3I84A

The crystal structure of human emmprin n-terminal domain 1 in p6(1)22 space group
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
80
structure length
79
Chain Sequence
GTVFTTVEDLGSKILLTCSLDDSTEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the EMMPRIN N-terminal domain 1: Dimerization via beta-strand swapping.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Cervical EMMPRIN
total genus 12
structure length 79
sequence length 80
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3i84A00
4QHLB 4DUXA 5HDLA 2VZUA 5JW3H 3IVKA 4OZHB 5I1AA 4N1HB 4Y8AA 2ZP0T 1MREH 4P2YA 3HNSH 4O4YH 2X09A 4Y4HC 1W72L 4IJ3B 2E7BA 1HZHH 1CE1L 2B5IB 4PGEB 1CE6B 2BX5A 3W11D 4YQXL 5F9JA 3I2CH 3RBGA 2BVQA 5DMJB 2GY5A 2CH8A 3WSQH 1CIUA 3HR5A 5MERB 3VG9C 3FRUA 4PJAF 5L0QC 4PBWD 3IXAB 4HX1A 2V17H 4G9DB 2IFGA 3C87A 3P4OA 1J12A 2UYLB 5J4MA 1B6DA 4LIQH 2QQNH 5C0IA 5I0DA 5JW4Q 3B9KC 3MV7B 5DD3H 4LK4A 3RZCD 1G1CA 3PABA 4JCMA 2V7NB 3JV4B 5HGBA 1D5XB 4CKVX 1E4JA 3JWDH 4HKJA 1CXEA 3KNBA 4P2RE 1O5DT 2P24B 5LGJA 4YUEL 5ICYA 2VZOA 1S7SB 4NO2A 4LHQB 4Y4FB 4YPGB 1XGTB 2HRLA 5DHVH 3NH7L 4JZOB 4N0FB 3GI9L 2GJ6B 3U4BL 1NUDA 1XR8A 5HYSB 3MFFB 2ENYA 3SDDB 4S1DD 4URTB 5A2IH 5D72L 1A7PH 2EKSA 1PD6A 3MA9L 2XTJE 1FGVL 2OTUA 3C5ZD 4UV7L 2OL3B 5ALBH 4LOUC 4NRZB 2NY6C 5DJXA 1RZJH 1E4KA 5GGTL 2YUWA 5SX4H 3HAEH 4MD5B 1E27A 1N2RB 2X7LA 5T5NF 1HWHB 3SKNA 2AJUH 5H37G 1FVCA 3UTPE 4EBQH 1IRAY 1ETZA 3F6IA 4WUUA 2Q87A 5H8DA 4LCCC 2B0SL 3L3JA 5EU7E 3LQZA 4OGYH 1CD1B 4ERSL 1A3RL 5I74C 5E9DE 1M71A 3DBXB 5C2BH 3UJTL 4MAYA 3AXLB 43CAA 5JORA 5D2NE 3MACL 2ZCHH 1GGYA 2FX9H 2APTA 4PGZA 3U30B 2DL2A 4PRNA 4I3GA 3VFVB 4BK5A 1W0WB 3QUKA 4NO0D 1RHFA 3X13B 5JDSA 4ETYA 1G6RH 3FRPG 2CRMA 2QSTA 3O3EA 1IKFL 4OQTH 1UKTA 1BOGA 3KYKH 5IW1A 5L6YL 3CPLA 4L8DA 3AU1B 3GDBA 2BVOB 3QJHA 4G8GE 5D5MB 3QP3A 4WDIA 3BP7A 2DQEH 3QEQB 4YC2B 1XF2A 3B8YA 1CGVA 1FVDA 3FT4A 3TT3H 4UUJB 5EUOF 1G7IA 2GJJA 3W9DA 2P5WE 2E9BA 3FONA 1FYTE 3PDOB 3G9VA 2OK0L 4YZFF 5CGTA 5CKGA 3BJLA 4UOJA 1WJ3A 4Y4KB 1I8IA 3HZYA 1H15A 3D3VB 5KAQF 2JIXA 2HP4A 3PNWB 1MAMH 4GBXA 1I8IB 3HZYB 3ZDYF 5CCKH 1VACB 1KLUA 2BNQE 2DAVA 4HPYH 1RY7B 4ZD3L 2BVYA 1J8HE 3VFPB 1D5ZA 1F45A 3L95A 4TUOB 4TVPL 3LKOB 3BZDA 3MLUH 3VRIA 2V5MA 7FABH 1SEQL 4L1DA 1T7XA 3QCVL 3PGCA 4X9BA 4UBDC 4BFEA 4MJIE 5JOFA 2GFBA 4RWYH 3VWKD 4O5LL 4R2GC 1N6VA 4HW6A 5I76A 2AXGA 5IT2H 4C4KO 1G7MA 3R06B 5IB1B 1JNNH 1V3LA 4Z7WF 3VXMB 4LFHD 1WSST 1T1WA 2D7QA 1U8LA 5MENE 4Z77A 5T1DH 3DGGA 4JO4H 4PRPA 5GGSY 4BELD 2H2SD 1FNHA 3SQBA 2QEJA 1F6AA 1DVFA 5JXAL 4BSWB 2V5RA 4S1QL 4PJ7F 1EJOL 4WI8A 3GGWA 3KPOB 4JPWL 3X3GL 3OB8A 2D9QB 2X1QA 4LSTL 5F89B 1J9CT 1DE4A 2OR9H 4S1SL 2NY2B 1UXWB 1NJ9B 2XA3A 4OZ4A 1YYLH 5ACLA 4NJ9H 3QIWA 4XP6L 3RUGE 1CICA 4IOIA 1JZ6A 1TMCB 5E8NA 1QOKA 3R8BB 4DWHA 3QDJB 4MMZC 2XIDA 1YEJL 3VG9B 3MLRH 4ODXA 4LLAA 2YRZA 4M5YL 2UWEE 3M45A 1FE8L 4JO3H 2VQTA 1N5AB 5IVNA 3W9EA 1NCCH 5J1TC 1FBIH 4ODXB 1RZIB 4M00A 1I85C 4E5XB 2H8PB 5FECB 3CFKB 3S98A 5DRNB 1NEZA 1MCHA 1QLFA 2VABA 4DVRL 3SCMD 2EDQA 3QAZB 2X9YA 1JMXA 1QFWM 5ANME 3MRCB 2UWEF 5DRNA 3C5SA 1I7RB 1INDL 2K9UA 3QIBB 2IALA 3KJ6H 1Z6JT 5EBLA 5DFVD 3I9GL 3RQ3A 3VXUB 1A6UH 1DQMH 3C6SA 3GJEB 1SHMA 4LCCA 2BHZA 5DS8A 5DEGB 3IRZA 4OTXH 1Y18A 4R7DB 3DURB 4WO4D 5GS2D 1T0PB 4HEME 3S35H 1UZ6F 5J9PA 2P5WA 1TQCB 3BZEA 4E41D 3FQNA 1MCRA 1QRNB 4PG9B 4OZHF 4M43H 3HI5L 5GGRA 3P0GB 3W81A 4LNRB 1RIHH 2P5ED 2L7UA 1WICA 5FO7B 4M3KB 1PX4A 1TNMA 3GKWH 1QSFB 1OAQL 1U8IB 2NXYD 3BPCA 5B39G 5IMMB 3FB8B 1MHEB 3ILQC 1A1OB 1JZ7A 5JW3L 1SY6L 3Q5TA 3RDTD 1GC1C 1RMFL 1MHEA 2HH0L 3G5ZB 4XMLH 1FSKB 2WBJA 3HTLX 5C86A 4KK6C 5CHNA 2EIEA 4EBQL 4WFHD 4HWEL 4X0KB 3TFKD 2QHRL 4M48H 2NY5C 3C5ZA 3QXAA 1CZ8H 3F62A 2XNAA 4PRBA 1A64A 4ONHA 3T4AA 2IWGA 5IW6A 4FQCL 1KCVL 1V7NL 1HXYA 3QZWA 3G6DL 1DFBH 2ITCB 3K2UL 5C0ND 2I26N 2NY4D 1J0ZA 4NQVB 1MCKA 4Y4KD 3WHE1 3SGJA 3L3JB 3ZKMD 3S96A 5DHVA 5C09A 4MA1B 1GGIL 1ZSDB 2J1KA 4XAWH 4X6CA 4E41A 5MEOA 4ZTOH 3OAUH 2DQUL 5C09B 4O9HL 5HVGB 2V2XA 2YUZA 3GHBH 4OF3A 1QSEB 5FUZL 3T0BA 1HQRB 4FXKA 5D72H 2AKRA 1HINH 3UO1H 2B4CH 4ODHH 4Q0XL 4HUWA 2IAMA 4PP2B 2VDRH 3OB0H 3MQIA 1S7TA 4UAOC 3LV3A 5ALBL 1QBBA 1EV2E 1F11A 4OLWH 3GK8H 3F7PC 3HPJB 1CWVA 2PYEB 4HUVB 2PXYB 5T1MB 2FATL 2JJUA 4FFYL 4OF8A 4ETQB 5KJRH 3P0YL 3WHE0 3MOAH 5F7EL 4M9OA 3QHFL 1XZ0B 5GISH 1QFPA 5IBTL 1FZMA 3EYOB 2D0GA 2VQ1A 3EGSA 4KKBD 5CILH 4PJ5A 1SJEB 2VDQH 3MLXL 1ZWIB 1CBVH 2NXZC 4UB0L 1JHKL 1IT9L 1R3HA 1A9EB 2OI9B 4L8BB 3IU3B 4L3CB 4W68A 3SN6N 1H15B 4XNQB 3HA0A 4ODTH 4HUMB 4OF6A 4PJGB 5HHOE 2YN5A 1MAKA 4YBLB 4ZSOE 3DSFH 4JRXA 1S7QB 1RV6X 3O4LB 3BHBB 1C5DB 3EFDL 1XGPA 3O2VH 1U3HD 1A7RH 1MJ8H 3ULVE 3VFWB 3VRIB 3GSNH 1WBYA 5F3HB 3S4SA 3VWKA 4HXAH 3BSZH 3RHWK 3FT3B 5EA0L 3WMSA 1N6QH 25C8L 3X3GH 4FTVE 4JFZL 4POZC 2ICWI 2WM0A 3UJIL 4LLDB 3RGVB 1S5IL 4G7VH 3BGFB 1L4IA 3KYKL 1OT1A 4XPGH 1UWGH 4R96B 4Y5YB 1X5AA 1JZ8A 1LP9F 2VLRE 2BSSA 3T0VA 1OT2A 4O2EA 1YEJH 3TZVD 2K1MA 3MFGB 5TE7H 2LFGA 4UTBL 2WBJD 1U8HB 4U6XA 4XNUH 2LAGB 4FTVA 2A83B 4JFOA 1FN4A 4ZUWB 1CFTB 1K4CB 3W2DL 3T0EA 