4OBSA 3MUUA 5D2NB 4YSUA 4FXKC 4OZHF 4TVPH 4A7TA 4M4RB 1BW8A 1XZWA 2CH8A 3HE7C 1OVZA 3SBWA 3VD3A 4FEIA 3LAFA 1N6VA 4X7CC 3TCLA 2E7BA 1NEPA 2XPGA 4OV6F 3LKOB 4HFWB 5I1AA 3ILPA 4KROD 4BSVB 1UOLA 2B4CC 3EDDA 2C7UA 5ILTL 3E6HB 1ETA1 4UNIA 2CJSA 3OL2A 4Z7NB 3WUWB 2VXUH 4NUGL 2AJ3A 2BVPA 3APNA 4HLJA 5F7HA 4G9DB 4M00A 4RX4D 2VUOA 3O4LD 4XPGH 3LHPH 4APXA 4PWKA 2CSPA 1EVTC 4GXUM 3V0EA 4HS6B 2QMJA 3GB7A 5FYLH 1F41A 1F6AA 3HN8A 3S5LG 2C26A 3BEWA 1G0YR 1SXZA 3ESNA 3EBGA 1KJ2L 5IROC 3H2WA 3S2AA 5I75C 4CN4A 5FS5A 3U36B 4A63A 1XCTA 4YDVB 1P7QD 4ONHB 2IH3B 3KLSA 1RUKL 1UWEH 5FKAA 3FTWA 4EZLA 2BHUA 4BH8A 4QHNB 4X0KA 1N7MH 2OSLB 1S2EA 1T7VA 1EGJH 3U0PB 4QLWA 2CHZA 2IADB 3MRMB 2NLJA 4M1GH 4TUOA 2RIKA 1AOHA 1IILE 1N26A 3CC5B 4AJWA 1NGXB 1E6JH 3TJEL 4B5EA 3DX0A 4FOMA 1B3IA 4GXUN 1WO2A 1RZ8A 2A9BA 3RWEB 5EO0A 2FATL 2HFGH 3ATFA 2UY7B 5D1QC 1YECL 3ZRFC 3MU3A 4LBEB 4MNQA 2B7DT 4FXKA 3RWFA 2CIKB 1TJGH 3OKLB 1ZT1B 3HE7A 1RJYA 4L8SB 4AT6A 5FO8B 1FE8L 5EOCH 3QJSB 4YIQB 3FHEA 5FR3A 3QDGA 2R1YA 2R7EA 3II3A 1H3PL 4L3EE 4F8PA 1FFNB 1R3JB 5LGYA 2XTLA 3TXAA 3O0RH 4RZCA 1KCRL 5B39G 4LDLB 4H2AA 5FM5O 5BV7B 2R0LL 5FYJL 4Y2LA 4RGND 4KK6C 3RBSA 3Q6GL 4HDIB 1S4IA 3D52A 3EDEA 4KROC 4EBQL 3DK0A 3HN5A 5HYEA 3HG1A 4FP8L 1DUZA 2NXZB 2VR3A 4HCRL 3T3MB 3O4OC 3I75B 5TDOA 4WWOA 1RUQH 3TBVA 5IROA 3VI3F 5DHMC 2XWDA 1PG7X 1J1PH 2FYYB 3HIZA 4Y4FB 1SDDA 3B9VA 4JMXA 1RUPH 2OZ4H 2YAPA 1U8CB 1DLFH 3BVNA 2Z7UA 2PW1A 4PCTA 4ZUVB 4LSRH 1HZHH 1JRHI 2X4TA 5IIEB 1HWHB 1NC4D 4GIOA 4HGWB 1J0HA 3MRKA 4I1NB 5ICYB 1N5YL 2VDLL 5CUSH 3ULVH 4RA0C 4LQFL 2YA0A 5CD5D 2FB4H 4A7VA 5D1QA 3IJYA 4W1TA 4MZRA 4XHQA 2VSKB 4F37K 3RE0A 1M4KA 1FHGA 3RWHA 4NWTH 2E8ZA 3RDTB 2P47B 4I7ZC 1T21A 3JT0A 4L37A 3WIHA 3IMVA 2YBRB 4XVJL 4DESA 5I26A 3L5WA 5C86A 5I0ZA 3CFIC 2HRPL 4HCGA 3N0PB 5F7LB 1M05A 5C3IA 3R8QA 4UZSA 2CHDA 3DYOA 1USQA 5I6PA 4DKTA 2YJLA 1TVHB 3ZUNC 1C8QA 3IAGC 2GBTA 5D2LA 3OLDA 2ZCHL 4RAVB 1ADQA 4RGNC 4XXCC 3AUWB 2V9UA 4M03A 1YLBB 5IB5B 4FERA 5FM4A 3L3OB 4YWGH 5AW0B 2Y06H 3O4LA 4FNLL 2XZQH 4WTXA 1KTRL 3IRPX 2WY3B 2ZWZA 1OTSD 3IFPB 4RA3A 5FA3B 3GMRA 2VWEC 4KPHL 3V9CA 2YIHA 3HI6L 5IBLD 3PV7A 4N8VA 1RZQA 4RDQG 1P7QA 4WHTB 1GMIA 4ZDHA 3HB3D 2J1WA 4WGWB 1HN1A 4DCQB 1MQKL 2JCCA 1UCTA 1KGIA 5HJBA 3AM8C 3TCTA 5D7LD 1QSFD 4I48B 1OARL 2NYKA 2C9PA 3FL7A 2ZPKL 4J4PD 1D2PA 1F00I 1ZCRA 4KO7A 3IXTB 4NPKA 5T3ZD 1OM3L 3BEVB 1RZKH 2DI9A 4NQDB 2EIDA 2R4RL 1MY5A 4NERA 3P3SA 5CD5C 2CJ3A 2WVVB 2XVBA 4YX2L 5DUML 2F8XC 1DVZA 1VACA 5B7EA 4AUJA 5GS3A 2IOOA 5IMMB 1Q9LA 3TO2A 1I8KA 1CFSA 1EWHA 1HIMH 2A73B 4ABQA 4HG4J 2KDYA 2PPEA 2YUXA 5BO1H 3I6SA 5IEHB 1GGIL 1H9VA 1IC4L 4RFOH 1CGSL 1QRKA 4LLQA 1XGQA 1T0OA 4M5YL 5DCCA 2E9GA 5ADOL 3W0WE 1LDPH 5KBLA 5F1KC 4FTDA 3PXJA 4XXCA 4G6ML 4U1SB 4LHUD 4C4KO 3SO3C 2IWEA 2ZTBA 3WBDA 4HX1A 2NY4B 4E42B 4A7GF 3O3EB 4XCCH 2G2PA 4Y88A 1C1EH 1HCYA 1JZFA 3F83A 3IXAB 3MR9A 1RPUA 4HJSA 2Y7QA 4GYBA 1U8MB 2YC1A 4O2FA 3F00A 4N1HB 1OTSC 4HAFA 1BG9A 1ZANL 2AVGA 5DJ8B 4OCWL 4CVZA 2CKBA 1JPSL 3O2DH 3DRQB 3OJDA 5LGKA 1OP3K 5EORH 2YEZA 1PL3A 2KDGA 5IBLC 3BMVA 5LQBH 3AM8A 4NT6A 4OU3A 3LD8C 4ZMAT 2IPUK 2HA1A 4PVNA 4OQ1A 3QAZC 4HK3N 1RZFH 2OCCB 1JK9A 1NC4A 3BUQA 5CGYD 3UX9B 2LLNA 3FZUD 3N55A 1CD0A 3C09C 3QDJD 2JKSA 1GVIA 1G84A 1MCPL 3IDNB 4UINL 4UTBH 4KDTC 5C0BE 5C8JB 1XGYH 3CVHL 2EICA 3NPSC 1SVCP 5E4EB 4EF3A 1D9KB 4IDJL 4KUZL 2LE9A 1MCQA 3CSFA 5C0AE 1MREH 3FRPG 1UM4H 3IU4H 2ATKB 1SJHB 3CFDB 3CZKA 3TEXA 4E9TA 2V5SA 4QYOB 1FV1A 2Z7ZA 4M5SA 3X1BA 1SUHA 2VQTA 4QHKI 4HZLB 4KH2A 2ZKYA 4XO3A 4KI5F 3HI5H 1A9VA 2WNKA 3CC1A 4A2EA 4PJ9C 4DZBB 3U1SL 2ED7A 1YEWA 3SKUD 2XY1A 3BN3B 2P1YA 5D7KD 1ZLWK 2OYMA 5KYNA 1J8HE 4P4RA 1Z3GH 