3FQ1A

Azurin c112d/m121i
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFDTFPGHSALIKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Type Zero Copper Proteins.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
molecule keywords Azurin
total genus 31
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2009-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3fq1A00
2GSMB 4P5RA 2LLNA 4G70B 2FT7A 2BP0A 3GYRA 3NSCA 3CG8A 4DPCX 4YSTA 4E9QA 1AZCA 5A7EA 1JZGA 1N68A 3FSWA 1AOZA 3QJUB 3TU6A 4KOCA 2YXVA 4YSDA 2UXFA 4HAKA 1OOWA 1JVLA 4JKNA 2PLTA 2E86A 3FSZA 1IBZA 1A4BA 3EF4A 1RZPA 2VM4A 2J56A 1ZDQA 1OE2A 1J9SA 5I26A 2IH8A 3NP3A 2B08A 4KO5A 2IWEA 2PPAA 5B1JC 1GW0A 3EH3B 2H47C 3V9CA 1XB3A 3X1FA 2JXMA 1TU2A 1AZBA 3HB3B 3SBPA 2DV6A 1NICA 2PPCA 1DYZA 1OE3A 3ASNB 4GYBA 5D4HA 1RZQA 4M4RB 1ZIAA 2IWKA 4DP2X 2AZAA 2XXFA 3N55A 4N8UA 4E9SA 2HX9A 3FU7A 2TSBA 3X1NA 2W88A 1PNCA 1PNDA 1JZJA 5I5JA 3NJMA 3NJKA 1NIFA 1NPJA 2ZXWB 2W8CA 2XLLA 1E30A 1AG6A 3ABMB 1ID2A 1SDDB 1QHQA 1NIEA 4GY4A 1SNRA 6PAZA 2DWTA 2TSAA 3AG2B 3T9WA 4BWUA 1FA4A 1E65A 1ASQA 1PLBA 1XB8A 2FQDA 1NWPA 1ASOA 1J5DA 4NERA 3X2QB 4FAAB 2FQEA 4A66A 2CJ3A 5PCYA 1L9QA 3EH5B 4W1TA 1TKWA 1L9RA 2BW4A 2VMJA 3FSVA 4KNUA 4YVUA 1NIDA 1PAZA 3MBWB 1BQRA 1SJMA 3WNJA 3NJGA 3ZDWA 1JERA 3ABLB 3ERXA 1QNIA 4DPAX 1NPNA 4GXFA 3IE9A 4ENZA 3WIAA 1JOIA 1KGYE 3FYIB 4HHGA 5I5IA 1PF3A 5I6KA 4DP0X 3ABGA 2FJSA 2VW4A 1KCWA 1PY0A 5D4IA 2A3TA 3QPKA 1MZYA 1QLEB 2BO0A 1TEFA 3EHBB 4KO7A 1L9OA 2YAHA 2JFCA 2HX8A 3OQRA 1W6WA 3X1GA 3AY2A 2XWZA 2BWDA 1GS7A 1N70A 2B3IA 2IDUA 3NP4A 2OJ1A 3ZX1A 3FT0A 1JXGA 2HRHA 4A2GA 3QJQB 3IN2A 2QT6A 4JHUA 1CUOA 1IBYA 2R7EA 3GDCA 4DP6X 2Y69B 1AS8A 2BP8A 2CAKA 3FU8A 4YSRA 1AZNA 1X9RA 1E5YA 3NYKA 1BQKA 3H56A 3T6WA 5I5MA 3NJNA 1V54B 3S8GB 2QDVA 4YSAA 2VN3A 4G7SB 3HEIB 2EINB 3WG7B 1KBVA 3FPYA 1J9QA 2ZWNA 4X4KA 4BDVA 3EH4B 2YQBA 1GS8A 3KW7A 5FC9A 4HCGA 1DZ0A 2XUWA 1JXFA 4HCFA 1F56A 2CALA 3RYMA 5B1BB 2P80A 4NB7A 1HAUA 1J9TA 4KOBA 3G5WA 1BXAA 3C75A 2IDFA 5ANHA 4BWTA 4G72B 4E9RA 1MG2C 4DPBX 1BYPA 1ETJA 2Y1AA 4DP8X 1ZIBA 2HZHA 1A4CA 1ZPUA 3TBCA 1CYXA 1X9UA 1IKOP 3NJJA 2PPEA 4A2FA 3D12B 3WNIA 4DP5X 4AX3A 2PPFA 4E9XA 5I6LA 1CC3A 3FYEB 2IDTA 1RKRA 4E9TA 2IAAC 1J9RA 2UXTA 2ZONA 1JZIA 1OCOB 1AAJA 2FT8A 1AG0A 1XMEB 2PP7A 4WTQA 5B1AB 3PLYA 1SF3A 2OCCB 3IBOA 2P80D 1ZV2A 3DIVA 4DP9X 3SBRA 2X87A 2YAFA 3WKQA 1PLAA 2J57A 3OMAB 5F7BA 1A4AA 3GXUB 2XV0A 3PAUA 2OV0A 2CUAA 4L0PB 2UXVA 1AS7A 2RACA 2GHZA 1IC0A 3T6VA 1M9WA 4N4YB 4E9WA 1PMYA 2DWSA 1SDDA 4AKOA 3CZUB 4QKTA 3WI9A 4YSUA 1EZLA 1JVOA 3AG4B 2GBAA 4YSOA 2GI0A 2IWFA 1RCYA 2MRYA 1AS6A 1JZEA 2J55A 1SFHA 3NSDA 3ZIYA 1SF5A 4GP4B 3SBQA 2X88A 2VSMB 3UAAA 1KCBA 1SHWA 1W8EA 2AANA 3CVCA 3CVDA 4UANA 1BQ5A 2UXGA 5AKRA 1SHXA 6PCYA 2I7SA 2VM3A 4ZK8A 3S8FB 1TEGA 3KW8A 4E9VA 4Q89A 3SQRA 4TXVB 2WSDA 3S3DB 3NJLA 4YSCA 5LDUA 4KO9A 4FA7B 5B3SB 5E9NA 2YAEA 2AFNA 4G71B 5I6MA 1EHKB 3FQ2A 4AZUA 2QDWA 5F7AA 1XB6A 2YARA 3DTUB 1NIAA 3FS9A 2YAMA 2AZUA 1ET5A 4CSZA 1WA1X 3PXLA 2XV2A 2CCWA 2XU9A 5I6PA 2VW7A 1HFUA 1OF0A 2DYRB 3NSYA 3DKHA 1JZHA 3UABA 4F2FA 3MX0B 3NJIA 4YSQA 2GC4C 1ILUA 1ILSA 3FQ1A 5I6OA 3QJVB 2J5WA 2AVFA 1MDAA 1NDTA 3UACA 2BW5A 2EILB 4DP7X 1PLCA 1BEXA 2PP9A 2FTAA 4UAHA 1A8ZA 2CBPA 1YLBB 2YAOA 1OE1A 3IN0A 4HHWA 4KNSA 4Q8BA 1PCSA 1E5ZA 5TK2A 4BXVA 2Q5BA 2FWLB 3AG1B 3JT2A 2HX7A 3CDZA 3X1BA 1JZFA 4E9YA 3CVBA 2I85A 1V10A 3NJFA 1WA2X 4AKPA 4CSPA 1A3ZA 2IDQA 2MTAA 1GSKA 1BXVA 7PCYA 4YSPA 2FQFA 1T5KA 3FU7B 5I6NA 3QQXA 3AW5A 4YSEA 4DP1X 1L9SA 3QJSB 1MZZA 2BHFA 4YVNA 2FNWA 1FWXA 1NWOA 1ZDSA 1OV8A 3WKPA 4G7RB 5B1KA 3FQYA 4G7QB 2FT6A 2XV3A 4AKQA 2PPDA 3NJHA 2BWIA 3BQVA 1URIA 2GB2A 1WS7A 5TK4A 2GC7C 4M3HA 2BZCA 2BP0B 2GIMA 1KBWA 4MFHA 4EF3A 1AIZA 3S3BB 3CDZB 4DP4X 8PAZA 3NT0A 1ADWA 2H5UA 4HALA 3IEAA 1AZRA 3L45A 1CYWA 1GY1A 2WO2B 2EIKB 2VW6A 3TBBA 4HIPA 4A2DA 4P5SA 1V55B 1NTDA 2XVBA 4WKXA 3QJRB 1UATA 4PAZA 1BAWA 5EHFA 2NRDA 4PCYA 3QJTB 4A67A 1PZAA 1GYCA 3S3CB 1PZBA 3PPSA 1KYAA 1AR1B 4F2EA 3FPXA 5AFAA 1NIBA 3PAZA 1J5CA 4F7KA 5AZUA 1WAEA 4GP5B 1IUZA 4QLWA 1SFDA 2XX0A 3N2JA 1CURA 1PZCA 1GY2A 1WS8A 4KO6A 3NSFA 3H4FA 2DYSB 2YAQA 3AG3B 3T6XA 3UADA 3UGEA 1W6LA 2PCYA 1BXUA 2DY2A 1OCRB 2H3XC 4KNTA 5D4JA 4W9ZA 3X1EA 3OM3B 1AZUA 5B7MA 2PCFA 4K9JA 1OCCB 4BXSV 4A68A 1AANA 1GS6X 3TA4D 2WO3B 4BWWA 4AI7A 7PAZA 2IH9A 1AQ8A 5I28A 1I53A 1JXDA 3BVDB 2JKWA 5B7EA 2Q9OA 5B1JA 4A2HA 3FU9A 2XXGA 2PP8A 4A2EA 2FQGA 1HAWA 1BYOA 4NAJA 2YAPA 2XYBA 4UF7C 1VLXA 1NZRA 1B3IA 1ET7A 3ZBMA 3FSAA 1AACA 2EIJB 2HXAA 1L9PA 4HCIA 4YL4A 3T71A 2XX1A 1ASPA 1E67A 5PAZA 3TASA 2EIMB 2QPDB 1KDIA 3UAEA 5IY5B 1R1CA 2N0MA 1M57B 1GR7A 2QPEB 4HZ1A 2BZ7A 3OMIB 4JHVA 1ET8A 2HRGA 1KV7A 2HLEB 2UX7A 3AZUA 3T6ZA 2I7OA 3PAVA 3U25A 1FFTB 5B7FA 1L9TA 3OD3A 2YXWA 2BP8B 3ASOB 3JTBA 1NINA 4YSSA 1KDJA 3OMNB 1MG3C 1WA0X 4RH4A 2ZOOA 3PCYA 2R7EB 2VSKB 3H4HA 1M56B 3ABKB 3V9EA 2IDSA 9PCYA 4GP8B 4BDVB 2UX6A 4BK5C 1OCZB 1A65A
chains in the Genus database with same CATH superfamily