1RPQA 3BJ91 4MDIA 5AZEL 5GZOD 2OK0H 2RQ8A 3MLTB 2SEBB 1DUYB 2DQJH 2R4SL 1XGUA 5F9OH 3KLAA 5HY9A 1CICD 4JDZB 4JFOB 1FN4B 2BNUB 1MRCL 5MI0B 5F9JB 4LVEA 4NKDB 3J7HA 4L3AA 1Y0LB 5D7KE 2Z8WC 1S9YB 1ZHBB 3WNOA 5D6CA 3BUYA 5C0EA 1T03L 2ADJA 1JNNL 1MI5B 3C8DA 5C6WH 3QNXB 1UA6H 1JPGA 2BK8A 2I5YL 2VTFA 1KTLB 2W60B 3QG6A 2FJGA 3MCG1 1RZIA 2PW1B 2ADJB 1GGCL 2A6KB 1T22B 1KACB 2CMRH 2YA1A 4NQEA 3ZSTA 4HC1A 2FJGB 3QB7C 4YXKL 1RIHL 2GUOB 1QVOB 2PO6A 1U2CA 5DRZA 4KI1A 4UIMB 1RK1B 5KSBE 4Q6IC 2B4CC 3C2SA 3IDGB 3RTQD 1HH9B 4H20H 4NSKA 5BW7C 3OKNA 2CDEB 1IAOB 5D1QC 4QHMA 4A6YL 4JHAL 3UTTB 5B3JE 4AIZB 2Y4SA 4BZ2H 5T1KD 3D85B 1CL7H 1F3JA 5IBLD 5B4MC 2DM2A 3L9RB 3UTTA 2J8UB 4IDLA 4OKVB 4JREC 3WNKA 3EJZC 4PUBH 3VGDA 3SY0B 1U8OA 4P46A 4Q9CA 3INUL 4IRSC 5L9DH 5C0BE 4XGZA 5FM8A 4P4KC 4I77L 4LSTH 4NRZA 1HHJB 3ZKMC 1J5OL 2DKSA 1R5IB 3VXRA 2BNRE 4N9GB 5TDNA 2V7HA 4XTRD 5I8KL 4JR9H 4WCYL 1UCBH 3QWRD 4S0TD 5JIIA 5E56A 5FO8B 2HFEA 1GGBL 1CDGA 1BWWA 2O5XH 2XZZA 1JFQL 4QHNB 4KRNA 3GO1L 3D3VE 2FJFB 4PB9H 3DMMA 4NCC2 1NGWB 1MJJA 2VDKL 3TN0B 1H3UA 4G9FA 4X4MA 1NPUA 3GJFH 3UAJD 3N1FC 5C0NC 4P2QE 1WBZA 3TBYB 5CBEA 1YNKL 4U3HA 3TYGH 3B5GA 4PRDB 2NQCA 4U1NA 4K71B 5JPMB 1R5WA 1IGCL 3KLHC 1KPUB 1QTYT 3QUZA 4FQJL 5CP7A 1ZVYA 4X6EA 1YMMB 3ES6A 1GRWA 5EBMB 1CDCA 2VXSH 3DNKA 5I9QC 2WWKO 5I16B 2UY6A 3HMXA 3V5KA 3MJ7B 4ZAKB 3MRGB 4NYLB 5D2LA 2F19L 3ME0A 4M48L 3SCMB 3OWEA 4LSVH 1XR9A 1UB5A 4QRRE 1KGCE 5HYQB 4U3CA 4DVBA 5C08B 3D3VA 4LASL 1P7QB 3HPJA 2PYEA 4NCDA 2UUDH 2ICWA 3VXQB 4F7TA 1VACA 1J0KA 4P3WA 3UC0L 5I1LA 4ZUVA 1ZKAA 4ODTL 1BZ7A 3ORJA 3P4NA 1UH4A 5BMFL 4R6UA 4LLYA 5HGAA 3ULUF 2DTML 1JGLH 1HILA 5BRZE 2FSEB 2P8PB 1X5FA 2X4SA 1X5GA 1FFOB 4MLSA 3NIGF 5AZ2H 1ED3A 5ALCL 1CLCA 1R3LB 4ZUSA 4CW1A 2FSEA 2FYYA 2P8PA 4FQCH 2WP3O 1EO5A 2NXZD 1YYML 5E5RB 3V8OA 3LMJL 2E27H 1QFWL 4AQOA 4JPVL 2GCYB 5EU5A 2ZUTA 3W0WA 1RZGB 1W2KT 3NPSC 4MZ2A 4GRWF 1U3JA 1BPVA 2F58H 2VL4A 4KJWD 4RA3A 5FHAL 4KTEL 4KROC 1WFTA 1S7QA 1Q9OB 5KG9A 3UXFA 5CKAA 2V5SA 1TETL 3ARDC 1KTDA 4MVBD 1NCDH 2NX5A 5HHME 4CAGA 2Z31D 4LQFH 1MY5A 3D5OF 1EHNA 4OLUH 4QWWD 4AEIH 2RHEA 1NFDE 3HG1E 2R39A 3HAEB 5F3HA 5GISL 2AK4E 3O8XD 4OKDA 5DA0B 2FIKB 1FL5B 4YHMH 1NCAH 3FO9A 4ODHL 4NKOA 2IH1A 1PYWB 3QCUH 3Q3GA 4U6HA 3G5VB 4WW2B 2AXJA 1OAUH 2ID5A 1N59B 1VERA 3MUY1 1J10A 2C7UA 1NFDB 5E2UH 5K59F 3CFDA 1RUQL 3Q3GB 4U6HB 2MCPL 1J8HA 4ELMF 4P5TB 3TZVC 3JVGA 1A3RH 3O2DH 1YN7A 3NN8B 3S36X 2ZWLT 3TH4T 4NWTH 3S7GA 4HH8A 5EOCH 4R2GB 2JKXA 1G9EA 2QJDA 3EFDH 4PRPD 3LS4H 4YIQA 3A6OA 4NM4L 3KXFB 2VDOL 5KTEL 4NZRL 4DGIH 2XWBA 4W81A 1I7UB 5DFVC 3FQXA 4X9FA 4HXAL 1RURL 3GJEA 1VEMA 4JDTH 3WE6B 2WUBL 2XWBB 2YPLD 5E8OA 4NKIH 4NNYB 2KPNA 1TCMA 1HNGA 1YEKH 2A77L 1RU9L 4G8GB 1FNGA 2VN4A 4DUWA 5GGVY 1NGQH 4HV8A 3MGTA 5FHBL 4NHUA 5J6GB 3MOBL 2ICCA 2PW1A 4CVUA 2HMIC 5HGDB 4G8GA 4P2OC 2LU3A 2F74A 4JY4B 4LF3B 1EXUB 4P3DA 3V95A 3S4SG 5KS9A 1KB5B 4Y89A 4RNRA 3QUZD 3TJHC 2BOBB 4HIXL 4OZFA 3TFKC 3IDGA 4JFZH 1NGYA 1QHOA 2EDNA 5HD8C 4RQQA 3MJ9H 2HJFA 4XNZB 4HFUL 1RZJL 4P46D 5HHVH 1QLRA 3L6FA 4LCWA 1G7JA 1X3DA 3O8XB 4U6VH 2AV7B 1JV5B 1I1CA 4S2SB 4JFFB 3LKQA 4PJCE 4XVUC 4QRRD 1I3UA 3T3MF 3MLSL 4JRXE 1VFBA 4H0HB 2NY1C 1KLGB 1XGQB 5F1IA 1HHHA 5EO1B 1LE5A 3BKYL 4X5XA 5GS0L 1E4XH 4PPTA 5C07B 2ZCHL 4TPRL 1RULL 3LD8C 3QCVH 3L3OA 5DK2B 2KH2B 1MQKH 4MDJB 3C6LD 3RIFF 2H2PC 1OOAA 3UYOD 3H9SE 1ZHLB 2VDPH 5IT2L 3I50H 2X4OB 2DYPD 5IM7B 4JZJC 4UOW0 2W0FB 2J8HA 1KJVA 1T89C 1I75A 4PRNB 2XN9A 1CVSC 1DL7L 1RZKC 3HE7A 1FCGA 3PGDB 2W0FA 5DXWA 1OM3H 5JDSB 2YKLL 1DBML 4S1QH 1WVZA 4JPWH 5DD1H 3VW3L 4G6ML 4XHJD 4HGWB 4CVWA 3OZ9H 3M07A 3U0WL 1S7VB 4HZLA 5IB4B 5K9OA 2MHAA 3QISA 1GGTA 4XP9L 3BP7B 1Z9OA 2YPVH 1UXSB 3BKJH 1EHAA 3JWOC 1S7VA 2PTUA 4GBXD 1E28A 2GY7B 2IGFH 1JNHA 2AERT 2M1KA 3O2DA 2AGJH 1CL7L 5DRXB 4JQXA 1R5WB 3SDDD 4G42B 5CEXA 4KJPD 1T5XA 2F9BT 2CK2A 1NMBL 2WAHA 1IM9B 3G6AA 1PY4A 3NIFF 3QDGB 4AT6A 4K2UH 5ADOL 4YBHA 5DGRA 1E6OH 1F4AA 2H45A 1B9ZA 2YUVA 4ODVL 2DS4A 3I3DA 3T4YB 3LCYA 4GKNA 1KPVB 1YJDC 4JFDA 1KC5H 2B1AL 2BY1A 2V6HA 3EO1B 3BPOC 1TJIH 4QRTA 5ETUB 5D96C 2J88L 1G7QA 3OF6D 3KJ6L 1NLBL 3BPNB 3VGFA 1JF6A 3MV9E 1T7YA 3ZT5A 5FM4A 4TUOA 3HB3D 3OHXA 4POZD 3NPZB 1FJ1A 1ZLVH 3VWKC 3OHXB 3BAEH 1JN6B 5I76B 2YPLE 5F7UA 3STLA 3RWGA 1PW3A 3VFSB 4HMEA 3QEQE 3QQ4A 2ESVB 1IE5A 4AEIL 2CR6A 2K3TA 5DUPH 4MXWH 2HT3C 4BKLA 4JM4H 2DQGH 5L88H 3EYSL 3SCMC 2IEPA 3JXAA 4Z7VB 3V2AR 4C56E 4TULH 4BSWA 3D25B 1OCWH 3EO9L 3W39B 3PQYE 2P24A 3PGFH 4LCIH 2Z31A 4G43B 2BOCA 1R3KA 1FNSL 5KAQG 4N0FA 3FMGL 2BHUA 1MCWM 5JZ7D 5LCVL 2ZUQC 5C6PB 4LL9A 2XT1B 4MDIB 3MXWH 4BFIA 4UT7H 3MFFA 3Q6GL 2NTFB 5E4IA 2CO6B 4ZFOL 2MTPA 2UWEA 4W6YB 5FGCB 4D0DA 5JXEC 3RI5K 3LS4L 1FLRL 4JHWL 1D5BB 1C8PA 35C8H 5DDHA 3MLWH 3RWCA 1RUML 1KSRA 2BSED 3VFRB 3CAFA 5DC9B 1RURH 4GAFB 3S6CA 2CQVA 4OTXL 4HIEA 1GAFH 3GMMA 3WUZA 1XF3B 4KROB 2IQ9H 1A4JB 1ZE3C 2DQUH 2MCG1 1LGVA 5FHBH 4WTZA 2VAAA 4XPBL 5BS0E 4HUXB 1MHHB 2DD8H 1MI5D 2HKHL 3IGAB 3S35X 2PYFA 3TH3T 4M03A 4P59L 3HG1D 1F8TL 2DIJA 4KVNL 5CZXD 3UROR 3FQXB 2G5BA 3V0VB 3UZEA 1F90H 3SBWA 4I3RH 