4HAFA

Crystal structure of fc-fragment of human igg2 antibody (primitive crystal form)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
209
structure length
209
Chain Sequence
AGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords Ig gamma-2 chain C region
publication title IgG2 Fc structure and the dynamic features of the IgG CH2-CH3 interface.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hafA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hafA01
1FFNB 5EC1B 1A3LH 3P4NB 3MYJB 4X9IA 4XP6L 2F8VA 1QOKA 4JM4H 5ESVB 1VACA 3QPXL 2X70A 3BRDA 2WINB 3NN8A 1BFSA 5IFJA 3MUGA 1OAKL 1DQQB 3HE7D 4CW1A 1Y18B 3BYYA 3O2VL 3GMOB 3OKKA 3T08A 3QNYB 2VSCA 1RUKL 1HKFA 3REWA 4WI3A 1OOAA 3HB3D 3VWJA 3GRWA 4S11A 2BDNL 1CVRA 2N1KA 4FP8H 3IDMA 4H26A 5IK3B 1RZ8B 3GBMH 2QQKH 3C08L 4DAGL 3PP4H 3KYKL 5CIPA 3EOAA 2ATKB 1NL0H 3NCYS 2VLKA 4U49A 3X3FH 1P84J 4YHNB 4PJHF 5FGBA 4LLVA 1C12A 4HIJA 3NA9H 4HUXA 4B7LA 4JQXA 4UILH 3U7AA 1QSVA 1N59B 2PTVA 5E8OA 3I75B 3VXUE 1GHFH 4ELME 2EDDA 4OUUA 1B6DA 4G6MH 4WHYH 5F96H 2LV4A 1FLRL 2D3VA 3OJVC 1MCEA 3O0RL 3TLRA 1U9KA 5CJOL 1DL7H 1YPZA 3FQUB 3HS0A 4NRZB 5DJ0A 3MA7A 3G08B 3KXFB 3KYOB 1T3FA 4QLRA 3BPOC 1KELL 5HDQH 4P99A 5LBSL 3SKNA 2CRYA 4WDIB 1JWSA 1RU9H 1S7UB 3KVQA 2VLLA 1H3UA 3UO1H 3TPUA 3BYTA 4HQQL 4XXCA 4X6DE 3ARWA 3O3AB 1LE9A 5B38A 4WHCA 4UV4L 4WU5A 1MI5D 2F19L 1FG2B 3C5ZA 1UZ8B 2FBOJ 5E6IC 3T09A 4JFED 1KUMA 3D0VB 5C9JB 4LHUD 2HTKD 5DMKA 2AEQH 2BSTA 5E1AA 2O5YL 1G7LB 3HMXA 1ZA6B 3MGAA 4M5ZL 4R4FL 5DJ6B 4H1LH 4S0SD 5MEQA 5A2IH 5FUZH 4YO0A 4WI7A 4LVHC 3RRQA 3CZFB 5FECA 1WIUA 5ICZA 3RIAF 4XH2B 2FJFB 3MGTB 3WD5H 1S9XA 3M8OH 4PJIA 1A7RH 3IT8D 2IEPA 2W9DL 4ODHH 5MEOA 4HDIB 5B3NA 3WHE0 5HGAA 4FQQA 5DZOA 2H6PA 4ZPVB 1HH6B 2NNAA 3FMGH 2IPUG 3RX8A 2VUYA 3B5HA 4JFPA 3ARUA 1AGCA 4P23D 4X6BB 2OCFD 5D7JD 5LGHL 4TSCL 2FX9L 2I9TA 2FDBP 3U2SA 4NQCE 3HC4H 1XF3A 3P9MB 2Q3AA 3U79A 1J5OH 3JV5A 4QRQB 3KPMA 4MA7H 1E4XL 1P4LA 1P84K 3H9HB 5KAQF 2EKSB 2X4SB 1VKXA 4FOMA 1MF2L 1F42A 2FLBT 4WWKA 3T4AB 4EUPA 1ROWA 5ALBL 5KN5A 4NCC1 1EHAA 4K94H 4PTTB 5CEYB 1I3GL 4Z7UE 2GCYA 2J4WH 1MHCB 1N7MH 2UVEA 3PWJA 1SEBA 2X1OA 3PL6B 4NSKB 3UROR 1OM3L 3O6FA 3TT3H 3J7HA 5GZND 1DQDL 4U1JB 1AGBA 1P4BL 3ARDC 3LRSA 4PYGA 1H8SA 4KJQC 2OI9C 5GSVB 5LGJA 4XBEH 1FYTD 3UTQA 3SKMB 2ZCKH 3ZKXC 4Q9QL 5BS0B 4WJ5A 4YHOH 3ORJA 3IFOA 4GW1A 4ZQKA 4WW1B 5H2BB 1HINH 4RAVA 4EKXA 2X89D 3TNNB 4ODWB 1KGCD 1ZVYA 4MA3A 3VFOA 3B2VL 1CFVL 1Q9KA 4U0RB 2B7DT 5D6CB 2ICWB 3IDXL 4JEGB 3W9DB 4LIQL 2WQ8A 2VISB 4NZJA 3L3GB 4OJFL 3JV6B 1LE5A 1KEMH 2PO6B 1OD9A 3QPQC 4PRPE 4CVXA 4LAQL 2E9JA 2IADB 1JZ5A 3MV9B 3V6OE 2EYRB 5EOCL 3LIZL 3X3GL 3DXAE 4X5XA 4WO4C 1CFTB 4RMWA 3UBXB 4PG9A 2AGJL 3TIEA 1U95A 5DHVB 4BM7A 2IALB 5C0AB 3U46B 4MCZB 3V7AE 4C56A 1AJ7H 2WIMA 1S7RB 4DFIA 2GSIB 1BOYA 4ONFH 3QIWA 4QRRB 4G9FD 2X4OB 5JQ6L 2EKJA 3QUZC 3PL6D 2XQYG 1F4WL 4IMKC 3V6FA 1JMXA 2AK4A 5I1HL 1EGJL 2EDYA 3FFDB 4V1DA 2RAMA 2LAGB 5I8OH 3IFNL 2EC9T 2Q1EA 2JCCA 5I1DA 3DURB 4XPHH 5BS0D 4DN3L 4A6YA 1A7NH 4FFZH 1RFDH 2ESVA 4B0MM 4LSUH 4GAYA 4G6AC 4IDJH 4C4KO 3VI3F 4DGIL 1BVLB 3FQTA 2AKRB 2C4FT 2XTJB 3D3VB 3ARVA 3UZQA 4I18C 5M95B 4Y4HA 2XKNA 4XP6H 1A47A 1HHJB 3MV9D 4RQQA 4RFEA 4YX2H 4EXKA 3MXWL 1YEEL 5DRNB 1UH3A 5F7DB 2VAAA 1OAKH 1IBGH 1I3UA 2GFBA 5CZKA 2F53D 3AS3A 3IF1A 4AT6A 1FFPB 2FECI 3AROA 1GOFA 4BK4A 3GMRB 1RUKH 1F8TL 3GK8L 4LP4A 3LSOB 4K3EL 1BQHG 2GJ6E 1S7VA 4QRRD 3VE0A 5SX5H 4M7LL 5DGRA 3IXAA 1N3NA 3T04D 2ZUVA 3SGEH 4DAGH 2MJWA 1FBIH 2R2EB 4HX1A 3BZ4B 4LOUC 3KPRA 3MFFA 1MY7A 2DQGL 4K55A 4Z6AT 4IRJB 4QRSB 5A2JH 1T21A 5IEKB 5AYQA 3RX7A 4O2EB 3NZHL 4HUVB 1FLRH 1QSFD 4UINL 5FDYA 3MRJA 5L0QB 1Z3GL 1A1NA 1OW0A 3D3VD 4G80A 4KRLB 3JVGA 5DJZB 4GRLA 5LBSH 4Y4KB 2HT3D 4NQDA 2ZSVB 1J05A 2Y6SC 1OGTB 4R26H 4L4VB 4XBGB 1IAKB 4I0PA 1KN2L 5JO5A 1CDHA 5I1KH 5ESQA 1V3JA 5D2LF 1QFOA 4R90L 4UV4H 5FOBA 4H1LB 3BDXA 1UYWL 3EOBA 4LLUA 4ZDHB 4LCCA 2ARWA 3B9EA 5C6WH 4Z7WF 43C9B 3WIHL 4RGNE 4MQSB 2PYEB 5IWLC 1OPGH 1OSPL 1FHGA 3G04A 4JDVB 4NNYB 1J8HE 4Z7OF 3E3QC 4M5ZH 4P2OA 3ES6B 3RVXD 4GXVL 5C07A 1FV1B 1U92A 1DVFD 4AM0A 2NY6B 1NGPL 4FXKB 3GJEA 2BCKA 3FQRB 1INDL 2A1WL 1AR1D 2DWDA 2V2TB 3GKZA 2XXCB 4LSPL 5GZNC 4LBEB 4ZFOB 4OSUH 4JO2H 3VFUA 5D7KD 4I0KA 5EBMB 3FT2B 2VJXA 1YEKH 4PGCA 2DTML 4JN2B 1X5GA 1SBSL 3KPQB 3ZKSD 3L3JA 1JHKL 5A40E 1A4JA 2OTUA 4KUZH 2AJYH 3RUGE 4G8GD 3NVQA 5LGHH 4HIXL 1M7XA 3CFIC 4HKZA 4MJIA 4PJBA 1J0YA 2OZ4H 2HKHL 2OR9L 2JJTA 1QLFA 2OL3A 1E4XH 3GMQB 4HZLA 1OQOA 3VFGL 4QT5A 4BFIA 4PRDA 3GI9H 1MF2H 1A7BA 3L6FB 32C2B 5TE4L 2ITCA 5E9DD 4WUUA 2CUMA 1ZLSL 1KLFA 4MQXC 3HE6C 4FXGA 3K3QA 4JPVL 4ZSOA 4CU7A 1U36A 1FVEB 1MEXL 3CX5K 4O5LL 3P73B 1DQDH 5E4IA 2HJKA 1JFQL 3TJEL 4X83A 4TUOA 1L6XA 1MIML 1ZT7A 5CZVL 3P4LA 3C8KB 2D03L 1XEDA 4PJGF 5EUOE 1L7TL 4LCYA 1XIWA 1RK0A 4IRSD 1EEZB 4F9LC 4TUJA 3C5JA 4O58H 3B2VH 3ROOA 4ZNEA 2QQLH 1RULL 5KSVA 1M6OA 5E56A 4OLXH 1I1AB 4PBVC 1J0IA 5I9QB 4UAOB 5F8RC 3LIZH 2PO6C 4RX4D 4PJDA 1BBJB 3X3GH 4WUKL 1JJUA 3VXUB 3MNZA 4ELMB 3W5MA 1KNOA 4OCMC 5JPMA 3DECA 2WWMD 2R0LL 3OKMB 4O2CA 5KVDL 