5DZVA 2EDHA 2GSMB 4P5RA 5KSAA 3AQDA 3QG6A 5I1CH 1KGWA 1WGVA 2AQRA 3L2LA 4JN2B 4UZGA 2AC0A 1ZXKA 5FUCC 3CG8A 3ECVA 4JDTL 2ZAHA 3EJYD 5G4NA 1JV2A 3W0WB 2NY6B 2ZP9A 4KBPA 5FUOH 1EWHA 4R0LC 4MD0B 1Y1UA 2G5BB 2Y9RT 4S10A 3A67H 2Q7NA 3ZUNC 1E5CA 1UTDA 3G6AA 3KWVA 3N85L 4BFOA 3FSZA 1IM9A 3KPMA 1YY8A 1JGVH 3UEZA 2B20A 3RA7L 2N1TE 3QPXH 4UQ2A 3D39A 4GKZA 2GYSA 4K7PL 4KKCC 3NGBC 2UWEB 4M9OA 1PW3A 4EO5A 5CSBA 3QRFM 3QHZH 4WHTA 4QJ3B 1S3RA 2WW8A 1EAOA 3EJZD 4R2GB 3V9CA 3WFBL 3WL9A 2YPVL 4LOVA 2JIXD 4J3WA 3V4PL 3BE1L 5KANG 3LQAL 5FW8A 3HUJE 3VFWA 3WSQL 1ZEAH 3QORD 3SDDD 4P9MH 3WKMH 1U8OA 3W9DB 4DTGH 1TVDA 4M1DH 3VFPA 2DB8A 2Y1VA 2OMXB 4AJWA 1XF1A 43C9B 5IHLB 1EJOL 1IGIH 1NJ9A 1N8OE 1OF2A 2K8QA 5AOZA 1ZTXE 1S5IH 3CFKB 1JNLL 1OCWL 1GGCL 2G0KA 3S3JA 3HS0B 3U82B 1QFWM 2J6EA 4QTIL 4AYGA 3OHXB 4NDMA 5CN3A 4XB8A 3NJMA 5C08D 3VXTA 3X12B 2ZXCA 2VZSA 4XNUL 3WFEH 4HS3A 1YEGH 4IMKC 4KJPD 4PJ5A 5CHNA 3S7GA 1NDMA 1INQB 3E1F1 4JDZB 4XMZA 1OT2A 4WO0A 3VG9B 1P5UC 3P4OA 1BJ8A 4HIXH 1WLHA 4JFPA 2VJ0A 3TT3H 4ODBD 4TUOB 4Z7VE 3EUDA 3MMEA 2CJ3A 2XZZA 4WO4D 1ZXQA 4XWGH 3BISA 3P0VH 1R5IA 4FYRA 4MSWA 1IT9H 1T21B 2QQNL 1HCYA 3LRKA 4Y7OC 5GRUL 4HIIA 2V2XB 4LAJH 2Z0UA 1M42A 3IDYC 5I24A 3WNJA 3P0YH 1OGAB 2WXPA 4JQXA 1ZHKA 4NQDA 4F80A 3GWJA 4HHGA 4MAUH 5H2BB 5IZ7A 1K4DA 4IK7A 3BAKA 3IVKB 2EE9A 4XP6H 1OAXH 3WHXA 5EWIH 5I8CB 2H0EA 5F9DC 4F8QA 5KVFH 1WZLA 4JHWH 4N20A 4Z23A 2NY3D 3NCXA 2HX8A 3US0A 1JGVL 3FUNA 2OZ4L 5F21B 1NCDL 3RAJL 2Z0BA 4HMEA 3L16A 1Z3GL 3GMMA 4JHUA 2Z1KA 3KYNA 4IRSD 3RIAK 3FU8A 3FFCA 4PD4K 5BPPA 4QRRA 1IAMA 4G9FE 4YIQB 4ZMOA 2AJZA 3B9DA 1BLIA 1TPXB 2Z6FA 3CFCL 3QUYB 2P7TB 3CVIH 2WXRA 1MFMA 4P9ML 1EZVX 4A6YB 5EEWA 1CLOL 4JKKA 1CD1A 2O5YH 3WEOA 4P4KB 1BF2A 7FABL 2FVNA 3PWNB 4QHUB 1MCEA 3FQTA 2F1EA 5EC1B 3L4WA 1CZ8L 8FABB 3CN1A 4D0BA 1ZE3H 1AJ7H 3HRZA 4QGTA 3JT0A 2G3XA 3O2WH 4L8CB 1L0QA 4X7CC 1P7BA 5B1BB 2ZD0A 2DQCH 3RYMA 3GSRA 2D7TH 4NB7A 1I9IH 3G7TA 3GBML 3OZKA 3EOBB 3ME0B 4ZW6A 3T2LA 3MA9H 4E0RA 1AMXA 4ZAKD 4FJ6A 2L7EA 1KPVB 4MJID 4PJ9A 2ZPKH 1UA6H 1MRFL 2J7LA 4DQOH 2YD5A 1X4ZA 3B9VA 4FNSA 4K7PH 3U0TB 3D12B 5IT2L 1ULVA 5F9JB 1M7IA 3QHZL 4RVBA 2P5WD 2XA8H 1BQLL 3OV6A 3ZDZB 3C5XA 4N68A 4NQSB 5KVFE 2P43B 1J9RA 1JZIA 4HS6B 3MV9A 4Y16B 2R8SH 4HIEB 3V4LA 2QJDA 1IQDA 4HG4J 3ILPA 1KBBA 1EUTA 1SF3A 2OCCB 2H26A 2P80D 1A0QH 3DIVA 2X87A 2VABB 1SUHA 3IJ9A 2PW2B 3WKQA 4DH2A 1WTGT 3HB3D 2V33A 2BP3A 2OI9C 2AEQL 4R4BB 1BVKA 5JPMA 1NMBH 3NTCL 4WFFE 3TBSB 4U1JB 2FO1A 2XV0A 2ZKMX 4L3AA 2GITA 3VXQA 2RACA 4DGYH 4N0FA 4XO9A 3SN6N 3FB6A 4PW9A 4DTGL 1A14L 4AYEC 3SGJC 1JVOA 2VE6A 4X5LA 4S1SL 4F8OA 4HXAH 4LNVA 2YPKA 4U7SA 4UIKL 4GIOA 4X6BA 2EIZA 4C47A 1FNEA 1K8IB 4XZUB 4NFBA 3EOTL 3T2OA 5IW1B 1HKLH 4AIZB 4LGSB 3QBTB 2XKNA 2ZJSH 5D7SL 2OCJA 3B7RL 3EHBD 3I3BA 4HUXB 1JZEA 4OCYL 1IGTB 1NQBA 3T0BA 1RFDH 1XGQB 4HGWB 4KGJA 3HZ3A 2ERJB 5AW8B 3S5LG 5FM8A 3K6FA 3BH8A 5DEZA 2V5MA 4BZ1H 4FKHA 1W0VA 4FZ8H 3I6GB 2ZUQB 3ETBF 3NSJA 5T1KD 1TEGA 3JV6A 4LXFA 2OTPA 4L4VB 4JFDB 3BP4B 4UOJA 2Q6WB 3S3DB 1FSKC 3GMQB 1QP1A 3QUML 5B21A 5C0IB 1M71B 4WUKH 5LDUA 3M17B 4XWOC 5B3SB 2YPVA 1IFHH 3HRZC 2YAEA 5JW3H 2B1HH 5I76A 2OBGA 1XH3B 2OQJA 3EO9L 3EG9A 4OZIA 2BOBB 1P84K 3VWJC 5FB8B 2QQKL 5EBGA 3DBXB 3CVHB 1UACL 4OD1L 3UTSA 5HDOA 2HLFD 2CHZA 5EU5B 4RMUA 1YEHL 1KELL 5FDWB 4UM8B 2DYRB 1ZGLP 4I2XE 4JDVB 4Y2NA 4EDWH 4YXLL 1RV6X 3LS5L 3BPNB 3F6JA 3T0EC 5J0BA 1NGYB 3N6YA 4KTDH 5JIKA 3VH8A 2XQYA 4D2NA 1HHGB 1QWUA 1SBSL 1O7VA 3UIYA 1GCFA 5T3ZL 4ZQKB 4IU2A 2D7NA 1N10A 3AUWB 4RGNE 5C09E 5KJRH 2HA1A 3G6JE 3JV4B 4MCZA 5C9KA 3FQWA 3TURA 2C1PB 4I87A 1I7TA 4G7YH 2PYEA 3IJYA 4QF1A 4PRHD 1ECYA 5AW3B 4M6NL 2IXQB 2WQ8A 3SDCC 3NABL 2PNDA 4HJ1A 4LDCA 4CKQA 1QHPA 3WN6A 2JE8A 3ARYA 5J6HA 2XWBB 3PJSB 2Z64C 3CVIL 5KVEL 4NCDA 1D3CA 2QMJA 4Y2OA 3AG1B 3NA4A 1Y07A 3JT2A 3BZEA 3B8YA 5ETUB 2ID5A 3CVBA 3QEQA 1G7PB 4PW4A 4O9HL 4RFNC 3T04D 3IGFA 1ED3B 2E9BA 2AERT 2EZ0C 1YMMA 2B39A 3SQOL 3SE4C 1B2YA 2CKBH 1BECA 3RIAF 3SYCA 4FJYA 2BHFA 5DJXB 4YVNA 4K9EH 2D3VA 5T3XD 2DQGL 5T1LA 3VXNA 4LPWA 4XMKL 2CH8A 4PMEA 4LSTH 4X4ME 5LQBH 4FZ8L 4X42A 1QR4A 4KVNL 2LAAA 4WLCA 2CK0L 5AEAA 3BSHA 4BFJA 3DJZA 1MKFA 3TYFB 4HKXB 2DQ6A 2IBZY 3QWNA 3UH8A 3MLZL 1HIMH 1OQXA 1YMHA 4EF3A 4PJEB 5T5NF 2XA8L 4BH8B 4WI3A 4PWEA 2WC7A 4Q9BA 3TA3D 3C6LB 1XVSA 5F7LB 3WCYA 2LFEA 4G3YH 2B1OA 3MV8B 1NAMH 3NRQA 4EN3C 2DDQL 1EGJH 3TBBA 5DF0A 4A2DA 4IBUA 1SYSA 2X4NA 1IFRA 5AOIA 2VWEC 1A5FL 1J8HD 3EO0A 5C9JA 4UT7H 4NO3A 3ELAT 4CW1A 1U58A 3GLDA 3KGUA 4HKZB 3KH3A 4OSUH 5CMAA 1IEHA 5DZJA 1ZLWK 5BV7H 3PPSA 3GJFH 1CL7I 1WC7A 4WEUD 2W38A 3GO1H 1T7VA 3VG9C 2KHAA 4L3ED 4FFZA 4CADA 2C26A 2ZKWA 3WU1A 2N7AA 4HP5A 4PJFA 4N8CL 5AYTA 2N56A 1CF8H 5CIPA 1ORSA 3E8UH 1MRCH 1I3GL 3KPTA 1OAJA 3FBQA 4ZW3A 4HUNB 1HDMA 1MW3A 3EFDL 3DMMA 1P4BH 5FHAL 1YJDL 5IHWA 2FO4B 5E0QA 1TEYA 3QQ9C 3HE7D 3CVHL 4OY9A 1JWMA 4X4YA 1IM9D 3KAAA 2B2XL 2WLHA 3T6XA 4BGDA 4HCRH 5BMFH 2Q8BL 4LKXA 1RIHH 2F6AA 4QPEA 3VJ6A 5BJTA 5IUSA 4EE2A 4TTGA 1YEDA 4N5EC 3OM3B 4YDVB 1NCWL 3D2UD 4OM0L 3MBEC 1B0GA 5G4MA 2BVOB 4PRDA 2WWMD 3GS0A 3U2SA 4JPKH 3B9KD 2BHUA 1NC2D 2BSSB 3WN5A 2XKUA 1S8DA 