4GRWH 4S1DC 2FX8H 1OSPL 4IOSD 1ACZA 3BE1H 4I3SL 1EHXA 1U8JB 4JVWA 1IZJA 5GIRB 1VPOL 2JB5L 4DCQB 5A2FA 2BXZA 5I18H 3NIDF 4J3WA 4EKXA 2BVOA 1I1RA 5M95B 1EEQA 3PHQB 3QRGL 1JK8B 1AP2A 1EDQA 4GUPB 1WITA 3QUMB 4RNRB 4NP4H 4Z7OE 1Q9LA 3EAKA 5EBGA 5EOCL 4MQSB 3H42H 2CDGB 2IC2A 2LTQC 1NGYB 3BYTA 4GMTH 4Y4FC 5CIPH 1CDBA 4JZJB 3CXDL 1OHQA 5CLWA 3O2WL 4XHQA 4LCYB 1RI8A 2V7HB 1U8NA 4XAKD 2A6DB 2A9ML 4NQCA 2RFXB 3JTSB 3MREB 4Z0BH 4RIRA 2D4FA 4QY8B 5C0RL 1CLOL 3HC4H 3WFZA 2HLFD 2NY3C 1CU4H 1FYTD 1IGIH 2R23A 5IB2B 2EDFA 4WHYH 5D5MF 4ZTOL 2KKQA 4PLKD 2ZPKH 3F7RA 1XIWD 3D0VA 4OGZA 1MJUH 1G9NL 5HJ3B 2BC4B 2N7AA 1DBMH 5SWSD 3LRSA 2YSSA 3TO4C 4NO5A 1HINL 5BJTA 3I6GB 1FVEA 5IWLA 1S7XA 2NNAB 5EO0A 5AUMA 3QIUA 4N5EC 4X5WB 4YHPB 4HCRL 1OL0A 1GZQA 4QHKJ 1Q0XL 4G7VL 4L3EB 2XQYK 3FTGB 4X6DA 5FYKU 3F5WA 3VXSB 2V5TA 1UM6L 4FHBD 4CNIA 1OARH 4Y1AB 5F7MC 1HCVA 2IPTL 1XT5A 1J0IA 1VDGA 3ARGA 3I6KA 5I1DA 4WUUD 4YHOH 4YHYC 5IHUL 1R3IH 3MODL 2IBZX 4JVPA 2ERJC 2CLRA 4HAFA 1FQ9C 1S9XB 2O5YL 1KLFA 2EDRA 4LPTA 1WCBA 3RZWA 3ABZA 4K55A 4H26B 5D7LA 1X44A 1PEWA 3HNTH 1RULH 5J57B 4Z7VE 3HI6L 1JHLL 4E0RB 2RCSH 4ODSL 3FOLB 2JB6A 3EGSB 2Y23A 4ELMB 3FO2B 4JFPA 3GBNL 2APWA 4HK3N 1U93A 3OAZK 2UVFA 4HUUB 1SYVA 1K2DA 2HJKB 4QEGA 3TN0C 1T20B 4LDLB 4FP8H 1A7RL 3MRJB 4XVJH 3O3AA 1P53A 4JFDD 4F58H 2QADC 1BZ9A 3O11A 5ERWB 2WBJC 2GCYA 5EU5B 3W0WB 5J89A 5EA0H 2VISA 3SJVA 5DSCB 1NEZB 4PTTA 3GBLA 5EIIB 1BFOB 3WDIA 4HF5L 1BVKA 2KBGA 2PYED 3TNMA 1ORQB 3T0ED 3PWNB 2IADA 5HDQH 3P0VL 3BD4A 4XPGL 1INEH 3GHEL 5EWIH 4Z7QF 2L0DA 5E1AA 5E4EB 3DOSA 2GITA 5GJTH 2JIXD 5DVMA 3GMLB 3X12A 5CUSH 4PJ8B 3K7UA 1JE6A 3SE9H 1CGYA 3RKDD 4OGAC 3B9KD 3D39A 2CSPA 4PGDA 4OUUA 1FLTX 4LSSH 1I1AC 4KJQC 2WINB 3SGEH 5F9OL 4IRJA 3ALXA 3OXSA 3PHSA 3GSQB 5C7XL 4Q9BA 2R29L 1VGKA 3O6KH 1NFDA 4GW1A 4LSPH 5DT1L 2HMID 3UZQA 3N1QC 4WUKL 5IMKA 4MJ5A 1IJ9A 2C1PA 4FTVB 5I8KH 3RL2A 1U9KA 2YPKB 3V6OA 2GIYA 4B53A 3W0WD 1NBQA 1EBPA 4MJIA 2NW2A 5HD8D 4FMKA 2FO1A 4KKCC 4O2FA 3BWAB 3G6JB 4MJIB 1ZHBA 4Z7VF 1E4XI 2EC9U 4M6OH 5JXED 4UQ3B 2IANE 3T4AB 3V0WL 3MNWA 3QEQD 2IFFH 4ENEC 2AK1L 3QG6B 1JYXA 1CF8H 3TBVB 2Z8RA 4OM1L 5DLML 2APXA 3EYQD 1AGFA 5FYLH 3REWB 2A6KA 1HSAA 4D9LL 1JGEA 3RUGF 3MJ9A 3TVMA 2CJUL 5E5MA 1YEDB 3DIFA 4L4VE 5T3ZD 4K3HA 5CJXA 5DRZB 4YO0A 2BFVL 2F74B 1PG7H 4HPOH 3DV6B 4TTDC 4XPHH 3DIFB 1YEDA 4HLZH 2VZ3A 3D87B 2P5EB 4K94L 4XNXH 1RSFA 3CSGA 5ITFA 2CLVB 4J3SA 1AGBA 2CIKB 3MZTA 4LDOB 4O02L 4JPKL 5LCVH 3TYFB 2Q8BH 3X13A 4RQQB 2DL9A 3EDJA 4UTAH 3BEVB 1S9KC 3QUXA 3F8UB 1AGBB 4G6FD 4NN6B 2FBOJ 5C2BL 4R90H 3CCHA 2YUXA 1MHCA 3DI2B 3EYSH 1KUMA 1CLYL 1OTUD 2EEAA 3MBEB 4L3ED 3CXDH 3PV7A 1KCUL 3EO9H 4M1CC 5E9DD 4DCQA 2UY7A 1T66C 2JCCB 4EIGB 5BMFH 1P9MC 3QI9D 3AAZA 4RGMB 5IROC 4P2RB 4U1LB 4F9LC 4ETQA 4XI5D 1GGBH 2YR3A 1IGIL 1OAYH 5INDB 1IBGL 2VLKD 3C8KA 3EKCA 3FONB 1X4ZA 4GBXC 3FB7A 1WTGT 3D48R 5DJ6A 3VFUA 2OBGA 5IJVA 5GRWA 5IFHL 3DRQB 1LDPH 5HVHC 4OT1L 2OP4H 2VH5L 3VWJB 4NC1E 5CSZB 1KYOK 1AIFB 5A2JH 3WLBA 4YEEA 3QHZL 4S11A 4PJCF 1YNLH 1Z3GL 5I6XC 1YMHA 3S34H 1T04A 3PWVA 4F57L 4JFDE 3HI1B 1NCNA 4M6AA 1F90L 2F58L 4QHNA 4LEXL 5SX5H 4HCRH 3NAAL 4MQ7B 1JHTA 1T1YA 5TE4H 3WIIH 4HKXA 3TVMD 2QHLA 3PWVB 1T04B 3EO0A 5CJOL 3WXVH 4XCNA 1OW0A 1G7PB 1EGJH 2MOVA 1BP3B 2IPTH 2NW3A 5EU3A 2MQ0A 3U6RA 4WHCA 1OWRM 2EDYA 4XP5H 4XNZC 1QSFE 1MAML 2HKHH 3C60D 5HJ3A 2RB8A 1KIQB 1RJYB 5I71B 3MRKB 3PDGA 3DVFA 3O41B 3I6GA 2NY5L 4N5ED 4X6EB 1AKJB 5A43C 3ZKQD 1IC4L 4P9MH 4XBEH 5HYEA 4CGTA 5I16A 1R24A 4Y4HA 3B3IA 2C4FU 4LPCA 3HMWL 1F6AB 4ZO7A 1CU4L 2NY3B 4KJYA 3TCLB 3LS5H 32C2A 2B7DT 2ZUWA 4R4NC 1NJ9A 5JA8B 1K5NA 3U48A 3T0EB 2WSKA 4QNPF 5IKCA 1JUFB 3H9SA 1NGPH 4FOMA 4XCEB 1U3HC 3NIFE 3TT3L 3FB5B 1Z0MA 4X7FC 1JZ2A 1UQSA 1F2QA 3NCBB 4PJBE 4LPUA 4CJ1A 2ILLA 4MLIA 1IKFH 1WBXA 1J1OH 5HDQL 2F54B 4NJ9L 1ITCA 4NO3A 1YN6A 4XP6H 3V7AG 3MRPA 2Z92A 2X41A 3WO4C 3OKMB 1X4YA 1UYWH 4U1KB 4KHTL 3KJ4C 4XCCH 4L29B 5LAXB 2R69L 3QQ4B 1GYAA 2DJ4A 3SJVD 3OKMA 4U1KA 4JM2F 5CUSL 5T3ZE 2VO5A 5IR1A 1I7RA 3A6BL 2YC1B 4PTTB 5DVLA 5EIIA 4FQ1H 2WUCL 1NBZB 5ICYB 3C6SB 4KUCD 4EN3D 3SDAD 3DECA 4NSKB 5F44A 2YEZB 3RL1B 1SEQH 4RMTA 1C7SA 3LAFA 3G5XA 2CXGA 4NO0B 1U92B 1VESA 3ULUH 3FQRA 2Q76B 5IHUH 4HEPG 3K4ZA 1FZKB 3L9RA 4Q2ZA 5I1IH 3VG0L 1DEEB 4QTHB 3OJVC 2V2WA 4DKEH 3CUPA 2HJLB 3B9DA 4OFKA 2BNQB 4C55A 4B7LA 2GQHA 5ACZB 4NM4H 1U3HA 4TVPH 4K8RL 3N0PB 4MXQC 1FZJB 5CINH 5HDOA 4XCYB 4U1IB 1RAMA 3LPGA 3NN8A 3QUZC 4YBQD 3VFRA 3WCYA 4GLRH 4XXDB 5TQ0H 2C1PB 2HFTA 1FZJA 5H37H 1IGTB 1MCPH 3CFJB 1B0WA 4G5ZL 2JCCF 3EYVA 3IAQA 4XWOC 2OZ4L 4J7RA 1DEDA 5AG9A 3P9LA 3C5ZB 3L3KB 3RU8H 5BOZG 3NABH 4OFVA 2BFVH 5IHZB 4M7KH 3DXAB 4F58L 5GJTL 3SE4A 4PBVC 3MLRL 3MRRB 2X9XA 3LDBB 1MIEH 2C3GA 2E7CA 2NY4C 3B2UD 1A14L 1MJ7L 4H1LB 4JPKH 3NACH 2F53E 4JFXA 3RY5A 2EO1A 1TZIA 2FWOB 3MROB 3OKKB 3U4EB 4YLQT 3ZMRA 1YEEH 2J6EA 3B9EA 3R1GL 3ZE1E 1RZ8B 1NDGA 2R9HC 1A7NH 4Y5VA 5FCSH 4JQXC 1EXUA 3RZCB 1JNJA 2DQFA 2G75A 1MH5A 5BZWB 2CIIA 1FG9C 5EZLA 4K2UL 4XXCC 3ETBF 1JPSH 5LBSH 3RZCA 4R7NB 4JO3L 4HCRA 2OX5A 4JRWA 4XTRC 5I30H 3TC9A 2BP3A 1LE9A 4IRSA 