4HAFA

Crystal structure of fc-fragment of human igg2 antibody (primitive crystal form)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
209
structure length
209
Chain Sequence
AGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ig gamma-2 chain C region
publication title IgG2 Fc structure and the dynamic features of the IgG CH2-CH3 interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 37
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hafA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hafA01
4ODTL 4YXKH 2R29H 3CX5J 5CILH 4EBQH 3QNXA 2AEWA 4MJ2A 3SGJA 5IQ9B 5DHYB 4X6EB 2GK0A 2HLAA 1YECL 5BVJA 1CBVH 3SDAB 5EC2A 3BH9B 2F53E 2ZCKH 4N9GB 4JY6A 4DUVA 1F97A 4P2OC 4RFEB 4WW1A 3WNNA 4NPYB 5FA4B 3V8OA 2PO6C 4GRWF 3O8XB 4PRDA 4U1NA 4F80A 1KTDB 1W8OA 3ARYA 4JZJB 4MSWA 3P73A 1KPVB 4KKNA 4OIIH 4OLYL 4XBGB 2GKIA 4ZSOE 3P0YH 4LCWA 1KT2B 5D7LE 5I8KL 5DFTA 2AERT 3BYYA 3ILPB 3UYRH 1I7ZA 2BVUA 2VXVL 3GSNB 3VFGL 3VXPA 4X7SL 4YHZH 3FQUB 4KKCC 1KJVA 4FTVD 3QI9D 3ZLQC 43C9A 1N0LA 3QIWB 2PN5A 3RAJL 3RKPA 1MCPH 1UZ8B 4AH2A 5FUOH 5F89B 5TE6H 2D03H 5GIRA 5GRJL 4D9LL 1I7TA 1OAZH 1ORQB 5HI3C 8FABB 1WZKA 2BOCA 3ARSA 3CK0L 2O61B 5A2JH 4S1DD 3L3GA 4TSBH 3HG1D 4AEHH 4MS8D 1A7RL 1ACYL 1JTOA 4Y16D 4I0CC 1FGVL 2YD7A 2DRUA 1EJOH 1GOGA 1QEWA 4R96B 1ZGLP 3BO8B 2JELH 4KAQL 2YN3A 1TDQA 1F6AB 1YYMH 3BZ4B 2WM0A 3QDJB 2X1XR 4KJWC 3RVWC 1LO3H 5EN2B 1OCWH 4BSVA 1I7RB 4D3CH 1GZPA 3T2PA 4ORZC 4ODVL 4LIQH 5EBMB 4RSVA 1BFVL 1OTSD 1KCLA 4GMTL 5DUBB 2FNBA 2H8PA 3EYOA 5L0QB 1I7UA 3O11B 1F3JB 5IVNA 4XPGH 5KS9E 2UZIL 4PBWD 5HTSA 4IBLT 4Y2DB 1OTTD 3QJFB 4M7JH 5J13C 4XCEB 2ARWA 5HGBB 3CAFA 1X4YA 4PGBA 4KDVA 4M48L 2HKFH 3QQ3B 4X4ZA 3ECBB 3TCLB 2E8ZA 2AXHA 4NNPH 2EYSB 3PXJA 1FZKB 1QO3B 4LPUA 5B4MD 3CZJA 1MFCH 2QR0A 1UCBH 3GGWA 3MUGB 1DFBH 1KIQA 4NHCL 2XG4A 2XQYK 2Q6WA 3TN0B 4MMXC 4YBLC 3SJVD 5HY9B 1HYSC 3HLAA 2FATL 3MREB 2DLHA 4Q9RH 5IF0A 3BX7C 2D7QA 2GTWA 3BJLA 1HH9B 5JPMA 3HTLX 4B5EA 4LSDA 4ZNEA 4ENEC 2E7BA 1NUNB 4CU6A 5JA9A 4KRPD 1YPZB 4QRPB 4ZTPL 1YYLL 5CCKL 2E27H 4JRYA 4CBPA 5D72H 3SDDD 1EIBA 3BP6B 1QFUL 2IPUG 1RUPH 4Z7WA 4JPIA 2BZDA 1P4BL 4YHOH 5K9QI 1TTFA 1A5FL 3BWUC 4HHAA 5D7IF 1NEUA 3MV8B 5DQ9A 4OGZA 1VFUA 3DBXB 4MCZA 3HRPA 1U3HC 3STLA 3T0ED 1UWGH 3PQYB 5D6DC 1FNGA 4CMMB 4JFED 4NZUH 2J5LC 4UILL 4FZEL 3VH8A 5I8EA 2IFGA 1SEQH 3LEYH 3P4NA 4HGWB 1RK1B 1KBGL 2D7TH 4NUGL 5KVDL 3OKKA 3CC5B 3VXSE 3QZWA 1EEUA 3TZVA 4YDKH 2IG2L 2BNQD 4OKVA 1ND0B 3PWNA 2V2TA 4GW5B 3VRJA 3PL6A 4M7LH 3UTSE 1DBJH 3MOAH 5EA0H 5C0FB 1S5IL 3CNKA 3LOWA 3LVEA 4ELMF 1UH2A 2HTLD 4K3JL 2Z4QB 4HUUB 4M02A 2YRZA 2ICCA 3UPRB 4TVPH 1QSFB 2X4TB 5GZOC 4P4KD 2A9ML 5IP4A 5I1LB 1UKTA 1QD0A 3HNSH 2PF6A 4P9HC 2ESVD 4XH2A 1UJ3B 4OV5A 5IKCB 2X1WL 3IU3A 4XP4L 2ATKA 2D31A 4JO1L 1MWAB 5GGQH 4CGTA 4OCSL 3FHQA 4S0SD 3LQZB 4NT6A 2OSLB 2RFXA 1CICD 4Y1AD 5HHMD 5J7CC 4F7PA 3F7YA 4AIXA 4K7PH 1UVQB 4GXUN 5C6WH 2JB5L 2C7UB 5MP6H 1NKRA 1A6UH 5HBBA 1D5ZB 1MJ8H 3TA3A 5KSUA 2KL6A 3MRFB 1INDH 5B8CB 5C0JA 5AZEL 5J6HA 1J1XL 5M95B 4P23C 4DWHA 1L0XA 4P9HL 4C4KO 2OL3L 4WTZG 1G7PB 2EZ0C 2PTTB 5IVZB 3TBYB 3QAZC 5DJCA 2ICES 3FT2A 1FO0A 1YEKL 1CLZL 1DBKH 4WI5A 5T1MA 1HDMA 2UWEE 3BDXA 5C09D 2G75A 4I4WA 4KVNH 3MRQA 2UUDK 1RI8A 2VLKD 4HIIB 3QEQA 4QEGA 4D0DB 4PLJC 3B9VA 4BQ9A 1MH5B 1KELH 1XF2A 1J1PL 3LKPA 3CVIL 4DW2H 1U8QB 3GIVB 1V5JA 1MFBH 4Q58C 4YXHL 4G8EB 3QIUB 3C5ZC 3QNZA 1XT5A 4XPAH 4GXVL 4MZ3A 3P30L 4XP1L 3MZTA 1CR9H 1N5AB 4U3XA 4G9FD 3H7LA 3J7HA 3QH3A 4GAFB 4PJBB 2X4SB 4U7MA 1NCNA 4QOKD 4ZOBA 3I3BA 4XCYB 4RWHA 25C8H 1ES0A 3DHJA 1MJJB 1SYVA 4WUUE 4IRJB 4CDHA 2XWBB 1YC7A 3SKMB 3I75B 2PXYA 3U30B 4MDJB 2OMNA 4HQQH 4LGRB 2DAVA 4LF3B 3UJTH 2VXTH 2V6HA 1I3GL 1MRFH 3BPLB 4OBSA 4P5TC 5TF1L 4LAQH 5DC9B 4D0BB 5D71L 1G7MA 2UUDH 1A6TA 3B43A 3EO9L 3P9LB 4MNQD 5BZDA 1YUHA 3SGDI 1OT2A 4MNGE 4Y19B 4KVCL 4HXBL 5EBGA 3UTZB 1FNLA 4S2SA 1CDYA 4U3HA 3ULSB 1FL5A 4UUJB 3KYMB 3LS4L 4M9OA 3GZKA 3BZEB 2P5WB 4NP4H 5CP3A 3VE0B 2YD9A 3OKEB 2QQLH 4YIQB 3DV6B 2FGWH 3NFSH 3VFTA 3PGDB 3C6SA 1FRGH 2R0ZH 1DANT 4OTXH 4ELKB 2X9XA 3PWJA 5DEZA 4FQPA 4J1UB 1ZEAL 4P46B 1AR2A 1FFPB 2AJUH 5FOBA 4UV7H 1QRNA 3EO0B 3ZT6A 5C0AD 2X41A 5I1JL 4KK9D 5E2VH 4DCQB 1T03H 4FABL 3B8SA 4I2XA 2HFFB 2XZCL 3UEZA 2BVPB 2VXSL 3HMWH 1BLNB 2JJWA 2KKQA 3GBNL 3UXFA 1RIHH 1RZKC 3PUCA 1KLGB 1UACH 2QKIB 4QNPE 5BQ7B 5E2WL 5ANMA 1ZHBA 5DK0B 1DQMH 3JV0A 3X13B 4FTVE 3SKOA 4YC2C 2HT4C 5D1XC 5HDOA 5AYUL 5FYLH 4ODSH 4LVOB 4OQTH 1IAOA 4CU7A 3T04D 4M5YL 3GRWA 2ZKHL 1I3RA 2B4CH 3QUYD 4JZOB 3PHOB 4YHNB 3WCYA 4JRYD 4TSCL 1OGTA 1HXMA 4JKPL 4OUOA 3GSRB 3G6JE 3Q6FB 4UQ2A 3HG1E 3DUHA 3MJGX 5EU4A 3JWDL 3MBEB 5E8EA 1AGCA 3D48R 1E4XL 1G9EA 4JKKA 3QQ9C 4G6AC 2IQAA 5BZWA 1XEDA 3S36H 1RZKL 4DZ8B 4YHPA 2DN7A 4M6AA 4QHKI 5BOZG 2FHFA 1H5BC 5E08L 5HDQL 4ZFGH 3T2OA 1IAMA 1KTLB 4U1MB 1KN2L 2I5YL 3ROOA 1J87A 1YN7A 4OZFA 5DTFA 4JB9H 4Z95L 4XPBH 4UT7H 3ILQD 3GB7A 3VGEA 4GKSB 2FJFA 4F7EB 3CSYB 4RWYL 4M1DL 3PP4L 2BMKB 3AC0A 2EEDA 4IIQB 5SV4A 3DYOA 5EOTB 1EXUA 4DFHA 1CGSH 4NKIH 1C1EH 2AJVL 2XYCA 3VXUB 4U0QB 4DVBA 1DL7L 4Z78B 2DYPD 