4PGZA 1G94A 3HG1D 1PG7X 1GYUA 2GJ6A 2JJTA 3TLRA 1G0YR 5KSBA 5J13B 3E3QC 1D5IL 1H15B 2XYBA 1FE8L 1IC7L 4NP4H 4WDIB 5L9DH 5KJRL 1YAZA 4RISH 1J8HA 1FORH 3OKOB 2WOBA 2NY5L 4R97B 2KLTA 4XPAL 4X6CE 3CFMA 4XAKD 3LH8A 3R19A 3NIFE 4JR9L 1N7ML 1RERA 3BKJH 2X4UB 4QRPA 5HVGB 1AE6L 3SCMB 2ISDA 2NY3B 1AKJB 4N24A 3OMIB 2GUOA 3AM8C 3CXHK 3V10A 4BK4A 5KAQG 2DDQH 2QPSA 1TTCA 4XGZA 4O58H 5EZLB 4YPGA 3TFKC 1JV2B 3ZKSD 3PV6B 5BUAA 4JFXA 5A2JH 1S9XB 5EU6B 4P57A 4PV1C 1KPUB 3SKNB 3FQRA 4G7YL 4L29B 3VRLF 4W81A 1MG3C 3CH8A 4LLMA 3MCYA 4Y5VB 1MFEL 4OQTA 4X80H 5KSBE 3VD1A 5J06A 2COVD 1QBLL 3BKML 3CQQA 2IQ9H 1T0NB 3D39B 4GKZB 4P4KD 2FATL 3NVQA 1H8OA 2A73B 5GJSL 4KWUA 2EEFA 3CXFA 4RIRA 2BSCA 5DJZB 1FNHA 2FZ3A 4M61A 3HZKA 3PJLA 3T4AB 3VFUB 1QX1A 3VXOA 3B3IB 2D31A 4PTTA 3VXUD 2DJMA 5CWSA 1N68A 3UPRA 1QOKA 3VFTA 1W80A 1NGZB 4KXZH 3MSPA 3H7BA 2DBLH 1DFBH 3BSZH 4WTWA 3L3OC 5FHBL 1LD9B 1PG7L 1A4KA 4Y19B 4QRQB 2DLFL 1PKQA 3FB5A 1WWCA 5F1OB 3LAFA 4UZUA 1FDLL 4G8EA 4BYHA 3L5JA 3ZDXF 1IL1B 4TULL 4JZOB 2BMKA 5C0CA 4XNXL 5HGAA 1M71A 4PRNB 1K2DB 2VITB 1C1EL 2V7NB 2Y72A 4X6FB 4ANXA 4X4ZA 1KIRB 4XRCB 3RVXD 3ZTNH 1VHPA 3NCEB 3QJFA 1IC7H 3K1DA 4C59B 4KI1A 3ROOA 1E6OL 2XPGB 4JFVA 2HFGL 4FXGC 4JQVC 3KPQA 1A7QH 2R1YB 1ZK5A 4GAYB 3QARA 4G42B 4ZXBA 4HETA 5D7EA 1WG3A 2G3MA 3GC3A 3CMGA 3P9WB 4JREB 4LAQL 5B3JE 1JXJA 2W88A 4MJJA 1FZKB 4TUKL 3K80A 3IRPX 4KMTL 4AQ1B 2ETWA 5KZCB 5DA0B 4PLKC 5DDHA 1NC4B 1IJNA 2A83B 32C2B 2YWZA 2AK4E 5HYIA 3G6DH 4CDHA 2I07B 3NRPA 4AOFA 2XQBH 5D1QE 3SPJA 4PJGE 3EJCA 3T9WA 3EH2A 1XB8A 3IJYB 2DH3A 1JHKL 2J2ZB 5GGUA 4OBSA 5CR8A 3PDOA 5F6HJ 5LXGH 5F96L 2YMOA 1WZMA 3FZUD 1XMWA 4XVUC 3HC0A 2AS5M 3PY9A 1TKWA 3A5VA 2X41A 2LLGA 3F62A 4GW4B 4GXVL 1OWRM 4OJYA 2CE6A 4MJ6B 2HH0L 5HJDA 1TJGH 1CBVH 1WAPA 1H3PL 3V7AE 5L9DL 5J3HD 2EH7H 4XC1L 2YC1A 1CQKA 1ZVNA 2J88H 5EUOF 3D4GA 1YEKL 4OIBA 3CZEA 5E5UB 5I15L 3DETD 2VZ1A 3A67L 3F7LA 2HUHA 3S98A 5FKAB 1K4CA 4N87A 1L9OA 4Z7WB 5DVNA 5CZVH 3W2DL 4LL1A 2G5UA 3KL3A 1FN4B 4FNLL 3NACL 2R59A 2WTOA 3H8NA 5C0DB 2NX5A 4MA1C 1FFRA 2DQMA 2DRUA 3RPKA 3EGXA 5ERWA 1IBYA 4LDEB 4UNTA 1WAAF 3BHBA 5T1JA 1M1XA 1RULL 3KLHD 2GSIA 4MJ2A 5TDPA 3FFCE 1VFAA 3FCBA 4DFIA 2D03L 4G8GE 1EDYA 3HW7A 3NPSB 2XN9E 2Q3ZA 4WUUE 3FT9A 1JNHB 3AREA 1Z9SA 2EDJA 3NQIA 3PE9A 5T5FA 5E2VL 1XIWA 4EI6B 3B6SA 4NNXB 3LPOA 4LDLB 4ZUVB 1MFBH 1UWEH 2I27N 1EXGA 4RFEA 1SYVA 3AY4C 4XMLL 1MCDA 2VABA 4WNQB 2IDFA 4XWGL 4JGJA 1E50A 4H1LB 5HHXL 3NCJL 3RHWF 4QXTB 4BWTA 3ZE0E 2BVUA 1ZPUA 3A24A 4MCYA 3QXVA 4HF5L 2ZYSA 4PS3A 5L0QC 1WBXB 2VOTA 1R5IB 4L5FE 4KHTH 3U36B 4KZEH 1CT8B 1EHAA 2A77L 3X13B 4G9DB 4IBYA 3UBXA 2OPCA 3NN8A 3K6IA 2ZKXA 3EJUA 2QQLH 1CE6B 3IXTA 1DQMH 2MCMA 2HFTA 4F9LC 3AREC 5D1ZC 1R3LB 4YHPB 4UV7L 3ZR5A 2CIKA 1TYRA 4XXCA 3QZWA 3DECA 4UT6L 4DP9X 1ZHLB 1KSRA 2ORBL 2DQEL 5C71A 1MLCB 1EJOH 1IGIL 4WO4A 3QO0B 4DCQA 3TEXA 3OMAB 2UY6B 5D93B 1IGMH 2O6EA 1RIHL 2LGNA 1KIUA 4W9GC 2EYRA 2CLZA 1RSFA 4Y4FD 5DJ0A 1JNNL 4MZ2A 3ARDC 1FFOA 4R7VA 4ELME 2C3XA 3UYOD 3GMQA 4NQDD 1TTAA 1MCJA 4FOMA 5CZRA 5GRXG 4BZYA 4S2SA 3QJHB 4XBEH 1TETH 2FE0A 2YS4A 1JZ6A 1XF5A 4UQ9A 4A7UA 5EC1A 5DJAA 4KMTH 1OT1A 4G1EA 2C4FT 2VSMB 3NZSA 5BOPA 4QRTA 2QPUA 4ADJA 4IRZH 4JAMA 2BVQA 3KLQA 4XVTL 1UM6L 1AGCB 3G5VA 4LSPL 1I4FA 4H5SA 4K9EC 4NN5B 1I9EA 3HPJA 3QP3A 3ZQ9A 4ZK8A 3LD8B 3UJTL 3SQRA 1OZTG 3PABA 1FORL 4LBAA 3GLEA 3R4DA 3KWWB 5JLZB 4JKMA 2OMWB 1AFVL 4PB0L 1BLNB 4QRSB 3O4LD 1XL6A 5I8EB 4FQ1H 4OD2A 4YWGH 3O11B 2XJLA 1BQHB 1RZ7H 2EXSA 1W0WA 2PCFB 5IG7A 1F3DJ 2CHNA 3L3DB 2Q8AH 5FCSH 1FNAA 1I8AA 2CG9X 3LNEA 1AQMA 2EE3A 1XB6A 3HC2A 5IEHB 2WB1A 2YKLH 1A7RL 2BNUA 2ZSVA 4IIZA 5CINH 2IH3B 5J11B 3BPNC 1JPGB 3OTTA 1Q9KB 1MQKL 1JWSA 4L5FH 4JM2D 1IQDB 3RWDB 5JHMA 1TITA 3IJSA 5D55A 5IBLD 4J3XA 5C8JB 3NGBB 1P1VA 4FHKA 3BLPX 2JKRM 4P2CG 2AVFA 3UYPB 2YSTA 3PWPD 5FYJU 1VGKA 3WLWC 1CK0H 4HJGA 1Q4NX 3KR3H 1U3JA 1UT1A 1OEZW 3C5ZC 5IB4B 2B0SL 4AQAA 3QZNA 5IROD 4MASA 3ARZA 4QDGA 4GQPH 4NN6C 4S0TD 3EOTH 4NRZB 1LDPL 1HH9B 2M2DA 3IDGB 2GT9A 4MAYA 5MENB 4OKVB 5CEXA 4YHNB 3DGGB 4JVWA 3GI8H 4APXA 3BXNB 3FUDA 1YLBB 5GS0D 5HVFB 2VL5A 5FCUL 4KNSA 2IQAA 3E9TA 3FQXB 5F88B 4PV9B 1AI1H 1OTUC 2O5ZH 1JZFA 3ARWA 1ETZA 4ONOA 5AKTA 1OGAE 1P9MC 1M4KA 2H6OA 2UYLA 4CL7A 1G6RA 3FU0A 1MW1A 3N0PB 3RRQA 1AIFA 4PWJA 3WAKA 1UJ3A 1OANA 4H0IA 4B41A 4ZI8A 4L4VA 4YH6A 3V6FB 1QTPA 2VTFA 2GEQA 5E4IA 4GRMB 4NWUL 3CQPA 1B4LA 1GGTA 1ZOXA 2EDLA 2MKWA 3BZDA 3MRJB 2CCVA 4G7RB 5C0EA 4U6YA 4DWHA 4PRPB 1O5PA 4GRWB 3D3VB 1RZFH 4FNQA 4FNRA 2UZPA 4I0PB 4TQEH 2G5BA 5DC2A 1BBDH 4EUPG 1N59A 3CZNA 3FCTB 3GMOA 2XY2A 1BYNA 4KHXL 4XX1E 1KB3A 2X40A 2DEYX 1J9CT 4Y4KA 3R8BB 3IPEA 2QELA 4HALA 5ICYA 1JK8B 4FQIL 1PFCA 1Z9LA 1P5VA 3EGSA 5D7IA 3AWGA 5G4OA 3VRLE 5AENA 2YD7A 3S5YA 1F18A 1JHTA 2XQBL 3BUYB 4NKIH 3GRWL 2V5SA 2NX5E 1IAIM 4ZQKA 3G9AB 4PWFA 1EMTH 4W4OA 1OAYH 1PZAA 3MU3A 4JVPA 1L7TH 5C07A 1H19A 4JO8A 4FHBD 5KVEH 2E9JA 5CGTA 2ZUTA 2Y36L 2L4OA 5D93C 5ICXB 1OO2A 3PWUB 3V4VL 3PGFH 3TH2T 5H37A 3U9WA 4YK4B 4JUTA 5D2LB 5I9QB 1RU9H 5C0DA 2Z1PA 2DIEA 1NBCA 4XBEL 1KB5L 3BWAA 5MERB 