2J1YA

Human p53 core domain mutant m133l-v203a-n239y-g245s-n268d
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
195
structure length
192
Chain Sequence
SSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCYSSCMGSMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclear protein
molecule keywords CELLULAR TUMOR ANTIGEN P53
publication title Structural Basis for Understanding Oncogenic P53 Mutations and Designing Rescue Drugs.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 192
sequence length 195
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2j1yA00
3WTSA 4IBSA 3ZMEA 4L18A 1TUPA 2IOOA 1GZHC 2XWRA 2J20A 3WTVA 5AOLA 3D05A 3IGKA 4LO9A 5AOMA 3WU1A 2VUKA 3D08A 3VD0A 3QYNA 3D06A 2BINA 5G4NA 3Q05A 5ECGA 4MZRA 2J6WA 1GZHA 4AGOA 4GUQA 1E50A 2X0VA 4IBWA 3TS8A 3EXJA 3Q06A 2X0WA 1T4WA 1YCSA 3VD1A 2ADYA 3US0A 3WTYA 2MEJB 4AGMA 5LGYA 3QYMA 1LJMA 4MZIA 5AOIA 3WTTA 4L0ZA 1CO1A 3D0AA 5KBDA 3D09A 4IBZA 4AGQA 2BIOA 4IBQA 4IBVA 2XWCA 3EXLA 2AC0A 4HJEA 2J21A 1IO4C 4XR8C 2BIQA 4G83A 4LOFA 2H1LM 5G4OA 2ATAA 2J1YA 4KVPA 2YBGA 2BIPA 3D07A 2AHIA 1EAQA 4L0YA 2OCJA 3WTUA 5A7BA 3US1A 4QO1B 3WTXA 2P52A 2GEQA 1EAOA 2RMNA 4LOEA 4AGLA 1HU8A 5AB9A 5AOKA 4IBUA 2FEJA 3VD2A 2WGXA 3KZ8A 3WTWA 4A63A 1EANA 4IBYA 1HJBC 5LAPA 3Q01A 1H9DA 2J1XA 4IBTA 2PCXA 1CMOA 4IJTA 4AGPA 1TSRA 1KZYA 2IOMA 5AOJA 4GUOA 5ABAA 5G4MA 3KMDA 2J1WA 5BUAA 2X0UA 4AGNA 2BIMA 2IOIA 1HJCA 4G82A 1UOLA 2J1ZA 3IGLA
chains in the Genus database with same CATH superfamily
3VO0A 4OLUL 4Y4HD 2DM7A 3HEIB 4W1TA 2LLNA 3STLB 1S5HB 4TRPH 3DI2B 2HT3C 3SBWC 3P3YA 3VE0B 4QNPF 4G9FD 4AQAA 2YUXA 3G04A 4AEHL 4XCEA 4HUMB 5AVUB 3TO4B 4YXLH 3BP7B 4KZCA 3MRHA 5LB1A 5HYSB 5D9SA 3RL1A 1J0KA 4WK4B 3QHTC 3AB0C 4U1KB 4AOFA 3GPEA 5IMKB 1NL0L 4MA8H 4DOHE 1CBVH 3QJVB 2XZAH 3SKNB 4FXGB 3ARBA 1JPGB 1PDKB 5FKPB 4WQOA 4MNGE 4BH8A 3I9GH 2PYED 1MCIA 2XYCA 3KLAA 4BFEA 4NQED 4LHUB 1QNIA 2B9AA 3C6LC 3RVWC 3FB5A 3KH4A 5DK0A 4F20A 1BZ7B 4JJ5B 2WV3A 2F7RA 2J5LC 1E5CA 1EMTH 3C8KA 3ZDYE 3V5HA 4J3OC 3KW8A 3F65A 1GW0A 5PAZA 4XH2A 3UBGA 1NBQA 4D9QD 5DO2D 3R1GH 5FA3B 1T1XA 4MB4A 1EUUA 4P5MB 3X14B 3QEGL 4G1EB 4MHHI 4R90H 4D9LH 3LIUA 4MAYB 3BVXA 5E2WH 1YYCA 2L7EA 2APXA 1OAYH 1SGKA 2CKNA 2JJTA 3NIFF 1FIEA 1OAJA 4JFHE 4V33A 2PTVA 4LKXA 2IAMC 2WQRA 5EU7C 3TONA 3CQFA 5F1OB 5J6HB 5I8OH 1ZGLB 4RESB 5MERA 2Q76A 5FW6A 3UPRA 1ZLUK 1KOAA 1JDDA 1JMZA 3MRNA 5EEWA 3U7YH 6PCYA 5HYQA 4PJ7F 4FABL 3HLAB 2WLNA 3MRQA 3CN1A 3HR5B 1IE4A 5B22A 4TTDD 4J8RA 3V9EA 5JOEA 1JVKA 3WNMA 3A3YB 2YJQA 4LLVB 4V11A 4NI3A 2OP4L 1L7TL 3O3BB 2ZONA 3ZKQD 3LN4A 3W39B 3ERXA 3WELA 5L2KD 3RZCB 4F7PB 3R4DA 4QXTB 3KYOA 4AYMC 4F8TA 2AQQA 1BJ8A 4NO2B 1RQ5A 2X6MA 5EF2A 4IBSA 5AL8A 3GXIA 2IDQA 3BWSA 4NQDB 2Z1KA 3VWJB 1KDJA 4L8BB 2GTZA 1G5GA 2EVGA 3ROLA 3ABGA 3MU3A 4HEPG 4C8XA 2R2HB 3MREA 4S0TD 3TN0D 2I69A 2PR4L 4MB5A 1CDCA 2XWXA 5ACLA 1G9NC 2VITA 4KJQD 1TF4A 1VGEL 4WCYL 2H5UA 1Y07A 4Y1AB 1JUFB 1DBJH 3L3KA 2CALA 4I3RL 1UEYA 3WN6A 1VDGA 3M46A 1CDJA 3US9A 1W0WB 1O6TA 1PQZA 1AR1B 4PVLA 2WQUA 1A7PL 1EXHA 1XEUA 1NBVL 1ASPA 5IHUL 2VMEA 4PU2A 1BJ1H 5D96C 3SPHA 1CN4A 2JI1A 4OF8A 1QSFB 3UTPD 2CIIB 4OGQC 1KXVA 3FHEA 1KXQA 4G42B 1Y7VA 3EFFB 3S4SG 1P53A 3RL2B 3UMNA 5IHLB 1YLBB 5A16B 5I0WA 5KOMC 2IMMA 3K2UL 1MJ8H 1PYWB 1KIUA 3HZ3A 2ZG2A 1OK0A 3ZLQC 1YVLA 3LKSB 5D7IF 3LEYH 1XIWD 3IFOA 1GPOL 1GGYA 3DRQA 3BH8A 35C8H 4O02B 1P4IH 3V4LA 3RRQA 1V3LA 4YNYB 2BVUA 2MKLC 4X9GA 4XAKD 5D5ME 2ICEB 4WSKA 2Y07L 5B8CC 1QBAA 4GG6E 5IEHA 1J48A 5E8EB 1SBSH 4KC3B 4N25A 2DWEA 1RPQA 4QMEA 3SOBL 2RMNA 1KENH 3ILQC 1CZ8H 3L5IA 4C83A 4UU9A 1H8OA 1G7QA 3TT3H 3QUYB 4ODSH 3HI6H 1Z3RA 3EUDA 4LIQE 4RMVA 4ZMTA 1CGUA 1WAEA 5CLTA 1LEKB 3VXUB 3QISA 4MTMA 5TE4H 2ITDA 2QEJA 4WW2F 1ZHBB 3V0EA 3NYKA 2DIBA 4KKRA 4FQXA 5AUMB 2X09A 2KH2B 4KPHH 1QLRB 4QJ5B 2L0DA 3MKGA 3VSVA 2M2DA 3HNTL 5IB4A 4C4KT 4V1DD 3RIFF 1ID2A 4GUPB 2DYSB 2CGRH 2RCSL 3DWTA 1FFPB 1CYXA 3T8VA 1YNKH 4LASL 3KPSE 3IGFA 5JPMB 4L3EE 4H20H 3TBVA 1N6UA 1IBZA 5B38B 3KMDA 3UEQA 4KKZA 2BSED 3OJDA 4L8SA 4LLYB 3T2OA 3PP3H 1E9QA 2W88A 4U3HA 3MCLL 4KZEH 2X7LA 3V0AC 4IU3A 2PYFB 1MCOH 1WO2A 3ZX1A 1HKFA 1E6JH 3VQLA 2V3EA 3KLHD 1J0HA 2VDQL 5KZCD 4Z7QF 4YPGB 3S0PA 4AEFA 3BKYH 2XX1A 4Y4KB 1N8ZA 4TUUA 2I9LB 5BS0A 4XMKH 5KG9B 2XA8H 4HHAA 1QEXA 1F90L 1EXGA 4IU2B 1HHIA 1AO7A 2FB4L 3HPJB 5DEJA 4FA8A 2VZSA 5FGCE 2VMFA 1VFAB 4M6NH 4BA0A 5DO8A 2Y22A 1TETL 1YPZB 1TTAA 1A5FH 2WXHA 3O8XB 4UINH 4NCDA 1XD0A 4CVZA 4Y8AA 3E7JA 2ZSWA 3GLEA 4OD1H 4ANUA 3VRJB 5D70L 1O7SA 5IW1A 4JZOB 5HVWA 3C2SA 4NRZA 4QI3A 3E8UL 4YBLC 5KVFE 3VA6A 5GSRA 1O7VA 3FTWA 5IG7B 2CR3A 3OL2A 2P5PA 5SX5H 4ODUA 1MLCA 3ULUH 4MZIA 5AOIA 5IREA 5A40E 3HRZB 2PUQT 3OWEA 1JWMA 5AW6B 1ESOA 4DP7X 1RVFL 3U79A 3VFVA 3KD4A 1E4JA 1VGKA 5EU4B 3EJQA 3MZGB 1ZT7A 2A9MH 4FOMA 4HC1A 3QNYB 5AW4B 2VM4A 3QPKA 1WZAA 2FT8A 3EJZC 4EXKA 5CCKL 2GAZA 4C58B 3CX2A 4MMZB 4B0MB 4UOJA 5HHQB 3C5ZD 4JRYA 1DVFA 4PRIB 1FNSH 2E9BA 2OW6A 4FD0A 4DN3L 2O5YL 3SKOB 1OE1A 2JKLA 3RIAK 4MXWL 4WEMB 4WFED 3M8OH 4Y5XB 4Y5VA 1PFCA 1BAWA 5KW9L 3BO8A 4MA7L 1U8LB 3IJEB 2AEWA 2DLEA 