3Q6FA 1IL1B 4GG6A 3U0PB 5EZJA 4L1DA 1BX2B 1VFAA 2BERA 2FD6H 3MXVL 5EG6C 3DX8A 3HNVL 3RZWA 5GS0L 3ARSA 3SGJA 5F1NA 1S7XB 2QHRH 1I9RL 5ESAB 1G7QA 5BZDB 1TDQA 2DQIH 2ARJQ 3S5LG 3PWNA 1VEPA 1EGJH 2EDOA 2BNQE 3MJ7B 1MUJB 4X6DB 3OKDB 2VXVH 3M17A 3O4LD 3P4OB 1IRAY 1BJ8A 5E2VL 1CLZL 5GIRB 4U1HA 5J56B 3FT3A 1FGNH 3VXOB 1BQHA 2GIYA 5E5RB 5IVXE 3O41B 3L5IA 4BQ6A 3Q3GB 4ODUA 1Q38A 4JFQB 4R3SB 4K3JL 4KDWA 2FYYB 4MAYA 3HZVB 2VLJE 3NH7L 2A83B 2XRAH 3QCTL 3K4AA 2YMXL 5C0BA 2FZ3A 3MV7E 3Q48A 1X5KA 4M1CD 2XTJC 1C16B 1GIGL 2VLRE 4B53A 4HKJB 5CUSL 4U1KA 5CP3H 4PYHA 4HS3A 1YEEH 1PGRB 3B4NA 3RJDA 1X5JA 2HT3C 1DCLA 4PRHE 3UJTL 4UDTA 5EUKA 2P48B 4X7CC 3DVNB 3T4YB 3WUWB 3PQYE 5FXCH 1GCFA 1F8TH 4K3EH 2VZ3A 4R96A 4UUJA 4OZIF 2P5WA 3D48R 5IW6B 1NCUA 3CVHA 4NQCB 4NOFA 4BSVB 4MD0B 4M61B 1ZAGA 4XX1G 2X2YA 1KB5L 1UWXH 2HRLA 4DK6A 2BSSA 1QHOA 4JRXD 4LASH 3IDIA 2B1AH 4M8QA 5GHWL 5FKPA 5JW4M 4H5SB 1MAMH 1K4DB 2EIEA 4KVNH 4Q0XH 4X8JA 4Y2DD 3RVXC 3TCLA 1KTLB 4MGXA 5GJTL 1UWGL 3PWVB 4IRJC 4Z7UB 4PJ7A 1I7RA 2EYSA 1CICB 1T1YA 5KSBE 3WNLA 3NZHH 5GS2H 5D1ZA 4MVBC 1WCBA 1YA5A 4JY5L 3G9VA 1EEQA 1HK6A 3VD9A 4M9OA 1PAMA 2YEZB 3IDNB 1OTTC 5L0QC 3T3PF 1FYHB 3LRGA 3S34L 1NCCL 1NANI 1S7WB 2MWCA 3NAAL 3TV3H 4FFWC 3V0VB 4YHZL 4Y4KC 1KN2H 2P7TA 2VQUA 5IB2B 2PYFB 3MRFA 4S1QL 4F7EB 4MXWL 2NZ9D 2BNRA 5A16B 1UYWH 3E0GA 1YPZF 3CGTA 2D9QB 3A6CH 1G7HB 4PRPB 43CAA 1UB5A 4YK4B 1XGRA 1LNUA 2DAVA 5FM5M 2FJHB 3ILQC 5T1LD 5IW1A 3MRPA 1G7IA 3DXAB 2EICA 1T0MA 5IVNA 1IM3B 2BNUA 1NGPH 4FMFA 4M03A 1INDH 3QG6B 5EZLA 3K46A 4LSPH 2HLAB 3UPRA 5FO9A 3OWEA 1RSFA 4NKDA 3QP3A 2NY6C 5C1MB 3WL9B 4JFZL 3OJMB 4P2QA 1DZBA 5D2NE 2R1YB 1BIIA 4BQ9A 1SBSH 4JANB 3F6IA 2C1OB 4IOFC 4R0LA 5I15H 1V7ML 5DRWB 2YSSA 4I77L 3WHXA 5FA4A 5CEZL 4XP1H 5T1KD 3UXFA 2XFXA 4BKLA 4HIXH 4MA8H 4QRPA 1CK0L 4CVUA 1RMFH 4GSDL 5AG8A 4FQCL 3CSGA 2IPKB 5AWNH 5E00A 3VFGH 4PS4L 4PJIF 2R4SL 3RWDB 4M7LT 1U2CA 1MVFA 1MHEA 4JPWL 3MRQB 4JRYE 5D1QB 3VXRA 2E7MA 3FQNA 3OKEB 4CVZA 5C8JA 3HRZB 1FCCA 3LPFA 3TBWA 4H25B 1YQVL 1MEXH 2FJGB 3PJSA 4X98B 4G8IB 4JLRB 2VZVA 4KAQH 2HVKB 1JFQH 1NKOA 3TJEH 4XRCB 4BSWB 2XNAB 2FHFA 5EO1B 3RNKA 1NMBL 5K59F 2C1PB 3HI1B 4EVNB 5CZVH 4CKVX 3BQUA 4GW5A 4R6UA 1CIUA 2IANA 5BMFH 2HMID 4HJ0C 4QF1A 1L7TH 3DMMB 2EDNA 3RU8L 2FATL 4AQ1B 4PLOB 4Q2ZB 2VXTH 4HIHB 4L3ED 2GJ6B 1ZE3C 1AXTL 2ICEB 3F5WA 4LLDA 3BZFB 3S37L 2DYPA 4XGZB 1BF2A 1WZLA 3H7BA 3S5LA 1RULH 5IKCA 3S88L 3DJ9A 5EU5A 3WS3B 4JY4A 5EO0A 5D8JL 1UXWA 3QUYA 4U6YA 4AH2B 1K5NA 4XZUA 4MX7B 5DK0A 4JGJA 2AJXL 4KKCD 1WAAF 1CLOL 4G6JH 5DEGB 1VGEL 1XGUB 3UYPA 2VXSL 2GYSA 4WUKH 4D9RE 4LSTH 1I1AC 2EDKA 5I9QC 4UAOC 4WFGD 1WZ1L 5KVDH 1K2DA 3GSNL 4XMPH 4BK5A 2IJ0C 3FRUA 5CEZE 2ICES 2ITDB 2DQHL 4NQVB 5ALCL 3HNVH 2XKUA 5GS0H 2G9HA 3UTOA 3A67L 1HILB 5I16A 4EBQH 5LCVL 5I1LB 1A9BB 2Z91A 4HC1H 4KJPD 3AGVA 1BOGB 3TO4D 1NLBH 5E2UL 5F8QC 2KQMA 1Z5LB 1OP9A 4LCWA 3QBTB 1CLZH 5D96B 1D5ZA 2FSEA 4QHUB 5D7IE 1WIPA 2OR8A 5GRVK 3UX9B 2HH0H 1FZKB 3MZGB 2YD3A 1D5XB 2OP4L 3MOQA 4K3JH 3TVMB 2HT2C 4RGNB 1NEZG 3ZT6A 3W0WE 3BKYL 2FECL 2LVEA 3V6BR 1GH7A 2NYYC 1J8HB 1E27B 3ZDZE 5C2BL 2L4OA 3ZDXE 1ZHNB 2HFEB 4HUNB 2JB5L 1ZVHA 2YMXH 4PJCE 4F37F 2VDOL 4Y0GA 3PWPD 4TN9A 5IMOA 2JCCF 4HG4K 1YN6B 4CAGA 1GIGH 1OT1A 4ODXB 4UI2A 3G5XA 5CUSH 1A6TA 2JLLA 5F89B 5HDBF 2DI7A 3UJTH 1K8IA 3F62A 4KV5F 4PRAA 3IXTB 5CD5D 3MLVL 4UT6L 5HXMA 1R3JB 2YKLL 2K9UA 4QNPE 2GSGB 3HZYA 1WC7B 1XF5A 2XPGB 4FTVD 5FM8A 2VABB 1LP9F 3FAXA 2VDLH 3RUGB 4AENB 3NTCH 1S9YB 1MRDL 1A21A 4Z0BH 1JZ3A 1KB5H 2Y5EA 3IDUA 1CXKA 5IV2A 4CN1A 3MMEA 1HDMA 4CJ0A 5GHWH 4IOIB 1PX3A 1U8OB 2A6JA 5CS7A 1HXMB 1EBAA 1NSNL 1U93A 2X10A 3QHTC 3QR2A 3UYOD 4JHWL 4J6RH 3OB0H 3LQZA 4U1IA 5D72L 4EIZC 3CXDL 2J6EL 4HT1L 4HMDA 5TDNA 2ZUTA 1B88A 1JZ4A 4ZXBB 1CICC 3MR9B 3R1GL 4OZGE 2WANA 1QLEL 2Q8BH 1XR8B 4PV9A 1X6LA 5EUOB 4ONGH 1MELA 1A22B 4KXZI 2ADFH 3OX8A 1AGDB 1HH9B 2AABL 2EDTA 3NAAH 4GMTL 4GQ9H 2AERT 4KWUA 5T5FL 1U91B 3SJVE 1FNGA 2W9LA 4S1QH 3P30H 5JQHC 1MQ8A 5E8NB 1C5CL 2V2XB 3RWJB 1FVDB 5FYLL 1T1WA 5B3JE 3MV8B 1H3GA 3P9LA 4G43B 2BRRL 1A2YB 3ULUL 4ODVL 3P11L 2VQ1B 4YK4C 5GS2D 1G7JA 7CGTA 1TVHA 1MIEL 3V6OC 1MCLA 4HIIB 5F1OB 2VIRA 2GJJA 3IKKA 1SBBA 4LEXL 4X99A 5C0CA 1BIHA 1TVBA 4PJ5D 2Y7QB 3RWGA 3B5GA 1EERB 1H3XA 2W65B 1OP3H 4HK0A 5JIIA 4K7FA 1QBLL 3O3BB 3OKYA 4X7TA 4MMXC 2H2PD 2P5ED 3NBNA 4OB5L 2CDGB 5JOPD 3BHBB 2XZAH 5LQBL 3T77B 3L5HA 2VXQH 3HMWL 2B8OT 4I77H 2BNQB 3DHJA 5CEZH 4NKIH 4X4ME 1FL6A 5GS1B 2HFFB 3TJHD 1J1XL 2B20A 5L8KB 1JTTA 3MYZA 5IJKA 1BLNB 5IVXB 3QJHB 5GRJL 5LKNA 3RY4A 4PD4J 3SY0A 4MJ5A 1Z9SA 2EIBA 5IJVA 2R4SH 3VD3A 1EHNA 2VB5A 3MZTA 2VLJB 3ARDA 1DSFL 1UT9A 3NCFB 4I4WB 5GRUL 1RZJL 2YHGA 2YPKB 3NFNA 2GUOA 3TBYA 4PLKD 5JW4R 1F97A 3MV8D 3GSOA 1GL4B 3MV7B 5EIQA 1CFNB 5D1QC 1UC6A 3JUYA 5E6ZA 3U0TB 3CUPA 2VLRB 3T0EA 2EDQA 2NW2B 3ALPA 4GUPA 1NMBH 3SE9L 5I73B 1T5WB 4OGYL 4PRHB 2HKFL 3QQ3A 1EXUA 4KKNA 4CJ1A 2HJFA 3PQYB 4WCYL 1QVOA 3HG1A 4R7DA 3EO1B 1I4FA 2FATH 3ETBF 4KJPC 5J3HD 5DTFA 3IFPB 4ZAKB 3S37H 4M93B 3WIFA 4XVJL 4D8PA 4XCFH 2BC4A 3DMMC 3EJZD 3RJQB 3ULUE 4XMKL 4X5WA 