4JGMA 2FVNA 2OL3A 3C5ZD 3QRBA 4RSVA 3HLKA 2ZOTA 4GKSA 1WA0X 4TF4A 1YNKL 2F54D 4OIIL 1AGFB 4AQ1B 3P4NB 3C6SB 4K9JA 5DD1L 1X5LA 4K7PL 1NDGA 3LQAL 4ZPVB 1WE5A 3HLAB 3HAEB 1QSFA 3KH3A 1O6SA 4RGMC 5T1LB 1S9XB 2LU5A 2GHWB 3IDGA 5DJ2A 1E3FA 3SE4C 2H3KA 4TSBL 2NUPB 3FZUC 4GXVH 3BDYH 4F8NA 4JPWL 4KDTA 3FONA 2ZOKA 3BKMH 2UY6B 1U8KA 5T1KB 5ERWB 1FO0L 4GKNA 1SHSA 3JWDL 3SJVB 4XNZC 5DT1L 3MNMA 3RP1A 2X38A 1F1DA 4BFJA 4HH9A 1IGMH 1MCKA 5D96C 3AGVA 4HW6A 3ZU8A 1B0RA 1M7IA 1MH5B 4WW1B 2RFXB 1LO2L 2KC0A 3AQYA 4QOKE 4U3SB 5I74C 3SDYH 3ZZ1A 2J55A 5JPMC 4L3ED 4PJ9A 4XO4A 4FMFA 3T0DA 3PDGA 4RETB 5FDYA 4LHUA 3GQFA 2A99A 3H7BA 4M93C 4OZHB 1OGAA 4Y1AE 1A4KB 3EYQD 4ZO9A 2VJ8A 4TNWK 5JORA 3FQUA 2IQ9H 2VZ3A 1LK2B 2B1HL 4K94C 3WKNA 1E5ZA 1HE7A 2B77A 3ETBJ 4QRQA 5DRWA 4EN3B 4PJ7E 5HXMA 1A7OH 1E8WA 3HEIB 4TLKA 1M2VA 1LEGA 3EYFA 3C5ZC 5L2JB 1JVOA 1JNHA 4JQXC 3H2QA 2MCG1 1T1WA 4K3JH 4LU5H 1RZ7L 4PP1C 1KY6A 4Y2DD 2DQIL 1U21A 4XAKE 1MCSA 3UTZA 3B9KB 4TQ8A 1JDCA 5ABAA 3SE4A 1KPUA 4HKXA 2NZ9D 3CIAA 3CZJA 4I1PA 1I3VA 3OLEA 2F0CA 1IC5L 5D70L 3ABKB 5FGRA 4Z7UF 4PGJA 2GTZA 1JZIA 4HWZA 2MHAA 4ORGA 3GXPA 3ZPDA 4ZZFA 1EMTL 3AWGA 1RJLB 2FGWL 3KYMB 3QQXA 4X5WB 4I0KA 5TDPA 3WFCH 2VZSA 3LJ3A 4IHOA 1GAFH 3AQXA 3IGAB 2L3BA 5F7WC 3IJSA 3TVMC 3FB8A 4Q97A 4XGZA 2QFRA 3CH1A 1ZLDA 4F57L 3NAAH 4BSWB 1O7DE 3HMXL 2XV0A 5EN2B 5JPMA 4IS6A 1EZVY 3KR3H 4BIKA 4YHZL 4NQCB 1I4FA 4ELME 2QGEA 2PPDA 2YEQA 3HZ3A 2OYLA 2O5YL 3VA2C 4YXKL 3W2DH 3CPLB 3TIDB 1ZT4B 2XVLA 4X7TB 1VENA 4IW4C 4RZKA 3EYQC 2CR6A 2CO3A 3MX0B 3QCTH 5G5DA 3C5ZA 3OKDA 4JQXA 5F7AA 4JDVA 4IM8A 5IVZB 2QVIA 1EUUA 3L3KB 1DQQB 3GGWA 2F54A 3D85B 3UTPE 1L7IL 5IB2A 2VJXA 5BO0D 4DZ8A 1UUNA 4JJ5A 3P2DA 4A55A 2A3TA 2QADB 5C09E 4HKJA 4TUJB 5T5NF 3CZFB 1KLUA 3HJEA 3GZQA 1WFMA 3UL4A 1ZXKA 3CCHB 3ML9A 3EF4A 1MXGA 3DV4A 3EO0A 3VI3B 1QASA 5H94B 5E8OB 3KPNB 1GR7A 3MROA 4OGYH 4TN9A 4A6YL 3NP4A 5JIHA 4KRNA 4XODA 3DHUA 3OAWA 5G55A 4XMKH 4G1EB 3TN0B 4N0YL 1UACL 3MLXH 3TVMA 2P4AB 1G87A 1CIUA 3MRGB 2AEOA 3PGCA 4F27A 5J11B 4HIHA 3BCFA 5DSCA 4EZMA 1I7ZA 5IK3A 2X2IA 1T6BX 3MBXH 1BQKA 3U4BH 2IPKA 5DQ9B 3UGUA 1HEZA 4PRID 5I73C 1JK8B 1JCVA 3F7YA 3PL6B 4LNRB 3U7WH 2Z8VC 3NCJL 1AH1A 5D1XC 4U1HA 1MRDH 4JVPA 1S7RA 2G75B 2OK0L 2PKDA 2YPLB 2N01B 1TYEB 2TAAA 3W0WD 3X3FH 1HCVA 5KJRH 5E5RB 2WIIA 4J3OD 3E6FA 5ICXB 5ALBL 1WF5A 4OH2A 4R83A 4OGXH 3LCYA 1WD9A 2K4AA 3QZOA 3INUL 2IV8A 3OC5A 1NCJA 1T7WA 2E27H 4LLDA 2CRYA 5FYKL 4A2LA 1IZJA 2QPFA 2C1OA 4TNVF 4AGLA 2Q8AH 2AJVL 1LP9A 3QR2A 3T6WA 4S2SA 4FI7A 3FPXA 4KRPD 2BXZA 4PJIE 4HLEA 5IBUG 5CLTA 1UD2A 3PFQA 5AB0A 4FI6A 5JW4M 4KZCA 5EMYA 3RVVD 3TURA 5F9AC 3EYUH 1OXYA 3CHQA 3BXNB 4QUOA 1BQSA 3VXQA 3H9SB 3WDHA 4FL4B 5SWSE 1F90H 2C4FT 1ZLUH 4I89A 3MGOB 1HHGA 5C0BD 3RFZB 2OR8A 2AXHA 1FZMB 1CDHA 3EDJA 1YCSA 3OX8A 1XHHA 2LT9A 4LF3A 4Y7OC 3DX1A 5D1XA 5M94B 4IOFD 3BZEA 1AIFA 5GGTA 5GRWA 4AK1A 4AL8L 5JW4N 4FE9A 1WP6A 1T83C 1HS6A 5FEBA 2QPDB 3T0ED 1NGYA 3QUMB 3UIYA 4PAZA 2VXTH 5LCVH 3FQXA 4JZOA 4KKLD 4JANA 4P3DB 1ZGLB 4J3OC 2XTJE 4O51A 1ZPUA 3QEHB 3VXSA 4FQXB 3C60C 1H5BB 4GI6A 3I02A 3ZR5A 4Z3IA 4QHUB 4XX1G 1RSYA 3UO1H 3HKZA 3OKNB 1J8HD 2PW2A 4HIJB 5DUPL 1JXDA 3QS2A 3PCYA 5I9QB 2NDFA 3ZDZE 2K7PA 5E1IA 4DUVA 3ZQ9A 1ZK5A 3WE1A 3TF4A 3LRGA 3EOBA 3LN9A 5DHVB 4K3GA 5HDLA 4HGKC 5D8JL 2J43A 1TQTA 3NACH 3VFMB 3L3DA 4ZNEE 3PREA 2CA4A 2BHYA 4KRPC 5TFSH 4ODUB 2FIKB 2P24A 2PYFB 5B7MA 3GXDA 3FT2A 4EI5B 2AI0H 5DEGB 1YEJL 4F80A 2I26N 2MOVA 3PWVA 3NJNA 3QXWA 1VRSA 3ABGA 3VFVB 1ZHLA 2HH0L 4LCYA 4PJBE 2J73A 4JGUA 4ELKB 4LDEB 1FI8C 2FIRT 4HEMA 3RVVC 4BH7B 1NLDL 1EO8H 3EJPA 5CF3A 1HEHC 1I8IB 3LRKA 3CU1A 4IRJB 5A2JH 5DK3A 4AYDC 2YGOA 4PPTA 5EZOH 4PWGA 