2J1YA

Human p53 core domain mutant m133l-v203a-n239y-g245s-n268d
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
195
structure length
192
Chain Sequence
SSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCYSSCMGSMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULAR TUMOR ANTIGEN P53
publication title Structural Basis for Understanding Oncogenic P53 Mutations and Designing Rescue Drugs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
total genus 43
structure length 192
sequence length 195
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2j1yA00
4HJEA 4AGPA 2ATAA 3D06A 1EAOA 4MZIA 2J1XA 1HJBC 2MEJB 4IBSA 3TS8A 1EANA 2J20A 1H9DA 4L0YA 4GUOA 1GZHC 4KVPA 5A7BA 2XWRA 1CO1A 1HU8A 2YBGA 3WTVA 3EXJA 3US1A 5ECGA 1GZHA 2BIMA 2J1ZA 5AOMA 4L0ZA 2ADYA 3QYMA 4AGOA 3IGKA 3VD1A 1TSRA 4A63A 5ABAA 3WTXA 4G83A 3D05A 5G4OA 1E50A 2X0VA 3D08A 4IBYA 4AGQA 2AHIA 2FEJA 3US0A 5AOLA 1IO4C 1YCSA 3Q01A 3D07A 2X0WA 3WTSA 3QYNA 1EAQA 4IBQA 4IBVA 2J1WA 4LOEA 4LO9A 2BIQA 5KBDA 4IBTA 4AGLA 3Q06A 2J21A 2RMNA 5LAPA 3KMDA 5AB9A 4GUQA 2BIPA 2J1YA 4IJTA 4IBZA 2X0UA 1KZYA 4IBUA 4MZRA 2PCXA 3IGLA 2IOOA 2OCJA 3WU1A 4L18A 3D09A 2IOMA 4QO1B 3WTYA 1LJMA 3VD0A 3WTTA 5LGYA 2P52A 2H1LM 3KZ8A 3Q05A 4IBWA 2AC0A 2GEQA 5AOIA 1CMOA 2XWCA 2VUKA 2IOIA 1T4WA 3D0AA 5BUAA 3VD2A 5G4NA 1HJCA 3ZMEA 3WTUA 4XR8C 2BINA 1TUPA 5G4MA 4AGMA 4LOFA 4AGNA 2J6WA 2WGXA 4G82A 3EXLA 3WTWA 5AOKA 2BIOA 1UOLA 5AOJA
chains in the Genus database with same CATH superfamily
3BWSA 3DGDA 1VGEL 1KB9K 3LAFA 4FFYH 4AUUA 4M7LL 4ATTA 3LMJL 2YRZA 4TVPE 1ZHLA 1F00I 3C5SA 3M8OL 3BD3A 1S7QA 5MERB 5HGHB 3WIHA 3KDMA 3U30B 5FA4A 4ABVA 1W0YT 5HYJE 3RAJH 4FFYL 4FJ6A 4IRJD 1CO1A 1L6XA 4XT1C 4Y2DB 1L5GA 4EQ2A 4ZFOB 5E2JA 2X89A 3OX8A 5I1LA 1HSAB 4B9FA 1IQWH 2V7HB 3RAJL 4QRPE 4XN2A 5I16B 1RZKC 1UD2A 1SM3L 3DJ9A 1CFQA 5JIHA 3U7WH 2DYPD 2QSVA 4A7VA 5KOMC 4HK0A 4BH8B 3MRHA 3ZL4H 4KV5E 5CCJA 1BD2E 1IQWL 3CHOA 1JNNH 2XDHA 1ZJBA 1T3FB 2VOTA 3PXJA 3GF8A 5M94B 1WYJA 3FT2A 1P84J 3U7WL 1EXHA 4HKXA 4PJDF 1B3JA 5AAWA 3JVFC 3ZL4L 4BUQA 4FGMA 1JNNL 3AG3B 5EBMA 4KROC 1E4HA 2VXTH 4WW2A 1YRKA 5DJ8B 2YD7A 1OP5H 3INUH 1EZSA 2X2UA 3QXDB 2YRLA 4H4NA 4AQ1C 2Y69B 3X14A 5MENA 2F0CA 4HS3A 4WW1B 3V55A 3ILQC 2VXTL 4WWKA 3L3DA 5IHWA 3KYMB 4TKWA 4YPJA 3RX5A 1T22A 4FS0A 1DJHA 3INUL 5B21A 2OL3H 1F3RB 2Q6WA 4OKVB 5I5IA 1WH0A 1QR1B 1ZANL 4UQAA 5IB1A 1UWXH 2BNQE 3EDKA 2ZX9A 3T65A 3IJ9A 3MJ9A 4NQSA 4I18C 1OGAB 5ITBH 4XRCA 3L4VA 4XZUB 3WELA 5E5UB 2OL3L 5BRZE 1E4KA 4J4PD 3WIFA 3QCTH 3QDMB 2DW5A 1EFXD 2W60B 2YRPA 3Q6GH 4XHJC 3SOBH 5CLWA 3TA3A 3BYTA 1YEKL 1U6AH 1ZT7B 5EO9B 2N01B 5ITBL 4LGRB 4E9QA 2Y3AA 5JZ7C 1VESA 3QH3A 1UKTA 3QCTL 4KXBA 2IMMA 2VZSA 3B2UC 3Q6GL 2NRDA 1KYAA 3SOBL 4EUPH 1U6AL 3IPBA 1AKJA 3AGWA 3GZQA 4E9RA 4HEME 4IDLA 4JFEE 3BXNA 2WNWA 5ADOH 4GI6A 3FT4A 4WSKA 5DQ9B 4J27A 5AW8B 4K4KA 2EP6A 3N85H 2FAUA 4K5LA 4EO5A 3HS0C 1AQMA 1GSMA 1N64H 2CHZA 1IGJB 2CJSA 5ADOL 2BINA 2GTWA 5KYNA 3N85L 5D1QA 3ALXA 1RZIA 2NLJB 3ISWA 1N64L 2UXGA 3MBEB 4L1TA 2H3NB 5CN2A 3QG6A 4V2CB 4NIKB 1AO7B 2C3XA 4N22A 2IGTA 4ZUSA 4AIZA 4BFNA 2Q3XA 3P4OA 4BSJA 4G8AC 3GJFH 5FB8A 1W0WA 2IANE 4AH2A 4JGUA 4NQCB 1XGPA 3OMZA 5DQDH 1T0MA 4JFPA 1P2CB 2D0GA 3EBIA 4HP5A 1OSEA 2V4LA 4Y2OA 3B8YA 3MRRA 2WWOA 4X6DF 3AADB 7PAZA 1GY2A 3OXRA 3NGBC 1GZHC 3V0EA 4YBQD 5DQDL 1WWCA 5LCVA 3QEQE 3SJVA 3L7EB 5C0EA 2BOCB 3T0VA 3MACH 3PL6D 4Z0XA 2A4EA 3WENA 1YN6A 3FUMA 3VRIB 5EMYA 3WXVH 5J11B 3TCTA 3O0RH 4WWOA 5IBUB 4DZ8B 1U41A 1J05A 3MACL 1Y6MR 3ZKND 4HIIB 1HZHH 4HXAH 4FXKB 4GRWH 2G4GA 4PWIA 3L5HA 3WTXA 3FJTA 1SJMA 1WFOA 1EV2E 3O0RL 1UENA 2PYEA 1BZ9A 2VDLH 2J5LB 4HCIA 4HXAL 1HZHL 2R83A 2VDRH 3GTVA 5AVZB 3I02B 1BXUA 2C9SA 2R4RH 4QF1B 2HKFH 3WKYA 1H3UA 4RSYA 4XMVA 1DSFH 2QEJA 1MJ7H 3C6LD 1N59A 1H3PH 2VDLL 4NPYA 1CL7H 3VRJB 3CE1A 3EZJB 3T1FA 3N40F 5C0FB 5LBVA 2R4RL 4B6ZA 2HKFL 3UCQA 3EYOA 1NFKA 1DSFL 1MJ7L 3RDTC 3Q8BA 2QGBA 1H3PL 3Q1SH 1CL7L 2X53A 3ESMA 4U6VH 1HKFA 3JTSB 2QMKA 2V7NB 3FCTA 1IUZA 1QPPA 3O6FB 3PWPE 1KGXA 1S9VA 2BW4A 3QDGE 3C6SA 4OLWH 3Q1SL 4X9GA 5CXPA 1T7ZA 2WBXA 4PTUB 1A6TA 3AXLA 2VDQH 4U6VL 2XYCA 4IBUA 2Y23A 2PCXA 4X6CE 4Y19B 5EEUA 2K6ZA 4WI5A 3S97C 4DKTA 4NUGH 3J8F7 4YK4C 3SKOA 5B3SB 1NCBH 2NSXA 1AGCB 3S3BB 2I9TA 2VDQL 3WTTA 1JUFB 4P46A 4MD0B 1HFUA 3NN8A 3QYCA 4ODVH 2V17H 5H37H 4NUGL 32C2B 4PJCA 1TG8A 4R4BA 5EZOH 1NCBL 3KH3A 4APXA 3EG9B 1E4XH 5EULV 2VUKA 5AW6B 1FZKB 4P4KD 1XF5B 1MG3C 2V17L 2I7SA 5EZOL 3QQ9D 1E4XL 2UVEA 4UTCA 3UPRB 1F18A 2HT3D 2X44D 8CGTA 2B3IA 4MJ2A 2VMEA 3ASOB 4GT0A 3ZYOA 1U0QA 4WSGA 1BEXA 4V33A 3MRMB 4DN4H 4N2MA 1OE2A 2DEWX 3IDMA 4PVBA 4GXVL 1OAJA 1LE9B 5IQMA 3SY0A 4JM4H 5D2LA 2BWQA 4AYGA 5H35A 1VIWA 2WBJD 3WN5A 4P2OC 4C55A 1JNLH 2X4NB 1JERA 4IBSA 4JM4L 4PFEA 5JQIB 3AG2B 4KXZI 4E42B 1EZVY 4WFED 3BQVA 1J9RA 3ECBA 3BWAB 1BZDA 2HXAA 3A24A 1JNLL 1R5IB 4H25B 3LKSA 4PJ8C 1KF9B 1JPGB 3AXHA 4JFTA 5C0GB 5KZCD 1PD1A 1WBYB 4LE8A 3TO4C 1QLEB 3UYPB 2XA8H 1OCWH 3GMOB 3DVIA 3J07A 4L05A 4LPWA 2XU9A 5EU3B 2X4OB 5E4IA 2ESVD 3W9DA 2X41A 3D0VA 4N8CH 5SWSB 3U36A 5EZJA 2XA8L 2O6PA 2ZCKH 