3S88H 4WO4A 4GRMA 4Y4FD 5E7FA 5IIEB 1I7UA 3GBNL 3FO2A 5BRZE 5MENE 3VXME 3GSWB 2WWKO 4PJ9B 4JFDA 5I75B 3C60B 4ZFFA 5EOQL 1R5IA 3SOBL 1D5MB 1CLOH 5IF0A 4ORGB 1VGEH 2CLRB 3DUHA 2APFA 1F11A 1LVEA 1HSBA 4U1GB 4PJXE 1NEZA 5KSBB 2Z31D 1FCGA 4Z9KB 1PY9A 5ANMA 4JFYA 2A9NL 4E41E 4FQIL 2Q7NA 1BJ1J 4G8FA 2DQHH 5ALCH 5FO8A 1JBJA 5IMKA 1FG9C 1T2XA 3A67H 5ICYB 5CD5C 4EN3D 4XPFL 4DZBA 3S37X 5DD5L 4HH9A 2B5IB 4X6FB 3RBSA 1X7QB 1DR9A 3OAUL 3VJ6B 2XI9A 2EE9A 5E70A 3WHE1 4FQXB 3MV11 2L0DA 4DN4H 4LRNL 4I18A 3HUJF 3UBXG 5DRXA 3SPVB 1AO7D 2E7BA 4MB5A 4I9WD 1NCBL 4QTIH 1JK8B 4YHIA 1KJ2L 4RDQG 1XGTB 4Z77A 5HYFA 5D96C 2QJDA 3D39E 3GRWL 1FFNA 3AXLB 5EC1A 5HGBB 3MYJA 4APQB 4J3OC 1RUPH 5C2BH 3TVMC 1V5JA 4RGNC 1UM5H 5ESVA 2VDOH 1JYXA 5ICXB 1SVCP 2GI7A 3LCYA 1DQQA 4W81A 1KFAL 3RAJH 1RUML 5E8DL 1KIRB 1Y18A 1HXYB 3W2DL 4EQ3A 3GMOA 3T1FB 3QNYA 1FDLL 2QKIB 2FH8A 5D2NB 1EMTL 1FFRA 4XC1L 3MBEB 2UZIL 1NCDL 4DGVH 4I3SH 5C2UB 5T5NF 3MLVH 1TZHB 1I85C 1KB5B 2BHYA 4H88L 4Y16D 4M1GL 4HEME 2YKLH 5IK3A 1RZ8A 1MLBB 2A6KB 4TPRL 3VCLB 1N5AB 1CE6A 5DSCB 5FYKD 1U3HD 4NO3B 5BVJB 4PJEE 3QYCA 2ATKA 3N9GH 1K6QL 5DJCB 3L9RB 2ZSWB 3NCCB 3K81A 1Z9OA 4XVUD 1A6VL 5KJRH 1V05A 1N59A 1FIGL 5DJAB 3I75A 3P0VH 2Z92B 3MRMB 4NNXB 5DT1H 4UOW0 4JRYB 1NBZA 4LDLB 1B4JH 1NCWL 4FABL 1NSNH 4A2LA 3FQUA 3MRGB 4FQJL 4NRZA 4C4KT 3BISA 3G08A 2ATPA 1F3RB 4WGWB 1DN2A 3KYOA 2F5BH 5HPOA 5J8OA 1TCRB 4ZOEA 4P23A 5D7JA 3OG6B 4WDIA 5HHMD 3R1GH 4GAJH 4R7NB 1AC0A 1DQJB 5DFVD 3HMXL 4PP1C 4ZUSB 2EIZB 4NQSB 3RNQB 4ZXBC 4WHYG 3ILPB 2R29H 4O4YL 3V5HB 4GMTH 3BKMH 3PGDA 4XWOD 4ZUTB 1G9ML 3KPNB 5IWLA 5T5FH 5E5UB 1FG2A 3D69B 4OKVB 1UZ8A 1NUFA 3D0VA 1DUZB 2CQVA 1JHTA 3OZ9L 1GAFL 3EUUA 1DEDA 3VXSD 4KROB 2V9RA 5DJ6A 1TLKA 2BMKB 1XMWA 1N8ZB 1C5DA 1E4KA 2BRRH 5GSRB 3FT4B 3CZFA 5D93B 3ULUH 1F3JB 3EO0B 4K7PL 4X4YA 2YK1L 1DQLL 4J4PC 4XPTL 4XH2A 1HHGB 2FJFA 3MGTA 1CT8B 5DMGD 1MIEH 2IF7A 4NN7B 4LEXH 4RGOH 1MH5B 1R0AL 4KVCL 4JG1L 4MJ6B 4U6XB 3TA3B 3LB6D 5GGVH 4ZPVA 1HH6A 1QBLH 2H3NA 5HYEA 5KZCB 4H1LG 4P5KA 5KG9A 3ZTNH 1F90L 1MAKA 4OB5H 5J3HC 5LQBH 3QQ9D 2VDQL 1MCIA 1YJDL 1TNNA 2O26U 2E27L 5KOVC 4WI4A 3P9MA 3GO1L 3LQAL 4QRQA 4I3RH 4MXQD 1KTKE 3PGCB 5D7IB 3H9HA 2HA1A 1P6AB 4NQXB 2X4SA 1VSCA 5GS1C 3MV01 5CMAA 1QFWM 1T2JA 4R4BB 4PTTA 5C0FA 5CEYA 3KYNB 4P3DB 1VADB 3QHZL 1DSFH 4O9HH 3QWOB 5GRUH 5I0ZA 1GZQB 5SWZE 5FCUL 3PL6A 4L1HA 4WGVB 1ZSDB 1TENA 4PJCB 4U1JA 5CCKL 4ZUVB 5J9PB 1CD1B 5GSVA 5CKAA 1FZJB 4M48L 3BRFA 5EIVA 1NGYB 4F9LA 3SKMA 4FZEH 5EZOL 4QHMB 3LY6A 5BS0A 4E42A 2MQCA 4Q6IC 3DV6A 3T2QA 1DLFL 1ZXQA 4WW1A 5H2BA 3F7VB 3TH3T 3TNNA 4ODWA 1QRNE 1L9NA 3DX7B 1QACA 2MCPL 1ONQB 1YNKL 1IC4H 5AAMA 1A7PL 5I73C 1NFDF 3I50L 1CFQB 3TM6A 4K9EH 3W9DA 1F6LL 1DQML 3JV6A 3UYRL 1DBBL 2PO6A 3WNPA 1UEYA 3UAJD 4OZHE 4Q9RH 1PFCA 1REIA 4LSSL 1A8JH 4ZAKC 3GBNH 3MV9A 4M93C 2EYRA 4CADB 3VI4E 2ZUSA 3IRZA 1CFTA 5LAXA 3UBXA 5CSZA 1QG3A 2AJUL 5EIIB 1ZK9A 5KTEL 5I2IB 1OF2A 3ABZA 4PJ9C 5I75C 5IB1B 3C60C 4A6YL 1MCWW 5C0AA 1QFWI 1G1CA 3U46A 2EH8L 2EDEA 3UJIL 3ZE0F 4N8CL 1ITCA 1NMCB 1S7RA 5JZ7D 3HPLB 5IFHH 2GSIA 4U1GC 2WW8A 4FQIH 4QRRA 5GS0C 1QLRB 1HYSC 4OQTA 4M3JA 4BFGA 4OZGB 4D9LH 2CMRL 4WW2B 3FFDA 4NP4L 4XPAL 1RURH 4XPFH 2D0GA 4RISL 4JJ5B 5DD5H 3DURA 3HHRB 2J12B 1OARL 1CDIA 1QA9B 4EIGB 3SJVB 2ZUXA 4ZG1A 3BP6B 1GYAA 4HGKC 2B5IC 4DK3A 1QSFA 2GK0B 3MROB 5C0IB 3QQNA 1BVLA 5FV2A 2AKRA 2VKWA 5L6YL 1F2XK 1NCBH 4FQXC 4ZYKB 1KJ2H 4EDXB 3D3VA 2A0LD 4NUGL 1QSED 2AQ2A 5HD8D 3DVIA 3LEXA 5KANI 1GOHA 4MWFB 5DRNA 1HOCB 1UKSA 4XPBL 5F7DA 5MHSE 3MLSH 4APQC 5KS9F 1DBML 2FBJL 5E8DH 1OAQL 2BVOA 3BE1H 1F4XL 1FFPA 5C09D 1A7QL 3GMRA 3NCJL 2ZNXA 4C56E 5LGKA 5HGDB 3LSOA 1NCDH 4U6VH 2BHZA 2OSLA 1A64A 4H88H 4M1GH 5D2NC 3NCMA 3MBEC 1IAIM 2Y9RT 4MQ7B 3KPPB 4V1DE 1AP2A 2IH3B 5DD6B 5HI4C 1VPOL 1K6QH 4IRJA 4KTEL 1B3JA 4GXUM 4Y1AE 4L29B 4QRSA 3LKOB 5FHAH 4DQOL 3MUHL 3SKUD 4YEEA 4OI8A 3F7YB 1EFXD 1QFHA 5F7WC 5I30L 3AMLA 1QBAA 2Q76B 4N0CD 1NCWH 5FO7B 2X4TA 4FABH 2APBA 1NANH 2X42A 4NBYB 5FGRA 1YMME 4FQJH 2J8UE 2R0KL 3WUWG 1BQLL 5JR1H 4NIKB 5DJZA 5FHBL 1CTNA 4P59L 1RJZB 4TNVK 3MLRL 2DQTH 2D7MA 1LO4L 2FB4L 5MI0B 5KVMC 2X4UB 2WAHA 3P0YL 2ZSVA 1I9JH 2EXYC 3MA9L 4UQ2B 4I13B 1OGTA 3WFDH 3V4UL 1H0DB 2P8LB 3DYMA 3GI8L 3EIFA 3MO1B 3QJFB 4TQEH 3MRHA 1NMAL 1IJ9A 4AK1A 4K8RH 5L8LB 3FOLB 4H1LA 4HJGB 4ZDHA 1T66D 4S10A 5E9DA 3WDIA 43C9A 4YH6A 2OXHA 3VRLF 3FN9A 3T0WA 2PYEA 3OZ9H 2E5EA 3B2UD 1UEMA 5HHPB 1IAII 5BRZB 5MENB 3VXMB 3LEYL 4JDVA 3QULB 4NNYA 4DWHA 3ES6A 3BFOA 3QG7H 4HLJA 4LLYB 3RWEB 1S5HB 3FQRA 3MLTB 4QRTB 2V2TA 4YIQB 4Z95H 4LBEA 4PJXB 4ELKB 4KROC 4ZFOA 1FNEB 2BJMH 5IVOA 3FT2A 5D93C 3HLAB 2VL5B 2BRQA 4E41B 1CN4A 1E0OB 4KVCH 2OL3L 4JN2A 3DOSA 4W6YB 3BEVA 4XP9L 4N68A 4NN7C 2IH1B 3D9AL 3KPQA 3QDJE 3SDXF 1F90H 1FNFA 3ULSB 3TA3C 2IAMB 4NQDE 4PRBB 4HUUA 4GJTB 1Q72H 3WEXA 4DUWA 1YJDH 4L5FL 5GRVL 4TVPE 2B2XL 1IGMH 3LQAH 3NIGE 3VGGA 1EHLL 5IB3B 3GMQA 4NZRL 5AYUL 1OSZB 5H37H 2VE6B 4PJ8D 2DM3A 3BDYL 3L6FA 2ZJSH 1U8MB 3D39B 1WK0A 3V7AG 3GM8A 1CGSH 3P73A 5CGYC 3EW3B 5JHDD 5JZ7C 5C07E 5CCKH 5KOMC 4MNGE 3SGKC 1K8DB 1P7QB 