1DL7H 2H32B 4A55A 2ENQA 4WWKA 43C9A 4IDLA 1EXHA 2EYSB 3CWGA 1YJDC 3DX2A 4XP5H 1IC4L 2BVYA 3OB8A 1ACYH 4ZDHA 4YOKA 3B2DC 4TV3A 1DVXA 3E9UA 4XMWA 4F1SA 3GRWA 2YPLB 1UM6H 2CHWA 4NKDB 2ICWB 4LRIA 5A2KH 2CKNA 4E5XA 2QR0A 3JVFC 5CINL 5AZ2L 3A3YB 1U8KB 5EBLB 1AZVA 4G1MB 4WU7A 4UM9D 2PTTA 3PWVB 3DK0A 1ZT4B 3AJ7A 5AYUL 2CM6A 3H3KA 3Q8EA 3II2A 1HQ4A 4PRID 4FQJL 2FQGA 3SDYH 2VQUA 4QAWA 1YN7A 3D4ZA 1PDKB 4NAJA 4M62L 4QXUH 1EO8H 5I8OH 1D5XB 1VLXA 3B7YA 1S3KH 5E6UB 3D7PA 3KL0A 2B14A 2GIXA 2WGXA 1S7SB 3T0EE 4ESKA 1D7CA 1ZLEA 1U41A 2V5TA 5E5LA 2AI0L 5F7DB 1M7IB 2CRZA 2KYIA 3TASA 1XGRA 2DWEA 3S37X 2QZQA 1MAJA 4AMWA 2GTWA 1JN6B 2HJFB 4HKBA 2HMIC 3RVVD 1CE6A 1DVUA 1MFDH 5H35A 5HHPB 4WHDA 2ARJB 5I8CA 1LO3L 2IH1B 5JOEA 2EUWA 1C8QA 3H2WA 1PQZB 3QNZB 3NOIA 2YD8A 1FFTB 4LVNC 5CO1A 1N5AB 3D69B 1XF3A 4JFHE 3A4AA 3GMNA 3FB7A 3ASOB 5CILH 1NLBH 1RUKL 6FABH 3BEWA 1S7UB 2EVHA 1W8OA 2E7CA 2N7SA 2ZOOA 1NAMA 4O2EA 3MGTB 3TO4D 1H6TA 1E0OB 1HKFA 1U92B 3KD4A 3AS2A 2TAAA 4PCSA 2O6PA 1CMOA 1K8DA 2VDPL 9PCYA 3FQTB 3QNXB 1D6EA 2VERN 3IGAB 1U8JA 3K81A 1RURL 3FMGL 4Z95H 4Z0BL 2ZWZA 4ALAC 1C08A 1FAKT 2CO2A 5LNGA 4KRLB 5EZIL 1UD2A 1KGCE 1S9WB 2NY1B 1Y0LB 3GLAA 1BBDL 8FABA 1J0HA 1NLDH 4X2UA 1LO5A 2KS0A 4GI9A 2WWKO 3KBHE 3V4PA 4NHCH 2FEDC 3PL6A 2YUVA 4KY1H 4M9PA 3OKMB 3QHTC 4NQUA 2BX5A 4OLYH 4NWUH 1UFUA 4FN0A 2E86A 1AZZC 4PRBA 1QLFB 2X4PB 4OLEA 5JORA 5JPNA 3C8DA 3EF4A 3CUPA 2IAND 3VE0B 3O3DA 3QNFA 2BSEA 4J4PC 4BA0A 1OW0A 1QWHA 5TE6H 2HFFA 2VDQH 4G8FA 4RWYL 5I0WA 4OSUL 4HIEA 4B6ZA 1G9NC 4L2LA 5EO0B 4AY0A 1P5UA 2NMSA 2VWEE 2WUCH 3NZ8A 5I71B 1OE3A 5EMYA 1KCVH 4U1GC 3OKYA 4JREC 5D4HA 3PP4L 4Z0XA 3CXDH 1F13A 2HT3C 2P8MB 4KUCD 2XZQL 5IBUG 4JN1L 3CSYB 1A6TB 1KB5H 5T1KA 5EZLA 3KM1A 1JUFA 2TSBA 3SPCA 5MP6L 1IAKA 2YGOA 4RWHA 1YY8B 5JW4N 1EX0A 4HC1A 4WWKC 3UTTB 4P3WA 4YHOH 1MFCH 3ULSB 3BMWA 3QWOB 1NCWH 1WQVT 2PYFB 5D2NC 2HVKA 4HD9A 5IFAL 2IG2H 2NY4D 4QHMB 2Y06H 4ECNA 5IMLA 2C34A 1HHJA 2VUKA 5JMOC 2DWTA 3WIHH 1NM4A 2OMUA 3B9KA 4DPRA 1TLMA 2C7FA 2GFBA 4FFVD 1Z9NA 2QQQA 3ZYZA 3NIFB 3SE8L 3DNKA 3GBDA 4QO1B 4EI5D 4N90D 3S96B 3SKUD 4A66A 1SXCA 4ERSH 3TH4T 4PVNA 4PWHA 2QKIB 5DSCB 3FQXA 3CZKA 2Q76A 3BPOB 2OJZL 4LARH 1A64A 3RA7H 3JWDH 3IMBA 1SJMA 4NLHA 4UQIM 1EA9C 1QNIA 3IDMB 5JW4R 3K72A 3FYIB 4DP0X 3BFOA 3IF1A 5DVOA 1PY0A 1HEHC 4ZBJA 2ZWKA 4WFHD 5D1XB 1BFVH 2V5RA 1KJ2B 1V3JA 2DQFA 4PWGA 3HRZB 2OX5B 4ZS6C 5HJ3A 5JA8B 3L3OA 5HGAB 5A6IA 1QUPA 5IHHA 1B0RA 2A4ZA 2XWZA 1UURA 1N70A 4JY5L 4PRAA 3RIFK 2CR6A 3VGAC 4XCFH 1CLVA 4OZFA 5H8DA 2H9GA 4GSDL 2BP8A 1C7SA 2Z92A 5CILL 6FABL 4Y19E 4PJBF 1IQWL 3SPHA 4Y5VA 5FV2A 3GHPA 2VXSH 3APNA 4IU2B 4NPKA 1ZKAA 1MJ7H 4GXUN 3D85A 4G7SB 3WHE1 1WBXA 4ZXBC 1JYNA 2A73A 5T1LD 3FFOA 5BRZD 1RUPH 3VCLB 4R97C 1FAIH 1A7QL 2O4EA 3EH4B 1E5UI 2YQBA 2B9AA 1F02I 1DZ0A 1GZQB 1JXFA 3HLKA 4NQDE 1KBPA 5F3BB 4A63A 3NZHL 3GS4A 4I3SH 3UJIL 2R69H 1IAOA 1I1AC 1F00I 1WFMA 5TTRA 2WQXA 3ESMA 5BZDB 4A7VA 2W9EH 1RUQL 4U1JA 3AVEA 3Q9PA 3UP1A 4BZ1L 1F8TL 1F4HA 4HQQH 2HZHA 4G6ML 4D8OA 4FI8A 2E27H 1X9UA 2WZ0A 1KIUB 1CVRA 4MMZA 3UZEA 3W11D 4A7GF 1J1OL 4AX3A 2PPFA 4N5UA 4JPWH 4KKQA 4NZTL 3FC8A 3P3YA 4E9TA 4LPCA 1G4RA 3CHXA 1NCUA 4U1LB 1OCOB 5CP7B 5GGTH 3V5KA 3GTNA 1XMEB 1BEYL 5GRJL 5B1AB 3UZQB 5JUEL 4G6KL 3ZDXE 4XN2A 5IOPA 3ZKMD 3VXRD 2XPGA 3VD2A 2HVJB 4AL8H 4L8CA 4M4RA 1JV5A 2CGRH 2YAFA 1P4LB 2JI3A 3C2SA 5DD6B 3I9PA 1BFVL 4RBPH 3H2QA 5D71H 1B3JA 3VX0A 2NY2D 1S7QB 1OK8A 1THCA 2OMYA 4P5MA 4ONHA 2WBJB 1WDAA 3DUUA 4D0CB 4L9LB 3EJJX 3CDYA 3MNMA 3LV3A 4LLWB 3ESVF 1I82A 1NAKH 4M5YH 3LVTA 1MCPL 4LOUC 3BT2H 3B2VL 2AEWA 1U58B 4HKZA 5FO9B 2LQRA 1HQRA 2IGFH 1XIWB 2W94A 2L04A 3FTYA 2F5AL 3VGFA 1AO7B 5D1QC 1KCBA 4KKBC 1YEEH 4NQEA 3IXAA 4JG1H 4OCNC 1OAKL 3T8MA 1JWMB 2WZ6A 15C8H 3DXAE 4RFEB 4X4YB 2IG2L 3JWOH 4RDQG 4XPFL 1R0AH 1UZ6F 3SO3C 2J43A 3GKZA 3LZNA 1HL4A 4XCNB 2O72A 2LHAA 3OLGA 1HZHL 4B60A 2C1PA 3RU8L 4FADA 5D9SB 4FL4C 4M8RA 1XR8A 1GOHA 4AQ8A 1LEKA 1P53A 1NCIA 2NTSP 4M8QA 5I1AB 2VDOL 3IMRA 2B59A 1QEWB 1S9VB 4KJYA 4OGAC 3H9HB 4BEIA 3ROLB 3ZR6A 5ABDE 2CCWA 4PP1D 3WNNA 4DUXA 1HFUA 2P52A 4JY6A 3DKHA 3QJZA 2JJSA 4NFCA 1MWAA 1ILUA 1UUNA 3HHSA 3Q6GL 5FUZL 5I6OA 2IMMA 1JPTH 4DSYA 1NCCL 3KLAA 2JKNA 4TSAL 3FQUB 1K85A 3VXTB 2NUPA 3OKMA 5A2FA 1DCLA 4HK3J 1TG8A 3L1EA 3QFJA 4JJOA 5EIQA 1KBKA 1MCHA 3E6FB 4YLBA 4BKLA 5F1KC 1FFOB 5TPWL 4JZOA 2BZDA 1WIOA 4CMMA 1CFMA 2PP9A 1Q0YL 4OCWH 3VD3A 1I8UA 2N7BA 3LKSA 5KS9E 1A21A 1D6VH 2XWTB 5K93A 1LHZA 2RQ8A 2DEXX 2CBPA 1TQWA 3PWPE 1DE4A 1P7KA 4IEFA 5EG6C 1M2VA 1Z32X 4QXGL 3UJIH 4U1HA 4OVUA 4KTEH 1T6VN 3U9UB 4DKTA 4XPTL 1GYAA 1RLWA 3PS6A 4KDTA 3MRMA 4E41E 1VCBC 4KFZC 4GW1B 3ULUD 5IMMA 3LH9A 5DK2A 4JDTH 4X6DB 12E8L 1FZKA 4O4YH 1KCRH 4L48A 3ORJA 4NQSA 3CV5A 2LFGA 4G9DA 1V05A 5C97A 1MZZA 4PY7B 3Q05A 2EH8L 5E6ID 1SOKA 2KDGA 2Q8AL 3LDBB 4OZHB 1A6UH 1RUQH 3CX2A 1XGYL 4YHPA 4G7QB 2B3RA 1BQHA 5EOTB 1HYRC 4Z7IA 3OKKB 3QQ4A 3GSVA 3RTQB 2HLAB 4ZO9A 1KYFA 2GB2A 3K5SA 4Z7OB 5LJYH 2BNUB 3GTTA 3NFNB 4L3EB 3F2LA 2WCPA 3K4AA 3PHQB 4HWBH 4TSCH 4XC3H 4Y4FB 3S3BB 4X9FA 5D2LF 4X99B 2DQDL 