3VGAB

Crystal structure of human adenosine a2a receptor with an allosteric inverse-agonist antibody at 3.1 a resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
212
structure length
212
Chain Sequence
DIVMTQSPASLSASVGDTVTITCRASEFIYSSLTWYQQKQGGSPQLLVYAATNLADAVPSRFSGSGSGTQFSLKINRLQPEDFGTYYCQHFYGSTWAFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Adenosine receptor A2a
publication title G-protein-coupled receptor inactivation by an allosteric inverse-agonist antibody
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2011-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vgaB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vgaB01
2XPGB 3KPPB 4WI2A 3MJ6A 5DUBA 1RY7B 4GAGH 2FX8H 5K9OA 1JNNL 4XNZC 3KPOB 2R8SH 4MAYA 5ISZB 1DBBL 1L0YA 3HAEH 2E8ZA 5JQ6H 4OFYD 1QSFD 4PJIF 2V9RA 2F8XC 1U8JB 3DUHA 5CEZD 4UBDC 2YN5A 4HUKB 4LKCB 4PY8J 5HHOB 1ZT4A 4P5TD 3CD4A 1S7QA 3RI5F 3T04D 4CVWA 3L6FA 5CP3H 4HHAB 1IM9A 4JQXC 1KEML 1Z3GH 3L3GB 1LEGA 1KUMA 2IADA 1A5FL 3D3VD 2O5YH 3AY4C 5IT2H 1MRDL 2J7LA 1NKOA 1TZIB 1FNSH 5LGJA 4UOW0 3UTTE 2IPUG 5JNYA 4TRPL 2JJSA 2DBLH 3GSRB 1GZQB 2VAAA 3EW3B 3C08L 1I3VA 1FLRH 3P73A 1ACYL 3HB3C 4JFEE 5D7IF 2NY7H 3PWNB 3N0PB 1RU9L 1RJLB 1PEZA 2BVPA 2P1YA 5E24E 4ZODA 4HK0B 4XVUC 4FFYH 3AU1B 4YC2B 3SPVB 4Z7NE 4HV8A 5HVWA 3MJ9A 4GRLA 5EOCJ 4NQED 5C0GA 4RFEB 4HC1L 3HI5L 1N0XL 3O4LB 3WFBH 1Q38A 3C5ZD 1YMHA 4K7PX 4N0FB 1QLEH 1I7UA 1OAXL 1MRCH 1R5IB 1QBLL 1SJHA 1NSNH 2NX5D 2F15A 3JWNC 4J4PD 2GK0A 4RDQF 1B6UA 4HXAL 5H94B 4MDIA 1LP9E 1XGPB 3EO9H 3QP3A 5EOCL 4OFIA 1DBAL 1UXSA 4Z77A 1T7WA 2P42B 2F9BT 1BD2A 1RHFA 1IRAY 4ELKA 3ECBB 5SWSB 3DMMC 4DN4L 3DUSB 1FNFA 1XZ0B 3PQYD 1RVFH 2EH7H 3RDTB 4GAJL 5IVZA 4GAYA 1D9KD 4RBPK 3H9HA 4HV8B 1NLBH 3SDCD 4PB0L 1XGTB 2VL5A 4W70A 1MLBB 32C2A 4UDTB 4QHKJ 2CLRA 4V2BA 1YNTB 4ZOAA 4L3EE 5IB4A 2J12B 3EOBA 4QXUL 2F74B 5JW4Q 4I5BA 3W9DB 1JCKA 5FCUL 1S7TB 4DUXA 5K9QG 4XNYL 3S9DB 4KXZI 5IB1A 4WFHE 3RL2A 4ETQA 1BVZA 1QEWA 1LK2A 2Q76A 2JF1A 2XQYG 4EI5B 1UKTA 3O41B 2DDQH 5J9PB 3ES6B 4WI9A 1XF5B 3G5YB 1MH5A 2QQLL 4CNIB 4KKBD 2AERT 1BP3B 4QYOA 5I76A 3KLDA 5AUMB 2D7PA 5CEYA 3TGXA 4WUUA 4ONFH 4ODVH 4QEGA 4WW2C 3ZMRA 1FH5L 3OPZH 3P4NB 2ZSWB 1M7DA 4AENB 3ULUC 5FXCH 4ZPTB 4UILH 2F53D 4HKBA 4JZOA 4F15B 3BKMH 4WTZA 3I3EA 4UT7L 2WSKA 1UM4L 1YJDC 5JIIA 5HI4D 1RIUH 4WIQA 2A0LC 3RWCB 2XWTB 4ODTH 3PHQA 2BCKB 2D3VA 4S1QL 4Z7WE 2ZUTA 2W59A 1NBVL 4QCIA 2LV4A 4OKVB 1ND0A 4JO1H 5GS0D 4AL8H 4U7MA 2QADD 4MA3A 5J1AA 1T21A 2CKBH 3RX8A 2VLKB 2JJTC 5T5NF 4LFHD 3RKPA 1WEJL 2I60L 2A83A 2FYYB 5IP4A 3UDWA 2YD1A 2H9GB 1H9VA 5GGRB 2Z35B 3IFOA 1IVLA 3FT2A 3MO1A 5D72L 1ZHNB 1S7VA 2NY1D 5KS9E 2Y06H 4APQA 5CIPH 1OCWH 4NQSB 2VXVH 1G0YR 3VXPA 4HC1A 2R23B 1QD0A 4HKZA 2DJUA 2WK2A 3QHTC 5A2LH 3BH9A 2VRAA 4ZS6D 1H3PH 3GKWH 1QSEB 1EBPA 3ZKXB 1TDQA 4M8VA 3TBTA 3VE0A 2AJXL 3HZMB 1P53A 4D0BB 1ODAA 1QLRA 3DV6B 4XNMB 3UC0L 5J13B 5MENB 1NBYA 1CL7I 2GSIA 1ZA3B 1Z9LA 4OLUH 4UT9H 2R0LL 4NQTA 3CX2A 3AS0A 5HHVL 4X6DA 2CR3A 4LIQE 2XNAA 1OF2A 4LSSH 4BQBA 4L29B 3VFPA 5FM8A 3DI3B 4F80A 5EIIA 5FYLL 1CYGA 4XMPH 3ZDXE 3CLFH 3MLVH 4L4TB 4RZCB 5FEBA 3NCJL 4GBXA 5IBLC 3RNQA 1C5BH 2J2ZA 3NABH 1B9ZA 4HS8L 1X5LA 4F33A 4JDVA 2ARWA 5GSVA 2A6DB 2NTFA 2AAVA 4ZYKA 5L7XL 3OAYK 4KVCL 4GW5A 4I3GA 3OGCA 3QFDB 2HT4D 3RWEA 3C5ZC 3I75A 3MA7A 3L3HB 3BZEB 3FTGB 2F54D 3BYTA 5BV7L 1A2YB 1PX3A 1NFDA 3KPNB 4GSDL 5E9DB 3GMPA 4U1MB 4J3SA 4MXQD 5C0BE 3LN5B 3QO0A 4WTXA 4HCRH 5A2FA 1KYOJ 3AMKA 3IKKA 2FX9H 5F7UA 1FFOB 1BVLB 5DRWA 3CDYA 2D7OA 3DV4A 2ZPKL 5K59E 4M03A 3O3DB 1UWEL 2X4PA 4U1KA 3HR6A 3U7WH 5DWUH 4GBXB 5KANI 3ZHLA 4CDHA 2XZQL 4LKXA 4MSWA 1A3RL 1UZ6F 2N56A 4KKAD 4ERSL 4NGHL 4X4ME 3SDCC 1KB5B 4EUPA 5IFJB 2AJZB 3VXUA 1FVCB 3W81A 4OLEA 5E8OA 3MNVA 3PDDA 1FL6A 4ODUB 1MSPA 3JV5A 2ZCKH 1WISA 2C4XA 3B9AA 1EH9A 1HCVA 1B0WA 5E4IA 2N7AA 2H32B 3QULA 2OMNA 2CRZA 2ERJB 4PJHA 3V4UL 2IANA 3V0AC 3HPJA 4S0SD 2DJ4A 2XA8L 5HGGS 5F97E 1DLHB 2E7LA 3VXQA 1NQBA 4KMLB 1KPUB 1UADC 1I7ZB 1B0GA 3R8QA 3TT1L 2X4PB 4OLVL 