3U46B 5EBWA 4HJ0C 4KQ3H 4ORZC 4GH7B 3V5KB 5FGSA 3GJFK 4B50A 4WFFE 3SE8L 1QO3B 2PXYA 1UB5B 1UH2A 5EB9A 2HT4C 3MV8B 4FQLH 4GMSH 1HDMA 3DXAD 1QBLL 4U2YA 4RFOL 1MLBB 1ZT7A 2B4CL 4Q0XH 5I8CB 3K8MA 2R56H 1OVZA 3GMNB 5FA4B 1HIML 3ROOB 4HDIA 3CK0H 1DL7H 1AQDA 5INDA 3GRWA 4LKXA 4OF7A 3OR6A 4HULB 1YQVH 2BVTA 4HWBA 2VXQH 3VMPA 3MBXH 2ZUVA 2NZ9C 2DQTL 4OCWH 4L8BA 4K94H 4XNXL 4UNTA 5DUPL 5FUCC 5TDPA 4CW1B 3UJJL 1J11A 1DN0B 4M61A 3NTCH 4UT9L 2AK1H 4GQ9L 3S88L 4LCWD 1H5BB 4J1UB 3BH8A 2W9EH 1P1ZB 2VDQL 4CUCA 5DQ9A 4DKDC 5C0AB 3ARFD 3NCYS 5C9JB 1S9XA 5EU3B 4HS3A 4D9RD 4H0IA 3HMWH 2FL5A 1LEKA 1C1EL 2Q8AH 2JK5B 3UYPA 3G04A 3QFJA 3U7YH 1OAYL 4KKBC 5D2NA 2CR3A 1F4WL 3OAUL 5M94B 3QFJB 4HWBH 3T0XA 1NGZA 4BZ1H 4EDXB 3EOBA 5I1EH 3JSSA 3MX0A 5JNYA 4M4RA 3WFCH 2FLBT 3T1FA 3GSUB 1KT2B 4GRWB 3OPZH 3W9EB 3MCKB 4O2EB 4HUUA 3D6GA 1SYVB 5E7FA 1F13A 2QQQA 1N59A 1PZ5B 4Y8DC 1QKZL 1XCTA 8FABA 4I5BA 5EOQL 2VDRL 1KN4L 4JANB 2F54D 3RBSA 1VHPA 5I74B 4XMPL 1JIBA 5DHYB 4ZYKB 1FDLL 4PS4H 3KYOB 2BSTB 2ENSA 1DQJB 3HS0B 3TIDA 1LEIB 1KFAH 3RIAF 1QSFD 5D1XB 2EXYD 4P5TD 4XNYH 5EH1A 1ZANH 3UTSA 5J6HA 3HS0A 3TIDB 1YNLL 4BK4A 5I17A 2IADB 1S9YA 3W2DH 4PY8J 1MNUL 2NY5H 3IU4L 5E1AB 5EOTB 3IDMB 4PR5A 5T5FL 4OLWL 4UILH 1BIHA 1U42A 1X5ZA 3IDNA 3MV7A 2ESVA 4NN7C 4MNQD 4OSUH 3UTPD 4J6RH 4KTDL 4F9PC 1QA9B 2FATH 1LMKA 3CZFB 4DZBB 3NZHH 1A9BB 4UU9B 4ZXBB 1GOGA 2VLMD 4MA7H 3GSRA 1U3YA 5BZDB 1UM4H 1A9BA 1XGTA 1N26A 1DVFD 1QFWI 1CXHA 2X4UB 3UTZB 3DX7B 3ARVA 3K8LA 3FFDB 4XWOD 5CEZH 3O45B 3BD5A 1DVFC 5JW4M 3O9WD 4N8CH 4G8FB 2F53A 4PP1C 1D9KD 4ZG1A 3C09B 4GW5A 4OKVA 1UC6A 1YDPA 2EDBA 4N0CC 3UYRL 2AQ1A 1QRND 2H1PH 4LU5L 2NY6D 5LQBH 4S2SA 4JPIB 3S3JA 1VFAA 1CTNA 1IEAA 4NUJA 2F8XC 1BF8A 4CN1A 3IFOA 2ARJA 1FV1A 4JFHD 4V2BA 3WXWH 4F8TA 4OM0L 4X7TA 2BSRA 2E9WA 1P2CA 3D9AH 2EE2A 2XQBL 2X1XR 1R5IA 1P4IH 4WFED 2BSRB 1P2CB 3U4AA 4BFBD 5E4EC 3EJYD 4L3EE 4MB3A 1EIBA 2R0KL 3WNMA 2P5EE 3QXWA 3TPKA 1I3GH 1JTOA 4F9LA 5EU4B 4NIKB 3HE6B 5FAAA 1OTTC 1YEEL 3R1GH 5IM7A 1WISA 3QNYB 2XFXA 1EERB 4KQ4H 3EW3B 5EUOA 1I1FA 1D6VH 1UWEH 4B0MM 2VC2H 4X80H 5IESL 1EAPB 4JVUA 4NN5B 4WJ5A 3A6CL 4PJXE 5HVWA 4MNGA 5AEAA 1HHGA 4KFZC 1SJVA 2X4PA 3U9PH 3DYPA 1GXEA 3QEQA 1XF2B 2E8YA 1T4KB 1JFQH 5CEYA 2YXMA 1NKRA 4KGJA 4XC1L 5E8PB 3CX5K 5CWSA 2XY1A 1PFCA 3ULVD 4KZEL 3QUMA 4GUPA 1A7QH 4XMKL 1FAKT 4ESKA 2D0FA 5TQ0L 3CD4A 4QRUB 2CDGA 2YRPA 4FTVD 4G5ZH 4IJ3C 3GMRB 5IJKC 4JHAH 1TPXC 4R7NA 4R26L 2DI8A 2OJZH 1ZWIA 3TYGL 5ACMA 4HFWB 1BLNA 1SBBA 1C5BL 1GH7A 2FDBP 3RPIB 1Q9WA 1G9NH 2EEBA 1KPRA 2AJ3A 3RY6A 5IFJA 4KK5D 1KEGL 1JPTH 3ZDZF 1FPTL 4HF5H 4OIBA 1HE7A 4WTWA 1K6QH 4PBXA 3TBWA 4PGJA 2W92A 5IFJB 2JIXB 4BSVA 3BO8A 4ZFOA 5KW9H 2GFBB 3QDJE 3PF2A 5FYKE 5GS1B 2Q6WB 5FM5O 4UDUB 1QEWB 2JJSC 1AH1A 3V5DB 3RWIB 1V7ML 4X5WA 4WW1A 3KPPB 1DANT 3MV9D 1J05A 2ZJSH 4UDUA 3RTQA 3I2CL 2XN9D 5DJYB 5T3XH 4PJGF 1AKJA 3N9GH 4FZ8L 4PGBA 4M61B 3U7YL 4NQCD 4QCIA 3D18A 3GUTA 5J1AA 4QXTA 1QR4A 1EUUA 5ABDE 3VXRE 4PGBB 4P5KA 3B6SA 5HI5C 4M6MH 1KTDB 4GS7C 2QL1A 2VR5A 5HYIA 3QUYD 5DD3L 2Z31B 1A6AB 4MZ3A 4I18C 4XC3L 1BFTA 4YFLI 5FHAH 4XVJL 1OLZA 3ESVF 1MIMH 4OZFH 1NLDH 3GI8L 1YPZA 4JGUA 5TF1L 4EXKA 1DE4B 3H9HB 4FQHA 2FEDC 3MRFB 1CS6A 5DO2C 2EYRA 3LEVL 1MCOL 3ARYA 3QDJA 4QOKE 3O3AB 1KIRA 1IGML 3ARGD 4JRYE 5E6ID 3UBXI 2GJ6D 4P5TA 2C5DC 2F54A 4I5BB 3P2TA 2FD6L 4O2CB 4PJIB 4Y1AD 4WFEE 4UV7H 4RISH 3CK0L 4R97C 4DOHE 3ARGC 4L29A 4ZPTA 1OF2B 3M8OL 3QQ9D 4HWNA 1FO0L 5D2NC 5CBAB 5CZVH 3ARXA 1RK1A 1WCQA 3KXFA 1YA5A 4OV5B 2W0KA 4W4NA 1MCEA 4LLUB 1HNFA 2XKNA 4QHUA 1WV7T 4PJ9A 4HUNB 4PG9A 3M1BA 1VFMA 1X5KA 5L8LB 4YPJA 1YNTB 5DF0A 1WT5A 3PHOB 3I02A 5KN5A 1MUJA 5IOPB 1F4WH 5CEZL 5E8EA 5JXEA 4NZRH 1AO7E 4WO4C 4OGAD 3S3SA 1WFOA 1IMHC 2UYLA 3E2HB 4K3GA 4JY4A 4LF3A 1TTGA 5KSUB 3U7WH 4UU9A 3AB0C 3DJ9A 3MRIA 1JGUL 4YNYB 4C83B 4MMXC 3LN4B 2D7NA 2GSGB 2Y06L 3NA9H 4MXQD 3HMXL 3PWJA 4JLRA 1MRFH 3O4LD 4WHTA 1NCDL 3D9AL 1X6LA 1WZLA 4YPGA 1L9NA 5J3HC 5I66B 1FZOB 3CH1B 5D1XC 3KPMA 5IBUG 4ONHB 1XR8B 5HYSA 4N90D 3MYJA 5LWYH 4APQD 2X89A 3MGAA 5GRJL 1GGUA 1P6FA 3BWUC 1JWMA 1IGYB 4BZYA 4UQ3A 4P46C 3V4PH 1HHHB 4MJ2A 1KCSH 5B38B 5GGTH 2HG5B 3BZ4B 3VXPB 2VC2L 3ZT7A 4P57B 2MCPH 3SDCA 3TV3L 4XNYL 3PWLA 5DMIH 1ZHLA 3CVHB 4G8EA 3ZT6A 2QQLL 5IB3A 2AK4A 3BZ4A 3FRPA 4WEBH 3TJEH 3WS6A 1CDJA 2EIZA 3U1SH 1FG2A 5GGRY 5ESQA 1CLYH 5ENWA 3UX9B 3ZTJG 3C6LC 1MH5B 5BZWA 1G9ML 5HHOB 4GJTB 3FTGA 4X6DB 5FO9A 5GQBA 5C9KA 5ESQB 5ENWB 4OZIB 2FX9L 5EG6C 1IAIM 3P9MB 1JZ5A 3MGOB 1A6VH 4KMTL 3L7EB 3C5JA 1VKXA 2BY3A 2X4RB 3CLEL 1S7UA 4U6YB 3SCMA 3U7AA 5C6TL 1NC4B 4PJHE 4IRSB 3U46A 5EU7C 4U1HB 2QQKL 5BO1L 5MENA 4NJAH 4MNGB 2G9HB 5L2JB 2AAVA 5BV7B 5EFIA 4Z7WB 2X5PA 4K9EL 1T0NA 2CGRH 4DZ8A 4G8IB 1RK0A 1OM3L 4F7TB 2VZSA 4WRLA 4YK4C 3DHJA 5CEZD 1MCBA 1TLKA 4LEXH 2ED8A 3UTOA 4I2XB 1SBSH 4JFYA 3WHXA 3IDYB 1A6ZB 1BAFL 1KENL 4ZOBA 1B4RA 3OR6B 3N1GC 2DM4A 3WD5L 2IGFL 2XPGA 4F15C 3EYOA 4LAJH 1OGTB 1WTLA 4JRXB 2CRZA 1XGRA 5C09E 4HXBH 3ZE0F 4DN3H 3NFPB 4R4BA 4X6DF 4JDVA 2QKIB 3WEXA 3VA2C 5JOPD 4P23C 3SE3C 4CVZB 4ZS7H 2NX5B 1BGXL 4LVHB 2DN7A 4TNVF 