1OGAE 3DPBA 3VFMA 4LLAA 2EABA 2FJHB 4LCYA 3ARUA 2O26U 4R6UA 5F7EL 4QY8A 3I02B 4X6DE 1GVIA 2FWOA 3UBXI 1BMGA 1G0XA 1SHWA 2EEXA 3HB3B 2AANA 4KNUA 5SWSB 1ZLWK 3S36H 3ZVVA 4Q9QL 1YEHH 2C1OB 2G30A 3EO0A 3NZ8A 1R3HA 2DL9A 5DURB 3W1ZA 2R69H 1I82A 3MXVH 5MEQA 2WQXA 3B2DC 3T77A 1AQ8A 1B9ZA 4EI5B 5IKCA 4XX1G 4P57B 2CO6B 2IOMA 1MI5D 5E6ZA 3ABMB 3UC0H 3DJTA 5K33A 1AHWB 5DJ8A 3DXAB 1KLFA 2WANA 3M07A 3UDWA 3N41B 1FBIH 5FUZL 3NCYP 4Z0BH 3QUKB 3GNML 3INUH 4FC3E 2J1ZA 4FMKA 2LU3A 2LQRA 2C4FU 3JWOC 3VI4B 2O1AA 5AOZA 2D4FA 3NSJA 3KVQA 1BREA 2G60L 4ZW5A 1SHSA 1KB5H 5EORH 1E90A 3ASOB 4QCIA 1H6TA 3QEQA 2JJUA 1LE5B 2R1XB 3GMRB 4D2NA 2BZCA 2DYRB 2XWTB 4E9WA 1UB5A 4NQUA 3ROOB 1LP9A 3W38A 4GNKB 2C8NA 4X99B 4KK5C 2V7HA 4Y88A 2ZUTA 2B3IA 2WXGA 3HZKA 2VLRD 2ARWA 3FRPG 1A47A 3MV8A 2I07B 3C5JB 3DMMB 4GKNA 3LH8A 5BO1L 3QARA 1W16A 2IANA 4TNFA 5F9WB 5E8PA 3SBRA 3SGKC 1A7BA 5E9DD 1CYWA 4FL4B 1KF9B 1BD2D 1BVZA 2N7BA 2ENSA 4GAJL 4TLTA 5AALA 3ILPA 1UURA 2RTTA 1UYWH 4AX3A 1UD8A 1CLOH 3F6JA 1NKGA 4PVBA 1F6FB 4P99A 2QQNL 1D5ZB 4ONGL 4G3YH 2MJWA 2BNQB 1XCTB 3QI9C 4PJEF 3X11A 3CZEA 3KPOA 5BZDA 2HJLA 3QIBC 3FFDA 5JPNC 2M83A 2SEBB 4ZFOB 3O0RH 3RGVA 4FDWA 1IM3B 1DSFH 2GEQA 4YHML 2Z7UA 2YMTA 1ZWIA 1AZRA 5A6LA 3MMEB 4PS8A 4NP4L 5D1QA 5DJ6B 3B6SB 4N5ED 4WO4D 5DUBA 3QUZA 2V5TA 2Y2YA 5BZZA 1J1OL 1RUML 4K07A 3CDZA 4B41A 5D6CB 4NKIH 1ND0A 4L4TE 2QPSA 4ONFL 5DUPH 2SODB 4AC4A 1I8KA 4DGYH 2Y1VA 1ZHKB 1QAWA 4KO5A 3BWAA 4NJ9H 3UCRA 2GUOB 5FYJE 1CFVH 2QQLH 1WIOA 3EYVA 5D6DA 3SQOH 3GRGA 4PJXE 4I1RA 4QHLA 5HJ3A 4LLQA 5DQDL 3TA3D 1T2JA 1KJ3H 3FT2B 4E9XA 3QR2A 3DO7A 5F7BA 3MRPB 3DTXB 4U1LB 2R0LL 3TYGH 1RSYA 4YDIL 5H4YA 3GHBH 1O6SA 1WGVA 4O02L 3FQNB 1X5FA 1HSAB 3S7GA 1DYZA 3B1UA 2IPTH 3NIGB 5F44A 2KS0A 3OF6D 1Z9LA 4ONOA 2ZX6A 3K6NA 4YQXL 1GGCL 1PKQE 3LS4L 2DI9A 4NBXB 3QFJE 5KJ7E 3MV11 4AM0B 1Z5YD 2J8UE 4X80L 5C09B 3SJVE 1XTLA 1EGJL 4ZT1A 1S9YB 2X1QA 5JLZB 1S9KC 1UG9A 1WG3A 3RWEA 3WLBA 4L3CA 1E28B 5FHAL 4NZRH 3KPMB 2KPNA 4NUGH 4YXKL 4KUZL 3UPAA 4M61B 4IDLA 4LSRL 4IRZL 5E8DH 4AM0Q 3AVEA 3TO2A 4PWEA 4Z77B 1LO0H 5DHDA 3JT0A 4K8RD 2XWJB 5A2AA 7FABL 4HF5H 1E9OA 4WI0B 2HFEB 3ZSSA 4S1SL 3U30B 3BZEA 4AQ1C 1N7ML 4YHYC 4N28A 1MWAA 4BKSC 1MEXH 1E6OH 5GGSB 5FHBL 4WTXA 4Z7UE 2APSA 2Z93A 5JHLA 2HH0L 5HYSG 1FVCA 4M6MH 1WIPA 5CWSB 4IRSC 1HE8A 1AGCA 3P4NB 5KSVB 1Y6NR 2M26A 1C12B 4QRTB 5DEGA 2FECI 4Y4FD 3TH2T 1IAMA 4LF3A 12E8H 5HHOB 2BNRE 4JM0A 1C16B 3HKZA 1BFOA 5DJCB 1FNFA 1WT5C 2EO9A 3D2UD 4LSUL 2EQDA 5FM8A 2EIDA 4ZW6A 4HW6A 1JRHH 3T65B 4AQ8C 4DCQB 4DSYA 3FUKA 4POUB 3FB6A 1SPDA 5C08D 3MROA 3VXQB 2JLLA 1FVEB 4Q9BA 5I74B 3QZWB 4PJ9C 4KQ0A 3ZE0F 1E2WA 3OKMB 1NICA 4Y89A 5KSAD 4C56D 5KYNA 3RTQC 1M6OA 3SZ6A 3CSPA 4N0UB 5GGQL 1NAMB 5T1DH 1MCKA 2NY0C 4HJIA 4C4UA 4ZODA 1CL7I 2EYSB 4M1DL 4XNMB 2F53D 3DV6B 3FQ4A 4PFEA 3VM5A 4D94A 3ZUNC 2CK0H 3QPQD 3WTWA 1EBAA 3OAZH 3S35H 2VC2H 4HIHB 3S3JA 4MA3A 1IFHL 7PAZA 4DH2A 3FH5A 1HHJB 1XV8A 1CD8A 1DN0A 1ZD6A 2Z7YA 4FLRA 3ULUE 2W0PA 2YMXH 4K71B 1CMOA 5IFHH 1CGSL 1UQSA 4XMPH 1PG7L 2J43A 2A9AA 2EEDA 1HWHB 4X42A 4K9EH 3N42B 1WAPA 3O6MH 5DJ2A 4JKPH 3DROA 4F9LA 1JWUA 2ZUYA 3RY6A 5FCUL 3D0VA 3N44F 2AVGA 4IEFA 2CJTA 1PCSA 3KS0J 3LXUX 2VLJD 3PWJA 1NCIA 2R2BB 4QRRB 4DKDC 4ZX3A 1M6UA 1M2VA 5EBLB 4Z3FA 5ALBH 2HT2D 5HHNA 4HIXH 4K3GA 2Y5QA 4LRIA 1IKNA 4CKVX 1J10A 3ARFB 4M7ZB 4UT9L 4PJ5A 5DJZB 4JFSA 1IGIH 1JV2B 4U6XB 5E1AA 4MZRA 4MBOA 2CRZA 1XF5B 4LL9A 1HQRB 4B7IA 1HZLA 4XMVA 3T4YA 1D9KB 5T3XH 4HSCX 4PRHD 4KO9A 5E6IA 2A77H 3HE7D 5CLWA 3WXWL 4D3CL 3E6HA 4R4FH 2X3AA 2WB7A 2MEJB 1HXYB 5DC9B 3SQBA 5BUGA 1LM8V 4GAFB 4XVJH 1OE3A 3OLEA 3VXMB 1SEQL 5I30L 4LQFL 4G8FB 3EDKA 2ZG3A 3ZDXB 1UA6H 4JMNA 1E2VA 3WFEH 1FIGH 1SF5A 4NWUL 4P5SA 1I7RA 1YN6B 5JHMA 2EVHA 4LVNC 1QMUA 2UZXA 5B7MA 5AD0A 4K7PL 3U1QA 1B4RA 2AQSA 4E41E 1MXGA 3D9AH 2AF2A 1RZFL 1PF3A 1NEPA 4XB8A 5I1HH 5JXED 3KPRA 5ELIA 3GXDA 4G7RB 3IFPA 3DOSB 4I77H 4E5XA 4XPTH 2WNXA 4A7GA 1XF2B 2F19H 1T2XA 1F4XL 4P46C 4TUJA 2W95A 2YZ1A 4U1MB 3BZFA 4H2AA 4WHTA 4Z18A 1U8KA 1XR8B 3ARVA 3FO9B 4HEPA 4F24A 4YFDB 2XV3A 4J23A 1FFNA 5M94B 1WBZA 3NZHH 4M93C 4E9VA 5C0DA 5C6TH 2GITA 4PJ6A 3N0AA 1CE6A 2H8PA 3EFOA 4JFDA 4BGDA 4LFHD 3FF7A 2BMKB 3CBKB 3A22A 5BVJB 2VLLB 4DEUA 1T66C 4DQOL 4A38A 2IV9A 3QEUA 1GYWA 2NY6D 1NBYA 3OXRA 3UROR 2A6KB 2UVFA 3N43B 3V0WH 3UEZA 4QJ3B 1TEYA 3FT3A 1A6WL 4RMRA 4ZYKA 2WXKA 3UABA 4AYGA 4XNDA 1ZHLA 3S4SA 4LBAA 3QUML 3DX9A 4JREB 3O2WL 1J88A 4AVJA 1K4CB 4RWHA 5E4AA 3MJ9L 1QWUA 3DX3A 1I1CA 3KPLA 3PU7A 3CZSA 3ZBMA 5D7EA 5AVYB 3IJYA 4M8UA 4XP1L 1OT2A 5T5FL 4PTTB 2EDJA 3FQYA 1AIZA 2Z0BA 4OFPA 3HC4L 4KROD 5FGSA 4G6AC 4ODVL 3HLKA 1WRFA 4YSEA 3O3AA 3MRIA 5MENA 2C3VB 5TPWH 3WE1A 1CTOA 3CN3A 5B38G 1IKFL 3ULUC 4TNWF 3QXAB 1N59A 4MBRA 3S37X 4PJBF 3GHPA 2JKWA 1IGYA 4EAEA 1GCYA 1CF8L 2F0CA 2GJ6E 1QYGH 1U8QA 3REWA 2BOCA 2P24A 4EDWL 3UZQA 1T04B 1DDHB 2ZYSA 5C07E 1JZ8A 4HDIA 3BN9C 2PPFA 5TD4A 3FQXB 3OM3B 4UMGA 3MA7B 2AZUA 4JO5A 4EZMA 5GRWA 3GBNL 3QXVA 1RU9L 2NY3D 3PQYA 3FYIB 1SN5A 2VXVH 3O6FD 3QNXA 1QEWB 3RY4A 4PP2A 2P8MB 3T3PF 1YECL 5JXEC 4OLZL 1EV2E 1YYLH 3Q2CA 2JMRA 