1GGBH 3G04B 1MJUL 4QHNB 4YQXL 5JA9A 2DQHL 1HINL 5CD3B 4HJJL 4KKBC 3WUWG 2Q7YA 3G08B 4QWWC 4M8QA 4N68A 3T0BA 1GJIA 3W0WB 3IFPB 4U1LB 4EOWH 5CKAA 4H8WL 2YHGA 1CE1L 1WWBX 4G8GD 3QZWB 4LVHC 4RRPA 4NOBA 2WWKT 3FFCB 5MEPA 5I18L 1GGUA 4YHML 5HI4C 4CJ0A 4ZFGL 3VXME 1QSZA 4GKZB 4LFHG 4JKLA 5E4EC 4ZXBA 3L1OH 3RWJA 2D9QB 1HWGB 4IJ3B 4KMTL 1AE6H 3D0LB 5D7JC 3GUTB 5L2KA 1FZKA 3BGAA 1AR1D 3ZYJA 5GS0C 2QADC 2EDRA 4J3OC 4PJFF 4H20H 1MQKH 4TNWK 4M61A 3DYPA 5BRZE 5KSBE 1K5NA 1CDHA 3MR9B 1E4JA 2X89D 4L8DA 2GJ6E 4O51A 5C07E 3UTSB 5C0FB 2NY1C 5EG6C 2DJSA 1OLZA 2J1KA 2DLEA 1RJYA 1KACB 4F7PB 2NY4D 2YPKA 4JFXB 1N5AB 4Y5YC 4UQ3B 5C9JB 1UWXK 3OX8A 4PTTB 5MP6L 3G6JF 1UH3A 1T4KA 4AH2A 3WFCH 4JFYA 4QRRA 2D0GA 4JGMA 4JN1H 1A14L 5ENWA 5BO1L 1KIQB 3CPLA 1AR2A 3FN9A 5C2UB 5GGTH 3LKSA 4CU7A 4C58B 3EO0B 3FJTA 1MRFL 2EEBA 3FB6A 4FMKA 1OGTA 3MX0A 1TXKA 1UFUA 3QEHA 4O4YH 3QDAA 2FGZA 5D7IA 4LRIC 4NCC1 5D7LB 3TH3T 4QXWA 4JPWL 4JFED 1C8PA 1LE5B 5C0IA 1VADB 3AXLA 4OTXL 1KC5H 1R3IL 4TULL 3P77B 2BSSA 3PWUB 3O11B 4GG6B 4JM2B 4X9BA 4Y88A 3NACL 5ALBL 3ZT7A 2JE8A 5EBGA 5F89A 2HT4C 2FECL 2PTUA 4MJIB 1RZIA 5FYJL 5C0AE 4KY1L 3NFNA 3T0EA 2IPTH 4M5YH 5T3ZD 1IQDA 1Y0LB 4MLSA 5J0BA 4TVPE 2BOCB 4NQDB 3HC0A 4NKDA 2UWEE 2PW1B 5J6GB 4RISL 5GS2H 3QXVA 4QRPB 1A6WH 5HDOA 1R5WA 5CZXD 3FT4A 3KYKL 3B2UD 2PR4L 1KV3A 3D18B 4M4RA 3VXTB 4GKOA 1RZ7H 2FLBT 3ZTNH 2V7NB 4KKAC 1X5GA 5IOPB 1VGEL 2X7LA 1EXUA 1GPOH 5LG1A 3LKQB 1I8KA 2HRPL 5M94B 4X5WA 4WGWB 5FM5O 1S5HB 1U36A 2OLDA 5C0EA 1RZJH 1NGQL 4PGBB 4XPBH 4XVJH 2P48B 2X44D 1QO3A 2YPLA 4NKQB 3K1KC 3ARBB 5J57B 3IFLH 1KCSL 3PWPA 1FIGH 3LIZL 3K2MC 2R0ZH 2FWOA 2DQEH 1R3LA 3S4SA 4FFZL 2C4FU 3PHSA 3C8DA 1FSKB 3EHBC 2UUDK 5EUOE 1T7YA 1D5XA 4NNPL 4PJDB 4PJCF 5D5MB 5CP3A 1HYRC 3S37L 3WYRA 1HIML 5IMMB 2QR0A 1I75A 3JTSA 5F9WB 3H7BB 3GIVA 1A6UH 5GS1B 1CL7H 1JPGB 3QDGE 1QO3B 4YFLI 1BQSA 1RJZB 5DD0L 5E08L 4UIMA 3FQTA 5C09A 4Q9RH 4N5EC 1T5WB 3FB7B 3DWTA 1R3LB 3HAEB 5GGUB 1HQRB 3EJYC 1AI1L 3DIFB 5F8QC 2XZCH 2NXZB 1AR1C 3WO4C 5I15H 3SO5A 3ROOA 4CMMA 3SCMA 1TTGA 4BH8A 4KUZH 5HPMB 4X6FB 2H8PA 2X4QB 1VCAA 4KJPD 5I8KL 5I1EH 4ZDHB 1W8NA 3KS0J 4YHLL 2JK5B 1S8DB 2BVQA 3H9YA 3FO0H 5I8OL 2Y72A 1I8LA 3F8UB 5B22A 2Q8BL 2FCBA 4LLVA 4MJ5A 3ZKQD 4X7TB 5IF0A 2NY4C 2EO9A 3X17A 1MHPL 1A7NL 1UWGH 3HZKA 2IQ9L 1DBKH 4YR6A 3MROA 3BKJL 4ODHL 1U9KA 1YNKL 5F88B 3BPLC 5DJAA 3QH3B 1WICA 3S88L 1B2WH 3MREA 1F4WH 2OL3H 3QHZH 2C9AA 4KUCD 4QGYA 5T3ZH 3MRBA 5IEKA 2VZOA 3SQOH 3U30B 3O3EA 3U0PB 4ZFFB 3SE3A 4RNRA 2DI7A 3L5IA 5DT1H 1TZGL 1OSZB 1XT5A 3CVHA 4LHUA 4QRUA 2F5AH 5TPWH 4YHNA 4E41E 4WO4A 1WVZA 5I73C 3QUZB 1AGCA 4LLVB 5HJ3A 1YEHL 4LP5A 1YY9C 5GJTL 1AY1L 4F57L 1F3DJ 1INQB 2XFXA 3HZVB 2BK8A 1OARL 1OSPH 5FV2A 3P9LB 2EDYA 3QFJE 3QXDA 2D4DA 1NCBH 4JVWA 2FJFB 3ZE0F 4KTDH 4CJ1A 5J12C 4BM7A 3QHFH 4JVUA 3LKPB 3N1FC 4PGCA 4Z7VE 1FZOB 3CSYB 3WDJA 4HLJA 5C0BD 3SE8L 3HE7B 3LN9A 2AK4A 4LPVA 1VFBA 1AXSB 2B7DT 5AD0A 5E8EA 5BS0B 4E5XB 1ZMYA 5CZXC 1S7WA 1AGCB 1ZS8A 3B2UC 3OKMB 1MJ8L 5DJ6B 4HWNA 5D1XB 5IW1B 3KPMB 4P48A 4MAUH 5HYSG 4LOUD 4PJ5D 1JWMA 3SE9H 3FOLB 3WHE1 3F12B 3ZKMD 2R1YB 5FYKD 1H8OA 2R39A 4TNVK 2GTZA 2C4FT 1F4YH 2VZVA 3NPZB 4MQXD 1KCLA 1MCNA 1LVEA 3KYOA 1W0VB 1BPVA 3B9EA 1WZKA 4G8FA 5E03A 3TJEL 3ULVF 2YD9A 2RJMA 1F2QA 2FJGB 1CFTB 1NCAH 4KK5D 3AFLA 4GQ9L 3NTCH 2X70B 1F11A 2HFEB 3HUJE 4BFIA 5E6IA 5CJOH 4KH2A 1FIEA 2VDLL 1XAUA 4GRMB 5CIPA 3SDXB 1SEQH 3VRIB 1FN4B 1TETH 1JWMB 3IDJB 4P5TB 3UYPA 5C0JB 1CF8L 1OAQH 2W0KA 3LS4H 1S7SA 3RI5K 5FF6A 1UB6B 3O9WA 2PNDA 1U8IA 1OAZL 1MEXH 3UTZB 5CS7A 5LGKA 4ZUWA 5IFHL 3I9GH 2HTLD 4Z0BH 3VFGH 4HKXA 2CKBB 1J0ZA 4HIIA 2DL9A 5FGSA 1J0JA 4PB9L 3VXMD 5DQ9B 3UJIH 3U36B 5C0ND 5AEAA 1RZFH 1FJ1A 4F7MB 3ARDB 3DARA 1AH1A 2HT3D 2JIXA 4JZJC 1KCKA 3DX7B 5E2UL 1NEZG 4KRMB 5FAAA 4YHPB 4NSKA 3LRHA 3CNKA 5DRNA 1N64L 5CIPB 4POZD 1G84A 1YUHB 4LPYA 1BZ9A 1KLGB 1KYOK 3HC3H 4WEMB 3V4VL 3O6FD 4MNQD 1ZWIB 3GO1H 3T65B 1F3JA 4YX2L 4LAJH 4YO0A 4DEPB 4UV7L 5EZOH 4QY8B 5KVDL 1FAIH 3LV3B 5E8PB 3GKZA 1LE9B 4ELMA 3MRMA 