5H2BB 1OCWL 3APNA 5BQDA 3X13A 5K9JH 4OZHB 1MWAH 4Q89A 4TSAH 4AKOA 1JDDA 4N8CL 4NO5A 2X1WL 1ZLEA 3IGAB 4PRHA 1HH6A 1MWAL 5HD8D 1QVOB 3Q2WA 3DUUB 4TSAL 3ZKMD 5DJZA 1T1WB 3V6OE 2YD6A 1A02N 3RZCB 4EIGB 1U93B 2PLTA 4KJYB 4Z7AA 2YKLH 1YEHH 2CNZA 3KR3H 1CF1A 3PQYB 4ICXA 1VGKA 2G3NA 3AZUA 3EUDA 3K8LA 4OF3A 2YKLL 4X5LA 5I8EA 2Z34A 5EORH 1E9QB 4P99A 4ZZFA 1YEHL 5JOFA 2P5EA 3KR3L 3QUYB 4CVXB 1BMWA 5J13B 1I7RA 3AU0A 3QWQB 1WGOA 1Z6JT 1QFWH 2ARJB 3E0GA 4UQ2A 3V9FA 1T0PB 3KBHE 3HC4H 1D5RA 2HVJA 5EORL 5D1XD 3EUUA 2IOOA 4E41D 1QFWL 5K59F 2JJSC 2H26B 3HC4L 2ZAHA 4JO5A 3UMTA 4HHAB 4NN5B 1EO7A 3IMVA 4WTZG 5FX3A 3PNWB 4N0FA 1ILSA 5DFVD 1KBGH 3VWJB 3HG1B 4DKAA 2FSEA 2K7QA 3BQUB 3V10A 5FF6B 3CBJB 1Y18B 2YSSB 3K0YA 2BSCA 3E7JA 3QWRD 3AQDA 2OMWA 2X2YA 1KBGL 3CDZB 5HDQH 3SEPA 1S9WA 2W91A 4KHXH 4P2CG 3WJMB 3GRWH 4EI6A 3MRJB 1Q0XH 3C08H 4EEEA 1U8CA 4WI0A 5HI4C 3NFNB 4ODUB 4B3EA 2KLTA 2YLHA 2YPLA 4LHQB 4QXUH 3VSUA 4OGXL 1GTNA 2XNAB 5HDQL 4KHXL 3GRWL 1X5XA 4FFWD 3ZL2A 1Q0XL 1U8KB 3C08L 3FQWA 2WO3B 1T2JA 3BOVA 4QXUL 5A7EA 5CD5C 4HZAA 1WAAF 3EO1B 3IMWA 5FYLH 3ZE2B 4XZ4A 2ZIDA 4MX7A 4KZ0A 1OOWA 1RSYA 3KPRE 1D2PA 1VEMA 2BNUB 1Z7JA 3OTTA 5FYLL 1R5VA 2QV4A 4G9FD 4N8VB 2APVA 1NBYB 1B4JH 2ZONA 4NCC1 4NQVB 2EEBA 1PYWA 3D69A 4XVUD 4J1UB 1SDYA 2JK5A 2DLEA 3IJSA 1B4JL 3F00A 2Z6FA 1YN7B 4GNKB 1TJMA 4HMCA 1NBQA 2B7DT 1E5UI 5ICZA 1BZ7A 3R4RA 2CAKA 2IQ9H 3ETSA 4X4XA 2VZ3A 5E9DD 3RGVA 3UTOA 1WUNT 3U2JA 5BNXD 3GSWA 4LSUH 4ZPVB 4JN2A 1AOZA 1NAMH 4GFXA 2PXYA 2NZ9C 3AACA 2IQ9L 1D9KD 4FFZH 4N2DA 1A6PA 1KDJA 3U6RB 5E5RB 1UJTA 3EDDA 2Y1YA 3L3IA 4LSUL 1QAWA 2PO6C 3LXAA 5GGTH 1NAML 4KDTA 3B7SA 3QUKB 4FFZL 3FU0A 2ZAIA 1SHSA 4P2RA 3WBDA 3IFPA 3SE3A 4WK0B 4W93A 5GGTL 5E24E 5DD6A 2PPEA 4NAMA 1FE8H 4OLXH 4YPGB 4NZ8A 3G6AB 1HYRC 3ECWA 3QFDA 3O3BA 3TH4T 3MRGB 4XXDB 4IRJB 4IIQB 4G70B 1CK0H 1YVLA 1FE8L 4OLXL 5IMKB 3CUPB 2VQUA 2XC8A 1KN2H 4P5KB 1BP3B 1AR2A 3GSNH 1CK0L 3EIFA 3SYPA 2ZJSH 1B4TA 1DP0A 1DYZA 3Q8EA 5DWPA 3RIFK 1KN2L 2IDTA 3I6LE 3QJHB 2CBOA 4LSSH 3JWOC 2AQ2A 3GSNL 5LN4A 3T0ED 1AMYA 5ABDE 3ARYA 3CFJA 1S9XB 1O75A 2WOYA 3LQAH 1AS7A 4MNHA 3ULVH 2ZJSL 5HDLA 3MUGA 1TPXB 3SDXF 1TEGA 1U8QA 4IRZH 2G2NA 4LSSL 2YUXA 2Q2LA 4K3JH 5HPMB 4PJFA 3BZFA 4IOIB 4OLEA 1F45A 3ULVL 2FDBP 2ZXEB 4TQPA 4K7PY 2PP7A 4IRZL 3W11D 3B7UX 1F0LA 4K3JL 3IAQA 3Q5OA 3A47A 1HINH 1WC7B 2OCCB 1HJBC 1G1OA 4HMEA 4D9LH 2ZZUT 1NEZA 2XKNA 3FB6B 1HINL 3WJJA 2CHNA 4TNWK 3W3BA 5G5DA 3ZOAA 4OCWH 3LN4A 4YMPA 3P3SA 1EFXB 5CEYB 1EH9A 4GEJA 4PR5B 4D9LL 1Q9WB 4O4YH 2BY0A 5F9JB 1AZUA 5E1GA 3IBOA 3STZA 3BH8B 2VERN 2AJUH 3JXAA 4OCWL 3SBQA 3PXLA 5AUMA 3RG1C 4O4YL 2R2HA 3ZZLA 1OTSD 2AJUL 5JDSA 4CC1A 3U46A 3SJVE 1SXSA 1WIUA 5DUMH 2K9UA 4Y5XB 4KKAC 5ALBH 5TDNA 5D71H 3D18B 1FFPB 3NJHA 3FK3A 4U1IA 4WO4A 4UT9A 4F7MA 5DUML 4G5AA 4IMKC 5ALBL 2WBKA 2UUDH 3DRTB 5E7BA 1LK2A 5D71L 4GH7B 4L3FA 5CU5A 2FT7A 1CFBA 5C6PB 3ISRA 2ZUTA 4XGZB 1F4AA 3MRCA 2LE9A 4KPHH 4B53A 1MY5A 2PYEE 1S7UB 1RK1B 1D5MA 1IVTA 4Z3TA 3QFGA 4ZOBA 2AEWA 4HULB 3EYVA 4G8GA 4DK5A 4ICWA 4I2XB 4U1KB 3RBSA 4RVBA 3VMPA 3RX7A 1JGUL 4KPHL 4S2SA 5HHOA 4R5TA 1VADB 1QLFA 4BYHA 2ZNXA 2K8QA 2ZSWA 4F7CB 3K8KA 1GMIA 3IFOB 5IBLD 1QNZH 3MA7B 3HUJA 4B7IA 2WYZA 4XNZB 4EF3A 1UWFA 3PL6B 3D87B 1IEHA 4KGJA 3C5JA 1TJIH 2CNYA 4ZOCA 2VO5A 1RP8A 3HZVA 3V0HA 5BUPA 4RNRA 3LKRB 5DI8B 4PLJD 4WEUD 3T08A 1OQXA 1TJIL 4ONGH 5I9QB 3JWDL 5HYQB 2X1PA 4D3CH 3B56A 1CZ8H 2VM3A 4Z7UF 1GHFH 3LRMA 4F8OA 1UB6A 3WFDH 5J1TC 3SBPA 2ERJC 1J7VR 2AV7A 4ONGL 4PJCE 1T1XA 4OZ4B 1CZ8L 1GHFL 3K3QA 2XI9A 3HHRB 3WFDL 1NL0H 4EDXA 2LQRA 3GMRB 3F62A 3CH8A 4WWPA 4NAJA 1V55B 2CK0H 4HISA 3L3KA 5F3HB 1UXSA 2YAEA 1IKOP 2XQYA 3GS7A 1NL0L 3GSRA 4PWEA 5AL0A 5E1HB 1OALA 1QSFA 5HYSA 4CBZA 5DD0H 1WS7A 2CK0L 4IRSD 4OUUB 2CDGA 3ZY7A 4TL4A 4LAJH 3N44F 3NJGA 3MJ7A 3OJVC 3KLSA 5D2LE 3BVNB 5DD0L 4ZFGH 3FB5B 2AJXH 4PG9A 3SE4C 3D3VA 4B9ZA 3MREB 2F58L 5C9KA 2XV0A 3MRIB 1L7TH 1RK0B 1PZAA 2XG5B 2O61A 2AANA 2HVBA 4L3CA 4ZFGL 1XR9A 2AJXL 1B2WH 5KYYA 2PPAA 1GSKA 1L7TL 5T1MA 3ZDYE 4QKTA 2P8MB 3NMEA 4FQJH 2NW2B 1UXLA 2IV9A 4IBLT 3WS3A 1B2WL 1MJJA 4XCEA 5D7SH 4B9IA 4DZBB 5GZOC 1CD1A 1FZMA 2QQLH 4QMEA 2VZTA 3MBEC 3UPCA 2DIAA 1KCVL 2X9XA 4FQJL 4UUJB 4WDIB 1CDYA 1QR4A 4QJ3B 2BIQA 2N1KA 5D7SL 1R4XA 3VFTA 4JZJB 2G3ZA 3SPJA 5IMOB 2QQLL 1K9TA 2Y36H 3QIWA 5FKPA 2DTML 2AEPH 5GXBB 3QUZA 4LSDA 5H8DA 2BC4B 1DBJH 2MQ3A 4PRHE 2OMYA 1CFNA 1HK6A 2Y36L 4PJ5A 2YD2A 3W2DH 4AJ0A 2AEPL 4Z7WB 1DBJL 5JW4R 3FFDA 3DROB 3IRZA 3MBWB 2EXTA 2A2QT 2Y6TE 2JXMB 1Q9KB 1SY6H 3W2DL 5KZCB 3LY6A 4L4JA 5EBWA 3JWNG 1HILA 3TM6A 2P5EE 4ZS7H 2IXQA 2MQ0A 4BQBA 2BRRH 3D34A 1J1XH 1SY6L 3QXVA 4M29A 1ETA1 3BH4A 3AITA 4HJJH 4AENA 2IDFA 3HIZA 2VRAA 4ZS7L 5FOJA 2BRRL 1MNUH 1J1XL 3IJHB 5JW4N 4HJJL 4QRPD 1S7VA 4BCYA 5I26A 1S8DA 1A3ZA 1M7IB 1CU4H 5I30H 4KKZA 1MNUL 4AYID 4MS8C 1L6PA 1MLBB 1NCCH 2CRZA 4R7NB 4F20A 5D7JC 2EZ0D 1I7ZB 1JWSB 3B2MA 2R1YA 5J56B 3SQOL 1S5HA 3EO0A 1CU4L 4NRYA 5I30L 4H8VA 1P5VB 1P4BH 3D51A 4FQPA 5F72S 4HFWB 4NRXB 1J5DA 3C5XA 3TYFA 1NCCL 1BXXA 5F7EH 4N0UB 1DJWA 1A4JA 3WNIA 1B0IA 4LQ1A 3ZUCA 4XMUA 3WAJA 