3QSKB 1SNRA 3ARSA 3I6KA 3JTSA 3WY4A 4PV9B 1XD1A 5HDQH 5K9OA 4CADB 3TPUB 1OCWH 3RNQB 2V3FA 4POZC 5D1XA 1D6EB 4KXCA 4DPBX 3WJLA 4AENB 2YD3A 3KPQB 3VQ1C 1A6TB 3AREC 5F7WC 2BWIA 1WS7A 3WJMA 3D0LA 1EFQA 3PXHA 4JLRB 3CVIL 2WTRB 4X6CE 2FO8A 4X9FA 1FPTH 1CU4L 1JNHA 4UOZA 3NJVA 2HG5B 5K9QG 1MUJB 2NY6C 4AXWA 3QQ3A 1S78C 2FIRT 3NSFA 4N2DA 4UV4L 4ERSL 3H3BC 3OJMB 2ZF8A 4O9HH 4CU8A 3BAEH 5FO9B 4TQEL 4JO3H 1Z3GL 4WUKL 5EA0H 3PJSB 5CLXA 4EN2A 4NB7A 3DGDA 4P9HH 3SPVB 5TE6H 1M7IA 1AGEB 2KQMA 1A1MA 4I18A 4Z3EA 2OMWB 5I8EB 4XAWL 2XI9A 1E4XI 3KJ4B 1JL8A 4PRAA 1VCAA 2E4FA 1HILA 1T4KB 3W5MA 2X70A 3ZMEA 1BXUA 1IGFH 4OD2A 1RZKH 2WJ7A 1GZQA 1MW1A 3FTGB 5DQ9A 1UOVA 3AT0A 3JWDL 4Y5YB 3ZYJA 5C0NC 4LKCB 2HTKC 4PD4K 5EH1A 3BP4A 5EOTA 3DJRA 4MAUL 4R5VA 3WMSA 2ETWA 3WNNA 3TFKD 5JZ7C 2F61A 1D7CA 5EN3A 4XE5B 1N19A 3H7BA 2F15A 4XWOD 4TL4A 4WNSA 3IFLH 2O61B 3O9WD 2V0AA 1OOWA 1ZA6A 1XQ4A 3PWUB 4XVTH 1L5GA 4ZXBB 1JN6A 3VD4A 3P2TA 1EXUB 2FX7L 2F7OA 3CDCA 2W0FA 1FNHA 1XZ0A 1I85C 5BVPH 5JW4R 2QLYA 3LRGA 4YL4A 2XKNA 2APFA 3GSWA 5LG6A 1AGBB 3UYPA 4ZMXA 2F74B 2Y25A 3E1ZA 1QWHA 4WWKC 4GKZB 2XTJD 4OFDA 2GFBB 5FDWB 4DAGH 4Q9CA 4XT1C 4AK1A 3RFZA 5J56B 3LV3B 1DBAL 4I3SH 4OCSL 1HH6A 5A6IA 3CDGB 1IBFA 3WFDH 1IBGH 2BW5A 2CMRH 4OF6A 2AHIA 3BXNA 4MZ2A 1UXSB 1T0NA 2WKOF 1TVHA 2OCJA 1BQHB 1Z9NA 3D87B 4G6MH 5BS0D 2WBJB 1MQKH 1HKLL 2IDUA 2R8SH 4M48L 3KXFA 4G11A 2DTML 3V9CA 1ADWA 3EH1A 3R06A 3EGXA 4JHVA 2RACA 4CVUA 4XO5A 5EBWB 3HW7A 1H5BB 4XPBH 3TBYA 4Z8FL 2VWEC 3HOGA 3VTMA 2CO2A 2JB5L 2W9LA 1DFBH 5DDHB 4ZFZA 3BSZA 3P4MA 1G7JA 3WHXB 5EU6E 1AZNA 4JFEA 4RGND 1T22A 4I13B 2JCCA 1ECYA 4QHUB 5CP7B 4MNHB 3VI3F 1V10A 4TOYL 4OZIB 2EDKA 2DQCH 4TL5A 3FRPA 2JE8A 2ATKA 1TYEB 3BUYB 4L1SA 1TSRA 4YHNA 5LGHH 5E8NA 4L4VB 4F7MB 4KK9D 4IGBB 2FLMA 5CGYC 1JNNL 4U6YA 2W5PA 3U6XS 3V0VB 3QEHB 3X1GA 4JM4L 2Z4QA 4RISL 1WFIA 3CXHJ 2EDOA 4B9PA 3MJ7B 3L45A 2VRAA 5D7KE 2YO3A 1K8DA 3L4XA 1QA9B 4FTDA 4S1RL 4YFLF 3HFFA 4JRYD 4H8HA 3WUZA 4Q6IC 2WB1A 2WYIA 2WBWB 3W9EA 5AAWA 4XP6L 5E0FA 4PJHB 4JRXE 3RWIB 2K6YA 3FB7B 4J7RA 3MN8A 3ZKSD 2X6CA 5KJ4A 4B9KC 4PRNA 4KRPC 4G7VL 2EO1A 4FGMA 1OAUL 5DGRA 3VD0A 1S8DB 3D06A 4RMUA 3HAEA 4ABUA 3IPBA 2X4SA 1Q9OA 4YXHH 5I73B 3IF1A 2H2SD 1QW8A 4JPKH 4KK8D 3TVMB 4N0FA 1EX0A 4KX8A 3BQUC 5EOCJ 4GI8A 3NCFB 2H4EA 3WBDA 4Y7OC 2X0WA 3VFGL 2A83A 1F86A 4P2QB 3C8DA 4D7PA 4OCRL 1DBKL 2IGTA 2VERN 3GBML 3UTSB 4KVCL 6PAZA 4OF7A 1PLGL 2BSRB 3AT8A 1KACB 4PV8A 1M42A 5GQBA 3N5AA 2NNAA 3K0WA 3KWWA 3PDOB 3QJFA 4AZ8B 4ZZFA 3F2LA 3BEWA 4L0ZA 2E9WA 2JVUA 1OVZA 1CQKA 2D2CC 3SDCD 5CJ8A 2DAVA 1CICD 2QADC 2WXNA 3JYCA 1ZXQA 5EU3B 1GH7A 2QSCL 3K6SA 4K3HA 2MRYA 3P1VA 2F8VA 2VLKB 3DVNB 3ZIMA 1CCZA 3UCQA 1I9IL 3ARDC 2OMZA 4XNAA 4G83A 2BNUB 5JDSB 4APXB 1G4MA 5TF1H 2OYPA 4TNVF 4BCYA 2PPAA 1GMIA 1QVOB 4HG4J 3BD4A 2NXYD 1UJ3B 1R24B 1RH8A 3FN0L 1L7IL 3IDGA 3L81A 5EIIB 1AE6H 3OHXA 4XBPB 1F58H 2IG2H 3WJJA 3WIHA 1U42A 3EYQD 3N3EA 2NUPB 4X5PA 5H2BA 4J4PA 1T83A 4XNYL 3QIWC 1AMYA 4W9CC 4U1NB 5IROC 5K39B 1AQKL 4IRJB 3TZVC 4WFFE 5GXBB 1U8JA 2LTQC 1N9PA 2BY0A 4UZUA 5FO8A 4GIAA 3DHJA 1KTLA 3GEFA 3Q43A 4OCNC 5I2IB 3VFRA 1IL1A 4F9PC 1KN2L 2ZOWA 3MV8D 4UZGA 4E9LA 2WVVA 4A67A 5IBLC 4K9EC 3D50A 4PUBH 4HZLA 1Y0LA 3CFCL 2HX7A 2GKIA 3L9YA 1IFGA 1NLBL 1UGNA 4HBCL 2YLKA 4LCIH 4PJGE 2ED6A 3BUPA 3GB7B 1RY7B 3QZWG 5DRXA 1TT6A 3OMAB 3BAIA 2NR6A 3ZE2E 3STLA 1S5HA 2D9QB 3RIFK 5GHWH 6FABH 4C4KO 4EBQH 4OLUH 3VE0A 1YNLL 2E27L 4QRAA 5LN8A 1UENA 2H0FA 1BAFL 4K4KA 3TO4A 2R29H 3BP7A 3BT2L 4IDJL 3UAJC 5HYSA 3OMIB 1YSOA 1OF0A 4AEHH 1E42A 2OCCB 2OMUB 2Y7NA 3BKML 3H2PA 4U1KA 3FAXA 4NUPA 1EZVY 5IMKA 4B6ZA 2FL5B 3RGVD 4WJKB 1NUFA 2H3KA 3SKNA 4R7DA 1NL0H 2DQTH 1JGUH 3C60B 4FFYA 2EDFA 4FXGA 3VU2A 4H88L 2CRMA 1B90A 1JPGA 1PDKA 2DD8L 2YUVA 1NCWL 2NQDA 3GDBA 4A7TA 3AQXA 4AK2A 2HP4A 5F88B 3NABL 3PWPA 1MF2L 3PUUA 4LHUA 3O0LA 1BQLL 5B39B 1BV8A 1YAZA 2MTPA 1KYDA 4AH2B 5L7XL 1BZ7A 2XBDA 1F4AA 1BVNT 4OZHE 4N2KA 4XXCA 5T1LB 1KCUL 1G6RB 1N18A 2EDYA 1A3LL 3I9AA 5DI8B 3GTVA 1T89A 4G1MB 2NX5B 5B1JC 1L9NA 3SCMB 5FA3A 4U2ZA 4EIGB 1EZLA 5CINL 3GXFA 5AKVA 3THML 4NOFA 5C0AA 3P30L 4P5MA 3X14A 3WO4C 4G1EA 5F3HB 1D5MB 5E03A 1OTUD 3CU1A 4ENED 2R27A 4MAYA 4IBLT 3E2HB 3A6BL 5IQMA 1XSKA 4FEMA 1WIUA 3QQ4B 3QEGH 4J12A 2IGFL 2ZJSL 3I9PA 1HCZA 5I75C 4I0PB 4H2CA 3FFCE 5A2FA 1MCRA 5KJRL 5J6HA 1RJLA 2CJ3A 1ZGLA 4NNXB 1M9WA 4PI2A 3N50A 3O11B 4K2UL 5IUCA 4DP4X 4LBEB 2C1PB 4LU5L 3QZPA 3GK8H 2ICES 5BOJA 4UQDA 1IEHA 3BX7C 2UX6A 2UXTA 3HLAA 4KTYA 4OJYA 3HR5A 1MCBA 1X5MA 2HVJB 4FJYA 3OTTA 3EJUA 3KEDA 4ISVB 5CIPH 1ZSDB 4FABH 4LLVA 3MRRA 1YNTF 2OBGA 3NPSB 1W80A 1IQWL 3D3VE 4OZGB 3O3BA 2GG1A 5CJXA 4HEMA 3W39A 2FQDA 4WAFA 4WFHE 2OP4H 3RZCA 4YUEL 4GMSL 4F7PA 1L7TH 3NEEA 4QXTA 1G6VK 4QHPA 4M5YL 4NO2A 1QTPA 4LHJB 2CO1A 1CT8B 3KL3A 4PLJC 3A4AA 4NQDA 1Q1PA 2A4CA 2D3VA 2VO5A 4L8BA 3VWJA 3ZDZB 1XZWA 4AYBA 2Q6WB 5AAPA 3O2VL 4JFWA 4C57C 4DT2A 4U0RB 2XFXB 3OR7B 2R2HA 1LWJA 2E7LA 3QDME 4ZO7A 5BQ7B 3P40A 3Q9QA 4ZFQA 2PR4H 1XH3B 5FO7B 4Y1AA 1JUFA 1ID5I 4Y19A 5H4ZA 2FR4B 1GZHC 5I28A 4YBHA 1VGEH 1W0WA 2ZUUA 4WCYH 4ABQA 1OPGL 