3FQ1A

Azurin c112d/m121i
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFDTFPGHSALIKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Type Zero Copper Proteins.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 31
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2009-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3fq1A00
4UAHA 2A3TA 2WO3B 3WIAA 2FT6A 3S3CB 2YAEA 2UXFA 5I6OA 3EH5B 1AOZA 3WNJA 1SJMA 1PCSA 2J55A 4G70B 1M56B 6PAZA 3ZDWA 2XV0A 1R1CA 1DYZA 1V54B 1KGYE 1JVLA 2YAOA 3S8GB 1SFHA 1MG2C 1SF5A 3QJTB 1PY0A 1T5KA 3WNIA 2IWFA 3TU6A 5D4IA 2XVBA 1M57B 3S3BB 1KBVA 2IH9A 2I7OA 2CJ3A 2XX0A 4QKTA 5B7EA 2B08A 2DYRB 3UABA 2AZUA 1JOIA 4E9QA 2OJ1A 1BXVA 2HZHA 3IN0A 1V10A 1OE1A 2MTAA 1AZUA 3TA4D 3CZUB 1JERA 2X88A 4BWUA 1KCBA 2YXVA 4DP6X 2AZAA 4NB7A 1QHQA 2FQDA 1W8EA 3CVBA 4JHVA 2P80A 4AKOA 1MDAA 4A2GA 2UX7A 3AG2B 3QJUB 4W1TA 4AKPA 3S3DB 4BK5C 3TBCA 5A7EA 3EH4B 1I53A 3T6WA 2HLEB 3WG7B 1TKWA 1GYCA 4W9ZA 1NICA 4E9XA 5PCYA 4KOBA 1TU2A 4E9VA 1AZCA 1XB8A 2AANA 5TK4A 3FQ2A 4E9YA 3OMIB 3NJFA 1A4CA 4YSCA 2VW6A 2BP0A 3DTUB 1NIAA 1AAJA 1AG0A 3EF4A 1AR1B 4KNUA 3FU7A 4DP9X 1OE2A 3AZUA 4GP5B 2CALA 3MBWB 3H4FA 5ANHA 2XX1A 2Y1AA 1J9SA 3ZBMA 3HB3B 3G5WA 3CDZB 3X2QB 2P80D 2TSBA 1J9TA 2PPDA 1E5YA 3N55A 2GHZA 4RH4A 2GC7C 2LLNA 1JZFA 2BP8B 2Y69B 3WKPA 3IE9A 3FYEB 3SBQA 2VM4A 1QLEB 4HCFA 3SBPA 2PPEA 4G7SB 2EIMB 4FAAB 3NSCA 2W8CA 1NIBA 1ZDQA 1AZNA 5B1JC 1AANA 4AZUA 1HFUA 4YSUA 3TBBA 2GIMA 1OCCB 3FU7B 3T6ZA 3X1NA 5AZUA 4BDVB 4KNSA 1ASPA 3PCYA 5I6MA 1AS6A 2DWTA 4UANA 1GSKA 1KV7A 2BW5A 5B7FA 3H4HA 1DZ0A 1CYWA 1PZAA 2CCWA 4E9RA 3NSFA 4NAJA 2H5UA 3QQXA 4Q89A 1FA4A 3H56A 3ABMB 4N8UA 4GY4A 1GR7A 2FWLB 3NJIA 2X87A 3GDCA 3U25A 5E9NA 5I26A 1HAUA 2YXWA 3NJLA 5EHFA 2BWDA 4N4YB 4A66A 4CSPA 3NJGA 3OMNB 1RZPA 1ILUA 1RCYA 1BYPA 4Q8BA 4YVNA 1NWOA 2EINB 2PP7A 1L9QA 1OV8A 2DWSA 2JFCA 2EILB 1L9RA 9PCYA 3X1GA 1E65A 1BXUA 1CYXA 1AIZA 3IN2A 3FT0A 1JXDA 3NSYA 1L9PA 1NPNA 2IAAC 1A8ZA 1KDJA 5I28A 1TEFA 2DY2A 1JXGA 3AG4B 1RZQA 1E67A 1OOWA 1ETJA 1J5DA 3FSAA 5I6LA 3PAUA 2PP8A 2VSMB 2I7SA 2PCFA 1L9TA 1J5CA 1ZV2A 3NJMA 1PZCA 4DPBX 2JXMA 4CSZA 1E5ZA 1HAWA 3FSWA 1TEGA 5PAZA 2MRYA 4K9JA 1ZIAA 4HCIA 1GS8A 1IBZA 2PPCA 5B1BB 4DP1X 4JKNA 3CDZA 1ID2A 1JZJA 1NTDA 2OCCB 1JZGA 4WTQA 4YSSA 2WSDA 1KCWA 1NDTA 1GW0A 3NSDA 4EF3A 5I5MA 5D4HA 1N68A 2BP8A 2FQGA 3NP4A 1OCRB 2PCYA 4DPAX 1ET8A 1SF3A 3PLYA 1SHWA 2TSAA 1PAZA 1E30A 1GY1A 2QDVA 1XMEB 3QJQB 2YAQA 1GS7A 2QPDB 1SHXA 1SDDB 2IDQA 2YAPA 2YQBA 2XV3A 2QT6A 1BQKA 1KBWA 4NERA 3FSVA 5FC9A 4BDVA 1CUOA 2B3IA 3DIVA 2IH8A 1CURA 2H47C 2XWZA 1AG6A 1AZBA 4G72B 4YVUA 1MZZA 3GXUB 5B1KA 3NJKA 3EH3B 3FPYA 2BZ7A 4GXFA 3NJJA 3PXLA 1WA2X 3OQRA 4GP4B 3T6VA 7PAZA 4YSTA 2AFNA 2VMJA 5IY5B 3ASOB 3IEAA 3FPXA 2BHFA 3C75A 7PCYA 5I6NA 3FU9A 5I6PA 3V9CA 4HIPA 1WAEA 2N0MA 2YARA 3JTBA 2UXGA 1OF0A 1OE3A 1ET5A 2CAKA 1AS7A 2UXVA 3IBOA 1FWXA 3V9EA 4YSQA 1AZRA 2IDUA 2YAMA 4A2HA 1AQ8A 3X1BA 4G7RB 2EIJB 2J5WA 5TK2A 4YSRA 2JKWA 1A4AA 2QPEB 1RKRA 4M4RB 2HRHA 2FTAA 5AKRA 4F2FA 2BZCA 1JZHA 1BXAA 1NINA 4KO5A 3ASNB 4ZK8A 4AKQA 1ASQA 8PAZA 2HX8A 5I5JA 3NJNA 4A2DA 2CBPA 4AX3A 2HRGA 2FQEA 1X9RA 2J56A 1L9SA 2UX6A 4A2EA 3DKHA 4DP2X 1JVOA 1ET7A 1IC0A 1EZLA 5B3SB 1OCOB 2BW4A 5I6KA 4QLWA 4A67A 1W6WA 4BXVA 2R7EB 4AI7A 1BAWA 2ZONA 3NJHA 1L9OA 4P5SA 1VLXA 2DV6A 4X4KA 3UAEA 2ZWNA 3FS9A 4KNTA 4HCGA 2XXFA 5F7AA 1ILSA 2IDFA 3FQYA 4KOCA 1NIFA 1J9RA 2HX9A 2FJSA 3NT0A 2OV0A 3NP3A 1JZEA 2Q5BA 1NPJA 1PLAA 3D12B 1EHKB 2UXTA 3MX0B 4YSPA 2PP9A 1ADWA 3BVDB 4GP8B 1CC3A 3AG1B 1IBYA 1PLCA 1V55B 5B1JA 4E9WA 3SQRA 2W88A 4GYBA 3OMAB 5I5IA 1JZIA 2XU9A 4HZ1A 2J57A 1XB6A 3ZIYA 3AY2A 3S8FB 1A65A 3SBRA 5B1AB 1SDDA 2BWIA 4HAKA 3UADA 4DP5X 3RYMA 3KW7A 2EIKB 1XB3A 2XYBA 6PCYA 3WKQA 3AG3B 4MFHA 3ABGA 2YAHA 1NZRA 5F7BA 4A2FA 4PAZA 3CVCA 1WA0X 1NWPA 2XXGA 3ABLB 3HEIB 4YL4A 2FT7A 3KW8A 2GI0A 4KO9A 1URIA 2E86A 4G71B 2FNWA 2VM3A 1GS6X 2ZOOA 3FQ1A 1BYOA 2HX7A 1OCZB 3FYIB 3PPSA 1B3IA 4P5RA 1NIDA 1A3ZA 1ZDSA 2NRDA 1ZPUA 4A68A 2YAFA 4FA7B 1F56A 4G7QB 1PNCA 1FFTB 3BQVA 4L0PB 3ZX1A 4UF7C 4YSAA 4ENZA 1BEXA 5D4JA 5AFAA 1WA1X 2GBAA 2QDWA 3X1FA 4PCYA 1W6LA 1AS8A 1KDIA 1UATA 2Q9OA 4DP8X 3QJRB 3T9WA 3GYRA 3X1EA 1M9WA 3FU8A 3UAAA 2DYSB 3QJVB 4M3HA 3N2JA 1PNDA 4HHWA 3AW5A 2HXAA 1YLBB 1IUZA 4DPCX 4YSEA 3ABKB 2FT8A 4WKXA 2VSKB 4DP0X 2R7EA 4F2EA 3PAVA 1PMYA 2IDTA 1ASOA 2FQFA 1PZBA 1J9QA 4HHGA 2GC4C 1BQ5A 3T6XA 1ZIBA 4BXSV 2IDSA 3ERXA 2I85A 4DP4X 1MZYA 2H3XC 3CG8A 1WS8A 3CVDA 2BP0B 4KO6A 3T71A 2VW7A 2XUWA 2CUAA 3UGEA 2ZXWB 4BWTA 1AACA 2VN3A 4E9SA 3NYKA 2XV2A 1MG3C 3L45A 1IKOP 1PF3A 2RACA 2GSMB 1X9UA 1QNIA 1SFDA 3QPKA 4DP7X 4YSOA 2PPFA 5B7MA 2PLTA 1A4BA 4TXVB 3OM3B 1WS7A 2AVFA 3UACA 1JXFA 5LDUA 3QJSB 1NIEA 3WI9A 4BWWA 3PAZA 4F7KA 4YSDA 2BO0A 1SNRA 1N70A 3FSZA 3TASA 2VW4A 3OD3A 2PPAA 4KO7A 1KYAA 4HALA 2GB2A 1BQRA 4JHUA 2IWEA 2IWKA 3EHBB 2WO2B 2XLLA 4E9TA 1PLBA 3JT2A 1GY2A
chains in the Genus database with same CATH superfamily
