3FQ1A

Azurin c112d/m121i
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
b'AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFDTFPGHSALIKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Type Zero Copper Proteins.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 31
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2009-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3fq1A00
3ERXA 3T6VA 2PP9A 3WI9A 2VSKB 2J5WA 5PCYA 2QPDB 2VW4A 3TASA 4A2DA 1JXFA 2PPDA 1E65A 1X9UA 1PNDA 3NJLA 3ZBMA 2XXGA 1AG6A 2BW4A 2MTAA 4DP4X 5I6PA 2UXGA 1IBYA 4E9TA 2PPEA 2AZAA 3CG8A 1ZIAA 4P5SA 1AZUA 1BXAA 3OD3A 4CSPA 1M57B 1W6LA 1NIAA 4A2EA 2XWZA 2R7EB 2E86A 1RZPA 2P80D 2IAAC 1J9RA 1ID2A 4KNSA 4DP9X 1AAJA 1E30A 3CVDA 4HHGA 4P5RA 2HRGA 1CYXA 3NJGA 3KW7A 1JZJA 1NPJA 3X1NA 1PMYA 1MG2C 1SNRA 2FT8A 3G5WA 2ZWNA 1TKWA 4Q89A 3DIVA 1AZCA 1OE3A 3NJMA 2HX9A 5B1JC 1BXUA 2W8CA 1BQKA 5E9NA 3FQYA 2X87A 1SHWA 3NSDA 1JERA 2WO2B 3N55A 4JHUA 2QPEB 2DYSB 2OJ1A 2CBPA 4RH4A 5I6MA 2YAQA 4DP2X 1AZNA 1JZGA 2XV2A 1CUOA 5AZUA 3NJHA 5D4IA 3FPXA 1BYPA 1AG0A 3ABKB 2DV6A 1XB8A 2WSDA 3UABA 1SDDA 1GYCA 1PLCA 1IUZA 1N70A 2UXFA 5PAZA 1L9SA 2GI0A 4BDVA 1M56B 1MZYA 4NERA 2B08A 1OCOB 1JOIA 1EHKB 5D4JA 1HFUA 1NZRA 2EILB 2UX7A 4NAJA 4F2FA 5IY5B 2VM3A 3ZIYA 2J55A 3FSAA 1AANA 4UAHA 3IEAA 2HLEB 3FSVA 3SQRA 1L9RA 2BP0B 1PF3A 3S3BB 2GC7C 2IWEA 2GB2A 3FU7B 3JT2A 1SF3A 3X1BA 1NIBA 3T9WA 1ET8A 1WS8A 2HX7A 1J9TA 1A4CA 2JFCA 4M3HA 2R7EA 6PCYA 4E9RA 2XUWA 1L9PA 2IH9A 3UAEA 1TU2A 4FAAB 2IDSA 1SF5A 2IH8A 4HZ1A 1GS7A 1JXGA 2I85A 3NSYA 5I5IA 4YSRA 3NJKA 2AFNA 1ILUA 1J9SA 4YVNA 3TA4D 1RCYA 4G72B 3IN0A 3MX0B 1JVLA 5I6OA 2WO3B 2EINB 2XLLA 1W6WA 2BP8B 4N4YB 3T6ZA 1FA4A 2BZCA 4YSQA 1MG3C 1L9QA 2BZ7A 2PP7A 1PCSA 1ASQA 3PAVA 4UANA 1L9OA 3PXLA 2YAEA 4KO6A 4HCFA 1BXVA 5B1AB 1GSKA 3ASNB 1IC0A 2A3TA 3T71A 3CVCA 3EH3B 1FWXA 2YAPA 1DYZA 1E67A 1AS6A 2CUAA 3QJRB 3S8GB 3ASOB 4F7KA 3GDCA 3QQXA 4Q8BA 1BQRA 1KGYE 4WTQA 3SBRA 1N68A 8PAZA 5B1JA 3D12B 1QLEB 1B3IA 9PCYA 2Q5BA 1BQ5A 4MFHA 4YSDA 3EH5B 5I5MA 1OOWA 4KOCA 2BO0A 2UXVA 1A3ZA 2CALA 1JVOA 2IDQA 2DWTA 4YSTA 4JKNA 2VM4A 2UX6A 2EIKB 3AG4B 1URIA 3PAUA 2BP0A 3CDZB 1E5YA 3V9CA 4A2HA 7PAZA 3OM3B 4DP6X 1L9TA 3S3CB 2IDTA 1XB3A 1NWOA 1A8ZA 1JZEA 3JTBA 3FU7A 4EF3A 1NIFA 1PLBA 3FYEB 4G71B 3RYMA 1A4BA 2GC4C 4DPBX 1IKOP 3WKPA 1AS7A 4YSOA 2PCFA 1V10A 1XB6A 1NINA 2CJ3A 2XV0A 1DZ0A 3PPSA 4AKQA 1ZIBA 3T6XA 1ILSA 3QJQB 5TK4A 3TU6A 2CAKA 3NJFA 1OF0A 1SJMA 1NDTA 3FT0A 4KNTA 3GXUB 4K9JA 2BP8A 3L45A 4ZK8A 4HCGA 5AKRA 1V54B 2HX8A 4HIPA 3IN2A 4GYBA 3FS9A 2AVFA 3ABLB 5EHFA 3S3DB 4L0PB 4GP8B 3GYRA 5F7AA 2X88A 4A66A 3H4FA 1WA0X 7PCYA 1ZV2A 1VLXA 4YSPA 5F7BA 3AG3B 4DP8X 4KNUA 4KO7A 2FQFA 2QDVA 4DPAX 1ASPA 1MDAA 2BW5A 2XX1A 3NP3A 4DP0X 1BAWA 1ET5A 3TBCA 3SBPA 4DPCX 3EF4A 3UAAA 1QNIA 2IDFA 4G7SB 3AG1B 4BWTA 4GY4A 2TSAA 2MRYA 5TK2A 3S8FB 2PLTA 4AZUA 1SFHA 6PAZA 1BEXA 3ABMB 2H47C 1OV8A 4PCYA 4E9VA 1CC3A 3BVDB 4YSEA 4A68A 1KV7A 2VN3A 5B3SB 2CCWA 2FTAA 2IWKA 3EHBB 1NTDA 5B1BB 4E9YA 3AZUA 1R1CA 2ZOOA 3FQ2A 2YAHA 2GSMB 3HEIB 1ZPUA 4G70B 2AZUA 4E9SA 3NSCA 1UATA 3QJSB 1I53A 4GP4B 2HRHA 2VSMB 2DYRB 2RACA 3WIAA 4BXVA 5I28A 1OCZB 4KO9A 3X2QB 1M9WA 5FC9A 3X1GA 3SBQA 2YXWA 3NSFA 1JXDA 1J9QA 1PLAA 2PPCA 1A4AA 3CZUB 1W8EA 1HAUA 1NWPA 2YQBA 5B1KA 4E9WA 2PP8A 1J5CA 2J57A 4NB7A 1JZHA 1OCRB 2W88A 1RKRA 3PAZA 4QLWA 3H56A 3HB3B 5D4HA 2N0MA 4DP1X 3PLYA 2FWLB 3FYIB 5I5JA 3WNJA 2YARA 3FU9A 3BQVA 3PCYA 2JKWA 5I26A 4BWWA 3OMNB 1ASOA 2FNWA 3ZX1A 1WA2X 2BHFA 4A2GA 1QHQA 5A7EA 2Y69B 2P80A 1AZBA 3NP4A 2HZHA 2XX0A 3V9EA 3IBOA 2XV3A 4YSUA 1PY0A 1GW0A 2JXMA 3C75A 3KW8A 2Q9OA 1V55B 1TEFA 1BYOA 4CSZA 3X1EA 1AQ8A 3ZDWA 2TSBA 3N2JA 2AANA 1J5DA 2EIMB 2OV0A 2OCCB 3UGEA 1KCWA 1ETJA 2BWDA 1CURA 1KBVA 2EIJB 1NIEA 3FU8A 3X1FA 5I6NA 2GHZA 3OQRA 1E5ZA 2ZONA 3FSZA 3TBBA 2PPFA 1WAEA 1ET7A 4AKPA 1KBWA 4E9QA 4AX3A 4BWUA 3QJTB 4KO5A 1AIZA 4DP7X 4UF7C 2LLNA 2J56A 5B7EA 3IE9A 2I7OA 3WG7B 1AZRA 2FQGA 1NPNA 3QJUB 2QDWA 4PAZA 4A2FA 1KYAA 4BXSV 3OMAB 2XYBA 2YAOA 3DKHA 3EH4B 4W1TA 1AOZA 1YLBB 1IBZA 4QKTA 4YSCA 4HAKA 4G7RB 5AFAA 2IWFA 3WKQA 4DP5X 5I6LA 2B3IA 2XXFA 3NJNA 1PZBA 2VW6A 1GS6X 3QPKA 4YL4A 3FSWA 1GR7A 1OE2A 1JZFA 2XVBA 3FQ1A 3T6WA 4AI7A 1ZDSA 1F56A 4X4KA 4GXFA 1SHXA 1EZLA 5I6KA 3AY2A 3FPYA 2Y1AA 1GY2A 2GBAA 2VW7A 1JZIA 1CYWA 5B7FA 3H4HA 4G7QB 1ZDQA 2IDUA 2UXTA 1FFTB 4JHVA 3AG2B 3CDZA 4HALA 3UADA 2DWSA 1SFDA 4GP5B 2XU9A 1T5KA 4HCIA 1HAWA 4AKOA 2FT6A 3CVBA 1AR1B 1OCCB 4YSAA 3U25A 5LDUA 1NIDA 2PCYA 2PPAA 2YXVA 4FA7B 4WKXA 1PZAA 1KDJA 3DTUB 2DY2A 4YVUA 1MZZA 3AW5A 3OMIB 2GIMA 3WNIA 4HHWA 3NJIA 2VMJA 1XMEB 5B7MA 1PAZA 4F2EA 2FJSA 4BK5C 1WA1X 1A65A 2HXAA 1RZQA 4N8UA 4ENZA 1AS8A 1ADWA 4W9ZA 1NICA 4TXVB 2H3XC 2NRDA 3UACA 1GS8A 1GY1A 2H5UA 1OE1A 1PNCA 2I7SA 3NT0A 2FQDA 2FQEA 1X9RA 3NYKA 1WS7A 2YAMA 1SDDB 1KDIA 4KOBA 1TEGA 1KCBA 2QT6A 3QJVB 4BDVB 4M4RB 4YSSA 4A67A 2YAFA 1AACA 2FT7A 3MBWB 2ZXWB 1PZCA 5ANHA 3NJJA 3ABGA 4E9XA 2BWIA
chains in the Genus database with same CATH superfamily