4LO9A 3RVXC 1SY6A 4I3RH 3WU1A 1KXTB 2A4EA 4LPVA 1QSFA 4G9FE 4KDWA 2CIIA 2NYYD 1NBVH 2ZG1A 3EFFA 1M3JA 3RL2A 3FT0A 1CE1L 2JJWA 5A16A 4MWFB 1YEGL 4L1TA 2A0LD 4NUJB 4ZS7L 3UTOA 1PYWA 3CMOL 1O7DC 2Z7WA 2K3TA 4PBWD 3L3GB 3LKSA 1X4ZA 2Z31B 4R96B 1WAAA 3G6DH 3K2UH 4F15C 3CLEL 3VGHA 4CSTA 3RX5A 2P47B 1GPOH 2HRGA 2LOEA 4IMKA 4P23C 4YNYA 3TBTB 2XJLA 4ZMYA 3N04A 4W9FC 2ICEA 3ZT6A 3CH1B 1JDCA 3VRLF 5E8EA 5JO5B 4A7QA 2EAEA 2AXJA 3I50L 1GKEA 2Y07H 2F54B 3NN8B 1AG0A 2MCMA 4AIOA 4AG4L 3FS9A 4LEXL 4RDBA 1MFEL 3SOBH 2YLHA 3QUYA 2AAAA 4KTGA 4KJWC 4XBEH 4DP8X 1RIHL 1WVZA 1AKJD 1ZTMA 3FU6A 1QSED 3DSFL 3VXUA 4JW3A 5HYJD 3WS3B 3U7WL 1ZHBA 1A4KB 2Z9TA 5I0XA 5AUMA 4X8CA 3ZHDA 1HOCB 3MV7B 4GBXC 1AD0B 1QLRA 2G9KA 3IM1A 3I74A 4Z7OF 1GL4B 4GUPA 2DL2A 3G5YB 2XN1A 1FFPA 3PL6B 4MXQC 3MBEA 3L1GA 3CBRA 3EOBB 4B9CA 1KCVH 2L04A 4LCCB 5JPMA 2DBJA 2RCSH 5T5NG 1OW0A 2E86A 1QUNA 2YK1L 2AJ3B 5B38A 2VZOA 4P9HC 4LASH 1P5VB 4ELMB 1VSCA 4GXUM 4LLYA 1ZAGA 4P2AA 4JK0D 1H9DA 2CSPA 1NEUA 3NCWA 2PO6C 3GSXB 1G7MB 4KZDH 3MCLH 1PL3A 4YPGA 3VB9A 4Y4KA 4RRPA 1XBDA 2I9LA 5KG9A 2VDQH 5FLUA 4IU2A 1PX8A 3HPJA 2XIBA 4XOAA 4LSDA 3VMOA 5GGRY 1VFAA 1JRHI 3AM8C 1F90H 2NT1A 2ZCKL 4G5ZL 4XB7A 2FB4H 1YPZA 1P6AB 5ANMB 3O8XA 3SIKA 1SOQA 5LGKA 1QRNA 5CSBA 5FGRA 4LPCA 4JFZL 3NA9L 3VRJA 1TETH 2WXLA 4JZOA 2KLSA 1IVTA 4LNVA 3B9EA 1O0VA 5D70H 5IG7A 3B3BA 5CU9A 2KQNA 2XN0A 4FF9A 1K2DB 4KHTL 3HG4A 3HNSL 1QLFB 4AEIH 4GKSB 1JCKA 1ADQL 3R7QA 1IC7H 4RCAA 5FUCE 4D7BA 5EU4A 3EUUA 2H3NB 1X5GA 5BRZD 4HLZG 3QNYA 3UJJH 3H54A 3QDJE 1CDHA 1TEFA 4WKXA 1R47A 5J3HD 2VDKL 1KPUB 2UXFA 4Y2NA 4K15A 5ACZB 2F5AL 1S7WB 4MMZA 5CCKH 1H3UA 3OBAA 2WQAA 4HIPA 3ZRCC 4UNVA 5HHQA 3KLDA 4PRIA 3TNMB 3SKOA 4F1ZA 1ZJBA 4Y5XA 5GGVL 2E46A 4KOBA 4B96A 2WTPA 4HQQL 4DEPB 3TXAA 4Y2OB 3OKLB 3MACL 1F4WL 1U8LA 2O5YH 4NCC2 4UTAA 3IJEA 4DN3H 1IT9L 3CCHB 2B9BA 2WTOA 1VF5C 1A14L 3G08B 1TQCB 5CZVL 5IVXB 4L23A 3V6OE 5KW9H 4WJ5B 2HKFL 4N3UA 3QJXA 4KRLB 3QUXC 5EZOL 5SWSA 4YGAB 1YMMB 4ODTL 1IZJA 1VPOL 1UD5A 1P7QB 1NCHA 4JY5L 4Q9QH 1VAHA 4H1LB 5GZNC 3WEBA 2J3SA 1DUYB 4I88A 2EIBA 4N26A 2RBLA 1FYTB 4EI5A 3D39E 1N5YL 3LJ3A 2CO6A 3UBXB 4YDNA 4S0HA 2FBJL 1G6RL 5EIVA 3AB0B 1AHWA 1CYGA 3DXAA 2JCCF 3MLTA 1GRWA 2YPVH 5GPRA 4LEEA 3VXRD 1A8ZA 2G4GA 1BQHG 3QUKA 1OLZA 5I1IL 1I3RB 4YE4L 3U2SB 5FUZH 3VI4A 3GNMH 4XNXL 4ZUVB 5EOCL 2MHAB 2ZWZA 1INEL 4XO4A 5FYKU 3BGFB 4KKQA 1HHGB 5GGUB 5CD5C 2HT4C 3VW3L 2FYYB 4Y0GA 4G70B 1LE5A 2R1XA 3GMRA 4RBPH 1FN4B 2OW7A 2XWTA 5EV7A 2KMWA 3DLQR 2X4UB 1KTKE 3MRGB 3ROOA 5HHXL 4B0MM 2V2XB 3SOTA 2NMSA 1TSHA 3APDA 3SDXE 4X99A 1SM3L 4ZK8A 1EERB 2Y2WA 4K23L 4QTFA 2K1MA 2I07A 3C5JA 5D72L 4PJCE 3WFHB 2DPKA 4MLIA 2WXQA 1PIGA 4MJIA 2MQ3A 4Y2DA 2QMJA 5FUOL 2B1HL 1HZHL 3F7KA 1V8HA 5J89A 4PTUB 4G9DB 2AFNA 1T5XA 3GHEL 1V7NL 4UIKL 4GAJH 3ZYOA 5BMFH 1MRCL 2IAMB 3FW6A 1D5ZA 4OZFB 2YMOA 2P5WE 2YPLB 3H56A 2BNQA 1XCTA 2R9HC 2R1YB 5HI4D 2VDPB 5CKGA 5C0BE 1NOLA 2QQNH 5FYLL 4KK6D 5DD5L 4ALAC 1KTJA 1MWOA 3EJJX 5B7EA 3JVFC 3STZB 3AXLB 2AGJL 3L4WA 5HDBF 3V2AR 3NJFA 2SEBA 3FO0L 4N86A 4A66A 4ZFOA 5IJCC 2IGLA 1T5WB 2VGLM 4Z7NB 1IM3A 5F0JB 1PPIA 4ORGB 3IU4L 1HHKB 4HXBH 5CZRA 1TVDA 4J27A 3NIDB 4NYLB 3MMEA 5DJ6A 3B6SA 4YHMH 3NSYA 2BJML 4Y4HB 3LPWA 2R0ZL 2OL3B 3SGJC 4NP4H 4BJLA 4WGVB 4X0KB 5D6CA 2JH2A 3HRPA 4I85A 2D3LA 1NCDL 3H55A 4TNEA 1J1OH 1RUMH 4HPHA 3LMJL 2JQMA 1ZHKA 1E5YA 1FZOB 5D55A 1DL7L 2PTUA 5FUCC 2UY6B 4P2RD 4ONFH 2VJXA 1UD2A 2GUOA 5E5MB 1PSKH 4HPOL 1JPEA 4KNTA 4WFEE 4M9PA 2W94A 3MRPA 3DTXA 5CJ5A 4DP9X 4U1LA 4PRPB 3MLRL 5DQDH 1W6LA 5AOKA 4PP1D 2WN2A 1MFDH 4IBUA 4JG9A 3B5HA 1I8IA 3FQNA 1HSAA 2CNYA 1ILSA 2R0LH 2GB2A 2XN9E 4KDTA 2AERT 1IGTB 3B7SA 3VXSB 3ZT5A 1Q94B 3F7RA 2R83A 4YDIH 1SDDB 3HE6D 3P4OB 3PWNB 2PYEB 4O02H 5EIIG 4RX4D 2BHUA 3IWUA 1J1XL 3P77B 1X4YA 3L5JA 2UWEB 4AM0A 1GGCH 5DXWA 3V6OC 5D96B 5C09A 3ZTJH 1S7VA 4JZJB 1S9YA 5DVLA 1OTSD 3Q8AA 5MHSE 1OGPA 4KJPD 1CR9L 5JHAA 1BM7A 1YRKA 2AQRA 3KBPA 5IF0B 1E28A 2LAAA 1AP2A 2D7OA 3KPMA 2ICWA 4G82A 4YGVB 2B2XL 3BW9B 1KT2B 2CKBB 1Q0EA 3EAKA 3L1OL 5FHAH 3MCG1 4YXKH 4OFKA 4KUZH 5E9AA 4Z77A 4IRZH 2NQ3A 4LSPL 1OSPL 2XWJA 1J86A 4WI0A 3NFNB 3RWFA 5B8CB 2HFEA 1FI8C 4BUQA 1J8HD 4Z7VE 5AVRB 5F7MC 1PG7W 5CZXD 7FABH 2K8MA 2OCFD 2R51A 2PP7A 1LEGB 3RVVC 5C0EB 4S1SH 4W9KC 5JTWA 4J8QA 3L3HB 4ZMAT 43CAB 4MMXC 1CLCA 4U7MA 1V54B 3H6AA 4F8QA 3BEVB 3NJXA 5CWSA 1VFMA 2WYHA 5FHBH 3P4NA 5KSVA 2HH0H 4PJIF 1C12A 3BGMA 3V4PB 4QRTA 4ZAKC 2PXYD 3OAZK 3J2PA 5CN1A 5HHOA 5DJCA 3IN2A 3MR9B 1HL5A 4DCQA 3T65A 1UD4A 4PGBB 3HBQA 3AQDA 4LSUH 1I1AD 5LBSH 4K0OA 4YHOL 2A6DA 1TJGL 4P49A 3WDIA 3VXQA 1T0PB 1FVEA 3G9VA 4LSQL 2EIJB 3QZWA 5DZOA 4EPSA 2ATPB 5AAMA 2BIOA 3OKMA 2ZAHA 4HJJL 3UGEA 5L2KB 3MV9D 5T3ZL 5IQ7L 3OSKA 3RJDA 1JGIA 4N0UA 1NAMA 3ZW3A 4MS8D 2DIAA 4KV5E 3COOA 4X6FB 2EYSA 3BUTA 1W2KT 3VXPB 4XNMA 4YBQC 3QORC 3DV6A 4WZ9A 5GGQH 5J11C 3RPKA 1KJVB 2D2OA 1DO5A 3NA4A 3OAUL 4A2DA 3LDBC 2OXGA 3HHSB 5TH2B 1UA7A 1B6DA 3OKKA 3TN0B 2MNWA 5F9JA 5IIEB 1HHJA 2AEQH 5C86A 5HGDB 1IFHH 2XV6B 3ME0A 4M9OA 3VCLB 2JJSA 4E0RB 2VDRL 4M3KB 4D9RE 3P9LB 1CGSH 4JFQB 1PY0A 2J8HA 3TV8A 