2XETA

Conserved hydrophobic clusters on the surface of the caf1a usher c-terminal domain are important for f1 antigen assembly
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
89
structure length
89
Chain Sequence
GGRLFLHLKRSDNKPVPFGSIVTIEGQSSSSGIVGDNSGVYLTGLPKKSKILVKWGRDKNQSCSSNVVLPEKTDISGAYRLSTTCILNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conserved Hydrophobic Clusters on the Surface of the Caf1A Usher C-Terminal Domain are Important for F1 Antigen Assembly.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Transport protein
molecule keywords F1 CAPSULE-ANCHORING PROTEIN
total genus 20
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13953 PapC_C PapC C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2070 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2xetA00
3RFZB 3L48A 2XETA 2KT6A 4J3OD
chains in the Genus database with same CATH superfamily
4BHUI 3S5YA 4ZPTB 4QY8B 4MD0A 1N0LB 4MMYA 1R0AL 1UFUA 1UOKA 4KO6A 3VRLF 1NDMB 4S1RH 5M94B 6FABH 3CVHL 5F7UA 5BMFL 2Y07H 2X0VA 3W5MA 1ZY9A 3LKQA 1U58A 3LQAL 4P0DA 4OGXL 4ZOAA 3MC0A 5E24E 1ZHKB 1KPVB 3V8OA 2ADJB 1WZ1L 3SB3A 1MW2A 3EFFA 5BRQA 5HHOE 1EGJA 2PF6A 4L8SA 5E4EB 1R19A 4H0HB 5BV7B 2MNWA 4MXWL 4ZI8A 3UP6A 3GXMA 4AJYV 4DN3H 3BKYH 3DX6A 3EAKA 4J3OG 1IM3B 3I50H 4TRPL 3ETTA 2YEZB 2CK0L 1FORH 4BM7A 4K3GA 4GLRH 5FUCC 4OAWA 5C07A 2DL2A 4PRHD 1KIPA 2OSYA 5CBEA 1YNTB 5I1EL 1M7IB 2V0AA 5F72S 1B4JH 4N1HB 3W0WB 4Y1AD 1IKOP 1IU1A 2ITEA 3MRIA 4PJXA 1FNAA 4DGYH 1UT1A 3DRQB 12E8L 1RZKL 3VXPB 3B5HA 3OTTA 1PY0A 4FERA 5CCJA 5JO5B 5FC9A 2BP3A 4YFLF 4GRMA 4G8EA 4LVHC 4YVNA 3NEOA 5C3IA 5IQMA 4CVXB 5AAPA 1Y6NR 4XPBH 4PRHA 1IGYA 3TBTA 5IHWA 1JZJA 4GY4A 2L7JA 4FFYL 2H1LM 5C0CD 2VUKA 1LTXA 4FTVD 4QTIL 4XNBA 5KSAD 3UG5A 1UM6L 1UACH 4YMPA 2BLFA 1L0QA 2CKNA 3NPSB 1N6QH 4PTTA 1XL6A 1DL7H 2NZ9C 2YUXA 3OD3A 1R5IB 1LEGA 3PWLA 1LE9B 1Y18A 3H56A 4PGBB 2ZUXA 4AMWA 3U7WH 2A0LD 3ZMNA 3KLKA 5IJVA 1PD0A 1KV7A 2J8UB 4PRAA 2AJZB 3TJPA 2CM5A 1KLUB 4G80B 3D06A 5KANI 1BYOA 2ERJC 1KIUB 1X4XA 4NQEB 3S48A 5CEXB 2G2RB 4X0NA 3QIBC 4NRZA 5D7LA 4Z9KB 5FYKL 1T4WA 3OM3B 3D18B 1G0XA 3FTSA 3SN6N 1M56B 2EDBA 2YSSA 5AW8B 2VXVL 3ARBD 2Y5QA 5ICXA 4RMRA 2VKWA 4WEBH 3UYRL 3VJ6B 5D1QE 5E00A 3HLKA 1HKLL 4YSCA 3FQYA 2JKLA 2ZOLA 5LN4A 1U3HC 2XTJE 4L1SA 4U1JB 1Q9OB 1J5CA 5E6UB 5E5LA 1QLEL 4U1SB 2UWEE 4EZKA 1RFDH 3OB8A 4TLUA 3RX7A 1BECA 2P26A 3S96B 3WIHH 1IJNA 1NCBH 3TEZA 5E8OA 5F2FA 3DIDA 3DSFH 4HOWA 4YHPA 4E41E 4OFDA 3W9EA 4IOIA 2GTWA 1UWYA 5EN2B 3KR3H 1HT6A 1S7TA 4XN1A 1RZGA 3WN5C 1QQDB 3CSPA 3O41B 2IH8A 3K6NA 3QNYA 2CA4A 1EJOH 3L45A 1TVHA 1XGPB 2Q1EA 3EADA 5CP7B 5FKPB 4J6RH 1ZGLM 2K7PA 1JVKA 5BCAA 4KX7A 3QYCA 1F13A 4XCNA 2YZ8A 1K4DB 3KLSA 1JNLH 5TH2A 1PKQA 2GIYA 3DJRA 3WIFB 3ARQA 3IU3B 2FIKB 2OL3A 4ZMTA 4ALAL 1OSEA 3OZKA 1MHEA 1VF5C 1FPTH 1AOHA 2DYPA 1PD1A 2XZAL 1T6BX 3FCGA 4F2MA 4PIBA 3IJEB 2A6KB 2CDGB 5D96B 2YRBA 1A0QH 3Q5OA 4R9HA 3K2IA 2ATAA 1RUQH 4Y9CA 3GMLB 4C58B 4NNXB 4N25A 4WHYG 4HBCH 4ZX3A 5AVYB 1I9EA 4O9HH 1NL0H 4ZZFA 4G42A 4AZ8B 4NWTH 3VI4E 3BN9C 1UZ6E 2FB4L 4YIQA 5I8KL 5HDRA 1CFQA 4P3CL 3X11A 1ZSDB 2KKQA 2WHVA 1S5HB 4ACPA 3AGWA 2G75B 3U9PL 3GXTA 3TTSA 3SE8H 1QBBA 3MLTB 4PBWD 1SJXA 4X5XA 5FA3A 3S97C 2ZP9A 3BAYA 2QSVA 1X5LA 1FZMA 2LOEA 3AUVA 3COOA 2WTPA 3QG6A 2VE6A 2WWMD 5C09B 3FL7A 4UZGA 3U7AA 3W39A 4CGTA 3CFEB 3HZMA 3V5DB 4PJHA 1U3ZA 4P5TB 2V2WA 1R3KB 3TO2A 3A24A 3NCCB 4KKCD 2P5WB 1IGIL 2HWZH 3V6OE 2F68X 3APCA 1GVIA 2WKOF 1KIRB 3T0EA 3M45A 3NCYS 2OQJA 1RZKH 4Y16C 4G1EB 3VXRE 1FGVL 1M2OA 3HG1E 3RGVA 2AQTA 5GZOC 1MWOA 4OM1H 5D93C 5EBMA 1WIPA 5FW6A 2J25A 4C56D 4F1SA 3ES6A 2VMFA 4JKPH 1N19A 5E6IA 2OZ4A 1K72A 1P6AB 4DAGL 4XP6H 3VFPA 1GJIA 4QTFA 3CHOA 3GMLA 3NSJA 1NGXB 2FHFA 5T5NF 4Y5XC 4MS6A 4A37A 2EKJA 3TVMC 2WXIA 3OF6D 3MOAL 4E9TA 3BVUA 1F3DJ 4F2MB 1UXWA 1TJGL 2VO5A 4Z0XA 3C8KB 4XHJD 1OB1B 1F2XK 1M42A 4Q58C 5IQ7H 3JQOB 1I3RA 1NAKL 1BFOB 4MXQD 4XC1L 3O3BB 3WV0A 4XWOD 4LLVA 1MHCB 4B53A 2VL5B 1RLBA 5DJYB 1MRCH 2DD8L 3H53A 3HMXL 4MA8H 2WGNB 2MCPL 3T77A 5C0AE 1N5AB 3QIWC 1FWXA 4JPVH 4HKZA 4KVPA 4M7KH 1MAKA 3VFPB 4LSPL 4NAMA 4PPTA 3V7AE 2GHZA 3D4YA 4MBOA 1HHKA 2VSKB 3N85H 2HLFC 2GTWB 1J1XH 3EYUH 3E3QE 3LS5H 4OJEH 1LO5A 4ABVA 4RESB 1S9XB 1PSKH 1MFEL 2OQJB 2NX5D 3QUMB 1WBYA 1QA9B 5L7XL 4AQEB 3VRLE 1CD1B 2R23A 2ZUSA 3PWVA 3RIFF 3H7BB 5K9KA 1S8DB 1H3WM 3FCTA 5IIEA 2AJYH 4L0PB 2A6IA 1KT2B 2YN5A 5T5FH 4LQFL 3KPQB 4DPRA 1F4XH 4K7FB 2IC2A 2KHAA 3LPPA 4A7VA 1XBRA 1KLGA 4IOSA 5C6TH 1OARL 4H44C 1MNUH 1RZIA 2V17H 4DKAA 2ZQKA 2Q8BL 1D6EA 4FG6D 1JDDA 3QIUB 4QWWD 3QW9A 3K2UL 4ZAKA 2UY6B 5DZOA 1FSKB 3NN8B 2ZCHL 1WGOA 1A3RL 2IF7A 4J8RA 3V9FA 1NIEA 3NN8A 4XCYB 3I3BA 2WQAA 1F90H 3N6YA 3PLYA 2XN1A 1FCCA 3LYRA 2CM6A 4MLIA 1YC7A 3IPEA 3HB3B 5HJBA 5EZLA 4BQCA 2RFXA 4BKSC 4GUCA 3F58H 2VITB 1FG2B 4DW2H 5F9OH 1MW0A 2AEIT 4I5BA 3CFQA 1G1YA 3BSZH 4ZFOB 3WJMB 4AQAB 4Z6AT 4JVPA 2GSIA 2Q6WA 3MSPA 5ADOH 3DGCR 2GCYB 2CBMA 4KI5F 1WEJH 3MBED 2GSGA 3B2UC 3TT3H 4XNXL 1TQSA 1WJ3A 2OTWB 2JQZA 4RISL 3RL1A 2R1XA 1AANA 2XJKA 1OD9A 2Q2EB 5DUMH 4PJEA 4AT6A 1KENH 2PO6D 4JO4L 1Z9SB 3AW5A 5ID0B 2W8CA 