4AQOA 1ZT1A 4YZFE 1RK0A 2EDQA 4JDEA 4JY5H 2FWSA 1OGAE 1MCJA 1E4XH 1IQWH 1FN4B 2HKAA 4RFOL 2BMKB 2VW4A 1MFDH 3IETA 5E8DL 5BXFB 2XYCA 2R0LL 1U3NA 1PNDA 5T5NG 4ZUTB 3V0HA 3PL6A 3UAJD 4G80A 1H19A 3O6FC 4AH2B 1NMAH 3MV7D 3O6LL 4AL8L 4XNQB 4AV4A 2AABH 2QQKH 2X6AA 2DIAA 3BDXA 3CIQA 1BMWA 1JNLH 2VH5L 1DJYA 4LSPH 3UZQA 4HWBA 2OTWA 4L2LA 3FT3A 1QFWL 2A9MH 1BBJA 4P5KA 3TJEL 3IRZA 3ALWA 2BX5A 1BQUA 1RZKC 4U1SB 3WUWB 4LRIC 1QLFB 1RLWA 5C3TA 3RJQB 3RJOA 1BD2D 1TZGH 3UPRB 2CO6B 3D0VB 4JY5L 1VFMA 1DSYA 4Q4EA 5TPWL 1E4XL 1IQWL 4FE9A 1MFDL 2NY2D 3L3JA 3N55A 2BVOA 1KXVC 4OVUA 4Z0BL 4U6YB 5C0RH 5E7FA 3EGXB 4AITA 3ZTNH 4U49A 5F1SA 1KC5L 1SXCA 3SPVB 3IAGC 1HK6A 4P0DA 4MVBC 3LNDA 3BQUA 2WBWB 3EJYD 1NMAL 2XV2A 4R96A 1UZGA 4Z7WA 1CUOA 2EE3A 5DJ8A 4N9GA 1EXUA 1T5WB 3ABKB 2AABL 2QQKL 4UM9B 5EIIA 3BX7C 1JNLL 1JHTB 2X1WL 3VWJB 4LSPL 1J86A 4Z8FH 3HHRB 4EUPG 3EJZC 1NGXB 3QNXA 4BH7A 4IEFB 1F42A 1M56B 3WJMB 4BDVA 4DW2H 3S98A 4E5XG 2A9ML 1T21B 1BZDA 2E8YA 1WCBB 5BMFH 1WGVA 2CBOA 1HXKA 3L4XA 1IT9H 1VSCA 3IRCA 3Q2VA 2ZX8A 4NP9A 1TZGL 3QFDB 1SJXA 4DK6A 1EAJA 1WZLA 1AHWA 2RJMA 1N0LA 5AOKA 1HHKB 2J12B 4AYDC 5D9SB 5CKAA 1T83C 3D5OF 5C0RL 1PF3A 1TJIH 5HHQB 3ZTNL 4A6YA 4XR8C 2XFXB 3SY0A 3UBXA 2DOCA 3UYRH 3K5RA 2JKXA 5C2BH 1WWCA 1NC2B 3QUZC 5BS0D 3CDGA 5BVPH 2NXZD 4TVPD 5IBTL 1W72H 1OP3K 2NUPA 3GZQA 3MVSA 4Z8FL 4EI5B 5DZLA 1Q9OB 2IH9A 5DC2A 2XG4A 2I60L 4NKMA 25C8H 2IH8A 3Q2NA 4DW2L 4APXB 4AIXA 1P4IH 1RJLA 3VJ6A 3KLQA 1P1ZB 5BMFL 1A2YB 1JIBA 5DFWH 5EEWA 1IT9L 4Y1AE 1C5BH 1IM9B 2J4WH 3ARQA 4NT6B 2GJ6B 4FMVA 3FQNA 5IWLA 3RDTD 4JO1H 5LN4A 1X44A 3ARGC 1U2CA 2VQTA 5GGRA 2EINB 5C08D 5DS1A 4MXVF 1E27A 1TJIL 5KSAA 4X50A 2BY0A 2BSRA 4LGSB 4R7XA 4FTVE 4HS8H 1N12A 1L9QA 1RY7B 1XGYL 3QRFM 4O2EB 5AKVA 3GB7B 1JWMB 2D3LA 5CJ8A 1L9OA 1Y6NR 2G4EA 4H25A 1KG0B 5BVPL 4NRXB 1QSVA 4LAQH 1W72L 4HJ1A 5DHDA 2HJLB 4JFFA 2A3TA 5EB9A 1HZKA 25C8L 1A7OH 3B3BA 2DMGA 4OFVA 1P4IL 3POCA 5I8CB 3QQ9C 4JZJC 2EAEA 5DS2A 3U46B 4DFIA 2YMTA 3RWIA 4LLWB 3SE6A 2OMWB 2DM7A 2J8UB 2VDNH 1C5BL 1GGIH 2B15A 2J4WL 3MKKA 4NS0A 5DSCB 1OOWA 2ITCB 5TGBA 4TLSA 3K81A 4JO1L 4U1NA 4AQAA 4K5PA 2JH2A 4TUOB 1DVSA 3H9SB 4IDLA 2WGXA 2XV6B 5JOFA 4OCYH 3HUJA 1RPQA 1YEGH 4HS8L 2WLIA 3QCVL 3TCLA 3BLBA 1MCRA 4NGHH 4EQ3A 1NIFA 3FW6A 1WWWX 1UWGL 3HG2A 3KJ4B 5D7KD 5JHDD 1N6UA 1TVHB 1IKFH 4LAQL 2X4RB 4IBQA 4QKXB 1HDMA 1IKOP 3IKCB 4NKOA 1A7OL 3MR9A 5KS9E 1NBZA 3L7FA 5HVGB 3ZT6A 2DMKA 3BGAA 3OX8B 4HJEA 2Y6TE 3NK4A 3EBIA 5SV3A 4O02B 2VDNL 5F7LB 1GGIL 2Q7YA 3DV6A 2VXQA 3BLPX 4Y9FA 2AJZB 4A7SA 2AJXH 3JTTA 3HNVH 4CU6A 3U6RB 3RBGA 1J1PH 5FB8B 1GOFA 2EVHA 1NDTA 3GBEA 4X9GA 1I8KB 2CM6A 2ADIA 1CFSA 2NX5D 2VDOB 4OCYL 3WD5H 2BP8A 4ZK8A 1YEGL 4FI7A 4PRIE 1FHGA 1P5VA 2OCFD 1RSFA 1T89C 1KACB 2BFVH 2HUHA 4IBWA 2I26N 2JKLA 4KVCH 1MLBA 1QR1A 1IKFL 2PCXA 3QIUD 1A6AA 4R90L 3QG6B 1XGQA 2OI9B 2OSWA 2WTRA 3KPLB 3LNIA 4JCMA 2B59B 1UHVA 4OV5B 2AK1H 2D7MA 3UBGA 3QUKB 3KXFB 1NFDA 3A4FA 3FJTA 3PWPB 4HIIB 1N5YL 1ETA1 4X0KB 2XT1B 3GRWH 2APBA 5EO0B 4BA8A 4ZPTB 4PCKA 1SVCP 3Q6FB 5FK9B 5FGCB 1EAPA 1BX2B 1S7QA 4FNSA 5EOCJ 3O11B 3QR1A 4G6FD 3CVIL 3MLWH 3MRMB 4MAYC 3BGFC 2TSAA 4CNIA 5KYUB 5D7LD 1UXMA 3WD5L 5IW1A 2WXLA 2R1XA 1G87A 4PJ9D 3QZOA 4I0PC 1AGCB 3BAKA 3PABA 2BFVL 4XMZA 6PAZA 1KEMH 4UQ2A 4KVCL 4KKAD 1BIIB 4J3OD 2NTFB 3GEWB 5DHYB 3CFUA 1BYNA 4W9CC 2CCWA 4MJ6B 4UTCA 3ARXA 2AK1L 1FG2A 2XKNA 3EOAB 4WEBL 2GSMB 1IZKA 5EF0A 5EEUA 2HG5A 4G43A 4L1BA 5I23A 1UD3A 2V2WA 1S9VA 3FFDA 5I28A 4GRWF 3W39B 2P5WD 2C1PB 2Q8AH 3X1GA 3NSFA 3VI3B 2EDTA 2O61B 2AQNA 1H0DA 3H2PA 4BCZA 4D9RD 3B2XA 4FQXA 1P6WA 1T66C 1B3JA 4GAAA 4UI2A 5ABZA 5KZCB 2HTKD 1S7WB 4QRTB 1KEML 3SODB 3Q0HA 2FO8A 5HTSA 2EICA 5TDPB 1AFVH 1ORSA 1P2CB 3FO9B 5DRXB 3QK0A 3SDXB 1VADB 3ZZSA 3BN9D 3UAJA 2C3HA 5I5JA 3GC3A 5K5YA 3UG4A 3PCYA 4M6OH 4WTZG 4YDZA 4OM0H 1OGAB 3MV7A 1H5BC 2IMNA 5FA3B 3GJFH 1YMMB 3HAEH 4NNYB 4CSSA 2QMKA 5HGDB 2H2PD 3SKOA 4U1IB 2VRQA 1AZBA 2IF7A 4LOVA 1L0PA 3WY1A 3ML8A 1CTNA 3MRFA 4LDEB 1QFOA 2H9GA 4JLRA 1P4UA 1KPVB 3KW8A 3NFNA 4NIKB 2Q8AL 3CFBB 1GIGH 1DQMH 3ZTJH 4AEHH 5GISH 1CGSH 5ANMB 4YC2B 2F7PA 4P04A 2IOIA 5C86A 4XGZB 4MAZA 4PS8A 3WY2A 4ACPA 2J2ZA 2EIJB 4R9HA 3VFPB 5BZDA 4WFFE 4CADA 3VGAC 1AFVL 2PPFA 3V4VL 4AKPA 5K59F 1JCKA 3KPSD 1K4CB 1SVBA 4EMZA 1GOHA 2CDFA 3OAZH 4M6OL 3VFRB 4EUPB 1FSKC 4OM0L 3RVXD 3TBWB 3NUKA 3WJLC 4XPFH 3BZEA 1MHEA 1SZNA 2AQPA 3ULUD 3C2AH 5TDNA 4E5XB 2QDWA 4PJGB 4KRPB 4L3ED 2X4TA 4M8QB 4K8RH 2EH8L 3B56A 1DBAH 1RV6X 3CCHB 3K71B 2WNGA 2EDWA 5IEHB 4YR6B 4W1TA 3WAKA 4IS6A 2CHWA 4YZWA 3TIDB 2PXYD 1IM9D 4ZOBA 5I8EA 2GJ6D 4ONGH 2VXVH 3NESA 1GIGL 4NOBA 1DQML 3CX5J 4AEHL 5IROC 5GISL 1CGSL 1P4BH 1XR9B 2HTLD 3KPOB 5EBMB 3REVB 3SDAB 4AVKA 3MNZA 4K3HA 4JFSA 4BKLA 4IIQC 4PU2A 3FQ1A 3UTSD 1DVUA 2J1XA 3D7PA 1EHNA 2O6CA 4GBXB 4YDKH 2I9LA 3WLWC 4ONHB 5I6KA 3G9VA 1QBLH 4K94C 2Y1AA 5B4MD 1UD5A 5BS0A 2H3NB 3SY6A 3C2AL 3K6NA 4TS6A 5C8JA 2C1OA 1YUHA 4RMBA 4JHVA 2YQGA 4K8RL 1KGWA 1DBAL 4IOIA 3MBEB 4POUB 1PY9A 2XU9A 1T5KA 1LJMA 3CVBA 1RHHB 2A0LD 4EN3B 1BECA 3LKRA 4ONGL 2VXVL 3FOLB 3OKDB 4HW6A 3JUYA 3V6FB 5C0DB 4NSKA 4BUGA 4OFQA 3IAPA 4ZUVA 