2A0LC 3MJ9L 3T77A 2R2EA 5IBTH 4LLVB 3C2AH 3B4NA 4I1NB 1JWUB 2YUWA 3BQUD 4HT1H 5J12B 4NZRH 5D7IA 3GNMH 2VXQH 3Q6GL 1WBZA 2NTSP 1FGNL 5HHVL 3BW9A 3SJVE 2IAMC 3A6CL 2XQBH 3MOQA 2XXCB 4GRWH 3SOBH 4R4BA 1A1MB 3DUSA 3X14A 2HJLB 1TNNA 1YEDB 4LEOA 3HI1A 3HC0A 2HT2D 3PV7A 4MJ4A 2DBLL 2ARJQ 5CP3H 4DQOH 3FL7A 1I8MA 2DQEH 1CLYL 1L6ZA 2C5DC 4OZHB 1I4FB 3RQ3A 1I8LC 3FT4A 4HUWA 5M94B 2OR9H 3TP4A 2YPKA 5F6HI 4YAQA 4ZXBC 1C08B 2NY3C 2VUOA 3LRGA 2Q8BH 1QFWM 4TVSa 2VH5H 5CD3B 4H88L 3T0EE 4WV1C 3GMLA 3WUWA 2Z31D 5BVPH 4I3RH 1CFTA 4P9ML 5DC0A 5H94A 4E5XA 4E9LA 2JJSA 4APQD 4JFEE 1IEBA 1G0XA 3ARGB 1QBBA 2ITDB 3OKNB 4ELMA 3QXTA 1NC2D 1JHTB 1QBMH 2P8MB 5FYLD 3SGDH 1DBMH 2IH1B 4XXDB 4KGJA 3UTPD 4YHLL 5JOFA 5IVXB 5GGRA 1DQJB 3D3VA 1FZOA 3G6AA 1OGAB 4NNXA 5C0EA 3W82A 1XH3A 5I76B 2BNQE 2J8OA 3EYUL 1MY7A 1M71B 1IL1A 5IHUH 2HTKD 4DGVH 3GRWH 3SQOH 1NC4B 1ZT7A 4OZ4B 1NL0L 5BOPA 3L7FB 3BEVA 4P2QD 1ORSA 3S5LB 4GMSL 4OM0H 1BZ7A 3CFBB 3UP1A 3WDJA 1XF5B 4V1DD 1VDGA 1ZA6A 2WINA 3HN3A 3P77B 4PYHA 1JRHI 4G8GB 4LIQE 5EPMB 1FE8H 4U1GB 4O2EB 2VOTA 3MA9H 1CLOH 4LLQB 5JXED 3BIKA 2AJYL 4NGHL 1NJ9A 2R0KH 3MLYL 5LQBH 3UO1H 3KNBA 3FO9A 1HINL 1MF2H 2ERJB 2EKSB 2W0KA 5D9SB 4Y1AE 3IDNA 5HHME 5LKNA 3PJSA 1NSNL 1F00I 4AT6A 5KN5B 1TQCB 1WT5C 3E6FB 4OZIB 3ZHDA 3DX6A 2YA2A 4E41A 1B0GA 4JDVB 5F9OH 1LD9B 1FFQA 1BBJB 4KQ4L 4N1HB 1NMAL 5FF6A 2F54A 4ZTOL 4Z7NE 1H3UA 4KKAC 4ESKA 5CEXB 1DBBH 2D9QB 3ARDC 1IGMH 4IRZH 1T1YA 3MRIB 4G7YL 3K7UA 5ADPH 3S8WA 3AB0C 5DYOA 1YEGH 4RFNC 3Q5YA 1E0OB 3FO1A 3ARVA 2APFA 4LOUC 2FEEI 2QHRH 4LPXA 3R0MA 4HKBB 4HZLB 4WWKB 4UB0L 2YC1B 2EIZB 1RZ8B 4XHQA 1YEFH 3ZDZF 5AUMB 1A6WH 5C09E 1CCZA 3ARUA 12E8H 4DGYH 2VLKE 4JRXB 5LGKA 3MMEB 5SX4H 5K9JL 2OP4H 1Y18A 5IQ7H 1E27B 5FYKL 5E8OA 2BNRD 3RDTB 3FJTA 4BA8A 1A3RL 1AGBB 1TQBC 1UM4H 2P48B 1EAPB 1TXKA 4OJFL 1SM3L 3DTXB 3MRMB 4PJ9C 2GITB 3L95A 4WW2B 2AABH 4QGYA 4LEXL 4XXCC 5GS3A 3VFWB 5KVGL 4Z0XA 4G9FE 5MHSD 2VSDA 3ALXA 1QSEB 4FQLH 2CDGB 3ALWA 2AP2A 4PRID 1G7JB 5EIVA 3C60A 3BE1L 4QOKE 5CAYB 4CKVX 3T8XA 5E6ZA 1U8IB 1MOEA 2K1MA 5GRWA 3TIDA 4OFYD 4ZUUA 3TO4A 5BMFL 3FOLB 3PGCA 3T1FA 5CINL 4MA7H 2IADA 1GGIL 3VFRB 4Y4KA 4FQHA 3IB4A 1EBAA 4PG2C 3WD5L 4TVPE 4OUUB 1CFQB 2UVEA 3SGEI 2WBJA 5DJ6B 5KSVB 3SCMA 5IB3A 4MAUH 4MNQE 2AQ2A 3RUGE 5BV7H 3D2UA 4PJ8C 4F37K 5BXFA 4HWZB 1HHJB 2NY7L 4HIHA 3CFDA 4PJXF 5DR5L 1R5WB 2O5YH 1IC5H 4OLXH 1W0WB 4LCUA 4NNYA 4GG8A 1Z9OA 2A9NL 3EIFA 2PKDA 1CD0A 5ILTH 1XF3B 3S37L 3DURA 4JM2F 1T7XA 2OZ4A 5EH1A 3Q48A 5C0AE 4PRAA 3RGVB 5T1KB 5HHQA 4MB4A 1RK0B 2Y23A 4GAJH 1Q0YL 5IOPA 7FABH 4YE4L 1MCWM 3FB7B 3R8BB 4PTTB 3N06B 5LGHL 3HB3C 5JXAL 2CDEA 5FYJH 5IFHL 2W0PA 4XMPH 2LAGB 1RUQH 3C8DA 1HH6A 3VG9C 3PABB 3RTQA 3EFFB 3DUUB 1HSAA 1ZVSA 3FOMA 4YO0A 1IGJB 1JRHH 2NY1C 3V2AR 2WLZA 1M7IA 3L3KA 5KSAD 1SBSL 5EORL 1U93B 3MRGB 4OSUL 1AIFB 1T1XB 4JRYE 2QV2A 1T4KA 1VADA 2KZWA 3VD4A 1MLBB 4HJJL 5DUMH 3NAAL 4LFHG 3MV7A 1FIGH 2ZUQB 4QHLB 4YDLC 5D1ZC 5D70H 1D9KD 4D0CA 3B83A 2B1AH 1EMTL 1SBBA 3KPRD 2WUCH 4Q0XH 1KG0A 3HZKB 4OLVH 4KJYB 3MBXH 5FECB 4XC3L 2AK1H 4YK4C 1J86A 3OZ9L 4MD4A 5HGHA 1CF8L 2XPGB 2G60L 3OV6A 4NKQB 4EZMA 4GQ9H 3QCVH 5IW6B 3V6OE 2Q8AH 5DXWA 1CQKA 1TVHA 1N5YH 4JEGB 1BGXH 4X7CC 3EW3B 2AS5M 4TNWK 4CNIB 1WISA 3NZHH 5HHNB 4Q9BA 5CZVH 3QA3B 3RNQB 3WBDA 3CXHK 3MGOB 5IR1B 1MQKH 1L4IA 3BN9D 3ELAT 4ZPVB 3GJFA 2P47B 1UH4A 2V9RA 4G43A 2R23B 2XG5A 5DMKB 5ICYB 2ADGA 3BHBB 4JFFB 2JJTC 4FFWC 1M05B 3P40A 5A1AA 4NM4L 5MI0B 4Z8FH 4KJQD 1R3LB 3L3JB 2HRLA 4OCXH 1J18A 2HJFA 4N0FA 5D2NB 1DVFB 3WNKA 1CE1L 2FX8L 4AEIH 1P7QD 3C09B 3VGDA 1R5VA 4AG4L 1MY5A 2XKSA 1OARL 1OP9A 4LGPB 4I48B 5C70A 1KLUB 4YR6B 1F6FB 5B39B 4HK0A 5DT1H 4BYHA 4NQDD 3H9ZA 3MJ7B 1RV6X 3O8XC 2FIRT 5FGSA 2Y72A 4JZJC 1UA6H 5EOCJ 4NO3B 3LDBC 3U36A 4HJ0D 4E41D 1XF4A 1BD2A 3O6FA 4I18A 3DXAA 3TFKD 3RWIA 2OZ4H 4NYLB 1KEGH 4JJ5A 4L8CB 2F54D 4V2CB 4HG4K 1KACB 3JTTA 4WHCA 4KRNA 4JLRB 3BAEH 1ETZA 3RWCB 2EDWA 1IE5A 5T5NG 3DVNB 1ZHLB 5FYLE 2B2XL 5F7WC 3TV3L 4AL8L 1U8LA 3L5WB 2DL9A 2GEEA 2VLLB 4LCCC 5EULV 5B21A 3LRSA 2CO6B 2YD8A 5KOMC 3UTPE 3QIWC 2DQFA 1WSST 1VPOL 3S7GA 1V7NH 2EECA 2HWZH 4WEUD 5E5RB 1ZGLB 3JXAA 5IJVA 1ZMYA 3BPCB 3A6OA 4ZAKD 4YNYA 3BZFB 4GAYA 4ZQKA 4U1SA 4RNRA 4TN9A 1JHLL 2BERA 3GJFK 3HPJB 1Q9OA 3TBVB 3FFDB 2P8PB 3QXDA 5FHBL 2VDRL 4I3GA 5DVNA 3BGMA 1F3RB 4P2QE 2WZPD 3BWAA 3M8OL 4BH8B 4V1DE 5E1AB 2V17H 3GSNL 3QIBD 1JGLH 3X11B 1FPTL 5TDPA 4MWFB 4M7KL 3OWEA 3AXLA 3GEWB 1RVFL 3C9NB 4QXUH 1KIPA 2GJJA 1T3FA 3A67H 3C60D 3EJZC 3S34H 5JUEL 5E94A 3S35H 5DJ2B 1YC8A 4R2GB 3UPAA 1T1ZA 1RJZA 2YOCA 3B5HA 2P8LA 1HE7A 1YNTA 1C5BL 2GUOA 4HF5L 1N2RB 3FAXA 2Z8WC 4WU7B 4XVJH 3SE4A 3IDIB 1KB5B 4Y2DC 1EGJL 2VIRA 5L2KD 4JHAH 4XGZB 5B3JF 2ZCHL 4LLWA 2G9HA 2CD0A 5FKAB 1BOGB 5ICZA 1XR9B 1S3KL 3DGGA 3HR5B 3ZE0F 3T3MF 5F1NB 1V3JA 4DGIH 5KOVC 4IRSA 5DJAA 1A9EA 1BWMA 3GJFH 1TNMA 2DLTA 4GRWE 5E95B 3KPQB 2VDKL 3D2UD 3TN0C 4FNLH 4U1IB 3ROLB 1I8KB 2IPTL 4XNZB 3VJ6B 1GPOL 4OGAC 1MUJB 4PD4J 3UAJD 4JHWH 4JDTL 4BZ2H 3KLAB 4ETQA 4TQEH 3IDJB 1CIDA 1HNGA 4R0LB 3UTTB 1CGXA 3LKQA 1I9IH 4X80H 3B6SA 4M4PA 1NAMB 4PD4K 