4UNUA 4JZNA 4RA3A 4U1IB 1KLGB 4JW3A 3C5SB 1F41A 2IOMA 2VRKA 3AXIA 1C5BH 5GGSY 1G7LA 3KWXA 2KUTA 2CGYA 2VW6A 3GF8A 3P69A 4UOW1 4Y1AB 2OXGA 2HG5A 4LZKA 4ZDHB 4HJ0D 1CYGA 1JI1A 1QFPA 5C6TH 25C8H 3Q5TA 1QFWH 1W72A 4UCFA 3IF1B 3MLPA 1ND0B 2NT0A 5IW1A 4J8RA 2VL4A 1K2DA 4R2GD 4Z3HA 4F57L 2AGJH 3WUWB 4IRJD 4X9GA 3MC0A 5CEZD 2P44B 5J1TC 1EVUA 3EYSL 2A38A 3X3FL 3T2NL 3OR7A 1W0VB 1A3RH 3IFLL 4Y8DC 3BN3B 4UT6A 3U30B 3K71B 5ISZE 1E8XA 3O9WD 1P1ZB 5I8KL 1N5YH 5E4OA 5H4ZA 3SO5A 2R0ZH 5D2NA 3RGVA 5MI0B 2PCFA 5IG7B 3I02A 1NOFA 2G2PA 3FU3A 1U2CA 2P24A 4MHHG 3BRGC 3Q9QA 3MV9B 4XB7A 5B22A 4FTVA 4AI7A 2VISA 2IH9A 3FO2A 3KPRA 5CJXA 3HC0B 5D8JL 2ZUSA 4IQHA 2LU7A 4RRPA 4YHLL 4NWTH 3UTSB 2YD6A 1WZAA 1MUJB 3SB3A 3MMEB 2GAZB 1YPZF 1FGNL 3BDBA 1PY9A 5I30H 4Z7AA 4EI0A 1J8RA 2VXQL 4OLZL 1YYLL 3HAEB 2GABA 2PW1A 5AB9A 1ROWA 3MUY1 3ULUL 3FT3A 3ARDA 2F8IA 4NENB 4MAYD 2WXMA 4V33A 3BYYA 4OZHF 2WVVA 4TSCL 4XC3L 2ZTBA 3UGUA 4BFEA 3ARSA 2FB4L 3HE6D 1M57B 4HFWA 3SDXE 5LGHL 2H6UA 5J1AA 1T5XB 4G8GD 1U3NA 4Q6KA 4UILH 2UX7A 4I18B 4XXDA 4IRSB 5A16B 5CP7A 4B95C 1D5RA 2CMRH 4DGIH 3MRDB 3D2TA 4M5ZH 5IHZA 2XFXA 3BH9B 4PY8J 3OKEA 3IDXH 1S8DB 3U7WL 4DCQB 3FXIC 1CICD 3OD3A 3JTBA 1LD9A 2NQDA 3RZCC 1U93B 4WY7L 4XP5L 2BNRB 3ECUA 2X9WA 1JJUA 3MUGB 4MX7B 3M17A 3V9EA 3TNMB 3TWCL 4FC3E 1C5CL 2X6CA 4K8RD 2PO6A 4BUHA 5AW6B 1KLFB 3RKDD 4I0PD 4XPTH 1K72A 5E24E 5F6IB 1EAQA 2LLNA 5F1IA 1T4WA 1BD2E 7CGTA 3NSCA 3S5LA 1A9BB 4NQQA 2XYCA 3QIBD 1G9ML 5L2JB 3QYNA 4M7LL 1SRDA 1HQRB 2JMRA 1JGDB 1I1CA 3GSNA 3L6FA 2O6DA 1L6PA 2O5XL 3SIKA 3VW3H 4NPYA 4Y4KD 3KPPB 4JFUA 4GQZA 4K3HA 2HUEA 3WIFA 3I6LE 3OJVC 3PABB 4YFLI 5AZ2H 4DQOL 5CF3A 1K4DB 5C7XL 1JHTB 1U2YA 3NA9L 5I26A 5I1HL 2QPFA 1DQQB 1R5WA 1D5XA 2XN0A 4XPBL 3O6LL 4OD2B 5B1JC 4IBLT 3KPLB 1SOSA 2KZWA 3HB3B 1P9MA 3VD9A 3RY6C 3SBPA 3S35X 1NICA 2YMTA 3I6SA 4YFEA 1V3MA 4LT7A 3GQFA 5IB1B 3C6LC 1NUDA 3G6JB 2M1KA 4UAOB 1RJLB 3KXFE 3NCYS 5IEKA 4XBPB 1NLBL 3BWAB 3VQ2C 5MERA 4ISVA 5HY9A 4C56E 2WK2A 3Q1EA 2PXYA 2K7PA 1MWAB 2Z8SA 4OZGB 1CD1B 3MOBL 4UTBA 3VA2C 1EEZA 1YN6B 3GXPA 3IK2A 2W1NA 1E5BA 4AQAB 5T1LB 5GS1C 1PSKH 2VXVH 4KPHH 3BJLA 4GY4A 2YOCA 2Q7YA 1WCBA 3D0VB 1ECZA 3FRPG 1RFDL 4HGWA 2OMXA 1UOKA 2K9FB 2P3YA 3UPCA 3WGUB 5FW6A 2JKSA 4P2QD 3QISA 4KY1L 3QA3A 5JQIB 2C9RA 4LCUA 3OXRA 2B9BA 4NRYA 4GEIA 5BOZG 1PZ2A 4HK0A 2A6IA 5JXAH 5H37G 4ZOBA 4LLUB 5IVZB 5D1XD 3NJGA 4NC1C 3ABLB 2BDNH 3DTDA 4P46B 4YX2H 4R9HA 4MRBA 4OJFH 2VDQL 4MCMA 1E3XA 2Y7QA 3KWWA 2DWEB 2VLKE 1MAMH 1MFNA 2XIIA 4PRPE 2EDFA 3BKCL 4B53A 3IS1X 1G7HB 2MOQA 1T2QL 4M6MH 1ML0A 2JFCA 3DBXA 2VXQH 1CPUA 1FLRH 1N0LB 2BS71 4MNGA 2OMTB 1RUAL 2OJ1A 2X4QB 2P4AB 2V9QA 2EDNA 3E6HA 4YXLH 1CUOA 3UZVA 1OP3K 3VTTA 3OAYH 3OF6A 2ZJSL 4AVHA 3BGAA 3NIGF 4FFWD 4WI6A 5EU6A 4H8WH 2L0DA 4BELD 1IC5L 4P5TD 2DBJA 4PJXB 2HJLA 3KJ4B 1E4XL 3DVGB 2APBA 2IC2A 4UILL 5FW7A 1BQUA 1U8JB 4OKVA 1JGEB 1SDYA 2Y06L 4IMLB 5CEXB 1OHZA 1PX8A 2D7QA 4DKDC 3VSTA 5SWZA 1CLYH 1Z3GH 3KHQA 3PQYA 4YK4C 5I9QC 4GW5A 2OSXA 1EPFA 4UTAL 2C3VB 4N2AA 1QBML 2ZUYA 3PG2A 2NZ1A 3CLWA 5IFHH 2UUDK 4KAQH 4APXB 4MNQB 5ISZA 3W5NA 1MG2C 5KSBB 5BRPA 1JZDC 3LYRA 3UPRB 4PJCA 2R0LL 2X10A 2OZ4A 2ZG3A 2IPKA 3QZOA 3DV6A 4MZIA 5EOQH 2B1AH 2GSIB 5AWNH 5EU6E 5GIRA 5J12C 3ATEA 2WQUA 3FFDB 5TGBB 3UERA 5TE4L 4NKOB 2ZX5A 3ARVA 4RAUA 5DO2D 1MHEB 2NXZC 2XV6B 1MJJB 2ZX8A 3IKCA 3R0MA 3RGHA 2WUBL 2J3SA 3MFFA 3OLDA 3HJ0A 4N0CC 2J71A 3HN5A 2XVKA 4PSPA 3OVUB 1ZV5A 3T0XA 1JGUH 1WICA 4LL4A 5E6ZA 5LG6A 4M7LT 5E2VH 3D30A 1NFDF 2PTTB 3H42H 4P57B 4YDIL 2WWNA 3TS8A 3UC2A 1HSAA 3BP7A 1NANH 3RZWA 2NY2B 4WNSA 2MQGA 3O2VH 2JQZA 4XI5D 4B7LA 4K2UH 3NIGE 1SDDA 5FDYA 2G4EA 3C2AL 4QRRD 2I07A 4Y4KB 4Z7NE 4PJEE 4TF4A 3OGCA 4NZJA 4HOWA 4A2MA 4AV0A 2ED8A 4YSOA 3QUZD 1XFPA 2GI0A 5I1GL 5CZXC 3EJSA 5D7JC 4KXBA 1E2VA 5GGUB 5CMAB 2DH2A 3VCLA 4J3OH 5CAYB 4IOFC 1KXQA 2J55A 5EU4B 3V7AG 3ZE1E 4TQPA 2BCKB 4MVBC 2R69L 3GEWB 1BHGA 3CTTA 2HB0A 1Y18A 3EBIA 3H9SE 1FPTH 2ATPA 2GTZB 1LMKA 4UANA 4HBQA 4N2OA 5EDSA 5A3ID 1N6QH 4ZAKB 3MBXL 4F7PA 1TQCC 1MJUL 1I8IA 3NESA 4AYFB 3B5GA 4HG4K 5ALCH 2J6EH 2MFNA 2KKQA 1OPGL 2WSDA 4ONGH 4FG4A 2H32A 2GBUA 1XIWC 2YPLA 2EC9T 4IYKA 4KX8A 4IKNA 4OCYH 3WTVA 4JO1H 4XN4A 3REWA 1D6EB 3LZRA 1E8YA 3MLRH 3UOAB 4Z7WA 5MENA 3UGXA 4ZMZA 5KYYA 3S36X 1IAIH 2NOYA 2QDWA 1CQYA 3Q1SH 3QQ3B 1OAZL 1FL3B 1BVLA 3DUHA 4ZSOB 1YQVH 2YAMA 4I18C 2VGLM 5DK0A 5AVVB 4XOAA 3T4AC 4DF9A 2R69A 4U3CA 1NH6A 1QASA 4PWIA 2LAGB 1KTDA 1LO5B 4D7PA 2ZUVA 3SD5A 4YHZH 5AUMA 1O75A 4OR1A 1DDTA 1A1NB 4G80B 1BSIA 2Y5TA 3MLWL 1BVNT 2Y7SA 2FX7L 3FQ1A 4PJ7F 3VD0A 2BNQA 1INEH 3QVAA 1T04A 1XO8A 2J5WA 4LPVA 5EOCL 1KGXA 2QSTA 3MRGB 4P04A 4PJFE 2YPLD 3DIDA 5D1ZA 5EEZA 2X6VA 4JO4H 4W6WB 3ZT7A 3D25B 3APFA 3QI9B 3LH2H 4AGMA 3C60A 3LZFH 3CSTA 2WZPD 4L9LA 1MHPH 2CXGA 4P46D 4DOHB 1JNHA 3LNGA 5L88L 4GUPA 1UXSA 3UTQB 2YK1H 3MV01 3SSGA 4R7XA 4BXVA 4NS0A 2Y5QA 5ID1B 4HWEH 3D3VD 3HCVA 2FWOA 4XB3A 3TVMD 3PV6A 3NJFA 5GJTL 4GPVA 3VH8B 1WISA 5FO8B 4J3OC 1A6TA 5T1KB 1H5BA 2KLSA 2JK5A 4L37A 4YSPA 2FQFA 1T5KA 3NA9H 4H1LA 5I6NA 2P48B 1KNOB 2JNZA 2X70A 