3MGOA 4E2OA 5LJYH 4QXTA 2Q3XA 1P4BL 3FT1A 3OR7B 4KGJA 4YVUA 4TQHA 5EZOH 3RDTA 3RWHA 3GWJA 1Y7VA 1KTJA 1V3LA 2FJGB 2GIMA 2ZX5A 3OAWA 1R5IA 3QWRA 4JMXA 2VLJE 3VXQB 1OAKH 2HFEA 1JMZA 1DN0A 1DE4B 1HYSD 4Y1AB 5KJ4A 4YDKL 5T3XE 1ADWA 4QHPA 2BLFA 2H3XC 5AW4B 3A47A 1C7TA 1QBLL 3SDCA 1GY1A 4I85A 3ZR5A 4F7EB 1Q94A 2RBLA 2CO1A 3EJTA 2DKSA 2KLTA 4IYKA 4JFYA 3UL4A 3TH2T 4OCSH 2QLYA 4X9BA 1X9RA 3NYKA 3RP1A 3RWJA 2CR3A 4FTVB 3QEHA 2EUWA 3J2PA 3BXNA 5J8OA 2VR4A 3ULVC 2X2UA 1PD6A 4TNVF 4JM2F 2EQDA 5FYJE 4OQ1A 4A63A 3AQDA 2JB6B 3NBNA 1SM3H 2BNRE 1H15B 2G2NA 5IMLA 3D0LB 4QJ5B 4X7DC 2QGDA 1OAKL 3PRZA 4WWPA 5MEQA 2J7LA 1A6VH 2BW4A 3ZQ9A 1IBYA 4LDCA 4NX0A 4IGBA 2PPEA 4PR5B 4OD1H 4PGZA 2D7PA 3FFCD 3STLA 1EZSA 4HKJA 4OCSL 4JCWA 1L7TL 3V5HA 3C08L 4H2CA 1XF2A 5E5MB 1L0YA 1OB1B 3CC1A 3KXFD 3FRPA 43C9A 3AWGA 1QUNB 5CCHE 1BQHG 4DWHA 1CD8A 1SN5A 4DNLA 4HKXB 4PMEA 5E5UB 2YPKA 1IGML 2XWJA 3CWGA 3P11H 4M7KH 5HYSA 2H2SC 4GLRI 3ZT5A 1E5UI 2WQXA 5E03A 4ZNEA 1OAYH 5KS9B 1TKWA 4XC3L 2NCMA 2WBJC 5ITBH 5CSZB 3C60B 3U30C 4CBZA 2DQUH 2NX5A 1OWRM 1DLFH 2EACA 2MSPA 2QPEB 2ZP9A 3SE4A 5A2BA 2ZYSA 1E6JH 2XNAA 1A6VL 4KJWC 4DP2X 2OMTA 4N0UB 1ZSDA 4MWFA 4IBLT 4XN1A 4NUPA 1F4XL 4OD1L 1RJZB 5GGTA 4U0RB 1E3FA 3I2CL 1S7VA 3QIUA 5IMKB 5EOQH 4HKZA 2J5LC 4PCTA 3N06B 4FFTA 1GYCA 2IQ9H 4PRIB 1YMHB 3CFTA 4PJDA 2Z92B 2VL5A 3LPGA 2LU4A 4X4YB 1PZDA 4ZFOL 3P11L 1OAUH 4M7KL 5G5DA 4GXUM 1HFUA 5CKGA 4HMDA 2CIIA 5GS0D 1OAYL 1RIHH 4X80H 5GRVK 3ORJA 1WAAF 3NEEA 1G9MH 2LE9A 5ITBL 3CFEA 3KS0J 2DQUL 5D7LA 4XPBH 1DLFL 3FSVA 5F0JB 1WK0A 4H0GA 3LKNB 3SQRA 4JN2B 1E6JL 5AALA 2FBRA 3D05A 4PJ9A 5IV2A 4ZUTA 1FZKB 3ECWA 3FCSB 5BW7A 3NA9H 1NCAH 2LVEA 1T1YB 2OSLB 3N43F 3NIDE 4G8EB 4HHAB 4AH2A 4DVRH 1TJHH 3VXSD 3KDMB 2EDOA 5F6HI 3W9EB 3KPNA 1YMMD 5EOQL 1VFAB 1XL4A 2I69A 2RIKA 1MHCB 5J6SA 2IQ9L 1L9PA 4FAAB 2YD5A 3B7YA 3ESVF 4XMVA 5AVXB 3W3BA 4OZ4A 3LZNA 4IOFD 2WP3O 2LOEA 2DTML 1BEYH 1MAMH 5DEJA 3HC3H 4PWFA 4R4FH 3TTSA 1D5XA 3DRQB 5LGHH 1AD0B 1CDCA 1RIHL 2ED8A 2V9UA 3KNBB 3TPUA 3WUWA 4X80L 5DUJA 3UPRA 2WY3B 2CO6A 5EU4B 1G9ML 5KOMC 1M2OA 4XPBL 4DKFH 1MCQA 1UXLA 2DZEA 1W6WA 3L3IB 3P9MA 2YEZB 4Z7OE 3QI9B 3GHPA 4LPVA 4U6YA 4U1HB 3EGXA 3SPVA 4PLKC 4NUGH 5D5MB 1NCAL 4UANA 2V3FA 2IFGA 1TJHL 1IO4C 1T3FB 5BCAA 3ZIMA 5I1LB 4Y19E 1K8IB 3FSOA 2OULB 3NZHH 3IJSB 1JHTA 3VWJA 3U0TA 4DGYH 3T71A 1ZA6A 1NGXA 2Z3FA 1FLTX 1BFOB 2XIBA 3UYPA 4IEFA 2FJFB 3MBXH 3S88H 1MAML 1PX3A 3HC3L 1T21A 4R4FL 1WCBA 5B1JA 2UZIH 3AJ7A 3E9TA 3JWNH 5JDJA 4WO4C 4X7SH 5FO7B 3NPSC 3T77A 3QFDA 3LQMA 2MCMA 3VD4A 2P8LB 2X89A 4DKFL 2VMCA 2NXYB 4UOQA 1YEIH 2XWEA 3T0ED 4BSVB 1HHKA 3FTVA 5DHVH 1WTLA 5D71H 4DP6X 4GBXD 4NUGL 2XFXA 1HINH 4PW4A 2K8MA 1R24B 4PMFA 1OO2A 3GF8A 4PGBB 2OP4H 1QHOA 4OIFA 3SO3B 2KPNA 2F54B 2W95A 4AQ8C 2UY6B 3NZHL 2BSDA 1BZEA 3CFQA 3N1PC 2W94A 3S97C 1CGTA 2QSCL 4FTDA 4Y8AA 4CMMA 4DGYL 4Y4FC 1Q9OA 2E7HA 3F7PC 4UTBH 2W92A 4GXVH 3CBKB 3MBXL 4APXA 1YNTB 4L1SA 1TTRA 4HH8A 4P57B 4X6FB 5TF1H 4EN3D 3S88L 1L7IH 1R34A 1P1ZA 2X4QB 5F3FA 2UZIL 2JE8A 1A2YA 1RZGB 2RTTA 2BVUA 2CPCA 1IM9A 5DD1H 3QPQD 3FBQA 2GJ6A 4NT6A 4XB3A 4XMXA 1ND0B 1QRNB 4AC4A 5JPNB 3ETBJ 1MOEA 1PD1A 1IFGA 4IRZH 1SJMA 2DW5A 3BVNB 5C07D 2VLLB 4KNTA 1YEIL 1CD1B 3EYQD 3OHXC 5D71L 3T3MF 4OZIF 1PG7W 4HCGA 1DQLH 5AKRA 3RX5A 1HINL 1QW9A 3UTSA 3VQMA 3IMTA 1JWMA 2WB1A 2OP4L 5L8JB 4M7JH 2N01B 4OZFA 3RY6C 4U1MB 1KG0A 4NRXA 3FB7B 5GS2D 2HJLA 2SODB 2B3RA 4QXGH 2FR4B 2HKHH 4UTBL 1I7TB 3DPBB 3WL9B 5GRYA 1V5JA 2B2XH 4GXVL 1TJGH 2EXWC 1YQ2A 5DC9B 1W0YT 1BPVA 4BSJA 1L7IL 1DQDH 4LP5A 3BFOA 4Y2OA 1IX2A 3DX8A 2OMWA 2J8UA 4DO4A 3GZOA 4KUZH 5SV4A 5FFGA 5DD1L 3DC0A 4LPYA 2ITCA 2HT2C 2Y7LA 5TFSH 1OTSC 4IRZL 5E70A 4XHJD 4HC1H 5C0IB 1KLUB 2BCMA 1AXSB 2MIZA 1DQLL 5KBNC 1HSBB 4D8OA 3QJHB 1LGVA 4PJEE 1QEWB 3QH3B 1BEXA 2WZ6A 4M7JL 4NRZB 2DWEB 1TVHA 2X4RA 3OHMB 2HCZX 2C3VB 1OGTB 3IKCA 4QXGL 3JVGC 4XPGL 2HKHL 5EULV 4NEHB 1IBHA 2IWKA 2VLJB 3LEYH 1BHGA 4N3UA 1TJGL 1ZTXE 2ATAA 2VO5A 3O8XD 3DJSA 3OX8A 4Z78B 2Z35B 3HEIB 4JJHA 4KC3B 4XB7A 4XN9A 4HV8A 3NSCA 2C26A 1Z66A 4O02A 4KUZL 2UWEF 3II3A 2IAND 5EBLB 2AJZA 5TFSL 3VFNB 3U6RA 5FB8A 3KEHA 2YXWA 4HC1L 4IJ3C 1S8DB 3APMA 15C8L 1I8KA 3C60D 1GAFH 1HAUA 3QEUB 5E4OA 5JQHC 1RHFA 1I31A 2CM5A 2JK5A 4AJYV 1MCPH 1INQB 3S35X 4KJPC 4EIGB 2JKJA 2CPUA 1N67A 3K8LA 3L9EA 4TSCH 1BQHB 2Z64C 1D9KC 3LEYL 1TVBB 3KPLA 3CHQA 2B59A 4PVMA 4OV5A 3K0YA 1ECYA 1WA2X 3QUKA 4ZMVA 2EXYD 3KXFA 1BM7A 3QUYD 4PQXA 5DD6B 3PWPA 4HIIA 4OLUH 1YEJH 2Y69B 4X0KA 4M1DH 3ZUCA 3C09B 5I0XA 1W0VA 2X1PA 5FK9A 4NN6C 3QDHA 4F7TB 1BX2A 2XQYA 4PRHE 3O11A 1XO8A 1HKLH 5FDYA 1CVSC 1KYUA 4PJHE 1GAFL 5KYUA 1FHNA 1G4MA 1NPUA 3B8YA 5CIPB 3AM8A 6CGTA 1DUYB 4XN2A 2HVJB 1LE9B 1BLIA 1TIUA 1CFQB 3ZW3A 1MCPL 2MHAB 1E5ZA 4LMQI 5DYOB 1BIIA 2H7WA 4TSCL 3QJTB 3ZL1A 1PIFA 1HOCB 2AXGB 1I85C 4DERA 3BD3A 3QXUA 3UTOA 4AE1A 3GTVA 3A22A 4MJ6A 3RKDD 3LHPH 5D7JC 1YRKA 4OLUL 3MGTA 1YEJL 2VMEA 3O6FB 4M5ZH 1IEBA 4Z7QF 2XYBA 2R15A 4M1DL 3T1FB 3VGBA 3QDME 4PYHA 4RMUA 3V4LA 1IAOB 3IGAB 4NUJB 4PVBA 5JOPE 1QQDA 4HF5H 3ZY7A 2NLJB 3W39A 4MMZC 5DFVD 