1PGRB 4WO4D 3P9MB 1LK2A 5KZCD 4N8CL 4RGOL 2JB6B 5EG6C 5CBAA 2PR4L 5CEZL 4LPVA 3CDYA 3H9YA 2RCSH 4P0DA 3C6LB 3DPBA 3KPMA 1EUUA 1B4JH 5D1QB 4I2XE 4KUCF 3RL1A 3VWKC 5C9JB 1F4WL 3KR3H 4XBPB 5ADOL 3CJJA 3RWJA 4QTIL 5MHSE 1G6RA 3I6KB 1JTPA 3MLZH 3OXSB 1U8PB 2FWOB 2BSTB 2JCCF 4PRIE 5I74B 1JNNH 4X6FA 2DQGL 2WIIB 1QLEL 1BQHB 2IPUK 2LTQB 3EYQC 1AY1L 3VWJD 3S88H 4PLOB 2BSSA 1H8OA 4RQQA 4HS6B 1SVCP 3NTCH 3TPUB 3TVMB 5EUOB 4UINL 4QYOB 1HHIB 5MEOB 2B0SL 5DS8A 3P11H 5F3HB 3MRDA 3QP3A 4PJXA 5JQ6L 4BFIB 2XNAB 4NBXB 5IIEA 3RKDC 4FQCH 5C8JA 3NMEA 1EO5A 3LB6C 3SE9L 2UYLA 2AKRA 1LP9E 1LO4L 1DLHB 4G9DB 4UDUB 3CXDL 4HIEB 4WTZA 4BELD 3FB6B 4JM2A 3WS3A 2C4FU 1JPSH 3FONB 4KPHH 2WWKO 4KXZH 4M43H 2NXYC 1G1CA 4KK6C 3QXAB 3P0GB 4ZPTB 1R3IH 1CD1A 1TJIL 2X4PB 4UTBL 3V5KA 1UJ3C 3QDGA 3LMJL 4LVHB 4OLEA 3V5HB 3VRIA 2G5BB 3GFUA 2AXGA 4LPYA 1BZQK 4FHBD 1OAUL 5IEHA 5EZOH 2VDQL 5D8JH 2JJVA 1TTGA 2F53B 2OX5A 2R56L 2ZG3A 3ARED 2DTML 1D5IL 4JFDD 5DC4B 3VFVA 3R1GH 3RBGA 4YHIB 5E6YA 2CIIB 4LSRH 4NQEA 1PEWA 2V5RA 32C2A 1LILA 1S9WB 4GRLA 2IANA 2RR3A 4JG0L 5K59E 1CU4H 1LO5A 4GJTB 5B8CC 3MLVH 1BM3L 2VITB 4F3FA 3G5ZB 4LLYB 4M03A 4PTUB 5DA0B 3WLBB 2OJEB 1A3LL 2H6PB 4YQXL 35C8H 3V0WL 4ZSOB 3L7EB 1DR9A 3KS0H 1T5XA 4XPTH 4ZOEA 1N0XH 5D7LB 1CDCA 1Y6MR 3L3DA 2XTLA 4UT9L 5F7DA 1UM6L 1MWAL 4BK5A 4QT5B 4L29A 3BRDA 3DGCR 1YJDL 3HE7B 4PJFF 4DKEH 1F8TH 1T83C 2FH6A 2O5XH 5MERA 5J9PA 3EJYD 5DRZA 3OX8A 1D5MA 1MCRA 4PV9B 3NGBB 4NKMB 2GSGA 3SDCA 5E8PB 5I73C 2WW8A 3AAZB 4HWBL 2J6EH 1I1AA 1J0ZA 1Q0XH 1G6VK 3U7YL 4IDJL 1MCWW 5I1AB 4YBQC 5GJTH 1IGTA 3NOIA 2CDFA 1BD2D 5SWQB 3F58H 5IB5A 3QIUC 5JPNA 2EICA 3DXAD 2DICA 2K9UA 1QBLL 3KPRE 4FFYL 1PG7L 5DJDA 3ZTJG 4KK5C 2IFFL 4TUJB 4MCYB 2BNUA 3D69B 5I75B 1E4KA 4ELME 1VB9A 1XIWD 1IGFL 1CFVL 3NFNB 1ZANH 2DJ4A 4QRRA 1G6RH 3MRKA 3LN9A 3WE6B 2BRQA 5FGCE 2DDQL 3F6LA 4F2MB 5IMLA 4Y4HA 4HWNA 4IRJC 4Q6YA 1QNZH 5SWSA 1OAKL 3D3VE 2ZJSL 4MXVF 1JZ5A 1PKQA 2NY0B 1KCUH 1ZXQA 3WS6A 1GHFH 1RU9L 4KKLC 1A7OL 2AVGA 4JO3H 5ETUA 2NY2D 1UWXK 1Y0LA 2HG5B 4Y4FA 3WO4B 5KS9B 3BPLC 1RHHA 1J8HD 1NCCH 2YS4A 3UBXG 2R69L 1MCDA 3O2DH 4L9LA 4AMKH 3WNPA 2NYYC 3ARRA 2XI9A 5DK2A 1WTGT 1UQSB 5ID0B 4O2FA 3BGAA 4PY7B 4ZDHB 1EO8L 4PJHE 3MRBA 1A6AA 1NGWB 2PYED 1MJ7L 2E7MA 4EUPG 5EFIA 5JIHA 4HBCL 4R7NB 3ZL4H 3OAUH 1AGEA 1AD0B 1L7TL 3OKLB 5IHBA 3HI5L 3IJYA 5IB4A 3DROA 4K2UH 1U8MA 3W39A 4P46C 3U7AA 5I1IL 1NFIA 3IDUA 3WIHA 2OQJB 4EXPX 4FQJL 4LNRA 1PAMA 5E9DA 2CK0L 4IJ3B 4YHMH 3WLWD 2FL5A 4E41E 2UV3A 3HZMB 3NA4A 3V7MA 5GS0H 1TVBA 2CK2A 5C0DA 5GJSH 5FYJE 2F54E 3EOTL 3MXWH 4LSPH 4OCRL 3MROA 4K3DH 1S7UA 2DM4A 3MTRA 3RWGB 1JTTA 4IRSD 4P2OA 3G5XA 1KENH 4NSKA 4KY1L 2PO6A 5MEQB 4PBXA 1BZ9B 4O51A 1JWMA 3D0LB 1MRCH 1ZK9A 2HAZA 1HZHL 3ZT5A 5H37H 5DVMA 1MIEL 2V5SA 2EE6A 4LVOC 4EI5B 4AY0A 4TTDC 4NOFA 1JMXA 1C5CH 1ZLWK 3VXSB 1L6XA 4AIZA 5HHOA 5HDLA 1TLKA 1IFHL 1I1YA 1SJEA 1YDPA 1R3JB 4OGXH 5DSCA 1ZKAA 5CGTA 3MBEC 5JR1L 3EAKA 2Y5EA 5CIPB 5FO7A 2R15A 3VFUB 2BOBB 2M2DA 1H3PH 3SDAD 1WBXB 1ACZA 1GZQB 2J8UF 1F11A 1PQZA 2NXZC 3O2WH 1K2DA 4N68A 2LABA 1TZHB 2F9BT 1BJ1H 2YWYA 3F7PC 3CZFB 1HCFX 5IEKA 1TENA 1F4XL 2VWEE 1E4WH 4PJEF 2P45B 1PW3A 1LO2L 3U9PL 4IIQC 4OZGF 4G8IB 4HFWB 1JGEA 1GIGH 2J1KA 4UBDD 1H3XA 3RHWF 2MKLC 5F7FA 4WY7L 1BQLH 3LS5L 5T3ZL 5L2KE 3FRUB 4R90H 5DFVD 4LU5H 1IKNC 6FABH 4NHUB 4ONHA 3G08A 4UU9A 2NY4C 1FNSH 2VKXA 1I85C 3FTGA 2CLZA 1SQ2N 4J12A 1WICA 3WFEL 2NR6D 2VNCA 3V52H 2A73B 3QUMB 3STBA 1PZ5B 4UQ3B 1FORL 3I50H 3UPCA 3ARFB 4BUGA 2DM7A 4UI2A 1HKLH 1GOHA 3K8LA 1BX2B 1JVKA 1U8OA 4DZBA 1DQTA 3WSQH 2UWEB 2JCCA 2DQTL 2MQ3A 3B5TA 1DQLH 1B90A 3QDJD 5GS0D 5F7NC 5F1IB 4IHOA 1CFSB 3LHPH 3WIHH 2FBJL 3AS2A 1KXQE 4KHXL 3D87B 4M00A 3ME0A 4GW1A 3PWUB 2DWEA 1F6LL 5LWYH 2QSCL 3VFGH 4KI5D 4X7SH 2VLRD 4POYA 5AZ2H 1BAFH 3PP3K 1Y6NR 4H26A 4L4TA 3MRJA 1X6NA 2H26A 3VXTB 2HT3C 5CP7A 3SDXE 3ZHLA 2PYFA 3EYSL 3Q5TA 1C5DA 5DQJB 3GJEB 4LKXB 4FZ8L 1U3HA 2W92A 4OF5A 4PGEB 3MRHB 1P5VA 3G5VB 1MEXH 1P4LA 3PV6B 5JIKA 1HK6A 1OAQL 2XFXA 1T2QL 4WUUB 1A7RH 1XR8A 5GXBB 1BVZA 4XPFH 4KZEH 4XZUB 3KJ4B 1I1AD 1Z0NA 4ZFOB 4Q2ZA 1OF2A 4M62L 1ITCA 4BZ1L 2X05A 1VERA 5KVEL 4XNXH 4YXLH 3FB5A 4HUMB 1CDGA 3IRZA 2CUIA 3IFLH 5ALCL 2HMID 4XVUD 4GKOA 2CJUL 4XP6H 4NCC2 3I6GA 3TYGH 1X5GA 3RU8H 4MNGB 3IU4L 4U1GC 5A16A 2GJ6D 3B2UD 5I1GL 1IQWH 4LCYA 1J0HA 1Q9KB 2BVEA 3CD4A 3H7BB 1WLHA 1A6VH 4TSAL 3TBWB 1QFHA 5FCSH 4J6RH 4FXKB 3MV8D 3C08L 1NUFA 1J88A 2ERJC 2K7QA 1CE6A 1XGRA 3IFNL 1B9ZA 1X5AA 4P2RD 1FYHB 1TQCC 4JFDE 2GSIB 5FKPB 4LMQE 4NRXB 1DZBA 4NN6B 5ITBH 3HPLA 4YUEH 3UC0L 2ZSWA 4PJFA 3FZUD 3PGFH 2BVQB 3CFIC 3EYVA 5DD6B 5C07D 1DLFL 2EC8A 3DNKA 3T65B 3Q3GB 1OT1A 2RIKA 2UZXB 5F7LB 3U79A 3JV5A 4U6VL 1YY9C 4ISVB 2VQ1B 5T3XH 4M6OL 4QY8A 2AJZB 3K46A 4ZTPH 1F2XK 1KUMA 3ULVC 3OR7A 3OJDB 4FTVB 5F3BA 2R0WL 5J1AA 2XZQL 4H0GA 1WAAE 2H2PC 4P23A 1A5FH 3QPQD 4K8RC 4ERSL 3VD9A 4JQXC 2HKHH 2OTWB 1NUGA 4GSDH 4NKOB 5I8CA 1JBJA 4OF7A 2ADFL 1QYGH 5DRWB 3G6JB 5IK3A 4LPTA 5MEPA 3T2NL 3HG1B 1BD2E 1K9TA 3DXAE 4Y16B 4LBEB 1DEEA 3OKOB 4UILH 4WW2C 5HGDA 1G7IB 3P4OA 4LP5A 3TWCL 3QO1B 4PLKD 2X1PA 