5EC1A 4JFFD 5ECJE 1RK0A 5DMJB 2CGRL 2G9KA 3OQ3B 5DD6A 5GGSA 3W2DL 4H8WC 4UOW1 2Z7WA 4YHYB 4BK5C 3RYMA 3JQOB 1JCKA 4NBXB 1AVAA 1JI2A 4PRIA 4S10A 5B7FA 5CEZE 3MRLB 3UG4A 2AKRB 1LNUA 3FTZA 1RU9H 4IOFC 1SY6L 4YSPA 1OGTA 4KKPA 4AQ8A 5HI5D 3GJFB 1KGCD 1ZLSL 4QOKD 1E6OL 4JRYE 4HG4K 3LH2H 4XNDA 1EHNA 2OMVB 3T0EC 1PZBA 5IFAL 2XETA 3C60A 2KL6A 3IK2A 3NUKA 4KKLC 4N20A 4PJ5E 4U33A 5GRVL 3TLRA 3BH9B 5F1NA 3HFFA 3TFBA 4Y1AD 4UTAA 2O4EA 2XA8L 1KLGA 5B3SB 4UQCA 4XVTH 3KPOB 4K9EH 1D7BA 4OJYA 5BZXA 1W8OA 3VFNA 3PRZA 4IIQA 2GITB 1DE4A 5D7HA 2TSBA 1ECZA 2Q3XA 4AOFA 5IFHL 2XNAA 2OW6A 4PJCA 1I3UA 3B2VL 3IDYC 1EEZA 3P0YH 3PG2A 5TE7L 3MQIA 3MJ9L 3PAVA 1G9MH 1VPOL 4XAKD 5T3XE 2EEAA 5CIPB 1B4TA 1B4LA 4PR5A 4NQEE 5ADPL 1IKFH 4LSVL 4XBGB 1I9IL 1KCUH 3NJIA 4UV7L 4XPFH 2W38A 2V2XB 4X98B 4KNTA 5BS0B 4Z5RA 5TD4A 5TE4L 3A67H 3EGDA 5D2LF 1U8NA 1GTNA 2AXJA 1BPVA 2Y6TE 5PCYA 1QVOA 2X4PA 1QI5A 3MLSH 2R29H 4LEXL 4OZ4A 5CWSA 2BINA 4HQQL 1BQLH 4YHLH 1W0YT 5JXEA 5T1DH 2B5IB 2EDYA 1MAMH 1TDQA 1KELH 1KIQA 2BNRE 1D6EA 5DEFB 3KLHD 3T0EA 1BEYL 1A1NA 2Y7OA 3BUBA 3HFML 4R96A 5HI5C 3V79C 3STZA 4YFDB 3SHSA 1KBKA 4B9KC 2X2YA 4F3FB 1U91B 4B9IA 2JCCF 5I0XA 3TA3D 5KVEH 4JG5A 4UIMA 5CP7B 1Z9LA 2H7WA 2DMHA 1J8HA 1N5AA 3IGFA 4RISH 4BXSV 1YYMH 3IFLL 1BQRA 1UQSB 5DFAA 3X3GL 3IMBA 3F04A 3UJTL 1F4WH 1NDMB 3MA7A 4OV5B 4J2XA 2LABA 3LKRB 4XMUA 3G04B 3H42L 1H3WM 3O8XB 4UTCA 2YZ1A 2ICWJ 3CX5J 4K2UL 4YBLC 3UTPD 1WC7B 1M7XA 1WFIA 4J6RL 4DWHA 1OQXA 3M1BB 1RSFA 2C3XA 5ENWB 2GVYA 3NGBB 4TQEL 2FSEB 1U2HA 3W9DA 3OHXA 4X83A 1PLGH 3WAJA 1N68A 3MBWA 3N43F 5TDNA 3V6OC 1ES0A 2NYYD 4FDWA 4M62L 3THML 3U2SB 3MHZA 4UWQB 3ZL4L 2E76C 3D0VA 4N2HA 1Z9OA 4NRZB 5CLZA 1BSIA 1O5PA 4JFFA 2V2TA 3W11D 1CT8A 2QQLL 4OVVA 2W92A 5C92A 4MA3B 3DTXB 4XP6H 4ZTOL 4DQOH 2RCSH 4MAYD 2JIXD 1TJXA 4WGVB 4Z7UB 5GJTL 3SE3C 3D4ZA 2BW5A 2ZSVB 3BZDA 1N9PA 4DVRH 4M1CD 5HHNB 1O7DC 4QOKA 1IFGA 5CINH 3SY0B 5J1AA 3DOHA 4R97C 4CU6A 1B4JL 3ULSB 1TKWB 1FRGL 2D7QA 2Q8BL 5B38G 4L4VB 3GBLA 1TJHL 4MXVF 3GXTA 5CBAA 1DQDH 4QY8B 1U2CA 4UYQA 3BH4A 4E5XB 3TA3C 3KCPA 3L9YA 1T0MA 3OQRA 3NRQA 2YKLH 8FABB 3VXOB 3ZE2E 3VFSB 1T7YA 2BVOA 1IQDA 2CUMA 4I85A 2VC2H 5DD3L 1BAGA 2H1XA 3RI5F 3UEZA 3GIZH 3GJEA 3T8XA 5KUKA 4N22A 4JO2L 5C0CB 4G3YL 1E3XA 4ZJ9A 3V4UH 4RMSA 2V7NA 3RWJB 3W57A 3SDCB 5IQMA 2AF2A 2DWDA 2ESVB 5F1IA 5FYLD 4PU2A 3UO8B 1HXYB 3V6OA 3E0GA 4U1JA 1GOGA 4U6VL 1AKJB 3QJHA 1FGNL 4DGWC 5EN3A 3ZGIA 3LRSA 2C3VA 4JREC 1BP3B 4Y5XC 2OTPA 3VFTA 1HKLH 2QVKA 4BGLA 3WFHB 1AHMA 4NPJA 4FTVB 3S4SB 1QW8A 2IGFH 3NJGA 1CMOA 4YHNA 2FJGB 3VG0H 1BZDA 5E6SB 3W11C 1P84K 1LK3H 1OGPA 2E3VA 3SE3A 3CAFA 4AVKA 4D7PA 3E2HB 2BNQE 2DQ6A 4NNPL 2ZXDA 5EU7C 4N9OB 1HSAA 4PCKA 5A6IA 3BRFA 1AZZC 2C9UA 3DVFA 2A9AA 4KJPD 4MAYC 4XR8C 2XV2A 5GRUH 2XZAH 3ZL2A 3GTTA 5L4JA 3NFNA 4JO3L 1U58B 4HS8L 5JO5B 4M1CC 4EIGB 1A7NL 2YKKA 4OBRA 3P73B 4NZTH 3U83A 4P59H 1N19A 3TA3A 3TV3L 5AAMC 3WTSA 2HG5B 4YDZA 3ZYJA 4LNVA 2GT9B 2XTJD 4WEBH 4WSJA 3MGTB 5IQ7H 3Q5TA 4HUKB 4RESB 3B2UC 2G9HA 1CFMA 5KN5B 1DUYA 2QGCA 3GMLB 1KCWA 2CXKA 3WS3B 4U1LB 2EE3A 2VITA 4EI6A 2H2SD 2W9EH 3BQUB 3MN8A 3PWPA 1J9RA 4G5ZH 4QCIA 5GZND 5HGDA 2AC0A 1R0AH 1J88A 1KN4L 4P3CH 1OE3A 3UTQB 2H26B 3MCYA 2ED8A 5JR1H 4WTWA 5AFAA 4Y16D 4Y5XA 3DTDA 2R15A 1MI5B 4LOUD 4UU9B 3KG5A 4AQEA 4CADB 3KPMA 1CCZA 4E9YA 5AWNL 3IWVA 5BRZB 3QORB 4TPRH 4F20A 1W8NA 3P77A 1QQDB 3BVUA 2OMYB 1ILUA 1TTFA 3ILQD 4IMKC 1OP3H 4N2EA 3BPNB 3BVTA 2A1WL 3PFUA 2VOTA 4U1NA 5HTSA 4MAYA 2JIXA 4UM9A 2I9LA 5GZOD 3MZTA 5I8KH 4XP4H 3TBBA 7PCYA 5K9JH 3WFBH 4QMEA 3TCLB 2G0KA 5IESH 1X9QA 2XPGB 3EKCA 4HIXH 2V9RA 4A2FA 4KJPC 4M7JH 2WQUA 3GRWH 3ILPB 1A1OA 1XDTT 3QUXD 3ES6A 2J3SA 1F6FB 