2GTQA 3TEWA 4DW2H 4P5MA 4EI5B 3G6JE 2BNQA 3VSTA 3LH8A 4G8GB 3WNJA 4G70B 2A0LD 2WBJB 1JGVL 1KENH 3SCMA 5GS0H 2D7MA 2YD4A 3MKGA 4AWJC 5I0XA 4XHQA 3T08A 4ZZKA 3KLQA 4C56A 1JPGA 1UFGA 2QSCL 5H4YA 4HT1H 5GZNA 3FH8A 4RMWA 1OM9A 3QHZH 5GGUA 4ZMYA 3FTZA 5C70A 3MLWL 2VLLA 3MMEA 5CZVL 1NDMB 1MHCA 1QPXA 1I31A 2G9HB 5E8EB 1KBVA 3MRKB 1CD1B 1XVSA 5LBSA 3E6FB 5F6IB 5K9OB 4H26B 2NY3D 1I9JL 1QPKA 4G1EA 4LQFL 4N0YL 3VRIB 5J57B 2RAMA 1QTYT 4ONFL 1AZZC 4IOSD 3RX9A 1F3DH 1YMMB 4BGLA 5BO0D 4FFZL 1JERA 1BOGB 2ARJB 2YLHA 4HWBA 1DVFA 3FL7A 1Z5HA 5IFJB 5EU5B 4HOZA 1LDPL 4IRJC 4KQ4H 5B4MC 2ESVB 2DIEA 4A2GA 1O6TA 5EN2B 4NZRL 2B4CL 5HJBA 5A7EA 3TBCA 4H8WH 3GTTA 1CU4H 2BNRB 2NY2B 4HUCA 4O4YH 1WAPA 4GBXA 4J3SA 4XR8C 2G30A 4W9ZA 4K94H 1YEDA 1YEIL 1T20B 1AZCA 1XB8A 3T2OA 3L4CA 3BE1H 4B9JA 4KJWC 3I6LD 5E1AB 5EBMA 1YY9D 3ALXA 3EDEA 3LN4A 4PS8A 4HD9A 4AJVA 4BRVA 1F6LL 3UTTD 5A16B 5ISZB 2F2HA 3P1VA 3WLBA 5C08E 3TEZA 2ZOLB 4JPKH 3KAAA 1H15A 2QZQA 3QISA 4XN8A 4NHCH 5DZOA 3G04B 3K6SA 3X11A 1EMTH 5EUKB 2PPDA 3TVMA 5AYUH 1S6NA 2R1XA 5HGAB 3N55A 2FK9A 2GITB 5EPMB 4PW9A 3BAEH 4LCWD 2NYYD 5F9JA 5E00A 1RZJC 1S78D 1GYAA 3GWJA 2XN9D 2Q76A 2Q8AL 1AO7E 2FJGB 2NSQA 2C9VA 1UXWB 4JAMB 1QLEB 1SMOA 4GEIA 2EIMB 1R6VA 4N8CL 4OM0H 2HVJB 4PRIB 4WI9A 4JKPL 4UOW0 4F27A 1IE5A 3CH1A 4YWGL 4FG6D 4JFQA 3B2VH 4PG2C 2F08A 1OCCB 4YHKH 2VZOA 3QG7H 5T5FA 4TUJA 3T6ZA 1CG9B 1RJZA 3B2UD 3GKZA 3I2CL 3LMJH 5EOTB 1QACA 4MJ6B 4RAUB 4BDVB 3EYQC 3QXDB 5IVXF 1WG3A 2HT2D 4N2MA 5C0CA 5LGKA 1GYWA 1WIOA 4D0BA 4GJTB 1ZANH 4PJ5B 1BX2B 5LHDA 5C97A 3TYFA 3HR6A 1FA4A 4L8DA 1G5GA 5HY9B 4M56A 1LP9F 3ARWA 3SYAA 3IDUA 2N7SA 5I1IH 1TCRB 1KWGA 1FE8H 3MOAL 3MSPA 2OCJA 1OAUL 1K8DA 1RHFA 2NZIA 4G42A 5JPMA 3S88L 4XVSH 5CEZD 3QZWA 3VXSB 4J28A 4YH6A 1IBHA 1ITBB 2GVYA 2ATPA 2D3VA 1NWOA 3ESOA 4M1DH 3S36L 2PWGA 1QRNB 4UM9D 1BQHG 3QWRA 2XHNA 5AWNL 4P2OB 5AW5B 4WV1B 5C0BB 1NANI 4KKBD 3L3IA 1YPZB 4KZDH 1L5GA 4EXPX 2VJXA 4KRPC 1PX8A 1A4JA 2VB5A 4N0CD 1AY1L 1CYXA 2V5SA 1BBJB 3IN2A 1CFMA 5CIPH 3KCPB 2X6CA 4ZFOL 3NSYA 1L9PA 2X4NB 3HAEG 5GGVH 4BK8A 2KZ1B 2ED7A 4Q9RL 3DC0A 4A1RA 1OCWL 3MLTA 4X4ME 4G6FB 5I8KH 4JO8A 1MIML 1BZEA 1I3GH 4LCUB 4ZBJA 5KSUB 4CADB 3U1PA 3PIQB 4OCYL 3VFGL 5DHVB 2DH2A 2IALB 1NAMB 3HG1A 2B2XL 4YK4B 3UTQA 3CHXA 2NX5D 4B97A 4DAGL 1ZT4B 1UZ6F 1RUML 3D0LB 4M1GL 4QF1B 4OZIA 2RCSH 4PP2B 1LO4H 2FGWL 1K3IA 4HD5A 1I1AB 5EV7A 4IOIB 4AGMA 5TDNB 4EI6B 4Z7WE 1Z2KA 4BHUI 2GEEA 1OIOA 3KGTA 4U6TA 4NQCE 2YGOA 2JCCA 4AW4A 2KHAA 3SPVB 4K9JA 5ERWB 3DSNB 1EXHA 1CFVL 4AC4A 4HP5A 3RWJB 3C60C 1MUJA 5F8RC 1OGTA 4FMFA 1NBVL 3UTPD 3T1WA 1M3JA 3M6DA 5T1JA 5FYLH 3QVAA 1KCWA 4BA8A 2UZYA 4C8XA 1I9EA 1SYSA 1CLOL 2DI7A 3FT4B 5GGTA 1HIML 4X6FB 1EEZA 5E70A 1SF3A 2GTZA 3PLYA 3CXDL 1L6XA 2CDEB 1BZ7A 3EYSL 3FTGB 4JZJA 1ZAGA 2UY6A 5DJ0A 1U9KA 2QDVA 3IXAA 3VE0B 5C6TL 1NM4A 1GS7A 3QFJD 2PYEE 2WCGA 4HIHB 5DA4A 4IU3B 4HMEA 4ANXA 4K5NA 5TF0A 2YWYA 2ROYA 5ICUA 1OP3K 3FQRB 1NDGB 4Y4KD 1LD9B 1SM3H 5GS3A 3LIZL 4U6HA 1VF5C 5C0FB 4GXUN 1XCQB 5KSBF 1HHJB 1NBYA 1J8KA 3SQOH 1IAOA 3IF1A 3MA7B 4K15A 3GMNA 4JB9L 3L1FA 3BDXA 4ONHB 1UD6A 5CJQL 4WAFA 1UJ3A 3D5OF 4WJG3 1T80A 3A23A 7PCYA 3V9CA 2BXYA 2R4RH 3A47A 5G55A 3VGDA 1WISA 1EAPB 3NDYE 4MDIA 1JHLH 3CFCL 4U1JB 3Q48A 5HGDB 1CGYA 5AW8B 3QDGA 3U7YH 3UEQA 3OAUH 4OAWA 3OB0H 4I3GA 2PCPB 2J21A 5EC1A 5K1VA 1QAWA 4F8QA 2HKHL 1T2QL 5J6GA 3FKUS 1X5GA 1BXAA 3B7YA 1WBXB 4ZK8A 4E2OA 5DJDB 1IGCH 4YAQB 1HH6B 2G2NA 4JFZL 2RFXB 1E2VA 2UX6A 1OTUC 3L95A 2CM5A 2APSA 2Y1VA 1H6EA 4P3DA 4LPVA 4WU5B 2HRPH 1J10A 5KW9H 3HNVL 4CSTA 2J12B 3PWJB 3LEVH 4LLWB 3QCUL 3T3MB 2YD1A 4EI5D 2ZONA 3HZKB 1E4KA 4KNTA 4G8GD 4OLZH 4PP1C 5C8JA 2WBJD 4UV4H 3MGAA 2A9NL 5AVWB 5LAXB 5DTFB 1N5YL 4GG6F 1EEYA 3UO8B 1MFAH 4WUKL 1T5XB 5DHEA 3UXFA 1GW6A 1RJYB 4QHLB 1RERA 4NUJA 2DL2A 1UJTA 3U1QA 2VWEC 3L4VA 3D39E 2Z6FA 3V0JA 3L3GB 3VXNB 2HJFB 1RL1A 2H8PA 4NM4H 1KSRA 3ZSSA 3JWNC 1ICTA 3NBNA 3SQRA 5E8NA 3OF6A 4L9LC 4D8OA 4LNRB 1WC7B 5T3XD 2DQIL 1RURL 3EFDH 4J3OH 3S8FB 4CC4A 3QAQA 1L6PA 1YMMD 3LPFA 4K9EC 3DNKA 3CFDA 3NAAL 3UADA 4WWKC 2ZAGA 5FGCB 4PJDA 5D9SA 1G4RA 3KHOA 5D1QC 1QKZL 2RTTA 5CXPA 2Y2YA 2GIXA 2C4FU 3AG3B 4L2YA 3UCRA 4DVRH 2ESVD 2Z8WC 5F7BA 1BF5A 3VMOA 4MD4B 3ES6A 1JV2B 4XPFL 2VR4A 3FUDA 5I0YA 2BNRD 2NY2D 2Y07H 4LEXL 2ATKB 4ODVH 4XMZA 3VFUB 3MV7A 8CGTA 4TV3A 2PUQT 2WQWA 4FNPA 3BSGA 2NSMA 3A67L 4HAFA 2QTVA 4U1GB 3SGDI 2OJZL 4CN1A 4Q56A 3RP1A 4IIQA 1SDYA 1XF4A 3AMKA 2BC4B 1AGFA 1Z9PA 2QVTA 4N2IA 4P5RA 25C8L 4J23A 3FUJA 4OGXH 5IWLC 4NEHB 1BJ8A 3ZDYF 5ISZD 2ICWB 5E99H 3FQUA 1IEBA 5CIPA 2X89D 4ES8A 2NRDA 1GHFH 4H8HA 5K59E 3T1FB 2DMKA 5LWYL 3VXMA 2ICEB 2CGZA 1PLGH 3ZE1E 4I3SH 4Q6IC 1E4XH 1E43A 3QNFA 3VI3E 3ECQA 2OYLA 1S5IH 3B5HA 3D85A 5KAQG 2AQTA 1RIHH 3ULVD 4WK0B 5H8DA 1MVFA 2ADJB 5AFAA 1WQVT 4R26H 5C0IB 4XXWA 3WEMA 2EUZA 4NGHH 4YHPB 3VXOB 1SJHB 4F8NA 4Q97A 2XZQL 3ZT6A 1JCVA 1S3KH 1CFBA 4WKZB 1FVCB 3CAFA 4LEBA 5F1NA 4IU2A 3M17A 4PRID 1FVEB 1CDUA 3IETB 3SDDA 2ENPA 2Y5TB 2CUMA 3MGTB 5F9WC 1LQBC 2W0LA 1TENA 4R7XA 1MCDA 3OZ9L 3KPSB 2VKXA 3N43B 1QVOB 1HEZA 3HLAB 3ERXA 2I85A 3MLVH 4S1RL 4DP4X 3F05A 1C08A 2BY2A 2X9XA 4RMRA 3TH3T 4XC3H 3CWGA 4L5FH 4APQB 