2J1YA

Human p53 core domain mutant m133l-v203a-n239y-g245s-n268d
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
195
structure length
192
Chain Sequence
SSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCYSSCMGSMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Understanding Oncogenic P53 Mutations and Designing Rescue Drugs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
molecule keywords CELLULAR TUMOR ANTIGEN P53
total genus 43
structure length 192
sequence length 195
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2j1yA00
4XR8C 3D0AA 3D09A 4IBVA 5AOJA 3WTSA 2J1WA 5AOLA 2IOMA 4MZRA 2PCXA 3VD2A 1CO1A 2BIMA 4IBWA 4AGNA 4A63A 2BINA 5ECGA 2YBGA 1LJMA 3Q06A 1IO4C 2MEJB 1HU8A 2GEQA 5ABAA 3QYNA 3WTVA 4KVPA 3VD1A 3WU1A 3WTUA 2IOOA 5A7BA 1TUPA 3EXLA 3US0A 2AC0A 2XWRA 4AGOA 1YCSA 3WTYA 3KZ8A 4AGMA 3EXJA 1GZHC 3Q05A 2XWCA 2X0VA 5G4MA 1EANA 1H9DA 3WTTA 1E50A 2BIPA 2J1YA 3ZMEA 3D07A 4IBUA 5AOIA 4IBYA 3D06A 4IBZA 2P52A 2ATAA 4HJEA 1T4WA 1UOLA 3US1A 2X0WA 4IJTA 3WTWA 2ADYA 3WTXA 3D08A 5AB9A 2BIQA 3Q01A 2J20A 2J6WA 4LOFA 4AGPA 3VD0A 1EAOA 2WGXA 4IBTA 4QO1B 3IGLA 5AOKA 4AGLA 1TSRA 2X0UA 2H1LM 3QYMA 2BIOA 3TS8A 4AGQA 4GUQA 2J1XA 1CMOA 2OCJA 5AOMA 1EAQA 1GZHA 4G82A 5LAPA 2J21A 4LOEA 1HJCA 5KBDA 5LGYA 2J1ZA 2RMNA 3IGKA 4L0YA 2VUKA 4LO9A 4L0ZA 5BUAA 4IBSA 4MZIA 3KMDA 4IBQA 4GUOA 3D05A 2FEJA 5G4OA 5G4NA 1KZYA 2IOIA 1HJBC 4G83A 2AHIA 4L18A
chains in the Genus database with same CATH superfamily
3S8GB 3HS0B 3I9AA 4RWHA 5I1EH 5LG1A 5KSBA 4G7RB 1ZHLA 2AJYL 3UC0H 4HIQA 1P1VA 1P2CA 1BJ8A 1Z66A 3DTXA 3X11A 5KG9A 3WMPA 1KULA 1AFVL 4G8GB 5K9QG 3EO1A 2V4LA 5ECGA 1ZEAL 4LDEB 2HUEA 4A2EA 2PR4L 4KK6C 3K6FA 4XVJL 5IVZB 1PZSA 4X5XA 5IFHL 3DTUB 4YSQA 4XMPL 1OT2A 4ACPA 3P4OA 5AG9A 1S7QB 3CFTA 3GKWL 2ZYRA 2ROYA 4XOBA 4TN9A 3T8MA 4E41A 4S11A 5E5MB 1WA1X 1DEDA 3IDXL 5A7BA 4H26A 3VFOA 1SOKA 2ERJB 3EGXA 4J5VA 5FUZH 1BM3L 1P1ZA 3WS3A 1RHFA 4XBGA 2OKMA 3TV3H 1MLBB 1NKRA 2V2TA 1BQHB 4TTGA 2K6WA 1AXTH 4HSCX 2A73B 5I6NA 1TSHA 1ZK9A 5L2JA 4U1IB 1DBAH 3UABA 5F0LB 3HNTH 4YDVB 2EVJA 4XE5B 3K8KA 4NJAH 1UB6B 1WLHA 4LU5L 3EHBC 1A7NL 2JLLA 2P24A 1QUNB 4M48L 4IGBC 1OHQA 2P8LA 3RX8A 2NDFA 1T7YA 1YAIA 1OAKH 4XX5A 4DO6A 4PV8B 1CIUA 4XPBH 4WSKA 4D0BA 2O6CA 2CQVA 3S35H 5JDJA 1UASA 3ZDXB 1N68A 4IOIA 3CDGA 4HU2A 4MJIB 5CZKA 5IJDC 4YWGL 4PJCE 4QYOB 4LHJB 4PJ9A 4X5WB 4Q6IA 4Y4FA 2BNUB 2V7NB 4ERSH 4Z5RB 4ZPTA 2ETWA 1EGJA 2WVTA 3GZKA 4X8GA 4NN6C 3D3VE 4YXKL 3NJLA 4A2LA 1WTLA 4WCYH 2BNQB 4ZXBB 3TA3D 3QK0A 4L4JA 3BAYA 3K71B 1OANA 4RA0C 4ODHH 1QSZA 3LRLA 4Y0GA 1UB5B 3IU4H 3N42B 1F4WL 1MRFL 4O2CB 5J6GA 2R1YA 1HK6A 5AAMA 1VFUA 5L7XH 1GTNA 5T3XH 3MLYL 1N59A 3ZIYA 3RA7H 2H45A 4G9FA 3TT3H 4YHNA 4LGPB 4K7FB 2CK0H 3MR9A 1FHGA 4H8WH 1T1WA 5BV7L 3T4AC 2XG4A 2CIIB 3UTSB 2YAPA 1B0RA 1YJDL 3Q2WA 4HAKA 4U1HB 1DVFB 3O6LH 3S37L 5BV7H 5JQIB 3AITA 2LFEA 4G8FA 5KSBF 3SGEI 4N1EA 1CDHA 1OSZA 4X7EC 3ARBC 3Q9QA 4Y1AB 5T3XL 4I5BB 4J3WA 1IM3A 4TVSa 4UQIM 4Y5VC 1BFVL 3OMAB 3HIZA 5DI8B 1GYVA 3FB8A 4CC0A 4CW1A 1QFWL 5DMKB 3BESR 3VXME 4P04A 2YBRB 5F1SA 5HYJD 1NAKH 3MLUL 1MF2H 3O2VL 4U6VL 1TEYA 2AVGA 3S48A 2O4EA 4R4NC 1TJIL 3FF7A 5MEOA 4KO6A 2Z35B 1OW0A 4AQOA 2VXQH 4P59L 1LTXA 2BSRA 4JFXB 1QQDA 2VN4A 3RGVB 3WE1A 3WAKA 4F8NA 3FQNB 2ILLA 4GKSA 4B6ZA 1B4RA 1XGZA 4LRNL 5H94A 1NOAA 2G0KA 3DVIA 3NFSH 4FFYL 3TBBA 4KDTA 4ZX5A 2EYSB 2APTA 5T5FH 1XB3A 4WI7A 4XTRD 3LMJH 2X1XR 4ICWA 4KUCD 4OZGE 4NUGL 1U8KA 5TDNB 3KLQA 3LTVA 1D9KD 2EEXA 5FGCB 5CHNB 4NDMA 3P4LA 4MQXD 3GIZH 1N2RB 3BT0A 2VDOB 5DEFA 1BAFH 3VE0A 3JWDC 4ELDA 2X3BA 4OZHE 3FPXA 2Z1KA 1BOGA 3W81A 2HN7B 3RZCC 3UJTH 3SKNB 3NYKA 5AW4B 4M7JL 1LD9A 1Q9KA 1BG9A 1FV1B 5F6HI 5TE4H 5F21B 2F8VA 5DSCB 4G6ML 3MMEB 1DJXA 3VFWA 4NQSA 1PF3A 2MMXA 4LQFH 1NAMB 3RZCA 3N0PB 5ILTH 3HMWL 2NX5B 4G6MH 3AU1B 2UY6A 3QIUA 5K1VA 3T2NH 1XF2A 1UZ6E 4IOSD 2ADGB 4MRBA 2DTML 2ZUWA 5DO2C 3WDJA 4MD0B 5C2BL 3HN8A 3BVUA 1PIFA 2BOCB 3T2PA 5EFIB 1KJMA 2CXKA 5E8DL 2AJYH 3EYQC 2H6OA 4QHUA 3UC0L 1H8LA 4K8RD 1NA8A 2GKIA 4EE2A 1C16B 3HHRB 3W9DA 3ARDC 4RMTA 4EDWH 3MLSL 1UCBH 3H9SE 5D1ZC 2IAMB 1E67A 1D3CA 3IS1X 1UVQA 1UM4H 3O81A 2RR3A 1WAAE 4ODUB 1RK0A 2DJ4A 2ZOKA 3C5SA 3F5WB 4AYGA 3BVTA 3BQUA 2VQ1A 4PJIB 5MERB 5F89A 5BS0B 1VF5C 5DS8B 2WINB 3HE7A 2L04A 1SHXA 3D0AA 1AY1L 5I8OL 2AJZA 3IGUA 1SJMA 3ESMA 3QPXH 5CGBA 4IMKC 5E6ID 1IKFL 5CZVH 5B38A 4D7PA 2Y2WA 3K6NA 5H35A 3KYOB 9PCYA 1RJYB 1TCMA 2J3SA 1K4DB 3U4EB 3QEQD 2CBPA 3TEWA 1ETA1 3VG0H 4TSCL 3VXSD 3T4YA 3UL4A 1CLZL 3CLEL 3O2DH 4AZ8B 2ICWI 4BCYA 4EOWH 1FFOA 4EZJA 5J11B 4G1EA 3MNZB 2VDPH 1SLUA 2Y4SA 3P0VL 2C4XA 4DWHA 2PCPA 2OQJB 2ESVA 3MJ8B 2WWOA 5IKCB 2IFFL 1H8OA 4WV1B 2CDFA 1U95B 1NGZB 4X80L 4R0LA 1OB1B 1XCTB 4XH2B 3IMVA 3IXAA 1JI1A 2ZCKH 4LEOA 4FD0A 4ZI8A 3BPLB 3I02A 1CGVA 5D1QE 1OAXL 4MYPA 5DJZA 3QXWA 1G7LB 3WS6A 3RL2A 4L1DA 1TCRB 1WSST 2DH2A 3QHZL 2NNXA 1W8OA 4K73A 4OLWL 1IQDB 4ISVA 4R2GB 4ZTOL 2FBJL 2XG5B 2BVYA 4JFFB 1KCSL 2H2PC 1CF8L 1MCKA 2Y7QB 4HP5A 4Q4IA 4JFDE 3WLBA 1E8WA 3MRJA 3VWJC 1L3NA 4GIAA 1TQCC 4U1GC 1EJFA 3HPJA 1E9QA 5EF0A 43C9B 3HB3D 