2H26A 4YUEL 1WBXA 2KZWA 3MLZL 1KJ2H 1CICA 3C2SA 3KLSA 4TSCL 1GIGL 3G6JA 3GSUA 5TDNB 5D70L 2PF6A 2XKNA 4XPFH 3S36X 5EU5A 4HS6A 1T83C 4UI2A 1YY8A 3T0WA 3PJSB 4U1JB 1FQ9C 4FXKA 2HLFD 4K3EH 1T7XA 3FZUC 1LO5A 1U92A 5CINH 1VEMA 4OCWL 3ZZ1A 4PJBF 3BJLA 3ARQA 1MVFA 3MV11 5HSFA 3W5NA 1EDQA 1E0OB 1D9KB 5I1GL 1CFBA 4GMTL 1G6VK 3MOAL 4UZGA 1AP2B 1J1OH 4KROC 3RUGA 1RULL 2PYEB 3L7EB 1FPTH 4HBCH 1MCWW 1OAKH 3QPXH 4PGEA 1T7VA 1DBJH 4PJGE 4FABL 5KAQF 1U8OB 4MHHI 5FHAL 3U1SH 3IFNH 4OB5H 3VXOA 1A4KB 3VXSA 1PKQB 5DUML 4MNGA 1DDHA 2IGFH 4JANB 2ATKB 4YGAB 2A6IB 3VH8G 4YDIL 4XCEA 4GLRH 2EYSA 1FO0H 5T1DL 3OKNA 4HIXH 2R1XA 3VG9B 1FL3A 5IIEA 1CU4H 3HZYA 4TVPD 4NN6B 5I0ZA 2EYRB 2F58H 4AEIH 1T5XB 2D0FA 3AAZB 4LSVL 1BFSA 2ZUQB 1CIUA 1H5BB 3MA9H 1S7XB 3WE6A 4G8IA 4GQPH 4H1LH 5AAMA 1IGMH 4MD4A 3C60A 2BNRE 4KRPC 1CT8A 4L8SB 1HXMA 1A0QH 1NGYA 3HN3A 1JHTB 3QXAB 1U41A 1TIUA 2AKRB 3BZFA 2KPNA 4LSRL 4OCRH 4LCWA 2R0WH 4LOUC 3C2AH 5DHYA 2EIEA 4OGXH 5FB8B 2IH3B 2NXYB 1Z6JT 4NO2B 3O3BA 4DOHB 2B5IB 1VPOL 4JB9L 1EFXA 3CC5A 2PTTB 5C0DA 5IJKC 1IC4H 1AIFA 3WHXB 3OKNB 4MQXC 2G5BB 3IJYA 3JTTB 1YQ2A 4KK9D 1JPTH 1S9XA 3BPOC 3ZHDA 3U9PH 1WT5C 3TNMB 3BPCA 1PDKA 4Z95L 3BZ4B 3JV4A 4YXLL 4KK5C 4F9PC 1IM3B 1YEIH 3DJ9A 3DNKA 1PY4A 3SBWA 4K7FA 5J7CC 4NRZA 3WNOA 3S36H 2DQFA 3MRDA 1N7ML 3NFSL 4PJ9A 1JPSH 1BZ7A 5ANME 4J1UB 4K3DH 2H2PD 2DLFL 4YLQT 4UB0H 1ZHLB 2ZOLA 2JLLA 1AIFB 5H35A 4LLYB 3SJVD 3TVMD 4HT1L 1N5YL 5FYLE 1L4IA 3GNMH 1INEH 5DUPL 3RY5A 3EBAA 4JO4H 2AEQH 4GW4B 2HTLC 4PJIE 4LQFH 1CLCA 3BPCB 4NZTH 4KVNH 2BNQA 3D87B 5K9KB 4PJAE 5I2IB 4OZFH 4JGJA 5C0NC 3STZB 3CMOH 4HQQH 4GXUN 3CZFA 3OR7B 4HPYH 4Y4FC 5ICYA 4K8RH 1EEYA 4UT6H 1DBMH 2YEZA 3S35L 1U93A 2Y7QA 2EE3A 3EYVB 1PX4A 3HMWH 3PXJA 4M7ZC 2R56H 3UMTA 4KHTL 5B39A 5IHZA 2EIBA 5FK9A 1AXTL 2YMXH 3O6FC 3WEXA 4X7CC 5I75B 3QISA 1N59A 3RWGA 1URLA 3DX8A 2AJVH 3PIQA 3EYFA 3GJEB 4XCCL 4AK1A 2F8OA 1CD0A 3RBSA 3IKCB 3MLYL 3VCLA 1ADQL 5IHBA 3BEWB 2QQNL 4IRSC 1NAMA 3KYNA 4KJWD 4XPTH 15C8L 5HYJD 4CW1B 4P2OB 5KSAD 3HS0B 3B9KA 1WBZB 3MRIB 5TGBA 2HLFC 1OVZA 4OD2A 5C08A 4HH9A 4PBVC 5B38G 3VD4A 4JFOA 2OTWB 3QNXA 2DQTL 1CLZL 4FQ1L 3TBYB 3WS6A 4HJGA 4UQ2B 3L5JA 1N4XH 2BVUA 4ZTOH 1KIUA 1WFUA 2OSLB 3QCVL 5FK9B 1IGYA 4FG6C 1REIA 5A16B 3RWDB 3MBEC 4P0DA 5DHVA 1AD0B 2X4TA 3QNZB 2R2EA 1MCQA 1TNMA 4CUCA 5FOBB 2ITDB 2J8OA 3VFRB 3DXAB 4ODSL 3QIUD 2DL2A 4JQIL 4ORGB 5T1KD 3LPWA 1JV5B 3BPNC 5ABDE 3C5JB 2ZOKB 4N0UA 1L0QA 1YN7A 3VJ6A 5IVXB 2FIKB 5HYEA 1ED3B 4FQCH 1N0LA 5TGBB 3UJTL 2VZ1A 4UNVA 2JELH 4KMQA 5DD3H 4NFBA 4XP9H 3OKKA 4GFTB 1UGNA 2EYTA 3MRNA 1MHCB 2VLJA 3E8UL 1MFBL 4POUB 1OGAA 4LLDA 4HEPG 3U79A 4GG8A 3X14A 2ED9A 1G7MB 5JLZA 5A1AA 4X7EC 3MV7A 4AYFA 2COQA 3LMJH 2AXJA 2MCPL 2BY2A 1S9KC 4V1DB 3TZVA 3H6JA 2JB6A 1C08A 3P3YA 2VXTH 2I5YL 3B2VH 2ZWLT 4JKMA 4TUKH 3RJQB 3GB7A 4DKFL 3QEQA 4C4KT 1HYSD 2PKDA 3HNTL 3QWRD 3KNBA 4QHUB 3TT3H 4DGVH 1EK3A 4PLOB 5DK2B 2I9LA 1SHMA 3OB0K 3B6SA 4HULB 3V5KB 4LF3A 5IB3A 3BMWA 2FEDD 4KK9C 1JNJA 3B8YA 3CCHB 1I9IL 2BJMH 3FO9B 4Y16C 4XCNB 3M45A 4X98A 3PDGA 2APFA 4HF5H 4TN9A 2F5BH 1AHWA 1I1CA 5E99L 3FRPA 4OJFL 3WXVH 1RHHB 1SBSH 5E6YA 1JPFB 1S9WA 4W4NA 4A2LA 4NQCD 3O3AB 3QJHA 1KJVB 1WZLA 2VH5H 2H2PC 3U4BH 2AQ2A 1MPAH 2VUYA 2EXYD 3KPTA 3SGKC 1ADQA 3TVMC 4NQXA 4KFZC 5LQBH 1Q0XH 3RA7H 4M1CD 4R26H 2PO6D 3HNVL 5DJZB 1FYTE 4P4KB 2JJUA 1G7LB 2YA1A 1OAUL 3TO2A 4EN3C 2KZ1B 4MNHA 2IMNA 3JXAA 5CKGA 4D8PB 2R1WB 1PVHA 4LSQL 4NOFA 2VDOL 3V0VB 4F2MB 4P23C 1MY7A 4OT1H 3DI2B 1LILA 4KKLC 1GC1L 2CLVA 4WU7B 1UZ8A 5FYJE 5I1HL 4YWGH 4XTRD 2XN9B 2H3NA 3WL9A 1G9NL 3Q6GH 4HEME 4PJDF 2AJ3B 4U7KA 1KB5L 4LSUL 4ZTPL 1OLLA 2LAAA 2WIMA 3BXNA 2AXGA 5DK0A 4G3YH 4Q58C 1XR8A 2OL3B 5ICXB 5IVNA 1UEMA 4OM1H 5GGSY 4G6KH 1JK8A 2OJZL 3Q1SH 4P9HC 2BHUA 1F90H 1KN2H 1T2QL 4PJBA 3I2CL 4G6AD 2D9CA 4OFPA 5E2WH 4XPHH 3DTXA 5F44A 4QNPF 4X4ZA 3DX9B 4A6YA 1BJMA 1I7TB 2I07A 4K9EC 2X1WL 1TNNA 2GSGA 4BH7B 4C56E 1G7PB 3JZ7A 4YHIB 2YD7A 1V05A 3HE6A 1HKLL 3GK8H 4GO6B 4HKJA 1S9YB 5TFSH 4XAWL 4K2UH 3QUYB 2ATPB 1TQCB 