4U1SB 2VKXA 1PG7H 4QPEA 3SE9H 3L3DB 2CIKB 4HXAL 1TZIB 3NFSL 4MHHG 4EMZA 4Y1SA 2GEEA 4EKXA 4DGIL 4HCRH 2LU5A 1U8OA 2WJ5A 4U3XA 1PX4A 2KERA 1NPUA 3PCYA 1E40A 3P73B 2R2BA 4QXGH 3RVTD 4QRRA 1SXBA 4FNPA 3LZPA 3HN8A 1CDUA 5EBLA 1XIWB 1MCCA 1GW6A 4JL2A 4BEIA 4KZ0A 3ARFA 1JCVA 1PNDA 2XYBA 1JV2A 1DJHA 1JXGA 5IBTL 4NNPL 1XF5A 1HQRA 4NC1E 4UT9H 1ZLSL 2JKJA 1MAKA 3BMVA 4N6QA 3VSQA 4FNRA 1TJHL 3BAKA 1A1NB 3O6KL 3POCA 2J1KA 3BKCL 4Q6YA 4FA6A 4X9HA 1HXYA 3WXWH 5ES4B 1C8QA 4IHOB 4D3CH 4F2FA 2I60L 4CC4C 1I8LA 2HLAB 4G8GE 4CJ0A 3VXMA 4ZPVB 1NC4B 3JTTB 4R4BB 1P6WA 2FH6A 3QT2A 4LCUB 1SEQH 2WOYA 5I30H 4LQFH 4R97C 1YCSA 1YN6A 2GBVA 4L9LC 2AJUL 1CDGA 1KYUA 1UVQB 4LARL 3US0A 1DQIA 1T6WA 4V1DB 5CM1A 4NWUH 2V4LA 1KC5L 1E4WL 2FBOJ 4XXWC 1BQKA 5D7SL 3HMXL 2GVYA 3FDWA 2IALB 1Q0XL 3HUJF 3DIFB 2P49B 3VGAB 4K7PH 2Y6SD 2RH0A 1RZFH 5DD6B 2Z92B 4WY7L 2YN3A 2JELL 4XZ4A 5KANI 3DOSA 3CPLB 4NDMA 2P80A 2YXFA 1MW2A 5JYMA 5A2CA 1XF2A 3RUGE 4RAUB 3LNHA 5CLYA 1XR8A 4WW1B 3SO3C 2EUZA 3B9KC 2X4OB 5G4OA 2AABL 3QBTB 2WCGA 1WQVT 2NY4C 2WD0A 5D2NB 1R3IL 3UYRL 2LVCA 1DCLA 4KXZH 4XBGB 3WEAA 2BMKA 4C47A 5BVJA 3R4RA 2VLLA 1VJSA 1DVUA 4F91B 3CX5K 2ISDA 4EN3C 2V2WB 1DANT 4NO3A 4ZQKA 4JFOB 1SYSB 5BW7C 5C0GB 2Q87A 3NFPB 4DQOH 2A4ZA 1IGCL 1BZOA 5B1AB 4LB8A 3PV6B 3BPOB 3ZL4H 1TXKA 4EUPB 3BLKA 4H0LC 4O2FB 1A6WH 1CGWA 4PJ7B 5CCJA 1MNUL 1DR9A 2XWBB 2DYPD 4IMLB 5MI0C 5IMOB 1K4CA 4UBDC 4M7LT 3N40P 3B5TA 3KPSB 1J5DA 3QUMH 2A74B 4QYOB 3QDGA 3O2WH 5FIEA 2APVA 1J7VR 3MJ9H 2K45A 3FSVA 2WSDA 1BXXA 4QWWC 5T5FH 2APBA 4YZFE 5G4MA 3QRGH 3DTDA 4FQIL 4CILA 1YMHB 1KYOK 3HC4H 2C3VA 4GFXA 3EFDL 4F92B 4AE0A 4ODVH 2ZYHA 3OZLA 4H25B 3UMTA 3TTYA 3QXAA 1EUTA 5DHVB 5BZWB 3F8UB 5KS9E 1IKFH 1XGYL 4P59L 5AOLA 3D05A 3EO9L 3QIBB 3VNYA 5ISZD 2CHXA 5JPNB 4Q14A 3G3LA 2X4QB 2YGNA 1DDHA 1CF8H 1R3JB 2WXMA 4NIYE 2L3BA 3ZHLA 4TUOB 1G9NL 3P0YL 3FQXA 4YSUA 3V8OA 4CKQA 3MA7A 3KYMA 5F1NB 4PBXA 2XVKA 3QCUL 2VXQA 4X5XB 4OCWL 3RB7A 2XRAL 1A2YA 2O5ZL 4PJFE 3GBNH 1QEWA 3IYLW 3U4KA 3TESA 2P8MA 3UL4A 5B3SB 3FB8B 1UCTA 4NQDD 4KH2A 3TURA 2V5RA 1TOXA 1CO1A 2I26N 2FZ3B 4PV9A 4NC1C 4CADA 1BF8A 4OLZH 3RZWA 3TPUA 5D7IB 1YJDC 2QPEB 3RNQA 3QIUD 4JQVC 5JUEL 3PXLA 4AENA 4HJEA 1C7TA 2NY2C 1ZV9A 1A6TA 2CKBL 3MRKB 1SVBA 3CZKA 4OFYD 3CBJB 4JGNA 2P44B 5E2TL 4JLRA 3IDYC 2WTRA 4LSTL 1GA2A 2K4WA 1I9JL 4KTDL 4AVIA 1U9KA 3KCWA 5AG8A 3N06B 2HG5A 1MUJA 1EHAA 3CVIH 4HA1A 4NAQA 2DRUA 1CU4H 2X38A 3T6VA 4JQIL 1RZ7L 3DA0A 4MKTA 5GRVL 4UV4H 5FO9A 5HHVL 4YPJA 8FABA 1B2WL 4ERSH 1QHPA 3KHQA 3PJSA 1P9MA 2FDBP 3ESVF 4MXVF 1WF5A 3SPGA 4K5LA 2YD8A 3WKML 2VLRB 3SPVA 5A3IC 3CIQA 2FEJA 2X42A 3QG7L 1AGEA 1XL6A 1Z3GH 2HKAA 4WUKH 2OMWA 2H6UA 5I8EA 4RFEB 5ICZB 2XLLA 3ULVE 5CMAB 5DZ9A 3U0TB 1DQML 1QBLH 1T4KA 3BWZA 4NKDB 4H0HB 3LQZB 4XAWH 5E0QA 5E9DB 1S9WB 1BD2B 1EJ6A 1MELA 2YEZB 3VI4F 2HVBA 1TENA 1QQDB 2FECL 3ZGHA 1XSIA 2J6EA 3LXBA 3FTGA 1L4IA 1OAXH 3AW5A 1IQDB 3CSBA 4X7DC 4Y5YA 4LKCA 2COQA 3D6GA 2HPTA 3DK2A 4WI5A 1V7ML 3JWDH 3UBXG 3H4FA 4EI0A 4AJ0A 4G80A 4IRSB 1HN1A 2NY1C 3D69B 3QP3A 3L9EA 4OCYL 3MRDB 2NNFA 2BP3A 3FU0A 4MAUH 5F0PB 3VXUD 4A2MA 3LEVL 4QF1B 1E27B 2Z65C 3SE6A 2O61A 2XQYG 3KNBB 3ZO9A 3ZT7A 1L6XA 4OUUB 3PWUA 4YSPA 4ZXBA 1J5HA 1CL7L 2I32A 1EXUA 4D8OA 1RLBA 3WIIH 2IQAB 3CHOA 1EVUA 1MPAL 2FX7H 2BXZA 3WS6C 4PJ9B 2J73A 1ETA1 4OFQA 3L3OC 4E9SA 4YAQB 4NKOA 2F74A 5DRZB 2Q0ZX 3LXAA 4GKZA 2NY0B 3BD3A 2GFBA 5FDWA 1MCPL 1O75A 2BWDA 1ET8A 2IDSA 3U36A 3LV3A 4XMUA 4JANB 4AY0A 3BYYA 4J3OG 3CDGA 5DD0L 4J3UA 1DBAH 3DBSA 4ETYA 4OCSH 2Y4SA 1M4KA 4AVKA 2FX8L 5A2KH 1A7NL 3G6JF 1PLCA 1BQHA 3GRWA 3W11C 2WBJA 3E3QE 5JR1H 4Z7WF 2QR0B 3HVNA 2P8PB 3QHZL 1ONQB 4JM2F 3VVVA 2H47C 3AU1B 4NQCD 1YAIA 4XOEA 1HKLH 5JXAL 4YDLC 3K71B 1DBMH 3GIZL 5EBWA 4NO0B 4BFJA 1H5BA 3HS0C 3KPPB 2DTMH 4XHJD 3NSXA 3D25A 5DDHA 4F2MA 1NFDE 1X44A 4OZFG 4Z8FH 4HX1B 5LCVL 3WHXA 4K7PY 1F97A 2GABA 2JB5H 3W56A 5D7LA 2ZPKL 1U36A 4QHUA 3SODB 1EEZB 4ES8A 3AITA 4OZIA 3VVWA 5IVZB 1LTXA 3UTZB 3BUYA 2BIIA 2V9TA 5EIQA 4L4VA 4TOYH 3X1BA 4DKEL 4IGBA 3JV6B 2DF3A 3QEHA 1R19A 3S3SA 1QZ1A 5L6YL 1NANI 1CI5A 1DVXA 5D7JD 1JNNH 3MJ7A 3P02A 1MCFA 4OIFA 3AS2A 4UQ9A 3T2QA 5JHDD 3FUJA 4RISH 4MJ2A 2N1KA 3HG0A 1QA9A 1XH0A 4JKWA 3ES6B 3SDAC 2MNUA 3L3IB 3GMMB 2WC7A 5EEUA 5CGMA 4S1RH 1A6VL 4DP5X 4O58L 1KXQE 4MRBA 1XEDA 4PJHA 1I8MB 4TVPE 3RWIA 2WP3T 1BMWA 2F6AA 3GTNA 3L8QA 1SJEB 3QFJB 4XP6H 4YSCA 3K6OA 2B59B 4ZSOB 3D2UB 1S8DA 2J8UB 4FX5A 4QLRA 2ALWA 1OCZB 1H6UA 2X0UA 4PJDA 4YVUA 2AK4D 5IJVA 3TVMA 2G5RA 4G7VH 1OAUH 2XSKA 4F8OA 2DJSA 3IGLA 3IETB 3ZRFC 2WXFA 4QRPE 5C08B 5SWSD 3RWGA 4K73A 3JWOL 1TUPA 5C0FB 1C08A 4LIQL 4P2QA 5KBMA 4HCIA 5D1ZC 2VYRE 2QL1A 3PGDB 4K3EL 3UTSA 3S3DB 4C56B 3F7VB 2MOVA 4LLWA 4HGWB 4DKFL 3EJYC 3VFGH 2X4PB 4OCRH 1DBKH 3GBMH 3ULVC 4KVCH 3PPSA 3CFIC 4EI5D 3PDOA 1RV6X 4AZ8A 1EHLL 1PLGH 3ARBC 2F53B 3LNFA 4JBSA 3V4VL 3MRCB 1VKXB 2EZ0D 2IDTA 3CK0L 3DXAD 3P69A 4GW4B 1CFNB 3AJ7A 4P46B 2PWEA 4AYID 2F9BT 5KSBE 2BP5M 2WINB 3CZFB 1NFKA 1CFTB 2WLZA 2VLKA 5L4FA 4WRLA 2H1PL 2LLGA 3SO5A 1JXFA 2BNUA 5JDSA 4APXA 3GXMA 1M7XA 1OOAA 4KKBD 2QPUA 4JFFD 1OE2A 3OG4B 