2ZJSH 1E4KC 1VFOA 4NGHL 3TPUA 2E5EA 5L88H 4I3RH 3Q13A 2AJ3B 2VXVH 2BVPB 4JRYD 3CZSA 2RB8A 3OHMB 1HINH 2IFFL 4ZAKA 2DLEA 4APXB 3BX7C 5A2BA 5BRPA 1J9CT 3GB7B 4PJ5D 1F6AB 4ICWA 3BEWB 2WOBA 1JXFA 2XTJC 4P5KA 2I7SA 5DFWH 1JF1A 4QXGL 2CUIA 2OMXA 2OFQA 2IO5A 4PJEA 4DPBX 1JGDA 1F11B 4HWUA 3UJJL 4C57C 2H2SC 4YDLC 3BE1L 4BH8B 1JF6A 1BFOA 4X0KB 1H6EA 1JMZA 2NNRA 2XA3A 4OVUA 4QHMB 2NLJB 4ZMQA 5HVHB 4XP6L 1ZLWH 4UOZA 2OXHB 3CDZA 1X5MA 4OUOA 1FNAA 2IV9A 4PJ8D 1A14L 4LOUC 4ETYA 5EO0B 2A5UA 4PYGA 3WEMA 1BQHG 2EP6A 3ZKMD 4IMKA 2Y1YA 3T6ZA 4YLQT 2JV6A 3I50H 4FXKB 4MNQB 5LKNA 3S35L 1DTUA 4X50A 5E9DE 2MEJB 3BGMA 3UPRA 1EGJA 3HE7B 3ILQC 1C5CH 1NEZA 1RJYB 1BXUA 1MY7A 3K6NA 3DURA 4PS4L 3RA7H 3HMWH 3QDGB 2R1YB 2R7EB 3RGBA 1KEGL 5J0BA 5EU4A 2OTWA 2KS0A 3AACA 4LQ1A 4RZCB 3ULVC 1G9NL 5KJ7E 4CUCA 5L8LB 1T0NB 1E4KA 2O5ZL 3NCXA 5IB4A 4RGOH 4DW2H 3QUXC 5F7EH 4E41E 2BNRD 3REWA 3SIKA 1DUZB 5ANME 2ITDA 5E2VL 5GISL 2ZUYA 5TDOB 3MRPB 2G3NA 5DO2D 4HALA 4N2AA 4OZGE 4WUUE 1NCAH 2ZX5A 3SPVA 3HI1B 3TBVB 4IKKA 1VIWA 1NIDA 3PPEA 3S3JA 2HPOA 5I75B 5LN8A 3QUZD 4ENZA 1DCEA 3OB8A 2IDSA 1SDDB 1E50A 2DBLH 2ZWLT 5DRZA 3GXNA 4XBPA 1PD0A 1V7ML 4KNUA 3HBQA 5GGVY 5MP6H 4YGAB 2DZEA 2WKGA 2ZP8A 1CYWA 2AJXH 3BVNB 4MJID 2AK1L 4LIQH 5LG6A 4L1LA 4QT5A 2PW1B 3VYPA 1NL0H 2F1AA 2R83A 3IVKA 2YD1A 5I1JH 2XQBH 4AE0A 2EIZA 2WLJA 3VRLF 2OJEB 2OR9H 3MRKB 5DD5H 3BUTA 3QEGL 4K3DL 2ODIA 2OZ4A 2JVUA 4BFBD 5D1QB 3IJYB 2NY6D 3L7EA 4PJ8C 1CLOH 3LPGA 4QYAA 3BAIA 3I2CH 3ZKMC 5LBVA 4DOHE 1PIFA 2LLGA 1QTYT 4KZ0A 4RDBA 4L37B 2GEEA 5I24A 1LMIA 1IBGH 1OAUL 1XQ4A 5ANHA 3UP1A 3L5WB 4K23H 1RIUH 1EAQA 3MKGA 4OQTL 1F6LL 3DKHA 1M05B 2EDEA 3NPZB 5A6MA 3LZFL 1YY9C 3Q1SL 4NZUH 2JQAA 3D1MC 3ZTNH 2YA1A 1RZKC 2LU3A 3MODL 3QUXA 3ROOA 4KROB 5FC9A 5D2LB 5B8CC 3L3HA 2D4DA 3MLUH 4XNQA 4GKZA 2WLLA 3O6KH 3W5NA 1PAMA 3O4OB 4DPAX 4ZG1A 3ZHNA 2VDKH 4MTMA 4ICXA 3O4LB 1DR9A 5BVPH 4B96A 5DO2C 1JV5A 4S0SD 2GHZA 2JJTA 3GMRB 4Y4HD 1ET7A 1MJUH 5JQHC 4J3UA 5E24E 2LU7A 3NFSL 5E7BA 3P4LA 4MYWB 3QUZC 3BSZH 3RZWA 1A6WH 1TZ8A 4N8VB 1P7QB 4QRTA 3RHWK 4LCUB 2KH2B 4XC3H 4ZDHB 5ABZA 1O7VA 1QSEE 3WELA 2JCCB 2B2XH 4MMYA 1JNNL 4HK3J 5DEJA 4PJAE 3HA0A 1OCRB 3RZCD 4HWEL 3SOBL 2Y24A 2GK0A 3O3DA 4H20L 2YN5A 2CA3A 3QHZH 5LAPA 4Y5VC 1ZTXH 5F8QC 4OJFH 5A2AA 1OAQH 4PJ8A 1LWJA 3VXUE 4DP2X 2I5YL 3SKOA 1JHLH 1P4BH 2X4OB 2I60H 4PI0A 1A4CA 1B6DA 1FDLH 1W2KT 4PM1A 2BVQA 4XPBL 1VACB 2X0UA 2RJMA 2VGLM 3C6LC 3RIAF 4CNIA 2VR5A 3TO2B 1I8KB 1SQ2N 1CFSB 4I3RL 2P8MA 3GK8H 4HP5A 2GJRA 1ZVNA 2WAHA 3N43B 2ICCA 3RJQB 5LNGA 4UQ2B 3MACL 1N3NB 5TE6H 2EILB 3N44F 4CVXB 1JXKA 1XGQB 4LLQB 1QRNA 2OSWA 5B8CA 5I1CL 1M7DA 2EINB 5KVFL 4RGNB 1QYGL 1JRHL 2BNRA 3LDBC 2J21A 4AEIL 4ANXA 4GG6E 2AEIT 2FLRT 2FHCA 3WFDH 1QUNA 1U92A 1EZLA 1U8LA 3MR9B 2BXYA 4OKDA 3SEPA 2ATAA 2J8OA 5T8IA 4F7TA 4O2FB 2YC1B 3LS4L 4CVZB 4PH8A 1UZ6E 2CKBB 2OX5A 3OJDB 1YZZA 1GJUA 4YGVA 2VDRH 3QZWA 2JKLA 2YEZB 4MJIA 1I3RA 1OIOA 2XDHA 3LVEA 4LARH 4NT6B 1U95A 2VN6A 3HMXA 3KDMA 2VLLA 4HH8A 1MFAL 4Q14A 4J28A 1Z9MA 4Y5VA 1NC4B 3WTWA 1QLEB 2PWGA 1S9YA 2W94A 4L3CA 3RZCC 5DJ6A 4EDWH 1ASPA 4M8QA 3CX5K 4LKXA 1O7SA 4X5RA 5DC4B 1KB5L 5E1AA 5I71B 1RIVL 4XX1E 4ZMYA 3DVIA 1RL1A 2AV7A 4Q4EA 3C6LA 4JFWA 1QZ1A 4IBUA 5AOZA 5IKCA 6PCYA 5M7QA 1FG2A 4J3OF 5EG6C 5BXFA 4FFYL 3NA9L 5FHAH 4ELDA 1OAKL 4B5ZA 2W81C 3BZFB 1FV1B 3PAZA 4WRLA 1I8AA 4OF7A 4ZFQA 4C4UA 4M48H 3MNVA 4UTBA 4R4ND 3I6LE 1RUMH 2DTSA 4G1MA 4GAJH 3SO3B 2EEFA 4G7VL 3V52L 4CL7A 4V11A 3ZDYE 4ZMTA 2IDQA 4JAMB 4PJCF 3RBGA 3RL1A 1YYCA 5I1DA 5CO1A 4P4RB 4E9RA 2WUBL 2OL3B 4GMSH 2EDLA 4GXFA 3HBZA 2WLMA 3QGVA 2NQCA 5DC0A 4NHUB 5TK4A 1DDHB 4U2ZA 4P8QA 3RKDD 3LD8B 4Z76A 3KS0J 4HLZH 3C8KB 