1HKLL 4H5SB 3VI3A 5IIEA 3L3KB 3TJHD 4N2BA 5DMGD 5BV7B 1X4YA 3TBTB 4Q52A 2G0KA 5CJXA 3L1OH 3WS3B 1S7WA 5CSBA 4QRTA 1TVDA 3T6WA 2SEBA 3T3PE 2QBWA 3LN5A 4DQOH 3SDXA 1P2CA 3FO9A 1E7VA 5EUOF 1VADA 4X4KA 4AL8C 4J6RH 1WBXB 1AHMA 1HILA 3WNMA 3RRQA 4L4JA 1YSOA 4HEPG 5DMKB 4E36A 2EIZB 1OGAA 3LHPL 3VXSA 1P9MC 5FA3A 3QUHA 1YMMA 1ZLVK 3VMPA 5HGDA 4M7ZC 4G9FD 4G82A 1A21A 2EP6A 5I17B 2Q1EA 4U1IA 3G6AA 3NIDB 1FZMB 3OR6B 4HF5L 4IKJA 1JF5A 1KPVA 2Y07H 4OD3H 1FDLH 4HAFA 1JF6A 1PFOA 2EUVA 3DTUB 3MHZA 2G3MA 5ANMA 2JKIS 2C3GA 3L1OL 5E0FA 4XGZA 2FGWL 5FKPB 5IREA 4CUCA 4FQQB 3DUSB 3TN0D 1SQ2N 4KUCD 4LPXA 4PLJC 2G2RB 4ICWA 4J6RL 5K9JL 4N20A 3VTMA 4M02A 1M7UA 2J6EH 3WIFB 2Y22A 3VFRA 1B9KA 3TBWA 4LCVA 2F74B 3MFFA 1W2KT 1N26A 1YCSA 1QTSA 4YH6A 1JPFB 2J6WA 3NT0A 4E5XA 2CGZA 1BAFH 4PJGA 4Z7OB 1FF5A 4ZMTA 1IC5L 4M8QA 4RGND 4Y9BA 1UWEH 3MREB 3CCHA 3CSYB 3NEOA 4M5YH 3K71A 1T2QH 3QUZB 5HP5A 5IEHA 4U6VH 3TIDA 2IPTH 3NCMA 4KBPA 2KLSA 5IJBC 3MNMA 1RK7A 2Y07L 4OD3L 2YAFA 3FUHA 3BVXA 1QRND 1N5AB 4QGYA 2HKFH 5F8RC 4FCAA 2BIQA 4K7PY 4F27A 2UVFA 1FJ1B 3KVDD 3KPOA 5EBMA 3REVA 4E9XA 2IMMA 4HG4K 3TWYA 3SDYH 4QLRA 1I7ZB 2PYFB 3SGKC 4F9PC 3RVWC 3T0EA 1PL3A 4OJAA 4UBDC 1WISA 1MFAH 2NSMA 4Z3FA 3DX7B 5ESAB 3ARGB 1AG6A 4GBXA 1CJYA 2J6EL 4ZFFA 2CCVA 1OM9A 1SJHB 1XX9C 2F0CA 3DX3A 3OD3A 2H3NA 1BAFL 1W15A 4JFWA 4H0IA 4ZTOL 1UWEL 4M5YL 1T2QL 4QF1B 4WHTB 5JO5B 4P59H 3RIFF 2J1YA 5C0CE 5L4FA 1RHHA 3T0BA 2VT0A 1E30A 4HHGA 4EN3A 3OKDA 4QHUB 5C0DA 4NN5C 1JI2A 2HKFL 4M48H 1NPJA 5JTWA 2ZKWA 3OR7A 4B9CA 4AVJA 2YPLD 2D4DA 4JZJB 3SDYL 1MSPA 2BNQE 4ZW5A 1KCKA 2FJGA 5MENE 3VXQA 3QZLA 3QDJE 4HLZG 3GK8H 4V1DB 3T4AC 4ELMF 1XFPA 2KH2B 4PY8I 4AJVA 1MFAL 3KMDA 1B6UA 1DE4A 2OJ1A 2CBPA 1KFAL 1ZVSB 3CN2A 4Y1AA 5I6MA 5HJBA 1Q72H 4F7EA 3VGFA 1F3JB 4KZ0A 1BFVH 5F93C 1AR1C 4L8SC 1XAUA 4W9FC 1MCWW 4QOKE 2V7NB 1JGUH 1TZ8A 3RZCD 1UC6A 3V0AC 1MW1A 5F9OH 4DGIH 4NERA 1G7QA 2B08A 2DQJH 1RPUA 4PLNC 4KH9A 4M48L 3G08B 2JB6A 1BWMA 1H15A 3D0LA 8CGTA 2UX7A 3KBHE 4NRYA 4JKWA 1KGUA 5FAAA 3CE1A 2A74A 3GK8L 3FSAA 4UAHA 4D0BA 4KDWA 2ZOUA 1PJWA 1J8SA 4AV0A 1QFUH 1QKZH 2E27H 3NFPB 1U3HC 5M95B 1Q72L 2NPLX 2QTEA 4EZMA 2XWDA 3L4VA 3M07A 4OM1H 1OD7A 3N40F 4OBSA 5D7EA 2BSTA 1GC1L 1S3RA 4FL4C 3MUJA 5E5MA 4JFOA 1I8IA 2P5EB 1QUNA 2XUWA 4N86A 1JGUL 3IJHB 4P46C 5LAPA 5CD5C 3R1GL 2WWMC 1YY9C 5F9OL 4DGIL 4TNEA 2DQJL 3W38A 4CJ1A 1IE5A 1BOGB 4YSRA 3SPGA 4M3KB 3EFDH 4I18C 5GZOC 3QUXD 3LKQB 1BM3H 3QCUH 2R8SL 2L7UA 4B3VA 2NY5L 3O4OC 1H6TA 3C60A 3EJRA 1ZT7B 5CSZA 1Q38A 2ZOLB 5GQBA 1QKZL 1TFHA 2BZCA 4W9JC 5ENWA 3SGDH 35C8H 3BI9X 4K55A 4N0UA 2JCCE 1WFNA 4MAYB 3BGFB 4X6BB 1RJZA 4OM1L 3FU6A 3U0PB 4I0PB 1GSKA 4YN3A 1F6LL 5IMKA 3B8SA 3EJJX 1WFMA 4QRPE 4FFVD 5KSBB 3O6FD 3PU7A 4PRIA 3K2IA 1YMHA 2JCWA 5FYLD 1YC7A 4RGMC 4AGQA 4MHHG 3S8GB 1VEOA 3QQXA 1B4RA 1FYTE 3UZEA 4X4YA 4PJ8D 2PR4H 3EFDL 3BUYB 4NXKA 5HGGS 1KEGH 4Z7WF 1K2DB 5ACLA 3X13B 3OJMB 1BM3L 1VENA 2WXRA 1PZUB 3QCUL 5FWRA 1JVOA 4PBDA 3ARRA 5L4IA 3L95B 5L2KE 3LKNA 1LM8V 3I6LD 4JN2A 3CDZB 2E7MA 3DVGB 35C8L 4A2HA 4R2GC 1YEWA 2X6UA 4EOWH 3FCSA 2NT0A 3DWTA 4XBGB 3S35H 4DTGH 1DVXA 4PRHB 4G8EA 1T1YA 1J5OH 5ESVA 4S1RH 5LNDA 4F57H 5AVQB 3KDMA 4PJHB 5H37H 5ALBH 2PTVA 3W82A 1KCSH 1VFAA 3DO3A 2BRQA 5A43C 3K72A 4QRFA 3GSRB 4KZDH 1MHCA 2X1XR 1WTGT 5FA4A 4X9FA 4XZUB 4O4YH 5IB5B 2PR4L 5C9JB 3MLVH 1INEL 1H3VA 1H5BB 2CLRB 3IU4H 1KEGL 2E9BA 3MV9D 3TNMA 3QJQB 3DRQA 4LKXB 3BIBX 1AD0A 3BSGA 4UYPA 3KNBA 4AYFA 1R6VA 1UFGA 3QWOA 4ONFH 3SIKA 2X4UB 5EU4A 2WXQA 5LG6A 3T6QC 4W9KC 2KERA 2IPUK 3L3IA 3QEQD 3P4NA 2YEZA 3QDMB 3QI9A 2XIIA 4N68A 4EOWL 1GKOA 4DTGL 2AF2A 3S35L 4PB9H 5D5MA 3OKEB 4I4WA 1J5OL 5LQBH 4S1RL 3FUKA 5EBGA 4JKKA 4F57L 1T3FA 5ALBL 4IRSC 4RESB 2DYPB 4I48B 3RIAK 3IJYA 1MCKA 5J4MA 1ZT4B 3IJSA 3VGAB 5ID1B 5LXGH 1QO3B 3FK3A 2X41A 1BFOA 2JLLA 3BVVA 2DJUA 4O4YL 4KRMB 3T3PB 3QR0A 8FABB 4JRYE 1XEDA 1A6WH 1FSKB 2WNXA 3MLVL 4WU5B 3I9PA 1MDAA 3IU4L 2R51A 1BAWA 3SBPA 3CLWA 3TIEB 4F33B 5FO7A 4ONFL 4J3XA 1NCNA 1YAIA 3MJGX 2E56A 1ZLUK 4ZMWA 2MQ0A 4BSVA 1S46A 2DDQH 3U48A 2JKNA 1SFHA 1VERA 4YHPB 3ARGD 5GHWL 4QIRA 5AVVB 4PB9L 2C9QA 2VQUA 4GMTH 2J1KA 2YHGA 1U9KA 2X1OA 3T5WA 4PGBA 3WS6A 4PJCE 3ZL4H 1NAKH 1CC3A 2F54A 1EV2E 2UY6A 4IIQB 5LXGL 1KV7A 2LFGA 4FHKA 3MROA 1EERB 3MC0A 2XC8A 3DJRA 5SX4H 5A6IA 2IADB 3HUJF 3EZ8A 1YNTA 4P57A 4X6FA 1A6WL 5HDBE 1CD0A 1NCJA 2OR9H 1ETB1 3T0WA 4LDOB 2HRHA 2VSMB 1RZGA 5IFHH 3QZMA 5E1HB 1ND0A 1QRNA 2OJZH 3VXUE 3BVNA 4V1DD 2YWZA 1CD1A 2DDQL 1A4AA 2ISDA 2K6ZA 1DTUA 2GT9B 2ZXBA 4W4OA 3BC9A 1M7IB 1KCUH 3II1A 4GMTL 4U31A 1FFQA 4R7DB 4N25A 1WG3A 4XP1H 3ZL4L 1NAKL 4U1MA 4RFNC 3FB7A 2CQVA 4K8RC 3UTPE 1TQCC 3M1OA 4MDJA 3RFZA 3D25A 4P23C 4BFKA 2FR4A 1I7TA 1FFPB 3WL9A 2VR7A 3ZX1A 3FCBA 1CFTA 3ZHDA 2Z93B 4ZMOA 3W5NA 2APFA 2OR9L 1F1AA 2UV3A 2PABA 3FOMB 5KANI 1AQMA 5IFHL 3V9EA 4NM4L 3CSTA 1QTYT 5DGRA 4ZS6C 5DWUL 5EO9B 3TZVC 3M1CA 3QNYA 1T7XA 1NAMH 3ROLA 4XO8A 1KLUA 1AXSA 3X11B 3EW3B 5C0CB 4UZSA 4F93B 4PJIE 1HSBA 1W91A 2LR4A 1KCUL 3NOIA 3GJEB 5C09E 3QJHA 5IB2B 3QH3A 3V79C 1OL0A 3HHMA 2DM3A 4XP1L 5KYWA 4NRZA 