4NQDB 3DUUB 4WWKC 2LAAA 3LKOA 4XZUB 3FJTA 3OAZH 3CFBA 4Z7UF 4B7IA 1IEBA 3AS3A 1HSBA 3EOTH 4N8VG 1ZHNA 2CRYA 4Z9KB 1RFDH 2XV6B 4MA8L 4MA3B 5KANI 3I75B 3WN5A 4IBLT 4PRIA 4JG0L 3G08A 3O6FC 3U9UA 5H35B 1AO7D 1WIPA 4NBZB 4R26H 3FT3A 1QYGH 4XX1E 4AENA 4WI3A 2EE3A 4JFQA 4QCIB 3D18B 2YD4A 3SDYH 3GUTB 5EPMA 5C0CD 4R3SA 5H35A 3T0DA 1KBGL 4IDJL 5DFTA 1XF5A 4YDIL 4JFQB 4LSUL 2Y1VA 4ZQKB 3SGJC 4R96A 4Y5YA 3MJ8A 5FYJD 4MJ5B 5AD0A 4UT6L 4F8QA 1XAUA 3MNZA 1TXKA 5L88L 4QRSB 1DLFH 3E8UH 2VIRB 5FYKH 4MWFB 4KTYA 1CXLA 3GBML 2RR3A 4JKWA 1A1NA 1NMCB 3TT1L 3PP4H 1AXTL 1P5UA 4YQXH 4MWFA 1MVFA 4BQ8A 2SEBA 3LQAL 1N3NA 1VEPA 5F93C 1MFEL 3NIDE 4NO3B 5I8EA 5T3XL 3SDXF 2X05A 4Z7UB 1T7VA 4HWEH 3IXAA 4HX1B 1O0VA 1TVBB 1IGFL 4U0RB 4NHUB 1IC5H 1JWSA 5D6CB 4NNXB 4DUVA 3BKJL 3F12A 3SO5A 3MRQB 1D5IL 12E8H 3QPQC 2VAAB 3G6DH 1RIUH 1KJ2A 1MFNA 4PP1D 4YXHL 1BJ8A 3G5YB 3MRQA 1FFNB 3A0OA 1CFVL 5FV2A 1NAKH 1OGAD 4OLXH 2YA0A 5C0BA 5I30L 5EN2B 3I9GH 1B3JA 5LGJB 4FNLL 4GAGL 4K7PH 5DD0L 4YWGL 5INCA 4J3UA 15C8H 5DHXB 4JZOA 3RTQC 4NHCL 4I4WA 5C07D 1EEYA 1FFRA 4X8JA 2BJML 3O8XA 1MFCH 4L1HA 1NUFA 1OP3K 3QUXB 3SDDA 1ONQA 2BVPA 1ZA6A 1G9NC 1CD0A 2GK0A 2Z35A 1BF2A 4KMQA 2NXZB 4JFFD 4JKPH 5B4MD 1JYVA 3GHBL 1P6AB 5D1ZC 2AP2A 4XNMB 1HIMH 1A22B 1WC7B 4OAWB 4XPFH 5DRWB 1RHHA 1HK6A 3E6FA 2DDQH 1B0GB 1YEIL 1MWAL 4U1MB 4I0PB 3NZ8A 5A16B 4HJJL 4OAWA 1NLDL 3GI8H 1CGUA 1ZT1B 3ALWA 1FORH 2QR0A 5DJ6B 4U1MA 3LRHA 3NZ8B 3C6LB 1P7QD 1ES0B 1G0DA 3ELAT 3WSQL 5D1XD 1LO4L 2EDXA 3GIVB 3MRLB 2AJSH 4X0KA 2IAMD 4JM4L 4APQC 3FQUB 2ICEA 1A1MA 3I6LE 5KS9E 3HI1A 1JWMB 2P47B 3O3DA 4PRBB 2CXKA 2WWMD 3P77B 2NY0B 2NMSA 1V7NH 2HT2C 1FO0H 1KXQE 2C1OB 3BMWA 3QZWB 4JFXB 1I1AA 4MHHI 1K8IA 2BC4A 5HHNB 4MNQB 3VXPA 1YEHL 4MJID 4OJFL 4KDTA 3TN0A 1K3IA 3T8XB 1NC2A 1ZV5A 4N1CA 2IQ9L 5EBMA 5HI4D 4GRLB 5E7BA 5DRXA 1GGIH 1PLGH 1QFHA 2FH6A 3BKCL 1GJIA 2R8SH 3UTQB 4U1NB 3VXUE 2V9TA 3GSNL 5L0QB 1XR9B 1KTKE 2X40A 3B43A 4QT5A 2DMCA 5MI0C 4PRHA 1I85A 3PL6C 3SPVB 4ZSOA 2P7TA 5KSVA 2AKRB 4IIQA 4PRAA 1TENA 1WCBB 2FJHA 4JY5L 2BCKB 4H88L 3SPVA 5DURD 5KVDL 3QDMD 1MLBA 2H41A 4PV9B 1BJMA 3S5LG 4DVBB 3FAWA 1V5JA 2ED7A 2Z9TA 2JJTA 1G7LB 3O3BA 5DMGD 2H3NB 2YK1L 2VITB 2J2ZA 5D7SL 4X5LA 1K2DB 3CFCL 5LGHH 1U95A 3SDDC 4JY6A 1XF4B 3O6FB 1W8OA 4WW1B 2R2BA 5FKAA 2VLJE 1I9EA 4Z8FH 3G6JE 4HS6B 1CD9B 3DETD 1JI2A 1A6WL 4M6NH 1WWBX 2FBJL 4JRYB 4LPYA 5JW5B 3VXMA 4WNQB 3QEUA 5C0AD 1S8DB 3SO3C 2EDEA 4QF1A 1Q8MA 3VXTA 3M17A 4JG0H 5H94B 1X5XA 4CRPA 4MVBC 4QXTB 3JUZA 4R4BB 3EOAB 5BW7A 3PQYB 5CIPA 4KY1H 4WNQA 2CD0A 3ARED 2OTWB 4HIIA 4OD3L 4CVZA 4V1DA 2MQ3A 3HAEA 1F6LL 3I84A 3O8XC 4E41E 4XZUA 5HYFA 2MPAL 5JZ7C 1GIGH 2OCFD 5KZCD 4NKOB 4V1DB 1C12B 4LPVA 5KVFL 1DQLH 3MLYL 2OR9L 3PWUB 5JMRA 3I85A 1CT8A 3IB4A 4PGDB 3VA6A 2X42A 1FDLH 3H9HA 5E8NB 1EK3A 4M7LL 1NGXA 2GAZB 1N64H 2X70B 3TPUB 9CGTA 5F97E 1HI6B 1AD0A 5F1NA 3GSVA 4QHLA 1MJUL 2FZ3B 2IBZY 3DMMC 1AXSA 3F7YA 1NGXB 2CUIA 2BSSB 2GAZA 1FE8H 3C08L 1NCCL 4OZHA 1KIRB 3RL2B 5I1AB 5DJDB 1I3GL 5EO9B 4JQIL 1DBBL 4I0KA 1SQ2N 2DQHH 4Y2DB 5JOPE 4YC2C 1QLFB 4TVPE 4RGOH 1AHWC 3ROLA 5DD6B 4XP1L 1MHHA 2Q7YB 3LOWA 3NZHL 4PJCB 1DUYA 4DK6A 4KK6D 5HY9B 2RCSL 5GGUA 4JDZA 3OF6A 4KKLC 1CR9H 5D9SA 5CCKL 5J12B 3X3FH 4PJCA 1FNGB 4U1JA 1CFVH 5EOTA 2AEPH 3D3VD 3DURA 4OLVL 3R8QA 4RGNB 4HSQA 1I1AD 4M1DL 3REWA 1S9WB 4M43L 2IPUG 3T2NL 2WIIA 3GSRB 4YO0B 2H26A 1OTSD 5KVMC 4PJ7A 4PRHE 4OZFB 3CLFH 1A7OL 5SWSE 4LSUH 2VDKH 3DX7A 4JG1L 4YNYA 4C83A 1IZKA 4MA8H 3G5YA 1Q72H 4AL8H 3RNKB 5JPNB 2IAND 2GJ6A 4RDQF 3G5ZA 2AV7A 2CUMA 3LY6A 5E6ZA 4GW5B 3UPAA 1U8NB 1WAAE 3MUHL 3CX5J 2CLZB 4I4WB 1EEYB 4N0CD 2CK0H 5TF0A 1LE9B 3GMQA 1AJ7H 1F3JB 3UCRA 5FKPA 4MB5A 3SE9L 4K8RC 4F33A 1QLEH 1NAMB 1MFEH 2JJWA 4KI5E 2NX5D 3AAZB 3DX6A 4XNMA 5H2BB 4ZFFA 3RKPA 1ETZB 3P0VH 3NPSB 2NY1D 3F58L 1MF2H 1UWEL 1IC1A 2OR8A 2YSSB 1I8LA 3ULVF 4KUZH 1DBKH 3DRQA 3A6CH 4M5YH 4LKXB 1A6UL 1DQML 1NAKL 4OLXL 4ZFZA 2EECA 3MMEB 2I27N 4OJFH 4EN3B 5HHOD 4CNIB 6FABL 1LD9A 1H9VA 3K0WA 4QRPE 4P3CH 1YMME 5TDOB 1CFSB 4O9HH 3QEHB 3IF1A 2IANB 4EI5C 2OP4L 5DYOB 3RWFB 5D71H 5FV1L 4TRPH 1YYMH 2R1XA 2BERA 5CGMA 2A9NL 2C1OA 2ADFH 3EYUL 4L4VB 4PJFB 1LK2A 4Q6IA 3ZO0A 4G42A 4FQQA 3LDBC 5FOBA 4LVOB 4HJJH 2NY4B 1KXTB 3MV7E 1UXSA 1Y6MR 3KLSA 5GZND 4NOFA 1GOHA 4ZOEA 3L3IB 4C56B 3QNZA 2AJSL 4PV8B 3MLXH 4LLWA 5D7SH 2ICWJ 1ZEAL 1XCTB 4O51A 2PF6A 4Y2DD 3RFZC 2BXYA 3HRZA 2VISB 3P3YA 1KLUB 5TE6L 4GKZA 5J56B 1BVKB 2P43B 1JUFA 4OCRL 3DUSB 1RUQH 3D69A 4ZUVB 3CIQA 3VFGH 2UVEA 4UTAL 3PGCB 1F4XH 5J6HB 4OI7A 1XGPB 5SWZB 5GHWL 5IMOA 3QXDB 3VFSA 2GITB 1MJ8L 4R4ND 3ILPB 5FYJE 4OD1H 2UZYB 1U8KB 3TA3A 5MEQA 3HC3L 4JY6B 1DQDH 3T65A 4WFGE 3C60B 2B5IC 3Q6FB 5FUZH 2J8UE 1N6QL 2R2CA 1T1WB 4J4PA 1QRKA 4NRYA 4F57H 1QFWH 4Z7VA 4LMQI 5KVFH 2Y7QB 5E9DB 3RWGB 3UJIH 1CFQB 1QQDA 1BBDL 4S0SD 3LEXA 3MRNB 3FAXA 2EDLA 4D0BA 1OY3B 4MD0B 5DGQA 3AREB 5JQ6H 1NSNH 2D7OA 4JY5H 1M7IA 3O0RL 3LEXB 1DN2A 3VI4F 2FO4A 3RJDA 2VXVH 4R0LC 1S7SA 4CVXA 4UTBH 1O7VA 4J3XA 3CGTA 4U1GC 4JJ5A 1UB6B 3ZDYE 4CU7A 3FFCB 2VXTL 5ILTL 3REVB 3KXFE 3MYZA 3KPTA 4MHHG 5HSFA 4QNPE 