1NDGB 1BJ8A 1UM6H 3QAZB 1X9LA 4U1GC 2H5UA 1QW9A 1QSFB 4EQ2A 3ZW3A 1AZBA 1O6SB 1S7QA 3RZCA 5IB3A 1T5KA 3C09B 2HWZL 4F7CA 5DJ2B 2K45A 5AVQB 1Z5LA 4JL1A 1IE4A 3ME0B 3DIFB 4AMKH 1EAJA 2R1WA 2A6KB 1OB1A 2ZOKB 2K78A 2AABL 2EE0A 1XAKA 3NPSB 1CD1A 1U8KB 2IG2H 4GKNB 4KHXH 1WTLA 1RUAL 2WOYA 2F58H 3OXRB 1OT4A 1MRFL 5EV7A 1E5CA 1BV8A 4PGZA 4KGLA 1KB3A 4J3SA 4LL1A 2XYBA 4WFFE 3MUHL 5LVEA 5E9DD 5TK2A 4BXVA 1CICD 3K7UA 5I8EA 3FSOA 4ODTL 1B0RB 1OLLA 3QHTC 3VI4A 4OLUH 4DVBA 2PPCA 8PAZA 4JZNA 3CFCL 5D6CA 1P7BA 1SHWA 4PJ9B 4NWUH 4LHUB 3QEQA 5ISZE 1E8ZA 1VERA 1OGAB 4HJ1A 1NANH 1XB3A 2L0DA 1C9SA 4JHBA 4E41D 3FQUB 1CI3M 4MMXA 4XPHL 4WKXA 3C87A 1NMBL 4QRQB 5DRWB 4XXDA 4WK0B 3V6BR 1M2VB 3EYFB 1AG6A 3LV3B 4UV4H 5E1HB 3B7UX 1JNHB 3L5XL 4WUUD 1JN6A 1ZD6A 4Z7QF 4FHJA 3NIFE 3OLGA 1T1WB 3R0MA 3FPYA 1HOCA 4TOYH 3UAFA 3RKDC 5I1LA 4KXZH 4PEEA 4RGMB 3E3QE 3UTZB 1HYSC 4Y5YC 4PS7A 4KK5D 3TIEA 4IRSD 4JDTH 3JTBA 1XH3A 2XICA 3NJVA 1KPUB 4HKXB 3REVA 4HOMA 4PWIA 3QQ4B 3QDJB 3T2NL 4LL9A 4Q58C 2GTZB 1ETB1 4HWZB 2CMRH 4ZFOA 4ORGB 4Y2NA 1AD0A 1S5IH 2Y25A 3VW3L 4XNZB 1TIUA 1M6UA 5TDPB 4YPGA 5D7EA 3WIFA 4IHOB 4F8OA 5IMKB 4XNAA 3LEXA 5D96B 1YPZA 1ZGLP 2R4SH 3IJSB 3DI3B 3QWOA 4XGZB 1JD9A 3CH1B 1AGBA 2BNUA 2WWMD 2VE6A 3NN8A 2WN2A 3V2AR 5LXVA 5I74B 3EXLA 1CICC 2QT6A 2WGNB 4GQ9H 4B9PA 1CXEA 4IS6B 4IRZH 3UTOA 2ZXGA 2PP8A 1GIGL 2Z35A 4DFIA 3BUDA 4J3BA 3I84A 4M93B 1I4FB 1JL8A 3FN9A 3AT9A 5MENE 2YPVL 2IBGA 2HUHA 1FZJB 2WQVA 4XOBA 4IU2A 4ZOAA 4ZK8A 3JWOL 3B2PA 5I23A 4KDVA 1IAIM 5G5DB 2WCGA 1FNHA 3C5ZB 3OKDB 1CE1L 1CFBA 4JDVB 1II4E 1MCCA 5KAQG 4XZ4A 3GGWB 25C8L 2F54B 3SKJH 5IB2B 4DZ8B 4JJ5B 5HVGB 5JHLH 4Y5YA 4EDXA 1CXLA 1DVUA 1NA8A 4OLYH 3TS8A 1GPOL 4B9JA 3LYRA 1KLUB 3LPPA 1A0QH 1XX9C 4KK5C 3QJFA 1QSED 3DV4B 2BHZA 3DX7A 1V7NL 3EO0B 4IRSC 4MCMA 1E0OB 1WFUA 3HNVL 5IHUH 2B0SL 4JKKA 4KZEL 5KUMA 1A7BA 4JY6B 5KBMA 3VFWB 3K8LA 3BVXA 5AVVB 4G43A 1F45A 2QVTA 4OLWH 3VXUD 3TVMB 1NBVH 2ZX8A 4TL4A 1P9MC 3VNZA 3ZR6A 4G6FD 3NK3A 5CZVH 4NZRL 2ZOWA 5DSCB 3SDDD 3APFA 2BIOA 4FS0A 4IJ3C 4WNSA 5IK3B 1CICA 5I19L 2DDQL 3W37A 2VJ0A 3CLFH 3HS8A 3VH8A 2IPKB 2WWMC 3MRIA 4YSEA 1DQML 3F7YB 3U6XA 2HXAA 4L5FE 2XBTA 4XBMA 3UH8A 3UDWC 4MDJA 1FNSL 4U1HB 1S7RB 4QRFA 4YDJA 2BP8A 1WD8A 3G08B 5DLLA 4XN1A 4JG9A 1WGVA 1MFEL 5ID0A 3N42F 1L9RA 2WIIB 3E6FB 5HHOA 3EAKA 3A3YB 1DANU 4NQXA 5FW6A 3M7FB 4ZX6A 2NMSA 5D5ME 4WJ5B 3SY6A 2M83A 4WUUA 4LLDB 2Z92A 3GO1H 2APWA 3A24A 4KVNL 4FXLA 4AMKL 2HVJA 3ELQA 3VX1A 4JN2A 2C1OB 1QATA 1JYNA 4Z8FH 3G7TA 1FORL 4ZX5A 1UXWA 2VDPB 4S2SB 5CSZA 2WWKO 4K0OA 3W38A 2VLKE 4HOWA 4HIIA 4AYID 4XN5A 2EKSA 3LZOA 4BRVA 2QSCL 4PRNA 3MJ6A 4NM8H 3SE9L 5DVNA 1MHHA 3V5HA 1TNMA 4UM8B 4NRYB 1P9MA 2ORBL 4XBEH 3VXQB 2WO2B 5IUSA 1A5FH 1A6TA 3QDHA 3EOTL 3L4YA 2A9ML 1PY4A 2PABA 1HHGB 2DWYA 3KEHA 1Y07A 2BS9A 5MEPA 2IDUA 4NIKB 1MJ7L 5I73B 3OX8B 4IGBA 2DTML 3DV6A 3SDDC 4LF3B 4X6EB 3DX6A 3UDWA 4O2CA 1IGTA 3NRFA 4AV0A 4ACPA 3BI9X 2ZT9C 4JG1L 2OXGA 4M61A 2IIJA 4N2DA 2FBJL 1WFOA 4PW4A 4WUKL 5BNXD 1AIFB 1GGTA 3BZEB 2F53E 4S1QH 5EFIA 1WYJA 4R5TA 3UG3A 4NCDA 4UMSA 4Q0XH 1WAAE 1P0SE 3I6LD 4PJEF 3ET9F 4JY4A 4HUCA 3FQXB 4JZOB 4JANB 1KENL 1Z9NA 4UQIM 4O51B 1H6TA 2DI8A 5HHME 2X5PA 1SBSH 3I02B 3DGCR 1QLFA 3N44B 4PJ6A 3AAZA 4JKNA 4PJIF 2V0AA 5HYSG 3EFDL 4BKSC 1BMGA 2PW2B 3QISA 1S8DA 3FF7A 5B1JC 2LLLA 3WNNA 1OCWL 5ICUA 4S1SL 4YDIL 3EOBB 2Y6SD 1LO5B 4R8WL 1F58H 3UERA 2PN5A 5LCVA 4JUSA 1AXTL 2J25A 2ZUTA 5HVFB 3S88H 3L3DB 4TNVK 4BWUA 5F44A 3ZDXF 3A47A 1GCYA 2Y7SA 5DO8A 2P24B 1JGUH 2AS5M 4ZQKA 3FT2B 5DVOA 1Z6JT 3GI9L 1KYAA 3PWVB 2J1YA 3AXIA 2YAFA 1AACA 3PQYD 4KVCH 2AVFA 4PJAA 1ZHLB 1NAKL 3FU6A 4NOFA 4LCYB 5I16A 4K9EC 3MNZB 3CLWA 1CB4A 3QUYC 