3GNMH 4RAVB 3ZKNC 5D7JB 1R3IL 1J1OH 3B2PA 1QBLH 2M83A 3CGTA 1N12A 1WIUA 1ZT7A 4U0RC 4CN6A 4DKAA 1RZ7L 1ZLVH 5A6MA 4NZTH 2WVSA 1NWOA 5DS1A 5HYQB 4OI7A 2EC8A 4R5TA 5B1KA 2E4FA 3N1QC 1BBJA 1YNTF 5DRNA 3DGGA 2AW2A 1J1PL 2AXGB 4FJZA 2AV1A 5ALCL 4AL8L 1TTUA 1J5HA 1ZLVK 3FUMA 5TK4A 1DLFL 2GIMA 1VJSA 4WI0A 4PV9A 3Q6GH 4XNXH 3ROLA 3HFFA 3QUYA 4Q0XL 4W9IC 2NUTB 3BKJL 5DHXB 4A6YH 1ADWA 3H7BB 1VA9A 4NC2B 1AI1L 5DS8B 1AZRA 1HT6A 1I7ZA 2BLFA 2DLFH 3B34A 3K8KA 4UTBH 5KSVA 5DR5L 4P5SA 1V55B 5DURB 3TO2B 2MNUA 3BPLC 3HI1A 3GHEL 4N1EA 5INCB 5TPWH 4AW4A 3UTZA 1QSVA 2CO3A 1OM3H 1HH6A 4TKWA 3QJTB 3HUJB 5IMKB 3GUTA 5AOLA 4M6OH 1BPLB 3LPFA 5E6RB 2VN5A 4JRXD 4QCIA 4LE8A 4K5OA 4U4BA 5DMJB 3O2VL 3O6FA 4NQED 3GIZL 2G60H 2F54B 2W0FB 3GHBH 2J8OA 2BFVH 1I1AA 4NPJA 4ETQB 1AQKL 1RZJH 2AF2A 1IV8A 1CGXA 3WXWH 3DOIA 2QTVA 3MV7A 4OT1L 2VLJA 4YX2L 4PG2A 3HMWH 2ENPA 3UGEA 1S7SA 1BVOA 1XV8A 5DDHB 1YRKA 3BAWA 3NPSC 2MPAH 4JFZH 4MMZC 4NO3B 3SDCD 3ZDXB 2Y2TA 5C2BL 3Q0HA 2AK4A 5FA3B 3MCLL 1M7DA 4I3RH 4WW2C 4CADB 2CIIA 1RIVH 2ADIA 1NEZA 3HLAA 3L3IB 4HFWB 4NZ8A 4CAGA 1GVIA 5T1DL 3WENA 1JHKH 4TPRH 1EJ6A 3CAFA 4IRZA 4I48A 3UAJD 2J8UA 1ZS2A 3B2XA 2DQDH 2PP8A 3PGDB 2W60B 4GMTH 2R27A 3PL6D 1FZMA 3WS6C 5DQJA 2IAMC 3QUKB 1IL1A 3TNNB 1HI6A 3RFZB 1B3IA 1ET7A 1U3HA 5CU5A 5D1XA 1AACA 1JMZA 3QJHA 3BXNA 3ZE2E 4B9JA 1I9RH 4U1LA 5MENE 1DVFD 35C8H 1DSWA 1T5WB 1UUSA 4NKMB 3BWSA 5EZOL 2XJKA 4ES9A 1Y7VA 3E0GA 4BJLA 4Z3JA 1J0KA 2IF7A 2M8XA 4MBRA 4LEXL 3UDWA 2O61A 2YD0A 4HWBA 3KLDA 4FQXD 3QW9A 3BAEL 5CCJA 1XEUA 3QI9C 4KZDL 3PCYA 4NLAA 1YO4A 5DEJA 5E99L 5L88H 2FJUB 3CD4A 4NXKA 3LXAA 5C0NC 2CCLA 2XWCA 3FU6A 5I8EA 3WKYA 2MIZA 1SM3H 4POZC 5IJKA 2NR6A 3V0IA 3SZKC 3UBFA 2VQ1A 2ICWI 3VNYA 2Z7YA 1Q1JL 5HJGA 4MNHA 3ZHKA 3BUDA 1O9VA 3PDOB 3FCTA 1JZ5A 1QR1A 2H2SD 4NWTL 5H35B 1LWHA 4MNQD 4JPIA 3D3VA 5HYJB 1IFGA 1X5HA 1RP8A 2HKHL 1R3HA 3MLUH 4KUZL 5LCVL 5FYLH 3D33A 2UXFA 3WMSA 2A74B 1A2YB 4Y5XA 5E8OA 5GJSH 5LBSH 1A14H 3MOAL 3QXDA 5I1KH 1GGUA 1S3KL 3T3MB 2ADJB 4UT6H 4ZPVA 4WI2A 1C12A 1KOAA 1MFUA 2CD0A 2WBJD 3CFQA 4Y1AD 1EEZB 3MBED 2PO6D 1FIEA 5FOBA 3C5JA 3TPUB 2JKTM 2B5IC 4N25A 5KVDL 5HHVH 2QQLL 5E9DA 3L1OH 1FGNH 1RHFA 4QRUB 1FN4A 2BHZA 2DMKA 4LF3B 4JRXE 3N1MC 4J8RB 5B39B 3BI9X 4TN9A 3DVIA 1DBKH 1VPOH 2CMRL 4FQ2H 2DV6A 1EZSA 2VXUH 3QQ3A 1I3VA 3BVWA 4JQIH 2XBTA 1IM3D 4EI5A 2DIBA 1J8HE 1P6FA 2NXYC 3QPQC 4EZLA 5A16A 2XXFA 1ES0B 1YEIL 2QVTA 2FEEL 3FQNA 5ES4B 2OMVB 4FQLL 4LLQB 2H1XA 4OD3H 4MQSB 3VD4A 1EEYB 4MXQD 1A7PH 2VDPH 1JNNH 3MCKB 4EN3B 4PSRA 4MD4A 2EYSA 4F91B 4H0LC 1FO0A 5ACZB 4GG6B 1OAZH 1RL1A 3U6XS 2BINA 4I1RA 3LDBC 3F7YB 1H6UA 3MUHL 2P8LB 4JFHD 1DQKA 1Y6NR 3NEOA 3EDEA 4KJQC 3O3EA 4I0PA 1ASQA 2FQDA 4OIFA 2COQA 3HPLB 4NERA 4U3HA 3EJTA 3WDIA 4YBLB 4QD2E 4WU7B 1GIGL 4NQEB 2Z8VC 3R8QA 4YVUA 3E80A 4X98B 3MODL 1JGDA 2J12B 1ZLSL 5EEYA 1CICA 1VADB 1VZHA 4FCHA 5I1HH 2FR4B 4IHOB 1JERA 1XGRB 2VZVA 5DJ2A 1U8NB 32C2A 4WW2B 1DEDA 3EYOB 4WI9A 3VXSE 3Q2WA 3HG0A 3ARGB 1OY3B 4UV4H 4BD4A 1QLEB 3TWYA 2ZOLA 5FWRA 3EHBB 2V17L 1CD9B 1DVYA 2Q7AA 3F58L 3WTUA 3ARBC 4G43A 3L5IA 1FGVL 2E75C 4DGIL 5J1SC 4GQ9L 2B4CL 2IDUA 2VR3A 1Z0NA 3HHSB 3S37L 1AGEA 1LVEA 3U6XA 2HRHA 2WKGA 3IBEA 4WZ9A 1JBJA 1DQDL 5E2WL 5ISZB 2CAKA 3ARPA 2C3WA 2D7PA 4GUQA 1KB9K 3L1OL 3M7FB 5DSCA 5F2FA 3VO0A 2OW6A 5A7BA 3CFJA 1A3LL 2X9YA 3C5SA 3L9EA 4C58B 4M7JH 4OZ4B 2ITFA 2QDVA 3TNMA 1X4XA 3OXSB 3ETSA 5BUGA 2EINB 1U8CB 3MRKA 3HA0A 1A25A 5E6IA 4GI8A 4OFYA 3TL5A 1DUYA 1AQHA 3TYGL 3U1PA 3UMTA 1GOGA 2CHXA 3IFOB 5B38G 2JI2A 3O4OB 2FJFB 4YZFE 3ULVD 3B4NA 2VDLB 2BSSA 1ZWIB 2HT4D 3WE6A 4R0LA 3TZVC 1E28B 4FG2A 3VI3A 3MA7A 5E99H 3B43A 3ELQA 1HAUA 5CJXC 1TQBB 4ZPTA 4TVPH 2G9KA 1BZ8A 1OQOA 4PCKA 4FQHB 3HZMB 3L4ZA 4I85A 4DP8X 2JCCE 3CZSA 5D70L 3EYQC 2NTFA 1KC5H 3ECWA 4YDKH 3KXFB 3S9DB 2DYPD 2PPEA 4OGXL 5IJBC 3WNIA 4GG6F 3LV3B 4XP9L 4U1MB 3VFOA 1L3WA 3K6SB 4MQ7A 1O6VA 2ZAIA 2Y7MA 1WITA 5CFAA 3MYJA 3OB0H 1WZ1H 3OKKA 4BKTC 2H45A 3I02B 1JN6A 3MLUL 4KRPB 1RK1B 4WWID 1M2OA 3L4VA 2R2HB 3MOAH 2V3EA 2AEIT 3IBOA 1BV8A 4JPVL 4TQEL 4X6CA 1EXUB 5AKSA 5BZXA 1YSOA 3KDMA 3EFDH 3NZ8B 4QRPE 5KZCD 4HBCL 2OL3B 5F0PB 3B2UC 4XNYL 5HD8C 3QO1B 1FHNA 1AD9A 1IC0A 1DN0A 4ZFZB 2XKSA 2Z31C 3FOMB 3EJZC 2IANB 5DQJB 4FQ2L 3GMLB 2VZOA 3SCMC 1TTBA 5JA9A 4I3GA 4PP2A 1F8TH 5FFOA 4ODSL 1I8MA 3AAZA 5KVMC 4YHYB 1OGAD 1C08B 2D2CC 2VR9A 3KVPA 4ANUA 2CO4A 2VL5B 3FBKA 4UAOC 5SWSA 4LRNH 4CSSA 3NSDA 3ZTJH 4PN6A 1XF4A 4OD3L 2VLKB 1WTLA 1T0MA 5DK0B 4KROD 2E9GA 2PR4L 1YPZA 5I1DB 2IOOA 3N44F 4RGNC 2QV4A 3QNYA 1WFTA 3RX9A 1CFSB 1SEBA 1SVZA 6PCYA 4DW2H 5HGBA 4K7PX 2YEZB 7TAAA 1E4JA 4GAJH 5D7LA 3L7EB 5AVQB 4AQ8C 2I9LA 4HW6A 2YD9A 2P46B 2QEJA 3LIUA 3RILA 2YSSA 4WW1B 4GMSL 1S9KC 4ZMYA 1DLHB 3B9EA 1YEJL 3TESA 1U4FA 2AFNA 4U1NA 5F89B 3C5ZA 4ZUTB 5ACMA 3DPBA 3SHSA 3N50A 5F0JB 1THAA 4LASH 1LEGA 3QFGA 2RHEA 4X9BA 5C0CD 1RMFL 3VXPA 2YARA 2VQ1B 4RA0C 1WP6A 5I73C 4O02H 1XL4A 2E9WA 2VW7A 3BCFA 4LCIH 2R9HD 5CCGE 3QR0A 5IFJA 3RE0A 1QQDB 2ARWA 2WQRA 4UQDA 5CGMA 5D1ZI 2TRYA 4CILA 1YYMH 4L8SC 1WEJL 1MDAA 4Z6AT 1FO0L 2BW5A 3I50H 3BRFA 