3I84A

The crystal structure of human emmprin n-terminal domain 1 in p6(1)22 space group
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
80
structure length
79
Chain Sequence
GTVFTTVEDLGSKILLTCSLDDSTEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Cervical EMMPRIN
publication title Structure of the EMMPRIN N-terminal domain 1: Dimerization via beta-strand swapping.
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 79
sequence length 80
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3i84A00
3L6FB 1EJOH 5GS0C 2P5EB 1GC1C 5FGBC 2EICA 4ONFL 2X7LB 1XR8B 3LB6D 1OWWA 2JIXD 3JVGA 3L95B 1MPAH 4Z7UE 5E4EC 5E95B 3TT3L 1KJMB 3UTTB 4W6XB 3SJVB 5EU5A 5TGBB 1EEYB 4ELKB 4JY4B 4LVEA 3VFUA 5J6GB 2C3HA 4ELMA 3INUL 2VXSH 1J8HD 4X7TA 2ZUQB 1BZ7A 2MPAL 3SKJH 1FLTX 2APVA 2EH7H 5IB4A 5DJ6B 1NPUA 3QZWG 4JM2C 3VXTB 2FHFA 4EDXA 3QNZB 4OZHE 1RIHL 3I50H 5CS7A 5C0GB 4QRPE 4IRZL 3NOIA 1M7XA 1O7SA 5FYLH 4LLUB 1IC1A 1G6RB 1QA9A 1CFQA 2ZSWB 3KPRB 3FB8B 1P7QB 3DHMA 1BWWA 4MAYB 3MV7A 1U8LA 3NAAH 2NY3D 4YO0B 3WXVL 4HWNA 4LHUD 5BV7B 3QR2A 1DEEA 3V0VA 1H3UA 3WHE1 2HN7A 1ZHKA 3L3DB 4ODBD 4GMTH 2CDFB 4BM7A 2MCPL 3LPWA 4YDJA 4G80B 4IS6A 5D7LE 1Y6NR 4YHOH 5T1MA 4F15C 4E0RA 1MFBL 2CGRH 3MV9E 1A4JB 5I1EH 1EBAA 4ZUWA 4BFIA 4CUCA 4J3WA 5I74C 5SWSD 3MOBL 1R5VB 3TP4A 2NY7H 1HDMB 1LDSA 4UQ2B 4LARL 4NQEB 2P5WB 1P7KB 4Z0BH 4HX1A 5A3IC 3CZFB 5C0BD 5TPWL 3GI8H 2Y5TA 4RZCA 4K8RL 2APTA 4X6BB 3UZVB 3BDBA 5J11B 3SDYH 4BQCA 4Q7DA 5CJXC 3S98A 1MFDH 3SPVA 3TO4D 1Y6KR 2ICEA 4R0LA 4N0YL 2J8HA 2R1YA 3JV4A 4LCYA 5FIEA 3IDNB 5FCUL 2K3TA 1K6QL 3IXTB 3PABA 5FA4B 1UH2A 1QG3A 1N6QL 4H25B 4QCIB 4G43A 1ZEAH 1QBMH 4KZDH 3UP1A 1P69B 4P0DA 4RFNB 4Y4KA 3VFOA 4RAVB 1FVEB 5B38G 4QF1A 1M4KA 1A6UL 4XP1L 1MCJA 1TCRB 1P4BH 3MJ6A 1OW0C 7CGTA 1KIRB 1C08A 2DQGH 3QPXH 4IBLT 1MHPL 3SGJC 3VGDA 4FFZH 5EU7C 4YK4C 2DTSA 2CKBH 3L3OB 2AK1L 5EU6A 5E2WL 4I4WB 5GJSH 4CNIA 3H9HB 1QNZL 4H88L 4ZXBB 3I6LD 4W68A 4R4BB 1YN7A 1S5IL 3VI3E 1O7VA 3TCXA 3B3IB 1P84J 2A77H 4MB5A 5DSCA 4QXUL 4BJLA 4JY5H 3THML 1U2HA 5IVZA 2L4OA 5HI4D 2ZOLB 4OD3H 5AD0A 3LPGA 1TVBB 1MSPA 3T1FA 4FTVA 1KFAH 4PV8B 5DURB 1A6ZB 5EN2A 4HUUA 1LO4L 1KPRB 5F1SA 3HC3H 5EIIA 1OP3H 1Q9KA 2FJHB 5CKAA 2UWEA 3LN9A 3BH9A 2BZDA 4Q9RL 3BXNB 4I18A 4LRNL 3BJLA 3ARDA 4N5EC 3G6JB 3QWOB 5DVMA 4LHUG 4G5ZL 4PREA 2O26U 1YY9D 4N8CL 3LQAL 3MLXH 3HI5H 3OTTA 4NQDB 5FKAA 2W91A 2OK0L 5A2JH 4TYUA 5DRWA 1ZA3A 5DQJA 2CJUH 5DT1H 4EVNA 2ILLA 4WFHD 2PYEB 3U0TA 4OLUH 4GAJL 1QFOA 4U6YA 3D39E 3JTTA 1IVLA 3FFCD 1YPZA 3C09B 4DOHE 1JZ3A 1XZ0A 2CRIA 1Z5LB 2MQ0A 2Z93A 3MLZH 4EBQH 4RNRA 3KG5A 3W0WD 1B4JL 4F9PA 3LHPL 5EBLB 1MCSA 3VXMA 1OM3H 1XGYL 5DJCB 2JJSA 1J7VR 4JY6B 4KJWD 4GG8A 4R4ND 2V5RA 5C0NC 1W8OA 3HPJA 1IGFH 1UCBL 1QBLL 3F58H 4JREB 5KVFL 1U8IA 4PJDB 4QT5A 5ISZE 4WO4D 1CF8L 3MROB 5DD0H 5LAXB 1VHPA 3F6IA 2VXUL 1ACZA 5HBBA 4URTB 4HIHB 1QFWM 2IQ9H 3K4AA 1SEQL 2HT2D 1CK0L 2FHBA 1V7ML 5DEGB 3T77A 3WEXB 1KJ3L 4QRQB 1WQVT 4P5KB 5DWUH 4A2LA 1N7ML 3RNQB 5F89A 1X7QA 4Q9QL 1DBJH 2QR0A 1NCDL 1XGQA 2X4TA 1I1CA 3K8KA 4YQXH 5MP6H 3VFRA 2GK0A 1HH9A 3L5XL 1A7QL 1U58B 4L4TA 1U3HB 3VFVB 4U2YA 2BNQB 3LQZB 1AJ7L 1MLCB 5HY9A 2WLYA 4RIRA 4WNQB 2UZIL 1B0RB 2B1AH 4EOWL 3HAEH 5FO8A 1ORSA 4Z5RA 3B9KB 3S4SG 5CCKL 1HQRA 4NJAH 4F37K 4MAUL 3C60C 4MQTB 3PWPD 3DRTA 1EO5A 1I9JH 1FN4B 3MZTA 4NHCH 4S1QL 3JWDL 4X4XB 1PAMA 2L0DA 1XF5B 5IROA 1I9IH 3RGVC 1HWGB 3LKOB 1IQDB 3B83A 4D9LH 1IT9H 1ZT7A 5HYSB 2BNRA 2RR3A 3PXHA 3WFZA 1ORQA 2Z31B 5JXAH 3S35L 2ZPKL 2IADA 4YXHL 4XP5H 3W39B 4MB4A 5DVOA 2E7MA 3H9SD 1WWCA 4FQJL 4PRPD 3MQIA 4K23L 5INDA 4YGVA 5I30L 5D4QA 3MBEA 1WFOA 1OP3K 4UUJA 1TJIL 2DLFL 4XB8A 5JQHC 5HPOA 3M1BB 4JFXA 1MNUH 4NFDA 3JTSA 3IDIB 4PJHB 3ARWA 3L7EA 4XCNA 3WSQH 2AJYL 3FAXA 4RSVA 3RKDC 5D5MF 4S1RL 4U1GB 3ULVH 4UT7H 2Y72A 5DXWA 1KELL 3A6CL 3QO1B 4Y4HD 1MCOL 4FMFA 4QRSB 1E4XH 3DXAE 4OBSA 5I6XC 1TJGL 4OI9A 1KCUL 1SM3L 2V2XA 5B8CB 2YD8A 5F7DA 5IMKA 4P59H 1RD6A 5LQBH 1A7PH 5L0QC 3QUXD 1MIEL 1G7MB 2VIRB 1A1OA 3GJFA 4M6MH 1EEUA 3KS0J 3QZWB 2W0FA 1Q94A 1HYSC 3VWJA 1M6OA 1J86A 1T5XB 3VCLA 2CK2A 2WQRA 3UTPE 5ETUA 5E2TH 4GG6E 2Z9TA 5B21A 2JCCA 4LVNB 5C09E 1A21A 5BVPL 1FO0A 1WVZA 5CD3B 1I7TB 3WNMA 3B6SA 4PGBB 4XVUD 4XP9H 4OQ1A 2CXKA 4OFPA 1MI5A 1MJJB 1MQKH 2F74A 1ZXQA 2YD6A 4Y19E 2H1PH 2EC9T 3SDDB 3SDAD 4R3SB 1CFNA 3LD8B 2CIKA 5CP3H 4ZFFA 3WIFA 4M5YL 1F4XH 2P24B 4PBXA 3V4VH 1UA6L 4MLSA 1CL7L 1JWMA 3S36H 2CXGA 4L8DB 1TZHA 3W5NA 2BJML 3JZ7A 2X6MA 1RV6X 2V9TA 4UNTA 1EFXD 4LSPH 4G8GE 5KSAD 4TUOA 3VXPB 4BSJA 3VFTB 3IFLH 4QNPF 5L9DH 4RGMC 4IRJC 1T0NB 1D9KB 1AGEB 3HE7A 2EDHA 2KL6A 3PGCA 3ULUE 4N90D 3RWIA 5DA0B 3S5LG 3DARA 4UAOC 3TIEB 3WO3B 1V8HA 4HGMA 4ORGB 4PRAA 1JE6A 4KY1H 3TWCH 1VSCA 1DBBH 1FFPB 3HE6C 5LWYL 2I25N 1T80A 3QDJA 1ZA6B 1K3IA 3IU3A 2N56A 2V2WB 4KH2A 1I8IA 5D7KE 1ZVHA 3C08L 3GSXA 4YHPB 3MRDB 5EUOE 4OD1L 3TYGL 4OCNC 5F1IA 5J56B 5FM4A 5H8DA 1BWMA 1Q72H 3DTXB 3BSZH 4NN7C 2GEEA 4J3UA 5B38B 4DGYL 4WRLA 1J0HA 1JV5A 4HCRH 5SWSA 5JOPD 1B88A 5D1QC 3I85A 4OLYH 1F6AA 5C0BA 2NX5D 3MXWL 3VXSB 4P5MA 1MCPH 1T89C 4Z7VE 