4G8AC 3GHEL 5EUOE 3WMSA 1ZSDA 3M8OH 3QCVH 3PYCA 2R1XB 4RAUA 1OW0C 5EC1B 2R51A 1RK0B 4B53A 1YJDH 5DD6B 3SDDA 2JQMA 5GGSB 2WTPA 4XWGH 1G9MC 2ZNWA 5DLMH 2FD6H 3QZPA 1X3DA 1EZSA 4PRIB 5DVMA 4B6ZA 1MFMA 1LNUB 2H9GA 4WFFD 4XP1H 3LIZL 5AQ0A 5BV7L 1CDGA 2GUOA 1CTMA 4HJJL 3EO9L 1TR7A 1NFKA 2AQ1A 4PTUA 3SGEH 4C59B 3ZDZF 3EG9A 4K7PY 1BBJA 4PMEA 1BHGA 3C60B 1PG7H 3UTTE 4UZGA 5ISZD 3BAXA 4PJDE 5F1NB 2FBRA 3FQ2A 2WXRA 5B1JA 5IHLB 4KDWA 5SX4I 3VD9A 3HVNA 4LLWA 4ZFGL 4H5SA 3QJOA 5GS0L 4PY7A 2O6PA 3EH5B 2XNAB 4G8FA 4KRPB 4PJBF 3CLEL 4PJCB 2AEWA 2FH6A 4AG4L 2SODB 1KXQA 2Z91B 1IGIL 3VRIA 4D94A 1DZBA 3ML8A 5C6TL 5JA8B 2XIIA 3FQNA 1NBYA 3D2UD 3ALXA 2HKHH 4WI4A 4PR5B 3CK0L 4JG0H 5CN3A 5IW1A 3QUYA 2B1OA 4ODWA 1XR8A 3IGKA 2LFEA 4EUPG 3NDZE 2ZXEB 2WPGA 5C7ZA 2J6WA 4Z5RB 1M56B 3Q8CA 4X8XA 2V4LA 3VWJD 3EGDB 3BPLC 1U8NB 2J88H 2HSIA 4GSDL 4PREA 5C0BB 4NB7A 3P3TA 1QPKA 3DDGA 3TV8A 4BM7A 2CALA 2X4PB 1QBLL 2K3HA 5CWSB 4ZODA 5I18H 2IANE 2X1WL 1BZOA 1KIQB 4JL2A 1D6EB 3NABH 2GSGA 3W5MA 3T0EB 1FP5A 5FYJE 2VDNH 3EJJX 1A1NB 3PWJA 5AL0A 4R96B 3MXWL 1U8JA 3QPQD 1HL9A 3STZB 1FIEA 2P5PA 3K1DA 4NKIL 5LXGL 5MEND 2R29A 4JQVA 1I75A 4FHBD 3H9YA 2VIRB 4BZ1L 4OFVA 4UIMB 4O58L 3U1PA 5EB9A 1PKQA 1FLRH 3IDXL 1J8HB 1N5AB 2IAMD 2DLIA 2DEYX 4M1DL 5AKRA 3VGFA 4OT1L 3MA7B 4XWOD 1EFXD 5EDXA 3IDYB 1ESOA 2WWOA 3R0NA 2J1KA 5F72S 5ITBH 2EIJB 5F7KC 2Y3AA 5C0JA 4P2RE 2WXJA 1DO6A 2CNYA 4M43L 1S46A 2Y5QA 1YEFH 1XF5B 4OGAD 3GXMA 1E4XI 3W9DB 4JMNA 2E47A 3PQYA 4JCLA 3W81A 4PYHA 4UIKL 1LE5A 1VFMA 5IHHA 3WTVA 4Z7QB 1J86A 5TDNB 1HCZA 1GSMA 3L5HA 4I5BA 2Y7LA 1ES0B 2WXNA 3JBG7 4N8CH 2X4UA 4X0NA 4KXAA 2L8AA 1IM3D 2P52A 3D0VB 3KXFE 4E9QA 1EAPB 5KVDH 1SFDA 5C7XH 4JFFB 3ARGA 2V2TB 1CT8B 3GMQA 4X42A 1T80A 4Q0XL 5DVPA 1P53A 2EIBA 2NZIA 3TFKD 1RVFL 4JPQA 3GDCA 4MYPA 2X3CA 3L1OL 4RWYL 4N2GA 3DIDA 1E27A 3L1EA 4X9GA 4CA4A 4P48A 5ESVA 4U1KA 3I9GL 5D72L 4QOKB 3COOA 3X13A 5J1AB 1AQKH 4J39A 2FEEI 1UB5B 2BVYA 5J6SA 4P5SA 5CILL 5CBAB 4Y1AB 3U79A 3VB8A 1AY1H 3KCPB 4JHWL 5AUMB 1T0MB 4TNEA 4NN6C 3SQOL 5I8CB 4KXDA 2YBGA 4Q4IA 2BVOB 1IQDB 1A7QL 2FQEA 1MHPH 2IAMC 3ZLQC 2FJFA 2H1LM 4XP9L 4YBLB 4GMTL 1G7HA 1VESA 2IF7A 4XWOC 1KACB 3GJEB 4U1IB 1QD0A 3EJRA 3T8XB 2YD5A 2DLHA 2V7NB 1HHKA 4M5ZL 4OLZH 3D2UA 3W39B 3EW3B 2DWDB 2VLKD 4O4YH 3F58L 4U1JB 2GBAA 4XMPL 1JPFA 3QJHB 1L5GA 3LRSB 2C3VB 3P54A 3VFTB 5AG9A 3MCG1 4UMGA 3FNKA 5J06A 3QIWC 1JFQH 1A4JB 5HHVH 4NHCH 3K6FA 2B59A 3PP3K 3HE6D 5DJCA 1Q9WA 1ZV9A 3F12B 3S36H 4YHNB 4RRPA 2ZIDA 1G7MA 3ARUA 3F5WA 3TFKC 1HSAB 4AW7A 3VACA 4J8QA 4L8DA 3CSPA 4CBPA 2BO0A 5LWYH 2DQDH 5GSRA 3KLAA 1MEXH 4IEFA 3U9UA 2V7HB 2VO5A 3TH4T 3NFNB 3F3HA 4R97B 4BUHA 1S3RA 4F58H 3GINA 1ZE3H 3H6JA 5BMFH 1KCVH 5INCA 3GKWL 4NJ9L 4JGJA 3IPFA 4OFYD 5MENA 4QF1A 3RJDA 3RDJA 5F7DA 2XV3A 2A4ZA 3K8KA 3TA3B 2CK2A 3MV7E 2OYKA 1WZKA 1NKGA 2WLZA 2KZ1B 5TH2A 5E2TH 3IAPA 1SLXA 3MRRB 1FWXA 5HHMD 2IAMA 4KKZA 3UZEC 1BF8A 4N25A 2G9HB 4YXLL 1DUYB 2ZXCA 4R7XA 1EFXA 5L9DL 1W16A 4DTGH 4EI6B 3N42B 2VITB 3PWPB 4QCIB 1A3RL 2DIJA 5IQ9A 5IHWA 4TQHA 3N41F 3ARXA 1N64L 2ZF8A 1F86A 4NUMA 1JOIA 2KHAA 5HGHB 2EAEA 3ASOB 2RQEA 5AZ2L 4JVUA 4JREB 4Y5XB 3HPJA 2JTDA 1ROCA 4X99A 1ZA3A 1W6LA 1OT2A 1KJVA 3PUUA 4P23C 1PSKH 4AQEB 2EVHA 3QIWA 1MAJA 5CMAA 4JKWA 3RVWD 1EEUA 3GMNB 4JFXB 5K59E 3P77B 1JG9A 2X40A 4LL4A 5I5MA 3DGDA 3NJMA 2WD0A 1M7UA 1KJ3H 3HE6C 3Q3GA 4OLVH 2N56A 3VRJA 4EO5A 4U1NB 2OMWA 4MAYB 2JIXB 5FFGA 4UM9B 1YEDA 5EEXA 2BMKA 3CU7A 4M6NH 3ARYA 4L2LA 1A7PH 5FUZH 2XKNA 2H8PA 5KSBA 4HPHA 3A6OA 2MJWA 4PFEA 1HH9A 1NIAA 4LCWE 4H0LC 4ZO6A 1N4XL 3LEYH 3CMOH 1QACA 4J3XA 3TESA 5D7IA 4GT7A 4UT9L 3JV0A 4N2MA 1U8HA 3KPSE 1WZAA 1SM3L 3K2UL 3MRJA 1GGBL 1P2CB 