2ICWJ 4RFNB 3C8KA 3JTTA 5B8CA 3O4LA 5EZOH 3BW9A 4WEBL 4U7SA 1EEZA 4JR9L 3MRRB 3FQWB 1HHHB 5CJ5A 3HC3L 2JE8A 1LO2L 4WU7B 3CK0L 2QSVA 3VDAA 3UTSD 4MS8C 3IJHB 3UYRH 1DBBH 4PJEB 2VDPL 5F1IB 1NKRA 1P4IL 3FN0H 3RVUD 4LSSH 1Z9LA 3SKJL 1I1AA 1U8QB 3WFBH 4M7ZB 4MJIE 1BBJA 3IFLH 4D0CB 4NJ9H 4JO4L 2AJUH 3L95B 3CLEL 5HD8C 4DJMA 4BH8B 4NBXB 2R8SL 4OF0A 1IL1A 1YNTB 3U0PA 3OF6A 1EEYB 1IGCH 3QDGD 1BX2A 1QBMH 1I8MB 3UJIH 4N8CH 2FL5B 3O9WB 5JXAL 4ZSOE 4F7TB 4GKNB 1S7XA 3VWKB 3RTQD 5ESAA 4LCIL 2Y25A 5BZDA 4DKFL 1NMCC 2CMRH 1DTUA 5TE7L 2FHCA 3T8XB 3MUGB 4NP4H 1ZGLM 3MJ7A 3K8LA 4WI5A 2PTTA 4X6DA 3OKDA 3ARRA 3P4OA 1OARH 2PW2A 5CBAB 2F54E 1KJ2B 3KPSE 4WW2C 4NZTL 4Y2DA 2C9AA 4H20L 3VXOA 1VGKB 4JKPH 3RDTD 3VWJB 3O41A 1EA9C 3U7WH 1ZHKB 5I0DA 3Q3GA 4JFQA 4HWBH 4C58B 4LSQL 4ZNEE 1M1SA 4HAFA 4U7KA 3SDCD 2AJSH 4JQVC 1MJ7L 4DOHE 3EOTH 5L6YH 2AQ1A 2A83A 3EOAB 1MQKL 3HAEH 5JUEL 4NUGH 2DIBA 1U8LB 2D7OA 3SE8H 4PB9H 5E24E 5C0GA 1C16A 5TH2B 2NY0B 4PJDE 4XXDB 2DI8A 4HKJA 1BD2D 4XPBH 3CVHL 4LSRL 1JF6A 1XFPA 3IETB 1JPTL 3O81A 1DBMH 3MCLL 3T4YA 3TZVD 1F4XH 1EUUA 5IG7B 1T83C 3KLAB 3QAZB 1A7QH 2DQUH 4LPWA 5HI3C 4GG6E 2YZ1A 1T3FB 1F6AB 3NCJH 1U8KB 1PEWA 3ARFB 1MCRA 3EYVA 1Q9LB 3O9WD 4NM8L 4OLVH 1N6UA 4YFLF 1S8DB 3VWKD 4OGZA 4K23L 5I1CL 4BSVA 5K9QG 3TPUB 4M61A 4KK5D 4PV8A 4CMHB 1IZKA 4DQOH 4TUKL 1K4DA 2FGZA 3A0OA 3QUXB 3OHXB 1KTLA 3PWVA 4TVPH 1V3MA 3K4DA 1CICA 4OFPA 5I30H 1GC1L 4KXZH 4YXLL 2BSTB 5E1AB 3KWWA 1KLGB 5SWZB 2ZPKL 2R0KH 5JW4N 2YUXA 5MEQB 1TJGH 1PKOA 4X80H 5GRYA 3MLRH 2YEZA 4JFFE 5T3ZL 5FECB 5ICZB 4FXLA 4KY1L 2RR3A 4YGAB 2NY0D 1JI1A 3MA9H 1S9XB 4HHAB 1OAUH 3V4UH 4I3GA 1S7WA 1FFQA 1QRNB 3V0VA 5MI0C 3CXHJ 5HGAB 4XNQB 2PYFA 2XY1A 4TTDD 1RY7B 2MNUA 4F7EA 4K7PY 3GSUB 1Z2KA 4F58H 1NBVL 1R3LB 1G7HA 4PRPA 1AGCB 4OZHB 5C08E 3V7MA 1L9MA 3CIQA 1WJ3A 4N0YH 2EDLA 2FJHA 5ITBL 3V6OA 3H7LA 4XNMB 3UTTE 2UVFA 1IFHL 4OF7A 1XF3B 3ULUC 3MFGB 3DXAA 1IM3A 2VITB 1P4LB 3QFJD 3REVB 4CVWA 3BAEL 3E2HB 3W9EA 1AC6A 3QXWA 5DXWA 4EUPB 5KN5B 4P4KB 4N90E 2DQFA 5H35B 3QDME 3T2OA 1ND0B 2I60L 3WL9A 4F57H 5JXED 4L3EA 4JM2B 4ODSL 3FB5A 5CJXC 1BM3L 2R1YA 1MFAL 4K3DH 1AGBB 2OJEB 4JANA 2OZ4A 4X7FC 2C1OA 1Q1JH 2NY3B 4RMUA 3EJYD 5DRWA 3N85L 4QKXB 4PJAE 5D7LD 1F6FB 4WJ5B 5GISH 3IFOB 4Z7NF 4L5FH 3RGVB 3OR6B 2B2XH 1RD6A 4KHXL 4F3FB 3OJ2C 1EHLH 1OCWL 1SYSB 4AEIH 2IAMC 2IPKA 3AM8C 5AYUH 4OGAC 1N64H 3RWDA 1WBZB 3HC0B 4N9OB 3VD7A 2EC8A 3L3DB 4HWEL 2BNRE 2HTLC 5J7CC 3MRQA 4EI5D 5D1QA 3CAFA 4HPOH 5D4QA 5EU7E 4E9LA 2FIRT 1EH9A 5T3ZE 3OKEA 2WUBL 1H8OA 4JRWA 3HRZA 1U8HB 4XP4L 5JW5A 4H25A 4L4TE 1F4YL 4X98A 2UZXB 4JLRA 3ULVH 2HVKA 4X5XB 4XRCA 4BSWA 2XNAA 5EO1A 2JJUA 3V5DB 2C1PA 3HI1A 4EVNA 1MCOL 5E0QA 3TO4A 2Y5TA 3GIVB 4E5XB 5IT2H 1SJEB 4P4KD 3DMMA 3PUCA 3STZB 3UEZA 2AEWA 5CZXD 4Q2ZA 4RFNC 4LVOB 3QEQE 3WS6C 4HIHA 2GJ6A 2WUCH 2ICEA 3BZFA 4HAGA 4XGZA 2AI0L 3WLWC 3UCRA 1WFNA 1PLGL 4V1DB 3WS3A 4AH2A 5DD3H 15C8H 2P1YA 2AEPH 4LDEB 3PWPA 3B6SB 3S96B 5GRWA 4Y1AB 3SKJH 4PY8I 4A6YB 2X05A 1JNJA 3X14A 3OB8A 1ZTXH 4QRPE 3TN0D 5DEGA 25C8L 2R1WB 5FYJU 1KPVB 1XGUA 4HFWA 2JB6A 3FO0H 4HS6B 1YY8B 4BZ1L 1NCAH 4M7ZC 5SWSD 4OD3L 1YMMB 2KBGA 1EGJA 2J8UB 2ITDA 2EC9U 5IVZB 4NQVA 4Y4HB 4PRID 1JNNL 3RPIB 4W4OC 5C86A 3RWHB 3U4BL 4F9PC 4LCIH 2P8MB 1R5WB 4DKFH 1A9BA 3O9WC 5TE7H 2B4CH 4ZS6C 1BOGA 3VWKC 4D9QE 2IANE 2X6MA 1Z5LA 4ZO6A 5T1DH 2C4FU 4JVWA 4QHUA 3DLQR 4H20H 4JDZB 4RDQF 5BOZG 3HAEB 2QL1A 1FZKA 1D5XA 1V3KA 3TVMA 4LSQH 5DHYB 3VE0B 2IG2L 3B83A 4YHLL 1N3NB 4WFHE 5DD0L 2NW3B 3LPGA 3DHMA 5CP3A 3VWJC 4DGYL 5IW3A 4HX1B 1PSKH 1JNLL 4NJAL 1J8HA 1E27A 1JGEB 1ZHNA 3MFFB 4WTXA 3N1FC 1A6UL 5CINH 1G1YA 2WLYA 3GKWL 5B4MD 5MEPB 5INCB 1PBYA 3HI5L 4RA3A 4ODXA 1RHHB 3MLUH 3B9KB 3DRQB 2APXA 5HDLA 1F5WA 3QIUB 1JPTH 1MRCH 1NCNA 5FGBC 2XA8H 5IBLD 2NY0C 3MRJB 1MJ8H 3D0LA 3IXTA 1J10A 1YUHA 3QDJB 1R3JA 2GSGA 4UDUB 1WC7A 2XPGA 3QAZC 2O5ZL 2VABA 2FX8L 4NQDB 3RUGA 3WNOA 4AENA 4K23H 1S9YA 3ARFC 5I1CH 2XWTB 2W1NA 1CD9B 5E6YA 5FOBB 3QXVA 1CFBA 4JAMB 4OM1L 1U8OA 1HXMA 4N1CA 1DBJL 4CMHC 3CLFL 3EGSB 1XGPB 3D1MC 3FZUC 4YXLH 3SQOL 2AXJA 5C3LD 3QUXC 2ENSA 1R3HB 1UZ6E 4PTUB 5DK2B 3RWIB 2CK2A 3QRFM 1MFBL 4YBQD 5C07B 4ZXBA 1U92B 4MNGB 4CL7A 1J0JA 4LFHD 3V4PL 2P42B 3ZE1F 1XR8A 5DUPL 5E2TL 1WIOA 5EUOA 1OP5K 3BP7A 3B9KD 1AGDA 1HH9A 1KJ3H 1SM3H 3Q1SH 5T3XL 3WN5B 1ZT4B 5GGRB 5HHOE 1PEZA 5TQ2H 4K8RC 1HHIB 1B4RA 4P5TD 4EOWL 4WTZG 5D2LE 1U91A 4S2SB 3BKCH 2CRIA 4MNQE 1ZWIB 4QXTA 1U8NB 4QYOB 5E8NA 4GH7B 2ZG1A 5DI8B 2V2XA 4KQ4H 3RWJA 3L3JB 5DO2C 3EYUL 1A4JB 3FFCE 4WI8A 5DQ9B 3DO3A 4J4PA 1AQKL 1CE1H 2X4QB 3MV8A 2KDGA 3HI6H 1AY1L 1OTUD 4Z7OE 4KK8C 1MRFL 4JKLA 5ITBH 1A2YA 3ARGB 4HKZB 4GMSL 1UM6H 2VDKH 4MJIB 2JJSC 2VQ1A 1WISA 1QLFB 2OL3B 3L5XL 4KMQA 5ITFB 4BFIB 1R3IL 1T7VA 3Q6GL 3BAEH 1U6AH 3PIQB 1MFEH 2A38A 2Y7QA 3WYRA 2W65A 2NX5D 2VWEE 3CCHB 4D3CH 1JV5B 3F12B 1U0QA 5CLWA 4YAQB 3E2HC 5CJ8A 2XN9E 1Z9MA 5CP7B 4ZSOB 4ODSH 3O3BA 4P4KC 5D5MF 4IS6B 1MFAH 5SWQB 3BHBA 3T77A 2P49B 4DCQB 1XF2A 1RJCA 1RK1A 5A43C 4JREB 1T7ZA 1ZT7B 2BNQA 2Z8VC 4JM2C 1YJDC 4JPKH 4Z8FL 1BBDL 5GS1A 4BQ8A 2HFFA 3KLHC 