5LWYH 3QUZC 5I0YA 3U0PB 2DWEA 4OQTL 1O5PA 1OGTB 5AKVA 3ALWA 4JAMA 2EXTA 2JK5B 4PCKA 1ASOA 4F7CB 5EZLA 1MPAH 5IBLD 4OH2A 1GYWA 3FB7B 5HHNA 2EKJA 4XNDA 1AD0B 3I85A 3C8KA 2BSSA 2CJTA 8FABA 2CPUA 3HC3L 5DU7A 3B6SA 4IKKA 2L7JA 3GMRB 3QFGA 2GSMB 4JRFA 4XPAH 3TESA 1ZHBA 1AZBA 3HMXH 3TNNA 5BRZD 1AKJA 3RUGB 3U46B 4U6YB 4PJ7B 5EOCH 4PJDB 3ZYZA 5SWQB 1QR1B 1UEYA 5H2BA 3VA2C 1WO2A 2XKUA 3AAZA 2VITB 3S6CA 3WEMA 1F13A 3KPRA 2VW4A 3MRNB 3VWJD 5IFAL 2IOIA 1ML0A 3Q1SL 4KAQL 5IK3B 4PJXA 2VSMB 1OP5K 3N3EA 2AZUA 2H2PD 5EZIH 3WCYA 4DGIH 1TNMA 2DAVA 2XNAA 1KB5A 4ANWA 4C55A 4YS4A 1LXMA 4KOBA 4PJ9B 4QGYA 4Y4FB 5F9WB 1XT5A 4GIPD 5EIIG 4K3JH 4PJGF 3CDGB 1E4KA 4ZODA 2ADFL 2H3NA 3E7JA 2BC4A 4LLUA 1P4LB 4ELMB 1I7RA 3HZMB 4MDJA 3U0WL 2J12B 35C8L 4HKJA 3UTSD 4LCUB 3D85B 4KZDH 1BMGA 2VLRE 4RQQB 4JPIB 3RWJB 3NIDB 4NI3A 4DZ8A 5FDWA 1JS4A 2F19L 1C12B 1WIOA 4FQXD 4AM0Q 3HVDA 4FNUA 1KUMA 2FX7H 3EKCA 4FQQB 3PREA 2PCPB 4F15B 4W9EC 1FFPB 3SZ6A 2E47A 1CI5A 1GPOH 1IZKA 3CDYA 5CCKH 4LF3B 3THML 1HYRC 3FN0L 1M7XA 2ICWB 2J2ZB 3RJQB 4KZEH 1FFRA 1KCSH 3KE0A 2VDQL 1IGFH 3KBHE 2AQ2A 1EO7A 3P9MB 3B2UD 1MN4A 4OLXL 3GNML 2GCYB 3MUY1 3SIKA 1QYGH 2QADB 2RBLA 2YPLD 1HVXA 1VJSA 1KLGB 4CNIB 4WWKD 3HZVA 4NIKB 2HKAA 1JWUA 2BVQB 2WIIB 3CHXA 4JM2D 4PVMA 1E4JA 2F7QA 4OJYA 1PG7W 4R8WL 1BBDH 4YE4L 1AGFA 3LV3A 5HHOA 4M00A 2P8MB 3ZDXE 5DS8A 3QI9D 2EILB 4ZUVB 4GQZA 4F80A 2HAZA 2VQ1B 2F1EA 5ITFB 1RUMH 5G5DB 5DD3H 5C08D 4AKQA 3L3KB 2EDBA 4R97C 4AT6A 1H19A 2AF2A 3UBXA 5K9OA 3U1PA 4JFOB 4QY8B 2YGPA 1H5BA 3AY4A 4HZLA 2GJZB 1SF3A 3HPLB 3OB8A 4PR5A 4UT9H 3SE4C 3T3MB 1JGDA 4BK5C 4DEUA 1WZLA 4GRLB 4NENA 3PWVB 3OTTA 5SX5H 4ODXB 2ZQKA 1HCFX 1SYVA 1MHPH 2XIDA 4B0MB 1JYWA 3EHBB 1QRNA 3VXRA 4H5SB 5I16A 1SRDA 3GZOA 2AJXL 2DM3A 1AY1H 1XTMA 3FQWB 2CM5A 1YEHL 1KTRL 2OK0H 5HYIA 3HEIB 1L0PA 4P5MB 3DOSB 4F3FB 2LLGA 2X4NA 2W9EH 4HBCH 1OW0C 3FUHA 4CAGA 5KSVA 3O2DA 5F9DC 1DN0B 4N0CC 1W16A 1DUZA 3U9UA 2FATH 4L48A 4YE0A 5IVXE 5TE4L 2FD6L 1KWKA 4URKA 3UTTE 5K9JL 4ODVL 2EEFA 5CEXB 2DQHL 2X05A 5IQOA 3S3CB 4C54A 1SMOA 1JPEA 1XZ0A 3HVNA 5MEPB 5J1AB 2EYSA 5C7XH 1T21A 3D8MA 4XGZA 4Y8AA 1A6UL 3ZSTA 5GJSH 3I50L 2AEPH 2UZPA 3LH2L 4OAWA 2WMPA 4ZMAT 3KHOA 1JZJA 2CLRB 5ANMA 4QOKB 5TD4A 3I9PA 4R96B 3V0EA 4NOFA 1Z9PA 3SJVE 1PZDA 4IDJL 3GKWH 4MMZA 3O41A 1WE5A 4KVNL 4R4ND 3LHPH 4QMEA 4S0TD 3K6SB 3BP6B 2Z8SA 1GSKA 3HFML 4M3JA 3PF2A 1MFBL 1IB5A 2A6IA 4KXZI 4KRPB 3V6OA 3KPMB 4QDGA 3R7QA 4G6FD 3PXLA 1YEWA 1JOIA 4CKVX 2IDQA 5KVDL 3V4UH 5JW4Q 3EDJA 3L5WB 4O02H 2BVPA 5AG8A 1B4JL 3FB8B 2L7QA 4NI6A 4NYLA 1U3YA 3HBZA 4OI9A 5DT1L 2QSCH 4P3DA 1IE5A 5HHPA 3QWOA 5GS1A 3CHQA 4Y8DC 1KGUA 5I76B 5F7BA 4HKZA 5E8EA 5TDOA 3BP4B 2CKBA 4NZTH 4KDWA 4K9EL 3TU6A 2WP3T 2F18A 2H1PH 4HHAA 5IV2A 2B9BA 4MJID 3DUUA 4AGQA 2VLJA 4NPKA 5JW3L 3MXWH 5DJ8A 1XXFC 5EIIB 3ROLA 1EFXA 2CUHA 3QJRB 4QXUH 3NJGA 4KTDL 3WJLC 1A9VA 2ICEB 5AVZB 4NNXA 3OGCB 4AG4L 4DP9X 3NIFF 5IIEA 3J8F7 3MV8A 3QJFA 3ORJA 4KH9A 3BAKA 4D9QD 5E1HB 3D0VB 1P9MC 3HI5H 4ZMWA 2C1PB 1UXMA 1CL7H 2HG0A 4P23B 5I1LA 1HDMA 4I2XE 5C8JB 1LDSA 4NKQB 1BQLH 4U1KA 3MRGA 3ZE2E 4D0DA 2WVVA 5IF0B 2AV7A 3U2JA 3SGJC 4AUYA 4FXGA 3KPPB 4KTDH 1TJGL 1QOKA 4PV9B 2ZCHH 2C7UA 3PNRB 3QO1B 3HW7A 4OY9A 4AE1A 4PYGA 3FN3A 2DM4A 3VFUB 4JFEE 1R4XA 2OXGB 5HJBA 3FT0A 3T0XA 4ODTH 3UO1H 3CZEA 3NEOA 3QIUD 4DF9A 1T6VN 3DX4A 1LM8V 1IGJB 3HAEH 3MLXL 4ZUSB 1JZFA 4MA8L 4PREB 4J23A 2H4EA 3W9EB 2FQGA 2IAMC 1Z9OA 1ZKAA 4MWFB 4KHXH 4YSOA 4G5ZL 3O3EA 4JCLA 4KK5D 2Y2TA 4XC3L 5I19L 3MLPA 1MVFA 3QO0A 3HMXA 4BE5A 2KLSA 3WS3B 4APQD 2W0KA 4O02L 2W38A 3F58H 4POYA 1TVBB 3OSVA 3W0WA 3ZR5A 3CC1A 3R06A 1FAIL 4OCMC 2Q3XA 3BCFA 4WKXA 2EYTA 4MD4A 3V7AE 4WHYH 5E4IA 4DOHE 2DMHA 1NUDA 2JH2A 4LP5A 2ADJA 3PL6A 3MLWL 4XWGH 3UZVA 2UZXB 1LK2A 2QGBA 3C60B 5IROA 4WY7L 2MPVA 2W88A 1ETZA 3C5JA 2BDNH 1SXSA 4L8BB 4YSEA 4PRDA 2XZZA 4J7RA 2XXMB 3X3FL 1MDAA 2YD2A 1DSYA 4LARH 4TS6A 2QLVB 3KPSA 3UPRA 3ZT5A 4GAYB 2BP0A 2PWDA 4ORGB 3CMGA 4XPTH 1RPUA 3HUJA 5D8JH 5SWZB 5CGYC 3KW7A 3ISYA 3GIZL 5DGRA 3QWQB 3UYPA 4AYBA 4FFWC 1M2VA 1SDAB 2VKXA 2QVTA 2MOQA 4FTDA 1MFEH 1M56B 2XPGA 2NQDA 3V95A 3BWAA 4GOSA 1OF2B 4XCCH 1TSRA 1QSFE 1T83A 5AVYB 2JI2A 2APXA 1J1XL 3NA4A 2APWA 3X1BA 4FNRA 3D7PA 5LGJA 3APMA 2XPZA 3CLEH 1YEEH 3F00A 3WIHH 3RFZB 1PEWA 1U8JB 4N0RA 3K2IA 4PJBF 1EHLL 3QDHA 1HHHB 3QC5X 5D1XB 1MG2C 2HFFB 4K3HA 3ZRSA 1QLRA 5AW2B 1QSEA 5I8KH 3L9EA 1AI1H 3MLVL 2MPAL 5D1XD 3FS9A 3L3HA 4Y1TA 1X5XA 4WF7A 2WNKA 1HYSC 5HGHA 2AJ3A 4NWUL 3S5LB 4PS7A 3P3SA 2K7PA 4P06A 2VB5A 4I77L 2WPGA 3VWJB 1WZ1L 1QZNA 2JKXA 4M6NL 4EPSA 1P69B 3GHEL 4QTHB 4BZ2H 2Y06L 3SPJA 4NRZB 4Y5XA 1S46A 3FOLB 1QWHA 4GXUM 4N85A 3V0AC 5I23A 4UILH 1WWWX 3TO2A 1KJVA 5D1ZA 4CMHB 1WUZA 3BT2L 3QS2A 3IM1A 4KUZH 4OD2A 3UZEA 3VQ1C 2F58L 2EXSA 1VPOL 5C07A 4UIKH 5FW8A 4HGWA 5FB8A 1SOSA 2E27H 2OL3A 4NQVB 5DC4B 2HRPL 2WO2B 3PQYA 1G7JB 5D6DC 3H2QA 2A0LD 2Z8VC 3HZYB 5CN1A 3MRMA 4PU2A 1NBYA 4HMDA 4DT2A 1QFWM 1LEKA 1HKFA 3WNJA 3PJLA 3FF8A 4Z0BL 4E5XA 2Y72A 2NPLX 2XA3A 4GSXA 1JZEA 3NACL 1JZ2A 1WD9A 4XE0A 3MKGA 4YMPA 1CJYA 3CVHA 3U4BH 1FRGH 1UT9A 2EH8H 3EFOA 3QJVB 