4ONFL 1OSZA 3VRJA 1PVHA 4BFIB 1VFAB 1IEAB 1PX3A 4OV6F 3REVA 1OAUL 1MCLA 1AI1L 1BVLA 3C2AH 2D03H 3Q1SH 2IBGA 4XCYA 3ILQD 4Z7OF 3DSFL 5IVOA 4J8RA 3VG0H 1N2RA 5A2LH 5I1GH 5I1HH 4LLQB 2BNRA 4PJAA 4FXGA 3CFJA 5D93B 3D2UB 4KRLB 2IH3B 2VN7A 1ZGLP 4DKFH 5DD5L 1T83A 4LEOA 2PTTB 3QIBA 3CC5A 4NPYB 2ZKHL 3D2UA 5IBLC 2XZQL 4N0UA 1IQDA 3ZTJH 1BZQK 4KVCH 5IHZA 1FFNA 2ERJB 3QNYA 1S7WA 1U8MB 4H20L 2DKUA 2R2EB 5J9PB 4O00A 1ZT4B 3RNQB 1S5IH 4BZ2L 1A4KB 4H1LA 2VE6A 1I3VA 4M7LH 4RRPA 4FQXB 1REIA 2Y36H 4KHTH 3EJZD 4QXGL 4OD3H 4QRRB 1QSFA 3JWDC 4RX4A 3CPLB 4L8DB 2C3HA 1LWRA 1U8QB 2Y6SC 1I1YA 4P2RA 4U1LA 5IFAH 1UJTA 5L9DL 2G75B 3VXME 4ZOCA 2GT9A 1GIGL 1KELL 4G6MH 3QDHA 1X6NA 2WUCH 3LQAC 3WDJA 3KLDA 5IMLB 4D9QE 5DRWA 2DWDB 4OLEA 3JWNC 3BPNC 2A6DA 2GT9B 4NQCB 3FCTA 2YPVL 3P11H 1ZGLB 1AY1L 1KOAA 5HXMA 4XCCL 2E3VA 3ULUL 5HHPB 3CXHK 5HHQA 5DJCB 3K74B 3RPIA 1UCBL 3MR9B 5TE7L 2BHYA 5B3JF 5J12C 3NCEB 3L1OH 2D31A 1CD8A 5IB5A 1JHTB 5C0DA 5IW6B 1ZTXL 3U36B 3ZKNC 3PNWA 1KTRL 3MR9A 1LDSA 5C0JA 1G7PA 3BPLC 3VGEA 5FK9B 3O4OC 4Q9RL 5CINL 5DQDH 3QFDB 3TH2T 1XH3A 4G9FB 4X7SL 1B2WL 3CLFL 4AIXA 4YFLF 5C6TH 1T03H 4Z78B 5DMGC 3OSKA 3QUXC 3BW9B 3RVXD 1TZGL 4LCUB 1ROWA 3CDFA 4EN3A 3SDXB 1OP9A 5IB1A 1KJVB 3DXAE 3ARZA 4TQEL 4FQJH 3J8F7 4HIHB 2JJVA 4UNVA 1A7BA 3H0TA 4XT1C 4WV1A 3LKNB 4U05A 4MJ4A 2MJWA 3MJ7A 2C3VA 4ZAKA 3PL6D 4AEFA 4QHKI 1IQWH 5IVXA 4JG1H 1T2QL 5HPMA 3KPNB 4Z7QE 4MXWL 4F3FA 3P30H 3V4UH 2DQCL 5KANG 3VXSD 1AXTH 4Q6IB 3GSXB 1KB5H 3BP4A 3O6LL 4I2XA 4JFYB 1T3FA 4HT1L 1H0DA 1FZMB 3UC0H 4Z7NF 4KDWA 1JPSL 1T20A 4OLYH 5LBSL 4ALAL 2P8MB 1I3RA 3OAYH 1RZ7H 4FQHB 5ADOH 1IFHL 2FIRT 2DQDL 1YN6B 1J1XH 2FNBA 1P7KB 3FHAA 2HLAA 2CDFB 4RZCB 1R3LA 3V52H 4ZO6A 4ELKB 4M5ZH 1P69B 2ZZUT 3IDIB 1KJMB 2JTDA 1FNFA 4JPVH 1MCNA 2HTKC 1ORQA 4AG4H 3EO1A 5ETUA 5AWNL 4PRPE 1EFQA 1JGDB 4YHKH 3SKJL 2DMKA 2R56L 5DSCA 4JZNA 1CIDA 2N1KA 1X5IA 2E9JA 3LKSB 4PS4L 3GO1H 4PD4J 4YDVB 2VLLA 3PL6B 1J0HA 2DBJA 4WVRA 3WIHA 1J1PL 4LVOC 5E08H 4QWWC 3G08B 2WZPD 1FNEA 1NBVH 3I02B 1GL4B 1H3VA 3C60A 4YDVA 2VDML 5HGHA 2IG2L 5A40E 1UZ8B 1CVRA 3WKML 3KHOA 4OD2B 5SWZD 3QCUL 3GBMH 1HI6A 1O7SA 1MCQA 3MJGX 3VXMD 4M7JH 3S37H 1VGEH 4AEEA 3DMMD 3HNSL 3MUZ1 4O4YL 4XXDA 1GSMA 4PLJC 3AS1A 4JLRB 4G9FD 4RFEB 1TTUA 3EYVB 1VGKB 1ZLSH 1V3MA 3BVNB 3T3ME 3D0LB 1IC5L 4PREA 3EFFA 2OTUB 3HLAA 4PJAE 1FC2D 3T2OA 5IK3B 2ARJB 2JCCE 4K23L 3MRMA 1IGYA 3QWRA 2WLYA 1IEHA 3BWAA 3G6JA 4U1JB 4GXUM 4PYGA 2A1WL 1FVCB 4P4KD 5E5MB 4PTUA 4LAQL 2H1PL 1CLOH 1TZIB 4LU5H 4WI6A 3TWCH 5F8RC 5ID0B 5I15H 1E0OB 1BBDH 15C8L 4P57A 4ZS6D 4CDGC 2VZ1A 2E6QA 3UMTA 5IQ9A 1BQHB 5IB3B 3MOBH 3P4MA 3SGKA 3IT8D 2CLVA 3WFBL 3ARFA 3NH7H 2CIKA 2ZPKL 3HG1B 5CMAB 1MHPL 1NC4D 2CDEA 4Y88A 1S78D 2GEEA 1MFDH 5LVEA 4H25A 5D6DA 3RWEA 5F6IB 1S7WB 1U8MA 4OZIA 3MBEA 1G84A 5K33A 1I8MA 1FGNL 5DVNA 4M1CD 5IWLC 1MWAH 1QLRB 1S7UB 3O3EB 3ZKND 5F7DA 3OKYA 4I3SH 3X17A 1OARL 5L2JA 1NKOA 1JNLH 4FQXA 2DLFL 1WGOA 1I7ZB 1F11B 4P9HC 1R3IL 5TGBA 5CP3A 2J7LA 1U8QA 1GC1H 4POUB 4HJGA 1T2XA 4FFZL 3DTXB 3QRGH 4FG6D 3AM8C 1EPFA 3VWJA 3F7VB 1FIEA 1UCTA 2BVEA 4N9GA 5T5FH 5TDNB 5DK0A 4LP5A 3BQUB 4QRPB 3I3EA 1M7DB 3IJSA 4OSUL 5IHBA 2FGWL 2XXCB 1KPRB 2IJ0C 2VAJA 1B2WH 2XPGB 1A02N 1AQKL 2IAMC 2OZ4A 2ICES 1AI1H 3TZVB 4ZTPH 2Q1EA 3L5IA 1J0JA 2OJZL 2X6MA 2AI0L 3ZSSA 4D3CH 1C08B 2IANA 3NFPA 5LXGL 3JWOH 2OJEB 2B2XL 1RUPL 4MNQA 4MQ7A 3STBA 4PLKC 4A6YB 2MPAH 1D3CA 3BZFA 4B41A 1P84K 5JXAH 3U0WH 3KPPA 3BOVA 5K9OB 3CFBB 4YFDB 1T2QH 5HPOA 2AEWA 3MJ9L 1E28B 1IC7L 4HHAA 2Q86B 4EDXA 2FECL 3DGGB 1T5XB 5CEZE 4LLDA 4MNQE 1NMBH 2H2SC 4C56D 3C08H 5EC2B 2OL3H 2FX7H 3BEWB 4Y16C 1BX2B 3T3PE 3MRBA 3D39E 4NNPL 3IKCA 1BQLH 3QJFB 1XGYH 2VDNH 2JF1A 3FN0H 3IS1X 3LEYH 5T3XE 4Q9QH 1TJGL 4NC2B 1K5NB 3RGVC 1IM3A 3DO7A 4O51B 3BKML 2XA8H 4I13B 4YZFE 1NEUA 1F58L 1F02I 2WV3A 2YS4A 4NQTA 3W0WE 3TCLA 3P11L 1TJHL 2MSPA 4KZDL 5DJ0B 1NCWH 4LLYB 2X4QA 3BP4B 4E0RA 4PY7B 1OP5H 1MRDL 5GGTA 5I75B 2AJZA 3K3QA 1ED3B 4CBPA 2X4QB 2HT3D 2R2BB 1TZGH 3P73A 3B9AA 3IDMA 5FKAB 3U9PL 3ILPA 4TPRH 3DSNA 1L6ZA 3KPRE 4C54A 4KJQD 1LNUB 1HKLL 4M1GL 4DQOH 4ELKA 3V9FA 1TVBA 3E0GA 4OB5L 4KC3B 1J1PH 5E08L 2MNUA 4W4OC 5C1MB 1Z5LB 2A74B 1IKNC 3NGBC 1CG9B 3SJVB 43C9A 4NQEB 4HC1L 3B5TA 4IHOA 2X4UA 3UTZA 4MD0A 5DLMH 1KXVC 2HWZH 2P49B 1DUZA 1U92A 4J2XA 4I9WD 5D7IF 5KBNC 4TUKL 4WWKB 3ECBA 1GCFA 4JRYD 3BN3B 3H9ZA 3FN9A 3LVEA 2VWEC 5D7LE 4Z7NE 1KF9B 3VW3H 1FPTH 3ECBB 4HBCH 3HNVH 4X6DE 2C3XA 3G5XB 3OZ9L 1PYWA 4LVHC 3ARUA 2EYTB 3VGAB 1IFHH 1Q94A 4P4RB 3U0TA 5D6DC 3PXHA 4CN4A 5F7KC 2FEEL 3IYLW 4OD2A 5EORL 2EYTA 2NY7L 2R0WH 2V2WB 2AGJL 4FQPA 3MCLH 1QZ1A 1K85A 2XWTB 5DT1H 5MEPB 2BZDA 1HHJA 3O6LH 2HVKB 2VRAA 5IVZB 3L5HA 3VFMA 1D7FA 3ZL4L 1WWWX 1GAFL 3L3KA 1OQXA 6FABH 4XC3H 4QXWA 3GSOA 1NFIB 3CFIC 3T2NH 4GG8B 5I71C 4XAWL 4X98B 4OZHE 1KIPB 2EDDA 1TCRA 1JF1A 1HKFA 3P9LB 1UJ3B 5DI8B 5DMKB 3NCJL 1DTUA 2ADFL 5JLZB 1LK3L 4KH2A 1TNNA 2FJFA 5E2JA 1Q0YH 3A67H 2QSQA 1BQSA 3QH3B 2WQRA 5FYLL 5ESAA 1KCSL 4MSWB 2OMBA 3QWQB 4N90E 3BAEL 3QH3A 3TVMB 4TSAH 3MROA 4K3DL 3DLQR 1FNLA 5KOVC 4GRLA 5JPMA 1DQTA 1MCJA 