1GGIH 4FNUA 5CBEB 4WNQB 1C08A 5EEXA 2WXQA 5FGBA 3GJEB 1GIGL 4JVUA 1OK0A 3VTMA 1BQHG 1XQ4A 2NY5H 2YXMA 3OHXA 4HUXA 5KUKA 1YPZE 2GJPA 1RZJL 3RAJL 3OZ9H 5DJYA 2NXZD 2BP0B 4GKOA 4Z7WA 3G5XB 4WFED 4GXVL 4DEUA 5DZVA 3DSNB 3CH8A 3L13A 5GS1A 2XQBH 1WC7B 3ZKND 5EOTB 3GSWA 4YE4H 4ICWA 4D0DB 1JWSA 1FI8C 3DVGA 3Q8CA 3WTYA 4XBEL 4Z7VB 2XOTA 3ULUD 2CR0A 2YPVA 3JBG7 3D2TA 1ZLUH 1MCPL 5D2NC 3KPSB 3BKMH 1FVEB 3V52L 4YDJA 2BJML 5EO9A 1IBFA 4DTGL 3VG0L 3LDBC 3S98A 1FC2D 2X4RA 3QR0A 5LDUA 2WBKA 3LIZL 1VZIA 4S2SB 4TOYL 1RJLA 3VXOB 4F58H 4F80A 4BA8A 2MPAH 3GSRB 3APDA 1TG8A 5I6PA 5LWYL 1QLRA 5CJQH 1Y18B 4XP9H 1ZVNA 3NQIA 1Q90A 5CJBA 4ETQA 4QKXB 4E42A 5IW1A 4JW3A 4NHCL 4AUYA 3DDFA 4MJHA 1XGYH 2JKRM 2WWNA 2KZBA 4JFDA 2DJSA 3MO1A 1SQMA 5E1QA 4R7DA 4LSQH 4NFCA 4PG9B 4JKLA 3K2UH 2YD4A 5E1HB 3UPCA 4PRIE 2V2XB 5T1MA 3KS0J 3CD4A 3IDJA 4LLWA 1GJUA 4R0LB 1GA2A 2YFNA 5LLIC 3CFEA 1D7CA 4NBXB 3MJWA 2HLFD 3QUXD 5A6LA 2HLAB 4QHPA 5GGQH 3IJSB 5DJCA 5B3SB 1EJFA 3V0GA 4TV3A 4C59B 4PQXA 3TTYA 1JTOA 1TCMA 1WCBB 4AZUA 1OK8A 3TBCA 4PBVC 3FAXA 3UTPD 3BP5B 3EZ8A 3MN8A 4CNIA 1QEWB 1WBXB 4O02H 4WK2B 2IPUG 2ZOTA 3F12A 5LG1A 1N68A 4AGLA 5GGSY 2QLYA 1JYXA 4EIBA 3EO0B 4Y5XB 3F7PC 4XP5H 1VPOL 1AHMA 4PGEA 2X6VA 4OM0L 3MUZ1 2XA8H 4HJGB 4ODWA 4S1SL 2QBWA 2YO3A 4DGUA 4Q8BA 1OAUH 3X3GL 2DMCA 2XZZA 2J57A 1GZHC 2F53B 3F7LA 1M7XA 4TMPA 4UYPA 5KAQG 2NW2A 3TVMD 1IC4H 1NOAA 2Y1ZA 4F2EA 4KRMB 1TETH 4PJBB 1NBQA 3VGAC 2E76C 2BPBA 5D1XD 1EEYB 3O6ML 1UT2A 5HYEA 1E5YA 4AK1A 5DF0A 3T65A 3DOIA 1U92B 5E6IC 1UHVA 2N1KA 3BWZA 3PNWA 4Z77B 3MRJB 5AL8A 4F9PA 1TTFA 4HWBL 4TULH 4Y16D 3GS0A 5FV1L 5FB8B 1HQ4B 4ZBJA 5FF6B 3D09A 3F84A 3BVXA 1JZGA 2ZCLH 3ZN6A 4WTZG 5CP7A 5EV7A 4HMEA 1NUGA 1JD7A 1OAZH 4IOIB 2DIJA 2ZKHL 2F19H 4PP1C 2MQGA 4NKMA 4LP8A 1RZFH 3R8QA 4HD9A 1DVFD 2GITB 1J8HA 3K74B 4FULA 4R7NA 7CGTA 5FA4B 3VFUB 4XNYL 5CSZA 4LCCA 1L6PA 4QRRA 3IRPX 4PJBE 5EZIH 3OQRA 4XTRD 5E9DE 5FO8B 3RFZB 2XVKA 3OLDA 2MOGA 3CFCH 3X1EA 2NQDA 4U1JA 2WLLA 3NEEA 3VE0B 4F27A 2ZKYA 5JDJA 2W81C 2J8OA 4G8GE 2GBUA 5I1AA 5DVPA 2C1OB 4JFFA 3NCJL 4OH2A 5D71L 4HGWB 1YMHA 3D18A 3TBWA 1SOXA 4W9CC 1JZFA 1CE1H 4KY1H 4TL5A 4YNYA 5F7YC 3QNFA 3GTVA 1U41A 1HOCA 2FWUA 2XKNA 4FMFA 4M7JH 3PGCB 2K8QA 1SDAB 3GMPB 2G4GA 1SOKA 4NZUL 5BO1L 4NN7C 1A22B 3LKOB 3PHAA 5IEHB 3MV9D 1E40A 3BT2L 4BINA 3WO4B 4UAOB 3QFDA 3HKFA 4A2EA 3NABL 1P84J 4H13C 2VDKB 2FLMA 4HJJH 1CLZL 2H8PB 3HRZA 1E2ZA 4QUOA 3V4VL 1ZVSA 1WWBX 2Z65C 4ZMZA 4PLNC 1CIUA 5C0BD 2DYRB 3L4YA 5E5MB 2QADB 2EXSA 2X4UB 4ZFFB 1F8TH 4G9FE 5B39A 1F58L 3QZPA 4LHQB 4YNYB 2EYSA 3FFDA 1G7IA 4R2GC 1GGBH 1QVOB 3T8XB 4DP8X 1BYPA 5I1JL 1IGFL 1KCRH 1OTUD 4OBRA 2ZOKA 3SCMA 1B9ZA 4IJ3B 1RK1B 5CCHE 4M7LT 4FHBD 4JFEA 3DVIA 2ZWZA 2ZXQA 5AOJA 1SF5A 3QUXB 5HHOA 3H4HA 3FB8A 4OAWB 3BFQG 4OM1L 4Z7UE 3VFNA 1EV2E 1WP6A 5F9JB 4WW2C 2YLHA 1BAFL 4GMSL 1FAIH 2RGSA 4FGMA 4RNRA 4G83A 3MACH 3HFMH 1KCSL 1UASA 4KPHL 1S9KC 1RHFA 3BQUD 4PGJA 2I9LB 3NFPB 5TJWK 2DWEB 4KXAA 1XR9B 3BUYA 1BQUA 2DQUL 2YA2A 2ADIA 4PJ7B 4Y4HC 1FH5H 2MCMA 1JPST 2ID5A 4XVUD 1HQ4A 3RYMA 5DQ9B 5F1OB 1E9OB 4G82A 3EYOA 1AKPA 4ZO6A 1FL5A 3O8XD 4BEIA 4PWFA 3K6OA 1ED3B 1A1NA 2P24A 5FO7A 2NT1A 1K3IA 4KMTH 2AJ3B 5CKAA 2ARJQ 3KPLA 1E67A 5K9OB 1K9TA 4QRRE 1O6TA 1S6NA 2D7TH 2DQIH 4IBSA 4PSRA 4F7EA 5DCCA 5LG6A 1N9PA 7PCYA 1M05A 3A6OA 3ZIYA 3EHBC 2YWYA 3BD3A 3P54A 1ZLVH 3ZMEA 1AXIB 3WUWG 2EYTB 4PB9H 4GKNA 2D2CC 5F44A 2IWGA 1UYWH 3CUPB 1FFOB 3T8VA 3ZDZB 2HFEA 1RY7B 3ZTJH 1BMZA 1DQTA 2ATKA 1G9HA 3NZUA 2YQ2A 1YPZF 4M5ZL 2DAVA 5B8CA 3FW6A 3HE7D 3PAUA 4OZIA 1DQQB 3NBNA 4TLKA 1TZGH 3FU5A 1YEEH 3JVFC 3Q43A 4F8OA 3VFVA 5HHPB 2PWEA 2A2QT 3K1DA 3FS9A 3NCEB 5D1QD 1KYDA 5HPMA 1QSFE 4FEMA 5DJ6B 1E42A 4OZHB 1BJMA 4KI5D 2X4NA 3NSXA 4PBDA 4PRPD 4YDLC 3MOBH 5HGHA 1U8LA 4L3EA 4MQXC 2MNUA 4JFED 3GRGA 1IQDA 1NC2B 3K8KA 3MR9A 3MLUL 2R4RH 3IDYC 4LLYA 4GAYB 4MVBC 4Y4HB 2GC7C 3MLZH 4E9QA 1H8LA 3ML9A 2B3IA 2NY4C 4N1EA 3L95B 2D7TL 2DQIL 5DYFA 1UGNA 1NFKA 1H3GA 1NCAL 4N2CA 3UPRB 1RIHL 3Q9QA 4PLKD 3HN3A 3CXDL 3LJ3A 4OZFB 3IDNA 3GSRA 4WW2B 5I71C 4QHNA 5I74B 2DYSB 1X5IA 1XF5B 3CDZA 1SYVA 2YGOA 4NPYB 4QHUA 3OSKA 2R2BA 4I77H 3D9AL 3OC5A 4HIPA 1F58H 5SWSA 1S7QB 4ZUTA 1D5IL 4FQPA 2FSEA 4QGTA 1MCBA 4FNLL 4PLKC 1XB6A 1SN0A 4FZEL 4Z95L 5C0BB 3SQOL 3V4LA 5CZXC 1SJEA 2BOBB 2XN9D 2L7QA 1H9VA 3MRCA 3X1BA 1NAMA 2WOYA 4G1EA 4GFTB 3VYNA 1U8OA 2X87A 3DMMD 3DHMA 1Q9KB 1HOEA 2OX5A 3D3VE 1B9KA 4XAKE 1K8DB 3RRQA 3ABZA 2FUTA 3VFRB 4D9RD 1ZK9A 3A21A 1ZPLA 4G8GB 4RSYA 4X7FC 1DQDL 1BD2B 4PV9B 3O4OB 3TO4C 4NUPA 4TQEH 4MA3A 2DIAA 5AZEH 5C0JA 1U3YA 5E8EA 4XPAH 3WEOA 2BOCB 2VE6B 3U1PA 4J39A 3TN0A 4N68A 2EDDA 1K3ZA 1DVFA 5FO2A 1IIKA 2CMRL 4Y88A 2E7LA 2DI8A 4H25A 5BRPA 5CINH 5E2UL 5ALCL 1CI5A 5FHAH 4HYTB 3EDFA 3FFOA 3NK4A 1BAGA 3GB7B 4S1QH 2G3NA 1SHSA 5HGDA 3LH8A 4N2BA 2V7NA 2WZ0A 3EJTA 1ZSHA 5DO2D 1VFMA 1QR1B 4Y1AE 4RMSA 1JF6A 2WLNA 3EG9B 3IAQA 2YAMA 4OKVA 3ROLB 4TVPL 2PW2B 5F6HI 1IGTB 5MP6L 2AJXL 3DOSB 4AL8C 2UWEA 5B8CC 2I9TA 2G9HA 7FABH 3NT0A 5ITBL 4OV6F 3SYQA 5FX3A 3I9IA 2B1OA 3L9RB 5DVKA 2VDNH 1K5NB 2AMGA 4MXWH 5DEZA 2R29L 3RI5K 2XWXA 2IGFH 1JZ8A 1XWVA 2VDRB 5LCVL 2ICES 