2EIMB 2NY6C 2WKGA 3L4UA 2NOYA 3JQOB 1FPTL 2W92A 3SDAA 4J39A 2KPWA 4OUOA 5C0IB 1JV2A 5JYLA 3CSYB 4FA8A 1JCKA 1KG0B 3K80A 3I3BA 3LEYH 4GXUN 3UZEC 3VFVA 1KBVA 4NUJA 1EA9C 1I3GH 3NJVA 3VO0A 5CEYB 3VAEA 2PPEA 2CJUH 2X4RB 4KRLB 5CINH 2QLYA 2R0WH 4L3FA 4L1SA 4J3OH 5FYLD 3RPKA 1BFOB 2DYPA 2WBJD 2W1NA 2C3WA 2W9EL 4FS0A 2I07A 3BAJA 3K4DA 3TXAA 3U83A 4F1SA 3VFPA 3P4MA 2IQAA 1SHWA 4KVNH 1AACA 2WGXA 1KJ2A 4MQTB 4FJ6A 3RU8L 4CVWA 4DEPB 1ONQA 2CKNA 2WOYA 3CCHB 3DX9B 2DIBA 2V0AA 4A2MA 2F7IA 1ZLSH 2B2XH 1AP2A 3HZYA 4LDLB 3JTSA 5HYSA 4FMVA 4O5LH 1FVDA 2VXTH 3V4VA 1XQ4A 4NUPA 3PWUB 4HJIA 3CVBA 2R59A 1KBGL 1YYLL 2BVOB 4PG2A 1UZ8A 2YUWA 4M93B 1JFHA 1YEKL 1DQJB 2FYYB 3CV5A 3MRFB 3SOBL 1AIZA 4ZDHB 4HKBA 2FT7A 1LE5A 3SOTA 1U3JA 2AK4A 4DVRL 4LCWA 3ZE0B 3PWLB 2JCCF 4Z7VA 4B7IA 5CLZA 3CK0H 4HEPG 5ANME 1QSFA 5I17B 5KYYA 1ADQL 1DBML 2QL1A 1WGVA 5HI5D 3ZKMC 5M95B 1FUNA 3UBXG 2NY7L 4WW1B 5CP3H 5F7WC 3TEUA 2X41A 4EQ2A 1CU4L 3FUFA 1ET7A 1U91B 2I9TB 3I6GB 3AMKA 1HHHA 3UCRA 1SJHA 4K5LA 4TUKH 5DHVH 3H55A 1CGYA 1PTZA 3ZOAA 3A6CL 3K5SA 4MYWB 3Q2NA 4MLIA 3L7FB 4LSQL 2Z34A 3LQAH 3I75A 4NO0D 3A6CH 1RPKA 2A9AA 3BLPX 4JQXC 1GGBL 2PYEE 5CJXC 4DUWA 3L45A 3VFMB 3NP3A 5ICZA 1EO5A 1E28B 1ZXKA 4B27A 3LIZH 1G94A 1W91A 2EVFA 4PRHA 1GKOA 3PHSA 1TZIA 2HRPH 2XKNA 1U41A 2IANB 2YMTA 2DYSB 5T1JA 3VACA 1L0QA 5CN3A 4IRZA 3QH3A 3S35L 2CJSA 4ZUTB 1U8CB 1KTCA 1E7UA 2ZG1A 4G7YL 4NZFA 4PD4K 5F1OB 3PLYA 5GS0C 3BEVB 3GSXB 3EIFA 2ADJB 1CCZA 4ZFOL 4E42B 1P7KA 2IGFL 1PYWB 1T2QH 3O0LA 1CT8A 2DMBA 1XIWB 3WLWC 4X6EA 5F9AC 3INUH 2NTSP 2E86A 3BDYL 5CGTA 4NBXB 5EIVA 5CJ5A 3NCCB 2PETA 4I1PA 3HN5A 2Y3AA 1S7RB 2IWGA 4OW6A 5I6MA 1I8KB 5CSBA 3B7UX 1HNFA 4W9IC 5AOKA 3FZUD 1ZHKA 4PIRF 4UM8A 2Q6WB 2R9HC 2E7MA 3OKNA 2COQA 3GZPA 4ZFFB 4Z7UB 1DQDH 2R39A 2ENYA 3CFBB 1JVLA 3T3PE 4CJ0A 2YEZA 3IJYB 4F9PC 1NEZB 4X0NA 3MZTA 3ET9F 3QB7C 3ESVF 2D7QA 5KOMC 3WJLA 4LIQL 3HC4L 2XLLA 3RURA 1G9EA 1M6OB 4PJFB 3TLRA 3VFUA 1D2OA 1WWCA 3C6LC 4UTAH 5KYWA 5IW1A 5IJVA 3EGSA 2P5WD 1G87A 1GSMA 2AMUA 2V2XB 4FFWD 2KLTA 1EEZA 4FXTA 2KS0A 4U1SB 1JPFA 4Y19D 3FYIB 1IIIA 3CPLB 1OM3L 1MW0A 1IM9D 1BMWA 5MEQB 1W0WB 4L3EB 2OV0A 1Z5HA 2WY3B 4WZ9A 2Q76A 4P46B 4LARL 3ARZA 2E6PA 1U8NB 1OD9A 3T4AA 1Y7VA 2IGFH 1GHFL 2DJMA 4GLRH 4LVOB 5GRUL 2X9XA 1IAIH 5DJDB 1UURA 2DDQH 4HMEA 3N5AA 5CSZB 4WFGD 4Z3JA 3QFDA 2JJSC 2ZONA 4WWKB 2B08A 2CNZA 1TTFA 3DUUB 1T0NB 2AK4E 3MOBL 3NSCA 4Y16B 5JHDE 4Z7IA 2AK1L 5PCYA 3LZLA 1K8DB 4OFVA 1YNTF 2YXVA 2J25A 3INUL 3X1FA 4ZG1A 2ARJA 1KXHA 1NCWL 5D7SL 3FH5A 3COOA 4FHBD 1HHIA 4KHXL 3UYRL 3DHPA 3MLZL 4I1NB 1RUPH 4TNGA 3NJFA 3OMIB 4JQVC 4XN8A 3QWOB 4Z7OF 1OARL 1YNTB 3RAJL 1FZKB 3JYCA 4HLZH 1SYSA 3QUXC 4N2GA 4YSPA 4BWWA 4JO2L 4M8QA 1A9EA 2XVLA 5EBMA 1MFVA 3AROA 4ODWA 2CA3A 3DARA 1FC1A 1BQKA 1DDHB 4KMTH 4CSPA 2GIMA 3WFHA 3LRSA 2J4WL 3DGGB 5T1MB 1Y6KR 4JGUA 2PW2B 4KMTL 3W1ZA 5DYFA 5KSAB 1GL4B 4HJEA 1A3RL 1J05B 2VISA 2EDKA 4OFYA 5EBLB 3O41B 4EZKA 1UA6L 2Y7SA 2WBWB 3HZKB 4P9HC 2J6WA 3X13A 5DVMA 5TF1L 3RB5A 5I1AA 4TUKL 2OMNA 1JZGA 3BHBB 2MIZA 4K5MA 1C08A 2F7RA 3CVCA 3FUDA 5FFLA 5E94B 3EBAA 3TBWA 3GSOB 1VACA 1IGMH 2KDGA 4G8GD 1JZ7A 3LYRA 3UZQB 1TQWA 4WI5A 3KR3H 2X6CA 1DQVA 1K3IA 3CJJA 3NFPA 2IDUA 2NDGA 5GISH 1QBLH 1TEGA 3QNZB 5D7IA 1U3HC 2AANA 3A4DA 3O9WA 4G6AC 5KAQF 2H2SD 1FH2A 3CZLA 1N8ZB 2BSCA 3QZPA 4GI6A 4UQ2A 3HS0C 3CSBA 1R34A 4JDZA 1NIFA 1NMBH 3HG1E 1ZT7A 2KDYA 2RTTA 1JJUA 1NCBH 4PWFA 3HG1B 2NX5E 4AWJC 4FF9A 5IQ7H 3DSFL 3FJTA 1FDLH 1IJNA 1CD9B 2ZIDA 3FO9B 3IMSA 3VH8B 1U8LB 4EAEA 4I3RH 2Q86B 3GLEA 1G43A 3QUGA 4NO5B 3RBSA 3P0GB 4PW9A 2OTUB 3UEQA 3PGFL 2CR3A 2K6ZA 2HA1A 2CJUL 2X87A 2VIRA 3GPSA 1I3VA 4G9FE 1UD4A 4ZO9A 4XMKL 1NGPH 2WANA 5BRQA 5I30L 3BLKA 3U36B 4FTVA 2P42B 1D9KA 3HNVH 2VZUA 5BVJB 3M1OA 5F7HA 4GMSL 1DO5A 3OLDA 4N68A 4XI5D 3NA9H 5CNHA 5K39B 2FJHB 3H8NA 5DJ0A 5ERWA 3ECUA 1MCOH 1T3FB 1E5UI 4WJKB 2VDMB 2ZKHL 5JNYB 2AEPL 4XNUH 5TJWK 4M7ZB 5LQBL 3KR3L 2KBGA 4QHLA 4WWKA 3MRPB 5D96C 2RH0A 4IU2A 2ICEC 3ARFB 5I75C 1OLZA 2Z31C 1S7UA 1RVFL 2I24N 1QACA 1QHOA 1AE6L 4MZ2A 4HUMB 3BRGC 5IHUH 2XN9E 1GOGA 2X6UA 3HI1B 4DJMA 2EXYD 4E9YA 5HYJA 3OLEA 4FQCL 5C0AE 2I5YH 3IGAB 1NCGA 3OAWA 3ZX1A 2Q76B 4P46A 3ULAB 1GCFA 4XP9H 3EO9L 3QEGH 3T0BA 2I7OA 2N0MA 1FNSH 1W0WA 2CO4A 1NCDH 1XMWA 3P30H 3P73A 4JRLA 3VU1A 2R29L 1AZVA 4JJ5B 5AW7B 1QG3A 2J5LC 1M9WA 3GMNB 3MOQA 4WKZB 4FQQA 4I0PA 2A9ML 5ESAB 4P57B 1QBBA 3WL9B 4PJ8A 4EI5C 1KN2H 4N8CL 1BBJA 2ZXCA 3V7MA 5C6PB 2Q7YB 1LO3H 1TITA 3GGWB 1NDTA 2F9BT 1JYVA 3U36A 4U3SB 3D33A 5D7IF 5B38G 4JPSA 5LAPA 2CCWA 5EWIL 2C9QA 1UJ3B 2APBA 3OHMB 1RUML 4PJHA 5HHVH 3FQUA 3ABLB 5GRWA 3ZHDA 1OO2A 2DQFB 2DJUA 4HHWA 4P4RB 5DURD 4P9ML 3TYGL 1F6LL 2G9HA 1H8SA 3F85A 2DJSA 3EJCA 3UMNA 2VITA 1TZHA 2OTPA 3FDWA 4OLVH 3LNEA 2DZEA 4J3OF 5SWQA 5E2UH 5E2TL 1I8IA 4CU8A 3PQYE 1S7SB 4HS6A 4PGEB 3SDCC 1HXYA 4XP6L 4KROD 3QDJB 1HHJB 3WV0A 3PHOB 5GZOA 5J0BA 5D6DA 3L1OL 1DJWA 5EORH 4NFBA 4TVPL 2GTWB 1UWEH 2VXSL 4ZUTA 5L2KB 4HIXH 3EH3B 1EUTA 2GBUA 3FB7A 5HHNB 1S3RA 2P4AB 2ZUUA 4BFOA 1N3NB 5DD5L 4X6CE 5JIHA 3HJEA 3MV8D 4PRBB 2ZCZA 4GP5B 5AWNH 3EBHA 