3K6SA 3JYCA 1P4BL 2JKRM 4IU2A 1RZ8B 4PJHF 5F7EL 3BP6B 4MDJB 2YPLE 4YLQT 2E0PA 1MUJB 1ZV2A 1KG0B 4YHIB 5D1XB 3TWYA 1E3ZA 1SFDA 4YN3A 1XMWA 3SGJA 5B38A 2ZWZA 3O6LH 4DVBB 4LCVA 4PGZA 1OAKH 2BNQD 4B9CA 4LEOB 1ZXKA 2GY5A 3O3DB 1ETZB 1UM5H 4Z78B 3MROA 2EKJA 5BRZD 4IEFB 3O6LL 1XSKA 4OT1H 3T2PA 4NI3A 4XTRC 1OAKL 5JIPA 3Q6FA 2BPBA 2VDNH 1UM5L 2KS0A 3A67L 4H26A 1F2XK 2CKBL 4OT1L 2HG5B 3IDYB 4P23B 1EEZA 4YR6B 4GRWF 3VA2C 2VSCA 3WAKA 3DYPA 5LDUA 4U4BA 2G0KA 2H41A 2VDNL 3ML8A 3GMLA 3DO4A 4K71C 5KYWA 1MCIA 1T21B 4JFED 1UOWA 1Z5HA 4MS6A 3LQMA 5DZJA 1YUHA 4OI7A 1WWAX 3WS6C 1T5WA 4AI7A 3QORA 4JGJA 3CSTA 5EO1A 1LL1A 4WV1B 4FA7B 1RFDH 4ZJ9A 3FB7A 3NSJA 4CNIA 3NVQA 2WQSA 1KY6A 3Q8CA 3HMXA 1RFDL 4WCYH 3QBTB 5DCCA 4MLSA 1BEYH 4O9HH 2MNWA 1ONQA 4TOYH 4NKDB 5EO0A 4R0LA 3U9UB 5EOCH 5EF3A 3B9KD 5DGRA 4DFHA 4J3OG 3NZ8A 2P46B 1M53A 4WCYL 2IAND 1BEYL 4O9HL 2X1QA 1T4KB 4AM0A 1C5BH 4TOYL 3P2DA 5LHDA 1DQLH 1MCWW 5EOCL 2Q10A 4IBWA 3QQ3A 5DA4A 4P2RE 1E4WL 1A1MB 2AAVA 2VLJA 3H7BB 1C5BL 1NBZA 1UT1A 1J0YA 1DQLL 1MJ8H 1FFOA 4O51B 5GGRY 4EVNB 3JV5A 5F3FA 3GLEA 2V3DA 3EYFA 2DLFH 2EC9T 1QP1A 1E6JH 3T8VA 2AQSA 1MJ8L 1JF5A 2ZYRA 2C9UA 1CGTA 2YAFA 2A0LC 1EGJA 2DIEA 3IVKA 3FFOA 2DLFL 2EDOA 2UWEB 1E6JL 3DETD 1P4LA 3DV4B 2XWEA 5AZEH 4X5RA 3UO1H 2B59A 3QUYC 1NCUA 4XO8A 3S34H 1TMQA 2ATPB 1DANT 2QJDA 2CMRH 3ES6A 4L1SA 4EQ3A 3QI9D 4HDIA 4FQ1H 2X4UA 5AZEL 4W9HC 2EVHA 3BI9X 2H1PH 3Q0HA 3RL1B 4PJFE 3UO1L 5LGKA 4R96A 1R5WB 3S34L 5LNEA 3FT1A 2MCPH 2CMRL 4MNGA 4PVNA 4FQ1L 4L1HA 1DVQA 1L0XA 5EIIG 2NY1C 2H1PL 4LSQH 4RH4A 4WO0A 4WKXA 3TA4D 2VTFA 1Z5LA 2X7LA 3DLQR 4NN5C 4QWWC 2MCPL 3PWPD 3ZTNH 2AXJA 4LRNH 3QDGD 3KM1A 4LSQL 3SYQA 1ZV5A 1E50A 3WUWA 4RLDA 5FECA 2JTYA 3ZTNL 4HD9A 4L23A 3VSVA 4BXVA 3NEXA 4LRNL 1VFUA 3TIDB 3DX7B 5T1KA 3BO8B 1M7DB 3HE7D 3T0EB 3ULUH 5EOTB 1AXSA 1JN6B 1NGPH 2DQMA 4OF0A 4N5EC 4P06A 2OTUB 2EXSA 3ULUL 4IGBA 4U7MA 1NGPL 4HJ0D 1FGVH 2VR5A 3VDCA 3ULVC 1X5AA 3VU1A 1VZGA 3OR7A 2GW5A 4DGYH 3KMDA 2YKKA 3BKYH 5D5MB 4LCCB 4MA8H 1O5DT 4HD5A 5DHXB 7FABH 3S36X 4YS4A 4U1SA 1LO5A 3THMH 1FGVL 2OCFD 4L2LA 1N8ZB 4JFVA 5ID1B 3R0NA 4RZCB 1T03H 1OTTD 4DGYL 5E00B 4ZUVB 3H9SB 2ZOWA 5FCSH 1I4FB 3QT2A 7FABL 4MA8L 3TF7C 1BQLH 1FNGA 2XQYK 1I31A 3E1F1 3NCYS 4C56A 2YQ3A 3OXSB 1Z9SA 3THML 3MRNB 4NHCH 1JV2A 2PCFA 2GITB 2P5WB 2EO7A 1SFHA 3LNFA 4NUJA 4DH2A 1D7BA 1Z5YD 4A7QA 4ZFFB 2JH2A 4X50A 1T03L 1XSOA 4CKVX 5F44A 1BQLL 2NY6B 3BIBX 4ZTOL 1YQVH 4G8GE 1A6ZA 3BPLC 3SDYH 4NHCL 4OR1A 2JSFA 5HHOE 3F3HA 2CA3A 1FCCA 1PKOA 1VDGA 3MO1A 1LEIA 1UA7A 1YQVL 3KBEA 3SDYL 1I1RA 4AG4H 5GRVL 3HUJE 3KYOB 1G9HA 1N7MH 5D1ZB 1J5OH 3MSPA 4JMXA 3N1MC 1E27A 2J6WA 2L8AA 2VDPH 4QY8B 5C08A 1T5KA 4AG4L 3EOYG 3KDPB 3ZDZF 2KI6A 4WNJA 2QQNH 4ZO9A 5DTFA 5GS3A 1N7ML 3G5XB 4YL9A 4Z23A 3BVUA 2P80D 4ZMAT 2VDPL 4RMVA 4Y5VA 1HE8A 5DD3H 1MHHA 5BMFH 6PCYA 5D9SB 2QQNL 3RB5A 1J5IA 3L5WB 3VI3F 3VXSA 3H3PH 4V2BA 3VXPB 4Z3FA 3FTUA 1VACA 2XN1A 3L3GB 3ARDC 2YOCA 2F9BT 4GKSB 5DD3L 4EI0A 2YO3A 5BMFL 4QCIB 3HE6A 4YQXH 1JCKA 2FLBT 3VFPA 3L2LA 3AM8A 3D85A 1KY7A 3H3PL 3IDGB 4O5LH 4IRJC 4PBDA 2VERA 1M7UA 1U8MA 2CU9A 4Z77A 1KFAH 2QT6A 3AROA 3WKPA 3BFQG 2RA1A 2VAAB 4NUPA 4HUWA 4PVMA 1RZFH 3M88A 5C3TA 1OB0A 4O5LL 4LNRA 4J28A 3PHOA 4Z7VF 2ZD0A 1KFAL 3T0DA 4X6BB 1YY8A 1QSFE 5I1KL 1LD9A 1RZFL 1SYVA 1PGRB 2BSRA 1DBMH 2CGZA 3QXUA 4GSRA 5F1OB 4HSQA 2A4ZA 3BVDB 1QWUA 1MREH 4NM4H 2RFXB 2JI3A 2L7JA 4IS6A 5EU5A 3V0VB 3Q2CA 1DBML 3JWDC 3D3VE 4XP9H 5BZDB 1ZLUH 2A73A 1MREL 1UCTA 1UKQA 4K3HA 4NM4L 1B4LA 2KH2B 4I48A 4LCWA 1I82A 3Q1EA 2AJ3A 4XP9L 1GXEA 1B0GB 1TO4A 1NGZA 2HVKB 3ARGD 3GI8H 1NFDB 1OHZA 4KKCD 3ILDA 3BVTA 4NLAA 2IPTH 4ZXBB 3MRPA 4ELDA 4ETQA 1Y0LA 1BOYA 4LOUD 2J6EH 1NFIA 3GI8L 4ORGB 4Y4HA 4EXPX 3F7YA 3OKNA 4IKIA 4ZTEA 3CFTA 3FB8A 2IPTL 4C83A 3QRFM 43C9B 4PJDA 5F0MB 2J6EL 3M1OA 3OJMB 1JPST 2NUTB 1OXYA 3V8OA 1D6EA 1BFOA 5JXAH 5HHQA 3PHQB 2YA2A 2XT1B 4PTTB 3W0WB 4JRWA 4PJ5E 1M2OA 3HG3A 4X9BA 4PJGB 1R46A 4BK5A 5AYUH 5BCAA 3UAJA 5F7BA 5I8CB 5C0AD 5JXAL 3ZMEA 3UMNA 1P1ZA 1KWKA 1U8LA 1I85C 1MKFA 1XGRB 4F33B 5AYUL 3TBYB 1WD9A 2OFQA 1B90A 5TJWK 1KXQA 2AQPA 3WGUB 5GQBA 1KJMA 3MR9A 4Q4IA 4JVWA 1IU1A 4GP8B 4S1SH 3IT8D 4PGCB 1XCWA 5IR1B 1TZIA 1SJVA 4RDQF 3VXOA 2CDEA 5HGDA 3WFBH 2GB2A 1XHHA 4FJZA 4J7RA 5I2IA 4GLRI 4TSCH 4S1SL 5D4JA 3ZMNA 1Q8MA 2X89D 3KG5A 1HOCB 1ID5I 4KOBA 4ANWA 3QJVB 4JFSA 1W91A 2PPFA 3RUGB 4CSTA 3WFBL 5HSFA 3U0PA 4MXQD 1P7KA 3NEEA 4YSCA 4MQTB 1JTTA 5DR5L 1PCSA 4FTVA 4TSCL 1G94A 3AC0A 2HJKA 2LT9A 3B5TA 3TFBA 3L1EA 4FG6C 4YBQC 4C4KT 4APQA 3O2VH 1GZPA 4Y9EA 4JHAH 4M4RA 3FRUB 2FO8A 4H8WH 2DLIA 4NPKA 5GHWH 1PNDA 5ESVB 2R69H 1FNSH 4JZOB 2AEOA 4A63A 2GFBA 3O2VL 5DJYA 4ZW5A 5FEBA 4JHAL 4H8WL 1UZ6E 5MEND 5GHWL 3ZKNC 4DO4A 2DJSA 2R69L 4XI5D 1FNSL 3QUMA 5D6CB 3UROR 5HYJB 2AJZA 2MOGA 4WWKD 2N4IA 5FUCE 1QX1A 5CFHA 1OSZA 4GRMB 1CIUA 4D7PA 4TUUA 4KTYA 4QI3A 3KPLB 1OCZB 4L37B 3H56A 4YAQB 4R6UA 1SHXA 3UERA 2FNWA 3UPAA 3C6LC 2WO4A 2I27N 5IESH 1BD2B 3IU3B 3I6LD 4BRVA 2JELH 4JLRA 4LHUA 3PJSA 2XPZA 2A74A 3TA3D 1FO0H 2WQRA 4XE0A 3U1QA 1XL4A 5HVHB 2BSTA 3L4CA 3VD9A 3P77A 2JELL 2WYIA 