4PJ5D 2FAUA 4FXTA 3JTSA 5IB5B 3BVTA 4AQOA 4N85A 1GJWA 1BW8A 1UXSA 1U8IB 1ZHLB 4P5KB 1SFDA 2PETA 4NC1C 2V17H 4GQRA 2NT1A 3H53A 1NJ9A 3STBA 3KXFE 4X7SL 3V0GA 4O51B 1RIUL 2JTDA 5BRZE 2WK2A 4LF3B 5LDUA 5L8JB 2EUXA 4LAQL 4NS0A 3RILA 1AP2B 4HFUH 4O2EA 1D5ZB 1XSOA 5CP7B 4P2OD 4RLDA 1QLFB 5C0BD 4UAOB 1MW1A 1Q4NX 1OM3L 2FX7H 2XKUA 5HDWA 3GSNH 5L7XH 4OZIF 1XO8A 43C9B 4NLAA 4HWBL 1DUZB 2AK4E 2WXMA 1HWGB 2EDNA 4OLVL 2UXFA 3UJJH 2JCCF 5JHDB 1T22A 3L6FA 4G6FD 1T7ZA 2GQHA 4D7BA 2K8MA 3HAEH 1GA2A 4HWNA 3CZFA 4DUWA 3RU8H 1XD1A 3SKNB 3OLGA 3FFCE 3GUFA 4KK9C 5F89A 4UILL 4Y2DA 5KBMA 1NFDA 1QBML 3JWNG 4TN9A 1T4KB 3PQYE 3RHWF 1UH4A 3S5LA 3F58H 2YPKB 4MVBC 4DGYL 5IGXH 4ZPVB 5DJ2A 4FTDA 4H7VA 1CICB 1I1AD 2I5YL 1P5UA 3Q2WA 5LNDA 1AGCA 4M6MH 3VFPB 1HHGB 4IBZA 1N59B 2WKLA 4J8RB 4UTBL 5DRXA 1FNGA 3L7FB 4PYGA 3LV3B 3BD3A 5HYJA 1D2PA 4OCSL 4DEUA 5DK2B 4U0RB 1UT1A 2KMWA 4Z3TA 2XTJC 1VHPA 1FLRL 1FFPA 1NCAH 4BK4A 1G7JB 2X9YA 3BGMB 4L3EB 1EXUB 2ZICA 3U9WA 3U2IA 1IBGH 3HNTH 3KS0H 3RX8A 2ZPKL 3U30C 4XCFL 5BO1H 1SY6H 4RGNE 2HG5A 2WLLB 3WY1A 4RESB 2W0PA 1KUMA 2IG2H 1EHNA 3ARPA 1HHIB 3EYFA 5F88B 4AVJA 1GYCA 2MQCA 3ZHKA 1NICA 4G5AA 4S1DD 1VRSA 4A7SA 4BELD 2MIZA 2CUHA 2V9TA 1KIRA 2AANA 5DJ8B 2XNAA 3KZ8A 4QAMB 4XXCC 3L8QA 1GC1H 1LMKA 4B9CA 4HXAH 4OI8A 5B8CA 1BZDA 3FNKA 1L3WA 3MUZ1 1LE5B 3FOLB 3QCVL 4XPAH 3RRQA 1KIQB 2PO6C 1KELL 1YN6B 3O3BB 3K81A 4OZFB 2NY7L 1UUSA 1HWHB 2E7BA 3NIGE 3P4MB 2FEDC 5FUZL 2X4SA 4QWWC 2FL5B 3A6BH 4NZ8A 3IMBA 2HYMA 4YZFF 3BKJH 4GIAA 3BWZA 3IJEB 3LSOA 3HUJE 4PRBB 3Q13A 5DO2C 3T8MA 1J1PH 5JDSA 3VFOA 5HYQA 4DKDC 2J88L 2ZYSA 3NEEA 4WK4B 5GJSL 1OL0A 3PP3K 3PWLA 1GMIA 1MFUA 5C86A 3D0VB 3GPEA 1S8DA 1NCCL 2GAZA 2N1TE 4JRYB 3LN5A 4TLUA 1UQSB 4NYLA 3DHPA 1X5YA 1XDTT 1ZDQA 5JYMA 5C92A 4PMFA 4NSKA 3FCTA 3CV5A 5JIHA 1HCZA 3B9DA 5D5MA 5J6HB 1FZOB 3U4BH 5H94B 1A14L 1J05A 5EU4A 4BE5A 1J0YA 3QXTA 3X1NA 2LVCA 2DLTA 4Q6KA 4XNQB 4O5LL 5B1CA 5DRNA 2VN5A 3SKOB 3SODB 2IEPA 3OXRA 1F3JB 2PW1B 1F1DA 4BKLB 5KG9B 4NAJA 4B60A 1C5DA 3UJIH 5CR8A 2H5UA 4YMPA 5DHDA 3LHAA 1JPFA 4MA7H 4GY4A 3WUWB 4NKOB 2F68X 3F85A 4FZ8L 2ZUYA 1NEUA 3STLA 5ABZA 1JK9B 2R8SL 1A7RL 3WEXB 4PJIB 1Z7JA 3UO1H 2VDLL 3BZ5A 1O6VA 2ED9A 3MUGB 3SE9L 5I76B 3ATEA 2YN3A 3NGBB 4WGWB 4XMWA 5EZLA 5CLTA 2ZX6A 1QUNA 3KWVA 1SN5A 5CAYB 4UYQA 1BG1A 4KK6D 5ACZA 2DQ6A 3GI8H 2V2WA 1PZ3A 4QRPE 4IRSC 5IV2B 9PCYA 3FQ4A 2Y3AA 1IM3A 3NK4A 2MKLC 3CDCA 3FW6A 4L4TA 1IGMH 1Q94B 3BQUC 3LNGA 2DTSA 1UM5L 4JQXC 3WD5H 5D7KD 3HPLB 4OQTH 5DMKB 2P4AB 3SDYH 1MCKA 3AG4B 4DW2L 5IMMA 2Z31B 4M8QB 5FO9A 2W65B 5J89A 4M1CD 1MH5B 4KRNA 2VDOB 1KENL 5F6HI 3ZL4H 2G2PA 3N1PC 4MMZB 3KNBA 4BCYA 3N9GL 4KKNA 2WINB 3QHTC 5I1AA 5TJWK 1JS4A 5E8PB 4LK4A 2P5WB 2X3BA 2EO1A 3EH2A 4HT1L 4PJGF 2O61A 2ITFA 5D55A 1BZ9A 1PKQB 1XR8A 1T1WA 3A24A 3QHZL 2ZKXA 3AXHA 4OM1H 1KFGA 4NZJA 4JFDE 2MRYA 3RGVD 1IE4A 3CMOH 2Y25A 2C1OB 3AM8A 3BZ4A 5F1OB 3QPQD 1GKOA 4GRWF 1I8IA 4NN6B 1FH5H 4CU7A 5J9PB 1KBBA 1JF1B 3GSNA 4OKVA 3BLPX 3P11H 4GRMA 2HTLD 2O26U 3FB8B 5MERB 1KCRH 3O4LA 2PCYA 1N8ZB 1XIWB 4BH8A 5IB2B 2AQ2A 4ZFQA 5F3HA 2K9FB 4HUVA 3FUMA 1SXCA 4KQ4L 2X10A 1IAII 2JXMB 3QQ9D 4PFEA 4Z7VA 5B39G 3HAEA 3P4LA 5AG8A 4X5LA 3W11D 5IW1B 4HJSA 3FSVA 4P07A 1RXLA 1T04A 1JXKA 2CSPA 3CQQA 1XGQA 3G5XA 4OY9A 5I19L 2VL5B 3FQXA 3KM2A 4UM8B 1ESOA 5TD4A 3BE1L 1W91A 4H8QA 1VADA 3MNWA 4PRDB 4OCLC 2EDLA 3T6VA 1WA2X 1RZGB 4EOWL 2CKBA 5DUBB 3MLZH 3U46B 3C8KA 4TQPA 3VFNB 4X9GA 3OKKA 4GAJL 2WNKA 1HHHA 4JPKL 1MFMA 2X70A 4XO9A 4BFBD 3W37A 2QQLH 3H9SD 2CLVB 3QI9B 1TUPA 4XC1L 1Q9LA 5A2AA 4Q0XH 1EMTL 1I8UA 4Y19B 4APQD 5AYUL 4JY6B 1LWJA 1DQDH 4IRJA 4ZFZB 1SY6A 4LBEB 3VCLB 2YAMA 4OGAD 4Z76A 1CDYA 1SGKA 2GJZB 4P23B 2DICA 2YRLA 4R3SA 3HRPA 2AF2A 3LZOA 3EYOB 4FQLL 2B59B 4M4RB 1A1MA 1JZHA 3IDYB 2LOEA 4Y4FC 1ACYH 3KPPB 3B2VL 1WGOA 4FP8H 4QRQB 1S46A 4YHKL 4ZO8A 4HUUB 2OJEA 3LMJL 1MI5E 3A6CH 2HFFB 4QRFA 4LSQH 2DH3A 4K7FA 1CIUA 4FL4C 5CZXD 3WFEH 4MXQC 1ZGLM 4AK2A 3O0RL 1ZSHA 1ZANL 2NR6C 4JJOA 2J20A 3HZ3A 2XQBH 3UTSE 4ZSOB 4JKLA 4OCRH 5MEOB 4N2KA 5I1IL 3DBSA 8FABA 3TPUB 5D2NC 3R06A 2TAAA 1FE8L 4IS6A 5D7JC 3TFKC 5LVEA 3HHSB 4HHAA 1IGJA 5IROD 1JL8A 1RLBA 4GG8B 4XVSL 5C1MB 3O3EA 3BEWA 4EUPG 3N0PB 1JZEA 3QO0B 2Q5BA 4RNRB 4XWOC 4YDKL 1YN7A 4J2XA 4M1DL 2ZSWB 1LEGB 4Y8DC 2PP9A 2EEFA 4W9CC 1CBVL 3PGCB 1ORQB 1OALA 4BFOA 3JWNH 1CICD 2C7UB 4LDLB 4RDQF 1MEXH 4LHUG 5EUOE 3WO4C 4ODSL 4BSVA 2F1EA 4PG2A 5EF1A 1RULL 4HZ1A 5T1DL 4KZDL 5ALCL 4N25A 3DIDA 5AVZB 3AY2A 3VACA 4RFEB 4L0ZA 3RPIA 3SBRA 1SDDA 2BWIA 1TVHB 5GGVL 2HFGH 4K9EH 2XWTB 3A0OA 4L3ED 2EIKB 5I8KL 2XZZA 2KLSA 1I3GL 1H0DB 3WEOA 1MIEH 3IFPA 1D5XA 3ABGA 3ZE0F 1FV1B 3MPCA 3OMZA 5EO0B 2ITEA 3BPLC 5D71H 3RVWD 3DWTA 5IVOA 3F62A 5EOCH 1ZLUK 1LO4L 3N42F 4JFFB 5EBGA 4GKZA 1RZFH 1G7QA 1N6VA 1QSFE 3THMH 3GJFH 3K6OA 3GRWH 1CZ8H 3G5YA 3H9ZA 5DQ9B 3DIFB 3LRGA 1UM6L 3PPSA 4MNQE 1LEKA 1JWMB 1KZQA 3WNOA 5SWZE 4HUNB 3S37H 4LRNH 4QHNB 5IHLB 1IFHH 2J1KA 1CGVA 3MRGB 3KS0J 4OLWH 4MD0B 3RL1A 1FNSL 2V7HB 1WFOA 1QBAA 2P5PA 4OQTA 1KBGL 3UYOD 1ZPUA 1T3FA 1UFUA 3R1GL 4B53A 2XBTA 4XMKH 