1IM3B 5F88B 1FJ1B 3JUYA 4OLUL 4OFDA 4G5ZH 4JPKH 4LQ1A 5HVFB 4CVZA 3ULVL 2YXMA 4PGDA 3GMMB 1HHKA 5E1HB 2XT1B 3BZDA 4FQ1H 3DHMA 3WFZA 4M5ZL 3C5ZA 1KPRB 3AM8C 1AQDA 5J3HC 5IT2H 1NFKA 3AU1B 3PF2A 1S9VB 4EI6A 1JGUH 4JE4B 3ZKQD 5HHOD 4TTGA 1KB9J 3IJHA 1XCTA 1EHLL 1J8HE 3ARQA 4PJAF 5HGAB 2AJ3B 2P44B 1H3TA 3H3PH 4H1LB 3HHRB 1MCBA 3JWNC 2YSSB 2Z35B 4JFQA 2A9MH 3M1BB 3UX9B 2FZ3B 1WCBB 4BH7B 4ZUSA 3NACL 3BP7B 4HUKB 4LHQB 2QSTA 1T5WA 1HXYA 2AEPL 3N50A 3CMOL 4Z7VB 5IBUG 1CIUA 5CJBA 1KNOA 4JO1H 3SJVB 2X70B 4P5TA 2PYEE 4JN1L 4QXTA 1E4XI 4NQXB 1A64A 4LHUD 3CSGA 4KRPB 5F8RC 4YLQT 3CCHB 1ZSDB 5K9OA 1KIRA 5F71A 2FX7L 4G6KL 3RVWD 3SDDB 3RGVC 1LK3H 3QXVA 1MFEH 3REVB 1QA9B 1G7QB 4NJ9L 3B3IB 4R4ND 4YGVA 4B53A 4P9HH 4GH7B 4HXAH 2LU7A 5T3XD 3T0EB 2V7NA 2F74B 4N8VA 1YY8B 2I26N 2QQNL 4RX4A 2YPLA 1UXWA 1PX4A 4JFEB 4NDMA 2C3VB 2MPAL 5JHDA 1OTUC 1BQUA 5LCVL 3K0WA 2H45A 4KUCD 1K3IA 3L6FB 1A7QL 4J4PD 4LVNB 1S9YA 1J1OH 3I85A 3RNKA 2P43B 5T1DL 4LSSH 4F9PC 5C0IB 2J8UA 3DMMC 1RZ7L 4AYFA 3INUL 3FQNA 3F7VB 3S37X 2YD1A 2BNQB 3U0PA 5HYJA 4YXHH 3MLXH 3E0GA 1PX3A 1CFBA 3PHQB 3RWDA 4PJEA 3WJLC 2ZCLL 2ZUQC 3O2VL 5D1XA 2P5WD 1MHCB 4OZGA 3P30H 4XP1H 1MCQA 3FRPA 5F1KC 3BKJH 3KYOA 1L7IL 1TMCB 5KG9A 4HIXH 2BRRL 3H42H 2NZ9C 4P4KB 3OR6B 3JTSB 2RBLA 3L9RB 4Z5RB 1R5IB 5JA8B 1A7NH 2R9HD 1MPAH 3DVIA 1D6EA 2ATPA 4UTAH 4L3AA 2V2XA 2AXFB 1U91A 4NRYB 5IW1A 1JNHB 3U9UB 3DJ9A 4NO0A 3UTQA 1ADQA 3V4VH 3MJ9A 4XHJC 4EN3C 2AJSL 2J4WL 2OTUB 4N5ED 1ULVA 4HS8L 5IM7B 4QCIB 4NZDA 5FV1L 4BFEA 5IBLD 1I3GH 1H5BA 1CICB 1X3DA 2UVFA 4Y1AB 5HHMB 5L9DH 1NLDL 3GKZA 4YDIL 4CW1B 1WF5A 5HPOA 1C7SA 3LN4A 5KW9H 4MD0B 2DQDL 4I3SL 2KPNA 4PJXE 4EOWH 5DQDH 1OM3L 1M7DA 1F90L 1JV5B 3N1FC 4HXBH 2NY5C 3VRLF 2Z92B 2GTZB 4PRPD 4HAGA 3FQTB 1T7YA 3LS4H 3V4PL 1V8HA 2C1PA 3MFFA 1WUNT 5MI0C 4OCWH 3NN8B 1VSCA 2HP4A 3P4LA 1GRWA 4PYGA 4XNUL 5D2NC 1WWWX 1CVSC 1UXSA 3EDDA 1IQDA 3QNXB 5E8DL 3C09C 4LSUH 3GHEH 5FM8A 3DECA 2Q86B 3K8MA 3TESA 1O7VA 1GYAA 5BVJB 1A8JH 2CGRL 3MLRL 1MAML 4XI5D 4XNYH 5EC2B 3VG0H 1SVZA 2CIKA 5C09B 4HIJA 5F9AC 1U8HA 4JY6B 2N4IA 3GM8A 3GMRA 2IAMA 3TT3H 2VXSH 2NY5L 3I6LD 3V79C 5BRZA 3F12A 4LQFL 2RAMA 1WBYA 4TULL 3RHWK 3P9WB 4H20H 4MSWB 4XNMB 4FG6C 4JN2A 1HYRC 3BP5B 1SY6A 3HE6D 3D9AL 1NMBL 3F8UB 2C4FT 4I0PD 5DJXA 2AEQL 4PRBA 4KI5E 2VLRE 4K9EC 5DUPH 3K2MC 2W0FA 4O02L 1I8LA 4KGLA 3UCRA 4G9FB 4LCWB 1HSBA 1AC6A 4NKDA 1RJLA 4FQXC 3LKNA 2NZIA 2O26U 3GSXA 1I7ZB 1CWVA 4M5YH 4QOKB 4U1HA 2I24N 3VXUD 3VXPB 4NUJA 1AO7A 4TSCH 4RISL 5JLZB 4WV1A 3ORJA 5FYJU 2KDGA 3F62A 4Z6AT 3LIZL 1R6VA 3MOBH 3QQNA 3MRPA 2C4XA 5GGTL 1AI1H 3MCKA 5T33H 4HWEH 2BOCB 2EZ0D 1HI6A 1F3DH 1N59A 3BD3A 5DGRA 1NEZB 4O4YL 3D85A 3ZKSD 2DLGA 1KPUB 3TBTA 5E08H 4K9EL 1YMHB 1JNLH 2I5YH 2PNDA 3ABZA 1VACA 3RUGB 1QEWB 1OPGH 2HJKA 4WCYL 1JF5A 3HUJF 4O9HH 2OLDA 2GJ6E 2N1KA 3OF6A 1FFNB 3PP4H 2R8SL 2ZUVA 1J5OH 5GGVL 3MV8E 4MLSA 3VXNA 1Z9LA 5HI4C 2XRAH 4X99B 1QFWH 1HWHB 1VHPA 2XOTA 4P2RE 2DKSA 1PKQE 5HVGB 5J1SC 1IT9L 1N64H 1DL7H 5HVHB 4OCYL 1ADQH 3MJ9H 4I0KA 2P7TB 5HI5D 1LGVA 4Q6IB 1AGDB 3ARGD 5C0BA 5I71C 5GGUA 2VZTA 4RAVA 3VDAA 5C0AB 3IKCA 4Y89A 1ZLVH 5C07E 2APXA 4GW4A 2BVTA 3R06B 3HRZB 4CADA 2CLVA 5IB2B 1RUML 3BIAX 1HOCA 1UYWL 2AGJH 3LD8B 1VKXA 1WT5A 1N6VA 3ZKND 1FQ9C 2YBRA 3HLAB 4OCNC 4C4KT 1CLYH 1FG2A 3V0AC 1XGYH 5JPMB 3MNZA 3QCTL 4F33A 1FBIH 3H3BC 2VYRE 1KB5L 2ZNXA 3ARDA 4IDLA 3S5LG 1CGVA 1KC5H 2FX9H 4MQ7B 5HYSA 1I9JL 3QUYB 4JRYB 4I5BA 4EDWL 2HVKA 4FFZH 4G8GD 3N1QC 1N8ZA 3C6LC 4GUPA 1A1OA 3E2HC 5D1QC 4HHAB 5BJTB 5DQ9B 2HH0L 1S7SB 3KPPB 3CUPA 4MCZB 4H8WC 2ZWLT 3RVTD 1OWWA 5DDHA 4YHKL 5F97E 5I15L 1LVEA 1BFOB 4M7LT 3RVXD 3T0VA 4PJAA 5I74C 4PY8I 3ZYZA 1AKJA 4FFVC 1SY6H 1DQQB 2WQRA 4YHLH 2ZZUT 1NBYA 1NCAH 3VH8B 5I8EB 1NGPL 4GG6F 2FB4H 1UJTA 3A6BH 1NAML 5FO8A 5H35A 4EDXA 1EHNA 5ERWA 4PJ9A 3P4NB 3FO0H 3BPNC 1SMOA 1YPZF 5JDSB 3L5XH 4XXCA 3TVMC 2LV4A 3OKKB 4R97B 3WHE1 3QZWB 5HHOE 1S7VB 4PB0L 3WHE0 4FMFA 3V7AE 1MFNA 5FHAL 3VGGA 4OKVB 4GMSH 5TQ0H 4QHMA 1TZIA 3VRJB 4G42A 1P1ZB 1QLFA 1MLCA 1M7XA 4H8WL 4XTRD 4XP5H 3ULUD 4WWKD 1RIVH 5C86A 3HFMH 2D0HA 4X0KA 1CDJA 3BQUB 5EZLB 3QHZL 3HC3L 3EDFA 3BP4A 1A6ZB 3BOVA 4PR5A 1AD9A 3NIDE 4PG2A 2WSKA 3DRTA 1LEKA 3RDTD 3IXTB 4G6FD 1B0RB 4XH2B 1R0AH 3I9GL 4O58L 4OV5B 4DN3L 1D5XA 2W0LA 1CDIA 5FB8B 2D31B 3UBXI 5IB1B 4KMTH 3ZDXE 4NT6B 4KQ4H 3BKCH 4MQXD 2A1WL 4F7PB 1O5DT 1RULH 4HBQA 1QSED 3F7YB 5T1LD 2ITCA 3HCVA 3W5NA 2GFBA 5CGYD 4PJIE 5T3XE 5B3NA 1N4XH 2DM2A 4IOFC 3FO2A 1MRDH 5C0JB 1OSPH 2DQJL 1T80A 2J88H 3H2WA 3ZE2F 3T0AA 3SDYH 5DI8B 2HFTA 1F58H 4NQVB 5DD0L 3NCCB 3BFOA 5DHVH 3NFPA 4N9OB 3TJHD 2DQUL 3WNOA 5A40E 1CFNA 1F42A 4KJPD 2WNGA 3L5HA 3ET9F 4S11A 4HPYL 5FFLA 4MJID 1N3NB 5DJCB 3FT2B 1OAYL 3NGBC 4BKLA 3GSVA 4YH6A 4LASH 5FV2A 3TF7C 3D6GA 1AQKL 4TRPL 3MRQB 1Q1JL 4OJFH 1NDGA 2MJWA 5IESH 4RMUA 4BFGA 3O4LA 2AK4A 1XF2B 2KQMA 2ZUWA 3P4MB 5C3TA 3BUTA 1FLRH 3O3DA 5FCUH 4P2QB 1EPFA 3CLFH 1J05A 1DEDA 1K5NB 1YNKL 2X9WA 3QNZB 4N1CA 3B9AA 3QEGL 1A7BA 5CEYA 1MI5A 2A77L 4ONGL 1Q38A 1U9KA 1J0YA 4UZGA 5D1ZA 3P0VH 1JYNA 3O3AA 5CINH 1GGIH 3H6JA 4K94L 3G04B 