3E6FB 1G7LA 1RU9H 3TO4A 5BMFL 4TVPE 1IGCL 4LCIH 2R2CA 2JJWA 2VDOH 2ICWJ 1C5CL 5MENE 3VFMB 2X09A 1FG2A 4ZUUA 4PGDB 3ETBF 4Y4FA 3QHZL 4M93B 5CJQH 2E6QA 3VGAB 4MD5B 3U4EB 3U48A 4MJIA 4YHZH 5IUSA 3EDFA 2FWOA 2GTWB 2W60A 3ILPB 1P7HL 4EZMA 4P48A 4R96A 1RHHB 3HZYA 1CE6B 2E9BA 3SE8H 4J6RL 5IOPA 3L7FB 2XA8H 2DQJL 3QIWC 4B41A 1AXSA 2BVPA 4WJ5A 3IGAA 4FZEL 1X6LA 3BUYA 3OJMB 5F7EH 1HOCB 1R24B 4LHUB 1X5IA 4PJCA 1N5AB 2DQEL 4PJAE 4POZC 4CMMB 5IW6A 1PLGL 3VWKC 2BRRH 3PL6A 1AKJD 3LMJH 4X9HA 1YJDL 3DMMD 4OCRL 1C7SA 2IFFH 1F97A 2DWDB 1MIMH 2BX5A 3UEZA 3O2DL 4GRMA 4KK6D 5GS2D 5A40E 5J3HC 3BYTA 2IAMC 1HEZB 1FFNA 1YN6B 3AAZB 3QIUA 5I8CA 4YR6A 2E27L 2HAZA 3DV4B 1IGIL 4KUZL 3G6AB 2H45A 4NQCB 1HSBA 1E4XI 4PRDB 5GGTL 4KTDH 2Y06L 4HKJA 2AJ3A 1ZOXA 1CFVH 1LNUA 3FFDB 2VC2L 5K93A 5HHXH 5AZ2L 4OIIL 4WUUA 1LE5A 2EE3A 5BZWA 5B3JF 4NYLA 1FP5A 5JTWA 1T4KB 3DVGB 1Z9SA 3T8XA 3GM0A 4FQLH 5ENWA 3DX8A 2B7DT 2R0ZH 3QJHB 4CN1A 3IDGA 1AQKL 1A64A 1VKXB 4HKBB 5JPNB 4E41E 3FFCA 2H2PC 1E28A 2I07A 1L6ZA 2D4DA 5T3XH 4JZJB 5C08D 1U8JA 2VOTA 4KQ3L 3W0WA 2NXZD 3AFLA 4LLVA 3HMWL 2R2EA 5J13C 3MCKB 3BGAA 1IEBA 1R3LA 4IDJL 4PB0H 1DJSA 1ZHLB 1KCVH 3S4SB 3BGMB 3G9VA 4N0CC 5EU4A 3NIDE 4GXUN 2A9NH 4LGPB 1MQ8A 5JR1L 4LSTH 3HZVB 3STBA 3X14B 1IKNA 1OLLA 1MFCL 5CZXC 2GJZB 3VDAA 4U1IA 4ETQB 2VR9A 2R9HC 3NFPB 3OZ9L 5GISL 3VU2A 4DZBA 1FIGH 4PS4L 5FUZL 1NJ9A 4KKAD 4YE4H 5KSVB 4K94H 1MVFA 1GPOL 3BPNB 4L3ED 5EG6C 4I0KA 4BH7A 4M7JH 1ONQA 2C26A 3TA3A 3WNKA 2OCFD 1PKQA 4U1LB 5GGUB 1MJUH 4K71B 1FVDA 2Y07L 1LEGA 4QOKB 2NY0C 2BHZA 4FP8L 1BVKB 3H7LA 4NBYB 2VKXA 3DIFA 1YYLL 3GKWH 3PWPA 5DUMH 1Z6JT 3EO9L 3QDME 4P2OC 5GGVL 2EDJA 1G9NH 4KI5D 4O02L 3SE3C 2V5TA 6FABL 4GKSA 4ODXA 2EKJA 4WI6A 5AEAA 5ID1A 3MRHA 3BEWA 5IGXH 2FGWH 3S37L 1WTGT 5IQ7L 1NEZG 2C1OA 3V8OA 4OFVA 4HV8B 1NUNB 2GT9B 4TULL 2X4RB 1GOHA 2G9HA 3H9SA 3OJVC 4BZ1H 1HZHH 2YN3A 4U1SA 3BZ4A 1RUKL 2BNUB 1ZTXH 3BP5A 3L3GA 3T0BA 5IB3A 4WO4B 4NBZB 1DVFC 1BAFH 5HGAA 3MLUH 3WLBB 1CDCA 4ZPTB 9CGTA 3L3IA 5E8DH 2YZ8A 4OV6F 4FXGB 1LO3L 4JRXD 4Q9BA 2WP3T 4G6MH 2ARJQ 1X5LA 4XZUA 3MNZA 5E6ZA 8FABB 1DLFH 2YD3A 3RUGF 3A6BL 3BX7C 4C56B 1NBYB 1H8NA 2F53D 4XAKD 2DM3A 1LO5B 4LEXH 1QFPA 2RCSH 4OGYH 2PXYC 1LK2B 3U9UB 3TBSA 1CLZH 1F45A 3IKKA 3D0LA 4Z7UB 5FV1L 5IMLB 3M17B 5I17A 3O6MH 2F54D 1WJ3A 3QUXA 3O6KL 2X9XA 2R29H 1Y0LA 5D2NE 2GK2A 3KDMA 5INCA 1U8PB 4MJ4A 1I75A 2E9JA 4JLRB 4XXDA 1RJLB 3UTSD 4NRXB 1G6RL 5HHPA 2AQ2A 5HYJD 1P6FA 3S5LB 4JFPB 5F96H 3WFBL 4U3HA 1L0YA 1RK1A 4X0KA 4X4YB 5I8OH 3GIZL 4OLXH 3ARGD 3MACH 3BP6B 3BVNB 4WHYG 3RA7H 5H35A 4N0FA 1U42A 3VXUD 5CP7A 1HNFA 4TOYH 1JPST 4P3CH 2XRAL 4O2CA 4MWFA 4E5XB 3GMNA 4F58H 5HI5C 2Z8VC 5DUBB 3F5WB 5D7LB 3OKNA 5FO7A 1WBYB 1GGIL 4Y16D 3EBAA 2CQVA 3PV6A 4YFLI 4YXKL 1JMZA 5EBWB 1P2CA 4WTXA 15C8H 3GSOA 1HI6B 4N0UE 1AR1D 2Z91A 4Y5XA 4JRYE 2NW3A 1I4FB 2WUBL 3RIFK 5T1DH 1IBGH 5J1TC 4L1HA 3O8XD 1J0IA 1YEKL 5A2IH 3STZB 4ODHH 4C83A 1Z3GH 2P7TA 1CGTA 3V52L 2VUYA 3EKCA 1UC6A 3MJ9L 2GSGA 5HHNA 4QRTA 1S9VA 2P47B 1DL7H 4S1DC 3O9WD 2QQLH 3MRJA 4X5XA 2C4FT 3FOLA 3RY6C 3TEUA 4PJXA 5GIRA 4MA7H 3WFDL 2OI9C 4P23A 4QHNB 4F7TB 5KN5A 1UXWB 4DWHA 3O2DA 1F90H 5H37G 5FM5O 3WIHA 4BZ2L 2HJLB 4PJBB 3D6GA 1KF9B 4JHAL 3OR7B 2YOCA 5JXEA 1G7JA 4NNYA 4OT1L 3U79A 5IP4A 1JWSB 4ONFH 3TT3H 5KJRL 3LPFA 4MGXA 3CAFA 3BDYL 5JW4N 4NRZA 3GMLA 3INUH 4G6AD 1GL4B 3SDAB 3D85B 2FO1A 5JPMA 1Y18B 2NX5A 2MPAH 1MRCL 3NFNA 1I3VA 5CEXA 3OXSB 3RTQA 1HSAA 2ED8A 4Y5VC 4PRBB 2GKIA 1RIHH 3CPLB 4IRZH 5TDPA 4RDQF 5IVNA 3W2DL 4WI8A 1E4KA 1N4XL 3C8DA 4RA3A 1EFXB 5IMMA 3RWFB 4PJ9A 5KSAB 2JK5B 1QRNE 4XVSL 3ARED 3ES6A 4K7FA 3WXVH 5DJXA 1QQDB 4NKIL 5CEZL 1K2DA 1FZKB 3RBSA 1KTKE 2BC4B 2MCPH 4P2QA 3GEWB 4BSVA 3HZMB 5JDSA 1MFBH 2CO7B 2P45B 3GJFH 1UT9A 5E2VL 2F5AL 2R39A 3BYYA 2YZ1A 3RIAK 4JFDE 3CCHB 3MOBH 3QJFB 1BD2D 2GUOA 1AGDB 4C58B 4JZNA 4PRIE 4W6YB 4LARH 1FCCA 3FT3B 1FBIL 4TRPL 3TPUA 3DMMA 1UEYA 3ZE0E 3CK0L 5TPWH 1KCKA 3NGBB 4YHYB 5FM8A 5IEHB 4K8RH 4HUVB 4HKXB 4ZO8A 5AUMB 4IRSD 5FGRA 4AENB 3T0WA 4GKZA 5HGGS 4KK9C 5JIPA 4DKDC 2Q6WB 3D39B 1QLFB 4LOUC 1RZIA 1BX2A 3HUJE 3MUHL 4N0YH 2NY2D 3WJJA 3C8HA 4DKAA 2R2BB 2MKWA 4UQ3A 5FCUH 1K6QH 1K4CB 5HVWA 5I75B 1N6QH 1DQLL 3LKRB 1HKLL 5DQDL 5ISZB 4I0PD 4KK5C 4TUJB 3MRGB 3SDCD 1A6UH 4XP1H 4YDIL 1INQA 4RMTA 4XGZA 5FYJD 3PHOB 5EUKB 3HR6A 2AVGA 5E5MA 4ZAKC 1UVQB 1MHPH 3PDGA 3SKMB 4BSWA 4MZ3A 2AK1H 5CSZA 5E2WH 3UYRL 2WIMA 2EDOA 1F58L 3QUYB 5J1AA 3U4BL 1QNZH 4H88H 3CFCL 2KZWA 2DL2A 1X5XA 3BGFB 4Z7WF 3ZT5A 1FCGA 1S5IH 2O5XL 4G8EA 3OBAA 1IE5A 5EOQL 3IVKB 2ZJSL 5JHDE 4QXUH 2YHGA 4Y2OA 4KV5E 4JCLA 3THMH 2QSCL 2V5MA 3HRPA 5TDOA 3FO1B 4O4YL 3TZVD 3T0XA 1I3GL 5JUEL 1S78D 3LRGA 4BZYA 3OXRA 1AKJB 2NTFA 3GMRB 1QPXA 3RX5A 3BEVB 1LO4H 3D1MC 1EMTL 3MRBB 2PYFA 3MRCB 4XBEL 2X7LA 5HVFB 1XIWA 3GJEB 3SJVA 3JUYA 1DUYB 1KTLB 3FO0L 4Q9RH 1XGUB 4LRNH 1NEZB 3NCMA 3BN3B 4G5ZH 2CIIB 4N8CH 3LQAH 2FJFB 1JTTA 5JW5B 3QNZA 1PZUB 5ICZA 2OK0H 3GDBA 1I8MB 3FQXB 3RVTD 3TBYA 3O4OB 4AH2A 1NMAL 5E6IB 1QR1B 1TETL 4LQ1A 2GY5A 2WIIA 3FB8A 4GAJH 3KNBB 2VN4A 4YO0A 3B2UC 1UJ3C 4LCWD 4PLKD 5TJWK 