1BAGA 2DWEA 2CLZB 1YECH 2WC7A 1OGTA 2BNQB 2F53D 3EH2A 3JWDL 5MENB 4OFYD 4XO9A 4PBVC 3IGKA 3LNFA 1U8HB 4GPVA 4FP8H 3K5SA 2Z35A 1BPLB 1SXZA 4FEMA 5E95B 3BZ5A 2ALWA 2IGTA 4M7LH 3F6JA 4N1HB 4AZ8B 3IFNH 3RZCA 2FDBP 2Y1VA 5EBLA 2HN7B 1JPTH 5AFAA 5ECJE 4Q0XH 1KYOJ 2B3IA 1S8DA 4L9DA 4QOKB 3O3EB 4LFHG 1BLNB 2DAVA 2F08A 1EUUA 4PRNB 2ZUYA 2WQSA 4Z76B 1INQA 1FGVH 1XIWD 5E1IA 5DO2D 2OZ4A 5CEZD 5JIKA 1L0XA 3STZB 1YECL 2WBJB 3MUHL 1OTUC 2XA3A 2G3XA 3GXIA 4RZCB 3CLFH 4XO4A 3HOGA 4WGVB 3U30B 5EF1A 1BQHA 5ICYA 4IMKC 1I8LA 4JNXA 1S9KC 1R3LB 2VW7A 3MACH 5HI5C 5FF6B 4BK5A 1G5AA 1ZANH 1ZDQA 2AV1B 4FP8L 3LRKA 5DD6A 4BSWB 1EGJA 4M7LL 2GSIB 2WAQA 3IFNL 3TLRA 1U0QA 2A2QT 1CLCA 1CGWA 2J5LB 1T7VA 3WHE1 5BO1H 4FEIA 4KTEH 4MXVE 2E9WA 4F7TA 4N24A 5IVOA 2EVJA 5GRVL 1MZZA 1FIGH 1N8OE 2NYYC 5CIPA 4XXDA 2VLKB 4UQEA 2HVJA 4GSDH 5K9KB 1LE9A 4JFXB 3WNIA 2Z8SA 1CFQA 1C7SA 5DS8B 4K2UH 1FGVL 4CMHB 4ANVA 5GZNC 5DYOA 1UOLA 2YUXA 3F64A 3APFA 3PFQA 4G6MH 4OUUB 3CLFL 4AY0A 3IM1A 4W9ZA 4ENZA 1HOCA 2AXGA 5IK3B 5D7IE 4HJSA 4N3TA 4PJAB 3H1ZA 3MACL 3QWNA 4AGPA 3E0GA 1N2RB 3OBAA 4KKBC 1ZANL 2VITB 1ES0B 2FSDA 1J8HB 3O6FA 1F1DA 1KDIA 1FAIH 1N64H 4I1NB 4WNQB 4LIQH 3FH7A 4GO6B 4XVJL 3T1FA 1AI1H 1DP0A 1P7KA 1WFUA 2AXWA 4Y2LA 2GHWB 1IAOA 1ED3B 5I1AB 4PJ8A 3DMMC 5BO1L 2NLJA 4J3VA 1YEEH 4FG0A 4S1DC 1G1YA 4H5SA 4QRPB 2QJDA 3VM5A 3VXTB 5DJ2B 1FIGL 3GI8H 3L3KA 4L9LC 1G7IB 1PIGA 3TBTA 4GSDL 5AAMA 3B9KC 3T6VA 4K3EH 2L4OA 3MXWH 1FYTB 4WSJA 3WS3A 3LEXB 1X5XA 1ZPLA 4K2UL 4LGRB 2VKXA 4AGLA 4B97A 1FV1B 1X9UA 2XWCA 1CD9B 3NJLA 3OWRA 4G6ML 2KHAA 1CF8H 1XCWA 1MVUB 1WBXA 2UXGA 4RA3A 1QSED 6FABH 5DMKA 1KXVA 2EIZA 4RFEB 2GJPA 2X9YA 3PGDB 2K7QA 5L2KB 3B9EA 2NW3A 4YGVB 4P2AA 5I17A 1FAIL 1N64L 4NUQA 3P77B 3TA3D 1AI1L 3QAZB 2CO2A 3F5WB 2ZAIA 1UWYA 1FZMA 2L7EA 4JDTH 3OR6A 1PG7X 4LVHC 3MJ7B 1JPST 1YEEL 1GTNA 4JZNB 3BEVB 1MCHA 3TCTA 3GI8L 4PWGA 5BUPA 2UYLA 5AQ0A 3OPZH 3S37X 2GCYB 4XO5A 2HP4A 3MXWL 2NY4B 5FKPA 4U05A 5FO2A 1LO4H 3CFKB 3UJTH 4WO4B 4D7PA 3QEQA 1MVYA 1WJ3A 2YXFA 3DUSA 3NPSB 1A22B 1CF8L 4I13B 2G2RA 2V3EA 1WF5A 4OIBA 1SLUA 4LCUB 4X5PA 3WIFA 6FABL 4KQ3H 2EDJA 2F74A 4XOBA 4OUOA 1JPFA 4JREC 2R4SH 4GRLD 4MS8C 5FLVA 1JZ5A 5IFJA 1PLCA 3BH9B 4YMPA 3CSYA 1JNHB 1IUZA 3QUZA 2VZSA 3G6DH 3QORC 2PW2B 4Y2DC 2W07B 4Y4FB 3L5HA 1N5AA 1X5YA 2VDQH 2BNUB 1FJ1A 2W59A 4GH7B 4V2BA 2BCKA 4ORZC 5GIRB 4QDGA 1F3DJ 1SBSH 2FJHB 3OPZL 1I7ZA 2PYFA 1LO4L 4P5TC 4JRYB 4YHKH 3GMLB 1HJBC 1NMBH 3VNZA 2R2CA 1QMUA 3CBRA 1LWJA 3DX7A 5ESAA 1QFHA 2HH0L 3ARGA 3U9PH 4CN6A 1SJHA 1PYWB 3OHXB 4X5RA 1WS8A 4DGVH 4KK5C 4H2AA 1JE6A 1INDH 3S5ZA 1WICA 1WIUA 2R4SL 3D52A 5C0EA 3UP1A 2JFCA 2ZKYA 4BCYA 4GRWE 4YFLI 3UAEA 3EJQA 4QF1A 4QTHB 4WHTA 3G6DL 3JWNC 4M1CC 2ORBH 1GS7A 3MRPB 4QHUA 3WOVA 2VDQL 3VYOA 2YPVH 3HC2A 1FNGA 1ILUA 3APCA 3U6XS 3ULVD 1SBSL 4LE8A 1IVTA 1GGBH 3D08A 2Y2WA 1EZVX 1S7SA 1G94A 1H8SA 4N8VG 4YHKL 1DDHB 1IBFA 4V1DA 4ODUA 5HDBB 1NMBL 4JG0H 3T6ZA 1V3MA 1TO5A 1ZVSA 4NNPH 1A0QH 4ELDA 1T6VN 3OZKA 3ARBC 2IH3B 3NCYP 3VXUB 1F3JA 2F7IA 1INDL 4DGVL 5CFHA 5GPRA 1MFMA 4FG6C 1QG3A 4B5ZA 1F41A 4JJOA 7TAAA 3MLPA 1RU9H 3MJ9H 4PD4K 1QR4A 2K4WA 5JNYB 3P2DA 2ZE0A 3N1QC 1QTPA 2ORBL 4YDJA 3A6OA 1I8AA 2YPVL 3G08A 3WIIH 4DEUA 1MUJB 1AC0A 1GGBL 4C4BA 2GEQA 2EYTB 5K59E 2UXVA 4LASH 2H0JA 4UWQB 3ET9F 4JG0L 5DEZA 3G6JA 5FUCC 4ILDA 2DQFB 4LCCA 3OV6A 4N2CA 4NNPL 2OMXB 3NFPA 3S3CB 1OEZW 3FAWA 5JXEC 1H8OA 4OB5H 1F1GA 4KI5D 1PLBA 5E5RB 3FB6B 1UXWA 3M88A 1XZ0B 3AMKA 3RHWF 4BE6A 4UOZA 1RU9L 3MJ9L 4PJIB 1W16A 2P5EA 4OFYA 5C09B 1ZLSH 1CMOA 1RI8A 4LDLB 5DA4A 2ZUVA 4HU8A 3DBXA 3GKZA 4KKLC 5FUZH 2IGLA 3BCDA 1D9KB 4QEGA 3WFDH 1BOGA 4B9IA 2CJ3A 3SE3C 1QEXA 3A4DA 3ZOAA 1B0WA 4J3OF 1GL4B 2EH7H 1XGTB 3LKQA 2VLKD 4LASL 3NJFA 3WY3A 3UFIA 1CGYA 2J25A 2ZG3A 4W81A 1CDHA 4L5FH 3WDJA 3GXUB 3MV8E 1ZT7A 2ZOLA 4NN6B 2NZIA 3F04A 4Z77B 3B3IA 2PTTB 4MAYA 4OB5L 4X6BA 4QYOB 1XIWA 3UJJH 1B0IA 3U0PA 5F7AA 4QUOA 3UMTA 2Q7AA 4QRAA 1WA0X 1BW8A 2Y7MA 1ZV2A 3B4NA 1AOHA 5F21B 4RMWA 1ZLSL 4PJBB 3K1KC 3UJIH 1J8HD 5KSBA 1ZLVH 5FYKU 3AGWA 2Z31C 1Y6KR 3S36X 3BESR 4JGNA 4PREB 1RFDH 3WFDL 5FO9B 4MYPA 2ZQKA 4ZSOE 4C58B 3S3PA 1XGUB 5DK2B 3AADB 3BUYA 3O6ML 3WJJC 3VRJB 5D7JB 2EH7L 1K2DA 3SGEH 3NIFE 2QQLH 4L5FL 4LLVA 3IB4A 5F70A 2H41A 4JM0A 4EKXA 5C0ND 3L95A 1AC6A 4PSPA 1CI3M 2BVTA 3MA7A 3DVGA 4MMZB 4NWUH 4AIZB 5AVUB 4C4KT 1KJVB 4XBGA 3UJJL 4WJ5B 1B90A 1C1EL 4PJHA 5KVMC 4PY7B 5ADOH 1R3KA 3GSRA 1NM4A 2VN3A 1T7ZA 3Q5TA 4PTUB 1J5IA 4HJGB 4XZUA 1CGXA 1F6AA 1RFDL 4YFLF 5IB5A 4WI8A 4BYHA 4ZX4A 5C9JA 1SXAA 4P9HH 4UZUA 1GGCH 4I89A 1H5BA 3DO4A 2CLRA 2QQNL 2WXOA 3OJ2C 5D7IB 2CKNA 2BS9A 3FTWA 4M7ZB 5AG8A 4ZBJA 3FN0H 4LKXA 4NENB 2NY3D 5E8EB 1MDTA 3TEXA 5FW6A 2ZUUA 1CICD 4KO9A 3LQZB 2QQLL 2X4UA 3EOBB 2NY4D 4Z3HA 1WPCA 1JFQL 3AT8A 4KZEH 3ULUF 5HXMA 1IILE 1AE6H 2YQBA 4NWUL 4XWOD 3F7YB 2GY5A 4FYQA 4UMSA 2VUKA 2W88A 4HEPA 4PTTA 3DARA 3OKEA 5ESQB 1LMIA 1KJMB 2BHUA 5SWZD 4ETQB 2UVEA 4MD5A 3T0XA 2V37A 3FYIB 2DYPA 4I48A 5I18L 3SCMD 3WNJA 4F8NA 3BQVA 3C9NB 5HPOA 5ID1A 3TPKA 5BOJA 1V3JA 3OKOB 1EJ8A 4UM8B 4BUHA 4C4UA 1Z9SB 