4TTGA 2DLGA 5F88A 1DQJB 4WW1A 4UILH 4Z7NB 3L1OH 1AKJD 3ABGA 3MNVA 1D6EB 1SFHA 2NY6C 3HE6A 3CVHA 3HS8A 3Q2NA 1RSYA 4N2GA 3LKRA 1Q8MA 5IP4A 4WJKB 3BZDA 4LU5H 2DQDH 4BHUA 4KDWA 5HGAA 3HE7B 2VXQA 2ICWI 3J27A 1U8JA 2JJVA 4MB3A 1FFNA 1R33A 2BZDA 4IHOB 4NRYB 2KERA 4JBSA 4S1DC 3SIKA 2JKXA 1U9KA 4ZYKB 2J72A 5JORA 3FHEA 4EKJA 3IF1B 1V05A 4IRJB 4XNMA 4DP0X 1T6WA 4JHBA 3TCTA 1A3QA 4JQXA 1FL6A 3GIVB 1H6TA 2NUPB 4BZ1A 2ZUQB 3VAEA 3O4OC 4NPJA 3BT0A 5E5RB 3C6EA 1H5BA 1WH0A 3O6LL 1IC5L 2I27N 4ZX5A 1NC2D 1AG6A 4JDVA 5SWQB 2A6DB 2BOBA 3D69A 3NH7L 1AMXA 1D5MB 1H3TA 5GIRB 2EE3A 3GBNH 4GQQA 2VW7A 4BSWA 3T0BA 2M8XA 3PHSA 4Z3JA 2Q0ZX 2J55A 4L29A 3MRFB 3BWUC 2ITDB 3QJVB 3GRBA 3DDGA 3QC5X 4JO1L 5AUMA 3U0TB 3Q2CA 1RPQA 1YAIA 4G80A 3PDDA 3CDZB 2XWTB 2B59B 5E9DD 2OMVB 3X14B 4N28A 4IMKC 3TEYA 4A7SA 4PJ5A 1A7OL 4F7TA 1M1XB 1WCQA 4R5XA 5E2JA 4GO6B 1CL7L 5F96L 3ZDXE 2AGJL 3Q0HA 1TEFA 4LZKA 1B3IA 2F9BT 4IOFD 5D6DA 4PRBB 3UTTE 2ATPB 43CAA 4PYHA 3VGGA 5MI0B 2UWEB 1LDPL 1PIFA 2FHBA 4JG5A 1L7TL 1O75A 1ZHBA 1KCKA 3UX9B 1RXLA 4FNRA 4XI5D 3KVDD 4M3JA 3MR9B 3HC4L 3NAAL 4JFOA 5AW7B 2UX7A 1CXEA 1UWFA 1KTJA 2DW5A 4M29A 3UH8A 3S35X 1KV3A 1UZ8A 1JNNL 1PEWA 3ML8A 4U05A 1VEMA 1YNLH 3CDGA 1JPTH 1WWWX 4BFIB 3W38A 4G8GD 5CFHA 2ZYRA 4JCMA 1KEGH 2MTPA 1C16A 1KG0A 3W2DL 4M00A 4DZ8B 2Y1VA 3CDFA 1OTSD 5MI0C 1GJWA 32C2A 3P4OA 2XDHA 4GBXD 3K6IA 3WXWL 4JFPA 4IU2A 4HMCA 1PLGH 3GSUB 3QEQE 5E2VL 5JR1H 1EAQA 4Z3EA 3EHBD 3EOAA 3FF7A 2QPEB 2WINB 5GGVL 2XRAH 4M5ZH 4JO2L 2C8NA 4GG8A 1CICB 1NPNA 1I8KA 1WGVA 1PDKB 1GSMA 3P73B 2F5AL 1TZ8A 3H9HA 4WFFE 3RVTD 1I9IH 2AABL 4PJ8D 5E6YA 3X11B 4V2BA 3VD3A 5I0VA 3HMWH 1NAMB 5T3XD 3CC5B 4FQXD 3FUDA 2AK4A 4MX7B 2ADJA 2X3BA 4LSUL 2A9NH 2E5EA 1QNZL 2W9DL 1DJXA 5C3TA 4BFEA 5K39A 3AAZB 3VVVA 4Y2LA 2A74C 3ZDXB 3ZRSA 3FTYA 5HYJA 4DH2A 4LMQE 3DI2B 4QF1A 4Y4KC 5KBLA 5J13B 3VXSB 5EO1B 2GT9B 2O6EA 3U30B 3UERA 3CH1B 1RU9H 3MLVL 1ZLUK 4N5EC 4W4NA 2ZXDA 4IRSC 4E36A 2P7TB 1PLBA 4G7VH 4RNRB 1DBBH 1YY9C 1UD2A 5A2IH 4YLQT 3FFCB 5TD4A 3BUPA 2XYCA 4IEFA 1ZT1A 3D50A 2BSTB 4HJSA 1FAIL 2O5YH 1X7TA 3DUSA 1VADA 3S35H 3C5ZB 3L2MA 4XCFH 2BNRA 3QUZA 4TSAL 2R1YB 4IRJD 1MNUL 2V17L 2WQUA 3PHQA 1BZ7A 2OMNA 3ULVF 4L18A 1ADQH 4PJGF 4OLWH 2HFGH 3GMRA 4WU7A 3RHWK 1A9VA 4YO0B 4PJ9A 5I76A 4F7KA 4GW1A 3HBPA 4QJ3B 4JHVA 4ODUA 3SBPA 3OKYA 4J23A 4J3VA 1HZLA 2XKSA 2DQCL 5KBMA 4EVNB 1VKXA 4MZIA 2WSDA 5EZJB 2K45A 3UJIL 1M6OA 2K7QA 3RNQB 1R46A 3BGMA 5DZNA 5B8CB 2XCMC 4D94A 2UWEF 3HRZB 4ZUVA 4WF7A 4ZW3A 2BNRE 4CMMB 2AGJH 2CBOA 3F62A 4MDJB 4QXTA 4JN2B 1BHGA 3II3A 2YPKB 5HDLA 2RD0A 1M2VB 1B2WL 2EQDA 4GG6A 1Q38A 3QPXL 4PCYA 4M43L 2DH3A 1CG9B 4Y7OC 3GSVB 2WSPA 3MRMB 1A7PH 1XIWB 5E0QA 4LSSL 1MELA 1RU9L 3MLVH 4GBXC 4QRAA 4I7ZC 3BH9A 1LEGB 3PWLB 5FGCE 1R3LA 3QUZC 1PCXA 2IOMA 4PJIB 3BEVB 2VR7A 4ONHB 4EN3C 3KZ8A 3QJTB 3G9VA 4L8BA 3T2OA 1UA3A 2EZ0D 3AT9A 3E2HC 3OG6B 4RGMB 5LAXB 1IC5H 3QO0A 4QOKB 3OR6B 4Q4EA 1ZA6A 2PCFB 3GBML 5IJDC 4X6BB 3S9DB 3B2DC 4CVXA 5E56A 1JHTB 4Q2ZA 1FNEB 5L7XH 3CMGA 1EMTH 3FOMA 1OOAA 1CYWA 4DAGH 2IAAC 2VDMB 5HD8C 2VMCA 3QO1A 3PXLA 3FT3B 3UZVB 1G5GA 3MYJB 3TIDA 5IQ9B 5F9JA 1E4KA 1O9ZA 4BQ8A 5HYJE 3QULB 1E4JA 1T2JA 2GKIA 3GI8L 3SDDB 1CR9H 2IEPA 3MCKA 1QP1A 4QRPB 1BQ5A 5EFIB 1DANU 5FYKU 1ZS8B 4DN4L 2Z31D 1PLGL 5C09E 3LN5A 4J4PD 2D31B 1KB5L 3L3HA 5CZXD 4E41B 4LF3B 4NKDA 4CAGA 2D03L 3L2LA 3CSTA 1N4XL 5IV2A 4PEEA 4TYUA 3UJJH 1LO2H 3M6DA 2CR3A 2IQ9L 5EH1A 1VZHA 3CFBB 2H0EA 5JW4R 2VMEA 2YJLA 1TITA 2MIZA 3I02A 2EC9T 2QQNL 1RJYB 4IIQA 1B4TA 5IHHA 3TYFA 5LKNA 1IKNA 3TPKA 4ZUVB 3IJHA 3T0VA 2ZIDA 2Q86A 2XWJB 4HP5A 5HD8D 1FO0L 4GQPH 1A7NL 2JTYA 5SV3A 3QCUL 2XG4A 3F12B 2GI7A 1EO5A 3EBHA 2VZOA 1LP9B 4MD0B 3V9CA 1A2YB 2V9UA 3O4LE 3ORJA 4YBHA 5C0RH 3ATAA 2YRPA 1N7ML 3D87B 3TF7C 1VGKA 2PYEE 2QVKA 2BNQE 2HFGL 2Q7YA 4TPRH 3MROA 3QI9A 4LQ1A 4ALAH 5FGBC 1O7SA 4C83B 4WQOA 3DXAB 3RDTC 1OY3B 2HRGA 4JM0A 5E4OA 3Q6FA 1NCWL 5CZRA 5GGQL 4B9JA 2J88H 4DGWC 2ROXA 5KYYA 5KSUB 1K6QH 1HE8A 3VFUA 1AXTL 3N0PB 5FO9A 5JPMA 3T3PF 2VJ8A 1SLXA 2CH8A 1HI6B 2ZOUA 1TPXC 5GS0H 1HZHH 3BSHA 3QIWD 3GSNB 5KSBB 4P48A 3ARDB 4MXVF 5GSRB 5JHDA 2EH7H 3GRWA 1FHGA 1IBBA 4MAYD 4UQCA 5I73B 3FTGA 2ZXEB 3KE0A 3K5SA 5I1CL 1XCWA 1MCHA 3ARBA 3P1VA 1AJ7H 1LGVA 3VWJA 4G8FB 2VLRE 2Q86B 4DTGH 1OV8A 2BJMH 4YZFE 5IFJB 4N0YL 1BEYL 2O5ZL 4YZWA 4G9DB 5E99L 4NHUA 4P3DB 5DS1A 5TF0A 4P5KA 2G9KA 1SMAA 4PJBA 3DSNA 3UACA 2MSPA 4MAZA 4FCHA 4I2XA 4I3SH 2L4OA 2OJZL 1ET5A 2BVUA 4DP9X 4KZDL 1IM9B 2IGFL 3ULVD 1BZOA 2F5AH 2YA1A 1NC4B 3FCSA 4NKDB 2HJKB 4R7LA 1PLAA 2O6CA 7PAZA 5KSAA 2VXQH 4C47A 3LVEA 4QOKD 3EO0A 4Y5XA 1KACB 3DTXA 4LARL 3RKDC 3WE1A 4PRIA 2PYEB 4WWKA 4MJIE 4EZMA 3I9AA 4PJFF 1AVAA 1DL7L 3AWGA 3JV0A 1Z9SA 2EEFA 4D0BA 1NLBL 4LLDA 5F71A 2F7IA 4LK4A 1PPIA 3KM1A 1HVXA 1ETB1 3MA9H 4KKCC 4ANUA 2BMKA 3D48R 2XXGA 3L4VA 3SDDD 3OAUH 2BY3A 5EWIL 1FC1A 5AZ2L 1TFHA 5CINL 1CDJA 2HH0H 1JNNH 4X6BA 1YUHB 2V5TA 3OR6A 1ZV2A 2EH8L 4KUZL 5J6GA 2Z31B 5MEPB 5C0FA 5H35A 2CCLA 3ULSB 1HHHA 2X4OB 5ESQA 1RULH 4YXKH 3RJOA 3RDJA 4YHOL 1ZHLA 3ARDC 3B43A 1EBPA 3MRQB 3OGOE 5ESVA 5CN1A 4UOQA 4D8PA 3H0TA 4NN7B 3UZQB 2NQ3A 4G1MB 5I1EH 1HCVA 