2VZUA 2ZPKH 1ES0B 4HPOH 4LRIC 4MQTB 3WD5H 3VCLB 3WO4C 2VDML 4DK6A 3MLPA 2GCYA 4XPHL 3MUZ1 1S7RA 3BMVA 1LEIA 1FVDA 2B39A 1EFQA 3OJVC 1PG7X 4PRPE 1WTLA 2Y25A 1LDPL 4U6TA 4U1LB 5FUCE 1GJIA 3UJJH 4CUCA 5BZDB 3E1F1 1YUHB 3UYPA 4GRWB 1JHKH 1T22A 3PWPA 4HGMA 5HD8C 1MHHA 2ZUYA 4PJBF 1FL5B 3T1WA 2DJSA 4QKXB 3PNWA 2BHUA 3OF6D 5LBSH 1OLLA 1BEYL 4NZJA 2SEBA 2X4QB 4X5WA 1XGTA 2EIEA 2VC2L 3SGKC 2VKWA 2JJTA 1CXFA 3C5JA 1ZLUK 2ENYA 2L7JA 3VFTB 4NJAL 1LNUA 2YD3A 2H1PH 2Q7NA 5IQ9A 3PWJB 5DHYA 4IJ3C 1I3UA 2B1HL 3QUKA 3M45A 1CS6A 1DJSA 2X5PA 3BH9A 3AVEA 4NN5B 3NPZB 2AJXL 4LLUB 4GRMB 3VXRA 4I2XB 1W72A 3ZSSA 4I77L 5EWIH 5I1KL 5FA4A 4ACPA 4NO2A 2YPVH 3O0RL 3O8XA 1OB1A 2R4RL 1KTDA 4OAWA 2QQQA 2J7LA 4JZJA 3M07A 1KPVA 4Z0BH 5CSZA 1ED3A 5TQ2L 3TJEL 4XBGA 3VXUE 5ANMB 3GMNA 4EI5C 5DJ0B 4Q7DA 3O81A 3KXFA 1INEL 3SKOB 4FA8A 3KJ6H 4PREB 4YWGL 3HUJA 3CFCL 5A2IH 3CDCA 15C8L 4JFFD 4KRMB 5GQBA 1RD6A 2F5BH 1IC4H 3SE3C 2OK0L 3OHXB 5CZKA 1HXMB 4LCCA 3NABH 5TH2B 1DVFD 3QIWA 3F7RA 1UZ8A 1N6QL 3N85L 2IQ9L 43CAB 1YEHH 3TLRA 1LP9B 1JJUA 1ORQA 1F4HA 4KTDL 1T20B 4XC3H 5BZWB 4U6XA 4X4YA 4M1CD 2JJUA 5B39G 2O61A 1LE5A 3OZ9H 4R7DB 1JN6B 4YHPB 1LHZA 3FMGH 5BW7C 3ISWA 4Y7MA 4KMLB 3QDMD 4KFZC 3ROOB 1YN7B 5DTFB 4R96A 1P84J 2AI0H 3RY6C 3BO8A 1DQDH 4LCIH 2X7LA 3BZ4A 4HC1A 1UKQA 5EN2A 2UY7A 3GSUB 2K7PA 1IGIL 5GISH 1P69B 4MGXA 1UM5H 4J7RA 3JBG7 2PETA 1JF1A 5EBMA 5JW4Q 4R8WL 4PS4H 4X6BA 5ID1B 5E6ID 5DZOA 3T77B 5TE4L 1NGQH 3WUZA 3D0VA 3ARFC 3AFLA 1ZT1B 2HRPH 1DE4A 4Y2DA 3QJFA 1HCVA 1FSKB 2VXUL 4XCEA 5GHWL 1JF6A 5HGBA 1F45A 3U4AA 3BW9B 3OG4B 2VSCA 1L0YA 1EEQA 5F7KC 3ECBA 4HS3B 4IEFB 4HH9A 2EYSA 1FZKA 1QO3A 4N90D 3DUSB 3HI1B 3LRHA 5GZND 4DOHE 2O5ZL 2QADB 4K55A 5HY9A 5IFAH 1MFAL 1VFBA 3MREA 4GG6A 1HH9A 4RBPH 4G8GE 3X3GH 3FT4B 4HUWB 3L3HA 1FHGA 4G80A 5CS7A 1G1YA 3SBWC 2CH8A 2YPKB 1YPZA 4QRPA 1B3JA 3QUML 2GW5A 3H0TA 4R2GD 3S3PA 4H0IA 2ENSA 5BO1H 3WUWB 3BP6A 1I9RL 4ONFL 3VI4E 5CKAA 1IEBB 1W72H 5JW4M 5JHDE 4ELMB 4JJHA 4J2XA 1DUYA 3PQYA 1A7PL 3VWKA 5FGCB 1UZ6F 4JY5L 2ICWA 1ZHNA 2J8UE 3G9VA 5JOFB 4U6HA 5GGRB 3D3VB 4OFIA 2EDJA 5C0EB 1NCDH 4OD3L 3W81A 3LKRB 1WGOA 1CYGA 4HGWA 3F6IA 4MXWL 1T6VN 3O6LL 1D6VL 3O4LD 4S1SL 4PUBL 3NCMA 3ULUE 4IMKC 5E03A 1V7ML 5BV7B 3UTTD 2P46B 4JAMA 2OJZL 3RI5K 1ND0A 3CDGA 2NX5A 1RUAL 1SJVA 4GW5A 1VGEH 4D2NA 4L8BB 1NCWL 3EDEA 3RX8A 4ZMAT 1ZA3A 5C0ND 5C0FA 5H8DA 1ZA6B 1P5UA 1JYXA 2ID5A 1X7QB 1H8NA 1ODAA 4P57B 4HUUA 4PJHB 4HF5H 1ZTXL 4GLRI 3S4SG 2X4TA 1S7WB 4LDLB 5SX5H 5ITFA 3FO9B 4DKFH 2Q1EA 2ZCHH 4ZFOL 4NN6C 1CT8B 1ZOXA 3X3FH 4P3CL 1UJ3A 1QSEE 5IKCA 4HC1H 3DX6B 5GGSB 1DBAH 1H3VA 4NM8H 4E41B 4QXGH 2VDKH 9CGTA 4U7SA 5DZNA 1BQHG 2F54B 1FNEA 3QO0B 5EU6A 4HW6A 3T3PE 3WXVL 4OIAA 3WFHA 1T1YB 4ALAL 5EOCL 3RIAK 4F7MB 4HWBA 3PWPD 5DYOB 2OS7A 1CGUA 3V0VB 2ADJB 4XMKL 2Y07L 1H8SA 5CLWA 3QI9C 3MRFA 1MIML 4NC0B 5B8CA 3HI6H 4MJIE 5K33A 1T0NA 3IF1B 4N8CH 1BREA 3TIEA 3BRFA 2EDHA 4XRCB 2PR4H 1HHHA 4L1HA 3IRPX 4GS7B 2PTTA 4W6YB 3MV01 2ZG1A 4Z7UE 4S1DC 4JFHD 4MS8C 3L1OL 4Y16C 5E8OB 5ELIA 4LRNL 5BRZE 2NY6B 4GFTB 1T83A 4S1QH 3SO5A 3Q1SH 4H5SB 3BPOB 4PP1D 4HIIA 2E6PA 1GCFA 4L3EA 3TT1L 2YN5A 3NCYP 4P59H 4S0TD 4D0DA 1K4CA 3QIBB 4NWTL 1AY1H 1MH5A 1KEML 1NGXA 2FD6H 4IS6B 3X12A 1QVOB 3MACH 1U8QA 3NIFF 3LH2H 4G8EA 5HPMB 3QIUA 1OTSC 3C60B 1SHMA 5E00A 2H3NB 3T8XB 4RMSA 2VMFA 3KXFD 5FUZH 3ULVF 4LSQL 4MA8H 1MAJA 4PJBA 3TIDB 1EDQA 4ZUUB 5C71A 3TO4B 4ZS7L 1WIPA 2NW3B 3PGCB 3VXMA 2VDOL 2D4FA 1OTTC 4LSVL 3U46A 4RAUB 3IGAA 3CXDH 3PG2A 2IADB 2DLFL 5AWNH 1MJJA 1PDKA 4IRJA 5JQHC 3HE7D 1KN4H 3SCMB 4UTBH 4WW2F 1BOYA 5IB3B 5B4MC 3LMJH 4MDJA 1T21B 4ODWA 4LF3A 4X4MA 4F57L 2VDNH 2PW2B 3D2UB 3HAEA 3OGCA 1U8KB 2VQUA 1VGKB 4D0BA 4PGJA 3IT8D 3BGFB 2DTMH 2I60L 3P9LA 1D5IH 5FO9A 4KRPC 3CFDB 5EBWB 4Y19A 3N1PC 5FA3A 3I02A 4LCUB 3CVHH 4UUJA 4NNYB 1ZVHA 1WVZA 4BK4A 1KCSL 3SDDC 5TGBB 3QEUB 3EDKA 4WO4B 3FT3B 1RUKH 5KZCB 3DO3A 4UNTA 3VE0A 3ZDYF 3H9SD 3BH8A 1EEYA 4YXKL 3DV6A 3MR9A 2R29L 1EUTA 1EVTC 1KCKA 4C58B 4RA0C 3PGDA 5CILL 4EBQL 5HHQB 3GSOA 4CVXA 3T0EC 4ELKA 3RWHA 2IC2A 3BDYH 2EXYD 1GAFH 3WKML 4LGSB 3RWEA 3OAYK 2ZCKL 5C0GB 4DCQA 4W70A 4X4XA 4LVNC 3SDXB 3EOAA 3TPKA 2W9LA 4EKXA 1QFOA 4P2CG 4HWBH 3RTQB 5M7QA 3F5WA 3VWJB 1O7SA 1HSAB 3FOMB 1KLGA 3PWVB 3MLUH 3L3KB 5BQ7A 4JFFE 2G2RB 5DJYA 5DK0A 1WCQA 4WFED 4RAHA 2RQ8A 1WQVT 4YZFE 1AR1D 1PG7H 1T4KB 5TFSH 1GOFA 5HXMA 4MHHG 2HTLC 5E99H 2ED8A 5AD0A 3UYRL 3MV7B 5I17B 2X6MA 4D0CB 1JYVA 4E0RB 2VR9A 3PHOA 4P4KC 5AEAA 1W0YT 3GSRA 3Q6FA 1KG0B 1MCPL 3FN9A 5FUOL 5TE6L 3DETD 1OAKH 2D03L 2ZJSH 1KJMA 3QDME 1A7OH 4DZ8A 4MD4B 5HGHB 4NCC1 4WU5A 4TSBL 4AEHL 3OAYH 1BECA 5JHLH 1CICC 4ZUVA 1KTLA 3QXUA 1UB5B 1EJOL 5GS2H 4JFDB 5J11B 2JELL 1YYML 4OI9A 4GKSA 1HWGB 1RZFH 2P5EA 1S7QB 1LO3L 1OCWL 4D3CL 2F19H 1QOKA 5EOTA 4LIQL 1MJ7H 2ADGB 2NX5D 3VXSD 2OR8A 4Z78A 1IKNA 4XPGL 2HJFB 4KWUA 4LLVA 5E8NA 3HAEH 1JWUA 4ZNCD 3A0OA 4N90E 3HS0A 1I85A 3KHQA 2CXGA 1BQSA 1R5VB 3O45B 4M7JL 5D6CB 4FQJH 3IDGA 4H25B 3ZKXB 1AE6H 1RY7B 5JW3L 2HKFL 1AP2A 1JPFB 1RJYB 3WN5B 5F9WB 5EO9B 4NNPL 2B5IB 1SYSB 3MV11 2HJLA 3HNTH 1YEDA 1FH5L 1UCBL 