4QO1A 4NC0B 2A6JB 5GGSA 1RJZB 3ZYIA 3PDOA 4NP4L 4H25B 2XN9E 3AM8A 5IBTH 2QHRH 1BLNB 1JMZA 4N1EA 4HUWB 4JZJA 2IAMB 3ZHKA 4Y5XC 4H5SA 3WS3B 3F58H 3H9YA 2JJSA 4GKSA 1QBAA 1DBKL 5DJCA 5EFIB 1OAZH 3VXRD 4QYOB 1SJHA 4M7JL 4K23H 4IIQB 4PRAB 5CZVL 4H5SB 3WS3A 5D70L 4J12A 3C9NA 5DJ8A 4AMKL 4KDTC 3MNVB 5J13B 4ODBD 4QYOA 4ZFOB 1JPFA 4NUGH 3N1PC 4OI9A 3SKUD 5C0JB 4YBLC 5BVJA 4WGWB 1XZ0A 5D1ZA 4QKXB 5IF0B 4YXLH 1BZ7B 4PJ5D 1A6PA 4D3CL 2YD3A 4WWID 4K9EH 1JI1A 4G6FB 3JBG7 4PJ5B 1MAJA 5BS0A 4LARL 5D1ZB 5D71L 1FFPB 5DMYA 5IFHH 4QRPA 1FVEB 4UOW1 4UIKL 5SX4I 1UENA 1LD9B 2APVA 3OKDB 3QO1B 1HEZA 1SBSL 5I73C 1D9KB 4HS6A 5JHDA 4OF0A 3H2WA 4XVSH 2DM7A 2ZCKL 4MXVE 5E8DH 2VLKB 1IC7H 4QF1B 3B5HA 4RRPG 1T1YB 3VE0A 1CGXA 1H5BA 1L0XA 1LHZA 5GGQH 1DVFB 2VLKA 3CDGA 5KG9B 5T1KA 5F7HA 3VFNA 2PO6D 1MFBH 4L4VA 1F8TH 4KVNH 3TV3H 5HYSG 2FX7L 3S4SB 3VWKB 3KPSD 1QG3A 3KYMA 5FF6A 2EC8A 1M05A 5BVPL 2B1HL 2AEIT 1C12A 5JIKA 1FGNH 2I07B 3QDME 3K46A 1IC4H 1VPOH 4M8VA 4OQTA 4P9ML 1JHKH 5T1LA 5FUCE 4C56A 3H7BB 4KPHL 3WJJA 3BESR 4KMTH 3FQWA 1J8KA 5I1HL 1TVHA 3QYCA 4YAQB 4APQA 1BX2A 2P8LA 4YDLC 2I5YH 1BM3H 2Q7NA 1KJMA 3MNZB 3ZE2F 5EO9A 2XZQH 5L8KB 32C2B 3O2VL 3O4LE 3OKOB 5I8OH 1NBYB 1OD9A 4Z0BL 4IRJD 5C0FB 5C0RH 2IMNA 1G6RL 1DBJH 4C59B 1I8KA 2D0HA 4BH8B 4YGVA 3ZLQC 1JN6A 4GAJH 4PLNC 3GKZA 5D9SB 1MI5A 1NSNL 1OWWA 4KI5C 4KMLB 4DZBA 5SWQB 3IDJA 5EZJB 3O0RH 4YE4L 1S9VA 4PJIF 4NNXA 5MHSD 5HHMD 3X12B 3JWOL 3WFDL 4G6KL 5I1CL 1CGWA 1UYWL 3LPFA 1FYHB 4JREB 4Z95H 3L5WA 1R5VA 3TNNB 4J3OC 4YDKH 2EIBA 4Y16B 3JTTA 3AREA 3SGEI 4M4PA 3CZFA 3INUH 3D25A 4GRLD 43C9B 1HH9A 3OXSB 3QT2A 2YC1A 4NQUA 4I77H 1CGSL 3GMOB 1V3KA 3HI6H 4WY7L 1FFQA 4PLJD 5FFLA 2H6PA 2AXFA 4N0UE 3IXTA 3BRFA 3CH1A 4JJ5B 4PJXB 4Y1AE 3EOTL 1MFAH 3GNML 3KWWB 4WU7A 2OL3A 3O45A 4KKLD 3QAZC 5FGBA 5BOPA 3TESA 4Q2ZB 4NNPH 1BQLL 3B8SA 5DD5H 5FXCH 3OBAA 3K4AA 5F88A 5ISZA 5J0BA 5GPRA 4M6OL 1UM5L 3BKMH 1H5BC 2I24N 5H2BA 4YDIH 4M9PA 1QHPA 5F88B 1X9QA 3O6ML 4LOUD 1JWUB 4YXKH 1FV1B 1ZT1A 1NCWL 1N7ML 4GMSL 4Y19E 5HGGS 3P4LA 5JORB 6CGTA 2EH8H 4WUUB 2APBA 5GS0C 5KVGH 5EZOL 2GTWA 1SMAA 4GW4B 3U82B 1CDYA 3VFVA 1AGCA 1PG7L 3LQZB 3FQUA 1NFIA 3L3DB 4K07A 2EICA 3UBXB 1C5CL 3IJYB 4DAGH 4LCWE 4LBEB 3QIUD 3MGOA 1M71B 3P77A 1EJOH 1I9RH 3BI9X 5TDOA 1CFSA 1IQWL 3UBXA 5ESVB 2HKFH 4YHIB 4L4JA 5BXFB 3S36H 3VGAC 4Z7WA 4LGPB 5TFSH 1I8LC 3T8XA 2Y6SD 3VD5A 5BXFA 4WTZG 3HPLB 4MQXD 2K7QA 2JCCA 5E99H 1MCSA 1NCBH 2KDGA 4LSQH 2DWDA 1NMAH 3WHXB 4AMKH 4HJGB 1OD7A 1FBIL 3VCLA 1EHLL 4GG6A 1IBGH 4Y4FD 1HYSC 5CEXB 5DR5H 4PJHF 4K7PL 4Y4KA 5GZNC 3OL2A 3F7VA 2Q8AL 1EO8L 4TSBL 4YHYB 5K9JH 5FCUH 3VCLB 3KPRA 2WBWB 2R29H 3O6KL 1RQ5A 2X89D 5C0CE 1EAJA 3VI4E 3QNZB 4PV8A 2HLFC 3MV7D 3DPBA 1FIGH 5ANMA 4KV5E 3OXRB 5CJBA 4H0GA 4JDVB 4ZUTB 3T2QA 1WFNA 3MV8E 5L2KA 2CJUH 3BIBX 4QRPD 3RGVD 5JA9A 5DD0H 3QFDA 4YGAB 1F3DJ 2VITA 4JQVC 5IF0A 4NHCH 3T04D 2PR4L 5L2KB 4XPHL 1IGCH 1H8NA 2AXGB 3MRDA 1ZHNB 3CJJA 1S7XB 2NNAA 5EO0B 5TPWH 5DUMH 1KIQA 4S1RH 1KNOB 1KJ2H 1ZOXA 4EXPX 1U8LB 4O02H 1RZJC 2HA1A 5MHSE 1KNOA 4AENB 3HC0B 4EI6A 4R90L 3A67L 2PXYD 4XBEL 3GZKA 3M17B 4ERSH 3I3BA 4G6JH 4KV5F 5C3TA 1P1ZA 3LKNA 1CGTA 5BCAA 4RMRA 4HT1H 5EC2A 3DVNA 1E6JH 3V79C 4LLVB 4WW2C 1AHWA 2HN7B 4J6RL 4KTDH 4H1LH 5F1SA 4JM2B 5F71A 5FEBA 1U41A 2Y5TB 4Z6AT 2EXYC 4P5TC 4QRSA 1IM3B 1CZ8L 4OIIL 3SBWC 2BNQD 1IVLA 1YECH 4M5ZL 4YXLL 1NCTA 1BM3L 1YUHA 3RWJB 1L0QA 1IL1A 2JB6B 4HZAA 2XOTA 4HWBL 1UXWA 1Z3GH 5FIEA 2Y25A 1TZHA 4PJEB 5D70H 4UIKH 2QSCH 5IEHA 4IS6B 1JPGB 1JRHI 4JKKA 4ZPTB 1FAIL 3RWCB 1PKQE 3F12B 2XTJB 2ZCKH 3O11B 3FN3A 3MA7B 1NGQL 4X6BB 2VL5B 1RUKH 5HDBF 1MFDL 3KDMB 2LABA 1AGDA 4PJ9B 2LE9A 2RGSA 4JZNB 1BMGA 1A3LH 4ZFGH 3KGRA 3PWNA 2DYPA 5E5UB 1NBZA 3UTSB 3HZMA 1QRNA 4OV5A 2A0LD 3ZE0E 5E94A 2EE9A 5AYUL 3CFCH 5CJOH 1EBAA 3HR5B 5MERA 3VI3E 4BUGA 3FQRB 4F7PA 1MVUA 5KSUA 4PR5B 2R0ZL 4HGKC 1ACYH 2YRLA 1YNTA 3ZTNH 2P5WB 4I18A 2FBJH 3NCCB 5HGDA 4EZMA 3CU1A 4HH9B 4MA7L 3V4VL 1KB5A 4Y16A 1GPOH 3K81A 3ZYJA 4M1DH 1B0GA 3CMGA 3MV9A 2HFGH 4N68A 1AR1C 1F5WA 3KPMB 3QXVA 3VJ6B 1NMCC 1EJ6A 3LN4A 2RIKA 4WI7A 1Z9MA 4CMMA 2A1WH 1IGTA 3L6FB 1F4HA 3O6MH 1EEUA 4G8FA 4NM8L 2MKWA 4ZTPL 5EU6E 1TIUA 1DBJL 4WU7B 4NRXA 1FZOA 2EKSB 1T6WA 4NKIL 4P9HH 1UEYA 1WZ1H 1X5HA 1TVDA 4GQPH 1FL6B 3ARBC 5GRUH 4JPIA 3LSOB 1KCRL 1BFVL 4ZFFB 4DFHA 5KSAB 4G6KH 5I1CH 1L6XA 2AVGA 4ZS6C 4FZEL 3L3HB 2VUYA 1MLCB 1A0QH 3MLYH 1NC2B 4E41B 3ULUE 2XKUA 1DBBH 4HIXH 3GRWH 4GS7B 1PGRB 3PWLB 3LKPB 4MJ6B 5C0BD 5JHLH 5DC4B 1MF2L 3BW9A 1MCIA 3G9AB 2X4RA 4MAYB 3AXLA 43CAB 3U0PB 2VLJD 4EOWL 3TYFA 4KQ4L 7CGTA 4QRQB 3IJYA 4Y1AA 3VWJD 5DJAB 3SGKC 2Z4QA 2EDWA 1S7TB 4JJHA 1B88A 1ZHKA 5D2LB 4RGNE 4ZDHB 2BNRD 3CCHB 4PYHA 1VFUA 4OLVH 3U83A 1EFXD 3KJ4B 1BD2D 5T1MA 2FJHB 3U30C 2DQHL 2FHBA 1CLZH 1UWXH 1E4XL 2DICA 3HUJB 3EDFA 3T09A 2R0LL 3QR2A 4U1HA 3UTTE 3W5MA 1MQKL 4F3FB 3I6LD 5KZCB 1A7OH 3H8NA 4M6ML 4WDIB 4PGCA 4RFOH 1U6AH 2NZIA 2DQIL 1UKSA 5TH2B 1NH6A 5FDWA 3DVGA 1IARB 1QBMH 4BQ6A 1HQ4B 2E9IA 5KVGL 3GJFB 2XWJB 3H9SD 2YD6A 3NABL 4LLWB 4K7FA 4I48A 2YD8A 1L0YA 1T1ZA 4FQ2H 1HQ4A 5DEFB 4RMWA 