4PJ7B 4NP4L 4NRYA 2OI9C 2IQAA 1XIWD 3QIUC 4QRTB 1TJHH 4Y8DC 4YDKL 3WD5L 5HYQA 1VSCA 3BP7B 5I17B 1MCPL 1N3NA 3PGFL 5A2KH 3MYZA 4Z7UE 4BZ1L 3MSPA 1UZ6E 4HDIA 4M4PA 4YAQB 12E8H 4M7KL 2GFBB 1FBIH 3P0GB 3LVEA 3ZHKA 1FFPB 1I7RB 4XNXH 5DS8B 2PXYA 4LNRA 1J8HB 5IMOB 5AZEH 4PRAB 4DAGL 2Y07L 5CILL 1R3HA 3RWIA 3ZKSD 2A6JB 4IEFB 1IILE 2W91A 4IOIA 1VKXA 1UJ3B 4YBHA 3R1GL 3I3BA 4R4FL 4YHZH 2HKFH 3BE1H 2DD8L 1MHHA 1PW3A 3JUZA 1B0RB 4ZSOB 1UM6H 2RHEA 4E0RA 2Z92A 5IMLB 4RAUB 4WFGE 4TSAH 5HGAB 1HYSC 1KIPA 5DZOA 4OV5B 1HOCA 1IL1A 5IWLC 1LO2L 5IW6A 4PTUA 3GMNA 5I19L 4MCZA 5JOFB 4OLXH 1N2RA 4QHMB 1JYXA 3MFFB 2Y1VA 4DUVA 3LQMA 1OY3B 3LPFA 1ITBB 4JLRB 2FEDC 1Z9MA 3D69B 1X3DA 5ETUA 5T3XL 1OP3K 3U9UB 1YEEL 2VSDA 3OKLB 1P2CB 1A1NA 1DQJA 3IDXL 1QHOA 3ULUF 3QIBA 2Q3ZA 3NFPB 4PGDA 4AEHL 3SDDA 2E9IA 4LNVA 2BVOB 3D39E 4YPJA 4BSJA 5HYIA 4LVOB 3KPRA 4IRJD 4JRXE 1P4BH 3BH8A 4EBQL 2QSCL 4PR5B 4PJFE 3O6KH 1K4CB 4Z76A 5JMOC 5DHXB 1H3XA 3O4OC 3V5DB 2CDEA 2EXYC 2VDNH 3OJ2C 4FQQA 5FYLD 3WKMH 1XF4B 5JHDE 4FA8A 3WIHH 1MCWM 4XPAL 1BBDL 3BW9B 4X6CE 1NL0H 4WJ5B 4WDIB 3VD7A 2R2HB 1FRGH 3MLRH 3ZE1F 2Q6WB 1EFQA 2Y5TB 3QIBB 1E6OL 3V52L 1MFEL 1T80A 2QQQA 1RURL 4FQXA 1KJ2B 1I9RH 1WBYA 2O5XH 3SDXF 1FVEB 3H9SE 4NNYA 1BFOA 4JZNB 2J8HA 1P6FA 2P5WE 4G6FD 2W9EH 4LARH 1TJIH 4HUUB 2ADGA 2NTSP 3MJ7A 1ZLWH 3ZYOA 1KENH 4GMSL 3U7AA 1FLTX 3IDMA 4WHDA 1V8HA 4G80A 1EJOL 3IJSB 1OD9A 4JFQB 5I8EA 4XH2B 3VA6A 2NY5L 1A64A 4G7YL 3BDYH 2YRPA 3VH8B 1WIOA 3HG1B 3EDEA 5J89A 4KJYA 3K4AA 4TQEL 5IK3A 1GHFH 5DVOA 3LKOA 3R0NA 4M6NL 4LVNB 3BQUA 1V7NH 4MQ7A 3J8F7 5L6YH 4U6YB 1IMHC 5CZKA 4PJ5B 4TSBL 4X4XB 1QNZL 2FRGP 1T1WB 2VDML 5DJYA 3MRKA 4U1SA 1Q9KA 3HNSH 3D85B 3MLTA 2WQRA 3LQAH 3HC4H 2H41A 2ADFL 1FO0B 4ZOEA 1OM3L 4Y5XA 5I1DB 2EC9U 1BQHA 2J8UF 2I25N 2X2YA 5DC9B 2ZZUT 4EEEA 2P5EE 2ZSVA 4XVSH 5D2LB 1EAPB 2FGWH 4OZIB 4WWID 4ZAKB 2V7HB 4GAGL 4JFDB 2LQRA 1X5ZA 2Z4QB 1XCQA 4U4BA 2G9HA 2F19H 2R8SL 2VLRD 3TH4T 5HVHC 3OG4B 1OAYL 1T0NB 4LCIL 5HI3D 3L3DA 5CSZA 1EHNA 4H1LB 5L2JA 5JQ6L 3B9DA 1KFAL 5DQDH 3KPSD 2ZCLH 1YYMH 3FB5B 5JIKA 2Z91B 3REVB 3CFKB 5TF1L 4MJ6A 1IKNA 1ZLSL 1U3HA 1YPZA 3GMRA 2EDBA 1BEYL 4PJXA 4OIIL 4K07A 3EZ8A 1CGYA 3QIWA 5DMYA 1AGFA 4JEGB 3RP1A 5IROC 4FZEH 5DQJB 2CJUL 3T4YB 2ADJB 4U1HA 2P8PA 4ZD3H 3BGFC 3BUYB 4FHBD 4UOJA 2ZSVB 1SY6H 4RMWA 2O5YL 3DYMA 5IT2L 4K94L 1A7PL 4XXDA 2WBJD 1FNSL 1QFHA 3T3PF 3QQ4B 1YMME 2B4CC 2JTDA 4U3CA 2DBLL 4MX7A 3VMOA 3A67H 4JM4H 4YHKH 4HW6A 4PJCE 5FUZH 1FLRL 4XAKE 1XF3A 3AREA 3INUH 1E27A 5I9QB 1HH9B 4PV8B 1ETZA 2V2XB 1ES0A 4H5SB 4PRID 5H2BA 1G0DA 2R0KL 5F9AC 3F7PC 3OTTA 3QYCA 3TA3D 4MNQB 3WN5C 1DVFD 4FNLH 4WEBH 1CDUA 2XV6B 4LL9A 1ZXQA 1PKOA 4IDJH 4NJ9H 4PJ8C 1WCBA 5INCB 3WFBL 3WLWC 5IGXH 4OSUH 4PG9A 4R0LC 3EDJA 1QSVA 1CGVA 3C87A 3B4NA 1QLEL 3Q3GB 1QQDB 1MRCL 1I8MB 1J05B 5F1NB 1JNHA 3VXRA 1NSNL 2B1HL 1PY9A 3MACH 4HH8A 3ARGB 1U8PB 4P3WA 3P30H 4WTWA 4OZFB 4KQ4H 4R6UA 3B3IA 3KXFE 3VFTA 1K8DA 2HH0H 5EO1B 4L3CA 1MCIA 4BYHA 4KQ3L 4N0YL 2MOVA 3LEXB 5J56B 2GJZA 3NZHL 3D48R 3D25B 2HG5A 2QLVB 1ZT1B 2EH7L 1FYTD 4JKPH 3D2UA 1F5WA 1CFQA 2BSRB 3LKRB 2GITB 1A1MB 3U7YH 1JGUH 1A1OA 3ULUL 4WNQA 2CUHA 4RGNE 5ILTH 1IGCH 3FQNB 4DCQB 2ITCA 2WUCH 4PREA 2W9DH 3IDNA 5IESL 1DQQB 4JQXA 4LGSB 2N1KA 3DROB 3MV8D 2R69H 2ED8A 5GJSH 5ID1B 3E0GA 4RX4D 5E1AB 3AY4A 1BF2A 1O0VA 4D9RD 5IEHA 1WAAF 4OLYL 1G7HB 5ISZE 3MRLB 5EOTA 1W0WB 5F9JB 1M6OB 1YYLH 1HSAB 1BLNA 1KELL 3QUXC 4ODVL 3BHBA 3LSOB 3FQXA 4JDTL 5HHOE 5DC0A 2HFFB 3BIKA 3GHEL 4LPCA 2A73B 1KEGL 2WWKO 3GSWA 5HHPA 3MRHA 3ILQD 4UILL 1XFPA 2BFVL 1HILA 1W0YT 4D9QE 4LPTA 4C56D 5CEZL 3ZE0E 3IYLW 1TVBB 3U0TB 5L9DH 3D5OF 2ICWI 1NDGB 1ZK9A 1S5IH 1JRHL 3E1F1 4PRHD 1QBML 3O0RH 4FZ8L 3RTQD 2HFGH 1DE4A 5D1QC 3Q2CA 1RD6A 5DEZA 5A2JH 4ZPVB 1W72A 2D7TH 3ARPA 3M1BA 3BKYH 4UINH 2OZ4L 1FNGA 3U6RA 3O8XA 1YDPA 1LD9B 4JO1L 1JL8A 2FZ3B 4NNXB 3X13B 3SKOA 2BVTA 5IUSA 3MUGB 5HHNA 4M7LL 5INDA 5A3ID 5EOQH 1CZ8L 3IJHB 1EJ6A 2NNAB 2CKBL 4M93C 1UA6L 3TNNA 1A7RH 1NMCB 3AMLA 3M17B 3FL7A 1A7BA 3DMMA 4NQVB 4PBXA 