2QADB 1BMGA 1RZKL 3LQAC 3LS4L 2F54B 1MCWM 2NY3C 2X4RB 3KPSB 5HVWA 1XIWB 4YDIH 3OKOA 1G9NH 3GMNB 3C5JB 3QJHA 2EDFA 4RMVA 1OCWH 5EN2B 4HCRH 1U8PB 4H0GA 4PPTA 2Z31A 4OFVA 4RCAA 4NQEE 3RGVC 4QHKI 2VLJA 4JY6B 4DOHB 4AYFA 5KSVB 1TZGL 1DDHB 1M6OB 2YPKA 2RQ8A 4J8RB 2WUBH 1KXTB 3MV7A 3VG0H 1CFNA 1A6WL 3U0TA 5T3XE 2VLRA 4PJDB 1V3LA 4P46B 4ZFGH 1X5FA 2NW2A 2BVTA 1XCTA 1T5WA 1MCOH 4PRHA 3LKQB 1XAUA 4UOW1 2UWEE 4GG6B 5EZJB 3EO1A 4XI5D 3PXHA 1AKJB 4XT1C 3IFPA 4ZAKA 4FN0A 5GGQH 1D6VH 1M7IA 4M6NL 1PKQE 3RBGA 7FABH 3MREB 4LVOC 1PLGH 1ZV5A 1QFWH 1OAYL 2VR4A 4N8VB 3GSWA 3MCKA 3M17B 4OLUL 4NGHL 3VMNA 2ZWLT 4WNQA 4Q97A 4O51B 4U1HB 3VGEA 3FT3B 1BQHB 1D5MA 5EPMB 4HK3N 4ORGA 2CLRA 3ARBB 1INEH 35C8L 3RVVD 4ODUB 1FAIH 4KI1A 3Q5YA 3ULVD 4OD3H 4HC1A 1HWHB 4Q6YA 5CHNB 1MREL 5IBLC 4QHNA 4HZAA 4OCLC 1S5IL 4HLZH 4JFFB 5ICYA 1W0YT 5C0ND 2DMCA 5HJ3A 3IRPX 4OLYL 3CMOL 3FN3A 5EZIH 2EDBA 3T0EE 5E2JA 4Y4HC 4P46D 4U1SA 1X7QA 3PDOA 2JTDA 4N0RA 1SY6H 2A6DB 2Z8WC 3VJ6A 1X6NA 2D4FA 4ELMF 3PNWB 5FB8A 4QOKB 5L2KE 2HFGL 1KPRB 3SPVA 3ZKMD 4KZDL 5C08B 2P43B 1JK8A 2IG2H 5KVFH 1XGTA 4YHLH 5DD0H 2QEJA 2QR0B 1ERNA 4DGYH 2YD6A 3AXLA 3UTTB 4APQA 4XC3L 3P4MB 3H42L 5JIPA 1WITA 5FEBA 4FQLL 2CO7B 4QXWA 1Z0NA 1P2CB 3IDIB 5IMLB 4X7SL 1QRKA 1UCBL 4M8QB 2P46B 1A0QL 1S3KH 1W8OA 5ICXA 1CF8H 1I1RA 1T6VN 4X6DF 5C6PB 4KK6C 3QUKB 4HGWB 2AXHA 3N06B 1KIRA 1QFUL 1KENL 1HXYA 2Y72A 3QDMB 2HN7A 3T1FA 2EYSB 2QKIA 4XTRD 5D2NA 5ANME 2VNCA 3B9KC 1LD9A 3BZDA 1T4KB 1TZHA 3QIUC 1KB5A 1E6JL 2A6KA 1MLBA 3VCLA 5KVEL 4OZIE 1N5AA 3BP5B 2IMMA 4PJAB 4C59B 4KKLD 2MFNA 4NO3A 4M7JH 2D7PA 4RRPG 4LU5L 1ITBB 5DJCA 1BF8A 1AXSA 3O8XB 4WTZA 5JLZB 2P7TB 1I1CA 4K2UL 3FJTA 3BUTA 5DJAA 4OAWB 3RA7L 2Z92A 4NN5B 4QOKD 4BELD 4NNXA 1HI6B 4JRYA 3WJJC 1NQBA 1IEHA 2J1KA 2XQBL 3MRGA 1EJOL 5IUSA 1XGRB 1DBJH 5C08D 3CLFH 1J1PH 1DFBL 4OLEA 5CLTA 2RCSL 4L4TB 1TCRA 1ETZA 2HG5A 2D31B 2DBJA 2WK2A 2YUWA 1MFBH 1RZGB 5JTWA 4AMKL 2XZQL 1DQJA 1HIMH 5EZLB 3T3PE 5DUPH 2EIZA 2HWZL 3RNQA 1U3YA 1MPAH 2DD8L 1IAIH 3ILPA 1PX4A 3V5HA 5T3XH 4ZUTA 3QEQB 1MI5E 1TMCB 4EOWH 1P5UA 2R39A 4XNYH 3D69A 3I3DA 4OKVA 5FA3B 3V4VH 2F15A 4Z7UF 4JFEE 3WN5C 1FC1A 4NO2A 3WHXB 1DUZA 2Q87A 3LPWA 4RWYL 1RZFH 5ACZB 2Z4QB 3EYUH 3BVNA 4ZD3H 3KG5A 3EYQC 4BKLB 4WI9A 2BMKA 3W11C 1MRFH 1N8ZA 5GSRA 4QRPB 4GMSH 3O8XD 5FOJA 1F3JA 3EO0A 4PLJC 1I7TB 1CT8A 1UWXK 3Q6GH 3TCXA 3ARGC 1RIHL 2DWEB 3NFSH 3H9YA 2FO4B 1AGEB 4U6XA 1KCSL 4DKEH 1EO8L 1AFVL 4HMCA 5J57B 3D85D 1WUNT 1ZS8B 2ZCLH 3LKPB 5BQ7B 3I6LD 4P9ML 4QWWD 3RNKB 3OAYK 1QR4A 2J8OA 4RIRB 2UUDK 4Z8FH 3U30C 3O6ML 3GMLB 2IANB 5I66A 1J86A 4JG0H 1RZKH 3LS4H 4RNRA 4YHML 4MB3A 5IESH 4N0FB 2NTFB 4GAGL 4OCSL 4ONHB 1HSAA 1OT2A 3PGCA 5D7IA 4JREC 5C9KA 5J1AB 4NQXA 2EXWC 4ZOBA 2QADC 5TF0A 1ZVSB 3C2AL 3H7BB 3KYNA 4P3DA 1XIWC 3TC9A 3IDGB 3RVVC 4AIZB 4JY4B 3SGKA 3NIDE 4OF6A 1UXWB 1CZ8H 4UT7H 4R2GD 1K5NB 1ZSDA 4R4ND 3JTSB 4P4RB 3V2AR 2CDEB 1YEJH 4ZUVA 5J9PA 1CD1A 1FYTE 4UQ3B 1FZJA 4HXBL 3WJLC 1NGYA 1LO0L 4NUJB 4N5UA 1CLCA 1RHFA 1MFCL 3W39B 3F7VA 1KGCE 5CSGA 1CCZA 1E4WL 5FFLA 1K2DB 3DX7A 4P46C 1ONQA 4KGLA 3L3OB 5JORB 2KZWA 4N5ED 3E1F1 1UA6H 4PP2B 1G9EA 1CFQA 5DA0B 4XCYB 2G9HB 5J13B 5A3ID 1GPOH 1P1ZA 1TJIL 2IFFL 3RPKA 4XAKD 1FNAA 2O5XH 2BSED 3JWOH 3BUYA 1QSEA 1OAYH 3SGJC 2FIKB 1L7IH 4CADA 1D5BB 4WIQA 4YXHH 1FNHA 2AAVA 4IEFB 3DUSB 2DQDL 1D5ZB 5EIIA 3B9AA 4QCIB 5I2IA 4DUVA 4XAWL 1E6OL 35C8H 3NACH 5E03A 2VL4A 6FABL 5IB1A 4OFKA 5F72S 4MZ2A 3RIFK 1XF1A 3ARBC 3HPLA 2KQNA 1CDGA 2D2OA 4G9FE 2DLEA 2ZKHL 5T33L 2YA2A 1QLRA 5DK3A 4JM4L 1KC5L 1CDCA 3G6DH 3BO8A 2HJLA 3A6OA 4OZGA 1MWAL 4WW2A 5BO1H 1WEJH 3HZMB 3S98A 3QCVH 2LAAA 3VFVB 3CMOH 1TETL 2EEAA 4JJ5A 5BS0E 2F9BT 4ENED 3WDHA 1UWEH 5HHOB 3SCMD 1QA9A 4JQVA 5D2LB 3SJVA 3T3ME 2X4NB 2V5TA 1D7FA 4OIBA 4OLWH 3BP6A 4MNQB 2CDFB 1ZLWK 1CU4H 4FP8L 1FJ1A 2HFGH 4OBRA 5C0IA 3GBML 2QQKL 4P2RD 2CIIB 3HZYB 3FFCB 2QQNH 4FQ2L 3IDYB 4KZDH 4LQFH 4ZYKA 1GGTA 2AXFB 4EDXA 4RRPA 4Y8AA 1CR9L 4EXPX 2FHBA 1NL0L 1UADC 3X3FL 4KJWC 3MV9E 4I8DA 5J1TC 1BQUA 1KB9J 3W81A 2BP3A 2C3WA 3NA9L 4TVSa 1HDMB 1UCBH 4MWFA 1HOCA 4KK9D 1GHFL 5C0JB 2F53E 5F96L 2EDWA 4KKBD 2J8HA 5HDBE 3PABA 1IMHC 5FUCE 1QFUH 1KENH 5JA8B 1DL7L 4IOSD 4GKOA 3UC0H 3LKRB 5HHVH 5GGTH 1CLYH 2XN9B 4LAJH 3LQZB 1OTSD 4UU9B 5HGDA 2RBLA 4UNVA 5HDQL 4QRRE 1HKLL 5IHZB 2SEBB 1LP9E 2VZSA 4NOBA 5FGCE 5AAWA 2HLFD 3B43A 4MQ7A 3VD4A 3KPPA 4X4MA 1P7HL 3EHBD 2ZOKB 4U3HA 5KSAD 3WFHB 3H0TB 4L29A 3LKOA 2I27N 3VFNB 5EULV 1W72H 4F7MB 4K2UH 4NWTH 3F7YA 4NQEB 4BZ2H 3O8XC 3RA7H 4ZNCD 5HI5C 1QSFE 2Q76A 5I18H 4JFXB 2XQBH 4HFUL 3QWRA 1ODAA 3WCYA 4UZGA 3FFCD 3D3VE 4NN5C 5EU3B 1DFBH 5FUZL 4HIEA 2RCSH 5F9DC 5EU7C 2IQAB 3A6BH 2X4UA 3BDBA 2NY7L 5K9KB 4UQ2A 3VFMB 3RL1A 3SEPA 3WD5L 3PV6A 3M8OL 3R0MA 1A7RL 4ODHL 2UWEB 3RWGB 2HWZH 5DRZA 3W5NA 3MO1A 2YPVH 3QJFA 3VDCA 1INQB 1ACZA 4G8EB 3MACH 5F7FA 3I3BA 2VQTA 2Q8AH 1G7MB 1EZVX 3FOLA 4ZFOL 2ZP0T 3B3IB 4ZMAT 1OB1B 3CFKA 1PKQB 3EJJX 5DJYA 1WWBX 4RWYH 5BRZA 5HHPA 2D0FA 5MENA 3VXMA 1J5OL 3QULA 4R0LC 4HWNA 4HPYL 4K71B 1SEQH 4LLYA 3RWEA 1OD7A 1S5HA 3K7UA 2AJZB 4X6CA 5EH1A 3MLTA 