3DSFL 4X7CC 4GT7A 3H55A 4YSAA 1FUNA 4RWYH 4KHTH 4ENZA 5C0AE 1F4WL 4XBPA 2GPZA 1MCSA 1ZVHA 2A6JA 2EIDA 2GBAA 1C9SA 4WHCA 5ICXA 4IEFA 5GIRB 2L7JA 4JRYD 3NRPA 4NQDB 4Y5XB 4NQUA 4UQ3B 3QJFB 4HH9B 4TSCH 4CVXA 5FCUH 3IVKB 2KQMA 2J1ZA 2VSKB 1SM3L 4M62H 3ML8A 3NCWA 1ODAA 2NNFA 2Q6WA 2V2XB 2LE9A 2IDTA 1J9QA 2YLKA 1BQ5A 2ZP0T 3SQOL 4BFGA 5DGQA 5HJDA 2OK0H 1HKFA 1DQIA 4JG5A 5HGHB 2LT9A 3QT2A 3QJZA 3V4PB 2ZT9C 4JY4A 1U36A 4D0DA 4HLJA 3QNYA 4EIZC 5DK0A 3O41A 3ZUCA 3VI4E 3E2HB 1E3XA 2R4RL 2A83A 2CXGA 4URKA 2FO8A 3C5SB 1JHLL 5EBWA 5GZOD 1DQQA 4FI8A 4RGOH 4U6XA 1WS7A 3O81A 3OAUL 3VU1A 4U6YA 5IB4B 1JF6A 4U2YA 5ADOH 1AXSA 3HE7B 4LFHG 2EEAA 3D06A 4ENEC 4TLKA 2I32A 1QSEA 3BUQA 4G9FE 2A74B 1KYAA 2IWEA 3TBWB 4ODHH 2IWKA 1IGCL 3M1OA 4OF7A 3MRCB 4UAHA 5F0LB 2G5BB 2XN1A 4L48A 5KW9L 4KVNL 2IDCA 4M6NL 3LEVL 3SPCA 1LILA 5EH1A 4QCIA 2Z31D 4XVOA 5AKVA 4OLZL 1DSWA 4S0TD 2PABA 3MCKA 5E2WH 4UV4L 1A5FL 1CGUA 4TOYL 3OKDA 4PV8A 2GUOA 1MFAL 2GJPA 3IGKA 4MKTA 1F00I 3IPEA 1BD2E 4AGQA 2HVKA 5SWSE 4YL9A 1RI8A 4UT9H 2XWBB 4JREC 3AY4C 2VC2B 3OAZH 1NFIA 1EGJH 2JTYA 4NM4L 4A7QA 4F91B 1AZUA 5C07E 5B38G 1WAAA 2UWEB 1ZEAH 1EUTA 1OF2A 1OGAD 2ZXDA 2DQTL 2DWDA 3LEXB 2APVA 1TTBA 2V8MA 4LAJH 5DZAA 1XIWD 5I1LA 3KLDA 5INCB 4HZLB 5ITFA 4J6RH 5EMYA 2IC2A 3MRQB 2X4QB 4DVRL 2VITB 3POCA 4NDMA 1DJXA 3K4ZA 5FW8A 5IMLA 1N4XH 3F7YB 3GBEA 1UH3A 3ZVVA 5SX5K 2I60H 1FVDB 2Y07L 2ZXEB 3HG2A 4I87A 4ODVL 3FQ2A 3LNHA 3EJYC 2CO7A 4OIIH 1J0IA 4GMTH 1BLIA 4N9GA 2FO1A 3MJ9A 2QSQA 3U0PA 4QYAA 4AIZB 4Z0XA 1AHMA 3TBTB 1XH2A 3FQNA 5D2LA 4MX7A 2VMFA 3GXDA 3ZYIA 5EZOH 3UGXA 5BS0B 1IC5H 2YUWA 1H8LA 1NEZB 1MLBB 3IMUA 4HEMA 1KULA 5IMKA 3KWXA 4LIQE 5K9QI 1GHFL 3QI9D 4H0HB 1KG0B 1LGVA 1PLGL 2F8IA 4M5TA 1BVKA 4I3SL 4WWKA 2WBKA 4HQQL 5DZNA 1E4XL 4EVNA 4GKNB 5D1QA 3RKDC 4Y19D 1FI8C 1P1ZB 2BP8B 2Y69B 1RPUA 1E9QA 1S5IL 1HE7A 2L7EA 5FB8A 1OSZB 1RIHL 4X6EA 4FQPA 3NCMA 2YPVH 4G7SB 2AI0H 3BWUC 2FJFB 4P2RB 4X9FA 5E8OB 3MNZA 5KSAB 2FSEA 3Q0HA 4YHLH 1MCPL 2WMPB 1S3KL 1HFUA 2P5EB 1ETA1 1FL3B 4P23D 4W4NA 4YNYA 3VXUE 5HPOA 5FO7B 4HV8B 4M03A 5AL0A 4H20L 3GJFA 3II3A 2W38A 2WOBA 4ZS6D 3MYZA 1RH8A 1X3DA 2DWTA 3GRWA 4P2QA 2EXYC 4PS3A 4S10A 4UANA 5F0PB 1A02N 1SYVA 3H4HA 3Q2LA 4AYID 3CHRA 2AXGA 1VA9A 4DOHB 5FOBB 15C8H 3LYRA 3BGAA 4MXVE 2Z8VC 1B0RB 1Z5LB 5FLVA 1MLCB 4TNFA 5A2CA 2FWLB 1NCIA 2X4PB 1OLZA 4L5FL 4N2NA 3L1OH 4XX5A 5ETUA 5DD3H 1FSKC 1HILB 5EHFA 2WZ6A 1OEZW 2BWDA 1P9MC 2XPGA 1ND0B 1RHHB 3NJGA 4MAYC 4Q6IA 2R27A 5HI3D 1YEKH 1RZPA 2EEXA 2V17L 2EUWA 3VGAB 2HTKD 3EJCA 2E5EA 2LLGA 1OV8A 2ICES 4YGVA 3KR3H 3QDJD 3GGWB 5FUCC 4PJEE 3UAJD 3BAIA 3U36B 3DTXB 1L9RA 4HFUL 1KTDB 4DQOH 4EUPH 1CT8B 2WLJA 3BRFA 2EKSB 4RBPH 3QG6B 2A6IB 4OZGA 2B3RA 1PU0A 2BIQA 2FX7L 3FN3A 3HVNA 3GSNL 5AVVB 3ZDZB 4BH7A 5IUSA 4AGLA 5L7XL 3GBNH 5EB9A 2E75C 2OL3H 2J6EL 4LSDA 2C3XA 5KYYB 2F54E 2VCOA 1EV2E 1H8SA 4FNSA 4X2UA 3UJJL 2I9LA 4PJFA 4R5TA 1J5DA 2VO5A 3BSZH 3QWOA 3EUDA 2CBMA 3TO4A 5D7IA 5EDSA 4EKXA 2PWDA 3R8BB 3RU8L 4B27A 1JWUA 5H35A 1MWAB 1KXTB 3TLRA 4AC2A 2FVNA 4PRNA 5T5NF 1ZV2A 4AMXA 1JPSL 3LKQB 2VSCA 4KI5F 4PJHF 1R3HA 1JV5A 4R5VA 5AVXB 1SHSA 4AXWB 4JDZA 3RVUD 1XBRA 4Y4HA 1KLGA 4M6ML 3AGWA 1RZ7H 3K1KC 3TGXA 1F2XK 3T04D 3DVGA 3TIDA 3L5XH 3V5KB 4JUSA 5JTWA 1LP9B 3ZKXB 4H25A 4U1HA 1UD8A 4DKFH 1NDTA 1ZOXA 2Q7YA 4JPVH 3VD1A 5FM4A 4EI5C 1AGEB 3Q7JA 1NCAL 3RTLA 2BOBA 1KXVC 2EYTA 5CD5C 1VGEH 2AJYH 4HJJH 3MACH 3PV7A 2WBJC 3ROLA 3MR9B 1PAZA 1AOHA 4EBQL 2YGVA 4FOMA 1IBGL 3HNTL 3ULUD 1DEEB 4PY7A 1ZXQA 1MCLA 1SY6L 5BO1L 4F7PB 5EOCJ 3GMLB 4PBDA 1ES0B 1N2RA 4PQXA 1JDAA 2AITA 4NERA 4XVTH 1KJVA 3MLRL 1FIGL 3GS4A 4Z8FH 3O0LA 1YQ2A 5J1AB 3MV9E 4F92B 1VFBB 5IKCA 4TULH 4KXZI 4MGXA 5F6IC 1SOKA 1CDIA 5C0RH 5CJ5A 3KE0A 4HXAL 5EA0H 4UT9A 3OKMA 4I2XE 4GSXA 1EGJA 4QXUH 1BVLA 1HHKB 5FEBA 1OXYA 4KQ0A 4LMQI 3U1SH 1JN6A 4Y7OC 3W3BA 3A6BL 4TSAH 4WUUD 2K6YA 1Z5YD 1ZJAA 3BKJL 3ORJA 3DURB 3WN5B 5D2NE 3BAJA 4ERSH 4FADA 4P4KB 1JRHL 3BHBB 3A4DA 1IV8A 4CVZA 5DEFA 1ET5A 1AS7A 2CO1A 5AAWC 2NY2C 5I18L 2RB8A 4XX1G 1AZRA 3NRFA 4ODTH 3WE6B 1RZJL 1NC2A 3Q5TA 4UQIM 3JWOL 5D1XB 4CW1A 3NEOA 4HGWA 3TXAA 3CX5K 4GUPA 1D2OA 1AVAA 3UDWC 4NXSA 1PYWA 1MY5A 1PCXA 3EOYG 2YPLA 3MU3A 4KO5A 5BJTA 3HE7D 3P69A 1ASQA 1G7MB 3TTSA 5B39A 4XXCA 1AHKA 3BZFA 2FIRT 3NACH 4Z77B 2XN2A 4A2LA 2E8YA 1WEJL 3RVXC 4AM0Q 3DX7B 4A7VA 2PO6A 3V4LA 5K5YA 4AGNA 1EPFA 3RPKA 1MQ8A 3KPQB 2IF7A 1BWWA 3QQ4A 2LV4A 2XN0A 2X2IA 3PL6B 4FI7A 4HCGA 2E6QA 4MA7L 4LLMB 1OW0C 4U7SA 2FDBP 3O6KH 5F7AA 2WLNA 4Y9FA 2VT0A 2ZX8A 1TQVA 3RDTB 3GMMB 3UO1L 1BJ1H 1T66D 2P1YA 3ETSA 4Y8AA 2H1PL 3NIDE 4CKQA 3VWJC 4NZFA 5F9OH 2DM4A 4B0MM 2YPVA 5KSBB 2B9BA 3NTCH 4V1DA 3ZK0A 1QEWA 2PMZA 3ZMEA 5KOVC 1O9VA 2BFVH 2JKJA 2AXFB 2IOMA 3CNKA 4PJBA 3GI8L 2J5LB 3VFMA 4AJ0A 4E9WA 5DMIL 1D5BB 3FTYA 5CBAA 1I9RL 1ZA3B 3RTQB 2QJDA 3FH5A 3S2AA 4A7TA 1IGML 3HPJB 4ZQTA 2HN7B 4G8IA 3WD5L 3OXSB 4UIMA 1BAFH 3CFIC 4NKDA 4OQTL 4QGTA 4MMYB 1SMAA 3CZSA 3MRDB 1DSFH 6PCYA 1WUNT 3CVIL 3KYNA 4YHIB 1OHQA 1PKOA 3AB0B 4P5MB 1NL0H 3L9BA 3ZL4L 2BNQB 3DUSA 4F15B 2E4TA 1PG7L 3HIZA 3SCMB 