3ETTA 1EVTC 5E9AA 2CGRH 5IOPA 1R17A 1GGCL 1F45A 1JV2B 2WN3A 3RVTC 5EBWB 3TA3A 4UTAA 3HAEG 3V6ZB 3FN0L 3CDFA 1GGTA 1XAKA 5I9QC 4F33A 5HHPB 4GRMB 3VA2C 5F7EH 3PWJB 4L1DA 1KY6A 1DVZA 3S3SA 4KZEL 3ZDWA 3CTTA 4G6KH 3O4LE 2R29H 5LUMA 1AE6L 2ALAA 4N5ED 3Q3GB 4WFGD 2OCCB 5C0GB 5EMYA 3WFBH 1WIOA 2FX9L 2VOTA 3CSGA 5IROA 4RAUB 4MJID 4WVRA 1CDGA 4NCDA 2K78A 2J8UF 4LL4A 5EG6C 3QHTC 1VIWA 2Z1KA 1JUFB 4IIQA 3BDBA 2J88H 4N0FB 3ZE0F 5GS0L 1LEGB 3SQOL 3IDGB 4DHLA 2FQGA 2X7LB 1D2OA 3NCEB 1USQA 2IADA 2JJSA 2CGRL 1AYRA 3SPHA 1YYLH 4K07A 1WAAE 1HH6A 3LVEA 5LKNA 1PG7H 2E3VA 3MLSH 2YRLA 4GAJL 2B39A 5GJTH 1YN6B 4WSGA 4YSCA 5F7EL 4HAKA 1XD1A 4H8WH 1NCHA 4S1QH 4XXCA 3BDYH 3GIZL 1IVLA 1LWRA 4G6KL 4XNAA 2R29L 2XXFA 3HPLB 1CT8A 3NRPA 4AEFA 4GQRA 1UTDA 1BV8A 3DX2A 1OIOA 4NN5B 2GT9A 3C5XA 1KGCD 4G8GE 1OE2A 1F6FB 4X5WB 4ZD3H 1B4TA 4DAGH 4XX1E 1KTRL 4MQTB 4OD2B 2F7QA 1MH5B 3ZKXC 3LRMA 1O6TA 2J88L 3S2AA 1YA5A 3FPYA 3LB6D 5EU3B 1MJ8H 3OXSB 1FFPA 4IBTA 4JANB 1W72B 4M61B 2JNZA 2QVIA 4KQ4H 1K85A 5CP3A 1OAXH 2XXMB 5I8OH 4R4NC 4U3XA 1YYLL 3BQUC 2V5YA 3RGBA 2DWSA 3W9DB 1PG7L 3ESUF 3MLSL 3WTWA 1O9VA 4AKOA 4L8SB 1AR1B 5GJTL 1AGEB 1JHKH 2DIEA 3C6LD 3LNGA 4HZLA 3FU5A 4XX1G 4N8VB 1ZV9A 4O9HH 2E6PA 5EO9A 1T7WA 5EH1A 2PCYA 3BDYL 2BS8A 3C87A 1IGCH 3AT9A 4Q6KA 1RPKA 1YEHL 2DY2A 3HB3C 4GRWB 3S37L 4ENEC 4Y89A 3S96B 4MJ5A 3X11A 1AP2B 5C0CA 3ARFD 4G5ZH 5IB2A 3GJEA 3A0OA 4ZD3L 4DAGL 5D2LB 3DX0A 4F2EA 5DJXB 3GBLA 4JFQB 4POZC 5J3HC 1N3NB 3IRPX 5I75B 2CLZA 4N8UA 1CPUA 1AHWC 2P45B 4H13C 5K39B 1JCVA 3K2UH 1BFSA 3SD2A 3N0AA 5MENA 1MJ8L 1PD0A 4FHBD 3Q44A 1U8HA 4KQ4L 1U3HB 1TQSA 5AVTB 2IAMD 1KTLB 4LBEB 1XF1A 3HMXA 5I8OL 2QR0B 4JVPA 2Y7OA 4OLZL 1AJ7H 3HLKA 2EABA 4FL4B 5CN1A 1JHKL 1QYGH 4MXWH 4O9HL 3BSHA 1EFXD 4XC1H 2HN7A 1FVEB 1JP5A 3EOTH 1PZCA 1DJZA 2VDNB 4FYTA 4W6YB 4OGXH 2OL3H 4GT7A 4EE2A 2EXTA 1FYHB 2L7QA 2VJ8A 4L2YA 4G5ZL 1BLNA 1GMIA 1WQVT 4FDWA 2E47A 2PP9A 2B4CL 4XCCH 1EQWA 5PCYA 4I18B 5DFAA 4Z76A 3EYFB 3STZA 1GC1C 1LE5B 4RZCA 3O4OB 1XSJA 2VRKA 3K2UL 1QATA 1R3LA 3H3PL 4XPAH 5T5NF 2WTOA 2WWKO 4YXHL 5KSAC 2AV1A 5MP6H 1KULA 3FUEA 1JV5B 1NANI 1NCTA 1X5AA 4BSWA 1AJ7L 1BJ1J 2QSQA 2NR6D 2QTVA 1MFVA 1QYGL 4XMWA 5E6IC 5BZZA 3SDXF 3JVFC 2RFXB 1D6EA 3T3ME 1F3RB 4OZIE 4YE4H 4RGMB 4OGXL 2OL3L 2NY5C 2Q2LA 5DJYB 1CE1H 5IJKC 4EIBA 1M53A 2VLKA 2E8ZA 3DIVA 3HC4L 5K9KA 3D3VB 4XCCL 3AS2A 4LXFA 5KSVB 2GJJA 2D2CC 2B1AH 5DS8A 5AOMA 1OQXA 2L7JA 1GHFH 5AAWC 2OPCA 2R39A 3G04B 3ILPB 5HD8C 4RH4A 4XP4H 4P2RE 3H54A 4AW7A 2EVIA 4J2XA 2CXKA 3NDZE 3DHJA 4N26A 5IK3A 2O4EA 4PJAA 5C0AE 1CDUA 3TT1H 4U6HB 4XPAL 5AZUA 1HNGA 1N2RA 3MV8B 2D0HA 4R2GB 2UZPA 3HC0B 2VITA 3JWOH 1ES0A 3LKOB 5DD5H 5FCUH 3VD5A 3D4YA 5MP6L 2DICA 2VC2H 4MAUH 1J8HA 4M1GH 5D4QA 1ROCA 3OXRB 3NFSL 5FYKH 3JUZA 1JYNA 5HY9A 2DI8A 2QV2A 4YE4L 5I19H 3VX1A 2LTQC 3H85A 4QRPA 5EEZA 3VXTA 1T20B 2VGLM 2EILB 4NM8H 5DJ2A 4NAJA 3OSVA 4NQCE 1WFJA 3KLHD 1G7IA 3L9RB 4P4KD 3VFTB 4PJGF 3P3YA 3J8F7 1O7DC 2B1AL 4GXUN 3T09A 1GHFL 1FV1A 3KH3A 4QHKJ 1L9RA 4YWGL 4XP4L 5AD0B 3QNZB 1CR9L 4UT9H 4XNUL 5AW7B 4ANUA 2XQBL 3FU7B 5A2IH 5AWNH 5TH2B 2K8QA 3NIFB 5JW4R 2XWRA 4RFEA 2Z7UA 3PGDA 3JWOL 5DD5L 3JYBA 4LLDB 2A83A 2UWEE 3ATDA 1UCBH 3RZWA 2VC2L 4MAUL 4M1GL 4YGVA 3BN3B 3UP6A 3P77A 1EX0A 1TPXB 4U7KA 3S36H 4IRSB 3LPWA 3H7BA 4O51A 3F5WA 4S0TD 3VYNA 2F5BH 5T1LD 1AGBB 1WVZA 2D9QB 2RR3A 2J73A 3MJ7A 4AYBA 5I19L 2IQAB 2ITDB 2X4NA 4JZNA 3BEVA 4KHTH 2CIKB 2GITA 3O2VH 4YJZL 1F8TH 1Q8MA 3ETBF 5DU7A 2ARJB 3LH9A 2K7PA 3BWUC 3DETD 5D7SH 3NPZB 1UADC 2C3XA 3MRDB 2CU9A 2FZ3B 3CFKA 3LKSB 5I6OA 2YD3A 4RETB 3IAQA 1V7NH 4B7IA 2X40A 1G4RA 4WO4A 1IQDB 3H2WA 4MA8H 4UT9L 2PP7A 4MLIA 1L6PA 1BVOA 3OKLB 1ASQA 3FULA 5JORB 4CA4A 3QIWD 4XP9H 4NZUL 3V4VB 4PJXF 5FGSA 3DOIA 3KYMB 1AGFB 3AB0C 3L2MA 5E6ZA 1UCBL 3SCMA 4H40A 4RZKA 1OW0A 4DUWA 3BH9A 1JNHA 3GJFB 2HJKB 3HAEB 1JG9A 3S36L 2EVGA 1ZJAA 4AQ8A 1NJ9B 1HHIA 2PW2A 1D7DA 3GMNB 2B20A 2W07A 4Y4FA 1ZLDA 3BAWA 3WEXB 4KHTL 3O2VL 1B3IA 3WEMA 1M7DB 5LNGA 1NEPA 2BNUA 2IVFC 1FVCB 2FJHA 2HFGH 4H20H 1NUNB 2DWDA 1TZHB 5D7SL 1KV3A 3IDUA 1V7NL 3F7VA 1CO1A 3JWNG 3MRRA 2GI7A 3GXNA 3AG4B 1URIA 4MA8L 7PAZA 4L0YA 3ALPA 1L9TA 2NY0C 4E41E 1A4JA 4XP9L 1T5XB 2KS0A 3EZJB 2YKLH 3OHXA 4HJ0D 4Z7QE 4DPBX 3O4LB 1KBKA 1KJ2A 3U4AA 4KROB 5E4AA 3V4PH 3KYKH 1Z3RA 4PIRF 3IFPA 2VN5A 2ZSVB 1WO2A 1KB9K 4M4PA 4QTHA 4YXKH 3RY6A 3R4RA 1V10A 4LEEA 3UAJC 4K7PL 1TQCB 3MRPA 1OARL 1MHPH 4FI8A 4P23B 4NDMA 4GB9A 1ZIBA 1IAII 4BHUI 2R2HB 3QO1B 4CN4A 3LH2H 2HFGL 5FUCE 3MRHB 4P3WA 3N85L 3MLRH 5EUOE 3O2DA 3QVAA 1DDHA 2FO4B 4S0SD 3FQTB 3B1UA 4HIHB 5LLIC 3PHSA 4FYSA 1AD9B 2QSTA 4KKRA 3TWCH 3TZVB 5ADPH 3QFGA 4KQ0A 2VUYA 5EC1A 3HE6D 5E5LA 1ZS8A 2FD6H 1M6UA 2YKLL 3D85B 3VXUA 1NDGB 4X6CB 3VSQA 4S10A 1BDYA 4UIMB 3V4PL 3N43B 5K1NA 3HBQA 2X53A 2A38A 2HUEA 2NY2C 2Q2EB 5KBPA 3I02B 4YXKL 5GGVH 5JNYA 2QVTA 4H8HA 5DJDB 1MHPL 1UEYA 3JVGA 5HHXH 5GRXG 3EJYC 4FXKA 4HX1B 2BS71 4WQOA 2EDKA 1YY9D 1MUJA 3LH2L 5KAQF 2A4EA 3THML 3E6FB 1IARB 2EYTA 1P7QB 3MLRL 3FZUD 4WFED 3DURA 1X5KA 3AG1B 2OMVB 4YIQB 5ADPL 4OTXH 5GS1A 2DQFA 4FFYA 5D96B 