5EO9A 5FKAB 3WLBA 2CGRL 5HI3C 5JPMA 1R5VA 4H8WC 4Z7OF 5HVFB 3O4LE 4RA3A 3IF1B 5F9OL 4ZUTB 1LHZA 1X5HA 2Y06L 1WFTA 1U8NB 3BP6B 3IDGB 5JTWA 2Z31D 4KDVA 1RK0B 3ZKND 4AMKH 3GRWA 5DEFA 2GKIA 4F3FB 4PJEF 1FDLH 1BHGA 1QFOA 3RIAK 3SJVB 3O8XB 4MQSB 4FQHB 4Q9QH 3A6BL 1KTLB 3N1MC 4P2RB 1BMGA 2C3VA 3N06B 5SWSE 4JO3L 2IAMD 4WFGD 4R7DA 2KQMA 3C9NA 2ORBH 3PV6A 1DEEA 5SV3A 4XT1C 4LSSL 4DUWA 3SY0B 3EFDL 4D0CA 4JY6A 3UPCA 1MCLA 1LK3H 2PW2B 4R7NB 4WW2A 4ZUUA 3ARRA 5F21B 1Q8MA 3NMEA 1NDMB 3CFEA 3FOMA 5I1JH 3NABL 2H1PH 3MRPA 4DZ8A 4YNYA 4R96B 1A6AB 3PP3H 1RZGA 3GSXA 2X4UA 2P47B 1XF1A 3QI9D 2PCPA 3SDAD 5IB5B 4R90L 5B8CB 5T5NG 5ITBL 4U0QB 3D39D 1IC1A 4NRXB 2X40A 2XZAH 4QOKD 1S9VA 3BKCH 3PDOB 2X4SA 4JRXD 3CK0H 4NWUH 2YD8A 3E3QE 5HYJB 3GSNH 5KSAB 2P8LA 5I1LB 4HIHB 1NAKH 2YSSB 4J8RB 4OUUA 2MJWA 1FORL 4IOSD 5EDXA 4Y2DD 5FECA 2DLGA 2JJTA 5JHDD 3U7WL 5E7BA 5JW5B 4E42B 1RUPH 4XBGA 1RIHH 3LKNB 3Q0HA 5DFVC 1B4RA 1AKJD 1ZA6B 4RSVA 4YJZL 3IAQA 5CGYC 3N1GC 3L3IA 4OFYA 1GGYA 5CMAB 1QSFA 5CGTA 4MZ2A 4WW1A 1WC7A 2DYPD 3SEPA 2AV7B 4KV5F 4QTHB 3VWJD 2A2QT 1MCFA 1IAOB 2IMMA 3PWVA 1XCTA 3RGVD 2HAZA 1DQML 3I50H 4XP6H 2XZZA 5GGVH 4QT5A 3SOBH 3D3VA 2VLKE 4OZGB 3F5WA 4O00A 1MVUB 5BJTA 1GGBL 1T1XA 3PL6B 5EU4B 2OK0H 4I0PD 4JFPA 3A0OA 4UU9B 5IV2A 5DI8A 1RFDH 4L8BA 1A6TA 3UPRB 3G5XA 4L4JA 1BGXL 1WC7B 3C09C 3QUMH 1JF1A 2Y9RT 2W65A 3DPBA 3EGSA 4MXVE 1MLCA 1T04A 4JFFA 4P46B 3VMNA 3MV9B 5C70A 5TH2B 2LVEA 1T22A 3ILQC 1QSEE 1SMOA 4HXBH 4G9DA 3PNWA 4HIEA 3S3SA 4NQEA 4U0RC 1NPUA 2DICA 3RHWF 3MLSH 1XGQA 4R2GB 5MENE 3C5ZA 2E8YA 4YDVA 4N8CH 3QRFM 5D9SA 5C8JB 5BMFH 2NX5A 1HK6A 2J8UA 4WWKB 1C5CH 5JZ7C 2VKWA 4EVNB 3MUY1 4OCLC 4Z8FH 3O2DH 4JKWA 3B43A 4L4TE 4P2QA 4J7RA 4LLQB 2B0SH 1LP9F 4H20L 1MQKL 2EH8L 4XBPA 1FFNA 4IHOB 7FABH 4YBQD 3UBXG 4JFFB 1SJVA 1DQDL 3RWFB 2XI9A 4B5EA 5E2VH 3PQYA 4HAFA 1A6VH 5E5RB 3PNWB 1K8IA 5DJDB 4JJ5A 3SDCA 5AYUH 4XCFH 5I30H 2I9TB 4HUVA 5FIEA 4P3DA 4I48B 4NQCB 3NGBC 4LLWA 2N7BA 5GXBB 1KCRL 2XWJB 4YDVB 2A77H 2Z31C 4L9DA 5E9DE 3ZKNC 1E4XI 1DQLH 5FGBC 2E9JA 1AGDB 6FABH 1BFVH 5E5UB 1Q94B 3VFVA 5ALCL 4N1HB 1N6VA 4Q6IC 4NJAH 4P2QB 4I3RL 2GUOB 2PO6B 1QKZH 3WIFB 5GGTL 2EIZB 1R6VA 3IXTB 2IAMC 3WXWH 2VDKH 3VGAB 2CDFA 2NY2D 3GBLA 4PY7A 1J1XL 4O4YL 1SQ2N 4X6BA 5C0CA 2FD6H 2YZ8A 4W6YB 1MHEA 4PRDB 3RZCB 1FV1A 1X9QA 4NHUA 3V6FA 1QLFA 3NZ8B 3NN8B 3F7VB 5EB9A 2M1KA 1JI2A 5KVFL 3GJFA 4X99A 3WUWA 2F53A 4NM8L 4PLNC 1FNEA 3QI9C 5FKPA 1F2XK 2FO4A 4TUJB 4O02L 1G1CA 2VZTA 2IALB 4H0GA 2UYLB 2IEPA 3T09A 5EC1B 1JN6A 1A7OH 4M5YL 1P4LB 5D1ZD 4CMHB 5D7JA 4QXTB 3KYAA 5FA3A 2BRRH 3KLAB 3GBMH 3NCMA 5D93C 3BDBA 3W0WE 1TVHA 5TQ2H 2RR3A 2Q20A 3OAZK 1F4AA 3V6ZB 3O6ML 5IBTH 3KR3H 1WWAX 2LU7A 5BOZG 1TENA 3MBXL 1T1ZA 1CG9B 3FFCE 3ZTNL 2IPUK 4YHYB 1VFAB 3T0DA 4JGUA 2BZDA 2KQNA 2J88L 4OGAD 2YXFA 5D2NB 1OWRM 1J5OH 1XIWB 1EVTC 4RGND 2RFXB 4Y5YA 2R2BB 5IG7B 1RZJL 4JREC 1WUNT 3T2NH 5SWZB 2NY6D 1VEPA 3O6LL 4XPBL 1JGLH 4XVJL 4MB4A 2IC2A 3HMXL 3U0WH 2YBRA 4FQJH 4LSPH 3ARFD 5DTFB 1FIGL 3TN0B 2R0ZL 4NC2B 4UV4L 4LCUB 3VDBA 2DQEL 4KC3B 4DN3L 1NKRA 4KUCF 4LGRB 5ISZD 3H0TA 3UYRH 4I0PC 2Q86B 4NM4H 1YC7A 1CR9L 3T8XB 2EEAA 3UTSE 1GYAA 2CRMA 4U1NB 1M7IB 3QEUB 1R3KA 4LRIA 4LEOA 3UZQA 4ZNEE 5HHOD 4Z5RB 4G9FB 4NKIH 3ZDXF 4XRCB 5J11C 3VRLE 5LJYH 1DN2A 1BREA 2H45A 3QPQC 5DJCB 4D9QD 2IBGA 5MI0C 4X5XB 1ZKAA 3R06A 5JPNA 3DUUB 2KL6A 4AG4L 3AGVA 2BERA 2X10A 5KW9L 3VGDA 2DQCH 3QJFA 4BFGA 3MGOA 2O93L 1A9BB 2F54A 5EU6B 4B7IA 3MLPA 5DSCB 5H37G 4XMLL 4MAYD 2PYFA 4G5ZL 4M48H 5BZDA 2ICEB 2XZCL 5D7LE 2DWDA 1PLGH 4IRZH 2V6HA 4IIQC 2EC8A 2WINB 2P46B 3ZE2F 4LSTH 1KPRA 4JRYB 4KUZL 43CAA 1H3UA 3B9VA 1G6RB 4R8WL 4YBQC 5LWYH 4QGTA 3QCTH 5I1EL 1Q9WA 3LRSB 4GG6E 4P59L 5DJ2B 3KYMA 3O4LD 4KZDH 3C6LB 1AGEA 1WZ1H 3IDIB 2VXSL 4QKXB 4MJIE 4NO0A 1NCWH 3O45B 1I1RA 4IRJB 4MB3A 1L6ZA 5FO9A 3MGOB 4PJEA 4MWFA 1DBKL 2YWYA 4P49A 3QQ3B 2VDRH 4NYLA 5D4QA 3S5LB 4NQDE 1GL4B 4GUPB 2OR8A 4OFVA 4L4VB 4OZHB 5EUKA 1RZKL 2X9XA 4QF1B 5FGCB 1B2WL 4QRPE 4U3HA 2G2RA 1F4WL 2OL3L 3QHZL 3S7GA 3SKJL 