1DFBL 1PKOA 5LGJB 1BD2B 4NQSB 3DXAB 4U33A 4WDIA 5CD5D 3RWIB 4Z76B 3O4OB 3JTTB 4WHYH 5EU6D 4XWGH 3MQIA 4RDQF 2R0LH 4JO2H 1C08A 1ETZB 2ZOKB 2R1XB 1R3HA 1XIWB 1WEJH 1K8DA 5CD3A 5D72L 1CXEA 3FQRB 1URLA 1RUPL 7CGTA 3S97C 1QHOA 4HKJB 3TNMB 3MRLA 4ZD3H 2EH7H 2ITDA 1CD9B 4HX1B 1JHTA 2P24A 2NY2B 3KG5A 4WIQA 5E2TL 2C1OB 2Y7QB 1S9KC 4YNYB 4GAYB 2IH1A 2XXMB 3KLSA 4RNRB 3K8KA 1IAIL 1Q9OB 3O4LE 5IMKA 2WBKA 4PB9H 2V2WA 4JKLA 3DX9A 4HSQA 3UTTE 3RVUD 3BGMB 1T66C 3WFDH 5JNYB 1SEQL 3NZ8B 4L3ED 2D7TL 2PCPA 2XTJD 3CFJB 4YDKL 3U9PH 1NC4A 1VA9A 3KPSA 4OZ4A 3VRLE 5TDPB 3AXLB 2WWKT 2BY2A 2PYEB 3ARTA 1HIML 1T3FB 4DFIA 1XF5A 4M7LL 4WY7H 1DBJL 3LS5H 3MOAL 5EA0L 5T3ZH 3W0WA 4BSWB 3CPLA 5HVHC 3P77A 5EPMA 5IGXH 2MOVA 4XP9H 1UEYA 4NFDA 2GUOB 4Q6IC 4JQIH 4TVPL 3TH4T 4LLQA 3VXMD 2X4UA 2FIKA 3RX5A 5BS0D 1QR1B 1ZVYA 1OP5K 1IZJA 4PJ5A 4LLWB 1FLTX 1E6OL 2G9HB 3HNSL 1IAIM 3K1DA 5ESQA 2YUZA 3DGGB 5KN5A 3E6FA 2DM3A 4IRSB 2X1QA 1XF1A 5DJAB 1A9EB 3O6KH 4JDVA 5GGQL 3VXQA 3PWPE 5DD3H 3ALPA 1LD9A 3ARWA 1PLGL 1CZ8H 1BBJA 2F5AH 4I9WD 4D8PA 2E7LC 3MC0A 2FJGB 5EU7C 1L9MA 4KZDH 3MRIA 2GI7A 1NAKH 5MP6L 1YEIL 1ZWIA 3QUYC 1A6UL 4NQTA 1MJ8L 1MCLA 4GBXA 4BQBA 1K6QL 4C83B 5DWUH 4C56A 4JFHE 3HC4H 3MNVB 4HKBA 2VLJD 4G7VH 3QRFM 3UZEA 3LKSB 1TPXC 3VXRE 4F7CA 4MAYD 4JRXA 3CX5K 3MMEA 3RL1B 3EFDH 4JQXA 1RMFL 3QEHB 1DBKL 4U1KA 4HLZH 3BT2H 3D25A 3RWJB 4F58H 4FZ8H 1G6RB 4NC2B 3GBMH 4HUVB 4KVNL 1EAPA 3HMXA 1T2QH 2GITA 3ILQC 4WW2A 4PJ7F 1JPST 3KXFE 4XNQA 3V6OC 3VFWA 4R97C 1KCVH 3KPNA 3HUJE 1TZGH 1MFBL 4OQ1A 4RQQB 5C2UB 1G7JA 5DZLA 3MLTA 1IILE 4XPAL 5F7HA 1BF2A 2WLYA 1CR9L 2CJUH 1MJUH 3MRDB 4PJXB 4ODUA 5IIEB 3PDOB 2WQ8A 4L8SC 3BQUC 3ES6A 5I1GH 1F4YH 4K23H 1BF8A 4WI8A 5L7XH 4MJ6A 25C8L 3FN3A 3UROR 4OUUA 4DUWA 1CFQA 5KSVA 1CD1B 2BSRA 2IMMA 2QBWA 5F1OB 4OB5L 1R3KB 4HQQL 4X6CF 1YZZA 2FLRT 3UJTL 5DD1H 2VXTL 1MRFL 4X8JB 4HFUL 3MRCA 4KROB 4LAQL 3MPCA 1KGCD 5EUOF 4C54A 1HHJA 4EQ2A 5HSFA 1DP0A 4NN7B 3TCXA 3VFVB 2W65A 3H9SE 2GYSA 3GMOB 4WVRA 1R5WA 1YMMA 1W0WA 1OQXA 5CHNB 5DJ8A 32C2B 2QL1A 4YDVA 2P5ED 5E5MA 1LO5B 4M6OH 5IMOA 4JPWH 2Z31C 1JP5A 4NP4L 4HJGB 4APQC 1HILA 4R4FH 1EX0A 2QQLL 5GSRA 2VABA 1REIA 1Q9LA 3KWWA 2VLRB 3FQWA 3NFSL 5T1KA 4RRPG 5KANG 2AQ3A 2R0ZL 4OTXL 3NCBB 5ISZA 3DWTA 3GK8H 4KUZH 3FB7A 2XN9A 4P5KB 2YZ1A 4H1LG 4L1DA 2Y36H 4UV7L 3DX7A 1QUNA 5MERB 2ADFH 5E2VL 5DRZB 1T03L 3OX8B 1NLBH 1NPUA 4U49A 1EHXA 2GSGB 1EJ6A 4MD5A 4WFEE 3HMWL 3SDCB 4GG6E 2HTKC 1I1AB 2MNUA 2VDLH 5I0DA 4F15B 1RIHL 2WUBH 2D2OA 4Y5XC 4RCAA 1UACL 5MENA 1WC7B 4TNVF 4F9PA 3CU1A 5EOQH 4P2YA 3DMMA 5IB5B 3MRGA 5JPNB 1AIFA 1DQML 2D4DA 2VZ3A 3MFGB 5D7KE 1S7TB 5DJDB 2BHYA 4Y5YB 5FYLL 2BNUB 1MLBA 4ODSL 4OQTL 3CU7A 3WJLA 4K8RH 2GJ6B 4QHLA 2B4CL 4PJGE 5JXEC 4ZUTA 3VFSA 3HZKA 3HMXH 4QRUA 5IMLB 4U1JA 5A2FA 4DAGH 1KJ2L 4MX7B 2HLFD 4P2RB 1PKQB 3SO3B 5FECA 2RJMA 3S36L 2CMRH 3NACH 1CXHA 5I1DB 2ED7A 4Y4FB 2I07B 2EKJA 3BN3B 4TPRH 3KLHD 1CI5A 5E70A 2NCMA 3N1GC 4ZFGL 5C07B 4MB3A 5KSBE 4EN3A 4OCLC 4CNIA 4JB9L 2V9QA 5HHNA 1S78D 3QA3A 2NX5E 2ORBH 4X5LA 4X9GA 4U0RC 3MGOA 4ZFFA 5K9KA 4AEEA 4LARH 3BISA 5KJRL 1LMKA 4ZPVA 2QQKH 3KPSD 1UWEL 4AZ8A 5JW4N 2R23A 5DMKA 1A6AB 5I30H 5ICYA 4G6KH 5EFIB 4NKIL 2GJZB 1M05A 3ZE2E 3ARZA 5DMIH 4P3DB 3W0WD 3E3QE 3IJYB 5IB4B 3DROB 1R3LA 1U8MB 2E9IA 3BD4A 5IBTL 1NFIB 3KPLB 1KTKE 3C2AL 5D2NA 3KYNB 4KK8D 2N56A 5D7JD 4JGMA 5KS9F 4HT1L 5ENWB 4LNRB 5E9DB 3VFNA 4I48A 4NZRL 1P7HL 4NN5C 2VZVA 2VXQL 4NO5B 3RRQA 4PJ5D 2J2ZA 2YMXH 2Q7YB 2VAJA 2XQBL 5HYQA 1TVBB 2RB8A 5C0DB 4P99A 1V05A 3N0PB 3MROB 5LCVH 1S7UB 5EU6E 5FGBC 1QSZA 2A38A 1GH7A 2P4AB 1A7QH 4NO3A 4V2BA 4XCCL 5IG7B 5GGTA 1BVKA 2PO6B 3AY4C 3U6RB 1GC1H 4J8RB 2DQEL 1JWMB 1G7HA 2V7HA 2OR9L 3AUVA 2E7HA 3VGAC 4FXLA 2QEJA 3BSZH 4RIRA 2Q8BL 2A83A 2VH5L 4J23A 3OL2A 5HHOB 4GBXD 4FQXA 3T08A 5BVPL 4I3RL 1SJEB 4HCRA 1L7IH 2FH8A 2GT9B 5DSCB 3JV4A 2X89A 1ZGLA 4B0MM 2BCKB 5FO7B 3MXVH 1QBML 2R39A 3TC9A 3BPCA 3BZFA 1DBML 5ACMA 3FFCA 4M61A 4L3EE 2EYRA 1Z9MA 3HPJA 2XKNA 2XTJE 3DI3B 4PP2A 2DQHH 3FFDA 5IBUB 5I16A 1F11B 3WIIL 4HS8H 4KQ3H 4UIKH 5D5MF 5IEKB 4BH8A 2GY7B 2DMCA 5IHUL 1NLDH 3HNVH 3NIGF 5E1AA 3UTOA 4LHUB 1ZE3C 3SQOL 3VW3H 4I3SH 5D7SH 4QO1A 4XCNB 2MWCA 1AXTH 4MWFA 5EB9A 4F37F 2VDPH 4CAGA 3C9NA 4KTYA 3VXME 3IYLW 2JTDA 4LCWD 5DJ2A 3QRGH 5JW4R 1TJHL 5BS0E 4TUKH 2CO7B 2VISA 4FOMA 1FE8L 5EU3A 1XGPA 4PJIB 3MA9L 4ONHB 1N2RA 4XNUH 4UU9B 1CLOL 4WU7A 4Z7OF 3IDIA 1KB5A 1CDHA 3MYJB 4LDOB 4R26H 1FSKC 4B50A 2R0KL 4XGZA 3UO1L 1MF2L 4X4ME 3WEXB 5F44A 3MLRH 2YZ8A 1YN6A 4RGND 3K3QA 5J13B 4I9WE 1NEZG 1A47A 5F1NA 4TVPD 3DV4B 4S10A 4YGAB 1U8OB 3L5IA 3STZB 5KSAC 4QRSA 5F9OL 3TO2A 4DZBB 3MJ8B 4U1IA 3S6CA 3UJIH 4WNQB 2X2YA 3ROLA 5DEGA 1I8KA 3N9GH 3R0NA 2EDQA 3VJ6A 3VGHA 5I2IA 1DBBL 3KLAA 1NMBH 1KXTB 1K8IA 2VLJE 4PJ7A 4YBLB 4W68A 5ADPL 3GIZH 3WFBL 1D9KC 4U6YA 1YEGL 1NAMA 4JO4H 3P9MA 2JK5A 2QHRL 4XCFH 4GW1B 2DWEB 2C26A 4FQ2H 1VEMA 1A6WL 4RISH 4H26B 3C6LA 3QUXC 4ODXB 3IJSA 4OLWL 4DGYL 3ZYOA 5D1QA 3REWA 5CJOH 5TPWL 3U4EA 5IQ7L 4XBPA 1UM4L 3JWDC 3OXSA 1U8PA 2FWOA 2UWEF 4FXGA 3O6MH 3VFMA 1OY3B 5D2LE 1XR8B 2AABL 1BQHA 3BN9C 