5F72S 2M8XA 1R24A 2VMDA 5EIIA 3FTUA 5G55A 4XBPA 3K3QA 2BNRB 3MJGX 1T7ZA 3TIEB 3E9UA 2GYSA 2NUPA 4ORZC 2EE3A 1L7IH 2Z0UA 3UAAA 2E9JA 4GFTB 4U1NA 2HZHA 4IRJA 2X9ZA 4MJ5B 1AI1L 5JDJA 3VQ2C 1G0DA 2VLJB 4XNYH 1GJIA 5AW2B 1AQKH 2DQDL 2F5BL 5DF0A 5I2IA 1PVHA 1OL0A 1Z0NA 4HOXA 4ZOEA 3RNKB 3DMMD 1ADQA 2JJTC 3KS0H 1WDAA 3RAJL 4YSSA 2V9UA 1FCGA 2F8IA 5TDNB 5HVGB 2Y7MA 3WLWD 1KN2H 1VESA 5D4QA 2R0KH 1UWEL 5BS0E 4HU8A 3B34A 3WEOA 1OEZW 1H3PH 2MCG1 4X4KA 3CFKA 5KVFL 3GB7A 3T0EA 1AO7E 1UXWB 3CFCH 1CFSB 3QA3B 4PRHB 2HFFB 1NLBH 1TQUA 2IBZX 2VDNL 4HBCH 3IJ9A 4NM8L 1NKRA 1RP8A 3PPEA 3N1QC 2EDRA 5GGTA 1WD8A 2AJSL 2DQIL 2W91A 1PD0A 3E3QC 3RX7A 1E67A 2WGNB 1YNLH 2PTTB 2E27H 1QUPA 2OMUA 4JPWL 1BAFH 3KLKA 1SZNA 1IM9D 1DQDL 3BT2H 4IDJH 5EWIL 3ML9A 3BKMH 3FSOA 3C60A 3V8CA 4M1GH 5GS1B 4JM2D 4TRPL 1HI6B 4X4XA 4YH6A 3VWKD 5F88A 3DOHA 2YAEA 3I75B 3NZSA 2HJKB 4EXPX 2DD8H 3ZKMC 3UJIL 1NCWH 5I1EL 3MCKB 1MF2H 2VR6A 5B39A 2FJGB 4H5SA 4NM4L 3V95A 4AH2A 5KUKA 4NLHA 2DI8A 4ZS6C 1BQLH 1RUPL 4QEGA 3L4ZA 3EBAA 3Q0HA 5DSCB 4PJ8D 5T1LA 5L7XH 1G6RA 3N40F 4W4NA 5DI8A 4G1MA 2NX5A 3ZDXF 2F08A 2W0LA 1OP9A 4PGEB 5BRPA 1FGNL 4WUUB 5EO1B 1D5MA 1DUZB 2FIKB 4HUNB 1KXVC 1XL4A 2FRGP 5CINH 2X2HA 4GLRH 3THMH 2LGNA 3P30H 5GRXG 3QQ4A 3EOTH 5F9OL 4AGMA 3MSPA 4OGYL 2CBPA 1JZ7A 3S34H 5EUOF 2NY6B 1BDYA 1KBWA 4I0PA 3SHSA 5GZOA 2IGFH 2ZJSH 5LN4A 4OBSA 3UH8A 1E4XL 2OMYB 2ENPA 2ALAA 1TR7A 1NSNL 2J7LA 3WKNA 3GJEB 3O11A 4WKZB 1XTMA 3R1GL 1E4HA 4GAYA 4LBEA 5BV7C 1UWXH 4ADIA 4W6YB 1JAEA 4OVUA 4LU5H 1KB5B 4ISVA 2NTFB 3UACA 4LDCA 2C9VA 4BHUA 4QDGA 4DF9A 4KROB 4OZGA 3ZE0B 3QAQA 3FCTB 4N8VB 4TMPA 5AVTB 2BSSB 4LOUD 1FFOB 1XGPB 1MDAA 4WVRA 2OR9L 1JGVL 2Q3AA 2QVIA 3QEQE 1CT8A 1KNOB 1QO3B 2ZUQC 1YEWA 3K2MC 4FQXC 4FHKA 4GMSH 4IOFC 2EICA 2W81C 4M5YH 3B1TA 1L9OA 2HN7B 4TQ8A 2Q6WA 1BAGA 1JGEB 1LP9E 3B2VL 1LO3L 4RZKA 5HHOD 2XFXA 5F6IB 1BJMA 4FFZA 4ESKA 2HTLC 1Y1DA 1Q90A 1LILA 3O2VH 1NM9A 3AU0A 4JFTA 3LS5L 4N2EA 4TM9A 5DWUH 5FO7A 2IANE 4X5RA 3BCFA 4BBWA 2B0SH 4W6XB 2NY3B 5HI3C 2NNCA 5F3BB 1X9UA 4WHYH 1KXTA 3N44B 4JKNA 1OPGH 1TFPA 4N24A 4GSQA 4X7TB 4CAGA 4EUPG 2BIMA 1HHHB 1HJCA 1LDPL 2OFQA 3QVAA 4X7FC 2EH7L 1F4HA 1LD9B 4MWFA 4NUJA 3T6ZA 5IEKB 2HFGH 3CFDB 3L3GA 4W9IC 4KXAA 1CE1H 1BQSA 5DEZA 4R96A 1YEGH 4ZS7H 2OV0A 3CMOH 3NRPA 3QCVL 4RMSA 5FOJA 3EDFA 2K9FB 3J07A 3TBTA 3CLEH 1HE7A 3CWGA 5FYJL 5D1QE 2J6WA 4AJYV 3CH1A 4X4ME 1JF1B 5JO5A 1JHTB 3OQRA 4V2CB 5LNGA 1FNGB 2F54A 3HFML 2Y69B 3NN8A 4YK4B 4ZUTB 2ZKYA 1S7SB 3I50H 4NZDA 4HWBL 1E5ZA 4A6YL 3LEYL 1C5CL 4DIXA 3DGCR 4AG4H 5L4IA 2H9GB 4LEXH 35C8L 1CQYA 2LE9A 3QJTB 3KWTA 1MFEH 2XVGA 3W0WD 3WS3A 2FGZA 2JK5B 4ZO8A 1A4KA 1MHPL 4FNLL 1RIHH 3S5LA 2YXWA 3ARFD 3MV7A 1RPUA 1AD0A 3U7WH 1N6QH 1DVFC 5C92A 4YHLH 2CRYA 1BXVA 5JMRA 5IUSA 3MDJA 1D9KD 3G5YA 3C08L 4PB0H 2QVFB 3PL6A 4Y5VC 4AWJC 3EOBA 1ZLDA 3OWRA 4BH7B 4LCCA 1PJWA 3TT3L 1YEJL 4HJ0C 5CEXB 2EYRB 1ZTXH 5IB5B 2VXUH 1P5VA 4ELMA 4FYSA 2YK1H 2F8XC 2XOTA 2BCKB 3B4NA 2XT1B 4ZPTA 5IWLA 4KPHL 4A39A 1A7QH 3GSXA 4L1BA 1G7MA 4KRPB 3MLWL 5FLVA 3SE4A 1UXLA 1TFHA 2CGRL 4PG2C 4DPRA 1ZDSA 1AQMA 1LQBC 4JG0L 4WEUD 4PV1C 1QHQA 4B27A 1YNKL 5FO2A 3ZMNA 2H41A 3BQUB 3L95B 1VZIA 3UAFA 1WFUA 4DGUA 3ZKND 2H32H 5ANMA 4XNUL 1EDQA 3UDWC 2EILB 5HDLA 4G5ZH 4KI1A 2XTJB 1FDLL 2ZCKH 4KZEL 4F33B 3IMTA 3HHRB 2E7HA 2I24N 2VISB 5K1VA 1E8YA 2ADFL 3IPFA 1K2DA 1YDPA 3LNIA 1QLFA 2XA8L 1HFUA 5HGGS 3FBQA 2LVEA 4UB0H 1CDYA 4KHTH 3HNSH 3WXVL 3OLIA 4M6NL 3ARDB 2ID5A 2H3NA 1IE5A 1B3IA 2YQ3A 2CWRA 4R83A 1NPNA 4Z23A 1R4XA 4JPVH 3LRMA 2WWOA 3MGOB 1KPUA 1NCUA 4APQA 1YQ2A 4JVWA 4N2OA 5DU7A 1DSYA 2W9DH 4N9GB 1S7WA 1IAKB 4FG4A 1H19A 2N0KA 4PIBA 3LB6D 1VB9A 2VDKH 4G43B 1R5VB 4PJBB 3TNMA 2HRLA 2VC2B 2F5AH 2E3VA 2JLPA 3TJHD 2LTQB 3H2WA 1T4WA 4FQJL 3ILDA 4BWWA 1F1GA 3OKLA 4Y2OA 5LDUA 5LJYH 2VABB 5I66A 1KPRB 1VZGA 5GGVH 3CCHA 2FK9A 3P54A 4HQQH 3G08A 5IVXA 1CBJA 1F4WH 3MACH 2UVEA 1URZA 4WJ5A 2HMIC 2G0KA 1IT9H 1VZHA 1PGRB 1A14H 1A6ZB 2GI0A 5CZVH 2X6VA 2YGPA 5KBDA 1AGFB 2H7WA 2HKFH 4YL9A 1YMMA 1CLVA 2BFVH 1F11B 3UJTH 1FNSL 1P7QA 3STBA 2GJZB 3T3PB 3SBWA 3TBWA 3VMNA 4DZ8B 3UPCA 1QABA 1VPOH 4H1LA 4ANKA 1DUYA 3BUIA 4IKIA 4RBPK 3H8NA 1FYTA 1IBBA 3UBXA 5D1QC 4FG6C 1OAQL 1HK6A 2C9QA 5A7BA 1XMEB 3QUZC 2MSPA 1N5YH 4YSQA 2E74C 2XQYA 2FBJH 2OMVB 1WS8A 4RVBA 2OAAA 3NQIA 2WAHA 4BFRA 1I3RA 3T08A 2XZCL 3U2SA 3FC8A 4QHKI 4PJ5E 4YVNA 4ZUVA 5D6DC 3KWUA 5I1IH 2R69L 3TF7C 2MHAA 4YE4H 3RX8A 2HPOA 2GSGB 1RUKL 2YKKA 1HHGA 1WBXA 3IRCA 4XNXH 2D9CA 4GO6B 5GGUA 2XWDA 5EOCH 4NLAA 1INEH 1AXIB 3F7LA 4I0CC 4JDEB 2DN7A 2ZXBA 1FN4A 3VW3H 1JPFB 1P1ZA 2X4RB 2X4UA 3MRGA 1TQBB 3SDCB 2R59A 1CICB 2V2XA 3DHMA 4XN8A 4N87A 5HHXH 3BDYH 2R2EB 3WFHA 4KMLB 4KGJA 3AAZB 5D71L 5EORL 1F2XK 3BJ91 5D72H 4A2GA 4FFWC 2EUXA 2BSDA 4DVRH 4JRXB 4P5TD 3LNEA 4XNZB 1D5BB 1Q9WA 2NXYB 4PTUA 5FUOH 4G9DA 3OLDA 3I6LE 4G7YL 3KPNB 4G6JL 2B1HH 3TCXA 4LVEA 1KGJA 5I0VA 2DMCA 3RGBA 4PMEA 3DX7B 5FF6B 4UIKH 1V7NH 2X6BA 3HTLX 3L7EA 4OZFA 1B0WA 5HHME 4EIUA 3KPRE 2R1YA 3D08A 3S96A 5I1CL 2D0GA 1GY2A 3ALPA 2D7PA 3STZA 3AXLA 5KVMC 5KYUB 5FYLH 3HZVB 5DD5H 4AYSA 1JZ5A 