1WTGT 4R97B 4G8FA 1KZYA 1FO0L 5AVQB 1CLVA 1AKJD 2VLRA 4I0KA 3SGKC 8FABA 1BQKA 4S0TD 3RPIA 2CD0A 1KTDB 2WP3T 5DS1A 5C0DA 1H0DB 1BYOA 4LSTH 2BNQB 5CJBA 5D1QD 1F13A 2Y1AA 1EUTA 5J7CC 4G8EA 1M2VB 3ZIYA 3V6FB 4WKZB 4LSTL 4M5TA 1FGNH 3DYMA 3CVHH 5AZ2H 5J6GB 4O02H 4P4KC 2VSKB 4X6FA 3QQNA 4PREA 2CQVA 3QQ9C 4HS8H 4TUOA 3G08B 4TQIA 3HNVH 4TLTA 4NJ9H 3LZRA 4Y0GA 1FGNL 5AZ2L 3CVHL 4O02L 1V3MA 2AKRB 4IIZA 3C5ZC 2MTAA 4G7VH 1HXYB 2I9LA 4HS8L 5D2NC 3HNVL 4NJ9L 4OAWB 5IB2B 2FQFA 3QQDA 3SJVD 2HKAA 4FLRA 2J1XA 4G7VL 4FFVD 4MNQA 3S48A 3QEGH 3CK0H 2WBJC 2FBRA 4BZ1H 3GTNA 4X6EB 1XGQB 5T3XE 2PYFB 2B77A 4YHNA 1W72H 3LSOA 5PCYA 5CGMA 2YPKB 3CK0L 4BZ1L 4A04A 3L5JA 4KBPA 2ZF9A 3S0PA 2VWEE 5FOBA 5DHVA 3VFRB 4LIQH 2ZCZA 1W72L 3B9KB 2FT8A 2PYED 1JI2A 3DHUA 4AGOA 2IANB 4PCYA 4GQRA 5EFIB 4YSTA 2DS4A 3B4NA 1SVBA 2R23A 1NZRA 5IK3B 1RJCA 4LIQL 1GGUA 1S9YA 4PV9B 4X5PA 1DJZA 1TTUA 1P6FA 5EIIA 3FQRA 2OMZA 5DF0A 3F7KA 3BKCH 4HAKA 3QEQB 3WLWD 4MNGE 4BFEA 2BLFA 2WNKA 3CZJA 5DDHA 5L2KE 1XGUB 4H44C 4X4ZA 3BKCL 5HD8C 1PDKA 4X7DC 5E70A 3NP4A 3ZKMC 3GZPA 5EN2A 1RJZB 5I0YA 3T9WA 1Z3GH 4KI5E 1CYGA 5B3JE 1S7SB 2W0KA 4IU3B 5DRNB 1WIPA 4ODBD 2EDKA 1JF1A 1NWOA 1C9SA 2OMNA 4U3XA 3OWEA 1WAPA 5A1AA 1Z3GL 4WU5A 5L4MA 2IBGA 2BS71 4P46D 4X4YA 1BVNT 1NDGB 2ZKWA 1BZQK 1K4CB 1RUKH 2FCBA 3QWOA 5E8OB 5DFTA 2ZWNA 1HEHC 3HBGA 4HUUB 2ADIB 1P84K 1AP2A 3LQZB 4HZLB 4M6MH 4NSKB 1TXKA 1RUKL 3K6FA 5LGYA 4DT2A 2V37A 4HOMA 3RNKA 4X8XA 2XWTB 3BAEH 1U8PB 5DSCA 1JHTA 3MNWA 5LG1A 4M6ML 1NM4A 3IDNB 2FJGA 5K39A 3QDGB 3HPLB 5IQ9A 3ZRSA 5DFVC 1W16A 4KK5D 3BAEL 3ZTDC 2LTQC 5AL8A 3RI5K 1KYFA 4LP8A 1UWYA 2COVD 4X6CB 3NZHH 4C56E 3ZIMA 2Z8WC 3IDYC 4BFKA 1UEMA 2YN5A 3F7LA 5C0RH 1IGYB 5IEKB 2HMID 2QBWA 3HE7B 1WEJH 3AGVA 3HHSA 4UBDC 4FFTA 2H6UA 1FHNA 3NZHL 2YAQA 3RTLA 2WN2A 4ABWA 1ZIBA 5DEGA 4HIHB 3MZGB 1G1CA 5KSAB 5C0RL 2JKTM 1WEJL 4WLCA 3DVFA 4WV1C 4FFWC 2APSA 3CXFA 2H2SD 4WJKB 4F9LA 3ULUC 5DJ0A 4H8UA 2VL5B 3G5ZB 1QASA 2DWTA 3T3MF 1VKXA 3LIZH 3NPSB 4AW7A 5EC1B 5E5LA 2AZUA 1TTRA 5E6ZA 2XWRA 5A2AA 3RWFA 2ID5A 5BUGA 4YXKH 3UGUA 3NJJA 4XMWA 5EU6A 1DE4A 3F6IA 4F57H 1OCOB 4X5WA 3BC9A 2WXKA 4JFOB 2GJ6A 2VYRE 3VXTA 3WY1A 3LIZL 3PWLB 3MPCA 2DYSB 2ED7A 5FFGA 3HAEG 1NCTA 4L4TA 5C09A 1L9SA 4YXKL 1AY1H 5FO2A 4F9PC 4F57L 2BHUA 1TQBB 4LAQH 4MD4A 4PRHD 2BSDA 3MGOA 1AGEB 3HZYB 1ZHBB 5BOJA 1U3YA 1QWHA 2E9BA 1AY1L 5CJ8A 4XVUC 1KV7A 4PJBF 4LAQL 4ANXA 3MYJB 5AOLA 4NKMA 5FW6A 1N12A 4ZFQA 4L0PB 4J2XA 1BVZA 4MCZB 2RGSA 5KVEH 1IEAB 1ZTXE 4NYLB 4I3RH 4PGJA 4ZZKA 1RU9H 5I5MA 2Z4TA 1WAAA 2P5ED 1F1GA 3V4UH 3WD5H 2J3SA 4YUEH 4BINA 1JNHB 3MUY1 4RGNE 1E6OH 3N6YA 4RMUA 1KUMA 3W56A 4I3RL 5KVEL 1GYVA 1RU9L 3HN5A 1D9KC 4QRTA 3WFHB 2NZ1A 2CM5A 2JJVA 3V4UL 4YUEL 3WD5L 4OM1H 2OR7A 1E6OL 3LJ3A 1HHGB 5JPNA 3CLFH 2JB5H 3DRQA 4BZ2H 5GSRA 4I3SH 4JFHE 4Z5RB 4KJWD 5MEPB 1TQVA 1JPTH 1Z0NA 4DKEH 4NXSA 3U2SA 4OM1L 1UYWH 3DURB 4OQTH 4ZW8A 3CLFL 2JB5L 4BZ2L 1NANH 4CDHA 4I3SL 4FD0A 2O6FA 4LCWE 3SKNB 1XCQB 1TDQA 1JPTL 2UV3A 4DKEL 4GKZA 2X6UA 1UYWL 4OQTL 2BS9A 1HHIA 5DEFA 2Y9RT 1A7PH 2R29A 3P9LA 3TL5A 4I4WA 2H2PD 3S96B 4N9OB 4NXKA 3IE4A 1H9VA 3UTSA 1KEMH 3D4CA 3EFFB 4M5ZH 5HJBA 3S5LA 5CJ5A 5JA9A 2MOQA 5I1CH 1NMBH 1GC1H 5TE4H 2YPLD 5HHVL 1A7PL 5MEQA 3RRQA 5C2UB 2X4PA 2AEQL 4AXWA 3V4VA 4P2OA 3CFNA 4XXCA 1N3NA 4FTDA 1KEML 4PJDE 1P7QB 4PCKA 5DZPA 5I1CL 1NMBL 1GC1L 2WTRB 5TE4L 3Q43A 3FU7B 2OMVB 3KD4A 4FQCH 1BVLA 4OFDA 4UF7C 2DMGA 2WLNA 2Z92A 2HTKD 4BE5A 3DTXA 4LCUA 3TO4A 2IH1A 3QPQD 2VRQA 2QVFB 2C3GA 1G9MH 1QTYT 1H15B 3JWNE 4FQCL 3L3JA 2K4WA 5CJXA 4J39A 1UFUA 5F0LB 4ONOA 1ACZA 3L4WA 2A9DA 3ARGB 4ZNEA 2CXGA 3TIEB 3GINA 3ARUA 3CHPA 1OT2A 1ZWIA 1G9ML 1KXQE 4G9DA 4LARH 3VXQA 2VDKH 3QULB 3TJEH 5EUKB 4I0PB 5B3NA 1TQCB 3BVXA 4J12A 1YECH 2YXFA 4LARL 2X42A 4ZMYA 2VDKL 4O2EB 3TV3H 5IJCC 3PAYA 1S7RA 3TJEL 4JPIA 3V5KA 3F8UB 4L9LB 1N67A 3RGVD 3SDXA 3SPHA 3X2QB 4HOXA 1AVAA 1YECL 2CA4A 4OIFA 1G7PA 2MPVA 3TV3L 1S7WA 5L8KB 3EOAB 1COBA 4OGAD 4FTVE 2DQJH 4RA0C 4YZFF 1L0QA 3FQTA 5CO1A 3AY4A 2EIZA 5EOCJ 1DJXA 3KPRB 3MNVA 3FF8A 3NOIA 1U3HB 1QABA 2DQJL 4KKBD 5J8OA 1NUNB 4P2RD 3PP3H 4PP2A 3PPEA 2F7QA 4ODSH 3X11A 2V9QA 4IKJA 4ABQA 3EFOB 3C5SB 3DA0A 3F12B 2JJSA 1S7QB 4M56A 4RRPG 3KDMB 5A6MA 5FA4B 3W39A 1HT6A 4DPRA 4ODSL 5LAPA 5AB9A 3DX6A 1L5GB 2DM2A 4JKKA 1ORSB 3FUFA 4JKPL 5I1LB 3OX8B 1M1XA 4TM9A 5J3HD 3UX9B 5AKSA 3PJLA 2J4WH 3S8FB 1CFQB 1X5GA 2FJUB 2HCZX 1CDUA 2F6AA 2HFEA 3DDFA 5CF3A 4HK0B 5I75B 2ZXAA 4HIJB 5F7LB 3I9IA 4FXGA 3VX1A 1IGTA 5CEZH 5KANI 1MIEH 4KKLD 4FCAA 5IBLC 3VD0A 2J4WL 5AFAA 1BBJA 3FT2B 3IEAA 3LHPH 3AS3A 1PEWA 4QRSB 4MASA 2Q86A 3E80A 1T20B 4KAQH 4A66A 5CEZL 1MIEL 1N19A 2FYVA 3F7PC 5GGSB 3LHPL 3G3LA 2VLRE 1I3UA 1PLGH 3BRDA 2CRYA 4MMYB 5FA3A 4KAQL 4Z6AT 4WWKB 3GS0A 4U33A 2YD9A 1PLGL 1H5BA 1DDTA 1G9NH 1T22B 3FHEA 4J3WA 3ZRCC 1ZEAH 4M03A 5I6PA 5E6SB 3RFZA 4UAOC 5IB1B 2F53A 4FQLH 3UZVA 2X12A 2JKIS 4QRRA 4DUVA 4NQSB 1KBWA 1G9NL 5FO7B 3RKDD 3EJTA 1ZEAL 2R9HD 4MZIA 1EBPA 1K2DA 1UACL 4FQLL 2H4EA 1BSIA 3GO1H 4KY2A 2XPGB 3IMSA 3QH3B 1DQVA 5BO1H 2A7BA 2GTQA 4HAGA 3GO1L 4HH9B 1XO8A 2VLKA 4IRSC 