4IMKA 4XMLL 3BXNA 1DN0A 1I9RL 1T1ZB 2OM5A 3O4LA 4PJEF 4L3CA 1A8JH 4MNHA 1B90A 3PJSA 5I1JH 3IDXH 2OTWA 3QUYC 1XGRB 4A6YA 3RVTC 2DQGL 4PJHB 4I1NB 2E6PA 5F7LB 1DJSA 3DX8B 2O5ZH 5E2VH 3WEXB 1HXMA 3EYFA 4R4FH 4DAGL 3U9UB 1QEWA 3MV11 2DLEA 4G80B 1OW0C 1MIEL 3Q6FA 1M05B 4YHZH 4CADA 3SDAA 2UV3A 3KPQB 3D39D 3EYFB 3GMLA 4JAMA 1HSBB 4LDEB 5T3XD 5DVOA 3Q6GH 5HI3D 3TGXA 1PBYA 3AUVA 1F58H 1ORSB 3GMPB 3PDDA 4BZ1L 3GSVB 3MRNA 3QCTH 3H7BA 5IG7A 1JGVL 3OPZL 4YR6A 3V8CA 2A83A 5IUSA 1B0RB 4WU5B 1NLBH 5JIPA 3RWHA 2VIRA 5BRZB 4PJBF 3RI5F 4PJIE 4KK9C 3DO3A 4RFEA 1DQQB 1QR1A 2YPKA 4YUEH 4X7DC 3MJ8B 5K9JL 1HKLH 3HZVA 5DK3A 3GK8L 4J3TA 4AJ0A 1RIVH 3RIFK 2FHCA 5HYJB 4FABL 4OZGF 4NGHH 1I9JH 4P59H 1KTLA 1A3LL 1QBLH 4ZFGL 3P0YH 3HN3A 4XB7A 1U58A 5ADPL 5C8JB 5FUOH 4KI5D 5LWYL 1SYSB 1T22A 3JVGC 4TOYH 2FX8L 3MGTB 4NDMA 5CD5C 4LLQA 3RWDB 4WEUD 2GI7A 3ZZ1A 3IDNB 1KJ2B 4YDJB 3PWPA 4K3DH 3HE6D 3CFKA 2H26B 4XPTL 3WJJC 1OCWL 4Z7UA 1BECA 1W72H 3MA7A 2R2HA 4X6BA 2JB5H 4EUPB 1LO5B 1IT9H 3L3GA 2P4AB 4AY0A 4HBCL 1YY9D 3ZTNL 4QHMB 1OGAB 4N0UB 4OCRH 3IGAA 5BZDA 3ARFB 2GSIA 4Y5XA 2HYMA 5JPNA 5CZXC 3VFGL 2GUOA 2GYSA 3V4VH 2HJFB 2R2EA 3HZMB 2NY7H 1YECL 5DS8B 1I9IH 4JB9L 4LCWB 1LP9A 2CUHA 4OD1L 2F53B 2NY2D 5KOMC 3IDYC 3BEVA 1Q9KB 4D0CB 4TVPD 3KAAA 35C8L 1G7HA 1EZVX 1FL3B 3JV6A 2HAZA 5I2IA 5FO7A 5SWSB 5ACZA 1WAAF 1C7TA 5KSAC 25C8H 4NUJB 4RMSA 4EVNB 4I0PA 5A16A 3O9WB 4ZPVA 4MD4A 4OZGB 3VXRB 1U8IA 3BPCB 1JGUH 3L3OB 5DK2A 3SY0A 1U8OB 4JN2A 2A73B 5JQ6L 2MKLC 4QTIH 2H2PD 3B9VA 5IEKA 1BFVH 1UVQA 5D8JH 2DD8L 3FB7B 3GIVA 3MRLA 3TO4B 1N4XH 5HHQB 5C0CA 3IJHA 4U7SA 4P0DA 1M7DA 3IJSB 3FHQA 3EHBD 1ZK9A 3OGCA 4OF5A 2WWMC 2Q3AA 5C0CB 4P99A 3PWPD 4KK5C 4HKXB 1A1MB 2G60L 1EMTH 1CFNB 1MRCH 3LHPH 4LVNB 4Y5VC 1EEZA 4XX1G 2ZOKB 2C9AA 5BJTB 3GIZL 4ZD3H 4AH2A 1MLCA 1HYSD 3QI9C 4M93C 3CVHA 4G8EB 3RP1A 3IU4H 3ES6B 5D7JC 1MY7A 4LCUA 2CIIB 4NFCA 4CN6A 5AYUH 3U1SL 4ODWB 4XP4L 1FG2B 4ONFH 4AH2B 5GGSB 4X6CB 5MEOB 3LH2H 2XYCA 4NWUL 4QRUA 5HI4C 2BRRL 2ZUXA 4HS8H 3UTSD 5K59E 4UUJA 5EU6D 5C0AE 1CYGA 3OB0K 3WUWB 5F6IC 1BVZA 2W9DL 1VCAA 3GBNH 5DJAA 2Z4QB 4WTXA 2W9LA 3B3IB 3B9KA 3CLEH 5JW4N 1HQRA 1J88A 1X7QB 3WN5C 3ZE2E 2E7LA 4XAKE 1NANH 1AO7B 4MCZB 2X2YA 1CK0H 2G9HA 5DJ8B 2Y36L 3RVUD 3MRGA 4NYLA 2PO6C 2QADB 2DQEL 4L4TD 3OTTA 4G8IA 1SVZA 3BDBA 5HGAB 4UBDD 3GMNA 5FA3A 3VGBA 4NM8H 1N0XH 5IIEB 5BV7H 1A0QL 4GAJL 5LQBL 2P8MA 4PY7A 4UT6H 5TH2A 1D5MA 3V4UL 4QGYA 1CQKA 1JRHH 5GGQL 5JO5A 1H3PH 2Y72A 4Q97A 3RWIA 3VXNB 3IAPA 3RVVD 3QEUB 5GRVK 1D9KA 4MAYC 5C0GB 4QXUH 4BM7A 3O6FA 4K3EL 4BKLB 3HC0A 3QG7H 1D6EA 1BFOA 2DLTA 2VXUH 3S97C 2OI9C 1QFUH 4W4OA 4HQQH 3PJSB 2N7BA 4IHOB 2OSLB 4NKMA 1IGFH 4NKQB 4KHXH 3MLUL 1OPGH 4BQBA 4KZEH 5JHLL 4KPHH 2BOCB 1R3KB 1U0QA 1J87A 3IFPA 4X80L 5IESH 2OSLA 4NKMB 4ODSH 3DYMA 3WIFB 4OLZL 1WIUA 2P48B 2KL6A 3L1OL 4FS0A 2DQIH 4MA3A 4PG2C 4NQXA 4ELME 4NN7B 5GS0H 4PD4K 2UWEB 1NGZB 3KPQA 5L2KD 1CICB 1I7TB 2FZ3A 3MJ6A 3GB7B 1D5BA 1FL5A 3VH8B 1X4XA 3HI5H 3SDYL 3D1MC 4FQ2L 4DEPC 3CUPB 1YN7B 4YHLH 5IEHB 4L8SB 2X44D 3LEVH 4HG4J 3S3PA 4LKCB 3N85L 3VH8A 1MSPA 1QPXA 1PAMA 4FXGB 5DHYA 4ZYKA 4PJIA 5D7IB 5FUOL 1INQB 2HVJB 4W6WB 2Q7YA 4U6XB 3T08A 2DQCH 1DQQA 4YX2H 1ZVSB 3MRCA 3MPCA 3WV0A 4LLMA 4G6AD 3TIEB 4Y2DA 1YEIH 4FQIL 5I17B 3SJVE 5EU6B 1JPTL 1AE6H 3PXJA 4IMLB 3T0EE 1KV3A 1K6QL 4XPAH 2OTPA 4L9DA 1TCRB 2GJZA 3QDMA 3VXOB 1DDHB 4R7DA 5CLTA 3BUYB 2VE6B 5C0EB 1LO4H 1UWXK 1MUJB 5IOPA 1JGLL 4QRRA 5CD5D 1TFHA 3L7FA 4NNYA 5FYJU 3AFLA 1HHIA 4YDJA 3U4EA 1JYWA 5ALCH 4CDHA 2CKBB 2YA2A 4XCFH 1BQHG 3QPQD 3W82A 1QSZA 3L3GB 5B38G 3MRIB 3OKEB 3FB8A 4RA0C 1S78C 3DROB 4UIMA 1YC7A 1RZ7L 2Y06H 4BQ9A 1A2YA 2CLZA 3O9WC 5EN2A 1JYNA 1G6VK 1LO2L 4LHUG 3RY6C 4NZDA 1UM5H 3NGBB 3FQTB 3V52L 3RDTA 2W59A 1CDIA 5HBBA 1OAKL 2UUDK 5CHNB 4Z18A 2EH7L 3D85A 1PLGL 3DARA 1N8ZA 2VH5H 3LIZH 4OBRA 2D7MA 3VWJC 3PIQB 4QOKB 3HCVA 3AC0A 5AWNH 5CJ8A 2IFFL 2OQJB 2EH8L 4YHKL 3F65A 3SKJH 5I19H 2XNAB 1AC0A 3PIQA 4QOKA 5FK9A 1L9MA 5JR1H 3LKQB 3HFML 3DTXA 3BRGC 2P45B 1MCDA 5EO1A 3QI9B 4M93B 1JNLL 4V1DD 2W0PA 4ZFZB 3RJQB 1YEFH 5AUMB 3QIUB 3WNNA 2M26A 5CSZA 1FO0A 2QR0B 4NGHL 1V8HA 4Q58C 1UACL 3BT2L 5B39A 2EXWD 4MCYB 4OCNC 3X14B 1W72B 4EI5D 5C09D 4LHUA 3IFLH 5TDPB 2O61B 1A21A 1FO0B 1MEXL 2WBKA 3ARGB 3I6KB 5I1DB 1EAPA 3U0PA 3M8OH 1J7VR 4EJ1C 4YHNB 2BY2A 3EO0B 4FQXC 4HKZA 4LHUB 1EX0A 1RVFH 1YPZE 4BJLA 4YHIA 4H8WH 3LH2L 2XN9B 4Z8FL 4HS8L 3VE0B 4YHNA 4PJFA 3KPNA 4RAVB 2VNCA 1T4KA 1RJYA 3VGHA 5I15L 4HS3B 4P23D 3HMXH 3WJLA 1UJ3C 3HPLA 3CFEB 4HGWA 4KJPC 5K9QI 3BFOA 4AT6B 3QDGA 4JHWH 2DLIA 5E2TL 1L7TH 2YZ1A 3CDCA 3STZA 1RD6A 2HFFA 4TNVK 4XH2A 1NGPL 1FRGL 1JNHB 1GHFH 5FDWB 4X99A 1KJ3H 2VZTA 4K71C 5A2KH 4NZTL 4DW2H 1OB1B 2QV2A 4Y19B 4UAOB 3GSWA 2DWEA 3WBDA 4RWHA 4X99B 4L5FL 4ZSOB 1PZ5A 3PWPE 5ANMB 2CPCA 2P8LB 3BDXA 4QTIL 2DLFH 4PJGA 2ZSWB 3IS0X 2X4TA 2OL3L 3QEGL 1ZVHA 5IKCB 4UDTB 5EIVA 1AFVL 1DQJA 1GC1L 3CNKA 5IMOB 5I1LB 4JGJA 4NQSA 1ZLVK 3MLSH 2AJZB 5BQ7A 3OJDB 3W11C 5D7KD 5MEQB 3O3BB 2YK1H 3V4PL 4PJ8C 4AM0A 3DX8A 3H3PH 4QGTA 2FEDD 2VOTA 2R0ZH 5BQ7B 4XP1H 3BX7C 4KZDH 2NLJA 5