4ERSL 5ABAA 5TE7L 1VSCA 3HB3C 1MCPL 2O5YL 2FD6H 1C7SA 1UWEL 4OCRH 2HRHA 1FL3A 1IBFA 3L7FA 4JDTH 2MCG1 3SDCB 4IKLA 5ID0A 1J48A 4KDVA 1WVZA 2IANE 3RVVD 5D70L 3C6LA 3NCYS 3AQDA 4M1CC 2WXMA 3L08A 1BD2A 2TAAA 2ZUSA 1RI8A 2GJPA 4WVRA 3HC0B 3D18B 2C7FA 5ID0B 4U7KA 4ELKA 3E6HB 1DBAL 4JO1L 4RWYH 3LEYL 3SJVA 4U05A 3JXAA 1FDLL 3WHE1 2VW7A 3BZDA 4N24A 5JMOC 3O6ML 3DKHA 3HLKA 3WO4B 1PJWA 1D5MA 3WE6B 1IC7H 3DOIA 3GMMB 2BM3A 2BNQD 1Z3GL 3VXSA 2XY1A 2EIZB 3NZHH 1FO0A 1TZOA 4GAFB 1LE5B 3QCVL 3IGLA 2NRDA 5J3HC 2LR4A 5KAQG 5AAWC 1CXEA 2EE9A 1E65A 1OT4A 1J9RA 4JANA 2CO7B 3PP4H 4JG1H 1K4CA 1HILA 2E7BA 1CMOA 1ZANH 5CIPB 3H2WA 1WF5A 2ZAIA 1AH1A 2WXLA 3FFOA 4RAUB 3TBVB 5FYKD 1I8IB 3QUZD 1THCA 1RK1A 1QSED 3QXDB 1TZHB 3OAUH 1MWAA 4UB0H 2WXGA 3U7WH 4TQPA 1CL7L 1T20B 2H26A 4K9EH 2NY6B 3GSNB 4ZMQA 1YYCA 4KK8D 2RA1A 4IRZH 2PPCA 3ZO0A 1ORSB 2ISDA 3PRZA 3KPNB 4P46D 1LK3H 1WA2X 2VLKA 1PNDA 3HAEA 3E3QC 3KHQA 4GINA 4JZJC 3B3IB 4KZCA 2VM4A 3S3DB 3IRCA 1J8HD 2HJLB 1TYEB 4Z3TA 2QBWA 3JVFC 1WRFA 1D6EA 3F7YA 3JWNH 4HUWA 3N42F 1NQBA 3IE9A 1OEZW 3G6JE 5HGBB 5ETUA 2KLRA 3TCTA 1S9YB 3KWTA 1ZA3B 4UTBH 5FA4B 4BFBD 5E6RB 4WENB 2EE0A 3DPBA 1RZ7L 1A4KB 3CSGA 4PG9B 4CMMA 1MY7A 4WDIA 3RGVC 5JLZB 2YAOA 5IB4B 5F1IA 4BRJA 2C1OA 3QEHB 4KVPA 5DZOA 3WU1A 4HF5L 4AMKL 5HDBB 3AREC 1XR9B 4N2MA 3VGFA 2BP3A 3IAPA 1L0XA 1CZ8L 1SVZA 3B43A 4JFEA 1EJOL 3CDFA 1LO4H 4OZHB 5C07B 3RTQB 3S97C 1YNLL 4EXKA 2X2IA 4Z0XB 4L29A 1Q8MA 5HDLA 5E70A 4HYTB 4LLYB 2ZSVA 4WEBL 4XTRC 1T5XB 2PO6A 3TOPA 2EIZA 5IR1A 4BH8B 4BUQA 2IANA 1AZZC 3MBEC 3GJFK 3NRQA 1KDJA 1UT2A 3FSOA 3UBGA 1R6VA 2GHWB 1UJTA 2AABH 3OKDA 3QZNA 3UTPD 5D5MF 4UIMB 3DI2B 1T2JA 3H56A 1LNUA 1MHEA 5F7MC 3WN5C 4B95C 4LP4A 4LASL 5MEOB 1OY3B 5C0CA 3BH8B 2XA8H 2IMMA 1LHZA 1LO0H 2JKTM 4MJ4A 4NQCB 4IS6A 1GGIH 1BM7A 5GIRA 2CNYA 4GMTH 4BZYA 5H37H 1Z9SA 4YC2B 3RDTB 3RX9A 4U31A 4UM9D 3FUKA 1FYTD 3KW8A 3G3LA 1Z7JA 1EHXA 4HPHA 3HLAA 5D1QC 2MKLC 3OM3B 5LGJB 2CGYA 5A7EA 4GRMA 4UAHA 3FO9A 1D5ZA 3MGOA 4RZCB 1HQ4B 3DX2A 3VGGA 5EU5B 5J89A 5GIRB 5FYJE 4XPGL 1G6RB 1FVEA 4WI0A 1IGCH 5CLTA 4JREB 3OKEA 3OPUA 5DK2B 2GK0A 1HHGA 2KH2B 1Q9OA 3MRRB 4YSDA 1L3WA 1KFAH 2HVJB 2PLTA 1AO7E 3KDMB 2PW1A 5EUOA 4L0ZA 5CEZD 3DX6A 2E7LA 3UYPB 1EFXD 4L3ED 5EZJA 2J4WH 3IU3A 4TL4A 5SV4A 5D2LA 4TRPL 3R4DA 5D7IB 1TXKA 3P77B 3PJSA 1A1MB 1S5IL 2FQEA 2X4TA 2IMNA 3EYSH 3MR9B 4JEGB 4MMYA 3NFPB 4ODSH 5AVWB 3QEGL 4NN5B 3MNMA 1W9XA 4MA7H 5HDQH 2XQYK 3H4HA 4WFHD 4G80B 2ADIB 2ZUYA 1WZMA 1KOAA 5E94A 3REWA 1LQSR 4EEEA 1CDBA 3CFNA 3JUZA 1KCUL 5I1CL 1BWMA 1NIBA 4HUNB 2VLKE 1RVFH 4JM4H 4BDVB 3GHEH 3D69B 2UXTA 1AGEA 1JG9A 1R3HA 3TA3C 3V6OE 4N25A 2Y1YA 3IFNH 4ZPTB 4ORZC 3NFNA 1BX2B 1SN2A 5F7UA 3GRBA 3ASNB 3E6FA 1LWRA 3O3EB 4JO3L 4QO1A 4OFKA 3T8VA 4PRPD 3VI3E 4AEHH 1VEOA 3DIFA 2BS8A 3FAWA 1FWXA 1B2WH 1TZGL 3VG9C 4OD1H 4H1LB 3F7LA 4J28A 3UTTA 2YA2A 3DGGA 1KSRA 4ZUSA 3QAZC 4MNGE 3S98A 4MB4A 4H25B 2VN6A 3FU7A 4NKDA 1IGCL 4TNWK 1MVUA 4HWZB 4LHUA 1Z2KA 1DLHB 2WUBL 3H85A 4GT0A 3ZYOA 43CAB 4FEIA 3OMZA 2E5EA 3V7AG 5LXGH 3GSUA 1OGAA 1T5WB 2VDQB 1ZTXE 1H9DA 3TT1L 5C0FA 4P57A 3SHSA 3WL9A 3KWWA 4K7PY 4S10A 3SE4A 5LNDA 5DD1H 1A5FL 3WXVH 4B9JA 1L9QA 4OTXL 2V2TB 5GQBA 2R69L 4KJYA 4HBQA 1FG2A 4HGKC 5CXPA 1YVLA 1VFAB 3LCYA 5KVEL 3EGXB 3CX5K 1IAMA 4LVEA 3GHBL 2EICA 4GUPB 1RIVH 3MRDB 4ES8A 3TBSB 2BFGA 3H3KA 4WTXA 3FU3A 5JMRA 2DYRB 2PPAA 2W80C 3QFDB 4AGLA 3HMWH 4Q9CA 4PI2A 1MFDH 1U92A 3U6XS 5AALA 5IP4A 4WGKA 2ZXEB 3AG1B 3D3VB 5KBPA 4BWTA 2JFCA 5I75B 4KK6D 3PGCA 2IWEA 4L4TD 3DTXB 3X11B 4RLDA 3RGVD 1XF4A 2GFBB 3K91A 2Q2EB 1ROWA 1U30A 2KZKA 2RIKA 1IGML 4HJJL 4R26L 4FRWA 4JFDB 3SGKC 1L9PA 1X4XA 2JCCA 3WNKA 1PEZA 2P47B 1JPFB 3OKMA 4OZFB 3IVKB 3KMDA 1RZ7H 4E9WA 3AWFA 5TF1H 4N2CA 2AGJH 3IEAA 4X6DA 5DFTA 4J6RL 5JW5B 1FNLA 5JIKA 3WJMB 1CK0H 4JFUA 4ZTOH 2DBLH 2D2CC 3LSOB 4OLWH 1SDDA 1DE4B 1ZWIB 4OCRL 5D1XE 5FK9A 1J1PL 4KXAA 1AD9A 3N1PC 1MJJA 3V4PL 1VZIA 1JNLL 1KBWA 4R4BA 4OV5A 3FT2B 1LWHA 2CDGA 1QVOB 2VR8A 4UOZA 4KK9C 3VYPA 1CFVL 1I8MB 4ZSOA 4AYDC 4AQ1C 2ICCA 2V2WB 3EJYC 3DURB 1CFQB 4OFIA 2CLRA 1BWWA 1NGQL 1O6SA 2CUIA 3H3BC 1W6WA 3D34A 3RWGB 2L7UA 3GMPB 3FFDB 5C71A 5AVQB 2IDCA 1PPIA 4ZAKD 3DRTB 4RGNC 4P07A 1CDCA 3LEVH 3V6FB 5JHAA 2VCOA 4DEWA 2EADA 1P9MA 4ORGA 1P4BL 1VIWA 4E9VA 1NOLA 2ZICA 2FO4B 5IMMA 3MLRH 4G80A 1JUFA 1VACB 4OLYH 4PRDB 4AVHA 3MOBH 1DJYA 5LCVA 3ARUA 2Z31A 3TO4A 3BYYA 4TV3A 4XN2A 3A4FA 5F9JB 2GI7A 1G7HB 1KIQB 3CC5B 4KQ4H 1COBA 2R0LL 1XDTT 4OB5L 1KEGL 2X7LA 4PJCB 1ZSDB 5J9PB 2TSBA 2V9QA 3PHOA 4EOWL 2XIIA 1QYGL 1R3JA 4FA6A 1DQLL 3KLAA 4HCGA 3ZL4L 2PW1B 1MFNA 2X4UA 5EUOB 4AJVA 1H15A 1HHGB 1J18A 4HPOL 2NW2A 1R0AH 4ZPVA 1TJHH 3I75B 1OP3H 1QSVA 1KBGH 2Y1ZA 3QUHA 4JGJA 1ZCRA 2GITA 2XSKA 4JCWA 2XX0A 1GZPA 4E9RA 3QVAA 3LRSB 4PJ7F 4Y2DA 2P7TB 5T1MA 3AM8C 3DVGA 3IMWA 1YMHA 2WYZA 2ZKMX 2FX7L 3CQQA 3O3BB 1MJ7L 3TH4T 3K6IA 4PLKD 2XXCB 4UNUA 3C5ZB 5J57B 1TU2B 1Y0LB 3P4NB 1S8DB 4GBXC 3RY6A 3N06B 5LKNA 1BJ1J 32C2A 4FX5A 4X8XA 1G7MB 2Q2LA 4X6DB 1HHIB 3S7GA 4OCSL 1Z3RA 4I0PB 1PZBA 3HRPA 3QE5A 2WQSA 4GRLD 4IBSA 2YD9A 2C34A 4MZIA 4EI0A 4JB9L 2AQNA 