2HYMA 4QRTA 4YIQA 2MOVA 3DBXB 4ELKA 5D7KE 4MJ5B 1FNEA 5CJXA 4OCYH 4NNPL 4K94L 5BW7C 5FYLD 5AZEH 4I5BA 2J4WL 3HLAA 3I6GB 2VL5A 4JDTH 4E41A 2ADGB 3SDAB 4YLQT 2GUOB 1W0WB 4OF8A 5JOFB 5J11B 5BJTB 2F5AL 4M6MH 3ULSA 3OL2A 3OB0K 2ZCKL 4G8GE 3T0EB 4U1LA 2IAMA 4PRBA 3AM8A 2NY2D 4YHOL 2R4RL 4NKQB 5I1EH 1BZQK 3QQ3B 3O6MH 1G9NC 1EXUB 5HSFA 4XHQA 5IB3A 1I4FB 5L2KB 1OSZA 4JCMA 4XNUH 2VE6A 1LMKA 3X12B 1QYGL 3QXDB 4GT7A 3NABL 5E9DE 2LU4A 1KEML 1Y6KR 1U8MA 4EUPG 3WSQL 5F3HB 4X5WB 2EH7H 3D39A 3WIIL 4CMMB 1A3QA 4GRMB 2EDXA 3RTQA 1TQCB 3EDJA 1R5IB 1PG7H 3DPBA 4NO0D 4HXBH 1K8DA 3HE7B 3WS6A 1JPFB 1HSBB 1AD9B 2APVA 2AXGB 4YQXH 5H37G 5IVXF 1MFCH 3RDTA 1AJ7L 5HBBA 1NC2D 5ANMB 4JFYB 3MRRA 4HS8H 5DJXA 3FQWA 1NAKH 1UQSB 1HHHA 3SDDD 3SDAD 2GITB 3SDCA 1ADQL 1OP3K 4OZIB 5J1SC 1LEKB 3IJHA 1UH4A 3KYAA 4GQPH 4XVTH 5F1IA 2GTZB 4XPHL 1VFMA 1AGFB 5J13C 1U8QA 3JZ7A 1B6UA 1A7NL 2XV6B 3EKCA 4FFZL 1RFDL 4LSUL 2BVUA 1BD2A 4D0CA 2AV7B 1XGYH 5C0DB 4ORZC 5EU6D 5FV1L 3L95A 5JOEA 2YN3A 5SV4A 3TZVA 4BH8A 4U6HB 1NGXB 1I8KB 4W4OA 1YNTA 2D7NA 4KK9C 4QXGH 4F9PA 3WXVH 1A5FL 5D6DC 2IBGA 3VRJA 1I8MA 2FL5A 3O9WA 2ZKHH 5T33H 2E7CA 4F7TA 4GKNA 1BEYH 1KC5H 3VWKA 4YX2L 3QIBD 2WMPA 1MWAH 3T8XA 4X6EB 1IBGL 3ZT5A 4JFOA 1TETH 3T1WA 1Y6NR 3O4LE 2GTWB 5CBAA 1KJ2A 1MI5B 4U4BA 2FH6A 1GOGA 1VGKA 1N6QH 3IJYB 2YWYA 1ZHKA 5KSBF 4JFEB 1YEIH 4ISVB 4YWGH 4LHUB 1OGAD 1G0XA 1MVUB 3HZKB 1CE6B 3S35H 3TYGH 4FQ2H 1P53A 1FBIL 3H9SB 1X5ZA 2H2SD 1CR9H 2DLFH 5DJ8A 3UTPD 1LHZA 1U8LA 1ZGLB 4WEMB 2DOCA 3IDYC 2PXYB 5TH2A 3PXJA 4XXDA 3DROB 5C0RH 1S9KC 1WZKA 2R9HD 3M45A 3IETA 1NBZB 3RHWF 5ECJE 1Q94A 5IG7A 3KLAA 1EZVY 3DRTB 2ATPB 2R0WH 1F6AA 1M4KA 1U8KA 3ARFA 2WBKA 1X4YA 3EZJB 1Q9LA 1SJHB 4MHHI 1A9EB 4P23B 5ENWB 3HAEG 1HKLH 2VWEC 4LKXB 5D7JB 4ALAH 4KHTH 1W72B 4NYLA 4AEEA 1S8DA 4ZPTB 3RVWD 3IGAA 5EO9B 4R26L 1GXEA 2VLKD 3PWUA 4MLIA 4F7CB 2XWJB 1UKTA 3S35X 1FVCB 4JRXE 1X5YA 5I1KL 2VLME 3QFJA 1KCUH 3PGDB 3U7YL 8FABB 4IHOB 3ARYA 4YDKH 1LEGB 4FG6D 3LN4A 3QUXA 5IMMB 1TIUA 3OHXA 1AR2A 4P3CH 1WCQA 3AFLA 4L3AA 1JHTB 1OPGL 1KLGA 3NPSB 4HFUH 1NGWB 4OGXH 5SWZA 2FEDD 4AG4H 2Y4SA 3CFCH 2GAZB 4Q9CA 3H9SD 1QHPA 2H8PA 1IGIH 1C5DB 1V7NH 1FYTB 4JO1H 3LN9A 4PUBH 4X4YB 4FS0A 2PXYD 4OSUL 4JO2L 2NY7H 4J3UA 4HHAA 1QRNA 5GRXG 1YEKL 4KMLB 3F7QA 4GRWE 4XNQA 3GSVB 4S1DD 3C5ZD 4Z7VF 5DMYA 1I9EA 3MJ9H 2XXMB 2H3NB 2WBWB 3GSUA 3X13A 4EI5A 4P5KB 5KG9B 1R3LA 4DKAA 4KUZL 1IAMA 4OZHA 2JJSA 2AJYL 5CBEA 4YR6A 4MCYB 1JPGB 4Z7QE 4QEGA 4XNMA 2OZ4L 3S3JA 2VITA 4HPYH 2AS5M 5EU4B 4NC1E 3EYSH 3REVA 3GI9L 2R2BA 4CBPA 2NY1D 3AUVA 1T2QH 1G6VK 5E95B 2HT4D 1F58H 4P4KA 5CMAB 4NNPH 5C0FB 2Z8RA 4F8TA 4K71C 2E9BA 1NLDL 1F3DH 5H35A 1ND0A 4M4RA 1FNLA 2UZYB 5IJKC 3LAFA 4G9FB 4LPXA 3GJFH 4JM2A 5CAYB 3TWCL 5L8JB 2OJEA 3C2SA 2F5AH 3HNSL 5ELIA 1T5XB 2W0FB 3SDAC 4E42B 3DV6B 5J11C 1RZKC 2R4RH 1M7DA 2ED8A 1DUYB 3MOBH 4D94A 4CUCA 3OMZA 3MRCB 3OR6A 3RGVA 2HAZA 5BVPL 3UTZB 4F3FA 2B39A 4O58L 3T0EC 1SYSA 4LGPB 3BSZH 4OD1L 4WWKD 3R4DA 1X3DA 4KFZC 1WBZA 2MTPA 3HC0A 2QQLL 5SWSA 3L3DA 1QYGH 2ICWI 3NABH 5D9SA 4ETYA 3WSQH 5JMRA 3WIIH 4OLXL 4V2CB 4BFBD 1U8HA 5E08H 1NDMA 1NC4D 2Y1VA 1KF9B 2I5YH 3CSPA 5LAXB 3GMMA 5CSZB 1JN6B 1YN7A 2JJVA 1IZJA 3V5DA 2F53B 1TQCC 3GIVA 4E5XA 1OF2B 1SJEA 3VXNB 4LGRB 5D7IF 1T22B 3STZA 2FD6L 1IC1A 4XNZB 3HE7C 4L3EE 3TBTB 3NCYP 3HTLX 1IE5A 3D6GA 4RGMB 1J0HA 2B1HL 2VTFA 2QHRL 5CEXB 3HB3C 1LP9B 1ADQH 5FGCB 1YEHL 2DQIL 3JWOC 3ZDZF 4LLQB 3PE9A 3ZDYE 4GLRI 4PJCF 4ZTOH 3ZHLA 3NCBB 4BSJA 1YECL 4P2YA 2VXVL 3B6SA 3S96A 3N1MC 4Y1AA 5E5MB 5DEZA 4GKZA 1FGNL 2E8ZA 2R1WA 1L0XA 1KPVA 3GUTB 4HS6A 1YY8A 4UIKH 1QSFB 3MRBA 3RWCB 1LO5B 4WFGE 3TFKD 1QD0A 2YRPA 5ETUB 3OJDB 4PJFE 1MWAB 1YMMA 2J8UA 3QIWD 2ADIB 1A5FH 2XRAL 4QNPF 1D6EB 5IVZA 5IROC 3N1GC 4P57B 3RPIA 1OP5H 3RWHA 3R0NA 3LEXB 3HKFA 1UJ3B 1FFOB 2P8MA 1R5WA 2G75A 4OD2B 4HWBA 3C6LD 4LMQI 4WI2A 4LK4A 2EZ0D 2PR4H 4N8VG 5CSBA 4L8CB 2BVOB 3RVWC 1T7WA 2ESVD 3NIFE 1A02N 1WFUA 3QI9B 4RZCB 5HYJD 4JDZA 3HAEA 1ZLUH 2OSLB 5DHYA 5DFTA 1ZHBB 4GRWH 2NW3A 3LEVL 1HQRB 1AP2B 1YY9D 3IU4H 1JNHB 1C5BL 1JGEA 1DVFB 4OZGF 4U1NB 3TIDB 2HTKC 4LASL 2B1AL 3PWPE 4YXKH 5I8CB 2R15A 5MEPA 3FB7B 5INCA 4P3WA 1MAML 4KVNL 3VXTB 1MJUL 4Q0XL 3UPCA 1RHHA 3BWUC 4H8WH 4HF5L 3B9KA 3DRQA 3U4AA 3TESA 3QIUA 4GKSB 4KTDL 2R1XB 4P5TA 3F8UB 5AZ2L 2X4TB 1M71B 2VDNL 4WY7L 1X5IA 3CX5J 3H9ZA 4O2FB 1GZPB 1CXHA 3QDJA 5B3JF 4FTVE 4UDUA 1CD0A 1G0DA 4G8GB 1G6RH 4XCEB 1P69B 3KPRD 1DE4B 3DUUA 5LVEA 4GS7B 4LPUA 4P23C 5DHXB 2XWTA 3RX5A 3TV3L 5D7JC 3WJJA 5INDB 3I9GH 3MRHB 1KCRL 2V5MA 5JPNB 2FWOB 3U7YH 3ET9F 2VH5L 1RV6X 3OR7B 3QI9D 2V5YA 4JAMA 4CNIB 4G6FB 5I1AA 5E9DB 3A6CL 2VN7A 1E28B 4M9PA 5DQDL 2XG5A 3EGSA 1XGPA 2H1PH 1R3HA 4GRLD 5HYQA 4PTUA 5DK2A 4NHUB 3RWIA 3IJSB 3TF7C 3TBVA 4MNGA 3QCUH 3DETD 3NPSC 3L7FB 4RAHA 2DDQH 3MGOA 2ICCA 1FRGH 5D1XD 3G6JA 1E4KC 4IRSB 1WF5A 3WN5A 1ZT4A 1UCTA 4RBPK 5GGRA 4MJ4A 2DLIA 1HHIA 4PGDB 5TE6H 3ZT7A 4S2SA 3BEVB 1ZWIA 1U8NA 3JWDL 4QYOA 1CDBA 1FH5H 3P77A 5I15L 5DI8A 5HVHB 4XP1L 4NZDA 2RFXA 3OAZK 5E99L 5DQ9A 2X4QA 2V2WB 4HUUB 3RKDD 3WEXB 3MJ8A 3V95A 1BAFH 3OV6A 