3BIKB 1PY9A 2FX9L 1B4JH 3LHPH 4UDUB 1XGYH 4NJ9L 3SN6N 4PJ5E 2DI7A 4K2UL 3S3JA 3C5JB 2KPNA 1N5YL 2A73B 3LRHA 4TN9A 1D5ZA 1UCBH 1QBLH 3RPKA 5KVFH 3BIAX 1CF8H 3PGFL 4MVBD 4U0RB 4LPXA 5C08B 1OAYL 2VXUH 4LLWB 2NXZB 1R5VA 1SEQH 1JK8B 1CK0H 1HDMA 1V7MH 5ACZA 3N50A 1KJ3H 1OGAD 3BP4A 3CZFA 5DD6A 3CX5K 3VMOA 1N7MH 4Q9QH 4OCYL 4GG6B 1T2XA 1NCDH 5L8KB 3EYQD 5EULV 3QUMA 5DZLA 3L5XH 1A7QH 2FH6A 4P5TC 1XH3B 2PETA 1AJ7H 3P4MB 3MJ9A 4LNRB 2UZIH 4EOWH 2VMFA 1EIBA 5CCKH 2WWMC 3OKKB 4QCIA 2X41A 3ULVF 4MAUH 1TJHL 4K94C 1YDPB 4L3EB 2WBJD 2OR7A 1FNAA 4OIBA 4S1QH 4RAVA 3JWDH 2DYPD 1TCRA 2F54A 3L3JA 4R0LC 2P8PA 4KJPD 1NUGA 3QIBB 4G8GB 4QRUB 4EJ1C 4JE4B 3WN5B 2IWGA 1HHGA 1J11A 5HTSA 4O51A 3ZSTA 5DFVC 2EECA 5HYJA 5DFWH 3S35H 2ZPKH 4YXHH 2YPLE 3RVXD 4HIIA 4K23H 3ARGA 1G9NC 5I30H 3SDXE 3BPLB 1IM3B 4WWID 1TJIH 2DLFH 1EV2E 4FQ2L 1MLBB 3MFFA 2NR6C 4L8SB 4WWKA 4Q97A 1B0GB 1DQTA 1SBSL 2W9EL 3WJLA 3WDJA 5JIHA 5E8NA 1JMXA 1BM3L 4N8VG 2AJYH 4LNVA 4OUOA 3KPSD 4S1RH 5GS3A 4NN5C 2XPGB 3ROLA 4UDTB 1KELH 3A6CH 2HTKC 1MCOH 1PDKA 4PG9A 4XNZB 2VDQL 4Y16A 1HQ4A 1TJGH 4PPTA 5C0AE 1KCUH 1SM3H 2EH8L 4JFYB 4XVTL 4NO3A 4KDTA 3G6JA 4MXQD 3TBWB 5C0CD 1H15B 1MIEH 3JV6B 5B4MC 3O8XA 3NCCB 4EIZC 2OYPA 2WINA 4HKZA 4F9LA 2CUIA 1DFBL 2H32B 4OZIF 4AT6A 2XI9A 4I18C 3ARDC 1OHQA 3U6RB 5DJYB 2X4QA 5BVPH 1L9NA 5KANI 5BXFB 5JDJA 5MENB 4P9ML 3RWDB 4MA3B 5F1NA 2P8MA 5EBLA 3ZE1E 5D7JC 1O0VA 1P1ZB 3FN0L 3MODL 2FEDC 4RA0C 4TTDD 5C07D 5GGRY 4M5YH 3CC5A 1FV1A 5I8EA 4GRLD 4ZO6A 1Q0YL 1UA6H 4OLVL 1CL7H 3JWNC 1MWAA 2BJMH 3VGBA 2BVOB 4IJ3C 3P0VL 3VRJB 4MQSB 4F9PC 3QFJE 4ZQKA 5F9JA 2D3VA 3VXNB 4PJAB 1P4LA 3DWTA 2DQCL 2QV2A 5ELIA 3ZE2F 2B0SL 5KG9B 4BH8B 3KPOB 2IGFL 4HWEL 5CBAA 3P4LA 1QLRB 1CWVA 1AGBA 4YUEL 5DJDB 1NH6A 3C6LD 3E3QC 4WIQA 4WENB 1BOGA 3AREA 1ED3B 2EXWD 1RZJL 3EYUL 2DD8L 3ZDZF 5LWYH 4RWYL 1JPGB 1VADA 1PEZA 4OCXL 3VH8G 3NABL 5KS9F 3BMVA 3C08H 4OD1H 1OT2A 3E3QE 3TYGH 5MHSD 4DGVL 3EO0A 4XCEB 1T3FB 2CPCA 3VXQA 4BK5A 3QUZB 4XH2B 5E1HB 3FT2B 1AC0A 1FN4A 3BD5A 1FL6B 2C4XA 1XF5A 1SHMA 4RWHA 5CJBA 2ZUTA 3W11C 3BQUD 2GJ6D 4DGYH 3FRUB 3IRZA 3JXAA 1IQDA 3O9WB 3TESA 3MLVL 4XI5C 1BD2A 3UJTL 1JIBA 2BSSB 1WT5A 1EEZB 5C0DA 3L5WA 3MXVL 3UPCA 3DX7B 4L4VE 3MXWH 4IRSA 4LLMB 5I2IB 4JAMB 2FRGP 4HJ0C 2X4SB 3DSNA 3U7AA 2XG5A 5BOZG 5BMFH 2PO6A 1IGCH 1DQQB 4OZ4B 1C5CH 3J8F7 2H26B 4P4KD 4PJHA 5JOFB 1T1ZB 3QHZH 2C3VB 4Y2DB 5GGSA 3WL9B 2Y1VA 2FJGA 3MLTB 2BSTB 3MJ8B 2HT4C 1MELA 2VLJD 2CLRB 2VISB 1H3GA 4B7LA 4I0PA 4QRSA 4KHXL 2HLFD 1ZGLB 4OGAC 1ZT1A 4C4KT 2X1WL 5GS1A 4J6RH 4JFED 3QA3B 4GW4A 2APFA 2WV3A 1NFKA 2DQJH 2X1XR 4FZEH 2MMXA 3P73B 4OCLC 3QI9D 1WBZB 1FRGL 1YEGL 2DQEH 5GS0D 1PLGH 3QZWA 4JVWA 4OKDA 1JGEB 3L3HB 1NGXB 2BY2A 1NBQA 1YJDH 1TPXB 4OCRH 2O61B 5BW7C 2ATKA 1A1MA 3GSQA 1M7DA 3E6HA 3O2DH 1AC6A 1MCHA 4JM2D 1MJJA 3MO1B 4FNLL 3O3AB 3S97C 4H1LA 3SDDA 4X6EB 1NCWL 2VABA 3O2WL 1S7UB 5D70L 4X7DC 1S7WB 2HFTA 2P24A 3D48R 5DDHB 2E27H 2MNUA 1IGIH 3B8SA 4KUZH 2JJUA 3GGWA 4L8DA 3F62A 3PIQB 3MLSL 2O5ZL 4Y1AA 2HA1A 3WUWG 4MMXC 1YUHA 2FATL 5GGTH 2EDRA 2B4CL 2VQTA 2Y06H 4XX1G 3VFTA 3WXWL 1RVFL 3OKMB 2VC2H 5ALCL 1T0NA 2NY2B 4OIIH 5AZ2H 4PJEE 2FD6L 4CN4A 1QRKA 3D87B 5CSBA 3AY4A 2AK4A 4EN3A 1B4RA 4YBLC 3MRNB 1J1XL 3IF1B 1BHGA 5HDOA 2VWEC 5JORB 1AQKH 2G5BB 1VERA 3NIFF 3SDCB 1N3NB 1FFPA 3DVFA 3UBXG 2GITA 3WS6C 3CNKA 4HDIA 4LCWA 4Y8DC 1G6VK 4KQ3H 4PLJC 3IDMB 1PZ5B 4ZYKA 5IIEB 3OG4B 3HMWH 5A3ID 1H3XA 5DC0A 3F7RA 5EO1B 5FF6A 1XGRB 4AM0B 4IDJH 4XPAL 3RJQB 5EOTB 3UYOD 1WIOA 3DGGB 4JO1L 4U31A 4XNUL 4IOIB 3QH3A 4U6VL 3QDGD 5KSBE 1VFAB 4NKMB 5JR1H 2X1OA 3RBGA 1CL7I 2DAVA 2LTQB 1MFCH 3C5SA 1NGWA 4UT6L 2M2DA 1Q9WB 5DQ9B 1ZMYA 4PLNC 5D2NB 3TZVB 1OGAA 3OZ9H 5GISH 1G1YA 1GZPB 3M45A 1UB6A 5IB1A 3VXSA 1NANH 1PYWB 1QPPA 4LVHC 4PS4H 5FUZH 3ARBC 4JFHD 1GPOH 4Y8AA 1AHWB 3R06A 2LFGA 5EIVA 4L29B 4NUGL 4ONHA 2X4UB 4NSKA 2FIKA 3KWWB 1FDLL 2DTML 4M03A 1IL1B 1UXSA 1RURL 5GQBA 2XIDA 3D3VD 2Y07H 1MCCA 2VQ1B 4GAFB 1BP3B 2ITDA 5C0EB 4FP8H 3U4EA 2ZUUA 4N8VB 5D2LE 5BRZE 2AI0L 1YYLH 2IANE 2VLKE 1CLOL 5MEQB 3LQAC 1L4IA 2QKIA 2AJZA 5JMRA 2ZCHL 3EO9H 3ILPA 3QNYB 5GGVH 1TQBB 4O02H 1FPTL 1KTRL 2DYPA 6FABH 1VGKB 1JNLL 1CE6A 3B9VA 5I76B 2D7TL 1JFQL 2A83A 4HH9A 1ZLVK 3QISA 3WFHB 4CBPA 2YD4A 3S37H 3LN5A 5IQ7H 3VD5A 1KGCD 4LAJH 4TULH 4N0UB 4OM0L 3ZDXF 1C5DA 4DQOL 4PJFF 2IH1A 1RUKH 3AS0A 2Q8BL 4J23A 3O2VL 4ZOEA 1FSKB 5CFHA 2YUVA 2A6IB 1ZSDA 1YPZF 2XKSA 1OARL 4MX7B 3FO9A 1S9KC 5CHNA 5FKPA 4UINL 1S7TA 1LO3H 5F88A 2VZUA 1U93B 1VENA 3WFCL 1YN6A 4L5FL 1HK6A 3AAZA 1J0KA 3A6BH 4UU9A 2YD7A 4DFHA 4LAQL 3ZKMC 4MDJA 3FRPA 2A2QT 3LH2L 4G42B 1U8KB 3PGDB 2XWTA 3GMQA 3T2PA 1JPFA 3FFDA 3U30C 5HGBA 3O6KH 2UUDH 5I19L 2G5RA 3EYOA 4GS7C 3ZKQD 3K80A 4X99A 1H3TA 1U95B 1KLGA 5C0ND 1DLHB 2CDGA 5D1XC 1G6RH 3DVGA 4XCYB 2QSQA 2NY1C 3QJHA 2WBJB 3TNNA 3WFBH 3UPAA 3TVMC 1FLRL 5JPNA 3GIZH 1I1AC 3NA4A 1DN0A 4JFFB 4U6XA 4LPYA 1NDMA 3SY0B 4U1NA 2ZCLL 4I1NB 3O81A 3HRZB 4NQUA 3CVHB 3KPQA 1QRNB 3H3PL 4K07A 5IT2L 4MSWA 3VH8B 3BRDA 3G5XB 1ZHLA 1S9XA 2IG2L 3KHOA 2XRAH 3MRLA 4GRLA 3BGMA 3V6OA 2GTZB 1F4YL 4BQ6A 2QQKL 