3SPVA 3WXVL 5BXFB 2IH3A 3T4AB 1QLRB 1NLBH 4MJID 4RAVA 1U36A 1EUUA 1THAA 2IDSA 1HC1A 3CWGA 4OCWH 3X14A 1RPUA 3MKGA 1OCWL 4XOAA 3FB5B 3NJLA 3RPKA 4GG6B 2D8KA 1NLDH 1A3RH 2JFCA 5INDA 4NNYB 4CW1A 2GBVA 5LDSA 2HKAA 1CDIA 2IMNA 4LVEA 3DWTA 3FN3A 2E86A 1I53A 4J3XA 3R7QA 3SGJC 2HVJB 1F4WH 2YPLE 1T0PB 4FNLH 1GAFL 4ONGL 1ZVHA 3TJHD 1T21B 5JYLA 1A7QH 1JWSB 3DBSA 1TQVA 4DCQA 1V55B 1S8DA 1A25A 1F4XL 3MRKA 1H9DA 4I77L 3L3GA 1Q0XL 1XH1A 1IAIH 2OMZB 4PJCB 2NUPA 1E4XH 5I1GL 3TJHC 4JY6B 2GJ6B 1SHMA 2WQWA 3Q8FA 4WKZA 6FABL 2EIZA 3EYQD 2GIMA 1WDAA 3C75A 5F89B 1B4RA 1JGIA 2F6AA 1KTLA 1SXAA 1LO5B 1WSST 2VLRA 2X6AA 2QEJA 4FQ2L 4WO4B 5HI4C 3SYPA 4YXHH 5BZDA 1MLCA 3UC0H 1NCAH 2FO4B 3MNWA 1YDPB 1DJYA 4R4BA 4HKZB 1W0WB 2EIMB 4U6XB 3C5ZA 4PJIF 5E6SB 4EDXB 4Z7AA 5C9JB 1BLNA 3EYFB 3G5VA 4Z1PA 1AHKA 4LGRB 4QXVA 3VYOA 4YDVA 4E5XB 4YK4C 1WPCA 4G7QB 4Y2DD 5FK9A 3U2SA 1ACZA 2XFXB 3ILQD 5F0PB 2ZF9A 3QXDB 3QIWB 1RUMH 1VLXA 4NEHB 4CGUB 1A6ZA 1KUMA 4RWHA 1WZ1H 3FONB 1M57B 4HK3N 1QSEE 3QUGA 3WIIH 3PWNA 3WUWB 1O0VA 1XR8B 1QZNA 2VDRH 3EJUA 4JRYA 4ZMYA 3UBXI 4UI2A 5JW3L 2MNJB 3F7VB 1UH3A 1YHPA 5C0GA 2NZIA 4S1RL 3LKPA 3NA4A 1BZQK 1WD8A 3DUHA 4LFHG 2F1BA 6PCYA 5GRWA 2PLTA 3SZ6A 1J5OH 1L0YA 2CHDA 3OR7A 1SY6A 5TDPB 2Z4TA 4XAKD 3BFOA 2FE0A 2YD1A 2F53D 2K6ZA 1AD9A 1JV2A 2XA3A 3K1KC 4L9LC 3TVMB 2YPLB 1E4HA 1TQWA 1ZWIB 2Q7AA 1HZKA 4ZMLA 3AS2A 2BC4B 3HZYB 5D1XB 5EU5B 1NJ9A 3LRSB 2ZX9A 3QCVH 4ILDA 4MNQA 1AY1L 4S1DD 1IAOA 2ZXWB 3W3BA 1BVKA 4DT2A 5FOBA 1M3JA 2YMXL 4A1RA 5AEAA 4PAZA 2J2ZA 4Y16B 1H3XA 4W81A 2EXYC 3FFCE 5LN8A 3RWJA 2P28B 2IBZX 4GLRI 3CSGA 3M46A 5KSBE 3GRWL 4JM2C 4XMPL 4GRLC 3MVSA 2YAOA 1N4XH 1TTBA 3ZE2E 2R23B 3PWVB 1ACYL 5CEYA 2WCPA 4JMXA 4JRFA 4RETB 2P8MB 4UUJB 3RDTD 5AB1A 2N7AA 3K71B 3MRCB 1II4E 2VTFA 4PGDA 3LXAA 5IFAH 1QOKA 1WBZB 4ENED 4YBLB 3ILDA 5KJ7E 1K4CA 3FULA 4HWUA 1CFSB 4PS8A 1JIBA 1ZLDA 3JWNH 4L2LA 1E28A 2FJHB 4NWTL 3T2NH 1DUYB 1NL0L 4JREB 4XR8C 4AYSA 4KZEL 2K1MA 4FJYA 5KG9B 1PYWA 4YX2L 2NNAA 1M3IA 3I6LE 4XN5A 3ESPA 4ZMAT 3HI1B 1KN2L 3S88L 5DJDA 1CD0A 4QYAA 2OMVA 5F7KC 3G9AB 3TXAA 4A7UA 4XZUA 5CLTA 4IGBC 2ZWLT 1ZEAL 3MLPA 4W6YB 1C9SA 2ARWA 2YD8A 3KBHE 4JRWA 4PUBL 1TFPA 3MV8D 4GAYA 1X7QB 5HHME 3OZLA 2N59A 3O41A 1CLZH 4OZGE 5CAYB 1T2QL 3KNBB 1R3IL 1WWCA 3KYKL 4BZ2L 3DMMC 3L5XH 2C4FT 4FS0A 4DO4A 2VXSL 3W9EB 5EUOE 5JLZB 2GJ6D 2APXA 3AXHA 3V7MA 1NCNA 5AKRA 3SBRA 2EVGA 4L0ZA 5I66B 1RUAH 3PPSA 5KVFH 2R9HD 3DK2A 1BXUA 4IRJA 3UEQA 3ESUF 5D71H 1DQQA 1S9YA 2CGRL 3QUYB 2V2WB 5TK2A 4HD5A 4FLOA 5E7FA 3U4BH 1G0YR 4RDQG 1HWGB 3F65A 4JQIA 4Z7UA 1DVUA 3PJSB 4N8VG 1FL3B 2W60A 2VSMB 2CSPA 1FDLL 2CIIA 1XF2B 4X5XB 1CICC 3FU9A 2X3CA 2VISB 2VXVH 3INUH 3O9WA 4HXAH 4WO0A 4MNQB 1WG3A 3VG0H 1FZJB 3BDBA 4JJOA 2Y5EA 3ECVA 5KBKA 2HMID 1Q9WB 3WGUB 3Q3GA 3MLSL 1T89C 5J57B 4PGBA 3ZL4H 1Q72H 2F58H 1GC1L 1BVZA 2PXYA 4M56A 3TJEL 3WN5A 4ZFGL 3S7GA 2JKIS 3QZLA 2HSIA 3HKZA 1NGWB 2X5PA 5GXBB 1ID2A 4QR7A 3QWRA 3CC1A 1AIFA 2VXUH 1XEDA 1DLFL 3ZIMA 4HLZH 4LPCA 4AVJA 3Q44A 5DA0B 5IB4A 3SOBH 1G6RL 4QTIH 4ZX4A 4DETA 1G87A 2WY3B 3AY2A 3PY9A 5DMYA 4HHGA 4ZSOE 3NA9L 4G8EB 4KVNL 4M48L 2YBRA 4XT1C 4HWBA 2VXUL 3NSDA 3RKPA 3DPBA 2G60L 4M43H 3I6KA 4HIEA 4W9JC 3RWFA 3KW7A 2HYMA 2P5WE 1QHQA 5HHOB 3VFMA 3BP4B 1Y6MR 2YD9A 4H8WC 1X5KA 2VLKA 4ZFGH 3SGJA 5T3XE 4F7CA 1RIUH 5IROA 3T04D 4HLZG 5C07B 1L9RA 1VHPA 3LRGA 3QDGA 1CZ8L 4F7MA 3DX3A 4YC2C 5E8NB 4Q89A 4HUVB 3TFKD 3REWB 2J3SA 1QVOA 3T8XA 5DMIL 4NQXA 4TLSA 5AOKA 4JO2H 2CK0H 4FLQA 2JIXD 4HDIB 1BX2B 4NQCB 1O7DC 2FYYA 3UTTA 1Q9KA 4UQIM 4OCSH 5KZCB 1MCLA 4PVMA 2CQVA 4IGBA 2JKTM 1KJMA 1UH4A 5FKAB 4IQHA 3AG3B 5E7BA 4AKQA 5CLXA 2F7OA 3ISRA 4Y4HD 4QHMA 3LKSB 4NI6A 4LCWD 1D5XB 4QXGH 3TA4D 1KEGL 1RUPL 1UZ6F 1IIIA 2ZXBA 4LKXA 5JYMA 1UA7A 3U7YL 4EUPH 3FTWA 4FNPA 2H9GA 3DRTB 4JFDE 2BOLA 4ZUUB 4CJ1A 4OQ1A 1A6VL 4HUNB 3L3JB 4HISA 4NUGL 2GVYA 4ZPTA 4DPAX 3JV4A 1R3IH 3KYKH 1AE6L 1T2QH 1MKFA 1I3VA 3B9AA 4K07A 5IT2L 3OLGA 5HHXH 2IH3B 3T4AA 2VZSA 1P7BA 3EDEA 3VW3L 2YXFA 2A9DA 1XCTA 4ERSL 4YHYB 2JI1A 3AB0C 3QDHA 1UXLA 1LP9E 5HYQB 1CGUA 1ZHLB 2VH5L 2YUZA 4NCC1 4CBZA 1ZOXA 3C87A 3MXWH 3IKCA 3OB0H 4DPBX 3ZDYE 2E9WA 3I75A 4MCZA 3REVB 4RGNB 4GRLA 2H2PD 4Z18A 5IB5B 5B38G 3QNXA 5FPIA 3KLHC 4FFTA 3I84A 1ACXA 3MTRA 3H9SD 4MMXA 3C6LD 5EC2A 3EFDL 4QHKJ 1YEFH 4IDJH 4DGVL 2X4PA 3KDPB 2FX7L 4I1NB 1GYVA 2IBZY 5DJZA 1GOHA 2ZD0A 5DSCB 3QUYD 4WSJA 4GXVH 1T0MB 3UGEA 3W0WA 3DX7A 2LU4A 1OAZL 1C5DB 4MA8L 1AGEB 1QI4A 4Q6IC 3RAJH 2YPVH 2FJGB 3AT8A 1BMGA 1WK0A 2VDLL 5I30H 3GLZA 3L3OB 4XOCA 5D6CA 1JJUA 4U1IA 3BZFB 4ATTA 1GYUA 2YAPA 3ARTA 4N5UA 4KO5A 3P3UA 4WHDA 1BD2E 1NAKH 3GJFB 1G9MH 3VXRD 4G7SB 2Y7SA 1NFIA 1UWXH 5F93C 1IM9A 2VR5A 5JDSA 1YMMB 2VC2H 2ZG2A 4KUCF 1OGPA 3AREB 1PQZA 4BELD 3Q5YA 3MRPB 4IKLA 3VSUA 3WELA 2WXJA 4YEFA 4FI6A 2D7OA 2K6YA 2BFVL 2CJSA 2H1XA 5C07E 5KVGL 2JCCF 5TF1L 5I5IA 1KTKE 4N2EA 3THML 3WD5H 1P7QA 1GGYA 1QKZL 3POCA 4QRSB 4XVJL 4FXLA 3TO4B 2FL5B 2BHFA 3OLIA 5M95B 4PGEB 3WEAA 2VDMH 1YN7A 3E7JA 5D55A 1NFAA 2PKDA 1UM5L 1ASOA 4KKAD 1WBXA 1LJMA 1QFPA 4LEEA 4R3SB 4HHWA 2W88A 4XGZA 4JRXA 5DTFB 1G7PB 4OF3A 5ERWB 2XVLA 4NN5B 1X9RA 2B15A 1NBZB 