4OBSA 4MA8L 3ARGA 1RMFL 1AI1L 1NFIB 3KHQA 3ZE2F 2DTSA 5AWNL 1T0PB 3CFDB 3LZFL 3GHBL 1MNUL 3QZWB 5ITFA 2AJ3A 2LVCA 1UACH 4I2XE 3PIQA 4PJ5E 4RFOH 2NPLX 3D18B 4JVPA 4G6FD 1NLDH 3CCHA 3DYOA 1JV5A 3F12A 1LO3L 4YAQA 2CLVB 4M8VA 5CP7A 2P5EE 2V6HA 3TWCH 4D0DB 3ULUF 5JOPE 4IS6A 5SWQA 2R23A 4KAQL 4LSVL 1F13A 4DCQA 2I9LB 3HNSH 3JTTB 3PL6C 2VZUA 5B8CB 3O4LB 1MCBA 3BW9B 4NWUL 5BMFL 5F9WB 3KGRA 4M43L 2F54A 2X4RA 4GW4B 3KPSA 3WKNA 3QEUB 5BVPH 5ABDE 1ACYH 4PJXF 3GMNA 2VXTL 3HUJB 4FFYL 2VKXA 5EN2A 1HZHH 1U8PA 1ZKAA 4XPGH 4OD1H 1G7PB 1P7KA 2RGSA 4FQ1L 1ED3A 4JY6A 4WUUD 4IJ3B 3KJ4B 4WEUD 1KLUB 1DDHA 1NJ9B 4U0RC 3WJLA 2E7LC 2XZCH 4J8RA 3U6RA 5B22A 3MV8E 5HVGB 3T2NL 2YD7A 1DEEA 4G6JL 2NXZD 2BVPA 4P46A 1J0KA 1XH3B 4Z0XB 1BFVH 1FSKB 3GEWB 1L0YA 4LSTL 3LKQA 1KOAA 2JELH 4JKWA 2OTWB 4XMPL 2ED9A 3ALXA 1AKJA 4NFBA 5FUCC 4PLNC 2B1HH 1FPTH 1GGUA 3OTTA 2MKLC 4EBQL 2FX7H 1YEHH 1Z0MA 3MREA 4XNZC 1LDSA 5J4MA 3R8QA 4HC1L 4OUOA 4N8VA 5C3TA 3E8UL 4RGMC 4IDLA 4JRXB 1NLBL 1YECH 2PTTB 2YZ8A 4YEFA 5F1SA 2PW2B 3K8KA 3TNMB 3JSSA 4UV7H 5FYKL 4O51A 3K4ZA 4Y2DB 5EPMA 3ARBA 2HH0L 3V5KB 3GHEH 4TOYL 1NH6A 2BK8A 1H5BB 1XZ0B 1T04B 4LLWB 2DICA 4KUCF 2UV3A 5CHNA 4NO5A 1TJHH 1C7TA 3BGFB 3MRIB 4JFFA 3WFEH 4PJEF 1TVDA 5H94B 5C0GB 1H9VA 2KL6A 2V9TA 2CJUL 2Z8SA 1N26A 2A6DA 4GRWB 4P49A 1UJ3C 4KDTC 2VR9A 3PNWA 3N1QC 4QOKA 1KPRA 4MAYD 3EYVB 3MRLA 3PGFL 1AO7E 3OPZH 4I9WE 5I17B 4LCUA 5C08A 1FL5B 2VDLL 4HLZG 3DO7A 1QNZL 3TEUA 3NTCL 2DL2A 3BGMB 3LEVH 3QI9C 3FCTB 5T1LB 4QTHB 5F88B 2H32H 2QR0A 3RZCD 3UTTA 3P4MA 5C0BD 4Z0BL 1C5BH 3EO9H 5IMLA 1P2CA 1WWAX 4G7YH 5FDWA 2VLMD 4KI5D 4PV8B 4UT9H 2F58H 1MJUH 2WIIB 3QUKA 1KIPB 5BXFB 3LHPL 4HF5H 1DVFC 4HGWA 4XHJD 1C08A 1J1OH 2LFGA 3LD8B 5KANG 3QDMA 1AR1C 4QHLB 4KH2A 4KTDH 4KMTH 3QISA 4OV6F 4XB7A 1G6RB 3MSPA 4J6RL 1X5AA 5AZ2H 3KWWB 4I0CC 5EC2A 2VDNH 3CFJB 4WY7H 5JW3L 5C92A 3OAYH 1T4KA 2M2DA 4TNWK 2P5WD 2UUDH 2Y06H 3Q2CA 4KKAD 5T1KB 5I19H 2Q8BL 3BP5A 3C6SB 2YD8A 4PJAA 1T0NA 5FYKE 4ONGL 1MHPH 2ADFL 2H26B 3O8XA 4GQ9L 4UTBL 5JLZA 2Q86B 1HYRC 1KCRH 2Q7YB 3P30L 2VH5H 1AIFA 4OAWA 1J18A 4GS7C 1HI6A 5TJWK 2BHUA 5D1ZD 4WV1B 3N50A 1CG9A 5DQDH 2ZUQB 2ZUWA 5EDXA 4L4TA 3BPLB 1K3ZA 3WFZA 2D31A 4HEPG 2NZIA 1R5VB 1RZGA 5HHME 2LABA 4O02H 4D0BB 2YXFA 4RMRA 1ZLVH 2A73B 3W9EB 1TFHA 4B41A 2J88L 4GBXB 3ZZ1A 2DQFB 4Y8DC 4L3EB 3QEQA 5DMIL 3FB5B 4F80A 5FA3A 5GZOD 1I7ZB 4BH7B 4P2CG 5F9JB 4IRSC 2XZAL 2C3XA 3SBWC 3JWDH 2VXQL 2XZZA 2OR7A 3ARTA 5TGBA 4YFDB 5ACZA 2Z4QA 3VXSE 3BN9D 3GSXB 1BVKB 4NKIL 5E99H 2H41A 3M07A 5BW7A 5HVHC 1MCPH 2I25N 1K4CB 1YQ2A 4ZODA 1A1OA 1AI1H 3AU1B 1CTOA 1I7TA 3LZFH 3GHBH 1MNUH 4K94C 3ESUF 4G7VH 2DWEA 4PJFB 3VW3H 2FO4A 5CJQH 4QY8B 1AGEA 2WWMC 2HVJB 4LF3B 4P9HH 1HNFA 1LO3H 4DW2H 4UBDD 1ZS8A 5JW5B 1A3RL 3BXNA 3LKPA 4Q9BA 5BQ7A 4JN1L 1PY4A 1S7QA 3K80A 3U9UB 3WMSA 4HG4J 4LPYA 4LSVH 3L3KA 3KLSA 4DVRH 2L7UA 4HCRA 2X1WL 2ZCHH 3QDAA 3THMH 4MXVE 3VI4F 4RIRA 3TO4B 2Y5TB 4Z7NE 3MLYL 3GMLA 2I26N 1ZLWH 4NWUH 4JO3L 4GBXD 4M43H 4JZNA 2NTFA 3DVFA 1JPSL 4N0FA 4ONHA 4N1EA 4YHKH 5F9OH 2EIDA 2VYRE 5J1AA 1AE6L 4FFYH 5B8CC 2G60H 4IIQB 5F9WC 4XCFL 1ZVSA 3VXRD 4FQ1H 3IDGA 4AIZA 4J7RA 3QHFH 4YHYB 3QH3B 5FM5O 3VA2C 1EIBA 3JTSA 4P4RA 3PWPB 2CDEA 4ZO8A 4OKDA 3T2NH 4IJ3C 4NDMB 3X14B 3KJ4C 4UQ3A 4L8DA 3RI5K 3BQUD 4HFWB 2JB6B 4NUJA 3L1OH 1QEWB 3U9PL 4EI6B 3FOMB 4M1CC 2EEDA 1ZHLB 3W39A 4CN6A 3QUMH 4TRPL 2NLJB 2J2ZA 1FN4B 1FSKC 3L3OA 4WFED 5JORA 3CNKA 4PP2A 4FTVB 2CD0A 1S9VA 4XCYA 1YMHB 3STLB 3E6FA 4WHDA 3QUYD 5IEHA 5M7QA 2DM2A 3E8UH 2FIKA 1D5BA 4IMLB 1IGJA 1LDPH 3DUSA 2OM5A 4HK3J 5FYKH 4DN4L 5D6DA 2UYLA 5MP6H 4MB4A 4HH8A 4QCIA 3ARED 3GMPA 1WQVT 3V52H 4U2YA 2ZG2A 4KZEH 4TOYH 1EVTC 1VFUA 2X1QA 1IEAB 1EBPA 1TCMA 4QTIL 4Y2DC 1IGFH 2NR6D 4YE4L 1YYMH 5FUOL 1PYWB 4EEEA 3G5ZB 1RUPL 1H5BC 2BVQB 1SY6A 3VFTB 1UM5L 2BY3A 4Y19B 3UZEA 1FZOB 1HN1A 3HZMA 2VOTA 3RAJL 4U2ZA 3VFVA 1NAMH 1EV2E 3H8NA 3BGFC 4LCWD 2AJVH 4M1DH 5HHOA 1KV3A 2CJUH 2R2HB 3DYPA 5D2LA 1RQ5A 2H32B 2X4NA 3D0LB 4DGVL 5J6HB 4I3SL 4MNQA 2CDFA 3HNTH 5SV3A 4Z7WA 4YBHA 1YUHB 4NPYA 3PGFH 3S3SA 2J8UF 2CIIA 3D2UD 3FFCA 2JK5B 3L3IB 3ZYZA 2AXFA 2NZ9C 4RAUB 2LU3A 1QNZH 3GSRB 3N9GL 1QSEE 1T6WA 2DM4A 3DVGB 2IMNA 4OCWH 5KJRL 4H8WC 2WBJB 1I75A 4LLAA 4NZUL 3C8HA 3P0VL 4I2XB 4PJ5B 4LNVA 5C0JA 5DT1L 3LHPH 2A2QT 4XP5H 1B4JL 5C09E 2BFVH 3DSFL 4NC1C 3LKRA 2DI9A 2F5BL 2XN9A 2P5EB 3UJJL 4UU9A 1BFOB 5FGSA 1OQXA 2P8PB 1XT5A 3GNML 3LD8C 5JW3H 5FF6B 1RUQL 5IHZA 3SDXB 2ORBH 4LSDA 2W60B 2SEBA 3N0PB 4GAJL 5GZOC 4LHUG 4Y19D 2YD4A 1KEGL 3K2UH 1OAXH 3BP7B 2F74A 2ZOKA 3ME0A 3MTRA 3WFHA 2R29L 3H0TA 4LMQE 2KZ1B 3BKML 3VFNA 4UTBH 3NA4A 2MCG1 4F7MA 1P9MC 5KW9L 2QSCH 4NQEA 4QXTB 2Z93B 3GM0A 4URTB 3U36B 1A4KB 3PV7A 1IM9B 5FKAB 4JFXA 1A6AB 1T7YA 5EU3A 4Z78B 1EPFA 4HUWA 2IQAA 3QA3A 4WV1C 4C57C 1N4XH 2XKSA 5DC4B 3ZE1E 4UBDC 2ZUQC 1FIEA 4HWZB 5K9KA 4OIIH 3VFMA 2J7LA 2WBJD 3BPLC 5E6ID 2PKDA 1OY3B 4RGOL 2J88H 2UWEA 4LHQB 5D7SH 1INQA 5DYOB 1GVIA 4G8EA 5GGVL 2WP3O 1G7MA 2HMIC 5J0BA 5DMIH 4GBXC 3B3IA 5K9JH 3TYFB 3SDYH 1OB1A 3ZTNL 2X1XR 4ACPA 3NZ8A 1PKQA 2QSTA 4PREB 3RIAK 4Y4FB 1XF2B 