4QRRD 2YEZB 2Z92A 3CSYB 4NZJA 2XOTA 3TO2B 2PF6A 4HUMB 2EEDA 5BS0E 4O2EA 4XBGA 3IAGC 1TCMA 3K4DA 1GGIH 4YXKH 2GJZA 1JWUB 3QNXB 3NFPA 4JFDB 5D6DC 3F7YB 5DRXA 4HC1A 5EC1B 2FO4A 3C60D 3BPOC 5L2KD 1NFDE 3KPSB 4PRIB 1E27B 1H5BC 5DYOA 2WUBH 5KSVA 1AIFA 3I02B 4DUXA 3P30L 3CFJB 4EXPX 1FL5A 4QHMB 4X4MA 3RGVD 1YEKH 3TBTA 3C6LA 1FJ1B 4K3HA 3V52H 5ERWB 1BVLB 1QVOA 2DQHL 2FX7L 3MJ9H 4APQA 3HKFA 5IF0B 1EEQA 1SBBA 3CFDB 4F3FA 1RUPL 2EIZB 2EKSA 1TLKA 4QOKA 1E6OL 5C0CB 1KLUB 4P2CG 4TNVK 3FHQA 1KOAA 4FQQA 3HUJB 1D5IL 1DR9A 3R0NA 3GMMB 5HGDB 2J88L 2YPKB 3PQYE 4UI2A 1RZ7L 1GXEA 4BZ2H 4JHAH 4BQ8A 1IAKA 4MHHG 4RRPG 1RULL 4XNYL 1W0WB 2GJ6A 3STLB 4OT1H 4RGOL 1BIIB 2X4OA 5KJRH 4OUUB 3MJ7B 4G8FA 3RKDD 3BDYH 3KYOA 3GO1L 2X4RA 5I1HL 1P6AB 4NP4L 1ZT4B 3BHBB 2BOBB 3L9RB 4J1UB 1I1RA 1MRCH 1R3JA 5C0IB 4B5EA 1UKTA 3AGVA 2BNUA 4ONOA 2VYRE 3L3KB 2DQUH 3QXDB 3DBXB 3IJYB 2W65B 2EYTA 1WCBB 1CICC 3WLBA 3IDJA 3RY4A 2XQYK 2ZSVB 1JJUA 3W2DH 4L9LA 5TQ2L 1N4XH 4P4KA 2XZQL 3DRQB 4FXGA 3I6KB 1XMWA 1HYSD 4XVSH 4KRPB 1UENA 2ATPA 2UUDK 4D2NA 2VLJA 2YXFA 8FABA 3KPMB 4I2XA 4NKIH 5CEZH 3D25B 2VLRE 5J89A 3UTZA 2GY7B 4FQXB 4PJ7E 3IXAB 4NM4L 4PGJA 5FB8B 1LK2A 3U9UA 3GNML 4Z7UA 2G75A 1T1WA 3WUWB 2BVEA 3B5GA 3IU4L 3G5VB 5E2VH 3H6JA 2F5AH 4OFYD 4M61A 3C87A 3X3GL 5IV2B 5DK0B 1X5YA 4PBVC 3RZWA 4X98B 2NXYC 5J9PB 3ZYIA 4IIQC 4J8RA 4OZGF 3D2UD 1FBIH 4TRPH 4AYFA 3O4LD 1WAAF 2EIDA 5GSVB 1X5FA 4OZHA 3CK0H 4QRPA 3LKNA 4RAUB 1CZ8L 1CVSC 1MCFA 3BQUB 3BO8B 1SJHB 4MNQD 3T0EC 1MH5B 3BP6A 2EDFA 3C5ZC 4XBPA 5IESL 5D5MA 2VE6A 4IRJD 4JM2A 4LRIC 3UBXB 3PF2A 4KRNA 5EPMB 5DMGC 3QAZB 5EZIL 1IILE 3W9EB 4OCMC 4PYGA 4WU5A 4A6YB 3ARVA 1CCZA 4PJ8C 4PJ5B 1L9MA 4NO5B 1DQLH 3H42L 1HKLH 3IYLW 5DQDH 5CILL 4R90L 3MV9A 3NMEA 3TH3T 3I75B 4YDIH 4NM8L 35C8L 4G7YL 5BZDB 1HI6A 5HVHB 1AO7E 5FA3A 4EI5B 4N68A 2JKXA 4JJ5A 1MREL 1I4FA 4TQEL 3KLAB 4EQ3A 1IGTB 5TH2A 1VCAA 3MRFB 3UYRH 3EZ8A 1F58H 3QSKB 3U4BH 3CFCH 4KU1A 3MRMA 4NN6B 4YGAB 4HGWB 5BVJB 2IF7A 2O5XH 4LLYA 2BVQA 5D1QD 4JFEB 1MCQA 3LEYL 3X11B 5EOQH 1F13A 2ZJSH 2LQRA 4JO2L 4Y5XC 2QSCH 2EC8A 3QI9B 2X1QA 4O4YH 4PRHD 4CVXB 3KYMB 2VAAB 4ZUVB 1I3GH 4S10A 2V7NB 5CJXA 5JUEH 1H8SA 3QEQE 1J0ZA 3QDGA 3FTGA 5I8KL 3K74B 1YJDC 3U82B 1EMTH 4XBEH 25C8L 1QEWB 4XRCB 1FNHA 3HC0B 4LKCB 2DKMA 1TTUA 4PJCF 3ULUL 3BPCB 3FO0H 1EO7A 4ZMAT 1KB5A 2AQ3A 2R23A 4X83A 1V3MA 1IM9D 1NDGB 1U8MA 1BFOA 2XZCL 3CH1B 4PRBA 5FYLD 1IEAB 3B9DA 4LSQL 3SGJA 2I9LA 3QIWD 1NMAH 4V1DD 4CDHA 3MA9L 1TETH 4DVBA 1LE9A 3RWFA 1OY3B 4S2SB 4Y0GA 2YUXA 3VWKD 3OMZA 3JSSA 3DETC 3RTQC 1N2RB 4LBEB 1PQZA 1QQDA 1NUFA 2FX9H 1YEDB 5HD8C 3MGTB 4NJ9H 1JN6B 4MD0B 1E4KC 4K2UH 3K7UA 4M7ZC 5CIPB 2QLVB 4P57A 4Z18A 4ZD3L 1N5YH 4LP4A 3PHQB 3V7MA 4HWZB 1HE7A 2QADC 3FB7B 1CI5A 5C0AB 3PGFH 3ZKSD 2IAMD 1OAYH 1SEBB 3ECBB 3RDTD 3QJFA 2BMKB 6CGTA 5DK2A 4PJIE 1WICA 1T04A 3OG6B 2XXMB 1VPOL 1RSFA 4TVPL 5FFLA 3S35X 5IVXF 4GMSL 4DFIA 4MB3A 1DDHB 2XTJC 2YWZA 4KC3B 4H1LH 4OCYH 3MNWA 4G9FE 5IQ9B 2DJ4A 3EUUA 1MAJA 1IARB 1E4JA 3OPZL 4WFED 2IQAB 3VXRD 4FQHB 3EFFA 1ZWIB 1QBAA 4GBXC 4HJJL 4X6DE 4OAWB 1A4KB 3ROOB 2D7OA 1T6WA 5DMKA 5K9QG 2ICWB 2V7HB 3LKQB 5MI0B 4PGEA 4Z8FL 2H2PD 5E00B 1TJHH 5ISZA 4LCCB 2OQJA 2HTLC 1MVUB 1MCEA 3AUVA 4TUJA 4HAFA 2EDTA 4ONGL 5HPMB 2OTUA 3PHOA 5DJAB 5D7IE 5FOJA 5IW3A 4J4PC 4H5SB 4LGSB 5C70A 2OR9L 2DM2A 2Y6SC 1NAMA 1JGDA 3QUYA 3HR5B 2NPLX 5GJTL 5DGRA 2P42B 3OKOB 2AJUL 1EAPB 5GXBB 2QSTA 5DJZB 4L3CA 1QR4A 3DROB 2IMMA 3IVKA 4FQ2H 3PG2A 3QFDA 3MUGB 2ITCB 5JW4Q 3ALWA 2MJWA 1SBSH 2W9EH 4KROB 4Z76B 1CGXA 3IJSB 3HB3D 1BM3H 4MDIB 4NKDB 2JJVA 4Q6IC 3VFPB 5JW4M 4K3GA 2A0LD 2C3XA 2ZUVA 3MRCA 3MRBA 3IFOB 1U8NA 1SMOA 1CDYA 2VDQH 1YEJH 4ZSOA 3B9EA 1VACB 1CDUA 3PWLB 3H7BA 2EH8H 1BIHA 1KJ2B 4XVTH 3RHWK 4ODUB 3L1OL 3C60A 3SQOL 5E9DD 1W72B 4P2OD 1XCQB 5FUOL 1BQLL 4YC2B 2FJFA 5JW5A 3HI1B 2V6HA 2UZXB 2VL5B 2OBGA 1I8MA 3EJJX 2DWEA 4U49A 1DFBH 5I1LA 5IFJB 3FQUA 1KTDA 3EJYD 2GYSA 4X5WB 4WU7B 2P5EE 3HPLB 2ZUQC 3ZHKA 5IHZA 3JV5A 4DN4L 4JFQA 1A3LL 5KVGL 1NMCB 4MXWL 4P9MH 4RGNE 4I48B 3WS3A 1F3DH 2J8OA 4W6WB 3ZKND 4G9DA 3FN0H 3MODH 4RDQG 5KSUB 5IB2B 1YMMD 5DZOA 1X9QA 2A73A 1U6AL 3D18B 4ACPA 3C2AL 1Q0YH 4MAYC 3DXAA 4OLVH 1HHKB 1NC4B 3RWGB 4KVNL 12E8L 3P0VH 1D5MB 3FT4A 5A1AA 1DUZB 4HHAB 2CDEB 1QHOA 3GSWB 5JNYB 3HC4L 5EO9B 2DQCH 2R1XA 4MQ7A 1I7UB 2PXYD 2IALA 3U7WL 4MA8L 2B0SH 2BSED 1ZVYA 1SJXA 3O6FB 4QRRB 2BOCB 1SJEB 3GZKA 4CRPA 2IGFH 4HWEH 5EBMB 4DK3A 3P9MB 4GG6A 2JB6B 4DEPB 4XMKH 5F6IB 4YUEH 2MCG1 4NQSB 4OZFB 4H8WL 5C09A 4KZEL 1XGPA 3EYUH 2DD8H 1OB1B 3GSUA 1T22A 1XH3A 5HHQB 4Y19A 1Z0MA 4RWYH 4OCXH 5L2KB 3EHBC 3NABH 1N64L 5CLWA 3NIGF 4HMCA 5J11C 1EGJL 3TBVA 5DZNA 1JNHB 2VR4A 2P5WE 4NQEE 4P3DA 4FQIL 1MUJA 4KKCC 1GZQA 3GK8L 4LP5A 4YNYA 1NGQL 1UG9A 4OLEA 3BWAB 5H2BA 3REVB 2VQUA 4OFYA 2Q7YB 1AD0B 1WBXA 2A6JB 3TN0B 3UAJC 2HVKB 3MLVH 4BFGA 3U36B 3GRWL 3UJTH 5HI5D 4ELME 2X42A 1IZKA 3BKCL 3KAAA 3LKSB 4RFNC 3MXVH 1VFOA 4LLQA 1F4AA 2V5YA 3F7VB 2A9ML 4MNQA 4GQPH 1IM3A 4Z78A 3I2CL 4IRJA 4PJXF 4EI6B 4HZLA 1OTSC 3MNVA 2DIJA 2NZIA 5I71B 2NY6B 5DHVA 1J05B 1X44A 3HG1D 1YMHA 4HG4J 