1TMCB 4KK9C 3PP3K 1KXTA 3IWUA 4OD2A 4PWEA 3KLQA 4H5SA 5JHDB 1U8CB 5HHMD 1LYQA 1F3JA 1OALA 3PV6A 2CU9A 4LPYA 3WTVA 3UTOA 4N2NA 1BVLB 3VI4F 2CO6B 4UF7C 3BAWA 1MI5B 4UWQB 4TVPH 5MP6H 4K5PA 2QPSA 2KLTA 4IBQA 5C0NC 1KPRA 3DIVA 4NENA 4K71B 1B3JA 4LDCA 1A4AA 1BZEA 2ZKMX 1C5CH 5ALBH 3CSYB 1A1MA 3I6LD 3DXAA 1KLFA 1R9FA 3PDOB 1KMGA 4HZAA 2B8OT 3GBNL 3KJ6L 3LRLA 5L8LB 3G08B 4BRJA 4HV8B 2DY2A 4OZGF 5TQ0L 1T1XA 2NQCA 2IPTH 5I9QC 3MNZA 2VZVA 3LXBA 2UZYB 1A2YA 2IVFC 3L1EA 5CCKH 5D7JA 2XN9A 3OLEA 3V6FA 1FGNH 1VIWA 2NW3B 3L81A 1DFBL 1VDGA 5DZLA 4R97B 5I8OH 3BP7A 2APFA 3LVTA 4L37B 4BA0A 2P80D 5T3ZH 1SDDA 5HHXL 3U30C 2CGYA 4DWHA 2RCSH 3TYFB 4CDHA 3HCVA 1J1PH 2OI9C 4JPVL 1FVDB 1ZXQA 1QSEB 2DKSA 4IJTA 2A6JB 5E9DB 3JWDH 2EDKA 2O1AA 1AG0A 5MERB 1CLOH 4Y2DC 1CCZA 5J9PB 3VFGH 1BPVA 1EQWA 3C2AH 3H7LA 5AWNL 3NOIA 4KNSA 2HVKA 4Z7WB 2QGCA 3QYMA 4CILA 2I85A 3V4PA 1IEAA 2DIEA 5FCUL 4O02B 4TTDD 4TNVF 4KROC 2HP4A 5F70A 4XXDB 5IB2A 1WIOA 1VCBC 3UEZA 1PNDA 1LO3H 1KBWA 2AXGB 2EO1A 4X8CA 3CSFA 1WTLA 1EO7A 2BS71 4EQ3A 5IMLA 4DKDC 2BSEA 4OGQC 4TN9A 3SO5A 5BJTB 1TKWA 4HXBH 4Y19E 1KTBA 3OKLA 4Y5YA 5KTEL 3T0WA 3T6VA 1Q1JL 3FU7A 1M53A 2X28A 3CN4A 4XVSH 1KZYA 3H42L 1YYLH 2VDPH 1HXYB 1Z9NA 4U4BA 4I88A 1F41A 5BZWA 3FN0L 4HX1B 3DX8B 2TAAA 2UZYA 1WZMA 4JKMA 3QB7C 4XI5C 3SE3A 1IL1B 1KJVA 3TP4A 2ADGB 3HPLB 2Q7NA 1WISA 5LNDA 4JFYA 5LB1A 3U48A 2XTSA 2Y7OA 1QLFA 5EORL 5TDNA 4HF5L 1IAMA 2EDOA 5EEZA 3TCXA 4M1DL 4KI5E 1DSWA 1MHHB 1A8ZA 2W65B 3VXRB 1ZHNB 1L9OA 3KYMA 4UM9B 3U2IA 3IETB 1NTDA 3K72A 1CICD 5F1SA 2JXMB 1G6RH 1M4KA 3BRDA 1EDQA 4X5WB 2QQKL 4PJ8B 1CDUA 4QRQB 1JF5A 4K8RD 5DHEA 1GTNA 5ITFB 1P4LA 3OAWA 4MJ5B 3M07A 3WFCL 5IESL 1D2OA 2NY2B 1OVZA 2A5UA 1R5WB 3LB6C 3MJ7A 4JO3H 4X50A 4AE0A 2DQGH 2F7RA 3KPQA 5B1KA 1KBKA 3ROOA 3ULVE 3GLAA 4LCUB 5KS9F 1DSFL 3FT4B 4AITA 1FCGA 1YQVH 1CIDA 1U8NA 5L2KA 4QNPE 3ERXA 2EIBA 3B3IA 3OKDB 3BQUA 4FN0A 3ILEA 4AIOA 4TXVB 5HHMB 1XSOA 1YSOA 2RJMA 4D3CL 3MLWL 4U1MA 4GW1B 4KMTL 1O5PA 4Y19B 3QXAA 1O5DT 1IZJA 4OFKA 4KXZI 4BK4A 4FKEA 4KAQH 5BOJA 2OJEB 3LB6D 3WFEH 5F7AA 4AW7A 3FFCD 4HS6A 4LB8A 1OANA 4A6YH 5FYKD 4J3TA 4AVHA 3X2QB 1HJCA 1FORL 1OP4A 3SGDH 2ODIA 3CDCA 3PE9A 4TL4A 1AR1B 5TE4H 4M8VA 3LQZB 5EIVA 3V4PL 1KCSH 3RB7A 4FQQA 3EKCA 4OUUB 1GRWA 3BZFA 1TVBB 1A7RL 3QG7L 1GPOL 3RZCA 4KITB 5EUKA 3IGLA 1SY6H 5C7XH 1VEOA 3GXDA 2O4EA 1PU0A 3KWUA 4ZMNA 4GXUM 1PG7X 1RV6X 1GGCL 3RNKB 3S36X 5MEND 5ANMA 2R0WL 1WT5A 3EFOB 1T04A 1U8KA 1AD0A 2JCCA 3NJFA 3QSKB 3OAZH 3CZLA 4XC3L 1N8ZA 5D7HA 5DVNA 2PR4L 5J8OA 1DQMH 4N3TA 3DGGB 3GKZA 3VQLA 4MAYC 3MLRH 3WNNA 2BNUA 1TZGL 5EOCJ 2AK4E 3HNVH 2OS7A 2HJLB 1DDHB 3KPMB 1I7RB 3P02A 1QSED 3MA7A 1NFDF 1CD8A 2CLZB 2VOTA 3QDJE 3GGWB 1OSYA 4WEBL 1HHGB 3TA3C 4GAGL 1MCJA 2YKKA 4J1UA 1Q4NX 4PSPA 1G0DA 4TNVK 4CJ0A 4AIEA 2D9CA 2VLJA 4EOWL 5F7MC 5I1DA 4JDZA 5B21A 1H0DB 3RB5A 1XIWD 2EXYD 4KTEH 5BQDA 4XNQB 1NINA 4HS8L 5E2TH 4F9LA 3DO7B 2N3JA 3SCMC 4OD3L 2C3VB 1I7TA 3NABH 5DMKA 4ZSOB 3HG3A 3KJ4B 5EU6D 4RBPK 3IXTB 1BREA 2ZP0T 5AB9A 2MCAA 3BZ5A 3LZLA 5DRWB 2I07A 1RK0A 3KYNB 4IU3B 2Y1YA 3UROR 2BSCA 3RFRA 1U6AH 3GMOB 3WEXA 5HYSB 3DV4A 4URTB 2NTFA 2H0FA 1UOWA 4ZTOH 4MQ7B 2XPZA 5F7DB 2BERA 2X1OA 3FQXB 5DK0B 1CC3A 2OTWA 3RL1B 2X0UA 3VNZA 1U6AL 4NO2B 5FS5A 1J05A 2LV4A 2IADA 4KAQL 5ESAA 2IOOA 2NLJA 1LO0H 2Y7NA 1CXIA 4FOMA 5DD0L 3BVTA 4QD2E 5EU3B 2QJDA 3WJMA 4AQAA 4ELMB 4ZFOA 5HHQB 3EXJA 2PPFA 2VDQL 4WI0B 3WIAA 2AV7B 2AAVA 5L4IA 4EKXA 2AEWA 5LNGA 2Z7YA 3D4ZA 1PX8A 4BV1A 3M1BA 3L3DA 5CR8A 5F7EL 5I18H 4E41D 2ROYA 4JM4H 3F6LA 2IV9A 2KMWA 4V2CB 2MEJB 2EADA 2X3AA 3VM5A 3MBXH 3VDCA 1XH3B 5BO0D 3P0VL 4O2FA 4BKTC 3KS0H 5J89A 1GY2A 2VR4A 3VMOA 4R0LC 1MFDH 5GHWL 2YMTA 3CVCA 3EO9H 4CVZB 1DQML 2FBRA 1EWHA 3OPZH 4PJCF 5HXMA 3WS3A 1YPZA 3MJGX 2WUBH 1SUHA 1S7UB 3BLPX 1INQA 2QGDA 4MKTA 5I75C 2YHGA 4OD1L 3L4ZA 1MDTA 3U4AA 5JZ7D 4OFYD 5CMAB 1A4CA 2H26A 5HYSG 3GMQA 3UADA 1HH6A 4HSCX 2WLJA 3V4PH 1R0AH 4F8LA 3T1WA 2OFQA 3KDMA 2ZSWB 1I7UB 4KKRA 1WBYB 4YGAB 3WMQA 3V0JA 2EEXA 3L4WA 3TFBA 4O2CB 4ELKA 1KC5H 1AP2A 2JKSA 4W9ZA 4WW2F 1UD3A 2B2XH 2FJFB 1NDGA 4NQDE 3UTPE 4AQZA 1T03H 4ODSL 2CIIB 4D7BA 5EEYA 1A6UL 2W1NA 1MI5E 3QAZC 5JNYA 4Z8FL 3MLWH 2W0FB 4S0TD 3CVHB 1CXLA 3V55A 5F1NB 3RA7H 3C6SB 1EH9A 4GAAA 3OXSB 3V5KA 4K23L 4YSOA 4WW1B 2X2YA 3V4VA 1DDTA 2J8UA 5IMOA 2KS0A 4B9KC 2QKIC 4YN3A 1SEQH 3X1FA 4MAYB 2VLRD 3D2UD 5DLML 2KH2B 1Y7VA 3SKNB 4KGJA 1BQRA 3ZE2B 2ZPKL 3GBDA 4UTCA 3B5GA 1HL5A 4OCYL 1I85C 3NIGE 4YL4A 4BYHA 2X38A 3ARSA 2NY7L 1OSZB 5DRNB 3GINA 5A2LH 3LEXA 4XX1E 1QUNB 3STLB 4ZXBA 4WI4A 1KGWA 2Z64C 5IHZA 2VQ1B 3A23A 4P9MH 4UNUA 5D70L 3TBBA 4D9LH 3AU0A 1CUOA 2MTAA 1T5XA 3OKEA 2Q2LA 4NYLB 4OLEA 4UTBA 1K2DB 1LEKB 1AQDA 5C0AA 1IGCL 4WEUD 4XPFH 1QUPA 2E27L 3LH2L 3QPQC 3LEYL 1NC4D 3WHE0 5T33L 1XMWA 4G6ML 4AM0A 1I4FB 3B4NA 3KCPB 1QNZH 3ZQXA 4LDLB 2NY1D 4KTGA 1IGML 3WU1A 4P4RA 2PYED 4DVRL 5KUMA 3EGSA 4R84A 4H88H 3SJVA 1VEPA 2AJUH 4N5ED 2EE9A 5D9SB 3SBQA 2VRAA 4NS0A 5DRZA 2AQ3A 1M7DB 1OP5K 4KK9D 2IG2L 1GKEA 2RR3A 2A9AA 3PHOA 5HTSA 3UABA 4PV1C 3SKMB 3Q05A 4FAAB 1SXNA 3GXPA 2UXTA 5JW4Q 4MMXC 3BKYL 4N87A 3IFPA 5JR1L 3AS1A 2WO2B 3CVIL 