5E6UB 3UL4A 1UD3A 4J8RA 3T4YA 4AYFA 3FT4B 3ZT5A 5BO1L 4Z7UA 4ZOAA 1FQ9C 3Q8AA 2LU5A 4GXUN 4LOVA 4MNQE 3CQPA 2EDRA 2J2ZA 1DJGA 1E5ZA 3TWCH 2FHFA 4WO4D 1JZ7A 2GTWB 3NCWA 4G6JH 1PY4A 1RZIB 4KGLA 1AANA 3E6HB 3TWCL 3FUIA 4DJMA 1KNOB 1B4RA 1LP9F 4ZUSB 4G6JL 1FG2A 2ITEA 1G7JB 1KIUB 1NUFA 5BZWA 4Y1AA 5JW5A 1Q94A 4ZUWB 3U82B 5FB8B 1W0WB 4G8GD 3WIHL 1I9EA 1AGDA 5A3IC 3QIUC 4RIRB 2GUOB 2HUHA 4Y2OB 1J0JA 5HHOD 1A7NH 3MRRB 4FFYA 3ULAB 3OXRB 4ZMOA 5BS0B 3WLBA 1IIKA 5KVGH 2ZE0A 5CD3B 5C0EB 1A7NL 3FO2A 3IAPA 5HDBE 2BZDA 1U8NB 1TQSA 1YN6B 4W4OC 4P5MA 3UGEA 1THAA 2HRPH 5IQLA 4RMWA 5KVGL 5L2JA 4AMKH 3PGCB 1J05B 4LLMB 2ZF8A 1JVKA 2KL6A 2B2XH 2HRPL 5KN5B 4W4NA 4AMKL 1CTNA 1W8EA 1WRFA 3X1GA 2JKXA 2BP0A 4CKQA 4H1LH 1EUUA 4OM0H 2AITA 1MHCA 2IH3A 2GEQA 2B2XL 3TONA 4DP6X 3FH5A 4GRLB 3D0AA 3OGCA 4UOW0 2J8UF 3UBHA 1N59B 3JYBA 4PGBB 4NPYB 4MMXA 3N42F 4OM0L 3RWEA 3C87A 1G43A 1FIGH 4R7VA 1XIWB 1P0SE 5D55A 4XVOA 1NMCC 2FJHA 4PJ6A 4AGNA 4RGMC 1RP9A 1XFPA 4KVCH 1FN4A 4DIXA 4EMZA 1V5JA 1LMIA 2G5BA 1AHMA 1O9WA 4WENB 2OL3A 1DBAH 2BWDA 1QSFD 3BP5A 2E7LA 1S9VB 2ZWKA 2EZ0C 3HOGA 3S5YA 3EDFA 3ZK0A 1A6TB 3AXLB 3K6IA 4KVCL 4HETA 3OMIB 5HVHC 1U3JA 3PJNA 1A6AB 3MFGB 2WYHA 4LLWA 1DBAL 5B1BB 1J9CT 4GINA 5K93A 2J20A 1YPZB 2F5AH 4PRAA 3D3VD 4OZFG 3B83A 4PJ7E 2BXZA 4P46B 2FLRT 3DX0A 3NN8B 1ZD6A 2F5AL 4PJCB 1BOGB 2G5UA 4NHUA 4EUPA 3HMWH 5TD4A 1PJ9A 3IXTA 2DQFA 3OKEA 3QDJA 1F90H 5CP3H 1BM3H 5EBGA 5CSZB 2G0LA 1IVLA 4M61A 4NRZA 1NTDA 4LPTA 2J25A 3HMWL 3BKJH 2ADJA 4YHZH 4TS6A 1F90L 1E9PB 1BM3L 4OD3H 4BFJA 4QHLA 1T89A 5EU6E 5HVGB 3H7LA 1XH3A 4PV8A 3BKJL 4YHZL 2O1AA 3IDMB 4PGEA 1NC4A 3QIWD 4RAVA 3SY0B 1ICTA 5I1JH 4L4TE 4OD3L 3QUZD 2IG2H 5C09E 5D2LB 1FCGA 3WN5B 1A14H 2VDOL 2F18A 3WEOA 5K1VA 3NIGB 4A55A 3GJFA 4PJ5D 5I1JL 4L8SA 2IG2L 2XZCH 2A5UA 1UKSA 1FH2A 4BWUA 3ECBB 4KO6A 4TF4A 2VN5A 3LKSB 2J5WA 3ZDYB 3RJOA 4BKLA 1CDCA 1CUOA 1OGSA 1OPOA 1XMEB 2XZCL 5EUOF 2XN9A 4F1SA 2HJFB 43CAA 2PP8A 1IE4A 2K70A 1WAAE 1AD0B 3FRPA 1VFOA 1QRNA 4YXHH 2DWEA 3W9DB 3D0VB 4OI8A 2I7OA 5EZJB 1XGTB 1JPSH 1KGJA 5CZRA 1KTRL 2GK2A 2AERT 4ZSOB 3B9KC 4YXHL 3SE6A 2IALB 2QSTA 3CFDA 5IJBC 1JPSL 2UZYB 2WQUA 4HIEA 4PRHB 5EBLA 1HH6B 4RAUA 3BJ91 5DJDA 3ZR6A 3ESOA 3HRZA 1G7MA 5JIKA 4ZG1A 4OCRH 2XTSA 3RP1A 2FATL 5B39B 4WFGE 4Q7DA 4W68A 4B60A 1VGKB 4HLZH 4OCRL 1KBPA 4F93B 1T6VN 1WF5A 4CRPA 4FCHA 3KGSA 2ZKYA 3DC0A 1J9TA 3CSYA 4OCYH 5D4HA 3ROOA 2E9GA 5JOFB 1I7RB 1H6TA 3UTSE 4HLJA 5D7LE 2ZUWA 3OPZH 1H8LA 2G30A 4XP4H 2HVJB 1L3NA 2PTTA 3DETC 4OCYL 5DYOA 3PWNA 4KNUA 1PS3A 4M93C 2WTOA 5HI3D 1GY1A 2EE0A 2WINB 2V9TA 1NUGA 3OPZL 2XWJA 3SZKC 3ZO0A 4XB7A 4XP4L 4HA1A 3TNNA 4RMQA 1FVDA 1WZMA 2OPCA 3QI9C 3VFOA 4PW9A 5KWYC 5AW1B 3FUKA 3D48R 4YE4H 5H37A 4YDKH 3EJQA 2WMPB 1ODUA 3IWUA 1M6OA 2HJLB 5E8NA 5GZOA 2APWA 1B0WA 2LHAA 3UBFA 1HH9A 2ZNWA 4MB4A 1SUHA 2BX5A 2OMWB 1GYAA 4ZNEE 2XX1A 4YE4L 3ZTJH 4YDKL 4PCSA 1S9WB 3HB3D 4EI6B 2X6VA 3HW7A 3MXWH 1U8CB 4P3DA 4WI0B 3BPOB 1RJLA 1ZT4A 3SQBA 2ZWLT 3QORD 2BVOA 1IAIH 4KRPD 1A7OH 3M1CA 3MXWL 1IBDA 4U4IA 3I9PA 1I7TB 1UD6A 2MQGA 3SDXE 4N6QA 1XEUA 2ZSVA 1MW2A 4CA4A 1IAIL 3X3FH 1A7OL 3TTYA 3BVVA 4N28A 3OAZK 4HVBA 2GBUA 1M9SA 1WCQA 2CCWA 4XNUH 3X3FL 4I8DA 3G04A 4HJ0C 1YAZA 4U1HA 3W5MA 2VH5H 1J0KA 3TCLB 2PCPB 1BVKA 1DQQB 1ND0A 3ABZA 5TH2A 4RRPA 3CD4A 1M4KA 4XNUL 1QBBA 2VH5L 3MNDA 5D7KD 2VLJD 4GAAA 3D69B 4JMNA 5T33H 4ONFH 5IW1A 3CIQA 4IYKA 3IJSB 2XX0A 2ZUXA 3ZE0E 1TQBC 3QXAA 5T33L 2ZX7A 2J43A 4ONFL 1BZ7B 4W6WB 4X4XB 5T3XD 4UQBA 1KDIA 4M5YH 1X7TA 3GSWB 3MAWA 3O3UN 2PWHA 3LV3B 3TF4A 4JRYE 2PXYB 3NJNA 3P0GB 4M5YL 2D3VA 2A6KA 3UP1A 5L4JA 3L3IB 4UTBH 1JYWA 4PLOB 2MCMA 4F2MB 1HXMA 3FULA 4R84A 3FTVA 1CGSH 1FYTB 4W70A 2VC2B 4P57B 3UXFA 4ZTPH 1R75A 2DM4A 1I8UA 4UTBL 5KEZA 3VH8G 1JE6A 3BFOA 4MQ7A 5DD6B 2Z0UA 1ML0A 5FHAL 1CF8H 1CGSL 3R06A 4XAWH 5IREA 2JFCA 4ZTPL 2F7RA 5F7FA 3O3BB 3OHMB 3BAXA 3WHXB 4GG8B 3O0LA 3ROLA 3LEVH 3OZ9H 4KVPA 3VQLA 1CF8L 4XAWL 3Q7JA 2F53E 2EIDA 3V6OC 4UM8B 3PV6A 4KI5D 4Q0XH 4A7TA 3LEVL 3OZ9L 2J1ZA 4MJ4A 4QAMB 1FV1A 1QSEA 2HLFD 5AW9B 3P3UA 4JRXA 2EXYD 3PIQA 1UOKA 4A7UA 4WI2A 3NZSA 4PYHA 4W9ZA 2NMSA 4YDNA 5T1KD 4Q0XL 3CFJB 4MNHB 5ESQB 1NOAA 2GJZA 3P0YH 4V11A 1U8QB 3MFFB 4MCYA 4F27A 5IKCA 3BZFB 2VLKE 2WB7A 3GRWA 1IT9H 3HVDA 3FTXA 3IXAA 4IGBD 2HG0A 3MV9A 3P0YL 1XV8A 4Z7UE 3VI3A 1SQMA 2Q5BA 1O7DC 3ARXA 1ZV9A 1IT9L 5HGBB 1R3KA 2OTWB 1O9VA 1J87A 1GAFH 1CDJA 3BHBA 3ZKXC 4ODXA 1NEZB 2DQ6A 4G80A 3KPSA 3NABH 5AOZA 1MFNA 4PV1C 1JTPA 4C56D 4R3SA 4AK2A 2R7EA 1X5MA 1GAFL 3ARGC 1D6VH 3HZMA 3KBFA 1R0AH 1TR7A 1ZHKB 5T5FA 4KKCC 3NABL 4Y1AE 3ETBF 3STZB 2O72A 3L5XH 3MLXH 1CDGA 2NR6A 3I50L 4LLVB 4LOUC 2DH2A 1D6VL 1R0AL 2EUWA 2OBGA 4CN6A 2R2HB 3RWIB 2UY6A 1OCCB 2G75A 3NFPA 4NBZB 3L5XL 3SDAA 4FX5A 2GK0A 4LT7A 3RVTD 3MLXL 3RJQB 1HAUA 2JKJA 4JHUA 4L9LC 4N85A 3OKLA 5DO8A 4ZAKA 2W8CA 5AVXB 3EF7A 1MHPH 5C0JB 1R3JA 5C08D 3ZE1B 5TFSH 3TFKD 1ZSDA 4UZSA 1KXVA 2P3YA 1X9LA 5ICUA 1NOLA 3QDAA 1LK2B 1MHPL 3D2TA 3P69A 1UH2A 1NAMA 2IGLA 5TFSL 2BH0A 2MOVA 8PAZA 2VMDA 1LDSA 3MRCB 5DVOA 4X7CC 3VXSD 4LU5H 3EXLA 5DURD 5GGTA 4JJHA 2BIOA 4G8GB 4YDZA 