4X6CA 1DDHA 1OF2B 4FQLL 2W9EH 5MEND 5F9JA 4PRPB 4HCRH 3IDMA 3TPUA 3TVMA 5EUOA 4TNWF 1CN4A 5MEOA 4Z7QF 4AQ1B 2G5RA 5IV2B 3MCG1 4KJQC 5FDWA 1X5LA 3O9WA 2XNAA 4XAWH 1FO0H 1FYTA 4IMLA 1T2XA 1DLHA 2IEPA 4G9DA 4IM8A 4JY4A 4MA7L 3WDIA 1LO0H 2FRGP 2H2SD 4OCYH 4BM7A 3LSOB 5JORA 5I1EH 5C6PB 3DSFL 3FONA 3TNNB 5L6YL 4B41A 1KGCE 5CLTA 3T2QA 2X4PA 1K3ZA 3QHTC 1DSFH 1FVCA 4HJ0C 5BV7L 1OWRM 4OFVA 1RUMH 2ZSWB 3OXRB 4HDIB 3THMH 3SQBA 3VH8G 5I19H 3TFKC 4M1GH 2P5EE 4WHTA 2F53A 4N0UE 3HE6B 4I0PB 1CL7L 4PG9B 3QQ4A 3CFEA 4YHIA 2O5YL 1IC5L 2CIIA 1NDMA 2D3VA 3QZWG 3TZVD 5F21B 1S9WA 3QCUH 1MHEA 1BBDL 2VITA 5ILTL 3G5ZA 4PTUA 1I9EA 3WDHA 3PL6D 3QHFH 3WLBA 2OJEA 2XICA 4EDWH 3OR7B 4ZSOA 2LFGA 2A74B 3L7EA 3RY4A 1MCNA 2VE6B 4GAJL 4GS7C 5J1AB 4L4VA 4ZAKC 7FABL 4P23B 3HZYB 3RWFB 1EEZB 4NQCA 3V6FB 3DLQR 1KCRH 3VD7A 4NWUL 4Z7VE 2D7OA 1IVLA 4QT5A 2EDDA 3MGTA 5I8CB 5FYJL 1QTYT 4XMPL 4W6WB 5IK3B 1KSRA 1RUQL 3QNYB 3WJJC 1DEEB 2CKNA 5INDA 3AAZA 4A2LA 3QIBC 3P4OB 1P6FA 2D7MA 5EZIH 1NBZA 5SWQA 1VFMA 4OI8A 3C60C 4QNPF 1A3QA 2XA8H 4CVZB 2VWEC 1HQRA 4PGDB 3FB8B 2VL5A 4PB0H 5T5FH 2OMBA 5J57B 4TUJA 4MCYA 3V95A 2NPLX 1RZJH 3VFOA 1FIGL 1AQDB 4MHHI 3C87A 3TA3D 2B1AL 5I0ZA 4EI6B 3NFNA 2WUCL 4JVUA 4FQXD 4Q0XL 1PVHA 1QSVA 3WE6A 3G6JF 4OLVL 3DVGB 3C8KB 2XWTB 5TF0A 3ZMRA 1W0VA 1PD6A 3MBXL 4JFQB 1CXKA 4MZ2A 4ZUSB 2AK1L 1E28B 1AFVL 3TH3T 2OM5A 3MLWH 1U3ZA 5KS9A 4GQ9L 4TNVK 1HXYB 3QCVL 2APBA 1RAMA 3P3YA 2F8OA 2VO5A 3UAJC 3KPSE 3K4ZA 4RFOH 4XVTH 1N5YL 3QEQD 3BGFC 1BGXL 1KNOB 4G6JL 4GO6B 4P5TB 5CZVL 3C5SA 4QXTB 1UQSA 5B38A 3MUHL 1MQKL 3L3IA 5ID0A 4NCDA 2R1WA 3W0WE 3AMLA 4ZDHA 1TJGH 4WO4C 4DOHB 4YHYC 2BVOB 3S9DB 1A22B 2MFNA 4CU8A 4O2CB 1OAXH 1AD0A 1BIIB 3OKLA 1B2WH 3GSWA 5DURD 4Z8FL 2LU3A 4PJ5E 1BJMA 4OCXL 3V9FA 1HN1A 3MODH 4M7ZB 3SGKA 3KHOA 4D9RD 3RZWA 1IKFL 3LQAH 1M6OA 4AEIL 1B88A 1X9QA 5CSBA 2W38A 5HHXH 3EKCA 4N8VB 2DKUA 4OZFH 2FSEB 3GKWH 4OF3A 5DT1L 3K4AA 2CKBA 4YDJB 2PXYD 5JHDB 1P2CB 3BKMH 3VWJC 1UA6L 2EDKA 1U6AH 3T4YA 5IHZA 3RNKB 2J8UB 1BP3B 1BZ9A 4KV5F 2OZ4L 3D0LA 1KEGL 1Q72H 4MJ5A 3FQNB 3QPXL 4UIMB 3BUYA 3U0PB 5E2UL 5D5MA 5TDOB 3RWDB 4EI5A 1YNKH 2EDLA 3BAEL 2YKLH 1S7XA 5DD5H 5DVLA 2EDYA 3VXOB 3U0WH 5CKGA 1L9NA 1FN4A 1R3JA 5JO5A 5KG9B 3DARA 2R4SH 2XIDA 5C7XH 1V7NL 2HWZL 4JG1H 3SE3A 1JPGB 3QB7C 4NRZB 5CIPA 3UTSA 1A2YA 1XGUB 1IC1A 2R1YB 5C0CA 2W9DL 1D6EB 2WK2A 4Y5VC 4G6FB 1QRND 2EEBA 1U91B 1GZQA 3EO1B 4XPHH 4L5FH 4MA1C 1TZHA 3AREC 3KAAA 4A6YA 3QYCA 5J11C 1Z3GH 2CRIA 4X5XA 1LDPH 1UB6B 3V6ZB 5BW7A 4LCWE 3IDYB 3RGHA 1BIHA 2V17L 1E6JH 3LN4B 5T1LB 2MHAB 4ZUWB 3MGAA 2ICWJ 2CR6A 4G8IA 4HFWA 4JFYB 4QXUL 3O41A 1U36A 2IGFL 3SE8H 1U8JB 3S35L 3QUZA 1P4IH 4LKCA 3FRUA 4XWOD 5LAXA 3IAQA 3LZFH 2DJUA 3O9WD 4JR9H 1ZT4A 4RGNE 5IFJB 3UZVB 1UXSB 4XVJL 3O3EA 1IQDB 2NNAB 4NJAH 2DIAA 3JVGC 4JHAL 3EJYC 4MJIB 2ARJB 2A73A 3QUMA 4RGMB 3ZKXC 3W11D 4UQ3A 1F2QA 3ARFA 1FL3A 4X9FA 2CIKB 4U31A 5F9WC 3WN5C 3RZCA 2B5IC 1U8HB 2VLMD 2FECL 2AJXH 2LE9A 4DGIL 2MQCA 1WZ1H 3GMRB 4Z7UB 4XMLH 1YMME 3O0RH 4FNLL 5BRZB 3LN5B 3F12B 4CMHC 2R4RH 3GO1L 2UWEA 4KDTC 1WBYB 4JHWL 4BZ2L 5A3ID 4TQEL 1IEAB 2XZZA 1KLFA 5F1IA 4K7FA 4KKBD 4FMKA 5F8QC 1XIWC 4HV8B 5HHPA 1I8IA 1HSBB 3SBWA 4YWGH 1RJLB 3CFCH 5DRNA 4L8DB 2NY3B 2A6KB 15C8H 2M1KA 3GSXB 3HA0A 4X7TB 1YEEL 2CKBH 4NUJB 1JZ2A 2RCSL 2BVYA 1MCCA 4WV1B 1B4JL 2NY2C 4L4VD 4NQCD 5I66B 1AJ7L 4NZTH 2YUXA 3KR3L 3MCKB 5DQJA 4LKXA 4OD1H 1HI6B 1N59B 2FO4B 3MLZL 3MRHA 5JIIA 3SY0A 3PV6A 3OG6B 5MENE 3BDBA 2PTVA 1JNNL 4WUUA 3TBTB 4OFKA 5C08A 4ZNEE 1S8DA 1G84A 3FN0H 2EEAA 3OKMA 4IOIB 4ZFOA 2QADD 4UV4H 2HJKB 3SKUD 4Z7WE 4JM4H 1AHWB 4IMKA 5HYEA 3P11L 1JZ4A 1IGIH 1T04B 4ORGB 3BXNA 4J3UA 4EEEA 4MNGA 4WEMB 4NBYB 4WWID 5C2BH 1QFPA 3WUWG 1Q9KA 3CH1B 2WWMD 3H7BA 4PGCA 3TBWA 3WLWC 4FXKA 1JPSL 3CIQA 1UKSA 4KPHL 2WIMA 4M43L 4A6YH 3DRQA 4JPVL 2D0FA 3O3BB 4DTGH 1R3IL 1FNAA 2X10A 1D3CA 4XC1H 3W9EB 4XB7A 5FKPA 4IRSC 4NRXA 3CSPA 4CADB 5DHVB 4H0HB 5EZOL 3D3VD 1MCIA 3RUGF 2KUTA 1RURH 1PSKH 2HFEA 5D8JL 2Y5TB 3OKDA 4Q9QH 1JI1A 2BVQA 1QKZH 5DD6A 5GRUH 1MCFA 1INQB 5I18H 5LXGL 2YD4A 4PJDF 1JFQH 3Q3GA 3BVNA 3QULA 3U2SA 1FG2B 4LSRL 3FQXA 4L4JA 4ISVA 5DA4A 4DEPB 4F33B 3ARDB 1JPTH 2EXWD 3KDMA 5EO1A 1T7ZA 2ED9A 2IPKA 3MLVL 5HYSB 4W81A 4MNHA 1DUZA 5FIEA 35C8L 4I5BB 4UNUA 5CFHA 4FTVA 3QI9A 3U1SL 2ADIB 3LY6A 4JREB 1A1OB 1AGFB 1N0XL 4ONFH 4XPTL 1FAKT 4ZO6A 3SDAC 4M6ML 1RZIA 5I6XB 3BYTA 1S9XA 2OTWA 1N7ML 3CUPB 1MFDH 4NKOA 1C12B 2ZSVB 4DKEL 2O5XL 2BJML 2X4NA 5DRWA 3G6JA 3KPOA 5EC1A 1AKJB 5E24E 4X7EC 4LBEA 3QG6A 1NBYB 3OKOA 2J6EL 1Q0XL 3QDMB 2FYYA 3DIFA 5FO8B 1IAKA 5ERWB 4PJ9B 1IM3A 3CLEH 4HKZA 5F88A 4Z77B 3IVKB 1FJ1A 5FYJD 4MXWH 3F58L 4UBDC 4S1SH 4PUBH 5I8OH 4S1RL 5DFVC 3SGEH 1ZLSH 3V5DB 2OJZH 4PJCF 4ETYA 4QTHB 4U05A 1KPRA 4M3JA 2FGZA 4TUOA 4G42B 3AU1A 5GRZA 2FHCA 1ZANL 1OHQA 4RRPA 4WEBH 5E6IB 2NR6C 3OKYA 4X0KB 3NCYS 5HGAA 1QNZL 2AJ3A 5DHXB 4H1LA 5TE7H 2Z35A 1KCUL 3QEQE 4HWUA 3M1BA 2FZ3A 1AD9B 1GHFL 1WCBA 4BH7A 4OF8A 5C0CD 4JO3L 5KBNC 5ESAA 3DRTB 4YX2H 5FM5M 3L5JA 2NY6D 1NCCL 5DGQA 4ZO8A 3ARXA 3O2DL 4AMKL 1OP3K 2BFVH 4ODBD 4CRPA 2X4RB 1GGCL 