1UCBL 1U6AL 3DSNA 3GMLA 5T3ZL 5D2LF 3T1FB 4OZIF 4PRBB 5SWSD 1MREH 5JHLH 1JGDA 3SQOL 5IR1B 2RAMA 4ALAH 3G5VA 4RGMB 3DURB 1HDMB 5DT1L 1TZHB 2AS5M 1MI5A 3ROLB 5TPWL 2G5RA 3Q5YA 4TYUA 5CD5D 2E6JA 3MRGA 2V2TB 4IMLB 4PP2B 5DVKA 1A22B 5F1KC 2K7PA 1ZEAH 4H88L 4Y19A 2C7UA 1I1FB 2IFFH 5CZVH 1GAFL 4DVBA 3T4AB 3ILPA 1RK1B 4G8GA 4TTDC 2A1WL 1MIEH 3SO3B 5GZOD 1C16B 4I18C 1CGTA 1OSPL 4QRQA 1EO8H 4G43A 5EBLA 4EI5D 2G2RB 4I2XB 2V5MA 2G60L 3QHFL 4OGYH 4QHKI 1X5YA 1EGJH 3IRZA 3LDBB 2BNUA 1EERB 4PRPA 5IMKA 5GGRY 1NC2A 3GSQB 3E2HC 1V7MH 5F6IC 5KSUB 4PJDE 4O5LL 2HVJB 4OD1H 4FTVB 5D5ME 5D96C 2K7QA 3HLAA 5GPRA 4LEXH 2NW3A 5ACZA 4OM0H 4HWBH 4NZRH 3L5WA 1D5ZB 1HHHA 3RL1A 3M07A 4F7CA 3SE9L 1RUQH 2X4NB 4M6OH 4CN4A 4Y5VB 3IETB 2A38A 3CXHJ 1CXIA 2CIKB 4RGNC 1JI1A 4QNPE 1NFIA 3WFZA 1IKFH 4ODBD 5CJQH 1QRNB 4J6RL 3TPUB 3M8OH 4AM0B 1QOKA 4M7JH 4XVTL 1I9JL 2D7NA 3OKDB 5LGHH 1I1YA 2VLRB 2NY0B 1HHGA 1NCAL 3P11L 3L9RA 2OYPA 1BJ1J 3NTCL 4NCC2 2UZXB 3UTTA 3KPSB 3MRFA 5CJOL 5ELIA 3UJJH 1JZ5A 1U8MA 1HI6B 3DVGA 1SEQL 4M00A 2DLIA 4TPRH 1U91A 4XC3H 2HTKD 3EFFB 1E4XH 1FG2A 2L7JA 4JFEA 1S7UB 1PYWB 3LS4L 3ZSSA 5I1KH 1E6JH 1EV2E 1QSED 4W68A 1AFVH 3CFDB 3VFWA 4F9LC 3MGTB 5H8DA 3I9GL 2VIRB 4JR9H 2WBJB 3REWA 4Z0BL 5MEND 3VFGL 4N8VB 2DQJH 1JGEA 2X4OB 1YEFL 3RGHA 5D6CB 1K9TA 2Z8VC 1LDPH 1AQDA 3LB6D 2AI0L 2DN7A 5C0RL 1U58A 1LP9A 2C3WA 3DO3A 5CHNB 4PRIB 1BZQK 1PZ5B 2HJFA 4L4TD 3LEYH 3QG6B 4MVBD 3TA3B 4K9EH 1OT2A 4ESKA 1GGTA 1DVFB 4TOYL 1HHIA 4X8JB 2MCG1 4CADA 4W6XB 2ZP0T 3AS3A 3MJ9H 5EPMA 4Z18A 3WV0A 4KDTC 4YC2C 2BVEA 3FFDA 3L95A 1OPGL 2DI8A 3DOSA 4LBEA 5EZOL 1J1PH 1UENA 2NZ9C 3STLA 3OHXA 1MCOH 1FAIL 4Y4KB 5GS3A 1UWXH 1UH2A 4CVXB 1ZGLM 2HN7A 4HPOH 4L3EA 5GGQH 3HI1A 5JOPE 4DKEH 4UDUA 3MGAA 1P1ZA 1T03H 3QDMB 5I1AB 1G7JA 3TBSA 3TBVA 2HLAA 3B8SA 5DJ8B 5HYSA 5BS0E 3MCKA 4L9LB 4BUGA 3I6GA 4HGWB 2XRAH 4OIAA 1NCUA 4GBXD 1YEGH 1BBJA 1KIRA 3RDTC 3MCLH 2VJXA 5CJBA 2AJUH 4IS6A 1R24A 5E56A 1BIIB 4LBEB 1XGRA 1GZPB 1YECH 2VZUA 2WLZA 1FPTL 5L88L 1G1YA 4ZO8A 1OAKL 3HRPA 3MJ8A 3QT2A 1DBJL 5M95B 3GI9H 3VXNA 1I1AB 3W39A 3U1SL 1Y6MR 4L3EB 3IFNL 4Y1AB 4D0DB 3T77A 4KWUA 4UDUB 3MV8B 3WSQH 3GSNB 4I77H 1G7IB 2E5EA 4MD5B 3PGDB 1JZ2A 3FRUB 5GZOC 2YD5A 3IAPA 3HCVA 3ZE1E 3S96B 4LCYB 5FYKL 1MJJB 5FHBH 4EI5C 3FONB 1FC1A 4WV1B 2ICWJ 4Z7WA 4HIXL 4PBWD 2P8MB 1CU4L 4MA7H 1L7TH 3BWAB 3ZL4H 1KN4L 3VI3F 5BQ7B 4JZJA 4W81A 3E3QC 5JW4R 1P84J 3SDXE 1EHLH 4AEIL 3I6KA 1FVDA 1OTUC 5CBEA 3VFSA 3W0WD 3MA9L 3V9FA 4ONHB 2C3HA 3MRQB 4KHXL 1M05B 3VWKB 2V2WB 1TVDA 2CDGB 1A0QL 3P0YH 3QNYB 4F15C 1L7IL 3KWWA 3FFCD 1NEZA 4NO3B 1KT2B 2IAND 4OCRL 5GQBA 3HRZB 1NCCH 3C2AL 1UM5L 3ALXA 5AAWA 5KS9A 1A5FH 3NIDE 3QDJB 4PRHB 5GRZA 3RTQB 1ITCA 4HMDA 2VQ1A 3PHOA 1H15B 1BJ8A 3EJJX 3TO4B 1MCRA 2X1PA 3CFBA 2YUXA 3RU8H 1T83A 1UYWH 3RWHB 5FO8A 1DUZA 2JCCB 5I66B 1CE6B 4LCCB 1J9CT 3O2DA 1JPTL 4WTZG 3ZYIA 3N9GL 3U9PL 3C08H 3WO3B 3TCLB 3TESA 5HI5C 3QUMB 1MUJB 3FQWB 4K3JH 3KPQA 1UKQA 1JMXA 3OR6B 2GJJA 4P5MB 4MJ2A 5CUSH 3K2UL 4XWGH 3C5SA 4WU5A 3UTSD 1ZVSA 2WLYA 1Q9OB 1IC7L 3B83A 1KG0B 1JPSL 4HC1H 3C6SB 3HI5H 1N0XH 4X6EA 3P9MB 5DD6B 1IFHL 2MNUA 1NGWB 3X12A 4UB0L 1OAXH 2QSTA 1QBLH 2B2XH 3B5TA 5LVEA 1XF2B 3DBXA 2R4RH 4AY0A 4ODWB 5HDQL 1X44A 2J4WH 2WQ8A 3ZKXC 4HXAH 5AG9A 4OI8A 3QWOA 5EOCH 1HXYB 5L2KD 1EVUA 3RVVD 5FDWB 2W0LA 1DBAH 4HX1B 3FO2B 2WV3A 4JO4L 3W9EB 5J13C 4LQFL 1IEBA 3Q48A 4KVNL 4NZTL 1CDBA 4XGZB 4LLUB 4WI4A 1WTGT 4HQQL 4NZUL 1UG9A 3RY6C 4HZLB 3EYOA 5EU3A 4DN4H 3MXWL 2IH1B 2C1PA 3IU3B 2XTJB 4GAJH 5C0BA 2PYEE 3IGAA 4ZS7H 5DJXA 4PB0H 3HMWL 4B50A 1AGBB 4MVBC 2R56L 5EZJA 3LHPH 2HP4A 4QXUH 2YMXL 1IEAA 1RUKH 1PKQE 4AIZB 4GKNA 4NUJB 3SDAB 3T3PE 3F7YB 1Z9OA 4JM2D 3TCXA 2AJVL 1TCRB 1HKFA 4X4MA 3RNKA 1NBZB 4QOKB 3H2WA 4XNYH 4FXGB 2NZIA 4F8TA 1CDGA 5J6HB 5IJKA 2FECI 1M4KA 1J12A 4XPTL 3NCBB 5LXGL 2D31A 4NQDD 5I1CH 2QQLH 1UXWA 4YXKL 1P7QB 3PGCA 5KJRH 1VHPA 1BQLH 4Y2DB 1EPFA 2BC4B 2YR3A 3BP5B 5I71B 4AJ0A 4QRPD 1Q9LB 3PABB 3RVTD 4MA1B 4DGYH 1WT5A 4QRSB 4OF7A 2ARJB 2FL5B 4MDJA 1E4WH 3V7AG 