4ODWA 3EJQA 1U3HC 1A8JH 3B9AA 4OZGF 5ANMA 4IKJA 2XRAL 1RH8A 1UASA 4K4KA 1NUNB 7FABH 1WPCA 3N04A 4CN4A 3GUFA 5SWQA 2VDLH 3Q6FB 5CP3A 3TXAA 2FTAA 2YXMA 3TT3L 4HOZA 2GFBB 3B56A 2IGFL 4XVJH 5FUOL 3MFGB 1SXNA 3ZY7A 3WJMA 4ZQTA 4HHWA 1JTTA 3D39E 1H6EA 1NCOA 3P4NB 4JRYA 1GJUA 5DRXB 5B4MC 3GSUB 2NQ3A 1NBZA 1R17A 1JPFA 2CPCA 5J6GB 4K3JH 2ZWSA 2WQVA 4AKPA 1DO5A 1EH9A 5F72S 5IHZB 2ZCHL 4EEEA 2AXHA 4LP5A 2DM2A 2VLME 4AIOA 1OF2B 4UQ3A 1T7ZA 4OGXH 3MXVL 4F15C 1S2EA 1RUML 3F5WB 5LG1A 2Y7LA 2Z91A 4NDMB 1FWXA 4ALAH 2YBGA 1SQ2N 4DESA 1X5ZA 2APSA 3WKPA 4ZW5A 1FHGA 3OSVA 3OWEA 3BLKA 5BO0D 4FG6D 4AKQA 3NJHA 3QXAA 5ENWB 3APDA 5DQ9A 4ODXA 3RB7A 1OAQL 1UQSB 2QVMA 1KN4H 4QIRA 4AL8C 1WE5A 2RFXB 3SKOB 3ARQA 4C56A 2AXFB 1C1EH 4ZT1A 2WTPA 3MRNB 4HULB 3JWDC 4MB1A 3MV7B 2EIBA 5AKVA 1P4IH 2PWHA 3SEPA 4YMPA 3GEFA 1YQVL 3U4KA 1FSKB 4GO9A 2J8HA 1U8MB 4TTDD 5EIVA 3RBGA 1N8ZA 4YDZA 5KVEE 1QRNA 5LXGL 4JM2C 1AR1B 3EZ8A 3FPXA 1OTTC 4Y9GA 1GZHC 3J07A 5IBLC 2CO7A 2EEBA 2E8ZA 2ADGB 5T3ZH 4DZ8B 5C0RL 3P0VL 4JHWL 2FH6A 4BFGA 3DGCR 1UA6L 4Z0BH 4D0DA 1JGIA 2UVFA 1D5BB 4I13B 5I66A 2HWZH 1U92A 1ZTXL 2FYYB 4PJ7A 4B5EA 1X5LA 4L1BA 5F97E 4Q6IB 5IROC 4UU9A 2YAQA 1Z6JT 3F7VA 5DHVA 3TJHC 4LCWB 4I5BA 4D9RD 2K78A 2X6UA 3FN9A 3CPLB 3D5OF 4UDUB 5EWIL 5KVFL 1WCBB 1OCCB 4M7KL 1U8CA 3IRZA 6CGTA 1AANA 1C5DB 3T2PA 3IU4H 3IMTA 1Y0LA 2WO3B 3MLVL 2CM5A 1W72B 3H3PH 3QIUD 1VAHA 1SY6L 2XFXB 3E8VA 1CFTB 5IUCA 1ZAGA 2XACC 3OKEB 1A7BA 4Q0XH 4PJBA 4WCYH 3V6OC 4RAHA 1YEWA 3K5RA 1UVQA 2BNQE 1CTNA 3MO1B 3VFSB 4NXSA 3PWJB 4AT6B 3JWDL 1J1PH 2WYIA 4U1SB 5F3FA 2F08A 4IU3A 5E5MA 4L8SA 1DBJH 3DJRA 4V2CB 1CZ8H 1L9PA 1PTZA 5PAZA 2E9IA 2X4OB 3I9GL 2DMBA 3L4TA 4G59C 5HI5D 1L3NA 4LOEA 4GUPB 1N0LA 3BJ91 3RI5F 5KUMA 2XICA 3D0LA 3MGOA 4WSJA 4YHML 4FTVE 3EXJA 2AJUL 4LU5H 4XTRD 3A6BL 1ZT4A 2ZXDA 5JIPA 2NW2A 3HAEG 3EYSH 3OKDB 3NCMA 1DSFH 2BP8B 3L95A 5CSZA 1B6UA 4BIKA 1MCWM 3MLXH 4URTB 5IOKA 2FECL 2C8NA 4GW1A 1ID5I 2H8PB 4M7ZB 5L2KD 3QEUA 4JMNA 2R4RH 4NI3A 5JQ6H 4NGHH 1JTPA 2ZF9A 5GZNA 3MCLH 3QEGH 3TTYA 1IEAA 5A43C 2A0LD 1MNUH 4S1SH 4MYWB 4YS4A 4E36A 4WVRA 3L3KA 4ELKB 4MCNA 3S3PA 3CFDB 1FBIL 4PJIB 2X6AA 4F20A 1JZGA 1F4XH 4GRWH 5DLML 3MI6A 2HLAA 2NZIA 4GBXA 2BXZA 2M26A 4ISVB 2JB5H 4OFIA 2YXVA 1B2WH 1NJ9B 4K3GA 5GGSB 4JKNA 1JPST 5C0AD 4F7PB 2D3NA 1N0XH 4IHBA 3JVGA 2IWGA 3L7FA 4WFGD 5HYSB 3JQOB 3GKWH 5A2LH 3NP3A 4PIBA 1RSYA 2IWEA 5F7FA 4KK9C 3OAZH 3BD4A 2GTQA 1CLCA 2H47C 3ESUF 3JTSA 4XHQA 1MHCA 2WNWA 4X8JB 4L1SA 1P4UA 4NZUH 4OB5H 4JANB 3QDGB 4P2OA 4BK5A 1UXWA 4YBQC 1EFQA 3VXSD 1GSMA 5GISL 4JNXA 2DQHL 4YQXH 5J89A 2IWKA 4R4FH 2W0PA 4M6AA 3BVNB 4PU2A 1RZJL 1S78D 4XX1G 2VZ3A 3GSNB 2BRRL 3NDZE 4YC2B 2X1XR 3AXLA 2DM3A 1S7QA 3WBDA 1DFXA 4MWFB 5EC2A 1CGUA 1R33A 1HHGA 4BQ9A 1FVCA 1GGBL 1SDDB 3RNKB 3MLSL 4PGCA 4RGMC 1MXDA 4QR7A 1N9PA 2KPWA 2W81C 4UUJA 1W72H 3W0WE 3O8XC 1HIML 4H8UA 2EE0A 1MCOL 1TTFA 1NWPA 2X1WL 4JN2A 3BLBA 3MRLB 3X2QB 4KY2A 1D7BA 4RDBA 3KPRB 1T66C 1S7WA 2GJRA 2V2WA 3Q3GB 4AG4H 1Z66A 1BG9A 1H0DB 5E51A 3DX9B 3SDAC 1UWGL 2E7HA 4KITB 4G9FD 3K74B 5F8QC 1JFHA 2VLMD 3RY4A 3TCLA 3TNNA 3FCSB 3HBZA 4N0RA 1TJHH 3MPCA 4JCWA 5DJCB 5TDOB 2G0LA 4FKEA 5DMGC 2F9BT 4AUUA 1IBGH 5E1HB 3VTMA 4ABUA 5I18L 5I6KA 1IZJA 1TVHB 1EEQA 1FL3A 3PWPB 3UTOA 1YVLA 2WWMC 2APVA 2UWEA 2HKHH 3LNDA 5JPNC 5FYKU 1OP3H 4GW5B 2H0FA 4KO7A 1S7XA 3CLEH 1DVFB 2VXUL 3BZ4B 4JG5A 4TNWK 1QNZH 2IVFC 3OHXC 5EU7C 3T0WA 1TZAA 5LAPA 2AXGA 1TQSA 2BWDA 4KVNH 4MNQA 2AVGA 3KPRD 3T4YB 4FQXA 4A2GA 5J56B 4XVOA 2Q76B 5CD5C 3O81A 3MJ7A 3QIUB 4PJCE 5AD0B 4M1CD 2NXZB 4HHAA 5ALBL 3VFRA 4YEEA 2WXHA 1H9VA 2W07B 4OJCA 5TD4A 4PW3A 2P49B 4C4KT 4JRWA 5KEZA 4OM0H 3WG7B 1IJ9A 5LWYH 5EIIG 3W37A 1NOLA 4IBVA 1AXSA 1F2QA 5BZWA 3TBTA 3IKCB 5JHDB 3ULVL 3KW7A 2EVFA 1BDYA 2PXYC 1BJMA 1G7QA 3D1MC 2FH8A 2HT3D 1MF2L 2KBGA 3ALXA 1AC0A 3PWVA 3VGEA 4FTDA 5I5RA 3FRUB 4TSBL 4AQZA 5GXBB 5JHLH 1M2VB 5EUOE 4L0YA 1FP5A 4UINH 4KK8D 1OAXL 4MNGB 5J8OA 1D5IH 1OIOA 3UTPD 4UQBA 2CJTA 3P73A 2BNRE 3UC0L 3ARFD 1AXIB 4GBXC 1FV1A 3UAFA 4J6RH 3N5AA 4Z9KB 3RWFB 4HKJB 2VLRB 4KHXH 1MAML 4B3VA 5KVDH 3FYEB 2IDTA 4NQVA 4LMQI 3X11B 2JB5L 2F8OA 1JRHI 1ZLDA 1A6ZB 2H6PB 5J1AB 3BGMA 2AMGA 4JRXB 3KVDD 3MODH 1ZLSH 4WUUA 3PLYA 4TNVK 1CG9B 1PKOA 4WV1C 3ZT5A 2C9PA 3HVNA 1A6VH 1E43A 1MXGA 4LP4A 2VDKH 3BEWB 2LV4A 3LZPA 5FM5O 5GQBA 5L4MA 3DDGA 1N19A 3EYVB 3KLAB 4Z77B 5CCKH 3SKMB 5D7KE 4F2ME 4Z78A 3ESNA 4KK6D 1MVYA 3QUKA 2OTWB 3CLEL 5IGXL 1G7LB 5EOCH 1CLOH 1FGVH 5F0MB 2Q6WA 5CCHE 3HG2A 4KVCH 4YZWA 1BZ9B 4XX5A 5G2NA 1JGLL 4JFFA 4NO0A 4Q9QH 3MN8A 3MACH 2YBRB 5AVUB 5E00A 3O2DL 4XR8C 4XCEB 5DEGA 1HH6B 4M7JL 3GJEA 2D7TL 5KSAD 5I71C 2PTVA 3FT1A 4XBGB 1TJIH 1FNSL 3O8XA 4YGAB 3Q06A 1SMAA 3BPCB 1GCYA 3ECBA 4C83B 2VKWA 3BC9A 5IMMB 4G6AC 5AKRA 1XXFC 2UXGA 3IWUA 4HJEA 3WTYA 1CGTA 3TOPA 1NEUA 1I1YA 3CUPB 4ZXBD 1ZHNA 3VE0A 4B9YA 4E9VA 3M46A 3RI5K 4W9JC 3HBPA 1FFNB 3S36H 5SV4A 4KO9A 2IPUG 3G04A 3AWEA 4Q2ZA 3L2MA 3QRBA 1CWVA 4GRLB 1G7HA 5D2NB 2PF6A 5I30L 4HUUB 4CC0A 3EJYC 5L6YH 3KGTA 4AG4L 1R4XA 5DFTA 4AZUA 4WJ5B 3QIWD 3WIHA 2VT0A 3HZVB 2Y7QB 