4WFGD 2VXTL 4ZXBC 3V7AG 4HS3B 3ULVD 1T0MA 5EUOA 1WC7B 3MMEA 1A9EA 1IGJB 3DYMA 1K5NB 3HE6A 2XPGA 5I66B 3A67L 4KHXH 1DEDA 2BP3A 4S1DD 1PGRB 4WWKC 2YA2A 1S5HB 5KSBB 2VNCA 5FYKE 4F57L 2R0LL 3QCVL 1K8IB 1IAOA 4KK8C 5I15L 3N0PB 5TF1L 1TNNA 3PWJB 2QSVA 3E2HB 4MJ5B 5FGCE 1FRGH 1YEGH 2E8YA 4DGIL 3NZHL 1BPVA 3AC0A 5D1QA 3MR9A 5IW1A 4Z7VA 4KDTC 4LQFL 1C1EL 5ESVB 2FB4L 5T1LB 3ELAT 1PX4A 3GMPA 2AV1B 5J6HA 1T89A 4FNLH 5C0FA 4OB5L 3BI9X 1NCWH 4WTWA 3O2WH 3HA0A 3NIFE 5D2LB 5D70H 5BRZB 1D5BB 3O4LB 1JZ5A 4JPWL 2OP4L 4PD4J 4JVPA 4NQDE 4D0BA 1S7QA 1HHHB 3FQWB 1RJZB 3C09C 5FO9A 3DO7A 3MLSH 5SX5K 2O5ZH 4U6HA 3RUGB 2FATH 5I1DB 2AJSH 2B4CH 2FH8A 3WXWH 1RVFH 2OZ4L 3MREB 5ALCH 3OGCB 2EEBA 3UCRA 4PJAA 4JREC 1IM9A 4XPBL 4XPHL 4NT6A 2FD6H 2NCMA 2EYSB 4V1DA 4PYHA 5FOBB 1J1XH 4GQ9L 3SGDI 2H2SC 1K3ZA 5F7WC 4PJDE 4EEEA 5IMOB 1KIQA 5CKGA 1QOKA 5LCVL 4L8BA 2HG5B 1JPGA 3CFIC 5E94B 2VL4A 3SCMB 3SO3B 3OAYK 3V6ZB 3OB0K 1TXKA 5HHOD 1IC5L 3OHXA 4JFOA 4X80L 4XPAH 5HJ3A 5MEOB 1CXHA 3QUZA 4EXKA 1KJVB 3FB6B 1U3HC 1YNTA 3EOBB 4JO1H 4XNUH 2X4PA 4LOUD 3ABZA 4U6VH 3U46B 1TVHA 2Q20A 3SKOA 5E8PA 4HD9A 1IC7L 2ZUYA 2X4NB 1FC2D 1F6FB 3B9KC 3LEXB 4YPGB 1CD1A 2UWEE 4UT6H 4KRLB 4PRHB 1ZGLM 4N1HB 3S37X 2OSLB 2J8UF 1BJ1J 2IBZX 2EZ0C 5DVKA 4KK5D 3DX7A 3GFUA 3OKYA 2XWBB 4LLMA 3CVHL 3MV11 2R69L 5GRVK 5HHME 1S7RB 4MXVF 4NUGH 4E41A 4UIMA 2DTMH 2Z31C 1A6PA 2EDYA 2ERJB 1RURH 3FO2A 3H3KA 5DRZB 3QQ9C 4ZFZB 4CW1B 1L6XA 1T1ZA 5FK9B 2E7HA 4LF3A 4JKLA 2AERT 3PDOA 3WL9A 3VFWA 3CGTA 4PBWD 2BSTA 4IOFD 3MJ8A 2AI0H 5D72L 1OAKL 2M1KA 4XHJC 1CLOH 2ZCHH 1FZOA 1ZGLA 1FPTH 1INEL 2LVEA 1MCWM 1JNLH 4JR9L 3V5KB 5BS0B 2CKBA 2YA0A 2D7TH 3IAQA 1JFQH 1S9WB 4GLRH 3CLEL 4D3CL 5ITFA 4U1GC 3FCTB 1WBZA 5GPRA 3SE4C 1QKZL 4OM0H 5T3ZE 4DQOH 1CD9B 4AY0A 3AS3A 5L7XL 3DUSA 1NFDB 1X5GA 5B8CC 1DANT 2DQTL 2Q8BH 2YWYA 1JTOA 2AGJL 3O2VH 1MFEL 1ZLSL 1S7SB 4FXKA 2FHCA 5E8OB 1CGSL 1VA9A 3D0VB 4H0HB 1NC2D 3FQTA 4S11A 1OARH 1XCTB 1AFVL 5BJTB 5TDNA 2XN9D 2D0FA 1CXEA 3RDTB 4YHNA 4UINH 3O3AA 2ADGA 4YHIB 4KI5F 4NC1C 4X6EA 3TGXA 3RU8L 4F7EB 4MCYA 4L4TE 1TZGL 5B3NA 3WFCH 1T5WA 1XF4B 4L5FH 3BZEB 3Q3GA 4DK6A 1NGYB 2PCPA 1SY6L 2XA3A 2E6JA 3QDMA 4LVNC 4NKOB 4WW2B 5CWSB 4LAQH 3T09A 3OAUL 3NCFB 4WV1B 2ADFL 1J9CT 3NH7L 4NC1E 1DBKL 4XWGL 3LH2H 3SDDC 3B2UD 3OJDB 3LD8C 3P9WB 3QPQC 1A3RL 1F4WL 3OKMA 4GSDL 5I19H 3VXRB 3SE3A 1EHNA 3G5YA 1RY7B 2X2YA 3DVNB 4X7EC 3WLWC 2RAMA 3MV7D 5TFSL 3MRNA 4MZ2A 4FFYL 2AS5M 3IF1A 3T3MF 5IBTL 1T1YA 4MNGA 5C8JA 5JORA 1FLRH 2KQMA 1T21A 1YEHL 3ARZA 5T3XD 1KG0B 4OD2A 1I85C 2FX8L 3IETA 2HWZL 1D9KC 2ZCLH 1Z9OA 4KTEL 4M8VA 3MSPA 1PZ5A 3H3PH 5IT2H 2MQ3A 3UPRB 1G7QA 1DVFA 1YMMA 1WZLA 4M02A 1KT2B 4PTTA 2IG2H 4Z77A 5C6TH 3S3PA 1F4YH 2QQKH 32C2B 3ARQA 5LBSL 5CJ5A 4IOIA 2I60L 3DLQR 4KUCD 1KIPB 4P5TD 4X9FA 2VXQL 1VFAA 5F3BA 2AV7A 2OJZL 3M07A 5AYQA 2DOCA 5AWNL 2GSIB 5DQ9A 4LSDA 3ZDYE 3OR6A 1G7IB 5D2NA 2WWMD 1CFBA 2YMXL 3C9NA 1YNLH 3GIVB 3VA6A 5C0JB 3ARFB 4NPYB 5DJ0A 2EDKA 1BEYL 1KXTB 1GZPA 4HK0B 1H0DA 3B4NA 3G04A 2ZOKB 5IK3A 3KPNB 2AABL 3P30H 5A2LH 1UM6L 1VFBB 1NL0L 2YPLD 4KTYA 2WSKA 1T66C 4W70A 3U2SB 5EC2B 1FVCA 5H94A 2DQHH 2FX7H 2E9WA 1IL1A 1KACB 3HAEA 3GSNB 4A6YL 5DFVD 1RUPH 2JCCE 1E6OH 4N5UA 1KN4L 2AKRB 1D5IH 5F70A 3RWEA 1MI5E 2J88H 4NCC2 4KKLC 1RZ7H 2JJTC 4OTXL 2NR6D 1RULH 3CUPA 4XNYH 5EU6D 3REWB 4BFEA 3G6JF 4RGOH 1I8KA 4PTUA 4M93C 3ZMRA 3VGAC 4Z0XB 4OI8A 3G08B 5IM7A 3MRPA 3GO1H 1UQSB 4S0SD 4RX4A 2CLVA 5I1HH 4NP4H 1AO7B 1J8HE 1T7YA 2HTKD 4M7KL 4BUGA 1RK0A 4JRYA 4M7LT 2XWJB 4X5LA 1NBZA 2OZ4A 5D1ZB 4FTVD 5K9KA 5EZLA 4WEUD 5FECB 4H0IA 4AK1A 1MF2L 3X3FL 3GI9L 4MX7A 2UYLA 5KZCB 3V6FB 5TQ2H 4O2FB 4HG4K 5B4MD 2HFEA 2XZQH 4Q58C 1BJ1H 3ZT7A 2ADIB 1HXYB 1U93A 3S6CA 2VERN 4X6FB 1E6JL 1IAIL 3GMOB 2PXYB 3ARDD 2PTVA 4EUPA 5F93C 1A0QL 3RY6A 4NM4H 4QLRA 2YD1A 4L4JA 1R5WA 1CT8B 1ODAA 3GNMH 1YY8B 3D5OF 2EE2A 2J12B 4R97B 2AXHA 3DOSA 3IU4H 1BQSA 3I3EA 4K3JL 3JV0A 5D6CA 2AXJA 2FEDD 1QBBA 3X3GH 1RZJC 3KGRA 5L8JB 5DK3A 5SWSE 1DLHA 4JHZA 1C5BL 3Q6FB 1NSNL 2VLMD 4I5BB 5GGQL 5F7KC 2PW2A 1B2WL 2B2XL 5HGHB 3CSBA 2APBA 4HH8A 4F2MB 1U8OA 1M05A 1CZ8H 4NOFA 3VXMD 1CG9B 3AM8C 1B6UA 1OQXA 5IESH 5SWQB 4Y5VA 1XGTB 4D9RD 5EZIH 3ILQC 1BF8A 4X4ZA 3EYFB 5D9SB 4WGWB 5JO5A 4PD4K 5C9JA 3U83A 2YRLA 3OWEA 3CSYA 4JZJC 2B8OT 3H42H 3TO2A 3FKUS 2ARWA 2VITB 1JUFA 5CILH 5ALBL 4ZFOA 3WCYA 4R90H 5F72S 3UDWA 1OTTC 5T5FL 1U3ZA 4NM8H 4D0CA 35C8H 1WZ1L 2NYYC 4G7YH 4U1JA 4Z7NE 4W4OC 4OZIA 5ILTL 4IHOB 4UNVA 3QUKB 1FNSL 1Q9OA 4PJIB 1E27A 1MREH 4TQEH 3W11D 1TQCB 2O5YL 4QHMA 1MHEB 3PWUB 1S8DA 4U1MB 4WHDA 3I6LE 3IT8D 1XFPA 4XI5D 1GGCL 5KBNC 4M6OL 5ACLA 4PJHF 4LIQE 5IF0A 3LEYH 3EO1B 2HJFB 1U9KA 2BCKB 4JO2H 1FYTD 3BN9D 3BPNC 3HUJA 5HHOA 5F9DC 1UEMA 5C6WH 2RGSA 3PWVB 5GRJL 3V5HA 3V5DA 4HJ0D 1X3DA 1IC4L 2BNRD 3FONB 4DKEL 2G2RA 4WFFD 2E9IA 3NN8B 4K71C 5DI8B 1CFTA 1KPVB 4RBPH 25C8H 1EHLL 5C2BL 1YY9C 1SQ2N 3ULUH 1UZ6F 5ID0A 3P3YA 3LZFL 2HT4D 5HYQB 3EIFA 1KCRL 2J1KA 4Z6AT 3SBWA 3S88L 4OGAD 5EOCJ 3L3KA 1WZKA 2XZCH 3DBXA 4ZAKA 4LSQH 2JELL 3O45A 2FR4B 1HXMA 2WBWB 2BVYA 1HILB 4OSUL 3MA9H 1JF1B 4WFHE 5JHDA 