3JSSA 3MRGB 1T7VA 4EN3D 4FG4A 1JXGA 2WIIA 5HHMD 1SY6H 3KEHA 1IX2A 3M7FB 4ALAH 4JHAL 2MCPL 4KTEL 1FPTH 5D6CA 4FQJL 1K85A 3QI9B 4N5EC 4WJ5A 1W2KT 1LGVA 3WD5L 3RX5A 1I8UA 1I7ZB 5FR3A 4K9JA 3H1ZA 4WEUD 3TNMA 4MNHA 1E4HA 1ZVSB 3CCHA 2XZCH 2Y6TE 3RVWC 5I1IH 2BX5A 3NK3A 4F33A 5ICXB 5C70A 3NQIA 4BQ6A 5JPNC 5GSVA 4XVJH 5IFHH 4UV4L 2OTWB 1PZUB 1UCTA 2E46A 3B2MA 3O4OC 4J1UB 1KBPA 1UM6L 4U1SA 4MXVF 4RMBA 1YA5A 1MUJB 4M1GH 4M9OA 2Z91A 4P59H 2FQDA 5ID1A 4XNQB 3BD5A 3CUPB 1MLCA 4JPIA 4L1HA 3F7PC 4K94C 4DKFH 1KTDB 1I9IL 5FA3A 1N10A 3VFVB 5C6TL 2R83A 2Z0UA 4LRNH 3TVMD 3BVNB 2IFGA 5B1KA 4XCFL 2OR9L 3NTCL 3QQ3B 4MJ5A 4BHUA 3L5WA 1T03L 1NEUA 5IUCA 4LCYB 3AB0C 3BGFB 4M6ML 2Y5TB 1T6BX 2QVIA 1GZPB 2X53A 1FGVL 1R1CA 2ZCHL 1HQRB 3LY6A 3VSTA 3EH4B 4P2OD 2BIPA 2K3TA 2Z64C 1D7CA 3MRIB 2FX8L 2MHAB 3MROB 3CE1A 4I0CC 3NFNB 1V54B 3OG6B 1QFHA 1YPZA 3STZB 1IC4L 4B0MM 1WT5A 2NLJB 4PUBH 2Z65C 1BSIA 1SMDA 3P1VA 4JKPH 1SN5A 2ZXWB 4KJPD 1P7KB 1NCNA 3VD0A 4ANXA 2A99A 3MLTB 3ML9A 4KI5F 2L7EA 1BFVH 1BA9A 1XH2A 2VL5B 4CSZA 3F2LA 5JOFB 3ASOB 4WK2B 1T7WA 1AGCB 2NW3B 3AQYA 4ZMVA 2BCMA 4R4FH 5EU3A 1XGRA 3AB0B 1KJ2H 3BGFC 3PJSB 4FCAA 5JW3H 5AVRB 4GG6B 1ZOXA 4PJIE 3GBMH 3O6LL 3THMH 5EC2B 4HKXB 1LLAA 3U0PA 1ZANL 2D3LA 1EZVY 4APQB 3PGDB 1X4ZA 1A9BB 1U8HA 1FH5L 4LKXA 4MHHI 2CK0L 1QKZL 3M1BB 3BW9B 1FVEB 4WI0B 1P7HL 2VDOL 1JPST 2APSA 4RZCA 3JTTA 2GK0B 3MRRA 4ZO8A 1YECH 5J1TC 3J2PA 3HC0A 1G1YA 4OZHF 1HSAB 4XWGL 5D7LB 4QAMB 1CFNA 1HQ4A 2PO6D 5LXVA 2ZCLH 3VGAB 1QA9A 3DUHA 3QAZB 4NERA 3AXLB 3QNXA 4M1DL 4WCYL 3WYRA 1QRNB 2BPBA 3MV9A 1P7QB 5E8NB 1I1RA 4X7SH 5IW6A 3HHSB 1P7QD 3FH8A 4JKWA 2WLZA 2VT0A 3BH8A 3QG7L 4M5ZL 1Q9WB 4ZW3A 2HSIA 4YWGH 5A6LA 1AANA 4Y5VA 4JFED 5FECB 1SYSB 2EEBA 2ZYIA 3NIFE 5T1KA 2YPLB 1N67A 3DSFH 2FUQA 2H2SC 3C6EA 1Z32X 1WHOA 2UVFA 1JDCA 3QNYA 4PCTA 4QY8A 3CX5J 1AR2A 1JHKL 1UD3A 5GZNC 1T66C 5C08E 1UACH 2Z0BA 5PAZA 4H88L 2ARJB 1CIDA 4XWOC 5JR1L 4YBQC 4NNPH 3B83A 4K5PA 2X9ZA 4BSVA 3OKKA 4F57H 4H0IA 5CKAA 2ATKA 4F8TA 1RIVL 5C2UB 3ARYA 4NN5C 2JXMB 2Z6FA 5EU7E 2B0SL 2QSQA 1AMXA 1ZEAH 4NPYA 3VD4A 1YEGH 2J56A 1NKOA 2V3EA 1ECYA 5JHDB 4HDIA 4NN7C 3QEQB 1A25A 2DB8A 4OIFA 4FG2A 5KSAC 4BH7A 4J4PC 3RGHA 4N87A 3VI3A 4UT9A 4DPAX 2ZKWA 5CUSL 3ABMB 3IDXH 1QFWI 4DEPC 5EUKB 3VI4B 4P4RA 3P4MB 2QMJA 4XMPH 5E08H 3C5SB 4G7VL 3GRGA 3I6LD 4HJ1A 3CMOH 3W9EA 4ZXBC 4GRLC 3LOWA 4PJAF 1Y6NR 3GUTB 3FCUB 4PREA 5JXAL 4JJHA 3HHMA 3UYOD 2V2XA 2ZWNA 3GYRA 4NC2B 1D6EB 3RDTC 1I7TA 4LVNB 4C4UA 4KH2A 3KPQA 3O8XA 3QDGE 3FQXA 5E5RB 4FABL 1X7SA 4TQ8A 3B7RL 4NHUB 5DS2A 5ADPH 4HKJB 1AMYA 2AXWA 4MD0A 2IPKB 3D85D 2NY0B 2WXOA 4HH9A 5D1XC 4F9PA 4XRCB 4Y4KC 3X14B 4NKDB 1I7RB 3HZMA 2NXYD 3MLUH 4D94A 5KBNC 1MHPL 4E9XA 4PJ8C 4EI5A 1TIUA 2YXFA 3FCSB 5F71A 3M1CA 2OL3L 3A67L 2MRYA 3KPPA 4KPHH 3QDJD 1CXLA 5GSVB 3ZTNH 1V3JA 1AG0A 4WO4B 3IGAA 1I4FA 2CRIA 4PJ5B 5AFAA 3TA3A 3VD5A 4P2RD 1BEXA 3JZ7A 1NCWH 5JPMB 1X6LA 5D72L 3MV8B 4QHMB 2Z7ZA 1TT6A 1ZLWK 4LVNC 4JX0A 5CGYD 3J7HA 4TRPH 1NGXA 4E42A 2JKNA 3WKYA 2WAQA 5JDSA 2G2NA 5GJTL 4CDGC 4HMCA 1ZHBB 5I8OH 1X7QB 5EO9B 3WMSA 2F61A 3RA7L 5CAYB 3SDYL 3ZTNL 5AB1A 2LFGA 3GSRA 2AS5M 1Z9MA 3VYOA 5KVGE 4XMUA 1UOVA 1XGUA 1D5MB 3U4AA 3D0LA 5D2NC 1KY7A 3I50H 3LH2H 5IM7A 5D2LB 3QIWD 3FOMB 2Y1VA 5J8OA 1HL9A 1NCOA 4FFVC 4WI3A 2ED7A 4ONFH 5EU6D 5HDRA 2FLMA 1BJMA 2WQUA 4FFYA 3RL1A 4P05A 5F7EH 1I9JL 1GPOL 4MX7A 4NYLB 4EI6A 3L6FA 1UXSB 4ZOCA 4PVLA 4EUPG 1J8HB 1DVYA 4JFQB 3MGOB 5HGAA 2DBLL 2EKSA 2FJGA 4PP1C 3ARDA 3VU2A 1NFAA 4KKZA 5I73C 3WENA 4DPBX 5EOTA 1T6WA 3L9YA 5KBDA 2WQWA 5C3LD 3J27A 1XSKA 2QGCA 4IRJC 2Q86A 4JZNB 2IXQB 2KQNA 4X7FC 1LP9B 3DOHA 3KLLA 4JL2A 1WC7A 3B5GA 5C09B 3BWAB 4XH2A 5E51A 3VFSA 1KPUB 1N5YL 5B1JC 3CZJA 1J5IA 2PXYA 4DP2X 2ODHA 5FDYA 1YYLH 3VJ6A 1LNUB 4PRBA 3QCUH 1FNEB 3WUWA 3ZLQC 4OCXH 1N6VA 4U1NB 4QJ4B 4GAYA 1WISA 1MWOA 3RNKA 1E6OL 3K1DA 3WKNA 4DKTA 1VA9A 1ZRUA 3LB6C 1G7HA 1M53A 1R5WA 5CD5C 1N59B 3OWEA 1GA2A 2IVFC 5GGQH 1BXVA 3L4VA 4LLYA 2RQEA 4Y7MA 2OZ4H 3LH8A 4JHUA 1X7QA 3JV5A 5EOCL 2BNRA 5TTRA 3HN3A 2A4EA 5I6LA 1S7SA 2KKQA 5D93C 1YAZA 1KEGH 2J8UA 3QHFL 3LIZL 2P26A 3MBXH 3O8XD 4HS6B 5C9JA 5E2JA 1XBRA 4Q6IB 1D2PA 2UX6A 3HZKA 4YZWA 12E8L 2C1OB 1IZJA 1WFNA 2XDHA 2XOTA 1RZGB 1K8IB 3AC0A 3KM1A 4F9LC 1YPZB 4LVHC 3STZA 4YHZL 1SM3H 3VG9B 2NQ3A 4BBWA 1C5CL 4DETA 1CBVH 4R7VA 4ONFL 3I2CH 2IPUG 3V0WH 4KMQA 3M88A 3FRPB 3LN4A 3FTSA 1HCZA 4Z3HA 1IGFL 2HTKC 4K94H 5BS0E 3K3QA 5FEBA 1GAFL 4JDEA 4G83A 3F7YB 1C16A 3MJ9A 3HPLA 4PR5B 1M1XB 4GKLA 5IBTL 5D93B 4JL1A 4EO5A 4YHIB 1P6AB 5BO0D 1HSBA 1G7IB 5I1JH 1DANT 2EH7H 3WY2A 1PBYA 2UYLB 3FSAA 3C87A 4WUKL 1F3DJ 3DA0A 2F19H 3CDZA 4WTZG 3PIQA 3F3HA 2X1OA 1OLLA 2NY7H 1PFOA 3BKYH 2AXFA 5E5MA 1LE9A 4HCRL 3ULUF 2D8KA 2GSIA 2HVBA 4MDIA 5DQDH 3MN8A 3CZFA 2WHVA 5ICXA 3D9AL 3QZWB 2AXGA 5AVTB 3WTVA 1J1OH 5BRZE 5C6WH 3WTUA 1CXFA 3VD1A 1Q0YL 4OGYL 1NBYB 3O2DL 15C8L 2EIBA 2A6DA 2X89A 1I1FA 4FXKB 5DJDA 3CBRA 1NMCB 4ABUA 2ODIA 5FYJU 3GWJA 3ROLB 3P9MA 3ZDYE 2EVHA 1HKLL 4QTIH 4A55A 5D1QB 1KJVB 4ZMXA 5K59E 3C08L 4U4BA 3RWCA 3A0OA 3FOLA 5ICUA 5FO7A 4GO6B 4GKSB 1IAIL 3FB5B 4ZOEA 