3TBVA 3KG5A 5EZPA 2FATH 4Y16C 4C56B 1JPGB 1JNNH 3B3BA 5JW3H 3U7WL 4WV1C 4UBDC 3JV0A 1DFBL 1Q38A 4B0MB 3NABH 4OU3A 4CNIA 2WAQA 2AEPL 3MMEB 2NY0B 1MHCB 3HN3A 1VEPA 4OD2A 4FMVA 4EUPA 3LKNA 5IQNA 2ZAHA 2NNCA 1HYSC 5AG9A 3DROA 2XDHA 1FH5L 4G1EB 3BQUA 4JQXA 1FDLH 4TQIA 4TNVK 5BS0D 3P11L 4GG6B 4LHUA 3QEQD 1CFTA 1KCRL 1M4KA 4GLRH 2EDRA 3W5MA 1OZUA 4PHZA 3MFGB 1DVFB 3I6LE 3BSZA 3MXVL 4QJ5B 5ES4B 2HLAA 3SGKC 4PCYA 1W6LA 5BW7C 2H6PA 2Q9OA 1BVNP 3G6DL 3GYRA 3X1EA 1M9WA 3UTTE 5B3JE 3QJVB 1JDDA 4P2RD 3K71A 5KBPA 4GBXB 5DFVD 1JE6A 1VERA 2P5ED 3ABKB 4DP0X 1YEDB 1UA7A 3LNEA 4MZ2A 5KVGE 1R75A 1J5HA 3DK0A 4M93B 5EBMB 1GKEA 2OAAA 4LCWE 3MLZL 1U92A 4HK3N 5TE4H 3LN4B 3BESR 2MNJB 4KO6A 4LLDB 4QHUA 2ZXAA 2XN9E 2ZXWB 3H42H 4BWTA 2AK1L 2K6ZA 3IMSA 3JYBA 4QOKB 4ZOEA 43CAA 3WLBB 1WJ3A 4NX0A 1H15B 3UBXA 2FYYA 4OZGF 3E1F1 4S1DC 2PPFA 2WSKA 1DQDL 3K6SB 3X11B 1Y1DA 1MAML 2BS8A 3DHJA 3HC2A 4C55A 3TVMB 2WB1A 3V52H 2R1XB 1UEYA 3FHEA 3PNWB 2DQUH 2BSSA 3WDJA 1NIEA 4ALAC 4BWWA 5E00B 4YSDA 3K74B 2Q10A 1TQCB 3FSZA 5AZ2L 2OR8A 4MD5A 2Q76B 1MCJA 1H3VA 2L3BA 1CPUA 1KLFA 2NXZB 3ZKMC 1BQRA 4JPQA 2GYSA 1ACYL 2UUDK 3S7GA 1S7UA 1O5PA 3EHBB 4UU9A 4WO4B 1EERB 3UBFA 5MI0C 2ZSVA 3CH1B 3SGJC 2G4EA 2WWNA 3JT2A 4JFQB 6TAAA 3A6CL 4IBWA 3WFDH 2XBZA 1WFTA 3IJ8A 5DS8A 4YR6A 4TUJB 3M07A 3QARA 3S3CB 1RJZB 2B9AA 4OFDA 3WNMA 5CEZE 1MDTA 2BSDA 1SOQA 2DQGH 2ZG1A 4U4IA 4AL8C 1DYZA 2EXTA 2XQBL 5C0CB 3QUZD 4M7KH 3UG3A 4K8RD 1FFOA 2XIDA 4D0BB 1Z9MA 4WGKA 1MG2C 1WWWX 3TYFB 3QXAA 1ZRUA 2F1BA 3VD3A 1A6TA 4FG2A 2YEQA 4N9OB 3T0AA 2DYRB 1K8DB 5JPMB 4G42B 5HHOD 3BWSA 1UWEL 1RUQH 5IQ9A 3B4NA 3QZWB 4R7DA 3VW3L 2ATPB 4HG4J 1OE1A 3C9NA 4Y4FA 1B9ZA 5MP6H 3BUYA 5B21A 4KHXH 4ORGA 5K33A 1WZMA 1YEFL 1U41A 2WXKA 4FYRA 4LLAA 4AQAA 1IQDA 5HDBF 3BI9X 1M7IA 4AY0A 2IPUG 1TZIA 3US9A 1JNHA 2XQ0A 2NX5E 3PDGA 1L5GB 4X6BA 4PJ9A 1COBA 1XQ4A 3NN8A 1A4JB 4K9EL 1RVFL 3UPAA 4AKPA 2WQAA 5FO8A 2NR6A 1SLXA 1NFAA 3FJTA 1CMOA 3CVHH 4KX7A 5A6IA 4F5CA 3MLTB 1AXIB 1JHTA 1AHWC 1Q72H 4Q74A 1CDBA 1JPEA 4GNKB 3ZKQD 5EOCL 1N6QH 4KMTL 3UTPE 3HE6D 4X50A 3UTQB 4ZMNA 1F45A 2ENJA 1RZFL 4EZKA 2VDLB 4QHPA 4WEBH 1LYQA 3AABA 3ARDC 4LOVA 3THML 4OZIB 2NNRA 2O93L 1HK6A 4R97B 3WY2A 4LASH 2OMTA 2RALA 2AAAA 1INDL 4KNUA 4QNPF 4HJ0C 5E4IA 2JCCB 5GRVL 4UNTA 4YS4A 1LVEA 3S37L 4LRNL 2FJHA 1IFHL 3QFJE 1SLVA 2LHAA 4M1CC 2LQRA 1U3NA 2P80D 3FT3A 3QC5X 1MUJB 4I4WA 1OGTB 1IQWL 5IR1A 3COOA 3V0VA 1IC4L 5TTRA 4P4KD 3L81A 2UZYB 4XMKL 4LVNC 2N4IA 1SYSB 5B38A 3RG1C 4UV7L 3SBQA 4RWYL 4KHTL 1EHLH 1EEZB 3P2TA 3SBPA 3VG9B 4JZJB 5TDPA 4AH2A 3B56A 2UY6B 5DJ0B 3IXAB 1U0QA 1AFVH 5D1XD 1T89C 4ZW5A 1E9PA 4YSUA 2P7TB 1RK7A 5DGRA 3BCFA 4U1GC 2YGNA 1HU8A 2NY1B 2K6WA 5HJGA 4IBVA 3N44F 2V9UA 3N1QC 4GS7C 4R4BA 2MCPH 3PCYA 1EQWA 4LNVA 4TSCL 5FCUL 1JFQH 5HVGB 5FECA 2Q3AA 5E6IC 2Y0SA 3FULA 3WXWL 1A3QA 4GMSH 4PWGA 4DCQA 2JELL 3WE1A 4U6HB 2OK0L 2NXYB 1IGFL 1NBYB 1ZS2A 2UV3A 3ABMB 3TCLA 1IAOB 3DJZA 2GG1A 3D34A 4KX9A 1E6OH 3GMNB 2D8KA 2DJMA 4ZUVA 3PL6D 4FJ6A 5BRQA 5E95B 1UJ3B 1RCYA 1SLUA 3TV8A 3WTTA 3LXAA 4L8SC 2NTSP 2VL4A 3L4XA 3MJ6A 2WIIA 3RDTD 3QEUA 4E41A 1L9QA 2FH8A 1TZHA 1R46A 4MDIB 1GJIA 1HNFA 4L0YA 2IO5A 5ADOL 2A6DA 3QDGB 5E4OA 2DIBA 4OAWB 1CBJA 1OWRM 4CGUB 3D48R 5DMJB 4BSWA 1FAIL 3ME0B 3CXFA 5EC1B 5GGVY 5D7LD 4ZNEE 2EP6A 4PJAE 5J6GB 2JNZA 4G8GE 2D3NA 3VWKD 4MA1C 3G08A 3S6CA 1MCWW 2AGJH 5T8IA 1J88A 1JGDA 5DS1A 5E2VH 4PLKD 3SYOA 3L95B 2HH0L 1HQ4A 2AXWA 5JQIB 3W0WA 2I7SA 5JXAH 3DPBA 1A7OH 1I1FA 3T0WA 1OK8A 1V7MH 3FB7A 3KWWA 1IBDA 5E2WL 4OGQC 4M02A 4JZNA 1ACXA 2YN5A 4Q7DA 1TEGA 3SCMD 4OF6A 5C8JB 1UB6A 2JB6A 4JGUA 5T3XE 1EEYB 1T0PB 2ROXA 4C56D 2YA1A 2BWQA 1V3KA 1YMME 2X9ZA 4JDVA 4NUJB 4XH2A 5F1IA 4UAOC 5F9DC 5KTEH 4I1PA 2WZPA 1V27A 3LRSA 2NY0D 3HMXL 2H8PB 3GXFA 2H3NB 1W8NA 5GRXG 4EF3A 2ESVE 2E3VA 1YYMH 1YEHH 2XXCB 1ZEAL 3CFKA 5E8NB 1FC1A 1PD6A 1UCTA 3Q1SH 5E1QA 2BNRE 1DDTA 3ZKNC 2B0SH 3WFBL 3SZKC 5JXED 3IDNA 1GTFA 3SY6A 2KDYA 3ZOAA 3CFDB 3L2LA 4J6RL 4XO8A 4PJDB 1DVFD 2P8PA 3WFCL 1NH6A 1L7TH 2VQ4A 1N4XL 1Y6KR 3OGOE 3VRJA 4CGTA 4K71C 1IILE 3R18A 5EFIA 2I60L 4TQHA 1CXEA 1NSNH 3ES6B 5ISZE 2BY1A 2E6JA 2FEJA 4OIIL 2GK2A 4FFVD 3KGSA 4GMTL 3FPYA 3MV7B 4LCIL 3AY4A 1S9VA 3L3HA 4U0RC 4X6DF 3ZTJG 5I23A 1BFTA 4QYOA 4C59B 1O7DC 2A5UA 2GFBA 5IY5B 5EZOL 2Z93A 3QRGH 4HIXH 1IC5L 4IIQB 3ULVE 2BHFA 1AGFB 3UC2A 2EYSA 2K3HA 4ICXA 4MMXA 3KVPA 1I1YA 1OF0A 4PJGB 4QI3A 2UXVA 5AB1A 3FQUB 4A7GA 5JHLH 2HA1A 1IEBB 5CIPB 2IDUA 4PRIE 1Y07A 3DX8A 1IAMA 1XCTB 3IDJA 2ICCA 3VXMB 3CVHA 3ZLQC 4YSRA 4TQEH 2YPVL 2AI0L 4FQIH 3TVMD 1FGNH 4ZUTA 4GRWB 1N9PA 3D85B 4R4ND 3RVVD 1P7QD 2CRMA 5I5JA 2VLJA 3S3PA 5D70H 2JLLA 3ISRA 1E27A 4GAAA 3M46A 1L9SA 2NXZD 1N67A 3UH8A 5EEYA 4PJ5E 2WWKO 3K8LA 1IIIA 1J0KA 1S9YA 4TS6A 3P9LA 4IU2B 5F1NB 1MJJA 3M17B 1FFNA 4TSBL 3SDDB 2CIKA 4E42A 1OKEA 4CN6A 4L3CA 1S7XA 3UCQA 15C8L 2P26A 3EIFA 4YIQA 5C9JA 2ZWNA 3HR5A 2N7BA 1SPDA 3D07A 2HJKA 1HEZB 1WGVA 4QXTA 5E1IA 5DD3L 2R39A 3RJOA 5C0CD 1C08B 2GBVA 4LIQL 4U0QB 4AQZA 1OD7A 4PLOB 2GY7B 1YEKL 3FRPB 2FUTA 1U8CA 5C0BE 3JTSB 4G3YH 3APMA 3EUUA 1UXSB 