3VG9B 1RK1B 3O11B 3H3PH 5IP4A 5LXGL 4S1RL 3H3BC 4I3RL 2R56L 3DTXB 4WRLA 1S9WB 3OKOB 2AJZA 3FO9B 2AEIT 4YZFE 3DBXA 5DUMH 1JYNA 5C0CD 2Z31B 5AEAA 5ACLA 4KKCC 1NC2A 4L9LA 3I6GA 4O9HL 4M5YH 3VRIB 4JHAL 2ADGA 2ZUYA 3LS5H 1IM9D 3SDAA 4OFYA 1W0WA 5JOFA 5D5ME 1BP3B 3GB7B 1I1FB 4EN3B 1A3RH 5BJTA 1Q0XL 3DX6B 1YEDB 4JN1H 4G42B 1VHPA 4FZEL 3MUJA 5F93C 4JB9H 4UNTA 4ZFZB 1HHKB 1XCTB 2ZZUT 4PJBF 3DX9B 3MLYH 3MJ6A 2DL9A 4JO3H 1JP5A 4FFVD 5EU6A 1JPSH 3BEWA 5GJSH 1IC4L 4K3GA 5L2KA 3TO4C 1AE6H 3S4SB 5IR1B 1AO7B 3ARDD 4K9EL 3X12A 4KJQD 4MDIB 1M7IB 1MFDH 3QXDA 4ODTH 3MPCA 1FQ9C 1CBVH 5F3HA 4Q9RL 5EA0H 4CMMA 5DMJB 4F7PA 1YEFL 1PG7W 4IIQC 5JHDE 3MCKB 1X5HA 5ACMA 3U0WH 3VXPB 3QUMB 4WNQB 1TTUA 4YHYC 4X6CE 2QSQA 2MPAH 3HE7A 1FO0H 1JPFA 1AD9A 4LGSB 4F2MA 1ZOXA 3GGWB 2AXGA 3U9PH 4GLRH 2PW1B 3HG1D 4ZUUA 3QPQD 1F4AA 4BFEA 3RP1A 1AQDB 5I8KH 2FCBA 5IFHL 4TRPH 4QXUH 5E8EB 1UQSA 1OGAA 4Y16B 5EFIB 4EQ2A 4WFFD 4QHNB 3ZHKA 2GITA 4OZIA 3UTSE 3LMJH 3KPTA 4YUEH 4WO4D 1IT9L 4D9LL 4XCCH 1U3HB 1LEKA 1RURL 5HJ3B 5F6HI 4FNLH 2HP4A 3SHSA 3ELAT 4L9DA 2GTZA 1VDGA 4U1SB 1AGFA 3PDOB 4JFDD 1H3WM 4ZOAA 4PJDF 4JZJA 2W9EH 2AV7A 4J3TA 5C0DA 5FB8B 4C83B 2E9IA 1CGXA 2VZTA 4TSAH 3QUZD 5ERWB 1P6FA 2H9GB 4PB0H 5IROA 1QSZA 4GG6F 4U6HA 1NGXA 1I8KA 4NT6B 3WNNA 4XVSL 3QDGE 2A74B 3I02B 3KPLB 3VFPB 4YE4H 5FUOH 1NAMB 3QNXA 3BKJL 2OBGA 2OYPA 3T65B 4YDJA 4HKXA 2YD2A 5CJBA 5HHMB 4BQBA 1ULVA 1BPVA 3BIKA 2CLZB 2FGWH 3QEHB 3MLSL 4G6AD 4X6EA 1GGBL 4LLMB 4Y5YB 1PDKA 2CO6B 3MNWB 1UB6B 3BE1L 3EYFB 1C7SA 2HN7B 2GTWA 1ZA3B 1MI5A 2GJZB 2GY7B 2VXUH 3I84A 3QXUA 3U48A 2E6JA 3IJYA 2GT9B 3R06A 1LD9B 4JFEA 4U6VL 5ISZB 4ISVA 1N2RB 4LHUA 1MVUA 3HZKA 3JUZA 1T7XA 3VXSB 1LWRA 3H9SA 5E4EB 2V7NB 2YA0A 4BA8A 1AXSB 1JPST 1X44A 4U6TA 1ZGLA 5FHAL 4YPGB 4MD4B 2PXYA 4KI5F 5GGTA 1KIQB 5L2JA 1W8NA 4PBWD 3DROA 4OQ1A 1BD2E 1A6PA 3K1DA 4NZUH 2XOTA 3QXTA 1MJJB 1O7SA 1VFBB 1F2QA 3LH2H 4ZO7A 1JGVH 1KBGH 3PDDA 3DSFH 3CZJA 2WBJC 3DRTA 1WWWX 3P40A 5JR1L 4LOUD 3UJJH 1ETZB 3F7PC 2HG5B 1SJHA 3GNMH 1A9EA 2DQTL 5ENWA 4HV8B 4LKXA 1RUQH 5FYJH 1W72A 1I9JL 2VSDA 4ZPTA 5GGUB 3KR3H 1B0GA 2AK1H 2H2PC 1WVZA 3HCVB 5EO9A 3WFDL 1KEGH 2V17H 4R8WL 5F97E 3KS0H 4LQ1A 1QKZL 4JGMA 2XWJA 4F7CA 2L7JA 1FVCA 3HR5B 4TQEL 4XMLH 4GG8B 5K9OB 4K8RL 2CGRH 8FABA 4IHOA 3TJHC 1LEGA 5KW9H 5IMMA 4PJ7F 4M7KL 1U8JB 3L5WA 5JHLL 5I1IH 5ISZD 3KXFD 4NO2B 2Y6SD 1OLLA 3BVNB 1NGWA 4FZ8H 5EB9A 2GAZA 2ARJB 3QG7L 1JWUB 1DLHB 4PJAF 1FYTA 4Z95L 3R8BB 4PLKC 5DR5H 2BJML 3K2MC 5IB4B 4AEHL 2X89A 3SGDI 5HGGS 1T80A 5DD1L 3HE6B 3GSVA 3OGOE 2G5RA 4KJYB 3JWDC 4FFVC 2CXKA 2IC2A 1GGIL 1RAMA 3OGCB 2XICA 2A9ML 1Q72L 1NFKA 4MCYA 1JPGA 3EJZC 5LXGH 1NC4A 4S1RH 2Z35B 1IGML 5F44A 5I66B 3LN5B 4RNRB 1WAAA 2C3VB 4Y4FC 2R56H 1HSAB 3VG9C 3QFJE 5EU4A 4YBLB 5D71H 4DUXA 4RA0C 2NTSP 1FGVL 2YA1A 2CPCA 1BFTA 4OCXH 3L5JA 2ZJSL 1WBXB 4JFHD 4Y89A 2Q6WB 4P9HC 4IBLT 4ZTPH 5IFAH 4G9FA 4JHAH 3EDKA 5DZNA 2Z31C 1CGSL 1KSRA 4X4ZA 3K74B 3ARPA 5C7XH 1CXIA 1Q0XH 1T5XA 1AH1A 5D7LE 2W0FA 3T0AA 2EO1A 3FTGB 1DUYA 2R69H 3MRCA 4EN3C 4JQIH 3UTZA 1KG0B 4MQXD 3HE6D 4W6WB 2E7LA 1H15B 3QZWG 3CC5A 2APTA 5HGHB 1P1ZB 2DMKA 4HBCH 1MCFA 1FO0B 4OCRH 3BUYB 1QZ1A 3FN0L 3QO1B 1QSEB 1YEFH 3FB6B 5TDOB 3WFBL 2O93L 4BZYA 3CMGA 3IFLL 3C6LA 4NJ9L 1JN6A 1Q9WA 2F53A 3N1PC 5F6IB 1KCKA 3I6KA 3FRPG 3G5VB 4OLZH 5C09B 2MQ3A 1VESA 3VXNA 1IGCL 3O6LH 1T22A 1YYLL 5HYJA 1W2KT 1QBML 1V8HA 2DLTA 5FIEA 3TBTA 5L9DH 2DIAA 3SKOB 1Y6MR 2PF6A 3BO8B 5CEXA 1MFNA 1LP9A 1NDGB 1JRHI 2HJLB 2PO6D 5HHQB 2Q3ZA 1IT9H 4LLQA 1LK3L 4OCNC 2BY1A 3Q5OA 3BMWA 2OK0L 4Y16C 4RSVA 3QPXH 1CI5A 4JJHA 5E5MA 1U3HC 3KPOB 4JKPL 1EFXB 3U7WL 2MMXA 4AQOA 4HWBL 1WBYB 3O2VH 1Q0YL 4LIQE 4U1MB 3GUTA 1FJ1B 3RWCA 5C0AD 1LO5A 4XVUC 5SWSE 2BX5A 2AJSL 5ETUA 1P5VA 1F00I 3OJDA 1MWAA 5H8DA 5DUBB 3EOTL 2BDNH 4XVSH 3GZKA 2ADIA 1FC2D 3E6HB 4PRIE 1D6EA 3C08H 5T5NG 4P57A 3BKJH 3SE8L 4PB9L 3KYKH 3BIBX 3BWAB 1UM4L 1UJ3A 1FFOA 4KDTA 4L8BB 3ROLB 4RBPH 4OD2A 1CGYA 5ILTL 1GGBH 3KLDA 3BH8B 3PABB 3WE6B 3ZYJA 1JCKA 4L8CA 3MX0A 5B39B 2DQUL 5DFVC 3QI9A 4RZCA 4Y5YC 3OAZH 3O45A 3O0RH 2M1KA 1NUNB 5CJOH 4OLVL 4TULL 4XWOC 2XTJD 1ZHBA 4OIAA 1UZ6F 1HQRA 2W38A 1KELH 3KDMB 1A7OL 1IAOA 1JNHA 2F8OA 1DVFA 2VN4A 4U1NA 3TIDA 5IOPB 5I8CA 3PHSA 3FB7A 4YNYB 3KNBB 3VXTA 3NOIA 1TITA 4HQQH 5D1XA 1JZ6A 5E4EC 2CXGA 4TVPL 3ZSTA 4GKSA 2R1XA 3BZEB 2F19H 1M71A 5DMGC 4O2FA 1GZPA 1Q9OB 5D5MB 1TJGL 3L7EB 3OSKA 4C54A 1II4E 4X80L 4HIEB 2W0LA 2O5YH 4Z18A 2EDHA 3LB6C 1ZEAL 4G8GA 2G5BA 4R4FH 4XCEA 4R9HA 1HCVA 3RL1B 3MQIA 1DE4A 3PV6B 2QTEA 2CRZA 1OAUL 4IRJD 4R8WH 1QKZH 2FR4A 5B21A 1IQWL 1A14L 5DRZB 2D7TL 5INDA 3QQ9C 4X8XA 1IEBB 4KU1A 1MOEA 4MVBD 1B2WL 5JPNA 2FWOA 5TFSL 3CSBA 4YDVB 4PJ8B 4KQ3L 2W9DH 3OR7A 4MXQC 4GO6B 2X4PB 4CNIA 4OI7A 3CFKB 4F58L 4M7KH 3JV4B 1RZIB 3U1SL 1E28A 1OTTD 5DJYB 5JHLH 3C5SB 4N0YL 1EK3A 3BD3A 1XCQB 4NHUA 5JHDB 3IJSA 4FFWD 5GGVY 4Y4KD 5F71A 2OMNA 4L3CB 2RIKA 3C9NA 4TSCH 4X6CB 2FX9H 4AL8L 1LEIA 5DQJB 3L7FA 1SHMA 3MJ9A 1HQ4B 4L4VD 1ORSB 4AEHH 4IRSA 3SBWA 4I5BB 4F57L 3WO3B 4FA8A 5DD1H 2W92A 5FYJD 3EDDA 2C3HA 3P0GB 1IILE 4PGDA 3VGAB 4JZO<