2E9IA 1GYCA 4KMTL 1X5LA 4ORGA 3L16A 3EXJA 2AGJH 2VQTA 5KVEH 3Q06A 5D8JL 3FO0H 3VH8B 5EUKB 2RQEA 4NYLA 4YSDA 3ZGIA 1AACA 2RAMA 3ATFA 4JFDE 4WWID 5EDSA 4QTHA 2X6AA 4G8EB 2F18A 4Y4HA 2QPDB 5I76B 5J12B 2OL3A 2AVFA 4X0KA 5F9AC 2WLHA 2WZ0A 2BJMH 3V0FA 4AUUA 1TTUA 1UH2A 2R0ZH 2MFNA 1WWWX 1FZOA 1J9SA 2NYZA 4MDIB 2UY6A 5I18L 2YRPA 1NCDH 4ANXA 3LMJH 5E5MA 4UM9D 1KY6A 1TJXA 1WZKA 1DL7H 1DSFL 2LV4A 3EXLA 2H0JA 3X13B 1YHPA 3CSYB 4WGWB 1FORL 3CD4A 1LNUB 2O6PA 3IU3A 4PRPA 1XVSA 3VD7A 4HPOH 2ENYA 4QXWA 3DX0A 3GEWB 3ECQA 2WZPD 4ODXA 4NKIL 4R2GC 5HGHB 3CUPB 3VXSA 5DUPL 3V6BR 1Q94A 2P7TB 1SDDA 3P4OA 3PWNA 4DGYL 2PYEA 2AQ3A 2UUDH 4NQEA 3P77A 3DX2A 2UWEA 5I6XB 5MENE 1F5WA 1SJMA 4D0BB 3W2DL 1Z5LB 2OSWA 1J1XH 4KNSA 4JZJA 4NS0A 3CN0A 2YBRB 3KWXA 3GZOA 2FHBA 5IF0A 3ZE2B 1B0RA 2ADIA 1CR9H 1WZLA 4N2AA 4UDUB 4YGVA 3BW9A 5GS2D 2Y5EA 5CN3A 4YWGL 2B2XH 3L2MA 2YD1A 4J3TA 1YY8A 3L1OH 5TQ0H 3NH7L 3VD3A 2CHZA 3NFNA 3C9NB 3S3CB 4A2HA 1LO4L 3PQYE 4XVUD 2OKMA 3R8BB 1OSPH 4FRWA 5C0EA 4O2EB 3FMGL 4I9WD 3L3HA 43CAA 4LRIC 2N3JA 4NUGL 3BEVA 3I9IA 1GJUA 3CVBA 3PJNA 4ZRGA 5E2VL 5E8DL 2NZ1A 1ZTXE 1PY4A 4RA3A 3QZOA 3V4PA 3FT1A 3IGKA 5E6IC 2KI6A 2FEDD 5KVEL 4U1IB 4NPJA 1QI5A 3AMLA 3MR9A 5D1XE 1KIPB 1H15B 3QC6X 1THAA 4IGBD 1RJZB 4TNGA 1CUOA 3WGVB 2YGVA 4XNQB 1BBJB 1AZBA 2W59A 4CMMA 1MEXL 2JSFA 4AL8C 4HVBA 5K69A 2ATPA 4N6RB 1T80A 2OI9B 5HHPB 3RG1C 4YHOH 1JVLA 2XWEA 1TJGH 4ZMOA 5L2KA 3ESOA 4LSQH 5IFJA 1NIEA 2R23B 2YOCA 3DHPA 4HJJH 4X6FA 3II3A 1VEMA 3VXPA 5IQ7H 2GY5A 3UO1L 3Q1SL 3TF4A 1KJVA 4HUUB 4RGMC 3F7QA 3MVSA 3HHSA 1KJMB 5TH2A 1BVKB 3TN0A 1F3RB 5FM4A 1FE8L 3FFCB 5IIEA 1F42A 3GJFH 1INQB 1K5NB 3I3BA 3PNRB 2O30A 2BIQA 5HGDA 3WKQA 5L2JB 43C9B 4GP5B 3VCLA 5B3JF 5T1DL 4DESA 4E0RA 3UTSD 3QJSB 1S9VB 3P9LA 1EZUA 4JFQA 2EXSA 1ED3A 3WUWG 4L3FA 3HMWL 2QLVB 2VDRH 2C5DC 1UZ6F 1SEBB 5HI5D 5E70A 4OQTA 2FJFB 2YOAA 4HXAH 3NFSH 3T8XB 4E2OA 4LPUA 5GJTH 1VHPA 3P73A 4GKOA 2BFGA 3HBGA 2VLKD 1WD9A 1DCEA 4XRCB 2HVKB 3D2TA 1XIWA 3LZRA 4W81A 3M1BA 3IDMB 2X1XR 2YWYA 3S3PA 3AWGA 4K9EL 1OGTB 3GSVB 4OJFL 2VN3A 4N8VG 4AMXA 1JPSH 3FZUC 5IBTH 2DOCA 1U8NB 5E7FA 1QFWI 1A1NA 3CHPA 4LGPB 4MNQE 4QXUL 4FE9A 1JBJA 4IRJD 4X8GA 1TJHH 1K9TA 1AYRA 4KOCA 3O6KH 4PYHA 3QAZB 2CBQA 3QJOA 3FULA 4GQQA 2HLAA 2ZE0A 4HIXL 4WU5A 1J18A 1S2EA 4HKBB 4XX1E 4JGMA 1NC4A 3JTTA 4R4BA 1UWGL 2I60H 1AKJB 2BC4B 4WNJA 2RJMA 5HYJB 4MS6A 3QS3A 4LCUA 5I17A 2MOQA 2XTLA 3HC2A 4R9HA 4Z7AA 5A2LH 3K2IA 4LEOB 4X50A 5IHBA 4MYPA 5E4EC 1GAFL 4V1DA 4ZZKA 4OT1L 3KXFE 2D4DA 4HKJB 5C2UB 1FSKB 4LARH 5JORB 1U93B 2IALA 2YD7A 4E42B 1I9EA 1KC5H 1E4WH 2X44D 4J3VA 5D2LF 4UT6A 5D7SH 1IUZA 3HMXH 1G5AA 1TU2A 1KIQB 1Q0XH 4G8IB 5DD6A 2Z92A 4O51B 4UUJB 3IVKB 1CXKA 1MN4A 2BSEA 15C8H 2CUAA 4JFEE 2WZ5A 3CPLA 4WY7H 4RAUA 5F96L 4PD4J 1XAUA 4WW1A 4PWKA 4DK5A 2X4OA 2XC8A 1E3XA 4W9HC 3C60D 4G7QB 4GRMA 4P4RB 4M4RB 1I8AA 3H9ZA 5D2NA 3ET9F 2AABH 3HG3A 4XBGA 4UANA 1WA0X 4ZMVA 3OKNB 1R3IH 3UYRH 4P06A 5I8CB 3GIVB 5IOPB 2APWA 2QSQA 3U0PB 1I53A 2V2WA 2Q2LA 4JFOA 3ARQA 1SYSA 4U2YA 5C0GA 3NFPA 5D1XC 3VRIB 4XPTL 1R75A 1UD6A 2B8OT 2F19L 3QQ9D 3WJLC 1HCFX 1WUZA 4AITA 2ZX7A 4DO4A 1EAQA 1X7SA 3IDJB 3PV6A 4EUPA 4F58L 3T2NL 5T1LD 4O2FA 3HJEA 4RSVA 3OJVC 1N0XL 4XX5A 1DANU 4XE0A 4XP4L 1XXFC 4PJ7A 2XWBA 4IMLA 1NMAL 3BZDA 4WI6A 5B1KA 5IMOA 3SCMD 1KCSL 5AZ2L 4QYOA 2A74A 4XN7A 1YNTB 3Q2NA 2VM9A 5DS8B 3BPLC 3OV6A 5FWRA 3RX9A 3FUEA 2GIMA 3N9GL 2WLMA 3FTXA 4MD5B 3QS2A 1MG3C 5KVEE 1X7TA 1B4LA 5BRZB 4U4IA 1WA1X 1D3CA 1ZCRA 2FD6L 4Z78B 1YMHA 3KYNA 1XDTT 4I0PD 3RBSA 5GZOD 2DLIA 2ARJB 3VMPA 5GS0H 4I18C 2KLRA 4FQIH 2V5MA 3JVGC 1SQ2N 4H25A 4UZSA 5DHVA 1VENA 5BZWA 3APCA 3B2UD 2B39A 1NGPL 3QIBA 1U8MB 1YZZA 5FKAB 5JPNA 1KEGL 2YKLL 1XGYH 3CSFA 3OSVA 3JZYA 2TRHA 4P59H 5FECB 1EDYA 4KKCC 2WP3O 2YFOA 1S7RB 3A21A 3N85L 5DEFB 5F1NA 2A7BA 4Z3IA 5ADPL 4OV5B 1G43A 4NOBA 3P0YH 1Z66A 5GRJL 5IR1B 3PGFL 3EBHA 3BH4A 3K8MA 4LESA 2QFRA 1RZJL 3LPGA 4ANVA 1BA9A 2P5EE 1BIHA 5K59E 1QP1A 3QCUH 2Y3AA 3FB8A 4OCWH 4R7VA 2XRAH 5IM7A 2O5ZH 5FYLD 4URKA 4HMCA 1MI5A 1HYSD 2FZ3A 3NCXA 2P8LB 3O2DA 5LO7A 1LK3L 3CFNA 3QDJB 5D7IA 5GGRB 1T3FB 4G8AC 3VXRB 4TULL 1MFAL 5D7HA 4OGAD 3ATEA 5JA8B 5M7QA 3NMEA 2Y3NA 3LVTA 5K9JL 2JIXB 3MRKA 4KKAD 1H8LA 2BVPB 1PJ9A 5JUEH 4YX2L 3IMUA 1LJMA 5AKRA 2J2ZB 2X3BA 1WHPA 4KY2A 3VFSB 1ZA3A 3D18B 2OXHA 4ZMPA 4PBDA 4LSTH 5I8KH 1I9JH 4KTDH 4WNQB 4OF5A 3TEXA 2AQNA 1DQQA 2Q20A 1OTTD 1NOAA 3CVHL 1WCQA 2FUQA 2Z4TA 3NJNA 1B2YA 5E94B 4JQIH 5H35A 4B9ZA 1RZ7H 4WW2A 4K94L 3T0DA 2Z31D 3MUUA 4CN1A 1FVDA 5HHVH 2VLRA 4UMSA 1B2WH 4L8DB 1NTDA 3QR0A 4DHLA 5ICZA 4RFEA 4QTIL 4Z7OB 3WKMH 5CMAA 4Q52A 3U0TA 3QG7H 1RZGB 1PEWA 4NKDA 4XCYB 5E9DA 3LQZA 4BK8A 1S9WA 1BD2A 1EEUA 1HU8A 1SOXA 2C7UA 2YEZA 3NRQA 4N1EA 6CGTA 3PWPE 2XPZA 1QQDA 2D0HA 2G3MA 1DQMH 4KVNL 4H26B 4N0CC 1V3JA 1IQDA 1WC7B 2Y24A 3CVCA 4GLRI 5EA0L 4NBZB 4MMXB 1GOHA 2N59A 2IVFC 1A7OL 2TSBA 2WIMA 3MJ6A 5TE6L 4IRSA 3D69A 5FW7A 4HMEA 2Z3FA 3MRDA 1E8WA 2OSLB 1V7MH 1TZOA 4QF1A 1E27A 4J3OF 5ERWB 4ZAKB 3VFNB 3E8VA 3T6QC 2NXZC 3KNBA 1R0AH 1WT5A 3HG1D 5CJBA 2BW4A 3LEVH 5CBAB 1IGFL 1CK0L 1IARB 2OMBA 