4N5UA 2PW1B 2OMXA 3AQXA 3CHOA 2FD6L 2AKRB 3JWDC 1DQKA 2CK2A 3FB6A 2DM4A 1CTOA 4M6NH 1XZ0A 3FO0H 4MNHB 2PETA 1KIPB 3GGWB 3NABL 5DZVA 1DO5A 1LK3H 1UG9A 3FUJA 4PJIA 4UT6A 3ZL2A 5C09A 3TCXA 4Q9QH 5B3SB 5GGVL 2HAZA 3L8QA 3KHQA 4RQQB 5HHXL 1ZPUA 1D9KA 1S5IH 4OAWB 4QJ4B 1I53A 1WYJA 3J7HA 3PWNA 1X6LA 2DQEH 3EYVB 4KU1A 2NXZC 2FHFA 4ETYA 5ILTH 1ZA3B 2R56H 4QYAA 2CK0H 2AEOA 5DVOA 4ZDHA 5C3LD 4U33A 2N59A 3PXHA 3D3VD 2BJMH 4OTXL 3R18A 5A3ID 1L5GB 2FWUA 1U8KB 3A6BL 4Z77A 2HFFB 5D1XC 5A2CA 3H56A 4TUJB 4QYOA 3V4UH 2LQRA 4DP1X 1BF8A 2VXSH 4XT1C 3FO0L 3PLYA 3RDTC 4WHYH 1DVYA 3NEXA 1LK3L 5AW0B 2XJLA 5BZWB 4HOZA 5D1ZC 1Q9WA 4PJBA 4Q9QL 4XBEL 5ICXB 1A1OA 1I9EA 3VDBA 1R3IH 4NCC2 1NC4D 4PREA 1BMZA 5FO9A 1S5IL 2O5NA 3ZZ1A 3FU0A 5D5MF 5DK2A 2DQEL 2OLDA 2NR6A 2Z7ZA 5ILTL 4ELME 4ZFOB 2Y5TB 2CK0L 2PWFA 3SDDD 1TEFA 1UYWH 1U95B 2BJML 1GZPB 1ORQA 3MLUL 3DMMB 4I7ZC 4OGQC 4AIZA 2MKWA 4PJ5E 3RWDB 1KJVA 2YMOA 3TO4D 4XMKH 5E9DD 3V4UL 4WJ5A 4OZIB 4L9LB 4QO1B 2VXSL 3OAUH 3VXMB 1JTPA 4E9QA 3B9KB 1UT1A 2XVKA 1MWAH 2X70B 3GSXB 4PY7A 2FCBA 3UC0L 4WDIA 5SWSE 5CMAA 2G3NA 3K0WA 3TESA 3GIVB 3L16A 3VXRD 4PTUA 3GRGA 1R3IL 2A6DB 4HJGA 3IPEA 1OALA 3SJVE 1P9MA 2FECI 3EH4B 3WSQH 2DB8A 5D7IA 1JYWA 1D5RA 4KUCF 4NENA 3ZHFA 1UYWL 4L8BB 3LQZA 3EOBA 1J1OH 4NPYB 5I6LA 4UNVA 2F8XC 2Y6SD 4AXWB 2KC0A 4LVHB 4NI3A 3S9DB 1WE5A 3TBSB 1T4KB 2ZX7A 3HZ3A 4OCRH 3N9GH 1TQWA 4XMKL 2YBRB 5DURB 3OAUL 5ESQA 3WU1A 1TMQA 1VGKB 4GAGL 4MMXA 1OK0A 1DEEB 1MWAL 4NQCB 1G7JB 5DZNA 4G8AC 3C9NA 3OJDB 1UACH 1OTTD 1G5GA 3ARZA 3BHBB 5JLZB 1QSFD 2FAUA 3H4HA 1Z9SA 4G7QB 2QSVA 3ILQD 3K6SB 2J3SA 2WXHA 3CPUA 4NC0B 1A6ZB 2WV3A 5IUCA 3BMVA 3WSQL 3RGVD 4UB0H 5LVEA 3V6ZA 2CLVB 2FECL 3QIUC 4JREB 3VYPA 5HHPA 1VKXB 4YO0A 4GRMA 3B43A 4F58H 2UWEB 3PWJA 1J1OL 2XICA 2IFFL 2BP3A 1KDJA 3QORB 5DUMH 5JDSB 5C0GA 4Y2DB 4HK0B 1UH4A 3HZVB 4JG9A 2VDPH 4OCRL 4XNXH 4BZ1H 3N9GL 3EO0B 2QADD 2F1AA 3I3BA 4RAUA 4LOEA 4BELD 4L4VB 1WA1X 2DEWX 1RZQA 2WCSA 4F9PA 4NBYB 4UZGA 1TZOA 2WLKA 4KROD 3QIWA 4KTYA 1UACL 2P7TB 1HS6A 2P4AB 2DQGH 4N0FA 1B4LA 1BVNP 3PE9A 3IDGA 4PJ9C 4Z7WE 4K8RD 5E99H 4Y7MA 5I0WA 4KKAC 4UB0L 3LXAA 3VB9A 4X7TA 1IC7H 1YN6A 3BZDA 1RUAL 3OC5A 3TS8A 5BVJA 4XTRD 5DUML 4BE5A 1I75A 1YEKH 4XNXL 3RL2B 2VDPL 4BZ1L 2CKBH 2EDMA 2TAAA 3MLXH 3L5WA 4L18A 4U2ZA 3UBHA 3TFKD 5DHVB 1E65A 4K3JL 5IHUH 1ZV5A 3ZBMA 1AGDB 3AITA 1MH5A 1HHHA 5EIIG 2DL2A 1NUGA 2XCMC 4GT0A 2WLYA 3WKMH 5EU3A 3VFMB 1JDCA 3OXSA 4G1EB 3QPXH 5EFIB 5TJWK 1NIAA 1W72A 1AIFB 2OJEB 1GJIA 2HTKC 4JE4B 5E99L 3L48A 4NZDA 3M46A 3ARBB 3KL5A 4HWZB 2P80D 4E41B 5D8JH 4LHUG 2AERT 3BN9C 3GXDA 2ZTBA 4L8SA 3VU2A 1AGEA 1OT1A 3L9BA 3WTTA 4N8VA 4NJAH 4AUUA 3B9DA 5J6HB 3F00A 3QR2A 3CVHH 5B38G 3X1NA 3ZO9A 1MG2C 5IHZA 3O9WD 1U58B 1YEKL 1C08B 1SPDA 2V5TA 2CKBL 2F18A 1QVOA 4B3EA 3MLXL 5B1JC 1PLGH 1JPEA 3O6KL 1XSKA 5D2LA 5E8OB 4TNFA 3W11C 2DYSB 4JFQA 3MUY1 1N3NA 1KB5H 3IXTB 2ZUWA 3IDJB 4TV3A 3WKML 1N9PA 2Q6WB 5K39A 3VE0B 2DBJA 3QPXL 4N2DA 4PRBB 4PWEA 4NP4H 1E4JA 1U3HA 1ITBB 3INOA 2YC1A 2KYIA 4LBEA 4JY4B 5I76B 5D8JL 3GPEA 4K4KA 1Q0YH 2OSYA 2V4LA 4Z9KB 3JV4A 3PNWA 4N0RA 5DZJA 3RVXC 5GGUB 1FVEA 5KN5A 3CVHL 3ULUC 4IK7A 3TTYA 5DVMA 2ICCA 1QI3A 4FFZH 5DFTA 1BP3B 1VRSA 1RERA 4JZOB 3ZMNA 2FIKB 2PXYC 2NYYD 1KB5L 1LE5A 3WO3B 3DX1A 3HUJE 5I1IH 3CUPB 2Q3AA 1NQBA 5TE6H 4NQEB 3ZT7A 1TZAA 2HTLC 3T9WA 5JW4M 1B2WH 4NP4L 2DLIA 3F83A 4Y9GA 2IV9A 3ECUA 5FFOA 4E9RA 4GI6A 2O6EA 1MFBH 1TU2A 1Q0YL 3ABZA 3NVQA 4LK4A 4KKBD 3MYZA 1MCDA 1U8OB 3TX4A 3PQYB 3QFJE 2NDGA 4ZYKB 1C8PA 2RFXA 2I85A 4C8XA 1VFBB 3TH3T 2ZAGA 5B4MC 3NJKA 3GO1H 3VUAA 3RWGB 4DKAA 2Z31B 4W9GC 1RIUH 3QXDB 5INDB 5JW3H 1Q4NX 3W5MA 4DIXA 1K8DB 4OCXL 4P3CH 4AEEA 3TA4D 1O7DE 2D8KA 3NZ8B 4FFZL 4G72B 2X5PA 1D7CA 4OI8A 3D3VA 4S1DD 5KSVA 1JVLA 2LU5A 3AQZA 4ZW6A 1EBAA 4KK8D 2A0LC 3GT6A 4L4TD 3G04A 3CN1A 3QQ3B 4M29A 1MJ7H 2PYEE 4HISA 4XPTH 5I1IL 2J72A 4QY8B 3B1TA 4GO8A 4JW3A 4Y9EA 1LO5A 2V9QA 2Y24A 1B2WL 1BXVA 2AGJH 4U6HA 3GTTA 2BDNH 3MV8A 2NZ1A 1GZHA 3HC0A 3EUDA 3PIQB 4RAVB 1PQZB 1IC0A 1BVLB 3V0VB 1MFBL 1S4IA 2APTA 2P49B 1HYSC 3OXRA 1F18A 5HYEA 2OMUB 1IKNC 1NC4A 4AC2A 4BH8B 3UDWA 3SBRA 3GRWA 3LOWA 3GO1L 5JMRA 4WK0B 1RIUL 5A16B 4FN0A 5IW6B 4KHXH 1MFEL 4U7SA 2P42B 4P3CL 4YSDA 3MCYA 5CNHA 1BF5A 5ICZB 3L9RA 5L4MA 5IF0B 3H0TB 4I9XA 3O3BB 3QUGA 1Y07A 2Y72A 2EIKB 1OHQA 3V9CA 5JYLA 1J0KA 2CR0A 3OM3B 3LRSB 1MJ7L 3Q5OA 3QNZA 4MXQD 3SKNA 4DKTA 4XPTL 1AQHA 5CGMA 3TO4A 4JFVA 4C55A 4PW9A 3QQ4B 3ZYOA 3FU7A 4EF3A 5CEXA 5TH2A 3RYMA 2AGJL 1DL7H 4GW5B 1EEUA 1SDAB 2BDNL 4Q2ZB 5TQ0H 2CRMA 5K33A 4ZMQA 1E42A 1QASA 4N85A 3WKPA 4UQDA 4PJ5B 1RUKH 3NQIA 4DFHA 4X5XB 5H37G 4M62H 4QAMB 4MS8D 3B2VH 4HU2A 2O5ZH 4Y5VC 1E8WA 5EU6B 2IQAA 4KHXL 4AKQA 2ITDA 5SWSB 1HL8A 5MEPB 2ZYRA 2BVQB 2FUTA 2X44D 2ARJA 4EI0A 3IDXH 3LN4B 2FZ3A 3B5HA 3LKSA 3FUNA 4IHBA 4TVSa 4YFEA 2ZXQA 1P6FA 1A9EA 3KL3A 1X5GA 1E2WA 1YY8B 4TUKH 3WE1A 2VNCA 2XETA 4JFZH 5J9PB 4G42B 3OKLA 4JG1H 4FOMA 1NCWH 1OZTG 3NGBC 5JORA 3OKKB 1RH8A 3V4VA 5TQ0L 1T2JA 3AM8C 3KM1A 3KYMA 3SPCA 1AGFA 2VISB 1EZUA 3H4FA 1VAHA 1ACCA 3GD1C 4FHJA 3I6KB 1RUKL 