5CNHA 2EXWD 1PTZA 2PYEA 1NMBH 1W72H 4PB0H 2FZ3A 4XMTA 4AEHH 3KR3L 3KJ4B 1NJ9B 3AG1B 3VDCA 1DFXA 2OFQA 4LBAA 4QMEA 5I6XB 4DQOL 1AQMA 1Q9OA 1VZIA 3RB5A 2Z4QB 2BZDA 4GKOA 5DFAA 2ZUTA 1YNTA 1E7UA 1OPOA 4O2EB 3QWRD 1ACCA 1WRFA 1YEJH 3TWCH 4BFFA 3GBNL 2OL3L 4LOUC 3CZJA 1OT2A 1EFXB 4YE0A 2BH0A 1UGKA 2DMHA 4FJYA 1UWGH 3VXRA 3BSZL 2ZX5A 1OSPL 2GT9A 5AKTA 5E7FA 1O0VA 3B8YA 1JZ7A 4K7PX 4D9QD 5K9JH 1P9MA 1T22B 1TZGH 4H0IA 4MAYA 3NGBC 4GFTB 3CZFB 4G71B 3N40P 4KX8A 5F89B 3OWEA 3TCXA 4Y2DB 3HG1D 4Z7UA 1NFDB 4G5ZH 1M7UA 4BFEA 3ZL1A 3S5LB 2A9MH 1FO0H 3G6JF 5DJ2B 1RZ7L 1TQBB 1DR9A 3BDYH 3PE9A 4W9DC 3X17A 1AGCB 3RZCA 3WL9A 4APXA 1K9TA 2YC1A 5DRXB 1FNGB 4DKFL 1EEQA 1JXJA 4G6JH 3N41F 1VESA 1VGEL 2AJYL 3P77A 2YAFA 3MACL 4HJJL 2JIXA 3LDBB 4P49A 5EF3A 3DTDA 4JZOA 4ZO7A 1FFPB 3ATAA 4WI0A 2XG4A 5D4JA 3V6FA 1U30A 3POHA 4H88H 1MKFA 2FNBA 2HG5B 5IW6A 5GRZA 2E7HA 3HI5L 1CQYA 3V0FA 4Z8FL 1G9HA 3EYFB 3ARYA 4HULB 4TULL 4KK5C 4PRHA 4YBQD 4Z7OB 5GS0D 2FT8A 1NLDL 5C0RL 3GXIA 3MOQA 4XCEA 3QZBA 2ZYRA 1KCUL 5EA0L 1TMCB 2G3XA 1JPTL 2XNAB 3SKJH 4FQHA 2XWRA 5DUPL 4NN6C 4QXUL 5B8CB 2DD8H 3P0YH 1J7VR 2HFTA 4JM4H 1L0PA 3HC4H 1FORH 3B34A 4N0FA 4XPGH 2D7PA 3UGEA 4TSAL 3K46A 2M1KA 2J7LA 2NXYD 3GXTA 3SQBB 5HHVL 2WUCH 4ERSL 1KXVA 2X4SB 5F7HA 2N7AA 3FTUA 1A6ZA 2DMBA 2GSMB 3CLWA 4Q4IA 2VSDA 3JTTB 4MJHA 4ZTPL 4F8PA 3N42B 2KKQA 1KPVA 3LSOB 1C1EH 4FKEA 4GSQA 1BZ8A 5HYQB 5JDSB 1YC7A 5CLWA 3T0DA 3S48A 5DEZA 1J1XH 2JB5H 2DMGA 3MRBA 3WI9A 4KJQC 3PWLB 4LVHC 4PBVC 3TASA 4BZYA 2I26N 4NRZA 1S8DB 5E8EA 2GAZB 3AWFA 3LN5B 3QDGD 1FC2D 4NYLB 1Q8MA 2DEWX 4G8FA 2WO2B 5K9OA 2IXQA 4NSKB 2N59A 2JQAA 3FCTB 3LKPA 2Y7QA 4GFXA 4YHOL 3T3ME 1J05B 2JI3A 5EU4B 2Y2TA 2HPTA 2ADFH 4Y9BA 2XSKA 4IHBA 2OBGA 4PIRF 1G6VK 2XV0A 1BOGA 5DRNB 4B50A 4XCYA 4AL8H 5AW1B 1F0LA 1WWAX 4ZOCA 2OMXA 1MCRA 3T65A 1JVLA 1YQVH 4IK6A 2H0PA 3H54A 3OBAA 1C5DB 4GO9A 4JDEA 3O6KL 3QUYC 1JPFB 3O8XC 5JHLA 5FKAB 2JKXA 1JNLH 1RSYA 3KVDD 3STLB 3S3BB 4E9LA 4J3WA 2B08A 5DS2A 4AUYA 5F1SA 4M00A 5F9OL 3IDYC 5D7KE 3NTCL 1MW0A 4JHBA 3UDWA 2Z35A 1M71A 2BFVL 5TH2A 5KN5A 3LOWA 4M3KB 5EZLB 5F7NC 4OD3H 4OF3A 4HG4K 3KLSA 2QSVA 3WUWG 5ACZB 5FGCE 1KCBA 2V2WB 4UOZA 2J4WH 5E03A 1IM3B 2EH7H 1TJMA 2WQSA 1BAFL 3FZUD 4L4TB 2QADC 1TJXA 1X5ZA 4MBRA 4MCMA 5D6CA 1EK3A 3OF6D 3S3DB 3S8WA 1A7NL 1DSFL 2E7DA 3HS0A 5HI3C 1B2WH 2D31A 3D87B 5HGAA 1I7TA 1I7ZB 5IMMB 3C8DA 1OW0A 4HIIA 5B22A 5IJBC 4BZ2H 2NY6C 5FO9B 1TU2A 3IK2A 1BZOA 1MREH 3IJYB 3KNBB 2YRZA 4FLHA 4EIUA 2FATL 4DK5A 3VTMA 4GQ9L 5F7EL 4PSPA 3KXFA 5FO2A 2Z9TA 3T4YA 3INUH 1JNNL 3VWJA 4Z7AA 5I1AB 5JW3L 2CUIA 1W72A 4WY7H 4W6YB 2NTFA 2O61B 1AG0A 3NABL 4A7GF 1BZ9B 1XR8B 5ICYA 1T1WB 2MKWA 1IGIL 4GSDH 2IGLA 4JK0D 3ARSA 3MV7D 4KY1H 2Y1AA 5DQJA 3BZ4B 4HKJA 2OA9A 1OT1A 1I8IB 3MOBL 2ZUQC 2ENSA 4HMDA 4C4UA 4Z7WF 4XODA 4OKVB 2WTRA 4GRMB 3MA9H 2DM2A 3PHOB 2VR6A 2NW3A 3IDGA 2P52A 4TUOA 2BINA 4K0OA 4HUVB 5F3HB 4Q2ZA 4FAAB 2XWEA 3MUHL 1EJ8A 3VXMD 3VXSA 5IP4A 3FFCA 4NLHA 1D3CA 2CE6A 4MZ3A 4K3HA 4Z7VB 4NN5B 3REVB 4GUOA 4MJ4A 4PJXE 4Y16A 1E28A 3D85D 3OJ2C 3H9SE 4MAUH 3FMGL 4A6YH 1OQXA 1XGQB 3CDGA 1YPZA 2CLZA 3KH4A 1FO0A 3FQXB 3T2QA 4E9RA 3NSFA 4Y1TA 1UM4H 5DEGB 4LPXA 1VADB 2A9BA 2B39A 2AJSL 3BKYH 3SDDD 4NQXA 4OLXL 2CA4A 2KH2B 3G9VA 4AM0B 4OF8A 2CKBB 1CXLA 3H42L 3C8KB 4LKXA 4PGZA 5I26A 4YXKL 3OKKB 4N0UA 4CC1A 5IB3B 3PREA 1HHHB 2EDHA 2X70B 4LCUA 4IKLA 1CGWA 1MXDA 1S7QA 3KLLA 4ATWA 5IHZA 4XP4L 1ILUA 5F44A 3QFGA 1K72A 1RLWA 2XKSA 1NKOA 2Y72A 1Q9LB 2IALA 4LSTH 5FYLD 3IPBA 1ZT4A 5ID1A 4FXLA 3V52L 3K8MA 1JTTA 3SGKA 2XY1A 3E9TA 4NI3A 1IZKA 2DQUL 4IRJB 5KVMC 2C8NA 2EEBA 4UDUA 1BMZA 1HINL 2ZCKH 2QPSA 1JF5A 5D1ZB 1YCSA 4DVBA 4Z76B 3Q5OA 2AEQH 5KBKA 3QH3B 4FQ1H 3G5ZB 4R3SB 3T8XA 2QHLA 5ERWA 3DSNA 3L3OC 2X0VA 1NPNA 1A1MB 4JFVA 3TBYA 5C0ND 1JD7A 1TXKA 2WKOA 2QKIB 2G0KA 1ZSDB 3WFDL 1JFHA 3FT2B 1KLUA 3QZMA 1FG2A 2OJEB 3LQZA 1TYJA 4ZOAA 1QFUH 3D4GA 4R7NA 1KIPB 2DQGL 4K7FB 4X6FA 1MJUH 2ITDA 1HOCA 3C6LD 5IVZB 2PR4H 1OANA 1DBMH 1IT9H 1G1CA 3VE0A 5JORA 5C71A 3AROA 5CKAA 2VN6A 8FABB 2AV1A 2QQQA 4X8CA 1W0VB 3R06B 4IS6B 4WCYH 4HHAB 1IGJB 1GS8A 4KMLB 5E9DA 1DVQA 2A74C 4XRCA 4DP1X 1DP0A 1RUQL 5FF6A 3O3EB 1H3TA 3LNDA 1O7DE 3BEWB 4RSVA 1F90H 4Y2DD 1IEHA 2H6OA 1UADC 1YN7B 3ZGHA 3FC8A 4L3EE 5HPMA 5MP6L 5GSVA 3S35L 4F7CB 4KHXL 1F3RB 5T3ZE 4WNSA 4KKAC 2VDPL 4BSVB 3ALWA 4UZSA 2TSAA 4ONHA 2EE9A 3SGEH 5I15H 3C6SA 2MCMA 4ZO9A 5HYJD 4KDTA 3RPIB 4LGPB 3CK0H 1ZLWH 1SDDB 3CN2A 1OAYH 4WHTA 3I84A 3CVHL 3TNMB 2E9WA 3PGDB 1SEBA 2WLZA 3T6QC 4FC3E 1Q72L 4N86A 2HT3C 2XWZA 3IFPB 1D5XB 2PCPA 12E8H 2GJ6D 2W91A 2YFNA 4A39A 1KC5H 4WEBL 4NXKA 5DWPA 2BIIA 4GKZB 4LASL 4YSTA 3QQNA 4YAQA 1DJSA 3IKCA 3ASOB 4MTMA 5LNGA 2WBWB 3G5YB 2JJVA 4DIXA 3QJHA 1P4UA 1LEKB 3RWDA 2DQMA 2WXGA 5I6NA 1E6JH 1T7WA 3KPRA 4JQVC 2PWHA 2QL1A 5T1LA 4YSQA 3IBOA 1ZTXE 4JRYE 5BV7L 3HOGA 1RK0A 4PJHB 3RL1B 5A7BA 1P84J 2ZOUA 3K0YA 3OJMB 5DJ6A 2YZ8A 2MCG1 1BF8A 2CO6A 3V2AR 1T3FB 1EHLL 4J3OD 4EI0A 5H37G 3FUHA 3LPWA 3D52A 3I50H 2A4CA 2IJ0C 3QS2A 1QMUA 4U1SA 1AHWA 4QHLA 1RJYA 1AFVL 2QLYA 3LN9A 1T2XA 4NUQA 