1Z32X 5C97A 1UZ8B 3HE6D 1F6AB 3RU8H 1E5CA 3A4AA 4LU5L 3D85D 1QLFB 4NO3B 3O4LA 3OAYH 4D0CB 3GJFK 3BLPX 1IBZA 3UTTB 1LMKA 1ZMYA 4JHWH 3PGDB 5D96B 3KNBB 3RU8L 3RWDA 1B9KA 1MAKA 1J9SA 2FT6A 1XSIA 4GBXB 4MXQC 4RGND 4F2EA 1XSJA 3FO0L 4JHWL 4N90E 1LEGB 1E28B 3GEWB 2EABA 3HZVB 3GSNA 4BSVA 2WLMA 3QYMA 2FJFB 5DC2A 3DX9A 2Y06H 1LDPH 2NX5E 4HKJA 4X0KB 2GSMB 3MRBA 1L9QA 4JRLA 3VXRA 4JFHD 5AAWC 4WNQA 4PI0A 4WW2C 1PKQA 3BEWA 2Y06L 5BPPA 2AV7B 3GSVA 4AUJA 1T1XB 4B5ZA 2LLGA 4LCWD 3KVPA 4IRZA 1HQ4B 1PG7X 4KMTH 4KKNA 5K9OA 3QDJE 2E7HA 1NKOA 1QD0A 1A5FH 3TYGH 4EDXB 3DO7A 1P4UA 3IGUA 2FECL 1YY9D 3GSQB 2CUIA 4KMTL 5BV7B 2NY4D 2X9WA 3FSOA 3L3KB 4WWID 1UXSB 1E9OA 3GRGA 5KS9E 3KGRA 4OF8A 3UP6A 2WJ7A 1A5FL 4Y4HD 5CLXA 3TYGL 5EF1A 3MRDA 1QZNA 1QSFB 5F88A 5ADPH 4RBPH 1YO4A 2N56A 2Z64C 3ZDXE 3X1NA 3DIFA 3B5HA 3CZGA 3T2LA 3TA3C 5DMJB 3UG4A 3JQOB 3MNZB 4KO7A 1WBXA 1RJYA 5ADPL 4HUVA 2E9JA 1ZVSA 2LFGA 3D3VB 4WY7H 5EB9A 3BAJA 3HN8A 4ZMXA 4BSWB 3TZVA 1G0DA 2W59A 4CMHC 2A6IA 3S3SA 2YBRB 1AFVH 1UEYA 3CPLA 3MQIA 2WPGA 4NKOA 3UAJD 1SGKA 4MQSB 4Y9GA 4L3CB 2E7BA 4AEHH 4MA3B 4WY7L 5KYYB 5KJ7E 1Z0MA 5T1MB 2H7WA 1AFVL 3SDDC 3K5RA 4ZMVA 1KJVA 3WS3B 4AEHL 5JW4M 4XCEB 5D1QC 4MCNA 4S1QH 1FZMB 2P24A 4GI9A 4U6YA 2DJMA 3ZHDA 2X3AA 5IGXH 3L9RB 5JO5B 3VFTB 2XWXA 4S1QL 3ARDA 3M17A 3O11A 3QS3A 4LOFA 4AYMC 4GRWE 5FKPB 1NQBA 1BBDH 3QUZB 4HKBA 4K2UH 4AUYA 2I69A 3CHQA 5LJYH 5IGXL 1MELA 4PRDB 1ETB1 2AV1B 1CFNB 2DB8A 3GEFA 3KVDD 4XCCH 4FTVD 5FFLA 4XOBA 4PJ5B 1BBDL 5F9WC 4K2UL 1IL1A 4APQD 2OJEA 5LBSH 2IIJA 5GJTH 4XCCL 2VN6A 3U1SH 3S8GB 4FFVC 4KRNA 4HS6B 1RIHH 3N1FC 4PMFA 3R4DA 2QPDB 5JOEA 5HHNA 5LBSL 5GJTL 2IXQB 5I1DB 3U1SL 3FQXA 2Q76B 4NWTH 5LAXB 4V1DA 4ONHA 3NFSH 4HWEH 1RIHL 1VEOA 1XZWA 4M8QB 4PJ9A 1XDTT 3GLDA 4AENB 1A7BA 2H1XA 3VD3A 4MQXD 4R83A 3EAKA 3T0WA 3TH2T 3MRLA 4KFMA 2B1OA 4BD4A 3NFSL 4HWEL 1GGCH 5AVWB 1BQHG 2V8LA 3FH7A 5DD5H 4A1RA 5ILTH 3IMUA 1DVUA 2GBAA 4PJEE 2JKNA 3FBKA 1X5ZA 2E7MA 5AYQA 4NC2B 5DD5L 2R1YB 2A77H 3LS5H 4LHUD 4LPUA 5ILTL 1S5HB 3S8WA 3ZVVA 3WTSA 3PNRB 3NYKA 1CLYL 3S98A 3ALWA 4M3JA 5K9KB 5GS0D 4Q6YA 3LS5L 2A77L 2D7PA 2VLRD 2ZP9A 1NDMB 1U8IB 3RWGA 2GJRA 1SBSH 3MOQA 4OIAA 6CGTA 3V79C 1AD9B 3DVGA 3CHRA 2FO4A 1V3KA 3FH8A 1SNRA 1MFDH 1TTGA 5AKRA 1R1CA 3MJWA 4B0MM 4BFRA 1QUNA 4WUUA 1SBSL 1VZHA 1JZ6A 4AQEA 4XOCA 4P46C 4IOSA 3BESR 3OB8A 4YFDB 3MROB 3VFSA 1MFDL 2A6DA 1JVOA 3DARA 4WEBH 3IMRA 2W80C 3PWVA 2G3XA 2PNDA 2XCMC 3LVEA 1WZKA 3IBEA 3S4SG 2Z93A 4H26B 4PIRF 5E94B 3DK0A 2W9EH 4WEBL 2W0LA 4JO8A 5BZXA 1ACCA 4ODTH 2ZUQB 1TZOA 1JXKA 3GMLB 5T3ZH 3SBWA 3HB3B 3NJKA 4ZMTA 2W9EL 4KK5C 2H0JA 1PFCA 1XH1A 1YUHB 1TUPA 1CWVA 4ODTL 4FN0A 1T5WB 3ARBA 1L0YA 4QHUB 5EO1B 1WPCA 5T3ZL 4MNQD 4PWKA 4JO1L 2HMIC 2RD0A 3I75A 1DVTA 1K3IA 3VD4A 1X5FA 3FB7B 4CNIB 3PYCA 1MQKH 3KJ4C 4YL4A 3KEDA 2CO7B 3ZHNA 5DUBB 3RL2A 4EIBA 4RQQB 5EO0B 4R0LB 4KH9A 3UIZA 2RH0A 2H2SC 3WMQA 1G7QA 2WXLA 3KYNA 4KXDA 2VR9A 4QHMA 2BNRA 1SY6A 3G9AB 3ILQD 3WDJA 2FIRT 3QQ3B 4JHZA 3UAEA 1LK3H 1OHQA 3N0PB 5HHXH 2NTSP 1E0OB 1I53A 2Z4QA 3KPQB 3KPOA 2FWLB 3ESNA 2HT2C 3DPBA 1FFOB 4TXVB 5MI0C 1CLOH 3EYFB 1LK3L 2F68X 4LVEA 3OJ2C 5HHXL 4JREB 1BJ1J 3MNMA 1OWWA 4OFKA 4DEPC 4KUCF 5DEZA 1CLOL 3F85A 1C8PA 1TQWA 1QSEE 4JRXE 1P4LB 1E5AA 2O5XH 2B9BA 1AHWC 1F97A 2NY0B 2DWDA 2O6DA 3C8KA 3NJXA 5INCA 1SOSA 2AQQA 2DMHA 4E9TA 3ABGA 2CRIA 1I9JH 1JPFA 2RAMA 4YFLF 3AREA 2NT1A 3ES6B 2O5XL 3ZDZE 5FYJH 4ALAC 4HDIB 3JZYA 2X4UB 2CKNA 1F3DH 4U1JB 3QHZH 3KCPA 2J72A 4R96B 1ZTMA 1A47A 4QXTB 1CVSC 4QRFA 3MV9E 4MNGB 5FYJL 4YDLB 3ZE2F 5L2KB 3VI3E 1IAOB 3QHZL 3I6KA 4ZT1A 4KJWC 1L9NA 4LVNB 4PJBA 2Y6SD 4U3HA 1AGFB 3VVVA 3UO8B 2JKSA 4OY9A 4PPTA 1F6FB 1GYCA 3CN1A 1DO6A 3WUWB 3SKMB 2PW1B 5FYLE 5FECB 5IMLB 1J5HA 3DSNA 1MCKA 3C5ZA 3VWKC 3O8XA 1Q9LB 1TNNA 3FXIC 2FBJH 3KWXA 1O0VA 2YGQA 1EEYB 3P9MA 3S3CB 1X44A 3LN5A 2KQMA 3MXVH 4NNPH 1FFTB 5DJCA 2FBJL 3FYIB 4IGBB 3FO9A 5DUPH 2OI9C 4GW1A 4XN8A 2G9KA 4Y4FA 3MXVL 4GPVA 1WFMA 1WUZA 2WXRA 2GT9B 4NNPL 2L4OA 3OR7B 3D2UB 5HGAB 3LPPA 2TAAA 5DUPL 2HTKC 5EU6D 1WA1X 1OPGH 3QPQC 2GJ6D 1BIIB 1LO3H 2PW2A 4U7SA 5GPRA 4Q52A 2W65A 1PAZA 4L4TD 1UXMA 5C09D 4C56B 5F7UA 4JG9A 4JM2B 3TT1H 1JZ4A 1OPGL 2PCFB 5CGTA 1MAMH 1GZQA 4QLRA 1LO3L 1BJ8A 2O5ZH 4KNTA 4XNMB 2ITFA 4UZGA 4XMTA 4B41A 2I07A 5IVZA 3LRGA 3US1A 5FC9A 5A2KH 3TT1L 2VXSH 3CFUA 5EEVA 4QHKJ 1MAML 1QHOA 5E6IA 1SN2A 4FQXA 3RIKA 3MO1B 3O4LE 1XB6A 1LEIB 2KZKA 4Y7OC 2VXSL 5I17A 3RGVC 3C2SA 4FNPA 5DC9B 1WFNA 3D08A 1ET7A 2Y0SA 1KULA 1SDAB 1PLBA 3EGSA 3F7VA 5DTFB 2CBMA 3B6SB 4JVPA 1TSHA 1BYPA 2NNCA 2FYYA 4GI8A 1ZA6B 2XHNA 1URIA 2P8LA 1N68A 3QZBA 1PD6A 4R7DB 1MHHB 4KKBC 3VXRE 3I85A 4I5BA 4YSPA 4WIQA 4AEFA 4Y88A 4JY6B 5J06A 1SF3A 1PKQE 1VACB 2BVUA 5FLUA 3SE9H 4D8OA 3B37A 3ULVE 2R0LH 4YDIH 4XCNA 2YD4A 3VFPB 4H8HA 3IFLH 4WFGD 1UZGA 5F7NC 5DZLA 2OQJA 3SE9L 2Z8SA 4IJTA 1U8MB 4Z77B 4JG1H 2R0LL 2XJKA 4YDIL 3GHEH 3WEAA 4M3KB 3IFLL 4TVPH 1NGQH 3UTSD 1RH8A 4LNRB 3KL5A 4RGNB 1JZ2A 2IDCA 4JG1L 4XMPH 4DGWC 1JL8A 4M7LT 3GHEL 1SYVB 4P2OD 5HHME 2BSRB 4XPTH 1JK9B 3DTDA 3FCBA 1A21A 1NGQL 3EGDA 5K9QI 2YUWA 4BDVB 3ETTA 4RA3A 