5F7BA 3K2KA 3MYJB 3GJFA 3HAEA 2HJKA 4KK5D 4M62L 1NJ9A 3B2VL 3MV7E 2O5ZL 1E8YA 3GRBA 3IETB 2E9GA 5F7KC 3WEXA 3QRLA 3K46A 1M7DA 4NI6A 4HUUB 2JXMB 1CL7I 3I9GL 3IDXL 1TZHA 4XVOA 1XVSA 4TLKA 4GY4A 2XFGB 5HYFA 3KPRD 3AWFA 1USZA 1N6VA 3GSNH 4JFZL 4JG1L 4I5BB 1BD2E 1NCWL 2K6WA 1T5XA 1T0OA 1UJ3C 5GS0C 1DQIA 4CN1A 1OV8A 3O4LA 1SXBA 4X8JB 4ANKA 4CC4A 2BP5M 5IJCC 2OW6A 3V95A 3CJJA 3G6JF 2X4OB 5B1BB 3ZKXB 3GSQA 3OWEA 3M8OH 2OMYA 4XBPA 2BOCB 3EG9B 4KH2A 4ZTEA 5J89A 1B0GB 4OFKA 3GPSA 4GP4B 1NEUA 1IGFH 2R2HA 1U8MB 3QO1A 1P84K 4ECNA 1H6UA 1BMGA 5EOCH 3BQUB 3MRHA 4ZZKA 3X2QB 4N2AA 5FC9A 5F7YC 2FO4A 4JL2A 5K1VA 1EXUB 2WIIB 3FQTA 3SE8H 4YDLC 4IOFC 2XPYA 5EIIB 4ZMPA 3GSNL 4TLTA 2D03L 4C56D 5DC4B 2J57A 2VMFA 1OCRB 3E9UA 4NB7A 5K1JA 3M1BB 3ZK0A 4QLWA 3HB3B 4G1MA 3D85A 3DJ9A 4JDZB 4WW2C 1NDGA 4YC2C 5FDWB 4X6CA 1OAZH 3CQPA 4UIMA 4JS7A 1QW8A 4RRPG 4LHUB 5D6DA 3I02A 2P48B 2F5AH 5DT1L 1FZOB 4MQ7B 4L23A 3SN6N 2YO3A 5DJDA 5BS0E 5JHLH 1AZVA 1CE6B 1TTUA 4TVPE 2P80A 5B38B 3LH8A 4F91B 3ZE2E 1PX8A 4UV4H 5G4NA 4R5XA 5I71C 5HHNB 4BQ6A 1IGFL 4A6YB 1S7UB 4GIOA 3ZU8A 3MV01 1P7QA 2EE6A 5TD4A 1KPUA 5KSBF 1IV8A 2BSSB 4UU9B 3SE8L 4URTB 2AANA 2OMVA 5E1GA 1KCWA 2ZUQC 4IBSA 1WWAX 4X8GA 3KBPA 2BRRH 2PW1A 2CZNA 1NIEA 3PWLB 4PW3A 2WSPA 2ZOWA 3ZTEA 1XCTB 1LK2B 4IQHA 1ET7A 4HUMB 2K3TA 4NQED 5DDHB 5C08E 2P46B 3VFWB 1OAZL 4MNHA 1H3UA 1KIPA 3GGWA 3D0AA 2OXGB 5BRZD 3HMWH 3T0EC 4W93A 4I3SH 3SKUD 1YEDB 2F5AL 1D6VL 4QT5B 4GBXC 4O2CB 3PQYD 1F4WH 1IAIM 3OMAB 3CN4A 4UV4L 3DKHA 4KX8A 3JQOB 5KSAB 4LCWD 1YLBB 2BSRB 2EDEA 2KL6A 3EYVA 3K4DA 1X5FA 4ICXA 5KVGH 1ZA3A 2QLVB 4EQ2A 3QB7C 4MX7B 3L6FB 1MCWM 5KVEE 2B4CC 3PPEA 1AY1L 1MEXH 4YBQD 4S1SH 3NMEA 5E6IB 1JTOA 3WTUA 3QDGB 4EN3C 1L5GA 1U8KA 2BRRL 4DGWC 1ZRUA 2HFFA 3CZLA 3K8KA 3K6OA 3QPQC 4GKLA 4OZGF 2WYZA 1G7LB 3RWIB 3QDAA 4M56A 3JV0A 5BZWA 5DC0A 4I3SL 3EYQC 2GBAA 4LSVH 5ICXA 1KLFA 1Z5YD 4ZQTA 4JFHD 1F4WL 4UQ9A 5D7KE 2P43B 5JHDE 1TITA 3NZUA 3TVMD 2Z91A 2IG2H 1FPTH 1A64A 2FT6A 2X4SA 3N50A 5KVGL 1OCCB 2Y5TA 3O3UN 3D06A 3TCLB 3U25A 4WWID 1SGKA 2FBJH 3T2LA 2O5XH 5CCJA 1MEXL 4JPWH 4S1SL 1PZAA 4UQ3B 4ABWA 3FNKA 4GFXA 3DMMA 4LB8A 1RMFH 4A7UA 3UIZA 2PWDA 2QL1A 1IIKA 4YE0A 4A38A 3QFJB 3RWDA 2LTQB 2G5RA 2VMJA 4X4ME 4LZKA 4OZIA 3L7FB 3CFMA 3BJ91 2VXUL 3ECBB 4L4TA 4QO1A 4R5VA 3VXMA 1XBDA 3B9KA 4JX0A 2NX5E 3GSXA 3QDJD 2A74C 1NICA 3HLAB 2Q7YB 4QRUB 3CGTA 3DV6B 1R5VA 5IB3A 4LSVL 2GKIA 3GIVA 3BPCB 1MXDA 2A5UA 2VDKL 2A6DA 2BXZA 4K7FB 4UDTB 4RISH 3HG1D 1A1MA 4FMKA 4Y16C 4DH2A 5HYSG 3V9FA 3EO9L 4AMXA 2PYEB 4N2GA 1CK0H 4XVSH 4K9EL 1KWKA 4GAYB 3GS4A 4YSSA 1OSZB 5AOLA 2FBJL 3KLAA 2O5XL 4MHHI 4L8BA 4JPWL 4NPYA 4K5MA 2ENSA 3NJJA 3VQLA 1A6AB 1RMFL 1TG8A 1V7MH 3O8XC 4AXWA 3P0GB 3ENEA 1XGQB 3TBSA 1T4KA 3Q1EA 4NO0B 2JJTA 1YPZF 2CBMA 3DV4B 3LY6A 5TE4H 4A1RA 2YBRA 3CDCA 5J6GB 3CQFA 1DEEA 2ZICA 3JWOC 5D7LE 3VSUA 3MTXA 1G7JA 1HESA 3C60C 1MFUA 1JPSH 2GTQA 3BHBA 3INUH 5JLZA 2ATKB 4JFPB 3BP4A 1TTGA 3B7TA 3K6SA 3HHSB 4UT7H 4ES9A 1A6ZA 2OCJA 1CK0L 4HPOH 2C4FT 3AB0B 4XVSL 1AAJA 2CLVA 1UGNA 4F1SA 5LGJB 1CYXA 1FNFA 5LAXB 2ZJSL 2ODHA 1D5ZA 2UWEA 4AGNA 4B9GA 3T1WA 3DX6B 4OLYH 5EEXA 4O5LL 3WNKA 3QORA 4MCYB 4EDXB 2EXYC 1O0VA 3QUYC 5JDSA 4Y2DA 4LPTA 3MZTA 3HZVA 4I88A 4OBRA 2HX9A 4F1ZA 3EO0A 5KJRH 1DUZB 5AW1B 2P5WE 5TE4L 3GSUB 1FG2B 2KI6A 2X3BA 2WVUA 1KF9B 3X12B 5EEYA 3VD2A 4L4VA 4P48A 1X7SA 2Z4TA 4M8UA 2Y0SA 3U1PA 4D9RE 4I9WE 1EWHA 3IJEA 4WJKB 2GUOB 1FC2D 1CQKA 1R4XA 1KZYA 2AJUL 1JPSL 1XL6A 2P7TA 3C12A 3MOAH 3QULA 5F96H 1S9VB 3BD5A 3ULVF 3INUL 5E1AA 1E4WL 2NY0B 4FXGA 4DEPC 2VDOH 4UT7L 2WSDA 4JPVH 2WKOA 1DCLA 1E8ZA 1FNSH 1H0DB 3POHA 4HPOL 4PWHA 1EVUA 1L9SA 5IQOA 4P2YA 3PDGA 1E90A 1TSHA 4IKIA 4A7TA 3N3EA 5F3BB 4OLYL 4BM7A 1ORSB 4X2UA 3RKDC 5KVFH 3D69B 2O6DA 3NG5A 1I82A 3GMRA 1KCLA 5TE7H 4MZ3A 5KJRL 3MV7B 3CX2A 1A7RH 1AANA 1TTAA 4UINH 5IHBA 3GUTB 4LP8A 3DGDA 3KPRA 1F4YH 1EFQA 5DHVA 3FT2B 4DVBA 2BP0B 2CO3A 3S3BB 5B8CA 1AGDA 3V10A 2Q8BH 3A21A 2VN7A 4JCLA 2CHZA 3AQYA 3MOAL 5F96L 2H9GB 4JLRB 4LHUD 3GS7A 3TJHC 5DMGC 4ODVL 3VFMA 5IHHA 1FL3A 4G1EA 5EFIA 1GOGA 3NFNB 1EHLH 4HFWA 2OJEA 1AIFA 1Z9PA 2VDOL 4FNTA 3P4MA 1R5WA 4JPVL 3DUHA 1FNSL 3KPSE 2EC9T 3ARBA 4HWZA 4PFEA 4UTBA 3T8MA 3BIAX 4M9PA 4GNKB 1BD2B 1CLYH 3GMOA 1EAQA 3ULUE 5BZDB 1QPPA 1JXGA 3PHQB 1QLRB 5CGTA 3UOAB 4L3EE 5IVZA 5J6HA 1AQKH 1ACZA 3UEQA 4KI5F 3B7UX 1DANT 3IKKA 1KYOK 3BWSA 5E94A 1U58A 1U91B 2CDFB 4WI9A 1UB6B 3LZFH 2C9RA 2Y3AA 3O2WL 4IRZA 4LPUA 4ODSH 4P06A 5TE7L 4UINL 2GJ6E 5CAYB 2ROXA 4UDUA 1F4YL 1MHHB 3NACH 5TDNB 1XSIA 2XLLA 3KGRA 1T03H 5E8OA 3UTTD 5AYUH 1VB9A 1JZ8A 4C56A 2Q8BL 1F00I 3IDJA 3IXTA 3BRFA 2HG0A 3W57A 3VE0A 2G60H 3B7RL 3BE1H 3UTSE 3BWZA 1EHLL 4PRBA 3UIYA 4P07A 5JXEA 3AY4C 2NYZA 2VB5A 1PJ9A 2A9DA 5I76A 3SSGA 5F1IA 4IIZA 3TN0C 2CUAA 1AS6A 2F68X 1CLYL 3WS6C 1AMYA 1QUPA 3SO3C 4A2MA 2HLAA 4ISVA 2QELA 4ABQA 3QC6X 1ZK5A 5GGUA 1AQKL 1OD9A 1TDQA 1YEFH 3PYCA 4PJAF 3B2UC 3EH5B 5HHMD 1QD0A 3LZFL 2J8UE 2MNJB 2WD0A 3QDGD 4RGNC 4ODSL 1RIVH 4HC1A 2QGEA 2IDQA 1C5DA 1QPKA 4H8QA 1D5MA 4ODHH 4MZRA 3TXAA 5BS0B 1T03L 4JZOA 3VW3H 2C1OB