4ABWA 4G7VL 1N0XL 2GUYA 5ICXB 1WPCA 4IEFB 2D03H 5BQDA 5K59F 2H2PC 3ARDA 5IQLA 2O6FA 1ET7A 1A6PA 1JFQL 3ZE1F 3LPOA 3ZDXE 1BFSA 2WXPA 3EAKA 3VI3F 5I6KA 3GSUA 5JW5A 1B6DA 4GMSL 4AJWA 4ZMAT 3WHE1 4LHQB 4CVXB 4LNRA 1VPOL 2R1WA 4IK7A 2Q6WB 5JHAA 3HKZA 3P9MB 1ZV9A 3FF8A 4PJ7E 4UOJA 1E6OL 5BMFL 4KOCA 1WFIA 1CGSL 3SIKA 4OT1L 2CHZA 4JY4B 4D0DB 3TBSA 2J2ZA 2ZUUA 2EZ0C 2OV0A 3NP3A 3QNYB 4DZBA 4KRLB 1E8ZA 2JKSA 3SZ6A 2EDJA 3O41B 2J25A 3ARVA 5KSAC 3RI5F 1XZWA 2A83B 1E4XI 1RIVH 4U1NA 5EBWB 1DQQB 1WFMA 4U6XB 4I9WD 4TVPH 4YPJA 3RA7H 2JJSA 3OMAB 2BVTA 1T89A 4U6YB 4KTGA 3Q2NA 4W9EC 3ZUNC 3ZQ9A 1AXSB 3KD4A 3ZIYA 1OY3B 5IOPA 3QUXA 3GM8A 1QSEB 5DMYA 1K3ZA 4A6YA 3NMEA 2QGDA 5E6IA 4AOFA 4DP5X 2JKNA 3IJSB 1K5NA 2AGJL 4RFOH 4XO4A 5F93C 4DWHA 1QI3A 2PNDA 1B4TA 1KMGA 5CM1A 2PXYA 3BPCB 1IM3D 2O5ZH 5E2VL 5IBTL 5A2BA 3T1FA 3CTTA 2ZCHH 2GSGB 5KBNC 4IBSA 5EEXA 5F72S 5JXAL 2MTPA 1A7OL 3TN0C 4F9LC 1DQLL 4FG0A 4H1LA 3P4OA 3CDFA 4JO3H 1FRGH 4QCIB 5AW9B 5I8OH 4IMLA 4L8SA 3VJ6A 3CFBA 2KI6A 2VM3A 4NAMA 3BVUA 4PY8I 1H9VA 3KLKA 3OKDB 4L9DA 4F93B 4PV8B 2VQ1A 1GAFH 4F1SA 1OGAE 2GUOB 3T09A 5ENWA 4QJ3B 1B3IA 4Y2NA 5AQ0A 3QA3A 1I75A 2HVKB 5KTEL 4ACPA 1IFGA 4KKCD 2DQCH 2X40A 2VR9A 2C26A 4ZPTA 4G7YH 4NIYE 5I82A 5I75C 5LGYA 1H3PH 1NFIB 4FJZA 4YDIL 1A25A 7FABH 1TDQA 1CE1L 3DHUA 1VDGA 2RHEA 3HLAA 3ESNA 4K8RC 2VLKA 1OP5K 1Y6MR 4PI2A 2B0SL 5LDSA 3GEFA 1WZAA 2ZF8A 1OF2B 2X42A 2IBZY 4GO8A 4BFIB 1HJBC 2DWDB 1UKSA 2CNYA 4W9IC 3L1GA 3QJRB 3O4LD 5I1LB 1L7TL 5ITFB 1PNDA 1NGQH 2VRKA 4NDMB 4ANWA 1QWNA 1KBKA 5IMLB 2W9LA 2R7EA 1PEZA 3FO1A 2YA0A 4FTVA 2V8LA 1XGYH 4EDWL 2AABH 3U4EA 2GC4C 4M7LL 4DGUA 5JW4M 1QLFA 1EZSA 4TUKH 2H3XC 1JHKH 5FAAA 3CVDA 5TGBA 2JWYA 1A6VH 2LTQC 4Y19E 3WTUA 4Z0XB 3BP5A 3GMQA 4HIXL 3FQNB 5D2LB 4XNXH 4GIPD 4MX7B 4XPBH 3ZPDA 2XA3A 5EEWA 4FHJA 2IOIA 1GZPA 4UIKH 2XY2A 2VGLM 4ZW7A 4F8LA 5JHDA 4YSOA 2W9EH 5B7MA 2Z65C 5IMKB 3NZHL 3EGDA 3GMRA 2RMNA 2V2TA 3SKNA 1G1KA 1T7YA 3CN1A 4WWKB 1BVKB 3ZZLA 3P0VH 4F7KA 3DO4A 4TQEL 3NIGF 2VLRA 1FGNL 2CRZA 1E9QB 2Y7MA 5FB8B 4X6EB 1K4CA 2GB2A 4IRJD 5B4MD 4P5TA 2PW2A 1A66A 1NEZG 5D70L 5GQBA 1KEGH 3MNZB 4NRXA 3HUJF 1FNAA 1N59A 2FSEB 5EU3B 3B7UX 4YNYB 3SOBH 1DQKA 2R0KL 4JR9H 4LDOB 2WWKT 3WN5C 4KJWD 2WVTA 4P2QB 4QLRA 4L37A 4ZMQA 5D4QA 1P1VA 1SYVB 1JAEA 1OAXH 5JR1H 2AXGB 3S36X 3V4UH 1FCGA 2A9DA 4RMQA 1SF5A 1B4LA 1NCNA 3QDJE 4B9IA 1T5KA 2OULB 2HVBA 2RH0A 3JT0A 2YSSA 3CBJB 1HHIA 5ETUB 4MYPA 3NCYS 1JRHI 35C8L 4X4XA 1QLEL 4G3YL 5C0AA 2XPGB 3A5VA 1TSHA 1UC6A 4Q6IB 4JPIB 1NMBL 5CCKH 1W72L 1CDHA 4PB0L 4AEHL 3GTNA 1V10A 1KGCD 4BE6A 4B5ZA 5HVFB 4QRUA 1QFPA 4YGVB 1L0XA 2J6WA 2ETWA 3FB5B 3K6NA 5JZ7C 3NVQA 3PPEA 2YXVA 3UG5A 4JG1H 3IGLA 1MVUA 3WJLC 1WHOA 3DOHA 5BVPH 2ZZUT 3UPCA 1YEJL 4OZGB 4QD2E 3TWCL 2CIIB 4YFEA 2IQAA 2YRPA 1CXIA 3ATBA 4WRLA 3ZHNA 1HC1A 2L7UA 4KUZH 4BH7B 1U8PA 4KK8C 3L5HA 1DL7L 2F0CA 3EYQD 4DO6A 4F9PA 1P6WA 2Q7AA 3PWNB 4LSSL 3V6OC 2I9LB 4PJFB 3E38A 3CPLA 3QWOB 3VI4A 5K9JL 2ED6A 2BDNH 3TO4B 3MQIA 5D7IB 3FCSA 2JKRM 4WFED 4WIQA 5DT1H 1NFKA 1JWUB 5H35B 5IFAH 1ID5I 2VW6A 2DKSA 2J5LC 4OJEH 6FABH 1A7QH 4XOEA 5J6HA 3CN3A 3KCWA 1JV5B 1FO0L 3OPZL 5FK9A 3RTQC 4JDZB 3ULUE 2CALA 3BDYL 4G9FA 1DN0A 5ANHA 5BUGA 3S98A 4GXVH 4Y4HB 1KLGB 3Q9PA 4QRBA 1S7TA 4ODBD 4Y9EA 5DJYA 1CDGA 1NOAA 1F3JA 3TIDB 4MQSB 1DBAH 2GC7C 4G6JL 3ZY7A 1HZHH 2IPKA 2XPZA 1QG3A 4H25B 4U1HB 1CE6A 1G7HA 3Q6GH 2BOCA 3VFSA 2BOBB 2EYTB 1ZJBA 2ZKYA 3V10A 4HMCA 3ROLB 1BAGA 3LZLA 1ORSB 2DQEH 3K4AA 5I74C 1XGZA 5B1JC 4H88L 4PY7B 3WAJA 2QEJA 4BQ6A 4K4KA 1T7XA 4ANVA 1N2RB 5GZNC 4XP6H 3QORB 3GBLA 4N26A 5HDBB 2ZX9A 4WUUE 4PJ8C 1HEHC 4LMQE 5GGRY 1KJVB 2NY0C 2X53A 4N68A 5F8QC 3WXVH 3WTSA 4I0PC 5IKCB 2BOLA 3SKJL 3EBGA 2AQNA 4FA6A 4AQ8C 3IWVA 1AQKL 2Z0BA 4M5ZL 4TNGA 2Y4SA 1Q94A 3P0YL 5ITBL 1KCVH 4KBPA 4LDCA 4ES9A 3SDXA 3OKMB 5DMKA 1FORL 4XPGL 1BVLB 3IDXH 2CBQA 1B88A 1JN6B 1R19A 4M8QA 2XQYK 4N6RA 4P9ML 1BYPA 2XTJB 3VXPA 3C60D 5LCVL 2DJ4A 3IFNH 4KROB 4YVNA 3RKPA 1C1EL 2IIJA 2DWSA 4N2GA 2VRQA 4CVZB 2P5WA 5DEFB 3WMQA 1C8PA 1YEGH 1J1XL 2JB5L 3LZRA 1BM7A 4GBXC 3FTWA 4ALAL 1HXYA 2I25N 1IBBA 4M5YH 3WY4A 3X1GA 1E65A 1E8WA 1NC2B 1YUKB 3JZ7A 2E27H 4P99A 4CW1B 4FFYH 4HGWB 4AYGA 4GUPB 5CJXC 5HHMD 1PYWB 4RETB 2H41A 2QGBA 2YPLB 2GTWA 3ZT7A 5BJTB 4LPWA 4ETQB 5FUOH 3T0EA 1FPTL 1NCDH 1QSED 1RZQA 2V3DA 1G6RB 4PGJA 2ADFL 3KPNA 1QYGL 5AD0A 4XPTL 4HU2A 1KGJA 5MERA 5EZJA 3PAUA 3QPXL 1DQML 1E3FA 1CLZH 5F0JB 4AL8L 4AVHA 4EXKA 2PO6B 3C87A 4W93A 1WT5C 1MJ8H 2VAAA 5CU5A 4QT5A 3TV3H 2FX8H 3FT1A 4WTXA 4XB7A 4PHXA 2JXMA 3QQ4B 3X3GH 2KUTA 1TT6A 4QRRA 2X3AA 4Z5RB 4BINA 1G5AA 3TWYA 5IW1A 3IU4L 1TQCC 2AJUH 3K6IA 4I1RA 2AEIT 4AG4L 2LFGA 4LSRH 3EHBC 2ZP8A 2D7OA 4LSPH 4WO4C 4PCKA 3VXUA 4PB9L 2R23A 4V1DB 1QEWB 1JK8A 3J8F7 2GJRA 4RIRA 3MJWA 4PJBB 3VFMB 5I1DB 2W9DH 5CBAB 4F7TA 4U6VH 4HXBL 4BFNA 2EH7L 3R0MA 2IPUK 3HFML 1XMEB 3BW9A 2O6EA 3QIUA 5HVWA 4G8IB 4WI5A 4B9PA 4UIMB 5CUSH 5TQ0H 1B2WL 5E0FA 5IZ7A 4EN3C 5A2KH 1OTUD 2NZ9C 1CTOA 2BFGA 2Y7LA 1NMAH 3MV8A 5DC4B 4IOFC 2MPAL 4BZ2L 3KYNB 5EUOF 3DIVA 3QUYA 1A7PL 3O8XA 3NFPA 1GTNA 