3E6FA 3LQAH 5C0AE 4YLCA 3AMKA 4H4NA 5DC2A 1CL7H 5AAWC 3DJZA 4OIBA 2W80C 5SWZD 2H45A 5IHHA 1F6AB 4YAQA 2ZXWB 5CEZE 4HUXB 1RHHB 5DRZA 4PSRA 1M71B 4P2RB 1PZUB 5FR3A 1NUDA 4JANA 2F1AA 2VSKB 3K1DA 4H13C 5B4MD 3O6LL 3FCBA 5CIPB 3LDBB 5EC1A 3MRLB 2V5YA 1JYWA 5CHNB 5DC4B 5DD0H 3GI9L 2JKXA 3MLSL 4RDQF 4HCGA 2DIJA 4UTCA 2QR0A 1A7NH 3LKPB 2P8PA 2X9WA 3NIDF 1ONQA 2EVJA 1BIIB 2VXSL 1HCYA 3AU1A 3HE6B 3OF6A 4Z6AT 5JYLA 1U3HD 3A4FA 4KY1L 3K71A 4AE1A 5T3ZD 1U3JA 3PAZA 4HISA 2EXWC 3KPPA 1N12A 3WE6B 3MNDA 3K4DA 1WFNA 4DKAA 4I3SL 1TMQA 3IS1X 3GIZH 2Y0SA 1MJ7L 2EC9T 4HX1A 4KQ3L 3WFDL 2C3WA 4M8RA 3SKMB 3ZY7A 2IQ9L 3GUTB 3KE0A 4Q0XL 4X9BA 4DFIA 1N68A 3WCYA 2FNBA 4G6ML 5LCVH 1MIML 3LY6A 1QFHA 4BZ2H 1KBGH 4E9TA 1EEZA 1LYQA 1NCGA 2W65B 1L0YA 5IVZA 3IAPA 4HAFA 2ZPKH 4I5BB 3WJJC 3UTZA 3V6FB 3ZOAA 3VH8G 1MFMA 2ZZUT 3MLYH 4PCYA 1ZEAL 3JV6A 3KLSA 4U1GB 2GC7C 3MAWA 1AQDB 2VJ8A 4GI6A 4B3EA 4YSAA 1E30A 1MAJA 2K6ZA 4Y1AE 4Y19E 2NW3A 3TCTA 1JYXA 4NZFA 5FOBB 1J8HB 3GD1C 3TM6A 1SDYA 2FUTA 2H0PA 4ZUSB 3DBXB 1OWWA 3MNWB 2VOTA 3KVPA 1N3NB 3ES6A 4FLSA 3L3IA 1QSFE 3GMMA 4FHBD 1F6LL 4AMWA 4HULB 3IDNB 1I8MA 5I6KA 3LZLA 3L4YA 7CGTA 4M7JL 2NR6C 1A6VH 1SJEA 4O58H 1MCNA 2B59A 4ZSOA 3D2UA 2J8UA 1WAAE 3K4ZA 3P0VL 4NCC1 4R97B 2MCPL 5JW4N 3SY0B 1I1AB 2J1XA 3IETA 3TO4C 1G7LA 2MPVA 4BRJA 5C08A 2FGWL 3I3EA 1P6FA 5C0FA 5AVQB 1UM5L 1IC5L 2OLDA 5HDOA 1P7QD 5DRWB 1U92B 2HT3D 4C56A 4MD0B 3S5ZA 3F7VA 4KUCF 3HPLB 3JWOH 3MV9B 4HGWA 2GHZA 4LIQH 2X4PA 1JFQL 2Z91A 4KDVA 1FYTD 4DKFH 3EGDA 3L54A 2E56A 4FXGC 5CKAA 2F53A 3ECWA 3MRCA 3OR6B 1VKXA 1RK0B 2CDGB 5F1IB 1KGUA 1S7TB 4YXHL 4GW4A 4PCSA 1CFNA 4P46A 3SDYL 4Z7VB 3V4VH 4W70A 4R4NC 1NDGB 2WINA 3CZFA 1CFTA 2AXWA 1HDMB 3CK0H 4QKTA 4Q7DA 4JFXB 4ODXB 1IIIA 2NY4B 1GS7A 1TQSA 5KVGH 5LNEA 2H1PH 1W72L 3ZDYF 4OIIL 1T89C 3C6LD 1FFQA 3DIDA 3RVWD 1ZT1A 2BNRA 3KBEA 3TIEA 4YDVB 3MV01 4YR6B 2RFXB 4KRNA 2CAKA 2E9GA 4MCZB 4MJ5A 3S3BB 2ZWKA 2G3XA 3GXUB 3EJRA 4MAYC 2ZIDA 3PY9A 2VLJA 3H9SB 4J3OD 4H8WH 5HDBB 4ECNA 4ALAL 2IC2A 3NK3A 3BZ4B 2NOYA 5IMMB 2VDQB 1AI1H 4GRLC 3RNKA 5TF1L 2X2IA 3B7UX 1OALA 3PNWB 3VFWB 3U0WL 2DQDH 1USQA 2F5BH 5TDNA 1Q1JL 1NH6A 3TGXA 2JQAA 1F58L 2CDFB 2V3DA 1HQ4B 1P84J 1UXWA 3QA3A 1CFSA 1MSPA 5ICXB 1UWEH 2HFFA 4PRHA 4QGTA 4AVHA 5KVFH 1YPZE 4HS6B 4O5LL 1OB1A 2IAMD 3MRFB 3HVDA 4DQAA 2VDNH 1QRNE 2YPLD 2VAJA 4JG1L 4NM8H 2YAPA 2XX0A 5FW8A 1A8JH 2PTTA 3CNKA 2DQIH 3QB7C 2I85A 2WHVA 3TEUA 4YHKL 2YC1A 1IZKA 5CJXC 1CG9B 4UDTB 2ESVD 1NGZB 4H8UA 3RZCC 4EOWH 5E6SB 5J57B 1DQDH 5EWIH 2K78A 1B4JL 5GS1A 2EE2A 4AUYA 1HI6A 2HFTA 4A04A 4XI5C 3SD5A 3I75A 3BUDA 1ITBB 2ZTBA 3VWJC 1ZANH 5KAQF 3EJCA 3FUIA 3OXSB 4GJTB 2C7FA 1WGOA 4NWTL 2WVUA 3MCKA 2R29L 1Z9SB 2DI7A 2WUCL 1BZEA 2FJGA 3UJIH 2ROXA 2E7LC 4P2YA 1I1YB 5I1EH 1DLFH 2XPGB 1BCIA 5JXEA 5DJXB 2C3HA 4QRUB 4PRIE 5IBUG 4NM4H 5DSCA 4FEIA 4PY7B 3U9WA 3QO0B 2DQTL 1JGUL 1RUPH 3VFTB 2NCEA 1A9EB 1U3YA 4FQ1L 4PRPD 1AR1C 1XMWA 4XN1A 5JW4M 5IJDC 1D6VL 1E9PB 3LH2L 2GCYB 5DLML 4HH8A 3D48R 4PGEA 1T0MB 4WUUA 3WTSA 5EO1A 4N2HA 1R46A 1DUZA 1TYRA 2AJVL 2FIKA 3VXSD 1UADC 1E2ZA 1T0OA 2R69A 1FGNH 1FG2B 2KYIA 1O5PA 3IDYB 2HSIA 3CZUB 3H9HB 3BVVA 3D5OF 3FBKA 3IGAB 1O9VA 1PMYA 3KDPB 2G9HB 5F9OH 5K93A 2OMYA 4OGYH 4WEBL 4I4WB 5E99L 2H6PB 3GJEA 4PJIB 4IMKC 4WFGD 1E4XH 2ICEC 5D5MF 3QFGA 2C3GA 2DYPB 1NSNH 4GG6F 1JTTA 2BK8A 1WJ3A 4PWIA 1OP3K 3ZTEA 3M1OA 2H0EA 1XF1A 1RCYA 2CCWA 4LPYA 5KVDE 1KB5A 5F8QC 2HLFC 3L4UA 2FX9H 4AV4A 2WLIB 1XBRA 4L8CB 3EJPA 3QUYC 1L9RA 4QHMB 4BXSV 3K80A 4KUCD 2GW5A 4NZUL 3FCTA 3KYAA 4N8VA 1TTGA 2BSSA 1FFOA 4YIQB 1S7QB 4GW1B 4YS4A 3ILQD 2ZXCA 4TN9A 1QO3A 2WNWA 5DJYA 3GK8L 5I1GH 1BFVH 1XF4B 1AMXA 3ABLB 2OR9H 1D2OA 1JGVH 1KB3A 1Q38A 2HN7A 5F89B 1JGEA 3EW3B 1KUMA 2NY1B 2VAAB 3UYOD 5E56A 5ISZB 2QTEA 3BPNB 4CSZA 3MBEC 4NFBA 3B2VH 1F0LA 1LO3H 3TA4D 5JPMC 1AD9B 1OW0C 4XGZB 5BOPA 5AB0A 4K7FB 5KANG 4MJIE 3SZKC 2V17L 1VACB 5GS0C 3AUWB 3W82A 3LS5H 1PBYA 1NDTA 2AMGA 1L0XA 3FUFA 3ZZLA 2QSTA 2X2JA 5F3BA 5FPIA 1A25A 1H0DB 4AMKL 3MNVB 3O6FA 5ID0B 1DTUA 1S9XB 5DLLA 2OR7A 4WTZG 5C1MB 1T7XA 3PHSA 4Y4KC 1TVBB 2BNQE 2QQQA 1EO8L 1LD9A 1MXDA 1VADB 1MJJB 3AGVA 5DMJB 2HAZA 1LDPH 1T1WB 3CFDA 4JFHD 4MJHA 4QHNB 4QOKE 3QIUB 2EH7H 4TPRL 4NGHH 3O8XC 2E59A 1B9KA 4RNRB 3VSUA 3ESUF 4FLOA 3CDYA 3GXPA 3AFLA 4DP1X 4HIIB 5I15L 1X5IA 1WFJA 4FQHB 3TCLB 4OCMC 1RZIA 3QCVH 4YDLB 1LDSA 4X4YB 1AVAA 1YUKB 5FYJH 1WHOA 4GPVA 1JHTA 2XV2A 3ENEA 2XWRA 1FNGA 3CHXA 5LGJB 1NMBL 4KAQH 4ZUTA 3G9AB 1S7SA 2DWTA 3ISRA 3LIZL 3HFMH 2A6JB 5DK2B 4HIEA 1BECA 4MCYB 2HB0A 5J13C 3G6DL 4ATWA 2H9GA 4XMWA 2EACA 4HWBH 4OFVA 4A6YH 1C5CH 2I25N 2N7AA 4ODWB 2QGCA 3ULAB 3HCVB 3FU3A 2NUTB 4MMZC 3QJUB 1TMCB 1MHPH 4FNLH 4DN4L 1E5BA 4UT7L 2DTSA 4I2XA 3GINA 2JCWA 3NIGE 1BM3H 2VQ1B 3HUJB 4Y5XC 3EJZD 3NCYS 5E4OA 3CQPA 2I27N 2ZAGA 4B9IA 4BH7A 2P28B 4ZD3L 3C08H 3N1PC 1QSZA 3GI8L 2EYRA 2XXFA 1UWFA 4QHKJ 4XBEL 2JKTM 5C09E 4BZ1L 1L3WA 1NMCC 2HYMA 3IXTA 5IB5A 5B1CA 1XF3B 1YEJH 4M1CC 1JG9A 4GW5B 1N6VA 1NC4D 5CN2A 2BCKA 4X6DF 5DT1L 5LNDA 3HB3C 3QFDB 3D85D 1UZGA 4UQEA 4Z1PA 5FK9B 3CPUA 2Q2EB 3QXDB 3O9WA 1RUAL 4KKLC 2QELA