4IS6B 5EU5B 4EIZC 3OG6B 4GB9A 3B1TA 4XPTL 2BMKA 4JY5H 1LILA 2P45B 2DM3A 1OAQH 2O93L 1L9OA 2DH3A 3QJOA 1KMGA 2F8XC 3TO4D 4LKXA 3BH9A 4OZGB 1O6SA 2XTJC 2WZAA 4LCWB 5FUZH 1KOAA 4JY5L 2EDQA 1OAQL 4GSXA 4YC2B 1OM9A 2CLVA 1A3QA 4HK3J 4OKDA 4O58H 4X8JA 3ECQA 1FFNA 5GSVB 4CC4A 1T1ZB 5E56A 2Z65C 5FUZL 1VCAA 2C1PB 2NY4B 2ICWA 1EXUA 5AVVB 5JR1H 4X83A 2B5IB 2QHLA 3L45A 3MRPB 4NAQA 1QUPA 1Y0LB 2WWKT 3VE0A 1NFIB 4LK4A 4O58L 3U2IA 3WJJC 5C71A 2YAHA 3F7YB 4F9PA 5AB0A 3RKDC 2D4FA 4L4VA 3T6WA 2R9HC 5BOPA 5JR1L 4ZUUA 2R56H 1FAKT 4PJDB 3NSYA 1BFOB 1I8IA 5HHQB 3CIAA 3KWVA 4LKCA 2R56L 4QTIH 4ABUA 1KV3A 4F8PA 5CBAA 5KSBE 3K6DA 1X6LA 3EJUA 2BP8B 1F3JA 4QTIL 1P1ZB 4OLUH 4YXLH 1VFAA 3K8MA 5C6TH 4F7TA 4F3FA 2AQNA 2IDUA 2MMXA 4WO4C 1KJMB 4FLSA 1IO4C 4OLUL 3OC5A 3FUEA 4V1DE 3GMNA 5DLLA 3CX5K 3LD8B 4YXLL 1AYOA 5C6TL 2IADB 1P6WA 1TZIB 4X4KA 1HZKA 3RBGA 1R3LA 2CDEB 5HGDB 1QOKA 3VXOB 5IHBA 3EGXA 3KW8A 3BE1H 3WL9A 4L29A 5B8CA 5IOPA 3U0PB 1P7KB 1I9RH 1TTFA 2YJQA 4OUOA 1A4KA 4FTVB 3BE1L 2HJKB 3HC0B 1BV8A 1EO5A 3T77B 4Y89A 3RPKA 4YEFA 1I1AB 4YSEA 5DMGC 1I9RL 2A9AA 5HI4D 4YH6A 3WU1A 3OL2A 3F5WA 3T09A 3O2DH 2GFBB 4TNEA 5DJYB 2QLVB 4U3SA 1PY9A 1LP9A 1JRHH 3UTQA 1BVNP 3O2DL 3QUMB 4Z7NE 4YHMH 5B4MD 2AJZB 4FQHA 3B3IA 4WEMB 1XT5A 3VFGH 4AJVA 1T1YA 3PCYA 1JRHL 4WUUE 3J27A 2PWFA 2F53D 2FD6H 4YHML 5IV2A 3CCHA 4NN6C 4QRRD 1KPRA 1MCFA 4O2FA 1NCIA 3VFGL 2XXFA 4F7KA 2BVQA 2AJYH 3CN0A 5DT1H 3DJSA 4AGMA 2W07A 3K74B 1URZA 5HDWA 4P3WA 2FD6L 3BN9D 3RTQB 3PJSB 1QKZH 2N7AA 3BUQA 3PUUA 2AJYL 4MA1B 5DT1L 7TAAA 3AQYA 2IWEA 3BMVA 1WFUA 1ZHNA 4AV0A 3P77B 4FI7A 1KGCE 4XB3A 4G8FB 4OFIA 4UV4H 3OMAB 5H94B 1QKZL 4DK3A 2WKOA 3BDXA 2VLRB 3H2PA 3RURA 1IAKA 2VLKD 3BZ4A 1KXTA 4YDVA 2J6EA 3P54A 3S88H 4JUTA 3HS9A 3QJXA 3RPIB 5E4EC 3EOBA 4LLQA 4Z7WF 4WVRA 3GZOA 3C8HA 2NZ9D 3S88L 2J8UA 5FS5A 2AXWA 4JUSA 4UM9B 3CFMA 4UT7H 2IFFH 1I8LA 4G8EB 4A2DA 1CL7I 4BHUI 1X7QA 5JPMA 3QNXB 4UT7L 4X7TA 2DICA 1INQA 3FCGA 2IFFL 4Y1AD 4QLWA 4JE4B 4PREB 4FF9A 4HKZA 4TUOB 1P5UA 4OW6A 5F89B 4ADGA 3RVUD 4DSYA 2BNRE 2RCSH 3SCMA 1O5PA 3FONA 2NNXA 3CVIH 1ASOA 1UH4A 3FAWA 3D07A 3T2NH 1I3VA 5IB5B 2H0EA 2DLGA 2B4CH 4GEIA 2RCSL 2Z7UA 3LIUA 2HFTA 3QIWC 3QQDB 1I1YA 3Q8FA 4LF3A 2MCG1 3CVIL 2IPKA 3T2NL 2PABA 2CDFA 5GRXG 1G7LA 2P4AB 3MX0B 2B4CL 4MXVF 4AEIH 3V9EA 5DK0A 3SGDH 4YHNB 3LSOB 1ZPLA 1Q9OA 4PRPA 3MV8A 5HVFB 2OX5B 4TPRH 2CJUH 2AXGA 1QRKA 4LMQE 4AEIL 2YHGA 5GRYA 1ZVNA 4CVWA 3SIKA 4CU6A 4OCXH 3T3ME 2QVTA 1OSYA 3O3AA 5E8PA 2OCJA 1MHEA 4AQ1B 4TPRL 1OQOA 1ZJAA 2CJUL 3C60A 3M1BB 4ZX3A 3SPGA 3ESVF 4JDZB 4P3CH 1F1AA 3ARSA 1JVLA 1S9YB 2N59A 2R69A 4OCXL 1KJ2H 4K0OA 4ESKA 5EIIB 3QCVH 2OMZB 3TVMA 4ADIA 1CYXA 1EVTC 3ZT6A 1PVHA 2BOBA 5HHPA 2GIXA 4P3CL 5DDHB 1KJ2L 3PS6A 3QRLA 5HDBB 3QQ4A 3QCVL 2YD3A 4KDWA 4AVJA 2ARWA 3QAQA 2NYZA 4DCQA 3W57A 3OMNB 1YG9A 4PJBE 4ZRGA 4N90D 2VT0A 1DUYB 5EN2B 1A1OA 2BK8A 1CFTA 2MPAH 4N5UA 3BSZH 3O41B 4F7PA 5EUOA 4FA6A 1CGVA 3H4FA 4M4PA 1ACXA 2CR0A 1BREA 3TBSB 4OIIH 3PWJA 3E2HC 5C6WH 3WE1A 1D5XB 2MPAL 1V7NH 2ZWSA 1FO0A 3N2JA 2DIBA 3BSZL 4M1CD 5D2NE 3OR6A 3CZNA 4HYTB 4X4YB 2LU4A 4OIIL 2VDMH 3QWOB 3M46A 3MRKA 3VXUA 3QDJD 1V7NL 4B0MB 2CLZA 3RA7H 1RV6X 3NJMA 1VFMA 5FUCC 3SGJC 1KPUA 5HI3C 5FYKH 2BZ7A 3VQ1C 2VDML 1YMHA 3CPUA 3RNKB 4ZMPA 1CLZL 3RA7L 2ZOKA 5DSCB 3CLWA 4ZFZB 1JHTB 5KYXA 1J8SA 3A6OA 3MNWB 4KK8D 4OLYH 1R6VA 1SN0A 5FYKL 2FJGB 5K39B 2Y5EA 5IQ9B 3PAZA 4YGVA 4UYPA 1NC4D 2FEEI 4M62H 2JI2A 3FYEB 4OLYL 3PDOA 3QIUA 2AK4A 4R4FH 4YO0A 3AAZA 2DWSA 3CVHA 5ENWA 5F6HI 4O02A 2BDNH 1EDYA 4N6RA 2ZUQC 4ANVA 3MCG1 1RVFH 3L95A 3B9DA 3ARZA 3HB3C 4M62L 4PJ7B 1Z2KA 5A2FA 1AE6H 2YLKA 3N41B 4BA0A 1SMDA 1QFWI 5DEGB 2F2HA 4R4FL 4FADA 2VISA 4FEMA 5I73C 2VZ1A 2BDNL 5JUEH 3QORC 5E6YA 5TTRA 1PZUB 1BF8A 1RVFL 1O6VA 4KRPC 3JV6A 3OKKB 1AE6L 1E30A 1U9KA 2XN9D 5DHVH 5DJ0B 4O2CA 2UWEF 1SJHA 5JUEL 2X6MA 1VKXB 4JW3A 1QRND 2Q8AH 4BZ1A 3HG5A 1DN2A 2H32B 3RWFB 5EU6B 2B16A 3ML9A 4RRPM 1DL7H 2EIBA 4X5WB 1FL6B 4R0LC 1W72A 3OAUH 5LLIC 1WSST 3I74A 2Q8AL 1ED3A 4AE0A 4L4TB 3BWUC 1M05A 3L3OC 4U6XA 3JTTA 4HCGA 1HC1A 1DL7L 1UGNA 4MD4B 3F05A 1S7XA 3WDIA 5J6HA 5KSUA 1YNTB 4HUNB 4E41E 3RDTB 4JQIH 3KYAA 4MB1A 2WLYA 2KPWA 2QGCA 5IB4A 3TEXA 1MEXH 4G42A 5C0IA 5KG9A 1JGDA 2GVYA 4CADA 2XKSA 4M8RA 4DPBX 1YLBB 4JQIL 4JHVA 4M7KH 2VKXA 5T1LA 3FT3A 3U79A 1MEXL 2DM7A 3IK2A 2HUEA 3NQKA 2Y25A 4G11A 4YK4B 1E2WA 2VWEC 2VKWA 3WKMH 4QRTB 3R19A 4BK8A 1AGBB 1S7TB 2J57A 4B9GA 1PEZA 5JPNB 2WQXA 1R3HA 1QFWM 1SYSA 5GSRB 4PLKD 3WKML 4HJEA 5FDYA 4IJ3C 1QMUA 1VCBC 4K94H 5JNYA 3KVQA 3ULUE 4OFPA 1JZJA 4GMTH 5D5MF 1RZQA 5FM5O 5KUKA 4Q6IC 1RURH 3W81A 5GZOD 2P49B 5T5NF 1GTFA 4K94L 4UT6H 2KC0A 1HHIB 2NYYD 5DEFB 1CFMA 3WTVA 4I4WB 4EN3A 1RURL 4K9EL 4L0ZA 3UTSB 4BFGA 5SWZA 3VNZA 1KTLA 4UT6L 3Q2NA 5D7LB 3VD1A 1PIGA 5TK2A 1WHPA 2IAMA 3EOTH 3PUCA 3VFMA 4L4VE 4EI5A 1ZE3H 5CUSL 4P2OB 1JNJA 1N3NB 2V2XA 4ELKA 3PAVA 3EYSH 4YLBA 2D3NA 2AHIA 3EOTL 5TE7L 1WE5A 5CCGE 2N1TE 3KLAA 1BVLB 4PJ8B 4ZQKA 4HALA 3FUDA 2Z92B 1ADWA 2QSCH 5LNDA 3EYSL 1EEUA 4CU7A 1HQRA 3TO4B 3UEQA 1LM8V 2G3MA 1JPEA 5IY5B 5J1AA 3TN0A 1DUZB 3M45A 