5H37H 3DRQA 4NDMB 3HZKA 3HNSH 3HLAA 4I13B 3B8YA 3FFCE 2B4CC 5IG7A 2ED7A 4WO4C 1FL3B 1TZIA 3W0WE 2WK2A 4OI7A 1JPTL 4P46B 1YEEL 3RVUD 1H8OA 4Z7OE 1KJ2L 1PKOA 3PXJA 4QHLB 3QEHA 4ZD3H 1W72L 1UH4A 2D9CA 4M4PA 3RI5F 5A16B 3VI4E 1S9YA 4JANB 1D6VL 4KJYB 1XF2A 3GUTA 3T4AA 3T4YB 1D6EB 4U1KA 5IFHL 2F19L 4X6CE 3RZCB 5GZOC 4LKXB 2H32H 5CGYC 3WIIL 5CEYA 3VRLF 1KNOB 3RL1B 3KPPA 4K8RD 1VPOH 4TVPH 3IDXL 2WM0A 1CFSA 4WTZG 4GMSH 4RAUA 1S7VA 1NC2A 3ARYA 2XN9A 2DLEA 3LRSB 3OPZH 1WFNA 5EPMA 1PKQE 1K8DB 1QO3B 4RGNB 4EDWL 1TENA 4HJJH 1R3KA 1JI2A 3ZT6A 4ZUTB 1R3HB 3EYVA 3W9EA 4A6YA 1OGTB 5ESAB 4JKWA 5GSRB 1HHIB 4Z8FH 2XY2A 4NO5A 1GGTA 2RFXB 3HE7D 1K4DB 1UJ3A 2YBRA 3PWPE 4PLJD 4E42A 1ZV5A 4JDZA 1I1YB 1QSED 3TNMA 1T83C 4NIKB 4ODTL 4ONGH 3WFEL 5KS9B 3MLPA 1RUAL 2L7UA 1ZHNB 1EZVX 4W4NA 3T3PE 1S3KL 3PP4L 4ODWB 4GH7B 3MUJA 4PP1C 1SJVA 3FN9A 3MRFA 4HFWB 5I16A 4N9GA 4M8QB 4OFIA 3KPLB 3QDJD 2OR9H 4XNMA 4M6NL 3F12B 5ADPL 2RHEA 3H9SE 1TIUA 4PRPE 5GJTH 2VR5A 2OJEA 3LN4B 2OXGA 3EOAB 4P2RD 2AJUH 4PJGE 2Z35A 1V7NL 4R7DB 3ULSA 3CFKA 4RBPK 2EDWA 5K59F 3L5IA 2MWCA 1OAXL 1ROWA 5I9QB 43CAB 4CVXA 5TE6L 3KYMA 3ARBD 1JHTB 2ADJB 3QG6A 3TJEL 4Y88A 2V7NA 4XVJL 4AEHL 1OF2A 3BZFB 1A6TA 3K81A 2VLKD 3A6OA 4P5TA 3WHXB 4EQ2A 4F7PB 4KQ4L 5IR1A 4FHBD 4JGJA 4KMLB 4KI1A 1T2QL 3PP3H 4CVWA 1Z9MA 4MD4A 5DJ2A 1DTUA 3BPCA 4WY7L 3L1OH 5C71A 3SQOH 1EXUB 1AQDA 5EB9A 3VFUB 5FUOH 4ELMB 1BQLH 2YPLA 5CJ8A 1I7RA 8CGTA 4X7TB 4Y4FD 1NCUA 3MV8D 3FJTA 3OX8A 5IB4B 4PJBE 3SDXA 4MJID 4NWTL 3MLWL 3SDAC 4EDXB 3M8OL 5IVOA 4DN4H 5EU3A 3DECA 1A3LH 5SWZD 5KVGH 4LBEA 1I7ZB 3DPBA 2R56L 2IEPA 4MXWH 1CFQB 3T2QA 3GBML 2C5DC 3IKCA 3MV7B 1U8LB 4HBCL 1JN6A 4AEIL 3NFSL 1A7NL 5KSAC 1U6AH 1DEEB 3C2AH 3V0VB 3S96B 2C7UA 2HN7B 1F11A 1H3PL 1R5IA 3MYJA 3PL6D 1ZHKB 5C0AA 4YBHA 4KVNH 3NIGE 12E8H 4YDJB 1LP9A 5T1MB 2ICCA 1WV7T 3ZKMD 1BGXL 1U92B 4M9OA 4BFIB 4NZUL 3CVIL 3VE0A 5FGCB 3QEGL 3HC4H 4AEEA 5GZNC 1WGOA 1CU4L 3U7WH 4MA8H 4N90E 5A2FA 4HIEA 1QZ1A 4HZAA 3RX7A 4QEGA 1FHGA 3DUUB 3QP3A 5FAAA 1GGBL 1SYVA 5IQ9A 1J1PL 4FFWC 3QIUD 4RMQA 1BECA 5FUCE 2Y5TB 4RZCB 4H8WH 4KZEH 4WEMB 5HDBE 3CMGA 5E8EB 3TPKA 2NY1D 1UM4L 4YHYC 3SPVB 3NGBC 3P4OA 1ZVSA 3PJSB 2ICEB 1N64H 3ROOA 2ICWA 5E1AA 1EGJH 2R1YB 3JV4B 1ES0A 4FQIH 1IEHA 4LCYB 4WUUD 1KV3A 3GK8H 1NGQH 1P9MC 4Q2ZA 4U05A 3PABB 1OTUC 3CDGA 5D7JA 4PJFA 3T65A 4G43B 3QFJA 4NO2B 3BH8A 4Y4KB 4QF1B 3GRWH 5JOPE 5J8OA 1M7IA 5I75C 4JHWL 2CRZA 3QQ4A 5DRNA 3BKCH 1C08B 1NCBL 2NX5E 1U8QA 5HI3C 5C3TA 2A9MH 2FLBT 2JF1A 4MNHA 3I2CH 4CNIB 2DIBA 1A8JH 5E03A 3EDDA 3N9GL 3RFZC 5DA4A 1OAUL 4FN0A 1YN7B 1QSFD 3PP3K 5DMJB 2DBLL 5DD5L 4PY7A 2FL5B 1UKQA 3QUYC 1K9TA 2VXTH 4YZFF 5DSCB 3BGFC 2A74A 5ICXA 5IVZB 4LSUL 5AD0B 2X9WA 1IAMA 4HPYL 1WK0A 3PQYD 3IFOA 3A67H 5EN2B 5MERA 4HUUB 5TE7L 2R1WA 4H20L 5IB5A 3CIQA 5EIIB 4F57H 1UM5L 2R0LH 3QCVH 4JCMA 3WNLA 1Q9KB 4ODUA 4G6KL 4NZDA 5I15H 5TF1H 1W72A 2UWEB 4OV5B 3TA3D 2VZSA 4FOMA 4G6FD 2VZVA 4HUXA 1DQJA 4B50A 4WDIA 4DGIH 3NZHH 3IS0X 4L4VA 4PREB 2P8LA 4AQOA 4X5WA 4LQFH 5FKAB 4XTRD 1C1EH 4GRWE 5HHMB 4JDTL 3MOAL 2BXYA 1ZHBA 1ZA3B 5DQJB 5DRWB 2FB4H 4Z9KB 1FYTA 4LU5L 1FZJA 4EVNB 1CLYL 3U0TB 2AEIT 1OSZA 4YHLL 1QLEL 4U6YB 3O4OC 2BK8A 5E6IC 1YPZB 1CICD 4UBDC 3RWJB 1XZ0B 1CXLA 2Z93B 1FFOA 1WISA 4RNRB 4Z7UF 3E0GA 5CMAA 4JPWH 2OP4H 4BUHA 1VGEL 3BT2L 1JL8A 3RWGA 3OGOE 1EFQA 3U0WL 2QTEA 3NCEB 4LMQE 4U3CA 1U8IB 4QT5B 4CN6A 2DLIA 4MCZB 3O3DA 3CU7A 2OZ4H 4YIQB 4HHAA 4R4FL 3DX6A 3P0YL 4OZHF 1WWAX 1ULVA 5EO9A 4XPHH 4XPBH 3T0AA 3AU1A 1A7OH 4ZPVB 4JG0L 4HS6B 4U0RC 4GQ9H 4JM2F 2V17L 2NXZC 4G8IA 4HIJA 4POUB 2SEBA 4OZFA 1MFAL 3P77A 1X7QB 5F89B 2NXYD 3VA2C 4HLJA 2QR0B 2R4SL 5EO0B 2YR3A 2X4TB 1XGQB 2AXGA 4M5ZL 5C08E 5LCVH 4EUPH 3VFRB 2GK0B 1CD8A 5BW7A 4TNWK 4L4TB 4ZO7A 5DGQA 2X70B 1JNHA 2Q8AL 1IC5H 5HY9B 4X80H 3T0ED 4RIRB 3C5ZD 3EDEA 3I6GA 3RNKA 4PP2B 3REVA 1U8HA 1HQRB 3VFSA 5DMGD 4R2GB 1IC7H 2NY4D 1NKOA 3DRTB 2YKLL 1KC5L 1JYWA 1RUML 4F8QA 1UB5A 1NKRA 4PJEA 2VB5A 1AGCA 2AP2A 5KVDL 2BNRB 1ORQB 1CQKA 4AEFA 2XTLA 2Z4QB 4RMRA 3QIBC 2IFGA 2R69H 3WN5C 2CSPA 1WIPA 4L3EE 5ANMA 4YGVB 1QD0A 1FYHB 2YD5A 1D5XB 3ULUC 3MBEB 4DVRL 1NLDL 1G0DA 4UUJB 2Z8WC 2PW1A 4JFXB 5T1KD 5IEKB 1WC7A 4HJGA 3BPLC 4G3YL 3MLYL 5D72H 3WS6A 1OAKH 3L7EB 1OPGL 4XCNB 4O58L 4WI4A 4M4RA 3EGSA 1QSEA 4M1CC 1INEH 4L8SC 4GXVL 5A43C 3Q0HA 4JR9H 4OZGA 2KKQA 2IJ0C 2JE8A 3DI3B 5K9JL 4EKXA 1WAAA 1DE4A 2BSRA 3WKNA 4D3CH 3CLEH 5DTFA 1OD7A 2VDML 2V2XB 5L2JA 5F7DB 4ZDHA 1A7BA 2P44B 1F6LL 5IMKB 1QKZH 3FQNA 4XNZC 4RAHA 5L7XH 3QEUA 3GSNL 4R7NA 3U7YL 3VI3F 4QO1A 4NUJA 4P2RA 2QHRL 2C3WA 2DQTH 3GJFB 4X8JA 4P23D 2AGJH 4A2MA 4CVZA 1MFEH 1ZLSH 5ESVA 2W0FB 1Q94B 1XF3A 3P4NA 3VWJB 1CGSH 4J12A 1T7XA 1M6OB 5ETUB 5FDYA 2VLLA 1AFVH 5JXED 2YK1L 5E7BA 5F1OB 2AV1A 1ZAGA 3ARBA 2H9GA 2JCCB 5CD5D 2QHLA 4JRXE 1FO0B 3LV3A 3RU8H 1TZGH 5D2LA 3B6SB 1IGYA 1I3RA 5KW9L 1MI5B 4CU8A 2IANA 2VLKA 4M9PA 3VD9A 4QYOA 2CRYA 1SY6H 4U7SA 1CFNB 4HWUA 3OAUH 2F53E 4XAKE 2ADFH 3NH7H 3VJ6A 1DBKH 2Z8RA 1LD9A 3WIFB 3RTQD 2I9TA 4XWGH 4JEGB 1T1XA 1EUTA 3HTLX 2JIXB 3R1GL 1JWMB 1A3RH 1BLNA 1TZHB 2V2TA 1F4WH 