4HZAA 5TH2B 4HK0A 3ABGA 4ONGH 5C0RL 4HBCL 1U8MB 2DQUL 4K71C 2G5RA 1BXXA 2YPLA 32C2B 4DKDC 4M48H 3M7OA 4U6HB 3QRFM 4WU5A 3SDXF 1AQMA 5IQNA 3I6LE 4JDEB 1TU2A 1F2QA 1RIUL 3FO0L 4ANKA 1DZ0A 2O26U 2VN7A 2YMXH 1U42A 1U3HB 1XB8A 2G60H 3MJ7B 1BP3B 4FA7B 3KXFB 4AV4A 1MFEL 4YIQA 5E1IA 3CN0A 3KPSE 2V5YA 1U4EA 4ZO7A 1G5AA 2NY6D 3LPPA 4N2NA 5BUGA 4HWBH 1G7QA 3EFFA 5D2NB 1OCWL 4ZFFA 3V79C 2QGDA 5CR1A 3SO3C 3RJOA 3TVMB 2VE6B 1ZAGA 5CJOL 3H7BA 4LIQH 2WIMA 2YWZA 1S7XA 4F57L 1R3HB 3MVSA 4JPKL 3ABKB 5HDWA 4HXAH 2LW3A 4LPTA 4NQDE 2YGNA 5JIMA 4L0YA 3FUNA 1G1CA 4DP0X 4R83A 3CH8A 4LNRB 4ENED 1DVFD 1NL0L 2CIIA 4L4TE 3GZQA 4V11A 4GG6A 2X7LB 1FL6A 4PJCA 5IWLA 1BIHA 4QTIL 5DRWB 2A9CA 5ES4B 4P2OA 3GI8H 4PSRA 5GJTH 4WEEA 4R8WH 1A4AA 3CD4A 2UWEF 3TO4B 2EDFA 2FWUA 4KUZL 4GPVA 4MMYB 5J6GB 5GZOC 5I1EL 1IGIH 3KL0A 5BJTA 3O11A 5FYKH 3ULVL 5KSVB 3KPRD 4N6QA 5E0FA 4HEPA 3VA6A 4A6YA 4A39A 1T1YA 3V6FA 4ZFGH 4LQ1A 4PGEA 2YKKA 1VADA 2NY2B 2C3XA 2J8UF 3FFDA 4NP4H 4KI1A 2FX9H 1KPUA 4UT7L 3JWOH 1WZ1H 3RWGA 3RVXC 2VZ3A 1G6RA 1CFQA 1EEQA 4O51B 3HG0A 1INEL 2FWSA 2VDOH 3ULUL 4YDNA 4LOUD 5DHVA 4YUEL 1QEXA 4YDIL 4DK3A 3FT3A 4D0BB 1G7QB 3EFFB 3HS8A 4HWUA 1U8IB 2DYPD 4M9PA 3KLDA 3FO2B 3WO3B 4OV5B 3Q6GL 4M8QB 3MRBB 4FULA 3L6FB 2D9QB 4OGAC 5DJAB 5FC9A 4JY5H 4MCYA 4ODWB 1DQKA 5E2VH 2VDLB 2DEWX 5DC0A 1XSIA 4DPCX 1KGCE 1XH3A 3BGAA 1Q94B 2ARJQ 4UNTA 3AGVA 1IBGL 1QSFB 5I17A 1JZ4A 1PAMA 4ZTPL 2RACA 4IM8A 4NQEE 1UOWA 3BRDA 4XNYH 2QFPA 3FB5A 2YHGA 4AZ8A 1A3QA 4IBZA 7FABL 3UTTD 4OCYH 3ULUD 4P46C 5D8JL 12E8H 5C8JA 2IPTH 3FU5A 4LASH 2XQBH 2VJ0A 2DS4A 4P23A 1F1AA 2BCKB 1I85A 3MBXL 4OKVB 3SB3A 2ORBL 1LILA 3UJIL 1CICB 3SDDB 5I8EB 4RBPH 1I7ZA 4NZTL 4MKMA 1XH1A 4L8DB 3UXFA 2YPVH 2G4EA 4GAAA 4TLSA 3H9HA 3A3YB 3TT3L 2FRGP 1GRWA 2DI7A 3T3ME 3B9KA 2OJEA 1GGYA 5C07D 2NNAB 4NNPL 4POZD 4APQC 3L2LA 3T4AB 5CJOH 2IH8A 4J3OC 1FFTB 1XMEB 2HRLA 3NQKA 3WAJA 1RZFL 4AL8C 2F54E 2QHRH 3F58L 4LFHD 2N0KA 3DBSA 2YD5A 3A4AA 2G2RA 5DJ0B 2WQAA 4S0SD 5ERWB 3AREB 1JNLH 3OXSA 4KJYB 3O6FA 5LWYL 4XPHH 3JV0A 5E0QA 1BVOA 4N28A 3ZMRA 3D85A 5GRYA 4KTYA 4NM4H 1CICC 5IJVB 1JNJA 3ATDA 3NFSL 4FFYH 1R24B 1L9OA 2WZPA 5I6OA 1TFHA 1P4LA 4ELMA 4PJ5D 3D52A 5CU9A 3P3UA 1LQBC 4H25A 3EH5B 4YXHL 5DQJB 1OP3K 1WS7A 3LEXB 1XH0A 3D09A 1A7NH 1NLDL 3KPNA 2OTUA 3CFBA 4KTEH 2YD1A 4X4ME 5AVUB 1M3IA 3REVB 2ENSA 4PRHD 3VD2A 1CO1A 2MWCA 4RFNC 3CFUA 5DVPA 1X9UA 1SEBA 2NY1D 4F7PA 4Y9FA 2F8IA 2R23B 4E5XB 5I6XC 3BIKA 2HN7A 2FECI 1TTCA 2IH3B 2X4UB 2VC2L 7FABH 1E5YA 3GIVA 5FO8B 5KTEH 4Z23A 1AGEB 3NCYP 4NPYB 3TL5A 1CUOA 5F3HA 2P5EB 1Q0YH 4HJ0D 4OGYH 4DAGL 4D2NA 2FB4L 2WVSA 1GOHA 1NICA 2EQDA 2WBXA 4HGMA 5GGTA 4IEFB 2R2BB 3MV11 1RP9A 1ZLDA 1NC2D 2F1BA 3BSZL 2OMYB 5DDHA 1LP9E 2XQBL 4Y2DD 1IE4A 1YEHH 2VR5A 5IROD 1B88A 2GSGB 2X12A 3NUKA 3JWNG 1DUZB 1EBAA 1A1NB 5FOJA 3WTTA 4XNYL 3HPJB 3D12B 4H8WL 4KROC 3HBGA 5AD0A 2NY3D 4HSAC 5CN2A 3MRJB 4D7BA 1E4XI 4GLRI 3TZVA 3CGTA 3DURA 2P52A 1A6ZB 3VFSB 2VISB 4UILL 1P7QA 4OJCA 4URTB 4WUUB 4XCFH 4DUXA 5I16B 1WH0A 3N85H 4PJAA 4XMLL 1IGYA 1JXKA 1PKQB 2NY0C 3WIHA 3GFUA 2A1WL 1SYVB 1UCBL 1FIGH 3WKPA 3SKJL 1TEFA 3N0AA 3UC2A 4WFEE 2I9TA 1SDDB 1ZWIA 2FL5B 2XQYA 4JZJA 4OIIL 4HOWA 2SEBB 1FZKA 4TUJA 1MY5A 3E1F1 3M17A 4RESB 4G8FB 1T83C 3VD3A 1U8HB 1NFDA 4CVZA 1TTUA 3T1WA 3ZRFC 5H4ZA 3DX3A 3UBXB 3A6BH 4JM4L 3ZQWA 4L9DA 4WWPA 1KTLA 5IFJB 1V8HA 5I18L 1JGLL 1SLVA 4M7ZC 4JDTL 5CJ8A 3VFGH 2H8PA 3MV7D 4NCC2 3TH3T 1FGNL 2Z8RA 1EHKB 1HH6B 3N1QC 1SJEB 5GHWL 5IQ9B 1OCCB 3NK4A 3ZZ1A 4C4KO 2RJMA 4O2CA 2Y6SD 4U1LB 3V4VB 4LLVB 3KH3A 5AENA 3SE9H 1IEHA 4ALAL 3FTVA 4NUQA 2EXYC 4HWBL 1MXGA 2AKRA 4N8VB 4ZTEA 3LNGA 3SE9L 4BKTC 4KNUA 1FVDB 1U92B 3U1SH 5CBEB 2IGLA 1CG9B 3TEZA 1PX4A 1KNOB 2F54A 1TVBA 1F56A 2QKIB 4S1SL 2WGNB 5DLLA 1R19A 4QWWC 2GIXA 1NDGA 5FYJH 4MJIA 1JGUL 5BCAA 5ADOH 3BXNB 3E80A 1HINH 3QHTC 4JKKA 2ARWA 2ZZUT 3SY6A 1T1ZB 3VXMD 2ZJSH 3W5MA 3Q06A 2K9UA 5IQLA 2IAMA 1WUNT 5FW7A 2ICWJ 3QDMA 3EH1A 1KBBA 3SPVA 4Z3FA 4FEMA 5LBGA 2D0GA 4LLQA 4Z3GA 2W9DH 2O6EA 1TKWB 4DZBB 1ZVYA 2MCAA 2DQDH 5BMFL 1BZ7B 4HG4J 4BCZA 3CUPA 3LRGA 5B3NA 1UWFA 4PJ9D 1JV5A 4Y4FD 1DDTA 5FOBA 1X5LA 2NY0D 4UOW0 3QDMB 1BVLB 2VN5A 3MRHA 4JW3A 4G8AC 5T5NF 3FB6B 2H3NB 4Y5YA 2HVKA 3QUMB 1GW6A 3GUTA 2Z92B 2RD0A 3RX7A 5IF0A 4ZX6A 1O7SA 1FV1A 5DSCA 3OJVC 3QQ4A 3UG3A 2B14A 5L4MA 2WBJA 3N44F 2HMID 4HJUA 4K2UH 1TETL 4QF1A 4QT5A 1YMME 3KPLB 5I0DA 2G3XA 2J8HA 4GNKB 4F7MB 5I0WA 3MRMB 2GJ6E 5CBEA 5IIEB 1L0YA 3N43B 1QR1A 1S7UB 1USZA 4QRUA 2WP3O 2Y6SC 1CZ8H 4AJ0A 2KYIA 4PB0L 4TXVB 3UP6A 2VDML 2NY5H 1OAUH 4J3BA 4H2AA 5F9OL 5IT2L 2ADIA 1OP4A 4YFDB 1FIEA 1Y07A 2H32H 4B9FA 3IMUA 4FQCH 4WJG3 5KSBB 1Q1JL 2FO1A 1HH6A 2YLKA 1MWAL 4TSBL 1HL5A 4UM9A 4LRIA 4V2BA 3IYLW 2BXZA 4Z95L 3PDGA 3VX1A 3P3TA 4HKZB 5KTEL 1PSKH 4NRZA 4Y5XB 5EZJB 3LKSB 1N0LB 5D2LF 4M8RA 1KCLA 2Y69B 4QXUL 1JTOA 3DX6B 1T0MB 4OD1L 1Z5LA 2J57A 3BIBX 3IJ8A 4X8JA 1Y0LA 5GGSB 5DHEA 4YDKH 1Q9OB 4C4KT 1HIMH 2BS9A 3FN0H 2YD3A 2DEXX 1KEML 4LIQE 1JZ3A 3Q2CA 2XICA 3C6SA 2Y7QA 4JCMA 4N26A 3C75A 2I9LA 2XG5A 2ZWZA 4LL1A 1O7DE 2ZPKH 3PAZA 2F8XC 1FO0L 4UOQA 2HFGH 