1JZHA 1W0VB 1ZLUK 1RZ7H 2CRMA 4K7FA 1UB5A 2PKDA 4G9DB 3VXQB 2PN5A 4BBWA 2CR3A 2NNAA 3Q06A 4Z9KB 1M71B 4J3UA 3WKNA 3LIZA 1RZ7L 3MCLH 4PBXA 4G1EA 4HLEA 1MSPA 1KBVA 5JORA 3L3HA 1IILE 5FIEA 1S7RB 1SXNA 4JPIB 3V5KB 3KPTA 2ITCB 5FWRA 3ERXA 3MCLL 3UCRA 1ZCRA 4HEPA 1WJ3A 2YPVH 1UATA 1G7PB 3GM0A 1S7WB 3QEUA 4ZDHA 3Q05A 4G1MB 2WB1A 3FQTB 4NJAH 4JFYA 3RVTC 2YPVL 3MNVB 4IK6A 4NQXA 1AIFA 1CQKA 1U58A 1FNLA 1L9RA 4KKPA 4KMLB 4NJAL 4Y4KA 2K3TA 2R2EA 4KU1A 5LNGA 1T7YA 3EH1A 3D25B 3X11B 4S0SD 1CR9H 5CZXD 5ID0B 1MLCA 1LP9E 2GTZA 4AWJC 2D7NA 5HGHA 4S1RH 4Y5VC 4X7SH 1NH6A 3W39B 5GIRA 1NLBH 2D0HA 3BIKB 3CVBA 3TBBA 1CR9L 1ZVYA 3ZE0B 3DX6B 5DHEA 3BZEB 3MLTA 1NINA 4LBEB 1JWUB 4Y2DA 5DJ6B 2W81C 1M1XB 4S1RL 5SV4A 4X7SL 3RILA 1NLBL 4PJAB 1NFDF 4KVNH 2PTUA 3HE6C 2HFEB 5I16A 1QSED 4JRYB 4JRXD 4QGYA 4OQTA 4BH8A 4ZS6D 1BBJB 4KVNL 1T3FA 5B22A 4GXUM 3QZWG 2G2RA 2Q86B 2O5NA 2FZ3A 4RGNC 1UASA 4NO0B 1R19A 3GMPA 4Y7MA 1IBBA 2FK9A 2YEVB 3NSXA 3V4VL 2NQ3A 2WSDA 3UABA 4KO5A 4PI2A 5FA3B 4XVSH 3MV9D 3QXDA 1MRCH 3MLYH 4M7ZC 2X4SA 4G83A 3NDZE 1A64A 4YHKH 2WUCH 1BFVH 4ZYKA 1XF2B 1J10A 4EZKA 3I9AA 4XVSL 4GQZA 2QMJA 2J8UE 3P4MB 1MRCL 3MLYL 2F53B 4Q58C 4U6HB 3UZVB 4YHKL 2WUCL 1BFVL 3KPSD 4NKIH 1BHGA 4JKWA 2Z31A 5F0PB 4HJTA 3I3EA 3OVUB 4ZMZA 4FG2A 3NJLA 5FYLD 1OGAA 5SX5K 4XZUA 2BS8A 4WJG3 3CXHJ 3BUPA 1XAKA 4LL1A 3QEHB 3QDMA 2OSLA 4NKIL 2NW3A 1YY9C 4NBYB 1ZT7A 1CBVH 3F2LA 4ENED 5ICYA 2NR6D 5I6NA 4FRWA 4Y4HC 4KX8A 1TETH 3GBEA 2FR4B 1RXLA 2KT6A 2VLKB 3SDAD 3T4YB 1CBVL 1NKGA 4UI2A 3RUGF 1RZGA 2I24N 4L1LA 3WNMA 3ZQ9A 5ITFA 1Y6NR 3C12A 2H6OA 5DQ9A 3BUIA 1TETL 3OPUA 4ZAKD 2ROXA 3CX2A 1JD9A 1TVHB 3VTAA 5C0CA 1IGJA 3INOA 3O45A 5JW3H 4MJ5A 4BK5C 2H1LM 2PO6B 3UAJC 1AZVA 4FYRA 1HL5A 4PRPE 3MV8E 4I9XA 2EQDA 4JFUA 1QZ1A 4XBGA 2NLJA 2Y2WA 5ISZA 1SMOA 5JW3L 1TZHA 4OJYA 1QPXA 1FG2B 1T4WA 1AO7A 4KUZH 3S2CA 3UBXI 4C4KO 1ZS8A 3Q2VA 1IC7H 1RZPA 3RDJA 4TYUA 4P4RB 1ECZA 4NQCA 4UNUA 3D39A 2NY1D 3N5AA 4KUZL 3SPIA 5J0BA 3N44B 1N6VA 2LLNA 1IC7L 3O4LD 1KTBA 5E51A 3LEXB 1C7TA 3M8OH 4WHYH 3WLBB 3UOAB 4JCWA 1BM7A 5FK9A 2BVPA 4Z76B 4RESB 1TKWB 3L7EA 3FO2B 4XWGH 4KV5F 1EAOA 3X1EA 1MVYA 3LN9A 3VRIA 3AQXA 3LS4H 3GBDA 4MD5B 4XWGL 5ANMA 4MVBD 5D7IB 1DJIA 5PAZA 4APQC 1NIDA 3FS9A 4K5PA 4HIIA 3T0AA 4FXKA 5EUOE 1MFAH 3LPFA 4H8QA 4ECNA 2XBTA 4N5ED 3VXRD 3N06B 2DI8A 2BP0B 3LS4L 5IQNA 1MHCB 4CC0A 2K78A 2X10A 4DVRH 1MFAL 3I02A 2V6HA 3OAZH 3ULVD 1A8JH 1U21A 3OGCB 1A9EA 1HIMH 1TMCB 5KAQG 5MEOB 3VXUE 3RWEB 3SQRA 1J8HA 3ZO9A 5L0QC 3VRJA 4DVRL 4MQXC 1NCDH 5C0FA 2EDJA 4N0YH 1IBYA 4Y9CA 3CJJA 1LWJA 3GJEA 2WP3O 3DYOA 4NZDA 3EADA 1JZEA 4UNVA 1NCDL 3FQUA 3JTSA 2V7NA 3DOSB 5LXGH 4N0YL 3BP5B 2NUPB 3O6FA 5HHMD 1IZKA 2EYSB 3AT0A 5DRWA 2A74C 1OWRM 2WXFA 4HUKB 2J1WA 3ZXAC 2NX5B 2GHWB 5LXGL 3TBWA 2AK4E 2NY2D 3TGXA 4PRAB 4KQ3H 3RJDA 3S35X 3TZVD 1AGCA 3GZKA 1JUFA 3VW3H 4AC4A 4MD0A 2ZWYA 1WHOA 2ZXBA 4KQ3L 4ANUA 5IT2H 3IXTB 2DQFB 3OKEB 3QDJB 4ATWA 2JCWA 5I23A 4YHLH 2WAQA 3VW3L 4M61B 4NRZB 4ZW6A 4LB8A 5IT2L 3HI5H 3ZYZA 4Z3JA 2ADJB 5KS9B 3UJTH 1WLHA 3S3PA 4YLCA 4WQOA 4YHLL 3HAEB 3N55A 3NG5A 4LMQI 4QHLB 3OQ3B 4NNYA 3ZDXB 1IX2A 3HI5L 5E2VH 3UJTL 4PGEB 1CMOA 3ARDD 1EA9C 4RAVB 1CGXA 3U4AA 4XMXA 3UZQB 4LIQE 3BT2H 3K4AA 3R8QA 2V3EA 2PCYA 3CWGA 5E2VL 1E40A 3HFFA 5G4MA 3T6XA 3ABLB 4L8SB 3EH4B 5F8RC 2QKIC 3D7PA 2JB6A 2UX6A 1K5NA 3BT2L 4E42A 3GMQB 4ZUTA 1CVRA 4BKLB 1DVXA 5C0GA 1JPGA 1CLCA 1PJWA 1DCEA 1BQSA 1MW0A 4WI9A 4AYBA 3FRPB 4A2FA 5IFJB 5C92A 1CBJA 4V1DD 4K07A 4PJ9D 4N0CD 4P05A 2E5EA 4IM8A 2NY5H 4JFWA 4HCFA 3Q5YA 3U9WA 4JPVH 4KKQA 3U6XA 5FGCE 2ERJB 3D6GA 1DDHA 4GRWB 2OYKA 3QK0A 2NY5L 3ATAA 4HIEB 5EBLB 4Z18A 4JPVL 4RAUB 5EDSA 4H1LA 4LQFH 5DJDB 1FVEB 1G7MB 1QVOA 3VD7A 3WFCH 3ARWA 4HWBH 3L8QA 1U93A 3TEYA 1JYVA 3UADA 3DV6A 3L4UA 4LQFL 5JQ6H 3CFKA 3RWCB 1NGXA 3TX4A 3PQYA 3WFCL 3KWUA 4G6MH 4HWBL 4X6CF 2E86A 3FF7A 3ROOB 2DQDH 3ZPDA 4N4YB 5JQ6L 4CVXA 5SWZE 3QYNA 1CDBA 2ARJA 3K72B 3ET9F 4G6ML 2PTTB 5DYOB 2DQDL 2XXCB 3PWNB 3BD4A 4QUOA 1FF5A 5L8LB 3OLIA 2VDQB 4WUUD 3CDYA 3WXWH 1KEGH 1ZSHA 2XWJB 1H6UA 2WXOA 1HE7A 3TNNB 4IOSD 1ZA3A 2H26A 3AQZA 1FVDB 4PJEB 3VFOB 1UT9A 2R1WB 2TRYA 3FPYA 4Q56A 3WXWL 2ZP8A 5D72H 5CAYB 4NOBA 3SDDA 1A6VH 4LESA 2BJMH 4G6FD 4JBSA 1CXIA 2W9DH 3UH8A 4RCAA 2F1EA 3HG1A 5DFAA 5DVMA 2OMXA 1N2RA 3BQUA 3QUHA 3HHMA 5E8NB 5FF6A 4YHPB 1ANUA 2WQWA 5D72L 5HYEA 4KQ0A 5CP3A 1KGCD 1A6VL 4XN4A 2W9DL 4HWUA 4RAHA 1CTMA 3UTZA 1X7SA 1JOIA 2Y6SC 1NEZG 4GAYB 1Y07A 5CSGA 3FU5A 1LXMA 4K9EC 1SJEB 2EILB 3KEHA 1K8DA 2Y7MA 3II2A 1ZT4B 4QPEA 3ARBD 3NFNA 4ODUA 3G5WA 2BVOB 1IGFH 2DTSA 2APXA 2XNAA 2Y3NA 5LQBH 3BP7A 5AVRB 4Q8BA 4FG6D 4LVHC 3GHBH 3MODH 1CGYA 1IGFL 1IC5H 4U3CA 4ELMF 1U8OA 2WGXA 2P8PA 4PM1A 3QGVA 5AAMA 4BEIA 4E36A 3GHBL 2ZOLB 3MODL 4F9LC 2O26U 2X3CA 3G04B 3MLSH 1IC5L 4U1HB 2ATKA 1VAHA 1WFIA 1USZA 4R4ND 3C8DA 5C8JA 2F15A 4K8RH 2FLMA 3NP3A 1ND0B 2HN7B 5I66A 3WXVL 2BNRD 1N4XH 5TH2B 1CXKA 2EADA 5KVEE 3MLSL 1NIAA 4EBQH 1KTJA 1TVBA 1NBYA 5BW7C 2DQEH 3IETA 4N9GA 4NQVA 1YEFH 4K8RL 3SKUD 4ZD3H 1N4XL 3QO1B 4R5XA 4ZQTA 5IW1B 4D2NA 3LX9A 4EBQL 2DQEL 1YEDA 3QXAB 1MWAB 2VDRL