3DLQR 3QR0A 4HBQA 1MREL 3FTVA 4LCYA 4F3FA 4G72B 5JPMC 3FXIC 4G83A 3VA2C 3DUSB 3F5WA 3EH3B 2B59A 4PJ6A 3TBVB 3GO1H 5C3TA 3ARQA 4PP1D 5BS0E 3NJJA 3QE5A 5KWYC 1QLRA 4HJ1A 4WY7L 3QEQE 2X2JA 5CJOH 3DUUA 4GSDL 3WHE0 2W1NA 4ABVA 4WQOA 3BJ91 4CNIB 3KYKH 4KV5F 5EDXA 3O2DH 2VUYA 2P44B 1KFAH 4HIPA 4OD2B 4EUPB 5E24E 3LKNB 1X5MA 4PWIA 4ZQKA 3DROB 4OLUL 1NMCC 5KVFH 4K3JH 4P2RE 4PV9A 4A2HA 2X2YA 4NQVA 1U42A 5CHNA 1P84K 4FQ2L 1CFTB 2P5EE 3RAJH 1P7BA 1X5HA 1ZE3C 4TLTA 1TETL 4GSUA 1J18A 4PJCA 3UYRL 4F80A 3LX9A 4WWKD 1LXMA 4RNRA 2HLAB 5D1QD 3T8VA 3KGUA 2H6PB 1LEGA 4R97C 4DOHE 5DQDH 5HHQA 5E4AA 1JSYA 3K71B 4A6YL 2CHWA 5KVGH 3NPSC 1W6WA 4UINH 1F42A 2G2RA 2Y2WA 1L9OA 4M29A 2DV6A 1ULVA 3GKWH 5FDWA 4FKKA 1WYJA 3T0VA 1Z9OA 2X4RB 4OSUL 4XNDA 5BXFA 4P2QD 1U92B 2AJXH 3QS3A 1SVZA 5AOIA 1XGTA 4QHUB 4L05A 5DUJA 3BYTA 1FV1A 3KYMA 43CAB 3OHXB 4LSTL 3GZOA 3RWEB 3UBXB 2W07A 5GS0C 4YBQC 3BVDB 5K39A 4JFFA 2NY1C 3I3EA 1RSFA 2ZCKL 1KPRA 3H7LA 2BSRA 3ZDZE 3BH4A 2AEQL 1XB6A 4Z6AT 4NZTH 2NQCA 5A6MA 2CK0H 3F83A 4YLCA 4PVMA 5J12C 5L9DH 2A73A 3VI4F 1KLFB 5F9AC 4I2XA 1I82A 2NXYC 1HJCA 4NM8H 1S7UB 2FYVA 4UU9B 5L2KA 4ABQA 3UX9B 2ZSVB 4G6KH 4MD0A 4I18C 5DS8B 3E80A 1IX2A 4YR6B 5CSZA 1UOLA 3PGFH 4XWGH 1MJUL 5HHOE 1XF1A 1UJ3C 1FAKT 1UGNA 3HEIB 2ZKHH 2PR4L 2FT7A 1IT9L 1DQVA 5CP3H 1E0OB 1JWSA 2YHGA 1FFOB 1AIFA 2CO2A 4L2LA 4JM2F 2GBUA 3DJ9A 3QXAB 1GS6X 3HFFA 3TO4D 4WCYL 1IGTA 4X42A 4IQHA 4NQDA 3SYQA 4XHJD 3W57A 1LP9E 1A6TB 1S7RA 3M7FB 3ARGA 1F90L 3I6KA 4K94C 2EH8H 3DA0A 1NCGA 5GRUH 1PZSA 1F58L 4FFYA 4OJYA 5IQ9B 4I1NB 3L3OA 4OIAA 4R7DB 2PWEA 3Q5YA 4QY8A 3C9NB 4Y4FB 4Y4HD 1T6BX 2VDMH 3BUYB 4ORGB 1JJUA 4ZUSB 3C09B 3LZPA 4AQAB 4RX4A 2MPVA 2JCWA 5F7LB 1TO5A 1IQDB 4XMPH 5I15L 1M7IB 1T21A 1R24A 1UD3A 3ULAB 2QPUA 1TZIB 1JNHB 3CK0L 4NENA 4KGJA 4IDJH 4PJ9B 1DTUA 4FL4B 3NN8B 5SV3A 3L9RA 3L08A 5TE6H 3VNYA 5DUML 3QZWG 2MMXA 1E4KC 3C5SA 1XF3A 5FO8B 2DYSB 4AIEA 4DK3A 1QA9A 1T0OA 2Z64C 3E6HA 4YUEL 5T1MA 2HUHA 3HC0A 12E8L 4XNUH 3V4VA 1JHTB 2ZYHA 4H8UA 3PAVA 3V95A 5AYTA 3IJ7A 1FIEA 1KC5L 4CUCA 2EVFA 3FU5A 5KJ7E 5IJDC 4KK9D 2R2HB 3TBWA 3BKML 4N1CA 1BIIA 4MVBD 2OMTB 3VX1A 1GOHA 2FE0A 2G5BA 2UZIH 4I3RL 1E6JL 2VR7A 4UZGA 5DWUH 1SQ2N 1PFCA 2FJHB 1IC7H 1MCBA 3RWGA 3OR7A 5D1XE 4FG4A 3FT3B 3LS4H 3SPJA 4I4WB 1WIPA 2HJLA 3O11B 3QZLA 2XTJD 5IR1B 1MHHA 3V0VB 3PAZA 2R15A 3G6JB 3EYUH 2ZUWA 2QVFB 1EIBA 5B38B 3LCYA 5FGBA 5KSVA 3HC3H 4JM0A 2H9GA 4HIEA 3JZYA 3B5TA 4AH2B 5TDPB 3QNXA 1R3KA 4IOSA 5F71A 4B96A 1NC2D 3D4CA 3BPLB 1NIAA 3IMRA 2EDOA 3OLEA 2NUPB 3N41B 1TMQA 1E9PB 1F97A 4U7KA 2FT6A 4DQAA 3HNSL 1SJMA 2Z7WA 2YPLD 3BP4A 4X5WA 1A64A 4R4BB 2WKGA 4D9LH 5FECB 2UWEA 5F0MB 4MJIA 3T3PE 4DCQB 2I24N 3O2DA 4F7MA 1TIUA 4JQVA 4QKXB 2PO6D 3TCLB 4EPSA 2FEDD 1M57B 4QWWD 2EYRB 5D7LE 1G7PA 2DLHA 3IS1X 5AVRB 3RZWA 2CWRA 2X44D 4U05A 4TUUA 3ARTA 2J8UA 1WE5A 3NFSH 5DO2D 1RIVL 3BIAX 1PEWA 2DKMA 4L3FA 4MXVF 2WIIB 4HETA 4Z9KB 3S9DB 3QEUB 4JGJA 4TVPL 3RA7L 4E41B 2EAEA 1TZHB 3V7MA 1WWCA 2E56A 1M2VB 3BO8A 2A6DB 5A2JH 1WBYA 4S1SL 2CDFA 5HP5A 3ALPA 4V1DD 4BD4A 1XSKA 1EX0A 3T2NL 1W8EA 4BSWB 4JHVA 2EDEA 5CCJA 4RFOL 1MLBA 3IFLH 3BAWA 1ODUA 5JQHC 4KI1A 4JL1A 3G08B 1ZWIA 4YDNA 3T6WA 3GM0A 1E8XA 3CFNA 3EOBB 2WXHA 5F7MC 1JGDB 3VSVA 4PJEF 4C56E 5PCYA 2XZAH 4QTIH 4E9VA 5FWQA 3L3JA 1QBBA 1HQ4B 4TPRH 4XOBA 3W0WB 4JO3L 1FRGL 5DHMC 3BXNA 4OB5H 3DPBB 2N56A 1I1FB 5ALBH 3CUPA 1NBCA 5E8OA 4JE0A 3QIBC 3FB7B 5I2IA 4UQ2A 5KSAA 3KWWB 1H19A 1X9LA 4WJKB 5I6XC 3U2JA 1GAFL 4JZNB 3HI6H 1CDCA 1LNUA 3K2UH 4B7LA 5C0NC 3LTVA 3MBEC 5DVNA 2JB6B 5LN4A 1J9SA 2DQCL 4XH2B 4JDVB 5F1IB 4X7TB 2J1YA 2DQJH 2E46A 7FABL 1EBPA 5SV4A 3OB8A 2AS5M 1QFOA 3TT3H 2A99A 1B0RA 2Z7ZA 3LRSB 3GI9H 4ZTEA 4O58H 2LLNA 3AWGA 4IRSD 2X4PA 3VD9A 3B7SA 1TLMA 3CFKB 3O9WB 1A0QL 3BQUD 1BQUA 3RWHA 4GI9A 4MNGA 3TN0A 4LHUD 1PAMA 1ZA6A 1AANA 3IDNB 3ZJAA 4OZ4A 5CP3A 3L4WA 1NGQL 2P8PB 4YFDB 4KNSA 1J1OH 3GGWA 3VRJB 2ERJC 4QHMA 2BW5A 5EFIB 1X5XA 1CYWA 1XGYL 2R4SH 3QG6A 5LBSH 5I8CA 2ENYA 1A2YA 2ZG3A 3NCCB 3SE6A 3H56A 1JHKL 2K9UA 1YUHA 1A6VL 4G6AC 1UVQA 4JREB 3VM7A 1LHZA 1S9VB 3L3HB 4FCAA 3VX0A 3N04A 2YXWA 4QYOB 4XPBL 3CZEA 4N4YB 2GFBB 2ILLA 2AQSA 4CSPA 2Z93B 4UIKL 3Q2VA 4WWNA 5HDQH 3LQAC 3DOIA 3QCTH 2W9EL 3MRIA 2X1XR 4YOKA 2EYSB 1LLAA 2ZIDA 4I8DA 4MMXB 1DVUA 1I1YB 2W81C 3UZEC 4QTHA 2EEDA 4BHUA 3LKQA 1KCLA 1C12A 3DX8B 3IDJB 1FF5A 3CVHB 4JFOA 4BZ1A 1BM3H 3FAWA 2COVD 4RA0C 4KAQL 5CBEA 5IVXA 4FNTA 1KEGL 4ZUTB 4G9DA 1P4LA 3ZR5A 1TYRA 3C5JA 3L7EA 5B8CC 4UWQB 2VLJB 1UWFA 3SOBL 3V5KA 1CD8A 5C0CE 4Z7WB 2NDFA 4JR9L 3PU7A 1MF2L 2JKTM 1ETJA 1GGBL 3MRJA 1S9YB 1S5HB 1CB4A 3P9LB 2PP8A 1MJJB 4L1DA 1FFNB 4GUQA 2X0WA 3V0HA 2CIKB 3MR9A 2PCFA 2AKRA 1L9TA 5JR1L 2XG5A 3H2WA 1QWUA 2R2BA 3DECA 1C5CH 1S7XB 4L3CB 3V4UL 1J5CA 3ELQA 4YIQB 4UTAH 5BUAA 4UT6H 3HR5B 1USZA 2B1OA 2HJKB 5D96C 2VXUH 2BY3A 1VGKB 4KXAA 3RNQA 1DVZA 2C34A 5TF1H 1F1AA 1RAMA 4EN2A 5CCKL 4JVUA 1U8CB 1KIUA 1R4XA 3DX0A 4M7JH 2OW7A 3P40A 2PYEB 3PHQA 1U2YA 2FZ3B 1GW0A 3NA4A 5CEXA 3UBHA 3NP4A 4J3VA 5F70A 4W9HC 2DWXA 3EZJB 2VXVH 5JDJA 1H8NA 2CDGA 3DX1A 2PTTB 1V05A