4PIRF 5HD8D 4GSDH 2F54E 4RFEA 2KH2B 3LSOA 2YRZA 2D31A 2R8SL 1J8HB 4PJ9D 4TUOB 3MV8A 4YAQA 2QADD 5TFSH 3UTSE 5HYJE 4FFYH 4GKNA 3HE7B 1X5ZA 3PGCB 5IBTH 2FBOJ 4PRNA 3RWHA 3DX9A 3PNWA 3RWIB 3VFNA 1YEHH 2UZYB 5CJOL 1MAKA 4LDOB 5SWZA 2FX8H 2ESVD 3NACL 2CR6A 2HWZH 3AXLA 5L6YL 4QY8B 4YHKL 3H3BC 4P2QD 4KTEH 4JGMA 3VXUE 4X9IA 4PRAB 2YA1A 5B39A 1NGZA 3SCMA 4CU6A 1YEFL 2NY3B 5T5NG 4KDWA 1A3QA 2XTJD 3BKJL 3CDFA 2XFXA 3IU3B 4FRWA 3O3BA 3Q5TA 4LEOB 5LBSH 4NO0A 4UB0L 2I60H 1KEML 5F1IB 3MRIB 3UTOA 1F3JA 2VXQH 1LQSR 5B22A 4GBXD 2OJZH 5F9OL 1I8LC 5DMIH 3U0PB 1P84K 2CK0L 4WVRA 1DQML 2I5YL 4LVHB 5AWNH 2DN7A 2GCYB 5CBEA 4D9QD 1JV5B 2ZUWA 5SWSB 3QUZC 4WI3A 2YMXH 1BEYH 3TJHC 4CAGA 5GGVY 2VUOA 4ORZC 4JG1L 3TIDA 2AABH 1F6AB 1UM6H 1NL0H 3MRQB 3O9WC 2YD2A 1QTYT 5C0BB 4K7PL 1JPSL 1JGLL 3IAPA 1HH6A 3U4AA 3KXFD 5D1XA 2VDPL 4A6YH 1G7LB 4CW1A 5FK9A 4TSCL 3TO4B 2Y6SD 3TVMA 4C4KO 3PWNA 1KN4H 1I1AA 2FZ3A 4RQQA 5DEFA 1FG2B 4ZUUB 4Y4FB 1MJ8L 5CUSL 4DJMA 4OTXH 3TFKC 5IJVB 3OKEA 3QCUL 3G5ZB 4G6AC 3QULB 2FWOB 5BS0A 3QB7C 2W60B 4Y2DC 4KAQL 2OL3B 4BQBA 4R96B 4PLOB 1CTOA 5IVXA 2E5EA 5IOPB 3FQRB 1GOFA 2D9QB 1AXSB 2BVPB 4WJ5B 4XP4L 1NFDA 3IGAB 3KS0H 1OOAA 2D2OA 2DF3A 3VRIB 3NCYP 4M3JA 3D0VA 5D6DA 3PL6B 3E1F1 1QSFA 2H6PA 1MF2H 4QXTA 3AROA 3GI9H 3X3FH 1H5BA 3WNNA 4NNXB 4KMTL 2VDKL 1F2XK 3H2WA 5EZJA 4FQ1L 3UTTD 1XIWD 1JZ4A 4CL7A 3SJVD 4GRMB 5F3HA 1TPXC 5BQ7A 1E6JH 1IAIH 3K0WA 4LPUA 4K3EL 1XF4A 3PQYA 4Y5YB 1I3UA 4NKOA 4M43L 2J4WL 1ZS8A 2B5IB 1A0QH 2NMSA 1WLHA 4XC3L 3O3EA 3QIUB 4YR6B 5I8CB 4HF5L 1CTNA 1LWRA 4JJHA 2NLJB 4H8WC 4K3JH 1KUMA 4I77H 3WDHA 3KPRD 1HSBB 4U1HA 5E7FA 1YNKH 1P7QD 2WNGA 3RRQA 1BD2E 1U36A 4HKJB 1C5BH 5DMYA 1VEMA 2AJ3B 4J3XA 5MEPA 1LNUB 1NSNH 4GG6F 3EDKA 5GGQH 1B2WH 1CGVA 5KOMC 5C3LD 2B2XH 1KPUA 2J3SA 4WUUB 1LE5B 5BZWB 1KG0A 2DI9A 3T8XB 1MRDL 5ENWB 2NY2C 3DX8B 1WEJL 3KLHD 2VZTA 4NQTA 4HUKB 2DJUA 3FFCB 1E28B 5CIPH 2BY0A 1CICA 2X9YA 2HVJA 1KN2L 1U8JB 5D8JL 3W0WB 2VLRA 1RZGA 4LLVB 3SDCC 2BERA 2R2EB 2H8PA 4PJ7A 2HFFA 1IEBB 1R3LB 4AIZA 4FQCL 4HEME 3QXAB 1HINL 1KIPA 1T7ZA 3ET9F 1JGUL 5ALBH 3EHBD 5T5FH 1AY1L 3ESVF 2ZUSA 4LLDB 3D9AL 3ULUF 5FYJE 3RPIB 1WZ1H 5DHXB 4X6CB 5ILTH 4YEFA 4NPYA 5C0JA 4XC1L 4Z7QE 4KKCD 1FQ9C 1FNSH 1A6AB 3KPNA 5EZOL 1XR9A 4HLZH 2O5YH 1FC1A 4D8PB 2LTQC 4DZBB 4QHUB 4N0RA 3UAJD 3U2SA 1NJ9B 5GRZA 1M1SA 5D2NC 3TZVC 1GGCH 4IIQA 4M6OH 1Q1JL 2XNAA 4HIXL 5EUOF 4BH7B 1ONQB 4DCQA 3O41A 3TA3B 2AKRA 5LGJA 1PKQB 1AHWC 2C4FU 4ZFGL 5GRJH 2FSEA 1FVDB 3T0EA 1OAZL 3LCYA 1L7IH 3C5ZA 1LEGB 1RJYA 2YC1B 4LRIA 1IC4H 3ZKXB 1OTSD 3CMOL 4XNXL 5F44A 4DKEH 3DIFB 2DJSA 3UTQA 2DMCA 3PWPB 2IH3B 2QQQA 4ZXBD 1EHLH 3G08A 5C2BH 2XQBL 4GKSB 4ODXB 3LQMA 4PJ8A 5BV7L 3R0MA 3CFBA 4FA8A 3LZFH 3D69A 4F80A 5ID1B 3RVTC 1AO7A 1TQBC 3BEWB 2ORBL 1KCRH 4Z7VF 2C1OB 4NQXB 3S88H 4WWKD 3IFPA 3Q6GL 2WWKO 2G9HB 3H9SB 4PRPB 4XPTL 2Q86A 5DURD 4KK8D 2H41A 4U1SB 3BZ4B 3UBXI 2BY3A 4PLKC 4PJGB 5KAQF 4OSUH 3L3GB 4O2FA 1X4YA 5IB3B 3QQ3A 4Q74A 5HGAB 4ZOBA 5T1KA 5CEZD 1HXYA 2E6PA 1N59B 1BOYA 4X6FA 2XYCA 1FSKC 4G7VL 4LCWE 5I1AA 2AEQL 2DMKA 2AJVL 3QEQA 1OWRM 3O6LL 1JPTH 3ZYZA 4MVBC 1YEEH 3T2OA 4BA8A 1KJ2H 4XZUB 3MNZB 5EORL 4RMVA 4KKBC 4JKPL 1W72H 4Y4HB 3MX0A 3KR3L 3WDIA 1INDL 1PSKL 3QO0A 1D6VH 1NCCL 4EIGB 4PJAF 3JWOL 3TBSB 3D0LB 4HWBL 5IFHH 2PYED 1U3JA 2F19H 1RZ8A 5C7XL 5E2UL 2HMID 3WIIH 3MRKA 3QUXB 3P9LB 5D7SL 2HT3C 1Y0LB 1OGAE 3CFEA 3KDMB 5INCB 3IDXH 4YPJA 4XXDB 2DQFA 4U0QB 1YECL 5J12B 4DUVA 1A1NA 3FB5A 2NY4B 1RK1B 4ZUSA 1EHXA 5SWQA 1ACYL 3NA9L 1AP2A 2OTWA 1XGTA 2NQCA 5SV4A 2WBJC 2EE6A 5H35B 4N0FB 2H2SD 2ARJB 5CP7B 2GFBA 3H0TA 4WW1A 5FYKL 2W92A 5K59E 1IAII 1WITA 5GGTA 1PG7W 2DM7A 4MWFB 1N8ZA 1BZ9B 3GMNB 5E70A 4YX2L 5FCSH 4ODTH 3WFEH 4CADB 4JFFE 3OKNB 1RUAH 4X8XA 1S3KH 3PP4H 1L7TL 1R3IL 3PV6B 3DO3A 4YDVA 1U3HD 4FS0A 1P2CB 2BNQD 1UWXH 3GSOB 4OZFH 2H3NA 3NZ8A 1OLZA 1FNEA 1EVUA 4M6NH 3UDWC 5ADPH 2NW3B 2ESVA 3S7GA 1V7NH 4G9FA 3RL2A 4C83B 1R6VA 2P7TB 2W07A 2EZ0D 4HS8L 4F33B 1JYNA 4JGUA 4ZS6C 5HHNB 1FFQA 1OAXH 1S9VB 5TE6H 4X6DA 3SKNB 3TJEH 3NIDF 2A6KA 2VTFA 4X5XB 3MRJB 4XVJH 3FOLB 4AEHH 5GIRB 3BAEL 3BE1L 3KPSE 4P23B 1UZ8B 2VRAA 2Z31D 4MXQC 2A1WL 2X40A 4F37F 4KQ4H 2W59A 3QQ9D 4GBXA 5GGSY 1T2QH 1CGUA 5M94B 1G7JB 5FDWA 4NNYB 1A6VL 4ENED 1WF5A 4WY7H 4ISVA 4NCDA 1A9BB 3LKPA 5D7IA 2HJKA 4PV9A 4OF6A 1CDHA 3P11L 2PO6D 3B5HA 5C0CE 3SGKC 3NPSB 1K85A 4NRZB 3GMLB 4BELD 3SOBL 1FH5L 5E24E 4HBQA 2IPKA 4H26A 5JPMB 2NX5B 5JZ7D 4P9HL 5CEXB 4FZ8L 2FR4A 3RTQB 1HSAB 3KXFA 4NWTH 3MLWH 4J4PA 2CH8A 3M8OH 4J3OC 4KHTL 4OKVA 3SBWC 3WE6B 5TDPB 2C1PA 2R56H 4XWOC 4PJ9B 1FL3A 2ICWI 3HS0A 4GJTB 4WI5A 3ARTA 1FNGA 3GBMH 4PR5A 4HGKC 3T2NL 4P46A 4HBCH 3ES6B 3I3DA 4K7FB 2OMBA 5C07E 3LDBB 4AEIH 1EH9A 5DJXB 3FHAA 3NFSH 1A7NH 1AE6L 5DHYA 3MBXL 4JQIL 4CJ1A 4KRPC 5A16A 1BBDL 1LGVA 1H3PH 2J8UA 4U7KA 5DC4B 4JANA 4Q6IA 3UMTA 4P2QB 4BSVB 3T4YA 4ERSL 5JDSB 5JLZA 1RZFL 3RZCA 5I1KL 2A6DA 4FQXC 4JFZL 2HYMA 1BGXH 2P49B 1KNOA 4NZUH 3CVIH 5J0BA 3QEGH 3P0GB 1CU4H 5DUPL 3SDDD 2GQHA 3C8KA 3FZUD 2GUOB 1CDIA 4JZNB 3L6FA 5DR5L 3TPUB 3KYKL 2FNBA 4UILL 3DMMB 4GRWB 2P5EA 