4HFUL 4LGPB 2AZUA 3SO3B 43CAA 4XNDA 1SJEA 5M7QA 1BCIA 2Y3AA 1HOCB 3D50A 4KMQA 2W5PA 3PXLA 4PB9L 2HFEA 3SGKA 5FPIA 4LVEA 5JW4M 5JYMA 3KJ6L 4R83A 5FOJA 5D6CA 1DQDH 3RWCA 4E5XG 3QUHA 4CC4A 4DN4H 4AYBA 4AQEB 25C8L 1DQML 1K6QL 3B9KC 3SODB 1ZGLB 2FIKA 1CDCA 1GPOL 1QD0A 2PN5A 4LSDA 1IE4A 2YQ3A 4D9LL 4L0ZA 3UACA 1I8IB 4AYFA 4EOWL 3QG7H 3F83A 1LQBC 5CSGA 1QSEE 3F65A 1F6FB 2WXQA 3QWRD 2JSFA 2IANA 3OLEA 3D18A 2KMWA 1QFUH 3GMLA 1J05A 2EKJA 1MELA 2ZP0T 4KJWD 4JFSA 1N3NA 3DTXA 1HILA 5DRNB 4Z3TA 3T6QC 2QADB 1A3RL 2YPLE 5HDBF 2VJ8A 1A8ZA 4LBEA 1USQA 2XKNB 1UWEL 5TK2A 3DSFH 4D7BA 3KYAA 3PQYB 5DZLA 3MRDA 1GZPA 2CRMA 3CDZA 3JTTA 4XAKE 3X1BA 4CMHC 3IDXL 4JY4A 4CSPA 4IGBD 5JR1L 1A3ZA 3DRQB 4NUJB 1LWRA 3KJ4C 1Q9LB 3IT8D 2GW5A 2JCCB 2MCPH 4CN1A 3DROA 4KDVA 4QAMB 1FZJA 1L9SA 5KYUA 1NC4D 3UBXG 1SN2A 3WY2A 2VMEA 4HMDA 4MNHB 4N0YH 4OLWL 1SN5A 2GKIA 3IWVA 2XFGB 4LOFA 4MWFA 5EC2B 1NC4A 3ZO9A 4K55A 1L5GB 4JS7A 2ZXGA 2BSBA 4GKSA 2PPDA 4Q6IC 4OLZH 2W9LA 2F53D 1MUJA 5F9OL 5BO1L 1PVHA 2A6KB 2HT2D 2BRQA 5HSFA 1ZANH 2YUWA 1JVKA 4RSVA 2C3GA 3ZKQD 5ITBH 1WHPA 4U1GB 2P45B 3L6FB 5AVTB 2NY6C 3EFFB 4Q9RH 5B8CC 2VUOA 2BVPB 1MHHA 4HVBA 2OA9A 4I1NB 1D9KB 5E4AA 3TONA 1KIQB 3MROA 1E9PB 4W9KC 2EIKB 4AITA 1G5GA 1R47A 3ARED 4N28A 1FG2A 1LE5B 3T65A 3QJRB 4F7EA 1J5OH 2Q86B 1JGLH 4HU2A 4W4NA 5B39G 4M02A 5C0CE 4AYDC 2ESVE 1EDHA 2FGZA 1GA2A 4HMCA 1QPKA 2F1BA 1G1CA 5KBNC 4X83A 4ORGA 1NIBA 3AXHA 3KHOA 4FFZH 2XQYK 1CK0L 3GMPA 2D7OA 3FQNB 3CHRA 5AZUA 1X5KA 1AGEB 1MCLA 2X5PA 3HIZA 2VDLL 3X3GL 4EI5B 3JV6B 2BIMA 5D7LE 3GSUA 5J6GA 4U0RB 1G7PA 2W91A 4U0QB 2AJZB 3VXME 3CNKA 4ZAKA 5JMRA 4NO5B 3WS3A 3IETA 3O4OC 3PQYE 1RULH 2QADC 4ZFFA 4LCCC 1U6AL 5TH2B 4TNWF 3A21A 4MQTB 1BOGB 5F7UA 4LSTL 2HN7B 4QGYA 3HHRB 1HSBA 2E7LA 5C0JA 5AALA 1CDUA 4KDTC 3DO7B 3JYCA 1XAUA 2DLEA 4AWJC 2KDYA 1RP9A 1T1XA 3NJVA 4XCFL 1AQ8A 3AY4A 1SHMA 3X3FH 2JJSC 3G3LA 2OYKA 2SEBB 3HRPA 4DGVH 4ZUSA 3MJWA 3HPLA 4J1UA 4TUOA 4FE9A 4KUZH 1KBGH 4ODHL 2NCEA 4PJ9B 3TF7C 4XCCH 3DX3A 2EE2A 1QLRB 2CZNA 3I50L 2QVIA 4ZX5A 4MSWB 4JLRA 3RDTA 3VVVA 1NPUA 5DQDH 4B9FA 1LDPH 4AM0A 4XHJC 5EF0A 3BGFB 2H4EA 5E95B 2DWDB 3NZHH 4I3SL 2JQMA 4HZ1A 4P2RB 4Y4HD 4NRXA 1P4IL 1FH2A 4PGEA 3MYZA 2I7OA 1FYHB 4JZJA 3T8VA 3P11H 2CDGA 3RPIB 2WBKA 2FLMA 3GSQB 4OZIE 4GSXA 4I48B 3MNVA 3DHUA 3LEVH 2P7TA 2EIEA 1QFUL 4P23B 4M00A 1WRFA 4UQ3B 1L0XA 5E6IB 1D5BA 4OCRL 1M56B 5DVPA 2WCSA 3WOVA 4OH2A 5FOBB 5C2BH 1A6WL 2ZKHL 5E1GA 4P2OC 4BK5C 1T4KA 3VMPA 4AVKA 4G6MH 3TJEH 3H9HA 1UA3A 4G70B 5IB2A 3D0AA 3PWNA 2R1WA 5E6SB 3DX6B 1LEIA 1VFBB 4FEMA 5BO1H 2XN9D 2BM3A 2V0AA 1UCBL 4KJPC 3BN9C 4HV8B 2AV7B 3BGFC 4CJ0A 4HLEA 1JRHH 3POCA 4OUUB 1HXYA 3WO3B 3SPIA 4HAKA 4XNMA 2VUYA 5BS0A 2XDHA 3QZPA 4UDTB 2GQHA 1O6SA 2I9LB 3CDGB 1E9QA 4L8DB 4WNJA 4KQ3H 3I6LD 5B8CA 1J9SA 5IMKA 3QWRA 4FXLA 2B08A 1QA9B 4ODUB 2WSKA 1RK1A 5F7EL 2I5YH 2XWTA 1UJ3C 3A23A 5AB2A 2OMWA 3M1BA 4K94H 4KV5E 5DJ8A 1G43A 4QRSA 1CO1A 4JDZA 3O6FB 3RY5A 4K2UL 5FO7A 5E9DD 5IBUB 4XZ4A 4YDLC 3N85H 3C8HA 3RL1B 4PBVC 3JWOL 3N06B 3SE3A 3QRGL 5T1MA 4PVLA 5I1CL 1T1YB 4Y2DA 3KXFD 2HX9A 3X3GH 2W0FA 5MHSE 4KTYA 3FU7A 4TQHA 3ARGD 4R4BA 5IF0B 5IW6A 2R23A 4QNPE 1KPUA 3SKNA 5A2BA 4UTAH 5CUSH 3ARBB 4YLCA 3RWGB 5L7XH 4WHYG 4FFZL 2W95A 3QCUL 2ZICA 5GS0L 3D34A 3SGDI 4A37A 4HJGB 3KPOA 4P5KB 3P0YL 4XO8A 3O41A 5FR3A 3PREA 1DJYA 2AP2A 1R3JA 2APXA 4JFED 2PETA 5TQ2L 2CQVA 1KXQE 3F01A 1CFTA 2W60A 2BWQA 1RJLA 1KJ2L 4KK5C 1KCLA 5GGQL 1IILE 3MQIA 3NRFA 2IPKB 2IQAB 2A9ML 2VMJA 2OZ4H 2DQUH 3FSVA 1L6ZA 2YKKA 3CFKA 1NIDA 1PAZA 1NGZA 1YDPA 5EO1B 1YMMB 1BQRA 1XT5A 2YLHA 3G5YA 4L4TA 2D4DA 3ZOAA 3IE9A 1DJWA 2IADB 5TJWK 4ENZA 5J6SA 3ABGA 5I0DA 5KN5A 3MLRL 2P1YA 1U9KA 4L8BB 5GZND 4BA8A 2O5YL 1T89C 3VI3B 1ZS8B 1H8SA 4HWZA 1HOEA 3C2AH 1RHHA 5J9PA 1QQDA 1MCQA 4M48L 4ZS7H 5K33A 4GKSB 4ODXB 3WD5H 3O3AA 3BP7B 4ZFGL 4FQHA 5FXCH 1N2RB 3IN2A 3ML8A 4H0GA 4BKSC 1D2PA 4WNQA 3FQRB 1UWXH 1NMAL 3NYKA 5I19H 3MRNA 2ODHA 1T1ZA 4OAWA 5F96H 1KYUA 3C6LA 5DXWA 5T8IA 5I5MA 2P5EB 4QXGH 1OB0A 3QUXC 5KVGE 1NGYA 1P2CB 3CQFA 5GSVA 2NY5C 1XD1A 5F3HA 4LHUB 1AO7E 3MJGX 3N41B 3KPNB 2Y4SA 3C60B 2Z4TA 1HK6A 4P0DA 4CVZA 1FG2B 5KS9B 4JHBA 5FC9A 2EH7L 2F19L 4L9LC 4XC1H 1G7IB 2XUWA 2Z35A 4MMXA 4NSKA 4JM2F 2P9RA 2KPNA 1UB6A 4NIKB 2Z31B 5EO9B 1NBZB 4RWYH 3THML 5HPMA 4OCRH 4NJ9L 3LKNB 1DBMH 4DUVA 4PFEA 4KOBA 2Y6SC 4FXKC 4EVNB 4GBXB 3ZQXA 3RTQD 1PX4A 3QRLA 2D8KA 5D7KD 4FNLH 4X6DE 1QPPA 1KT2B 2B15A 3HG1A 4GQ9H 4BSVB 3Q2LA 3DX9A 1U3HB 1CF1A 3TIEA 4MJ6A 4WWKB 4LKXB 1A7NL 4GSUA 1COBA 2XCMC 1QKZH 5I15H 3A22A 4PRNA 2DF3A 2HJKA 4HKXA 3VWKC 2ZONA 1HCZA 1JF1A 3D2UA 2F0CA 1FI8C 4WHTB 1XGQA 2H1PL 1NCNA 4DVBB 2PP7A 4X7TB 3FB8A 3KEDA 5IM7A 3RVWC 2OSLA 3U2SB 2R0LH 2RTTA 3VXSB 4KZ0A 1NCTA 3QDGD 1XHHA 3MRCB 4M8UA 1KJMA 1OM3L 5F7EH 4JFTA 3MRGA 3E1ZA 5FFLA 3AXLB 4JRLA 2RFXA 3LKPA 4Z76B 2KQNA 1N5YL 1XF2A 3AUVA 3EO0B 3US9A 4J1UB 4OF5A 1N26A 1ANUA 1YNLH 3ZE0B 4FFYA 2XXCB 4NUGH 2WIIB 3QQNA 5AAMA 2BY3A 3WI9A 5GS1A 5KSVB 1MHEA 2ESVD 4K3EH 3CSGA 1AQKH 2ZF8A 4NOFA 5CR1A 3ECQA 5HGGS 5F9JA 3SZ6A 2EXWC 3V5HA 1JHLL 2F7PA