4CADB 5E8NA 4BUGA 1PZAA 4HU8A 2VERN 2E56A 2GITB 2B5IB 3FU6A 1U91A 1KIUB 1LWJA 1C5DA 3QQDA 5HJ3A 3OR7B 1RZKH 2PR9A 1AGDB 5I30H 2ZOOA 1GJUA 3HG1A 1IGIL 3U4KA 4R0LB 3BO8B 3QUXD 2HKHH 3NCMA 3AQZA 3SYOA 3ARSA 1MCJA 3GXMA 4RX4A 4ENZA 2I60L 4R7LA 2CRZA 2DQTL 4APQA 3WFEL 4KY2A 3MKKA 1IMHC 5EC2A 1JZ6A 1N3NA 2NQCA 4KXBA 2ITEA 4XC1L 3PDOA 1Q9LB 4PG2C 4KFMA 2V9RA 4HIIB 1P84K 3BJ91 4Y9CA 3GLAA 2X2UA 2LABA 3MUZ1 5IB1B 1RJYA 1JD7A 5LO7A 4AITA 3GTTA 4WEMB 4FZEL 5D7JD 3OZ9H 2HWZL 1N12A 1ODAA 3MLTA 4F93B 4ZAKA 1M05A 5FUCE 5HVGB 2DD8L 1Z5YD 5C0JB 1ZD6A 3OZLA 3CU1A 2NY1C 3ML8A 4NO0A 4PCYA 2WCPA 3KCPA 1UHVA 5EDSA 3FQWA 3R18A 4LAQL 4PJIA 4NO3B 3MRIA 3D06A 1BZ9B 1UKSA 2XWJA 1HX0A 1QLFA 3BPLC 4KX7A 4BZ1L 4Y4KA 2EXWD 4PD4J 4UDUB 2X0WA 4I7ZC 4P2AA 1A7BA 1U36A 3HC4H 1KTJA 1XGYL 4MXWH 1TYRA 4Z9KB 4LOVA 5IOKA 4DTGL 1TNNA 3ARWA 3BKCH 5CFAA 3AM8A 2AERT 4RFOH 3I9IA 3EOYG 4LLDB 2NXZD 1E5ZA 3Q7JA 5D71H 4YN3A 1OD7A 1RD6A 4RX4D 1TQCB 4U1GB 4ZZFA 4XP4L 2V5TA 5I0ZA 2MFNA 1OIOA 3ZT7A 5ID1B 2NYKA 1TMQA 2IIJA 2XXFA 5L8LB 2DF3A 1UG9A 2WVVB 1OP9A 4G9FD 1SXBA 3G6JA 1WYJA 1NZRA 3R1GH 4RFNB 4RGMC 4BFFA 4JFDA 5IY5B 4NQSB 4NX0A 3B37A 3DO3A 1T0NA 4Y16A 1UXLA 4G43A 3RVXD 3D0VA 4I88A 2P28B 3WKQA 1HE7A 4KC3B 1I3UA 2ZWYA 4I85A 2AJVL 3US9A 3RNQB 4JVWA 3B9KB 3SBRA 3TO4C 2CLZB 1WFIA 4G8GE 4LKCB 2DWDA 3IDMB 2DKMA 3WLWD 4AIZB 1V05A 1IRAY 2R0LH 1MH5A 4OF6A 3SDDA 5D4JA 3K46A 5I2IB 1TO4A 1VDGA 1G84A 4DESA 4LK4A 3RWFB 1SXZA 3NAAL 1HIML 3V9FA 2IG2L 2VDRH 3ZKNC 4L1TA 4KGJA 3SGDI 2ZXBA 3ATEA 4G72B 4PJ9C 4Y4FC 2WNXA 5D4HA 4M6MH 3VRLF 3VXPB 3ZZQA 4JVPA 1KXVC 2QGEA 5BOJA 4F2ME 1J0HA 3TEXA 4P3DB 1KMGA 1GCYA 1YEFH 5EH1A 3T6QC 5DMGC 1Q94A 4ADIA 4BQBA 1RZIA 3BCDA 3UGXA 1UM4L 2Z35A 5GS1B 5E2WL 1OGAD 1A7RH 5HHPB 1CLCA 4HV8A 3QXAB 3UFIA 1JRHL 1PZCA 3KJ4C 2VO5A 4OFYD 4PVNA 1HXMA 3G5XB 3LRMA 1A65A 2WLYA 2N1KA 5KWYC 3C5ZD 5KS9A 1ZHKB 3BKML 4UM8B 3L9RA 3S3SA 2B4CH 1NCDL 3E2HB 2DLTA 4NZDA 4TPRL 5E1AA 1IM3B 1HZKA 4G3YH 4WW2B 4AM0A 1JGUH 1R47A 2ZOWA 4JZOA 3KWUA 4ZPVB 3TJHC 4Q9RL 2OZ4L 5ESVB 1X9RA 1ZT7B 2WN3A 1XGQA 4JFPB 4CVXB 4NLAA 3FTYA 1QAWA 3O9WB 2WCSA 1E4WL 3SDDC 5MEPA 4K23H 4N0FA 1UOLA 1OAZH 1KC5H 1BPLB 3PNWB 1Z9LA 3G08A 4JM2B 5SWZE 2WLIA 1G9NL 2G75A 1RUAL 3QEQE 2OYPA 1A1MA 1OF0A 2X4TB 1MKFA 3DYOA 1U8OA 4UBDC 4GW1A 2BERA 5DCCA 2DQCL 4QRRB 4M1DH 1NC4B 1B90A 1U93B 3ETSA 1FNHA 5GS2D 3EG9A 2KHAA 1WA0X 3FC8A 5J5EA 2XC8A 4K0OA 1AXSB 1FO0H 3D39E 4ANVA 2IALA 3AG2B 3SYQA 4KKLC 3QDJE 3SDXA 3DOSA 3VXOA 1X5ZA 4F3FA 4Z8FH 1NANI 1KJ3L 1K5NB 1E5CA 5EU5A 2V2WA 3MNWA 1BVKB 1DVSA 3LZFH 3L4TA 3QUZB 1I8MA 3MUUA 4CGUB 5CWSB 3VXRB 5KN5A 4DN4L 1OE3A 4GFXA 5IHWA 3MC0A 3TF7C 3LVTA 4X7CC 3PS6A 4GSDH 1JCVA 2YRBA 5C9KA 3CFJB 3N85L 3WS6C 3BVXA 3CBJB 1WZAA 5DO8A 5T3ZD 5FLUA 2BK8A 1JNNH 4PS4H 2B59B 1JF1B 1R0AL 1NGZA 4C58B 3SSGA 2E59A 3BE1H 2OXGA 3WJMA 6FABL 1RJZB 4Q14A 5IZ7A 1NFDF 1YNTA 1UM5L 5EU4A 3T04D 4PV9A 1WK0A 4H0GA 4JFOA 2ITDB 2NY5L 5EHFA 5DZJA 5TH2A 1RV6X 4ZUVA 1YUKB 1MXDA 2WSKA 1AC0A 3EADA 1BQHA 2HX8A 3Q0HA 3A6BL 3KPSD 4LCWB 3RG1C 2ZCKL 2ZX7A 3P73B 4NGHH 4KXZH 3MBWA 2DW5A 3HRZB 3MV8E 4IJ3B 2FHBA 1A7OL 2VYRE 2Y7LA 4OZFH 1K4DA 4F8LA 2C1PA 3OR6A 3AT8A 4M7LT 3II1A 1ORQA 2GEQA 2X88A 1HEZA 2VZTA 3DMMA 2G3MA 4M02A 4X5XB 1GKEA 2Q10A 3K81A 4L1BA 4P5KA 2WSPA 3MLYH 4OJEH 2D31A 2X89D 4MA3B 2BWDA 1SEQL 1CURA 2R56H 4XB3A 4QHLB 3ZKXB 4GUPA 1LO3L 3L3JA 3SO3B 2Y23A 3CTTA 5CJXA 4PJDF 4TQEL 4F15C 5JORA 2FZ3B 5C0CE 3GS0A 3QCUL 4TNVK 5J1SC 3MX0B 1AHKA 2ZX5A 4G8EA 4U6XA 1U58A 2O6DA 3UAFA 5AW0B 4L05A 3B9AA 2VGLM 4OBSA 1D5BA 3ERXA 4OM1H 4RIRA 2NZ9D 2AJVH 8PAZA 4W9DC 1ZT4B 4X6DE 3NPZB 5C6TH 1M7IA 5ICYA 1OARH 5MP6H 5I8CA 2BRRL 5C09E 3BKJL 2YSSB 1P84J 1N7MH 3LN4B 2OZNA 2VLKD 2XV3A 1OE1A 4NO5A 4UQEA 1JDDA 3MMEA 2O1AA 2YSTA 4GXFA 5CCJA 2WLLB 2H9GA 3X3GL 2HPTA 1I8LC 1KLUA 5EN2B 4MDRA 3N41F 4GY4A 1T4KA 3X3GH 4FL4B 4O2FB 5K9JH 4HJSA 2VH5H 4PJDA 1JRHI 1EXGA 4XCNB 4LPUA 2BSDA 1FSKC 3QIWC 4KTGA 3U46A 3AAZB 1N2RA 3LZOA 3L1OH 4GUCA 4H4NA 3UBXI 2L0DA 1N7ML 2LGNA 4LQFL 4JMXA 3QEUA 3I6KA 1M71A 4Y4HB 4UINL 5HVFB 3FONA 2VLJD 4F7EB 1PQZA 3B5HA 5E2TH 1KZYA 3ULUC 3SDXE 2Q3ZA 1U8QA 2I85A 3RWHA 4JDVA 3MLWH 4HD9A 3G5YB 1MAKA 3KYKL 5DA0B 5EZLB 3KS0H 3MZGB 1TJXA 2CD0A 1GYAA 1CC3A 4ZQKA 1E27A 3Q13A 2RALA 1CD8A 2CBQA 4GKZA 1RLWA 1DFXA 1S7TB 4N2OA 1QQDB 3RGVA 1KV7A 1WTGT 1VPOH 4FHKA 4GG8B 4FQHB 4PJEF 3VSVA 2B16A 3VMPA 4AMKH 4XX1G 3QPQD 5ICZB 4KKCC 1MSPA 4P5MA 4JRWA 4OGAD 4MNQE 5AYTA 1GMIA 3WLBB 5LBSA 3T6XA 3CLWA 4UT6H 2ALWA 3FCGA 2XVKA 2HXAA 1NMBL 4Q2ZA 2OXHA 3T6ZA 4LSRL 2VR9A 1V55B 2IAMD 4OZIB 4BV1A 3D5OF 1I53A 3UAJD 3ZGHA 4BXVA 5J13C 3T0WA 4B9CA 1ZA6A 1JN6A 4I18B 2AC0A 1SPDA 3S34L 2CDFB 5E6IA 1U58B 1OF2A 1YDPB 2A9MH 1FYTB 1BEYL 2D3VA 2IPTL 2R4SH 5EEWA 2ENJA 4AXWA 2YC1B 1MHEB 1GS6X 5FHAL 1F3JB 1L7IL 2YIHA 4LSVH 1KLFB 3DJZA 1DQLH 3ZL4H 5B1JA 3U82B 5DD6B 4OGXH 2X3CA 5F96H 2JKSA 3WKMH 2QQLL 3DK0A 1FBIL 2AVFA 3OAUL 4PS4L 1RIHH 2QJDA 5AW5B 3U4EA 1IC4H 5TQ0H 3MV7A 5HYQA 1SXNA 1FVCB 2XWEA 4L29B 5CCKL 3KYOA 4AGPA 1IKNA 5FYLE 2YARA 1ADQA 1BECA 3AWGA 5LQBH 4CN6A 3RTQA 4NZRL 5EU7C 3JVGC 3EJSA 