1GGBH 3V9FA 4X4ME 1J1PH 1FAIL 1XR8A 3L95A 3RAJL 2R0WL 3BD4A 1MJ7L 1CE1L 4OLXL 3UTTA 1KJMA 5TGBA 1EEYA 4YLQT 4ELKA 4JY4A 4Y1AD 4GKZB 5J6GA 4YBQC 1UM4H 1OVZA 4XX1E 4ZUTA 3EJZD 4U3XA 3BQUC 1RZIB 1BX2B 2CMRL 5F7LB 4MHHI 5DJ6A 4OF5A 1HHIA 5MHSE 1UWXK 3VXTA 1D9KD 4OFKA 4GOSA 1CDBA 4UQ3B 2AK4D 4EN3D 3P40A 2XY1A 3QAZC 5C0GA 3HCVB 5T3ZL 4LLUA 3KPRA 1G6RA 2ZSWA 1P7QA 3FOMB 4MAYA 1JYXA 1INQB 2IPUG 3NCBB 4XGZB 3MCLL 4RISL 4JHWH 2DKUA 5E5MB 3BKYL 5F9AC 1NCBH 4WHCA 4BSWB 4BQ9A 4MLIA 1BZQK 1N6VA 5CSZB 3L3DA 2CDFA 4G80A 3BIBX 5J1AB 4EI5C 3N9GH 2NZ9D 1OAUH 3UZEA 2UVEA 1A4JA 2DBLH 4DZ8B 1CGYA 5DD5H 4KGLA 4D94A 1NMBL 5HXMA 2A38A 1MOEA 2HLFC 2AAVA 4NN6C 2ZWLT 1QFWL 4CGTA 1H3WM 1GGUA 4LSUH 1A7RL 4L9DA 1MCDA 4UQ2A 4HPYH 2P5WA 4NQEA 1P7KA 3BZFA 2VLJE 3O0RL 1GSMA 3WHXA 4F7PA 3OXRB 2NTFB 3QI9C 3VXSD 4GT7A 4X6BA 5TE7H 2BDNL 2BY1A 1UWEL 4H20H 4JFEE 2PYFB 1UM5H 1G7PB 5FHAL 1J1OL 1XIWB 4G6KH 1EXUA 4KKLD 5LXGL 1UJTA 1PFCA 4G6JL 5CAYB 1QHPA 3IDNA 4HWBA 3LAFA 1KLFA 3IXTA 5FA4A 4ZNCD 5F7NC 4H25A 4JDTH 5ICZB 3MOAH 1VESA 1T6VN 4LSSL 3RWCB 3TBYB 1NGPL 4AH2B 1FVEA 4LU5H 1I7ZA 3R8BB 1CLYH 5JA8B 2WIIB 5D5ME 1KIRA 4YHLH 1QLEH 2HFGL 3HI6L 1B90A 4QGYA 2IPTL 4H1LG 3K3QA 3L3OA 4I4WA 3H9HA 1Q9LB 3S96A 1VGEH 4KVCL 5D96B 4ZXBA 3BT2H 4FQJH 4R4BA 1JHLL 5DO2C 2EEAA 4MS8C 4L1DA 1MCKA 3U0WH 1D5ZB 2DL9A 3B3IA 2BXZA 3OKLB 5K33A 3BW9B 2VDRL 1U92A 4R4FH 3P0YH 2ZOLA 4LPWA 4WI7A 1TVBA 4PV8A 3VMPA 4HQQL 2DQDL 4JG0H 1WIUA 1X4ZA 5ACZB 1A6ZA 3DUUA 2V17H 1KPRA 1HKFA 1FO0L 3BP4B 3WUZA 2KUTA 5DD6B 3NVQA 2FJHA 4LCUB 1MFAH 2R4SH 3MYZA 5E8EA 3MUY1 4M5ZH 3BXNA 2YD9A 4NQCD 3QUMB 3PJSA 4JRXB 3QWOA 1EX0A 3ME0A 4DW2L 2Q8AH 1QYGL 4NQDA 4L3AA 2F53B 2GW5A 3QDGE 4QNPE 1KCSL 3ILQD 4NO2A 2PYEA 2YKLH 1KC5H 1RUMH 5ECJE 2F54B 3L3JB 3ZE0F 5MI0C 1WWWX 2P8PB 1Z5LA 4LCCC 4B7IA 4YDLB 5KVDH 1HHGB 3UTSB 4O51B 4ZOCA 5DJCA 5C0RL 1OTTD 5HYJB 4JY6A 4JFHE 2Q3AA 3ORJA 2NYYD 4HIIB 4PJDA 3GBNL 5ACMA 3ARGB 3HUJF 1RPQA 3MROA 1GGYA 1MRFL 4UIKL 5EU7E 5LAXA 1BQHG 1NLDH 4DVRH 2FL5A 3VXUB 3S8WA 2XXCB 4HIHA 3D3VE 3QG7L 3MFFB 4I9WD 4WHTB 4WWKB 5DEGA 1SVZA 4G3YH 3WEXA 3MLYH 4O5LL 5E8NB 1OPGH 4JZOB 3TCLB 4QRQA 4O58H 4P5KA 2J6EL 5I1JL 3RNQA 4GXVH 4KROC 4R8WL 4N9OB 3ROLB 2HRPL 2F15A 5K9JH 3Q5OA 4PG9B 1YQ2A 4JN2B 4Y16B 1HQ4B 4HT1L 3Q48A 1U58A 2VDMH 5AAMA 4DTGL 1U3HA 3DVIA 4UT9L 2BRQA 3VFVA 4OV5A 5F9WB 2BNQA 4APQD 1KGCE 4QTHB 2OS7A 3LQZA 4NO3B 4ZTPL 3ARSA 1MLCA 3N1GC 3QDHA 4WNQA 1TFHA 4YXLL 1B0RA 4MQXD 4QOKD 3GSNH 3U7YH 2GAZB 3B9KA 1PG7L 2QHRH 3O8XB 4KV5F 3WHE0 3VXOB 2FECL 5IHBA 3WO4B 2WINB 4HKZB 3RVVC 2HKHL 2R15A 4X4XA 4AT6B 2YK1H 1TVDA 4YC2C 2PKDA 3LKOA 4ETYA 4KXZI 2X4QB 1J18A 2PTUA 5HYSA 5K9QI 4NQVB 3QWQB 4M00A 3RWJA 2DI8A 1T03L 2Z31A 5KW9H 3GSRB 2UVFA 2OL3L 5F1NB 2P8MB 3W39A 1IQWL 1NMCC 3MPCA 3KJ4B 3CC5B 1FV1B 5I8EB 4V2CB 3FRPG 3R1GH 4MCZA 1MWAB 4FABL 3M1BA 3QHTC 4YIQA 2F58L 2M26A 4TPRL 3SGEH 4CMHB 1IGML 4Y7MA 3IDIA 2R8SH 4ZQKB 4ZPVA 5I0ZA 4LIQL 4HS6A 2MTPA 5F9JB 4WTZA 4I8DA 1P4LB 5BO1L 2LAGB 5FGSA 5GRVL 3SE4A 4C56D 3QO1A 2NNAB 5GZOD 5CJOH 3ZTJH 5M95B 5CBAB 3NACH 2K7QA 5CGYD 5L6YH 5EO0A 5B8CA 4YFLF 4YHKH 5C86A 1AGBB 3CSGA 4ODSL 2N7BA 3O6FC 1BOGB 3AREB 2WAHA 1YEFH 3CX2A 2X70A 1G7MA 4DEPC 2VIRA 3BKJH 5F6IC 1VADB 2DMBA 1C12B 3GB7B 1W2KT 4PP2A 4QRRE 1T5XA 4UB0H 4HSQA 1KEMH 3EO0B 5DD1L 3VXQB 3IS1X 5F9OH 1PJ9A 5CINL 4QRPD 1ZLVH 2CK0H 4ZSOE 5B3JE 4MA1B 5CD3A 1DQMH 1I7TA 2I5YH 4LVOB 2EIEA 4PGBA 1W0VB 5GRXG 1BD2B 2VN7A 5L2KE 4R3SA 1HIML 2Z4QA 2XG4A 4JG1H 3TN0C 5C0DB 2VDNL 3L5WB 4K7PH 3DNKA 1JPSH 1JGLH 2FYYB 4IRSB 1D5XA 2XKNB 2VDPH 5D7LD 4LPVA 3K4ZA 4JO4L 4PP1D 3G9AB 1T2JA 4TSCH 3MV9D 2PO6B 2UY6A 5IEKA 3VXPA 4KUCF 1BFVL 1I85A 1C16B 2E3VA 1D9KA 1AGEA 1MJ8H 3OAZH 2LU3A 5CUSH 5GGSB 3BISA 3S9DB 5I71C 2NY6C 1DQDL 2FJGB 4NBXB 3QCUH 3KJ6L 4OGXL 3ALXA 1Z9LA 3TIEA 3N1MC 4I0PB 4KAQH 4ORGA 5GS1B 1ZT1B 1T0PB 2YSSB 1F8TL 4GW4B 4HUNB 5GRWA 1JF6A 2RQ8A 1ZA6A 1T7WA 2V2WA 4XP4H 43C9B 3SDXF 1X5KA 2ZCKL 3MRDA 4YHPA 3B43A 3RIFF 1T7VA 3ZYOA 2FDBP 1UACL 4LDEB 1LDPL 3Q1SL 3DTXA 3E2HC 5F6HJ 5HHVL 5B38A 2ATKB 1A1MB 4KMTH 1B6DA 2VDKH 1KXVC 3GSQB 1OCWL 4FQ1H 1M7DB 3E6HB 2P48B 4K3EH 1JNNL 4H1LB 3D85D 4M43H 3X12B 2VABB 1G7HB 4YH6A 1PEWA 2J4WH 5IWLC 1LP9F 2DLHA 4KPHL 4XNQB 4NC0B 4XC3H 3E6FA 2JIXA 2R4RL 4HF5H 3GGWB 1I1FB 1ETZB 4Y1AB 2JJTA 3BWUC 3VFMA 1J8HA 4PGDA 1YUHB 1JYVA 4YWGL 5GRUL 4MD5A 1ND0B 3O4LE 5GHWL 2GTWA 2AK4B 4EN3B 1JZ6A 1MRDH 4QY8A 1HN1A 4MNQE 1RHHA 2GJJA 1WEJH 3ZE1F 2MKLC 3L7FA 2ED9A 4ZO9A 5GZND 3RUGE 2GITB 2QL1A 4JO3L 1JHKL 1HOCA 4HDIB 1KN2H 1R24A 4AL8L 4LCWB 3MV01 5D8JH 4LHUA 5T33L 1N5AA 3DSFL 3B9AA 4ZYKB 4CMMA 5AZEL 1CR9L 4FFWD 5FF6B 2Z8SA 4LEOA 4FQCH 3AB0B 3MRIA 1HINH 3R8QA 4LHQB 1JGUH 3SCMC 2DWDA 3SO3C 2F8XC 5CZVL 4N5ED 3U0PA 2E7BA 4RMSA 1AY1H 3QH3B 5I1CL 2J6EA 4OCSL 3D9AH 4QWWC 2GCYA 2EYRB 2WBKA 3IDYB 1UCTA 3RIAF 4U6TA 4XC1H 3D39D 3C5SB 1HEZA 1NGWB 1V3LA 3QRFM 3NTCL 1M71B 2ZG2A 3VW3L 5EZOH 1OTUD 2OR8A 3K46A 4IMKC 1OGAB 3SGEI 3MRQA 3OAZK 3QBTB 3VG0L 1UB6B 5IB1B 3DV4A 5IBUG 1YA5A 3AS1A 2QJDA 4OF8A 2E7CA 2X5PA 3G6AA 3R06B 1Q1JH 4HIXH 4NQCA 5ISZD 1JRHL