3P4NA 4L4VD 2YWZA 2GIXA 5DEGA 3O11B 2C9VA 2NTSP 5BV7H 2C9AA 4UQ3B 1SXCA 5DK0A 3WS6C 4YHIB 1MDAA 5FCUH 3FRPB 1YYMH 2X2JA 1Z5LB 3LNEA 1AGFA 1ZGLB 3C9NA 3P9MB 3MJ8A 2FSEB 4JQVC 3WE6A 2OAAA 3PU7A 4YUEL 3OC8A 4LSDA 1BBDH 1HQRB 3OXRB 3WNLA 5K1NA 4KXCA 1T4KB 4U7MA 5CU9A 4X7SL 3RVWD 4AV5A 4GAFB 4V1DD 1T1WA 3UPAA 4HPOH 1QFWI 5CWSB 4EJ1C 5C6WH 3ASNB 3HTLX 3T6ZA 3GJFH 2WXPA 1JGUL 5I8OL 4P2QA 3L16A 2F0CA 2IALA 4HCRH 2PTTB 3R06A 4TSBL 3SE6A 4PS4L 1G9ML 4WEEA 4LDEB 3TBVA 3QISA 2D73A 5I2IA 3KPRE 4HETA 4JFFE 5I30L 2EVIA 4N6RA 2BNUB 3WY1A 1FYTD 1ONQA 1PZ5A 3D39A 4X7DC 5JZ7C 1TR7A 2EYRB 4XXWA 3RFZC 1AYRA 4YGVA 8PAZA 3WUWA 1U8KB 2JCCB 4JY5H 4AEEA 4W4OA 3HE6C 4PJFE 4OF7A 3MI6A 3O81A 2UZXB 4HHAA 3WHXA 4CC4A 1Q9OA 4BH8A 4WHCA 3QIWA 4JG9A 4IOFC 5ENWA 2EUXA 2X10A 4N0FA 3HG4A 4KQ3H 1MPAL 4OUOA 3MUJA 4WU5A 1RZQA 2QZQA 4YDVB 4HFWB 3VJ6A 5CLYA 4KK5C 4Y2DB 5DS8B 1NFDA 2MRYA 3VMNA 4K3JL 4XPGH 4A2DA 4RGNE 3IVKA 2OI9B 1KNOA 5CJOH 5EDXA 3BKCH 1L6XA 3I85A 4ORGA 4Z3GA 2J1YA 2Y25A 1CGWA 3D2UB 4FNQA 4YSDA 1FQ9C 3VFSB 3VMPA 3VI4B 3GF8A 3QXAB 1EEZB 4P2YA 1JZ7A 2QQNH 4JY6A 3EH5B 5BOPA 1EFXD 4RMWA 2PO6C 4FI8A 3W82A 2BCKB 3WMPA 3DVNB 5H37H 1CFMA 4JAMB 4JDEA 2OSLB 2A73A 1UB5B 4LSVH 1E6JL 5CIPB 3D8MA 4M62L 1LL1A 3U1QA 4C56A 4A2HA 2AJSH 2P8LA 1INQB 1BYNA 4NERA 5JIKA 4AJVA 2BHZA 1TLMA 3EO9L 5I0WA 1JPFA 3II2A 4GKZB 3NFPA 4OLYL 43C9A 2ALWA 4N2DA 4H1LB 3SDCA 3WDJA 4B9PA 1MIMH 1ZT7B 2FNWA 4OCSL 2Z35B 4ECNA 2HKFH 5LBGA 1U8HA 3QXVA 3BD4A 3S36L 2F8XC 1RHHB 1KGYE 4YSQA 3I6GB 5D96C 3SPVB 5BXFA 2HKHH 4HK0A 2K4AA 4GRWB 1JVOA 2BM3A 3KYMB 5CP3A 2BIPA 1RAMA 4N86A 3O2VH 5KYNA 2UY7A 2XZCL 1KXQA 4IBVA 3LOWA 3JZ7A 4RFOL 5E2UH 5J6GB 3L4XA 1DYZA 4G7YH 2VDKH 3H3BC 1FG9C 3GBMH 3VM7A 3LEYH 2ZOWA 4AMXA 5A2CA 1PJWA 3KWWA 1RK7A 2PXYC 1E8ZA 3H6JA 4Y4FD 4JPIA 4W9KC 3ZT7A 3KVQA 4L1HA 3VXMB 2ZWKA 1UM4L 3NSYA 2VXTL 3B34A 2H3NB 1F18A 5GS3A 4P9ML 4NO2A 4O5LL 1GMEA 1OQXA 1WFMA 4XMVA 3WKQA 3KYAA 5DGQA 1OGAB 2BWDA 4LSSH 3QUHA 1DQKA 5BS0E 1GZQB 4Y5YB 2VKXA 4A6YB 5C6PB 5C0IA 1AE6H 4YHKH 2ZKWA 1UTDA 2QDVA 4XE0A 4GRLD 2CWRA 3QXTA 5AKTA 4ZDHB 4AGMA 2HFFA 2CDEB 4HBQA 3P0GB 2WZPA 4OZ4A 1W72H 1OSPL 2GQHA 3CN1A 2FX9H 4ZSOA 5G4MA 1CFVL 3NSCA 4K5MA 1UXSA 1G1CA 4I2XB 4K23H 1F6FB 4J6IA 3P2TA 1XGUB 1YQ2A 1X5MA 2X0WA 3QPQD 2WXLA 2BP5M 1JTTA 3MOAH 3QIBB 4CRPA 1A6UH 2R9HC 4ZO7A 3C08H 3PJNA 1S7WA 4ZD3L 5IY5B 3JVGA 5EU4B 3CXDH 3NIGF 1SDDB 2HMIC 1XGTA 3CFDA 4ISVA 4OZHF 3C12A 1MREH 4YR6B 2XPGA 4WY7H 3TIEA 1IILE 1ROCA 2O5XH 3DUUB 1N2RA 1RLWA 4GSXA 4I85A 4AH2B 3SDXE 2E59A 1RZPA 3ARDA 1OGTA 3MNZB 1HL8A 4LLUB 4YDMA 1SEBA 2ODHA 3D0LB 4YK4B 1DO6A 2AI0L 5DQJA 4A68A 3HG1D 1IC7L 5I6KA 1W91A 3OJDB 1AMYA 3P3SA 3QNZB 4U6YB 3T4YB 1DBKH 4GW4A 3GD1C 2GK0B 1XGTB 2JSFA 3CFDB 4ISVB 1TJMA 1V10A 1A64A 3QK0A 4BK5C 3FCUB 3UTQA 3WTWA 4GKSA 4TVUA 3ZZ1A 3FTXA 4PJAF 2AFNA 2XX0A 2XG5A 5KVEH 1T7YA 4L8CB 1HE7A 3QHFH 5E8PA 1S3KH 5IB1B 2CUHA 4U2YA 1TTAA 1TZAA 3BYTA 2R0LH 3TPUB 4U1NB 5DYOB 1HCYA 4FRWA 2FWOA 4MVBD 4RIRB 4DQOH 1OTSC 1ND0A 2QHLA 3KG5A 4LASH 4M6AA 1E50A 3NJKA 1GC1H 3F7QA 3OMAB 4JFXB 4ODTH 4NZ8A 5ICYA 4HFUH 1G7MA 1TVDA 3AMKA 3HMWL 3OKDA 1P9MA 1W0VA 3O3AB 5KVEE 2BNQB 4JKKA 4A7TA 3WL9A 3INUL 4HXAL 5FM8A 3D4GA 4LASL 2YRZA 1R1CA 3U0WL 4CNIB 1VFAA 1ES0B 3A47A 2R0ZL 3WKPA 1LO0L 4UV4H 4JM2D 4J3UA 2CUMA 1CK0L 3QHFL 2H3NA 5ICZA 3BX7C 2AK4D 5CJ8A 3TPUA 4ZQKA 3V0FA 4JDTH 5F3HB 5I8EB 1MEXL 1ORQA 2ADFH 4L4VA 4NGHL 4PM1A 2QVTA 2OV0A 2F8IA 2Y7QA 3IGUA 3RUGA 4ENEC 5IKCA 4J6RL 3ABLB 5CLZA 5DMGC 3BW9A 2VDOL 4HULB 4HCIA 3VXNA 1MZZA 3BJ91 3MO1B 4JZNA 3O0RH 3BISA 3NCWA 1ZHNA 2J5WA 1I1AA 3MBWA 5DHYB 1PJ9A 3A6CL 2YMXH 4AC2A 4MNHB 4WZ9A 2QHRL 1VA9A 1BZ9A 1RHHA 4X8JB 5F0JB 2XTJB 3L7EB 1KELL 3SKOA 4YJZL 2D4DA 2APTA 3CHPA 2ENQA 4OLUH 5BRZB 2AVGA 1IQWH 2Z93A 4AIZA 3VXQB 1KYFA 5EU7C 5IW3A 4HWZA 3SDCB 1ODAA 1IGFH 1V7NL 4H7VA 4OLXL 4RMQA 4K3DL 3CLWA 1AS8A 1T22A 3G6JE 4MNGA 5TE7H 4DSYA 3CE1A 1QWUA 4OBSA 1CLCA 4YX2H 1HL9A 4RZCA 5MEQA 5F8QC 2MH4A 5FYJD 1BVNP 2AXGA 1USZA 2PR4H 5F1KC 1QRNA 2FDBP 2UXFA 1KDJA 4XHQA 3VCLA 4B0MB 2H32B 3Q6GL 3QORC 5AVTB 1OSPH 4AG4L 3FSOA 3IDMB 4FNSA 2N4IA 3ZHKA 4ZUSA 1P4IL 3IRZA 5JOPE 1E4KC 4W93A 3U9UB 5FYLE 1I8AA 2D7NA 2IH1A 5LO7A 1NKOA 4JN1L 2ORBH 3L3JA 1AZCA 3QIBD 1WFNA 2ZJSH 1U8IB 4LCIL 3IFOB 2E7LC 4JG1L 2CO7B 4AQOA 2E8YA 4FMVA 3UMNA 2A6JA 4HUWA 1CFTB 4U49A 4JMNA 3PUUA 5T3ZL 3V5HB 4TUOB 1J0ZA 1RJZA 4GXFA 3DYOA 3IN0A 3KYOA 5CGYD 1RZ8B 1MAJA 2E0PA 3TWCH 4L3EE 2DI7A 3UC0L 4GUOA 2NZ9D 5I18L 1KGCD 3C5SB 3O2DA 5FYLH 3P77A 4G6AD 3WFEL 3U6RA 3X1GA 1RIVH 2Q76B 1YECL 3KGTA 5JOEA 3HG2A 4QYOA 2UXGA 2OK0H 5I1GH 1FA4A 1MZYA 2R1WB 4H8UA 2VDQH 4M5YH 4KO9A 4PJDE 3NJVA 3VSTA 1S7XB 2WWOA 3PFQA 5KN5A 2QKIB 2N0MA 5EZIL 1P53A 5L2KE 1CLYH 3P30H 1H3VA 4P4KA 1C5CL 4MNQE 3NIDE 2B39A 5C08E 1AGBB 3GKWH 3RP1A 4OU3A 4YHMH 4NQVA 4HK0B 4PJBF 4DERA 3BP4A 1MG2C 5GPRA 4QXWA 5DR5L 1HNYA 1OCWH 2F15A 2KZ1B 3AT0A 3GEWB 3HR6A 4FFYA 1LK2A 3B6SA 3BO8B 2J6EA 3L5WB 1C1EL 1Q94A 1S7VA 3MRDA 3AM8C 5DURD 1D9KC 1UQSA 4OD3H 4BSVA 5GS0D 3UYPA 1E6JH 4RGOL 3QVAA 1PAZA 1R34A 2BVQB 5KAQF 1Q0EA 2VDML 1JPSH 4XWGH 4M1DH 3QWOA 5CNHA 5AB0A 4WJ5B 4N4YB 