1S7WA 3GRWA 2MNUA 4AKPA 1MCWM 2XXCB 3TT3L 1JF1B 3DSNA 3QC6X 2OMXB 4PJEB 1JGDB 3HOGA 2A0LD 3GDBA 3OXSB 4HETA 2PCXA 2FLMA 1HWWA 2CJUH 5AVRB 1XCWA 1GZHC 3DX9A 1KFAL 3BT0A 4MJJA 4PJIB 3DVGA 1YPZF 1KBPA 4KAQH 4PSPA 4ZUWB 2EQDA 4P23A 3C08L 3CDZB 4PJFE 5FX3A 1UWXK 1G1OA 1BLNB 1HESA 3V5DA 4AC4A 4X5XA 3ATBA 3ZOAA 2P46B 3IMRA 1I31A 3HE6A 3ZDXB 1EZVX 3CBKB 2VZOA 4XAWL 3BGMB 3KM2A 3MLVH 4JPKH 5J1TC 1NEZB 4XMLH 2WBJD 3DURB 3QQ3A 3L81A 5E6ID 2N7BA 5MEOA 1QFUH 1UWFA 5FK9A 5EU4B 3VU2A 2IPTH 4CC1A 5EIIG 4LPTA 1FFTB 2IGLA 3PIQB 4GINA 4MDIA 2P28B 3SGDH 1JPTH 2CCLA 4I77L 5IB4B 4FABL 3QA3B 3EADA 1IIIA 1ZY9A 3US9A 2VDQL 5CCJA 2QQNL 3SD2A 3ZY7A 4GRWH 1OKEA 2ITDB 5FYJD 5GGQL 1JXJA 1FAIL 2XKSA 3BP4A 1F0LA 1IGFH 1EAOA 3KHQA 3O6MH 3SPVB 5CCKL 2PYEA 2XTJB 4CVWA 5E6RB 3FHAA 1R5WB 2X6CA 2E7CA 2PP9A 1K85A 5DRZB 4WDIA 4XBPB 5E2UL 5HGBA 5KW9H 3ZDZB 2MQCA 4QRPE 4FFYA 4FKHA 2AJUL 2CHNA 2ZONA 4U0QB 4QT5B 2A0LC 3WLBA 3IVKB 2QPUA 1INDH 2HPTA 3QB7C 1CGUA 2EIZB 3U7YH 1BEXA 4OCYL 2X9XA 4I3SL 5TF0A 1GC1H 5KG9A 3MLYH 1R3HA 3OPZH 4PJBB 5IV2A 1CYGA 2JELH 4D9LH 3DYMA 5EUOA 2W9DL 1CDUA 1AZUA 2XI9A 4F5CE 1ED3A 3NYKA 2F74A 5JDJA 3Q2WA 4BKLA 4Y2OA 1WA1X 3QXTA 1RY7B 1IC7H 3FT3A 2O6FA 1HNFA 2WBJC 1RZGB 3P9WB 3W1ZA 5IVXA 1WIOA 4KUCD 4QHLB 5E6IC 4G6KL 1BZEA 4WV1C 1ADWA 5D6DC 1PNCA 3NH7H 3TJHD 3QNYA 3QUXB 2PF6A 4H88H 4JQIL 3BGAA 3RB7A 3KBPA 4XNQB 4GKZB 2WLLB 2XJKA 4AYBA 3QG6A 3TU6A 6PAZA 3MNWB 3GPEA 3KPRE 5TPWH 5T1JA 5G4NA 5KTEL 1FNLA 3GM0A 1JV5B 3CFKA 4P2AA 3GSNH 4N0UE 4XP5L 1MFBH 5AYUL 2UWEA 2APVA 1LYQA 2FWSA 3UYRL 2WYIA 1HHJA 4NC1E 4QRTB 2FNWA 3M7OA 5DFVD 1UH3A 1QR1A 4IIZA 4JM4H 5B39B 2FAUA 1CLYH 2P5WE 3FSZA 5D4IA 1DO5A 5DS2A 1SXCA 1IX2A 3MRFA 4I8DA 3B83A 3WY3A 1PFOA 1ZVYA 3GI8L 3O3DB 2GK0B 2BHFA 3FC8A 2UXVA 4GP4B 4NFBA 1T5WB 4PJ8B 3BSZA 2VRQA 3OZKA 4UQBA 3IN0A 4OD3L 35C8L 5AOKA 1TFPA 1WEJL 4TULL 5E1GA 3WCYA 2MH4A 1J0ZA 1MCEA 1U3NA 1KEML 2G4EA 1FGVH 4MA7L 1NIFA 4CKQA 2WBJA 1JZ5A 1A3LH 1MIMH 2P8MB 4TMPA 3SDXE 5E6IA 3FU8A 4AIXA 4WV1A 5D6DA 1RQ5A 2XX1A 3ABMB 3QJZA 4HGMA 1KOAA 1QRNB 5B8CB 4JRFA 1M7DB 4G9FD 4Z95H 2PCYA 3GSQA 3TJHC 4NXSA 4FGMA 1E4WL 4TTGA 1CK0L 1Q0XH 2BNRB 1MW2A 2M8XA 2WIMA 3QUML 3A23A 4F33A 2LQRA 2XTSA 1DJZA 1ORSA 1U92B 5I6XC 4R90H 2MNWA 3VJ6A 1U8LB 2HJFA 4HK0A 5HI3D 3IPBA 2JKTM 1IGYA 3CVIL 3D3VE 3AXLA 3QUZB 2GTQA 3LH9A 1RFDL 3C6EA 4PJAF 4KQ3H 3VQ1C 1JS4A 2OX5B 5FYKE 4YGVB 3QZWB 4MJIB 1BXXA 1I3RB 5F9OH 3L3JA 5KVGH 1U95B 1V3JA 2B20A 4QIRA 5JUEH 3BT2H 2VLLB 5C3TA 1CTNA 1S7UA 2QSTA 3SBQA 3MXVH 3VAEA 3T08A 4Y5VB 3KLKA 4YBQD 4N2BA 5I8OL 3HZMA 2DQCL 4L3CB 4XMLL 5DJ6B 3PF2A 2DLGA 2HFTA 2YPVA 4LKXB 5F3BA 4OGQC 4GW5A 4IOSA 2WB7A 1N67A 2GC4C 1F02I 1CU4L 2AV7B 3AG3B 3C6LB 3A4EA 3CHRA 3ZZLA 1FG2B 1NCDH 3X11A 1NIEA 2CLZB 2YUZA 5SWZD 4JO4L 5I1EL 4B60A 2MCPL 3MV8E 3WFEL 2OYPA 1HX0A 2YWZA 4GSRA 4QTIH 2AQ3A 3MNVB 1UENA 5EIVA 2G3ZA 1R3IL 5FW8A 1UZ6F 2B14A 2R0ZH 1ZEAH 1ZS2A 1PLCA 3RL1B 3BAEH 2APBA 5DRNB 2CO2A 1MXDA 1Q72H 2DKMA 5FYJU 5LGHH 1L9MA 3KPSD 3TBYA 5HI3C 1A6UH 1D5MA 2DQJH 4OFDA 3UACA 3VFGH 4ZNCD 3STBA 5MHSD 1VAHA 4IBSA 3B7TA 3WXVL 1JZJA 1Z1WA 4FYQA 5I1IL 4Z76B 4WSGA 2XPYA 3RIKA 1AAJA 2XWCA 1S7SA 3K74B 1F97A 3RZCB 5IB3B 4F7CB 4HMCA 1Z5LB 2B8OT 3FCTB 5A1AA 3GZOA 2NOYA 2VXQH 1VF5C 2R1WB 1OB1B 1AZNA 3LPWA 3RU8L 2AEQL 1CD1B 1TF4A 5E8DL 2JKXA 4PB0L 1JWSA 3N41B 1N6QH 5CR1A 2DM3A 3BWAA 1D5XA 4HAKA 3M6DA 5CNHA 2Y07H 1OALA 3ETTA 5I0VA 1QI3A 2O6EA 2PTUA 3ESOA 5I8EB 1C7SA 3ZDYF 1R3LA 4AH2A 1A8ZA 3V55A 2AJYH 3U25A 3FB6A 3O2WL 4YXHH 3D87B 3HN3A 4JDZB 3L4XA 1FJ1A 4G9FA 4PVBA 3L16A 4Y89A 2VW4A 2JNZA 4MNGE 2NQDA 4M6OL 2X0WA 1FNEA 4DKEL 3QPXL 4H40A 1SLWA 5CFAA 3RPBA 3VU1A 3CFTA 1JIBA 4NO5B 