2Z91B 2I9TA 3C2SA 5GS0C 5I1HH 5EBLA 2FR4B 5KVFH 3U4BH 4UDTB 3ARBA 2ITCB 2ZUXA 1ZSDA 3NH7L 4ALAH 4D9RE 1UCTA 1JMZA 2CUHA 5L0QC 2KQNA 2C3HA 4KI5C 1X5XA 3QUZD 3FO2B 1NGZA 4CDGC 1K4DB 3MLSH 1OSZA 4K2UL 1YNLH 3TO4D 3B3IA 2HFGH 3LCYA 2EYTA 4CVWA 2AW2A 4Y4KD 3T0EA 4YHML 4N0YH 1YY8A 4Y2OA 1MCEA 4O5LH 2WBJD 3JUZA 1GGBH 1U58A 3SCMD 2XZAH 3QDHA 5GS0L 5GJSL 3GSVB 3MXWL 4LSPL 4K3DL 1I1AC 3RZCD 1NDGB 1H15B 1KENL 3VG9B 3LV3B 3TT1H 3LQMA 5C0IA 3O4LB 2AK4B 4HUXB 1MRCL 2HMIC 1KEMH 1U3JA 2NY1B 1VFAA 3B9DA 4XVUC 2BNQA 3O3DB 4QRTB 4Y5YC 3W2DH 4PLNC 4ZFZB 5JZ7D 1J05B 3MUY1 1Q94B 3PHQA 1B6UA 4LNVA 3LPGA 3HZVB 3B2UC 1C5CL 2APWA 3RL2A 2IJ0C 4LSQH 1P7KB 4CN4A 4OGXL 3FCTA 5A43C 1QRNE 4PPTA 4JZNB 3S4SB 4CVUA 4P4KA 4WFFD 4LSTL 1FCGA 4PGZA 1R5IA 5J0BA 2DLFH 4FP8L 2Y06H 5J89A 3SO3C 3M17A 3GHBH 4E42B 3IDXH 2EE9A 2ESVA 3LEXA 3FZUC 2AXFA 4NRYA 2IBGA 4KI1A 1RSFA 3O2WL 1BFSA 3EHBD 4YK4B 1FVDB 2OTUA 5ANME 5GS1B 4F57H 5DMGD 3RTQD 1HQ4B 1CICA 4Y1AA 1E4WL 1D5BB 5C08D 4CW1A 4KHTL 3VGFA 3U0TA 4MD0A 1X5ZA 1MVUA 1FYTE 1CXIA 3PDDA 3PWPB 2GTZA 1IAII 1GIGL 4Q97A 3T4AB 4U2YA 4UOJA 4MDIA 4R90L 2SEBB 4LLDB 3MV7D 4X5WB 1XGTB 3QPQC 3NN8A 3GSQA 5DJZA 3S36X 3C5JB 1G9NH 4XVSL 1H0DA 5DF0A 1FNSL 2VLME 1LNUB 2YD2A 3OMZA 2Q86A 2VRAA 3V52L 3QUKB 3WKMH 5E4IA 4W4OC 3I50L 3VGBA 2YD6A 4FRWA 3PDGA 1FAIL 1HKLL 5C09A 3O3UN 2CLRA 4DN4H 3VXRB 4PLKC 2VLKA 2XV6B 4OGYH 1W72B 2Q20A 1YJDC 3B9EA 2E3VA 3IXAB 5GGRY 4NO2B 2HVJA 3WSQL 1OB1B 4UT6H 4OAWB 2DBJA 2KZ1B 4XNMA 4GAGH 3LDBB 3UZQA 3BP5A 5CSZB 1ED3B 1RIUL 2M8XA 1DQLL 4XBEL 4RMQA 3GMNB 2WP3O 3ZHKA 5ALBL 3FAWA 2APVA 3KXFB 3SKNA 3LHPL 2W07A 3WIHL 4G9FA 1A4KA 2QSQA 3E8UL 4L4VE 3ZE1F 3HUJB 5CUSL 4NQCE 2A6DA 5LWYL 4QOKA 1T2JA 2L4OA 2NLJB 5D7IE 5AZ2L 4YFEA 1BAFL 5JLZA 4LCCB 4N0CD 2YEZA 5F7EH 2Q76B 1JWSA 3JV6B 3MSPA 3V6BR 2IWGA 1PJ9A 4JFPA 3SKJH 4UNVA 4X4YB 4U6XB 3I2CL 3PIQA 1NEZA 1LE5B 2CPCA 1MEXL 4OM1H 2GAZB 3ZTNH 1KPUA 3E6HA 3ZO0A 4G6MH 3T0DA 4WRLA 4XPFL 4KZEL 2JIXA 1YMHA 3BEWA 4MNQA 5GGSY 3O6FD 3RUGA 1ROWA 4XNXL 4YXLL 2X7LB 4HEME 1FDLH 1J12A 2R2BB 1FFNA 3IFLL 4K3EL 4PJDA 4XP6L 3IFOA 3TYGL 3H9SB 4WUKH 4R4NC 3RU8L 2IBZY 3VFPA 4L9DA 3KYKH 1JF1B 3EBAA 4X99A 3GI9H 3G5YA 4X6BB 1IQWL 1FNHA 1LP9F 1A6VL 3BRGC 4J6RL 1TCRB 2P7TA 4Q6IA 1AGDA 1FFOB 3RA7H 3D0VB 4R6UA 5C0AA 1DE4B 3U30C 5DLMH 3K2UH 1A1NA 2LQRA 3R06A 4J4PC 3HRZA 1A0QH 5ITBL 4LLMB 5IB2A 5JW3H 1VEPA 4YUEL 3D1MC 5DFWH 4HH9B 3PGFL 1FH5H 3MCLH 3S96B 3CFKB 4ONOA 1VFBB 1EK3A 4GG6B 2OXHA 5EUKA 2E7LA 1FZJA 2DTSA 3L3HB 4G80B 3LEVL 5T3XL 2F58H 3ARBD 1C16B 4MQ7A 5K59F 3H0TB 3QUYA 1SJHA 1R24B 3B9KA 2IH3B 2X4OB 2R9HC 4PJCA 1A14H 3EGSA 4LPWA 3NPSB 3GI8H 1WJ3A 5BJTA 1NBVH 1S7SA 2HKHL 3KPPA 3S3JA 4GSDL 2V5TA 4PJGB 1DUYB 5E2TH 1QYGL 3MNWA 4N5EC 1BFOA 3F7QA 3VWKB 1JUFA 3QFJA 5IBLC 2DD8H 4KC3B 1IAIH 2ICWB 1DQQA 1ZHNB 1TFHA 4U6HB 5LG1A 1UWXH 3OPZL 3NVQA 2R2HB 5D5ME 2BY1A 4WI4A 3RVVD 5TDNB 3EDJA 1MCJA 4EIZC 3NIGE 4G5ZL 4JPKL 5JDSA 3V6OA 1GGUA 1S7VA 5KSBB 5FUCC 4FQ1L 5E56A 5EZJB 4ODHH 1MNUH 4JAMB 3U7WL 4HUNB 3CDGB 4OD2B 2NX5B 1HIMH 4PRHA 5AG8A 5IT2L 3OTTA 4N8PA 1P1ZA 1NCBH 2YRPA 2XWJB 4OF6A 1ZA3B 1JGUL 3AGVA 5C0CE 2DYPA 5A2KH 4QHUA 1X5YA 2VJXA 3CVHB 5DO2D 4Z7OE 1TETL 4XI5C 4L8SA 3BQUA 1G7LA 3H3PL 5EZLA 3U48A 1A6ZA 3DX8A 5ITFB 2CXKA 2NXYB 1E6OH 6CGTA 3IXTA 5IMMA 1B0RA 2H9GB 1KJ3H 1QQDB 1GL4B 1T89C 4M8QB 5FB8A 3HE6C 2YD5A 5IB1A 1NH6A 4I0PC 3DO7B 5F96H 1PLGH 2BDNH 1FNEB 1OD7A 4WJ5B 4RMTA 4G8FA 5EU6B 4WI6A 2ZOLB 3WFHB 2FEDD 4QLRA 5C6TL 4GKZA 1YEIH 5KTEH 4PJHF 4WENB 5CJQL 1LK3L 1MFEL 2IALA 1K6QH 2Z31A 4ODTH 1CGWA 5FXCH 1ZLWH 1T0NB 4APQA 3TIEB 5DI8A 3T0WA 1HHHB 3CX2A 4NQVA 5J12C 1OLZA 1NC2A 4MXQD 4HXAL 1CG9A 1IGYB 4JM2D 1LE9B 2W60A 1YECH 4OQTA 3KGRA 5C0RL 1N3NA 1RMFH 3QDGD 5L8LB 1AXSA 1SEBA 1NANI 1J1OL 2IMNA 4L3EB 4KROD 1KJ2A 4LSSL 5I73B 5HJ3A 2XTJB 1K4CB 2Y6SD 5CJXC 4POZD 5T5NF 1NGXB 3P4MA 4OLYH 3X12B 4Y5XA 2E6QA 4P2QA 2I9LA 3MLXL 3WHXA 3L3OB 1FL6A 4NQED 1K5NA 5E00B 4GRLD 4Z7QE 2IAND 4WFFE 4V1DA 5I8KH 4DVRL 5FAAA 3BKJL 5DRXA 5EDXA 2VXVH 3QBTB 5HI5C 1EFXA 3ARGC 4HIXL 5J6GA 5H37G 3WIFB 3VXMB 5JXEA 3H42L 1EV2E 3U46B 3IGAB 4RZCA 2BXZA 3JWOC 5BS0B 5JW5A 1A7NL 4MVBD 1MPAL 3RAJH 5ACZB 5D93B 4MQSB 3G04A 2IBZX 5GRJH 4D9LH 4UTAL 3VCLA 4NC1E 5C08E 2UZYB 3CK0H 5D6DA 4ZS6D 2MCPL 5F7YC 3V4VL 4OB5H 4ODWB 3ZKNC 1XCQA 1ACYH 2AAVA 2Z93B 3SDCD 3HAEB 3OGCB 1FGVH 4HFUH 4U1LA 5FK9B 4WTXA 5L9DL 3LPFA 2JIXD 5KW9L 4KAQH 3MV7E 4EOWL 1NCUA 5FO9B 1T66D 3K4DA 5DQDL 2PUQT 2VN4A 5CBEA 5FA3B 3I02B 3GMQA 1NBQA 3D18A 4RMWA 5AYQA 4AENA 4P48A 4ODVH 3JWOL 1BFVH 1FZMB 2X4QA 4OCWL 2VLJB 4GMTH 1IC7L 3BH8B 1EEYB 3MR9B 4M7ZC 1X4XA 3RVTC 4QRRD 3GSOB 2IF7A 4LSUL 4MAYB 4CVXB 3GHEL 3RWHB 2UZIH 3RVXC 3EOBA 4Y4HD 3PP3H 5SWSD 3WL9A 3RWEB 3H9HA 2BNRA 4XNYL 1Q9WA 1ERNA 4J3SA 3VG0L 3B2VL 4LLUA 4M48H 3LPWA 4GRMA 4X98A 4Y4FD 2OL3A 3W9DB 4X4XB 4PV8A 1JL8A 3EOAB 1JGDA 3TT3L 1ZS8B 3OB8A 1YEJL 4NHCH 3ZKMD 4WFGD 3F5WB 5FGBA 4H20L 2FATH 1ZHKA 4PRIA 1KV3A 3AY4A 5D2LB 5DJYB 5DJ0A 2PW1B 5DUPL 2BHZA 4WGWB 5B22A 4UMGA 4PREA 3CSBA 4XTRC 3ULUC 4WWKC 1YYLH 4OFYA 2GHWB 5CCKH 5AD0B 4F7TA 2DI9A 1NGYA