2A73B 5IMKB 3FO0H 3Q48A 2XWRA 3MRRA 4JM2B 5K39B 4LPXA 2ZX7A 2BFVH 3VFOA 3PWPB 1E4WH 1T83C 2AK4B 1CD1A 4Y1SA 3ZDYF 5C09D 3HNVL 4FI7A 4OM0H 3O11A 3RG1C 4F37F 2H3XC 3D39E 2FLRT 4NT6A 1I8KB 3MUY1 5JPNA 1I8MA 1LMKA 2OR9H 4YPGA 4QRTB 1R5VB 3ZRCC 3ULVC 3BSZA 5DSCA 3N42B 4NCC2 4NM8H 1TO4A 2VDLH 2VIRB 2YC1B 4JJHA 1JV5B 4Z76B 5JOPD 3L7FA 2P1YA 1NIAA 3PG2A 1GHFH 2DQJH 2HN7A 1OAKH 2Q87A 2D0FA 2ZYHA 1VACA 1KG0B 3NJGA 2XTJD 1AGEA 1F5WA 3FQ4A 4HHAB 3WHXB 1S9WA 5CFAA 2I5YL 4M93C 1RP9A 1BVNT 2WN2A 5B3NA 1YUKB 4Q9BA 1U93B 4X0KB 3DK0A 4U31A 4YDIH 4KK8C 3C8KA 3CPLA 4HC1L 1QBLH 4M6NL 5DJZB 4A6YL 3MFGB 4AWJC 3JWNG 1D7DA 4H8PA 4NM4L 3BCFA 3LZQA 1CK0H 2QMKA 3BOVA 3TNNB 4F92B 4EN3B 1X9LA 2CLVB 1X4YA 4PJFB 4ZS7L 2ICCA 2BP8A 3MV7A 3KHOA 1RUKL 2R0KL 5I1CH 5IM7A 3A67L 1XIWC 1HN1A 1PW3A 2ARJA 1JCKA 2R27A 5IT2H 2FH6A 1CS6A 1EEQA 3VFTA 3IFLH 4L1LA 3SKNA 1F2QA 3TWYA 4Y2OA 1CXFA 2CHXA 1OWWA 1DO5A 1PEZA 3EGDA 2CIKA 3G5ZB 2LHAA 2Y6SD 4H4NA 4G11A 1EDHA 2WUCL 1DBAH 1P4UA 2IAMD 1QO3B 2R4SH 1FH2A 3L5HA 3GSQA 1GOFA 2QQKH 4QXGL 2EE2A 2HB0A 2I24N 4Z76A 3GWJA 4X9GA 1FZMB 3OKNA 1KXVA 3OZ9L 4HIHA 2IV8A 4NRXB 3QEHA 5D1ZC 2OPCA 1I8MB 1FNGA 5AKSA 5IEKB 3BAEH 2JI3A 1GIGH 3ARFA 4X8GA 5D6DC 1KGUA 3FU0A 2R2HA 5AB2A 3L4TA 4GIOA 2HA1A 5DS2A 5EOCH 5KS9E 4FL4C 3UCRA 2OMXA 3D12B 1HFUA 1KENL 5JIDA 3JTTB 4ZAKC 2AV1A 4QNPF 4HFUL 2J20A 5FECA 4CUCA 4AVKA 3D34A 4P05A 2E4TA 2ISDA 3VYPA 4IBTA 3AS3A 4KU1A 5TGBA 4GUQA 1IBZA 1HSAA 4Y9FA 4NPKA 3OG4B 1S7UA 5F9AC 2G60H 4IRSB 3UTZB 3CJJA 4Q6YA 2QTEA 4YVUA 3A6BL 4X9BA 1IO4C 1DR9A 5A2BA 5DFVD 1HILA 3UJJL 1CGSH 4HK3J 2B20A 3IU3A 5L8KB 3FO2A 4Z3IA 3G6AB 3DROB 2V3FA 1TJHH 2I60L 2NOYA 3K8MA 4IOSD 4UZUA 4Y4KB 1JF1B 3P69A 1H3PH 1TO5A 2AS5M 1G7QA 3TBSA 3L08A 2V4LA 3PFUA 3TN0C 4N2MA 1SGKA 3QQ3B 4XOBA 4XCCL 4UIKH 5F3BA 5HHVH 1EEUA 3DURA 2F8VA 2VLMD 3IJYA 2OSWA 1ZTMA 3S8GB 4BCZA 2VZUA 5IUSA 3CZJA 5DLMH 3DYPA 3O8XA 2QSTA 2D7QA 2IGLA 4PRDB 5KANG 4AUUA 4PI2A 1NICA 3NCYP 3MLSH 4UNVA 4Y19D 3HNSH 2RCSL 5C7ZA 1AGDA 4HKJA 4BFNA 5BZZA 3H54A 1T20A 3ZTEA 3KWXA 1KGXA 3PGFL 5BUGA 3HJEA 1TXKA 1DFBH 1Z9PA 2NNFA 4HWEH 1FGNL 3RTQB 2IXQB 4PP2B 4HJEA 4BKLA 4KH9A 3TASA 3O9WB 5D5MB 4UOW1 3QUKA 2GK2A 3SKJL 3PL6B 4NQQA 3ARGA 3KGSA 4X9YA 4LOFA 2NTFB 3TU6A 3RWCA 1RJZB 2AJVH 3DIFB 1IJ9A 2L8AA 4K3EL 3GYRA 3SOTA 1PSKL 5LQBH 3D25A 5CS7A 4ZW7A 5T1KA 3TZVB 3WENA 4CKVX 2PCYA 3WY4A 3EOTL 2XWDA 4L05A 4FDWA 4LSRH 2W38A 2HT2C 4WFHE 5EO0A 1FZKA 4LSPH 2CXGA 2XUWA 4AUJA 4PI0A 3BDYH 5J3HD 4X2UA 4OIBA 2CNZA 3SDYL 1FP5A 1LDSA 2AANA 3KPSD 5INCA 5I66A 4XP4L 1U8OB 3G04B 2IPUK 4LHUB 1BOGA 1OO2A 3GZPA 2EACA 2N7BA 3G5YB 1MRDH 2Y0SA 3QARA 1B88A 2DM4A 3VFTB 3LEVH 4OCLC 5B4MD 4PUBH 4FXTA 1T0NA 4KDTC 1MAMH 5IVXF 3VXUA 3P40A 1OW0C 3MRGB 2D03H 4JZJA 3ZKXB 2YEQA 3RVWC 4W9DC 1A9EA 3UJIH 3NSFA 2SEBA 5KS9B 1E65A 4NB7A 1KN2H 4LBEB 3CDYA 4PR5A 1UM5H 4RRPA 4AGOA 4LRIA 3M1CA 4AIZB 3QHZH 2VDKL 3W9DA 4N2HA 4MD4B 1UOVA 1FN4A 4NOFA 4OLWL 2DM3A 3NEXA 4LNRB 1BXAA 5EU6B 4TQHA 3WD5L 4EZLA 4GG6F 3UG4A 2FH8A 3WEMA 4P49A 3S5ZA 4NQDA 4F57H 2ZXGA 1S46A 1I1AB 3MBWB 5B7EA 3UZEA 4XCFL 1I9RH 1ICTA 2B0SH 2P5PA 1EMTL 4AK2A 4RFEA 5L8JB 1ZDQA 1NGZA 2PABA 3SEPA 3B3BA 2Q8AH 5AG8A 1R24B 4X5PA 3H9SE 2X4NB 4GNKB 2I26N 1DBJL 3P0YL 1Y0LA 3VFWB 4FNTA 4HEPA 3MGTB 5JA8B 2B5IC 3FQXA 3VWKD 5I8CA 2VW6A 3ARXA 1HEZA 1L9MA 2IFFL 2DEYX 3BRFA 3I6SA 1M9SA 4JRXD 2QQLH 4GSDH 2EIJB 1XD0A 2DLIA 4Y0GA 1ZCRA 3FQUB 1NMBL 1F6AB 4CKQA 2MQ0A 1C8QA 4P2RA 4ZX6A 3TCLB 2WYZA 2K9UA 5HJGA 1P84K 4OJYA 4EO5A 1AY1H 3EOTH 3BIKA 3PV7A 4XNUL 4DP4X 2P42B 1M05B 4F1ZA 4Z7QB 3V6ZA 4Y4KD 2JJTA 1P7QD 1T0OA 4JM2F 4W6WB 5EOCL 3MRDB 5CD3B 1DVYA 4ERSH 5D7SL 1HAWA 4C4UA 1V3MA 2XNAA 4BFGA 5ID1A 2FCBA 5CILL 4EI6A 4KQ3L 3TVMA 4I87A 4OGAD 3D3VB 5KWYC 2EVFA 5IF0B 5L88H 1FL5B 3HG0A 1HHJA 3NIFF 2HT4C 3ZDXF 3C09B 5AG9A 2LW3A 2OCJA 4XN7A 2EXTA 4L4TB 4PRNA 3ALPA 3CZNA 5I0XA 3O6FA 5I6XC 3LZFL 1LM8V 4PJ7A 4NI3A 5EZPA 1N3NA 1P7HL 3LNGA 5FUOH 5KN5B 3MRNB 1AZZC 2H0PA 4NQDD 2DLTA 3HPLA 5CEZH 1YYML 1O9WA 3GSNA 4Y8AA 3WCYA 4YEEA 4JFQA 5KJRL 3PWPE 1XF3A 4B9IA 4MJ6A 5HHVL 2WK2A 5DD6A 3PL6D 4RDBA 2XWZA 1RVFH 4PTUA 1A4JA 3LAFA 2V5SA 1U91B 3NAAH 5FFGA 5DJ2A 4PJ6A 5IZ7A 3U2SB 1A6WH 1T7WA 1I7ZB 2FGZA 4C55A 4FZ8L 5KYYB 3TZVD 1P5UA 1YLBB 1E3FA 1HXKA 1SLWA 2ZSVA 1F4YH 2ZCKL 1JGVH 3IAPA 4M8QA 3A6BH 4DF9A 3FHAA 4LOUD 4A55A 2H6PB 3ETSA 5E8DL 5HI3C 4P9HL 5E70A 3JWNC 4O58H 4YLCA 1SPDA 5GZND 2HT3D 1A7OH 4HS6B 5ACZB 3KLHD 2B1AL 1UB6A 3UCQA 3QFJB 5HY9B 4MRCA 4LHUD 1RQ5A 2M1KA 5F7NC 2EO7A 4PLJC 2BIQA 3VD0A 3L5IA 3LMJL 2P5EE 2E27H 3NG5A 4NC1E 1YN6B 4DFIA 5C0CA 1DVXA 2VDQB 3CLEL 2JJSC 3RVUD 5MEQB 5MENE 1HX0A 4BJLA 1BOGB 3ROOB 4HQQL 5DFVC 1IBGL 4MA7H 1EAOA 1I7ZA 1UVQB 3CVIH 4H8QA 3HA0A 4UAHA 4ZPVA 3QRGH 3T09A 1RL1A 1RZJH 1XF4B 4NIYE 3ABKB 4L37A 4EE2A 1D7FA 4N2KA 3TV3L 1PMYA 5BVJA 4OCWL 5H94A 3ARGD 4FE9A 4F15B 2CKBB 3QZWG 4FP8L 3ETBJ 2L7UA 4MA1B 1P4BL 1ZTXH 3GMMB 4B60A 1GGIL 1D9KD 3HN8A 2KDGA 3LNIA 4OIFA 2IPKA 1K5WA 1KYAA 3R4RA 4JPWL 4UOJA 1JMXA 4YSRA 4IGBD 5DDHA 3TJEH 4A2FA 3ZL4L 4G72B 4CSPA 1J88A 4KJPD 4NLAA 2NY6D 3EW3B 4PVLA 3FRUA 4YXKL 4MNHA 1JXFA 1FFTB 1JHLH 4AW4A 2BSRB 4K3HA 