4ZTOL 2ZG1A 1GC1C 4TVPL 1R3JA 4TUOB 1AKJB 4PV9A 4XCYB 4F9PA 4QO1A 2ICWA 4R97B 1G9NC 1GH7A 2CXGA 1LNUA 2DYPB 3NPSB 4U31A 3RKDD 3KJ4B 4RAVB 4LSDA 3GSVA 4UT7H 1C5DA 3HUJF 4DOHE 4JDZB 3VWJB 5T1LA 3RGVB 3TH2T 3T0ED 4EQ3A 2HVKA 1OW0C 4WHYG 2VDPH 2ERJC 3SHSA 3DO7A 4FQCL 5FA4A 1I8IB 4RQQB 3ARBD 2C1OA 4KDWA 4EUPG 3P4MB 3LN4A 2ICCA 5JO5A 4HIJA 3VXMA 1C1EL 2WWMC 5FYKU 3QZWG 4NHCL 4Y4FA 4YE4L 2IBZY 1H8NA 4Y4HB 3FCTA 3VFUB 3I02B 1NJ9A 3C8KA 4HFWA 2VC2L 2VQTA 3LMJL 3ZT5A 1LMKA 4U6XB 4O2CA 3O6FA 5BRZA 2VXTL 1WAAE 4TUKL 1KCVH 4U2YA 3P4OB 5F7YC 5KSBA 4I1NB 1RUML 5ITFA 5HGDB 5SWQB 2AJXH 2GJ6A 2XWBA 5C07A 2YPLD 3RHWK 2OCFD 5JORB 3PWJB 1PQZA 3PWPD 1IQWL 3UC0H 4WCYH 3ESUF 1U8LA 5HY9A 4IRSA 3UROR 4IJ3C 1IAIL 4M43L 5E00B 4DJMA 4HG4K 2NXZD 4J3WA 1AD9A 4FRWA 1QG3A 4WHCA 2E3VA 1TLKA 1FE8H 1QYGH 1HHKA 4M3JA 3WJJC 4WHTA 3FQRA 3DGGA 3BWUC 3HA0A 2GT9B 2BMKA 4XPGL 3MBEA 5BRZB 4F7TB 1NLDH 5B38A 2VH5L 3QA3B 2AEIT 3OMZA 2BY3A 1CD1A 4NKOA 5GRUL 3U4BL 1T66D 3ARYA 1MPAL 4FQIL 5BV7H 5D71L 5MEQA 4S2SA 5EZLA 2YKLH 3VFMB 3RX7A 4PJGF 4OD3L 1AO7B 4PLJD 4LASL 2O26U 1QFUL 1LWRA 3IT8D 4I9WE 4R26L 4Y89A 5ESQA 3E6HB 4Z7OE 3NA9L 4Z0XA 1EEZB 4YIQB 2VE6B 3LD8B 4R4BB 5GSRA 1HNGA 5C0AA 1BOGB 4GW1A 1UWEH 3AS2A 3QXTA 3OQ3B 3T3MF 3JV6A 4O2EA 3TIEA 4U7SA 2GTWB 2XZQH 1S3KL 1A3RH 4U6HA 4ERSH 2UWEA 4NGHH 4RWYL 4YZFF 3DXAE 2P44B 4YWGL 1FNAA 4IOFC 1QVOA 3RZWA 1RSFA 4NKOB 1XGUB 4RAHA 2UVFA 5IVXE 4U33A 3TJHD 2QBWA 1A4JB 4JM2C 2CK2A 5DDHB 3WMSA 5EN2A 3FHQA 3V4UH 1S7RB 2HJKB 3VFOB 2XA8H 4JFZH 3SKMA 3P9WB 2VNCA 4G6KL 1MAKA 2B20A 1EGJA 3RY4A 3O2VL 2A9ML 4OLVH 1KN2L 3Q6FB 1VACB 5E2WL 4X8XA 2DQHH 1HINH 2Q8AH 1T3FA 4HJJH 3SKNA 2ESVB 2RIKA 3CXHK 3RVTC 5BS0D 5F1IA 4Y16A 3X11B 4V1DE 1D3CA 3MNWA 1IGIH 2MMXA 5C3LD 5TFSL 1ZT7B 4F58H 3U4EB 4K2UL 3VRJB 1NC4B 2VN4A 5I18H 2AXFA 2GAZB 3K80A 5EUOA 4X7SL 4BKLA 2NW2A 3OXSA 2NY6B 4P4RB 4S1DD 3SGKA 2H6PB 3TVMA 1F45A 3ARFB 5TE6H 4QHLA 1A7QH 2NY5C 3ARBC 5E2TH 3QDGA 4LQ1A 5T1MA 4EN3A 3JSSA 3WKNA 5JXAL 2AV1B 4KV5E 1AC6A 5T5FL 4P23A 2Q1EA 4PJAF 1FSKC 1WV7T 3TBWA 4X9HA 3CU7A 2WNGA 5DYOB 4YDJB 4YFDB 4UAOB 1JZ4A 4ZO6A 2VLME 1K2DB 2HKFL 3BE1L 2NYYD 1HCFX 2YA2A 2CLZA 1HQ4A 5ERWA 3QO1A 1UM6L 3HAEG 4OZ4B 3S4SG 5F9WC 4YGVA 4UUJA 4EI6A 1UQSA 5GS1C 5DUBB 4KAQL 4TSAL 3RPIA 5CGMA 5K9OB 1A14H 1MFAH 5JXED 3IAGC 3L7FA 4MAYB 3S37X 3ARDD 1I3RA 1YN6A 2OMBA 4F7EA 5E6ID 2CUMA 4ZFZA 2NXZC 3BVNA 1MCBA 5KSVA 3RRQA 1ZT4B 3UTOA 1IEHA 2XN9E 3QRGL 1S7QB 1FCCA 4JPWH 3H3BC 3L6FB 4J3VA 1IM9B 2Z8RA 1LEGB 4OTXH 4JJHA 2IADB 4TULH 3U2SA 1KNOA 1P9MC 4C55A 5ALBH 3U48A 3EO1A 2HWZH 5T3ZE 4K94C 5LGJB 5MHSD 4NCDA 4E41A 4GH7B 5JNYB 2OR9H 3QIUA 3OGOE 1P4IH 4OQTA 4KY1H 4YXHH 1CQKA 5T1KA 2VAAB 4OF5A 2VDNL 1ZHKA 1ZTXL 1F4XL 3P73B 4JO2L 4PLJC 3WIHL 9CGTA 1MF2L 3VFNA 4I0KA 4RISH 3QFJA 2BVPB 2V5SA 1K6QL 1RUAL 4ZUVA 4KK8D 1FRGL 3U30C 2DKUA 4GRLB 4NDMA 3FB8A 5C0GB 3CVHH 2W0FA 4Z7VA 3V0WL 4ISVA 1YMHB 2PYED 1KNOB 3CDFA 4PJ7E 1I7UB 1VESA 5A2IH 1SJHB 4HAGA 4P57A 3UAJD 1I9RL 2GK0B 3QUZC 1CICD 5ESAA 4E41B 4OBSA 2HRPH 4MDIB 1P84K 1V3LA 3P0VH 3OF6D 3ULSA 2W9EL 1UXSB 4Z77B 5TE4L 2AK1L 2OP4L 3N85L 4NPYA 1BD2B 5C6TH 2LABA 3H42H 1ZLUK 1H0DA 4ELKB 1NANI 5FFLA 5IWLA 1JHKL 1T6WA 5IJVA 3NOIA 1KCSH 1G7QA 3OSKA 5IVZB 4GAYB 1J8HE 3HI6H 3H9HB 4B0MM 3U82B 2VL5B 4OF0A 4D3CL 5CSBA 2W0FB 3HE7C 32C2B 1OWWA 2CLRB 4EIZC 5IB4B 3EOBB 4DVRL 1LEIA 1GHFL 5I6XB 3MRRA 4I5BB 1DL7L 2W60A 3TPKA 4ZSOE 3VXSD 5BVJA 5D1XC 2XXMB 4Q0XH 5IB1B 3S37H 3HUJA 3RL2B 4ETQB 1WF5A 1QEWB 1LK2B 2Q76B 5J4MA 1NGXA 1NMBH 5JW4M 4U2ZA 2NXYD 4JE4B 3LQAL 1TPXB 3EOYG 5DD0H 3HC4L 4M5ZL 1MH5B 4YHOH 3H8NA 5L8LB 3L5XL 2M8XA 1PZUB 3WS3A 5T33H 5J06A 4NUGL 4QYOB 1N26A 2FGWL 5I76B 3UTQA 4S1DC 2V17H 4G42A 5HHQA 5CEYB 1WWWX 2VTFA 4HJ0D 4WUUB 2V9TA 2B4CL 3GMMA 2OX5A 2WP3T 1MCJA 2F19L 1M7DB 4K7PH 1CGWA 4K3GA 1UKSA 5DQDL 3WCYA 4HKBB 4JZOB 3C60D 5E8DH 5ECJE 3NVQA 5F3BA 1NGPL 3PHQB 1G6RL 4P5TC 4QCIB 5ESVA 5SX4I 2KBGA 2Q8BH 1EFXD 4FZEL 1ND0B 4ZD3L 1MHPH 1A7NH 2NYYC 2QKIA 2HJLA 1SY6L 3KS0H 4MA3B 3BKJH 5J1AB 3TYFA 