1O9VA 3FO9A 2A74C 1A6VH 2YSSA 3T2QA 3VTTA 4MLSA 4IHBA 2CQVA 3RUGA 2X44D 3GZPA 2PR4H 5FPIA 1JN6B 5E08L 3RWIA 2AV1A 3WKMH 2VB5A 1CXKA 1EJFA 4DNLA 4PV8B 1HOCB 5KS9E 3OR7A 1HYRC 4U1GB 4YDKL 4Z0BH 1G7IB 2F8VA 5I1LB 3LKSB 3JTTB 4DERA 3TIEB 5LLIC 1UWGH 1FL5A 1QFWM 4QRPD 1XH3B 1FH5L 3HCVB 3LKOA 4K5PA 3FTGB 3E1ZA 4QNPF 4QRAA 5DU7A 5C9JB 4WWID 4LVEA 2EC9T 3K4AA 1BAFL 1WIPA 1IGCH 4O02L 5BPPA 4AYMC 1RJCA 4GUPA 2EDJA 4ZFOB 3HKFA 5EOQH 4M02A 5K1JA 3QWRD 3RAJL 4QJ3B 4YPGB 5E7FA 3U4EA 2BFVL 3LEXB 3V4PH 1YPZB 3I74A 1IQWH 3QWOB 1JGIA 4CU8A 4F2MA 5SWZA 1GJIA 4JKMA 1AGBB 2BNUB 4M56A 1MZZA 2VE6B 3NN8B 2Q5BA 4I87A 4BKTC 1UD5A 4YDVA 1H9DA 1YUKB 1AHWC 4ZMPA 1MHCA 4XPTL 1D7DA 3BUPA 4ZT1A 2X09A 1F1AA 2Z35B 3QJTB 2V8MA 5F1OB 1AR1D 2NYZA 1WHOA 2I27N 3ALWA 1SVZA 1I85A 4IU2B 3U9PL 4PBXA 3NIFF 4MHHI 4L18A 4A39A 7FABH 2CCWA 2A74A 3A4DA 4OSUH 5FXCH 2B39A 2Z65C 3N85H 4F37F 3OMZA 4Z3JA 1DZ0A 1U3HD 3O9WD 1XR9A 3MLRL 5ICZA 2YAHA 3KPRD 3V0WH 4IRZA 1KC5L 1WS8A 2HVBA 3D05A 4XVSL 1QBML 3TZVD 2HMID 1WFTA 3HG3A 3JSSA 5J8OA 2XN2A 4NAQA 5HPOA 4FC3E 4Y5YB 4KHTL 4EDXB 1QZNA 1A6ZA 1EHAA 5FW7A 1GSKA 4E9XA 1NWOA 4JPVH 2F5AH 2K6WA 1RLWA 3BSGA 3LN5A 4MZ2A 5IWLC 3TEYA 1GHFH 3RX7A 2N1TE 3V0GA 3QJFB 3DX7B 3KYNB 5G2NA 3E80A 4YEEA 1HHIA 3A6BL 3GMOA 1WAPA 4ODSH 3H9ZA 2XRAL 5JHLA 4N8PA 5HDQH 2MNJB 2QKIC 4DSYA 3DRTB 3I75A 4G43B 1IBDA 1R24A 1Y6KR 2NTSP 2D3VA 2UZPA 5AW4B 4DEWA 1MWOA 4HC1H 1XF4A 4EI0A 4CJ1A 4Q9RH 3BO8A 3H85A 3TWCL 5E9DB 2ZCZA 1CICB 1F2QA 2WSPA 4N26A 4ONGH 4KI1A 4Z9KB 1AHWA 3VH8B 5IOPA 5I0DA 5AKSA 4U0RC 2P5EE 1DSFL 4DP9X 3B9AA 4R4FH 4MDJB 4S1RL 1P6WA 4YDJB 1HL4A 2BP8B 4OCLC 2NRDA 4ZUVA 4XNXH 5BQDA 3F6LA 2KPWA 1C8PA 3KS0H 3LN4A 3A0OA 4F8QA 3P30H 1AR1C 5ID0B 2V3EA 2Y36L 3SJVE 5F7UA 5ICYA 1WIUA 4FFZL 4XB8A 3K4ZA 4E41B 5HHOB 1J0YA 4NQXB 2R8SL 3R1GL 4H1LG 5ANMB 2OCJA 3ECQA 3EH1A 1LL1A 1U3HC 3O9WC 5FOBB 5AVYB 4KNSA 4XNYH 3ZRSA 4FG4A 4WUUB 3HC4L 1YRKA 5IY5B 3B1UA 4KRLB 4W9DC 2HVJB 4YVUA 5DQDH 4JN2B 1PZUB 3MREB 3TZVC 2HMIC 3QWQB 1Q94A 3QRGH 2YRPA 1UXWB 5IWLA 2GC7C 5CSZB 4TLSA 5FYKD 1VGKA 4BDVB 1TLKA 4Y4KD 3G3LA 4IRSB 4QRPA 4HIIB 4GUCA 2EKSB 5FDWA 1R17A 2VR7A 1BJ1H 1BGXH 4PRNB 2QKIA 4RAVA 1CLZH 2K70A 2G4GA 2WN3A 3QWRA 1MHHB 3V5HB 4MJ6B 3DXAD 3MV9D 4JB9H 2WLHA 1A6TB 4UT7L 1OE1A 2DQGH 1DJSA 4ISVA 5FA3A 4IJ3B 3C5JB 5D7IF 4GQPH 1BECA 3SYCA 1OOAA 4F5CA 5MEPB 2A2QT 3PP4L 5ALCH 3DV6B 5L2KD 2ZKWA 3T1FA 5IMLA 5IQOA 3DX6B 4O2CB 1IGTB 4WHTA 3WEAA 4M61B 1BVLA 2OXGB 3QPKA 4PRPE 1P5UC 4JEGB 2J4WL 2X4NA 2HX8A 2YOAA 3T8VA 3MV8D 4Z7OF 1LO3H 1UH4A 4N0FA 4N24A 3VVVA 1OM9A 2CK0H 5C0GA 4JY4B 4YZFE 4K8RL 3MNDA 1UGKA 1FFRA 1YJDC 4QXUL 1U3HA 3O9WA 3BEVA 4B27A 2EYTA 4NSKA 5AZEL 4CBZA 3PP3H 5KVEL 2GJ6E 4DPCX 1D2OA 1QLFB 4QPEA 3AAZB 3GTNA 1CR9L 2HFFB 4LXFA 5JIKA 3S37H 1EUTA 4M6AA 5L8KB 4AVIA 1S8DB 4NAJA 4BINA 1H3VA 3I3DA 3F01A 2Y3NA 1XSOA 5GGRY 1KBGL 2HTLD 4GRWE 3MLZL 5IMMA 1EDHA 5CJQL 1D9KC 4H1LH 4XVUD 4FQIL 5TQ0H 4XPAH 5FO7A 4BWTA 1DJHA 5E2WH 1M71A 5DK2B 4A7QA 4Y4KC 1QSEB 1NIBA 3RQ3A 1MELA 1XSKA 1CBJA 4PJAB 3ZQXA 3ZKSD 2NY5H 4G6JH 2X87A 1U4EA 5C97A 3NTCH 5I16B 4P05A 2CLVB 4XN4A 1HVXA 3O3EA 3ILDA 1ZSDB 3WUWG 3B9EA 2Y7NA 1NMAH 3BN9C 4G6FB 4RAUB 5KYYA 4XN8A 2X41A 5G4OA 3B3BA 1OSZA 5KSUA 4L0YA 3SDDB 3HG4A 2FECI 1QLEH 1CF8H 2Z9TA 1JGLH 3FUHA 4HVBA 1P5UA 1M57B 1TLMA 2F5BH 2ZP9A 4DK3A 4LEOB 3MFFA 2H9GB 3UC0H 3SDXA 2CAKA 5IG7A 2B4CL 2YAEA 3T4YB 4BCYA 4WQOA 4ANUA 1NFIA 3J7HA 2BLFA 4PTUB 4UQEA 2DWTA 4L2YA 3ASNB 3EG9B 4EKXA 1BBJB 1I1FB 15C8L 2R69H 1DBJH 4I2XE 2GIXA 3A21A 2ZAGA 4LSQH 3IDNA 2KLRA 3G6JE 5C8JA 2CPUA 1YQVH 2OJ1A 1URZA 2VR8A 4H5SB 5JW4R 1D9KA 1J9TA 3RURA 4HUVA 1R5IA 2E0PA 3WNJA 1N10A 3V5KA 4PY7B 4DIXA