2WBJC 3LZPA 1BQLH 2IXQA 4PP2A 1F6LL 1D5ZB 5EZOL 3QQXA 3EOBB 4RGOH 4XPHL 3CIQA 4L5FE 2PO6A 5HJ3B 4KHXH 2AZUA 4ZTPL 5AW4B 1ZT7A 3ARZA 5C08B 4XE5B 2RQ8A 4UM8A 2IANB 1Q9LA 3OPUA 4XVTH 1J0IA 4K7PH 1A4KA 2JJSA 2Y1AA 5FDWB 4EIGB 1CL7H 1JHTA 5F96H 3BC9A 4PS7A 5CGBA 3FQTB 2P8LB 2VGLM 5DO2C 5D1QC 1JWMA 1T6VN 2KBGA 3RJQB 2AKRB 2A4ZA 2LTQB 3LZRA 3T6XA 3TV8A 3OMIB 1XGRB 1Z0NA 4JJ5A 4X98A 2A4CA 5CGYC 1RP8A 5IHUH 2BSSA 3EYVA 3TO4A 3TA3D 2OXGB 3QRLA 3V0WL 5I8CB 1IEAB 3VI3A 3IDIB 2FX8L 4NC0B 4LOVA 3VI4A 1SJHB 3QFJA 3HN5A 3QQ4B 1SHXA 4TTDC 2FWOB 3GZQA 4AXWA 2Q20A 3LV3A 3FJTA 4H8VA 4UB0L 1SXSA 5EOQL 1RIVL 3KXFA 4FYQA 5E4IA 4P04A 4ODSH 3TURA 5IJCC 2IANE 4G9DA 1I8LA 3JTTA 4JRYE 1BQHB 3TWCL 3UTQB 4KRPB 1KIQB 3FMGH 1FYTB 3CBJB 1INEH 3UJTL 3QEGH 5JOFA 3HUJE 4YXHL 4EQ2A 1YEJH 4NQDB 4MLSA 4PJ5E 2HZHA 1J1OH 3FT2B 3MJ9H 3FTGB 5BNXD 5KYWB 4MJ6B 2YQBA 1XVSA 5TQ0H 2F53E 1W6WA 2LE9A 1AZUA 1PIGA 4AMKL 4OD1H 1W80A 1AACA 3GMRB 3HS0B 4OJCA 2DD8H 4WU7B 4M93B 4JR9H 4OI8A 1Z9LA 1RMFL 1KCWA 4PJXF 4FQHB 2LLNA 3QS2A 1AZVA 4L4TA 5IWLA 4MDIA 3CN2A 3ZYOA 1CJYA 3CG8A 3CFUA 4S10A 3P9LB 4FQLH 2B16A 3CX5J 4UBDC 5C2UB 3D9AH 3G5ZA 3LNFA 5C0BE 3STBA 2KLSA 3IGAB 3WLBB 4K7PX 4TNEA 5C0ND 3RIKA 3FYEB 4E42B 4ONOA 4P9HC 2Y7LA 1KTDA 2WWMC 3QCUH 3KLAB 4V11A 2CJUH 2FAUA 2JI2A 1NIDA 4IBLT 2VCOA 1KJ2B 3BD5A 4L4TE 2FQGA 1LNUB 4GT7A 3FQRA 4N0UA 2ZYIA 5HYJB 1G6VK 4FTDA 2Y3NA 2X05A 1JPGB 5IREA 2Z92B 2YQGA 3TS8A 3BN9D 4Z7VA 4P57A 3QZWA 4WK0B 3CZKA 4FA7B 4PREB 2CGZA 3ZR6A 5K9JH 4IGBB 5DZAA 2QVIA 5LCVA 4R96B 5I0YA 4BIKA 2PP7A 4Q0XH 3LRHA 1JE6A 4Y1AB 4G5AA 1NCJA 4JR9L 1IEBA 1IC0A 4Q6IB 4UNIA 4Z23A 5E8NA 3UAJD 4HUVA 3ULVH 3BPNC 4Y9BA 4WNQA 1ZAGA 2LVCA 2UYLA 3ATEA 5EFIA 3QFJE 4D0CA 4KTEL 4L5FH 3H1ZA 2XN0A 1YEJL 4P3WA 5F8RC 4M3KB 4YBLC 3VU2A 2IAND 1JUFB 1UH2A 1ILUA 2YK1L 4XMLH 4FTVB 3HBZA 1OGAD 3MU3A 1PY9A 5E99H 4BD4A 3NIFE 4MMZB 1P1ZA 2E56A 4GKZA 3ZRFC 4BQ9A 1FFPA 3E6FB 3QDGE 3O2DL 4NAJA 5C71A 1IAIL 2DMKA 4H26A 4GRLB 1QG3A 1HSAB 3WNPA 1A6AB 4HT1L 4XC3H 4EZJA 2NSQA 4M61B 4GT0A 3BEVA 4UOZA 4HKBA 4WKXA 3GI9L 2DH2A 1G9EA 3MLZL 3GO1L 4EAEA 1XH2A 2B4CH 4J8RB 1JCVA 2VZ1A 1V5JA 5KJRH 3NJJA 2BS9A 4JRYD 4NQVB 2W9EH 1AHWB 5TQ2H 1GZPA 1FV1B 3VRJB 2P47B 3KM2A 1Z5YD 4HUUB 5GGUA 3C60B 3ZO0A 4MDIB 4NJ9H 5A40E 5KVDL 1GTFA 2WVUA 3KPOB 3UXFA 2DDQL 4PJEE 3VTTA 3BXNA 1NCWH 1MCWW 1TF4A 4KDTA 3WXVH 5GZOA 1P5UC 3K0WA 1IMHC 4L9DA 3GHEL 1B0RB 1F1DA 3SDXA 3N44F 3JYCA 2A83B 4D8OA 1AHWA 2E6JA 3S3CB 3C5SA 3GSXB 1TYRA 2NNCA 2ZUTA 3OJVC 1CQKA 4HDIA 1OM3L 3SGEI 2XACC 5JXEA 4BUHA 1PFCA 3KMDA 4ZYKA 4N8CL 5FYJU 3V4VH 3BPLB 4LBAA 4OIIL 4JPWH 3R1GH 3GC3A 3TYGL 5BS0A 3HE7A 5G2NA 3CXHK 3GHPA 3ECQA 4KK6C 4N24A 1YPZB 3TNNA 3TV3H 4XO4A 3ZT6A 5JIHA 1S3KL 6PAZA 2FGWL 1JERA 3BE1H 1JTPA 3V95A 3WOVA 2EVJA 5D4QA 3LXUX 4WO4C 5KYUA 4AENB 4P46D 5BQ7B 4JKWA 1DLFH 1KBPA 1HWHB 2DKMA 1BQKA 4GP8B 4N3UA 2OXHB 2F54A 2BNQD 4MNGB 1VENA 5DJ8B 4E9LA 4PB0H 2ETWA 4XMXA 4JFHE 2DMGA 4KNQA 3ZDWA 5DUPH 1NCGA 3OXRA 2AQ1A 4PHXA 3OKKA 1IVTA 2R8SL 1TJXA 4ABWA 5I1KH 3SKOB 4NP9A 2O93L 4PH8A 5DK3A 4HSAC 4UV7L 2G30A 2UV3A 4I0PA 4OZHE 2XRAL 4LEBA 1Y1UA 3DJZA 1CGVA 5GGVH 5A3ID 4N8PA 3IB4A 2WYTA 3EHBB 3M8OL 1XZ0B 1FNGB 4B5ZA 1GGBL 4OGAC 2P5WD 3BW9B 3MRLB 2CUIA 2ENJA 2ZCLL 2MOVA 3L3KB 4JM2A 2ADYA 2E6QA 3TN0B 3ESMA 4G5ZL 3MJ6A 3KH4A 3GMOA 1DJWA 3WEXB 1U8QA 1IFGA 4KK5D 4PRID 1QO3A 1FFRA 4PWKA 2GJJA 3IDXH 5L9DH 3LS4H 4X9IA 1I4FA 5LBVA 1E90A 4XB3A 3E8UL 3SDYH 1ZSDA 2VN5A 5GJSL 8FABA 3LIUA 1JN6A 1NCHA 2DQFB 1K2DA 4KKLD 1AI1L 1LEKA 1JWUB 3IGAA 3CMOL 3ZHDA 1KFAL 4X4ME 4WFHD 2JELH 4FKHA 1Y6KR 3GGWA 2CBQA 1T80A 3FQWB 2Y72A 5I1LA 4EUPG 2VXTH 4K3JH 5FM5O 4JPSA 2CJ3A 5IFHL 1YEHH 3MODL 3IU4L 1CYXA 2Z0UA 1EVUA 3SY0B 2DQCH 2EKSB 2LU3A 3WJJC 2H0JA 4DEWA 3WLWC 1ORSB 2CAKA 3U1SL 4LIQL 1HDMB 3EF7A 3AS0A 1IAKB 3QIUC 2MQCA 5IB1A 3HZVA 5J06A 3M7FB 2DKUA 5KVFE 3FRPG 1U93A 4ODHL 2B1HL 4MCYB 2IBBA 2VSCA 4EI0A 1A6ZB 1DVTA 2B59A 1RZFL 3MGAA 4P23A 3BUBA 1OE2A 2DWDB 2C7FA 2OCCB 4MQSB 4NN5C 2NX5B 5AKVA 1C7SA 1SUJA 4GXUN 4UCFA 1VGEH 3SDAA 3OJDA 5D7LE 4W1TA 4J3BA 1UWXK 2DQTH 2WXFA 3TONA 3PREA 4DJMA 1NDGB 3MRNA 1CE6A 3ARUA 4CU8A 3QWQB 3SE4A 2VMDA 1SYSA 3QI9D 2CNYA 2I25N 2OJEA 5J6SA 2ICWB 4BH7A 4TOYH 5KSBF 4F7PA 1ZT4B 4X5LA 5CEYB 2WVVA 2KUTA 4NXKA 4GB9A 4LEXL 4LVOB 1U8MA 3BI9X 3HUJF 3JUZA 1A21A 1OAJA 3BKML 3QIUD 3TH2T 2ZOLB 2ZG3A 3EOYG 3FT4A 2XIIA 3WG7B 4IHOA 3FOLA 1MJ8L 4H26B 5HI5C 5CD3A 1BG9A 2CALA 2HT2D 4YE4L 2GBAA 2C9UA 4P2OB 3AQXA 1P1ZB 4LLQA 3S5LA 5A2AA 5AL0A 3V0VA 1VPOH 5CHNB 5BOZG 1ODUA 2R69A 3BZ4A 5DURB 1KCVH 2AJZA 3X3FL 4N9GB 2VDNL 2XBZA 3JWOC 2BC4A 3HZYA 4G9FA 4ODBD 5D1XA 5EU5A 5H37G 4KKLC 3TL5A 4BWWA 4X5WA 1S5IL 1A7PL 1J5OL 5D2NE 1LE9A 3HHRB 1E6OH 2JTDA 2AJXH 2UUDK 4D8PB 3AG2B 3ZKNC 5IBTH 2JJWA 3MBEB 1UA6H 5I17B 2X9YA 3EJQA 4XVOA 2X1WL 2AJUL 3L9BA 1Q9LB 3R8BB 5JUEH 3RUGB 2BX5A 2G5BA 1ANUA 5F9WB 1OP5H 1ID5I 3ECWA 3S2AA 1HU8A 2PO6B 5EA0L 2AW2A 5IBLD 1KULA 1E9PB 4QRPD 1KGIA 4DKTA 1ML0A 2WTRA 1MHPH 4FJZA 2K70A 1D5ZA 2FK9A 4S11A 1XGQA 4NUJA 3IU4H 3HLAB 3BPOB 3OAYH 2VWEE 5FXCH 2EDTA 5IR1A 4X83A 1BZDA 2X88A 5DJAB 4DW2L 4IKIA 3G3LA 4XBPA 3EYFA 4WGKA