4PMEA 2AFNA 2XYBA 1TF4A 2R7EB 3D48R 3DHJA 3W39B 1H0DB 2V5RA 1URZA 3PQYD 3R06B 1WAPA 2PWGA 4WO4C 3QORC 1SLXA 4PMFA 3IJSA 5GRXG 3T65B 3MYZA 1KIRB 1HESA 4NQEA 4IOIB 4QNPF 4XWOD 1RURH 5AOMA 1DJIA 3HI6L 1UACL 1R17A 3S5ZA 2IDFA 5TK4A 3GPEA 5DF0A 4AYID 5MEQA 4FG6C 4XBPB 3DPBB 5KBLA 4JQIL 2OMVB 5FA4A 2QSCL 3RIAK 4WFFD 4QHNA 4U3SA 2N7BA 1JIBA 3HA0A 3L5XH 4M5YL 5I5IA 1JFQH 4EXPX 4Z3IA 2WKOF 5CEYA 3SGEH 4JPWL 3W9DB 2EYRA 4B9GA 3FQXB 3KCWA 3RKDC 5I19H 2NZ1A 2EJ1A 1ZS8A 1L9NA 4O9HH 3EBGA 5CM1A 5EFIA 1NEZA 5J12C 4XNMB 4K23L 4IDJH 5B4MD 4HC1H 2C9RA 5DURB 3UPCA 5F0MB 1L5GB 4CL7A 1YQVL 5KW9L 3G04A 3D39D 4AUUA 4QKTA 3TTYA 1KGXA 2WKLA 3SGJA 4EIZC 5MHSE 1NAMA 2YLHA 1ZVNA 3EJPA 2V8LA 3LKOB 4MZ3A 5CP3A 3T8XB 2JKWA 2VAAA 4PJDE 2ZXGA 2AI0L 2F5AL 4G3YL 4Y19A 3OKOB 4JKLA 1NC4A 5KVEE 3OXRB 3D2UD 1MWAB 1AR1C 5I73B 1LP9F 2FWLB 1CGUA 3IFLH 4WFGE 2VDRB 1CT8B 5LBSH 5DD5H 4RAUA 4N3TA 4RDQG 1VGKB 2D7OA 1ZLSL 2AAVA 3X1NA 3LKQB 5FKPA 3DX0A 3VI4E 4AE0A 4D9QE 1C8QA 1ZHLB 3G7TA 4YFLI 1V7MH 3F83A 3UERA 4YBQD 4Y2OB 5IV2B 3EXLA 1AHWB 3BUIA 2X4QA 4BSVB 5ADOL 2YPLE 1IC5L 3L3GA 1RFDH 4UOW1 4AXWB 3CNKA 5JZ7C 2BZDA 4JAMB 4N2LA 5B39B 3NGBB 1JPGA 3IAGC 2HFEA 4FQXA 4AK2A 3OF6D 1E9QB 3K6DA 3ETBF 1GR7A 2ZSWB 3GXTA 3DVNB 3LX9A 5I1HH 2YGOA 2X6BA 5KS9B 1I82A 2NT1A 1CYXA 3L4YA 4LSSL 4ELKB 4IIQA 3WN6A 2IFFH 1H3TA 2W65B 3D18A 3RYMA 4KWUA 3DV4B 2HFFA 2O5ZL 2D03H 3RI5F 1DN2A 5KYNA 1JK9B 4O2EA 3SYPA 4XN4A 2DWTA 4M43H 5EBGA 3RKPA 4E2OA 4S2SB 3Q8BA 2HG5A 5F97E 4DVBA 5H37A 4YGAB 2PYFA 4NBZB 4WW1A 4NZUH 4ZNEE 4ZMNA 3FCTA 4D3CL 4JDZB 4L4TA 5IT2H 1NEPA 4OFQA 5GGSA 3MJ8A 5L2KD 4YE4H 2EE2A 2FK9A 1D5IH 3L3DB 5KYYB 3ZHLA 1B0RB 1BQRA 2QKIC 2QFRA 3GMQA 3MBEA 2Y22A 4NN6B 4D3CH 4DKEL 4QRTA 5JYMA 5FPIA 4XBEL 3WY1A 2DL2A 3HFMH 1D5IL 3IKKA 1T21B 2E27L 3B9KC 5SWZA 3QGVA 3RWFA 3U7YH 3ZKND 1WS8A 1PIGA 5IMOA 4H44C 1T1WB 1LO2L 3EO0A 4JPQA 4M43L 5E8OA 3NJMA 5EU3B 4JRYD 1R3KB 4K7FA 3QDGB 4QRBA 1AGCA 1EGJL 3GMLB 4D8PB 4UQ3B 5I1DB 3DECA 5CCGE 4LLWB 1IL1A 3VXMB 1HI6B 4FQIL 4JM2C 5A16A 3UGUA 5HPOA 3PWUA 5IJBC 3C60A 4Q97A 4L37B 5F44A 3KYAA 3QQNA 4QCIA 2BO0A 2MCPH 2XWBA 2OL3H 3A67H 3LKRB 3NCJL 4WWKC 5SWSA 2J5WA 2JIXB 4NPJA 1M9SA 3RY4A 4D9LL 5DD0L 2E9IA 2OMBA 2K6YA 4G9DA 3HS9A 4HIEA 4V2CB 1R3IL 3QRGL 5AOLA 3BQUC 3S2CA 4EN3C 1ZS2A 2AQ1A 4X6FB 7CGTA 1R3LA 1INQA 3F01A 5I8KL 4G11A 1HN1A 4AC4A 4ZMPA 2CO6B 4HISA 3CH1B 1D6VL 1QX1A 1HNYA 2A6JA 2A4CA 5G2NA 4KQ3H 5E9DE 1XGPA 1RFDL 4UINH 2DN7A 3CLFH 4Z7WA 3BZ4A 4KZDL 2FB4H 1FNAA 4ODXA 2BWQA 2BHUA 3PXHA 4KI5D 4HEMA 4AH2B 3BEWA 4GMTL 4OZGB 5CIPH 1W72B 2FHCA 1OQOA 4CC4C 3QORB 1MCEA 3MX0A 1ZPUA 3UJTL 5TE7H 5K69A 2EABA 4PWEA 2KPNA 5E8PA 3SDAC 2VR6A 3V6ZA 5LNGA 1H3UA 2VXVL 4N90E 3VNZA 4X6CF 3BUYA 3GSNH 2KZWA 3H2PA 1C8PA 4K71B 1E9OA 5KS9F 2BOBB 3FO1B 4YSCA 3PV6B 4ODBD 3PU7A 2XWCA 4JJ5A 1XFPA 3CVIH 2X0VA 3ABZA 3VRLE 4NUGH 1FF5A 4YSAA 3WJJC 4GP4B 1S78D 2V33A 3NDYE 2OM5A 2PYEB 2YK1L 4H20L 4PGBA 1BLNB 1B9ZA 2JIXA 4YX2H 1BZ8A 2J44A 4QCIB 3SJVB 1UT1A 3T1FA 3G5ZB 4AJYV 3W3BA 2IPUK 4HUVB 4HC1L 1DL7H 5KG9B 3HC3H 5D6CB 1S9XB 3FNKA 1R46A 4OF7A 5AAWA 3HRZA 1Y6MR 1XCQB 4GAJL 5KJRL 3IJEB 2DKSA 4KZ0A 4OIIH 4HW6A 4JREC 3TO2B 4A2HA 2VLJB 1M3JA 5DRXA 3DYPA 2JI3A 3GS4A 3C60D 5H94B 3ARFD 3BP4A 1WJ3A 3PAYA 4JUTA 3UADA 1PW3A 1M4KA 4J8RA 1B0WA 1BPVA 4KPHL 4Y88A 2JKJA 2IGTA 2ZCLL 3BO8A 1GYCA 3LNHA 4Z7NE 3ULVC 5KUKA 2AQTA 4WV1C 3DROB 3IMRA 3KWVA 4PJFA 5SX4H 5KYWB 1OSPL 3L1GA 4R7NA 3PAUA 4TUOB 4X4ZA 1SXAA 1WDAA 2P5ED 2NSMA 2V3FA 3L3HB 4FTVE 5AVSB 1PD1A 4IKJA 5INDA 4FABH 4NQUA 4N8CH 4CADA 3QRLA 2X4SA 3H42H 3NJXA 4HAGA 2ZX6A 2LTQB 2ZOLA 4LSPH 4W70A 3MNWB 3QHFH 3TJEH 5DEJA 3T0EB 1IM9B 1X6NA 5GGUA 1JD9A 3K0WA 3MNDA 1AXSA 4ICXA 4I5BA 1D5XB 1HNGA 3QJUB 1FZOB 2BMKA 4ETQB 2I5YL 2Q8BH 2DTSA 3TYFA 3RPIB 3QSKB 5B39G 1JGIA 4R96A 3ZZLA 3VCLB 2QHLA 3CVIL 5HJDA 3HUJB 3TZVD 1ZLUH 1S5IH 4ODSL 3U1SL 3H7LA 1TVHA 4JFTA 1LJMA 3QUML 2NY5C 3BEVA 3GSXA 3QNZA 3WNIA 1IO4C 2YFNA 3I6SA 2MCMA 3B34A 3LKQA 3OF6A 5BOPA 2FSEB 4H8VA 5BV7C 2KT6A 3MU3A 3LRKA 3IJEA 4WTZA 4LSRH 4FNPA 3HJ0A 5GZND 3SN6N 2MPAH 4F7CA 2K1MA 2BZCA 2R2EB 4HWEL 5JR1H 1W80A 2XVGA 3STLB 2Y36H 3QZMA 3LKNB 3MUJA 1H9VA 4MXVE 3T1FB 4TNFA 4W9ZA 2RHEA 2ZWLT 4XCEA 3ARGC 2XIBA 4JGMA 3X13B 4KK9D 5E56A 2VKWA 3E9TA 1ZLVH 5DLMH 2ZOLB 1Z1WA 1T1XA 4Y5YB 3I84A 4IRSA 3C2AL 4AKPA 2DLFH 5E1QA 4G6KL 4HV8B 1MDTA 5A1AA 4IGBA 1U33A 4Y1AD 4KKPA 2M8XA 1KCRH 4HIJA 2QVFB 3AUVA 2E74C 2VN3A 1XF5B 4LOFA 4HOZA 1UB6A 3OC5A 3PL6D 5GHWH 4PP2A 1E4KC 2OMVA 2A3TA 3EYQD 4WY7H 2EZ0C 2EDXA 4WEBH 1YYML 4MD5A 1AXIB 2CJ3A 1FP5A 1KELL 4F58H 5ENWA 3LKPB 3KGRA 5GSRB 5K1NA 1NMAH 3WGUB 2GBTA 3T3PB 4PTTB 5D7LE 1INQB 2XPYA 1ANUA 1L7TH 1KCRL 3BJLA 3FQ2A 4DKEH 4LCWD 2JB5H 4PJBE 5EZOH 4W93A 4ZFOB 5DXWA 1TQUA 2F58H 2IQ9H 5IOPB 2ENQA 5KVGH 5H35B 2DRUA 3ZE1E 4JFZH 2G3NA 3P0VH 5CO1A 5IVXF 2H47C 2AXHA 3EJZC 4AYFB 3QNFA 5EOCJ 4IW4C 2ICEA 5KSBE 3QA3B 1AS7A 4IBQA 3PWPB 4N2BA 1MCLA 2X5PA 1MNUH 5AW1B 5IOPA 1N18A 2VDKL 2PWEA 4UQ3A 3DUSA 2NY2D 5JXEA 4XHJD 2QQKH 4LDOB 1A0QL 4HWEH 3RTQD 4UQBA 2YGQA 3EYSL 3GRWA 4GSUA 4X5QA 3NAAH 1B0IA 1T89C<