1YNKH 1T21B 4EIGB 1D5IL 43C9A 5DD1H 3VD3A 3GMMB 3OB0H 3S88H 2A83B 1YEDA 4NKMA 2E7BA 5KOVC 5JXEC 4ONGH 4ZQKA 3IFOB 4YHKL 5E5MA 5FUZL 3FT2B 2CK0H 3MO1B 3ARDC 1Y18A 3INUL 5TDOA 3MOBH 1DUYA 1S7VB 8FABA 1V5JA 3GI8L 4APQB 3BRGC 3VXPB 3NIGF 5MERA 2X4RA 3K0WA 4HKZB 4O2FA 3UTPE 4FNLL 2YD4A 1JFQL 3BH9B 5BZWA 1JTOA 4NJ9L 3TBTB 3VE0B 5IGXL 4DEPC 2LU3A 5GJTH 4F57H 3CSPA 1EZVX 1QLRB 2VWEE 4RA0C 5DRZA 1ZHBA 5F3HA 1NBYB 2GSIB 4WFED 3WDIA 4R3SA 3HKFA 4J4PC 1U3ZA 4HMEA 4PS4L 4MZ3A 1CTNA 4I8DA 2ZJSH 4UOW1 1FG9C 4ZOCA 2P24A 1EO5A 4X6DB 2ZUYA 4PJGA 2XNAB 1OF2B 3QR2A 4GJTB 3VFPB 4I3SL 3ZE2E 4P2OD 1CXHA 5EIIB 1F3DH 2HH0L 3HG1E 4N9GA 4WUKL 3SE8H 1XR9A 4I9WD 5GGSA 3LS5L 2DWEA 5A43C 3MUZ1 4JKPL 4Z7UF 1U2CA 3RNQB 4O2FB 3EZJB 4F33B 4KK8C 1D9KC 1T0MA 4JDVB 5GSVB 2APBA 1HH6A 5C9KA 2NTFB 4ZYKB 3U7YL 1JGUL 4PJ5E 2IPKA 1SMAA 4GW5B 5EH1A 1JIBA 2DM3A 3OGCB 3HPLA 3RWEB 3I75B 5IQ7H 3MFGB 5FYKE 1LO3L 3MA7B 3DXAD 1IGCL 2CSPA 4P5KA 2WUCL 1NFDB 5D7SL 2W9DL 1OP5H 3GMPB 1E4KC 3QO0B 3LEVH 5IROA 4OCSL 1VENA 5D2LE 1IBGH 5CBAA 4YEFA 4OZIE 2R69L 4JAMA 5GJSL 2BNRA 4GOSA 5DRWB 4WRLA 5BOPA 4JFDE 2BSTA 3DV4B 4ZFOL 4H26A 3TYGH 5CJ8A 5C08D 5GS2D 4U1KB 3DECA 3IRPX 3AM8C 1LO0L 1MJ7H 2FH6A 5F7DA 1YYLL 4LKXB 3VG9C 4MSWB 1P5VA 3S97C 4XZUA 3PP4H 1BAFH 4NN6C 4P9ML 4EUPB 1CCZA 5ACMA 2L0DA 2EDLA 3HPLB 4JG1L 3VXUB 4M1DH 1KCUH 3LQZA 5E8OB 3MNVB 2ZUQC 2VDLH 1H5BC 1INDH 4YPGA 1FL6B 2BDNH 3WN5A 2YZ1A 2EO1A 4M02A 3HR5A 4GKSA 4HUWA 1HWHB 4V1DD 1CF8H 1NUGA 1SBBA 3QULB 4L8SC 4PJ8A 4PJHB 1SEBA 2IANB 5L9DL 3QUKA 3HPJB 4R0LA 1S5IL 4JRWA 5JW4N 2A9NH 3L3JA 3VXQB 2EIDA 5IFHH 1B0GB 2HFGL 2NXYC 2B5IC 2DMKA 2MQ0A 5ANMA 3BKYL 4FQLL 4UINL 1MWAL 3CGTA 2VLJD 1KXTB 1CXFA 4QTIL 4JN2A 3JWOH 2NY3D 2Q7YB 1UB5A 1KPVA 2FSEA 2BXYA 3HFML 2E9BA 4M8QB 5E8NA 1UCTA 4G6MH 1QPXA 5E2UH 2HFTA 4MNQE 3MV7D 1IC5H 4PJIA 3BP4A 1JTTA 3V4VH 2UY6A 4PJAA 3TZVD 4X6CF 2FJHA 5MEPB 4ZMAT 3RFZC 3GM0A 4UV7H 3RVWD 2IG2L 4XX1G 1GXEA 4OLZH 1X5FA 1DQTA 3TIDA 4DZBA 3MYJA 4ZXBB 4XWOD 2CRIA 4HK3J 3RWJB 1LGVA 2VLMD 4ZS6C 3MLZH 1FDLL 2CO7B 5DGRA 4TSCH 3VD5A 5DJ0A 4Q9QL 1RIVH 4JPIA 3H3PL 5JA8B 5L2KB 1FZKB 2HKHL 1D5MA 5KVEH 3EAKA 5F96L 1L9MA 1F6LL 5LAXA 4OCWH 4M61B 2ORBL 4P4KD 5SX5K 1K5NB 1A9EA 3CFCL 3L3OA 4LHJB 2C3XA 4L8DB 4O51B 1I4FA 4GMTH 3QUXA 2XYCA 1UC6A 3DRQA 2XQBL 4WI8A 1RJYB 1JWUA 1RULH 5DMIH 5L8JB 2I24N 2YPKB 2H1PL 5F7KC 2FNBA 5TDPA 1IGTA 2XN9D 4U3XA 5AZ2H 4KXZH 3OX8B 5BV7B 4FABH 5I75C 1V3KA 1ORSA 1T4KB 5FHAH 3S35X 4AH2B 4JFYB 4QRRB 4M9PA 1P7KA 5ENWB 1NANH 1NEUA 3BKCL 3CPLB 4OIBA 1F6AA 5LAXB 4C83A 3LKSB 1A6PA 5D1QA 4NWUL 4YDIH 3FB6B 2ILLA 4MXQC 1OGTB 1NAMH 1KB9J 3QEHB 1NAKL 4HWZA 4WGVB 1IGJA 4P2OC 5D7IB 3FQUA 5I16A 3CSBA 2MQCA 5JIPA 2DF3A 5GIRA 3CFJA 3ZYZA 1D5BA 2BP3A 1JWUB 2VDQL 2QL1A 4LSVH 5C0IB 4F37F 3AXLB 1RUPL 1JJUA 1ROWA 2BSSB 2AP2A 5DHVH 1X5JA 4CL7A 2CH8A 2BHZA 1JWSA 3EKCA 2E27L 1P7KB 4NT6A 5F89B 3QUYD 3GSOA 3WFDL 4LGPB 1RZIB 4LSRH 1UVQA 3NFNB 3T0EB 1OTTD 1IQDB 2P7TA 1VPOH 2CMRL 3HC0B 4NKDB 2APTA 1MWAA 3E6FA 3X3FL 2QSVA 2ZKHH 1MFNA 1R5WB 1DEDA 1N8ZA 1IAKA 5EU7E 2BY0A 3FT4B 3OKOA 2OK0L 3CJJA 4RIRA 3F58L 2J5LB 1J8HD 4YXLH 3SE4C 2X7LB 1EXUB 4BQ9A 1YA5A 1U3JA 3U46A 3KDMA 2R29L 5SX4H 4U1IA 1I8KB 3NFSH 4X5WB 1Z5LA 2VZ3A 4HXBL 5C0EB 1FL5A 2J6EL 3SJVE 1HEZA 1KJMA 4MS8D 1PD6A 4BSWA 1RZJC 1U8KA 3MLSL 4P2RE 2ADIA 1M1SA 2YPLB 4Q6YA 5AWNH 3SGDI 4HT1H 4N8CL 3VI3E 1N5YH 1WLHA 1VDGA 3PWPB 4JPKH 5BMFL 1BWWA 5KG9A 1IAKB 3GMOA 2FWOB 3S4SB 1BX2A 1Z2KA 2IBBA 3K8MA 2NCMA 3ULVH 5EBMA 1RZ8A 2B0SL 4MCYA 1U8HA 3VW3H 3S35H 4MD0A 4UTAH 1D5XB 4O9HL 5DR5H 5E2VL 3VG0H 1FYTA 1JE6A 4J23A 2A6KA 4KHTH 2QR0B 3OJDA 1AXTH 4O58H 3JTSB 5I30L 3GIVB 1DN0A 4WENB 2Q3AA 5ADOL 3A6CH 2ZCHH 4UIMB 2A77L 3RVWC 3FQTB 5C09B 1DQLL 4LLMA 5IKCA 2APXA 4XWOC 5HYJE 6FABL 3GHBH 1BFVL 1TQBB 3I6LE 1ZLWK 1ADQH 1QA9A 2QQNH 3AVEA 1GGCL 4NJAL 1HSBA 15C8H 1K4DA 5DURB 4PRNA 3CDGA 3KHQA 3ROOB 4CMMB 3V5HA 3SCMB 4BH8B 5EO0A 3OKEA 4P4KC 5LCVL 1Q0YH 2H8PB 1EMTL 1SM3L 5DK3A 2DQGL 2FD6L 3QCVH 3QIBD 1PG7L 2BVQB 5E94A 3UZEA 1T20A 2OQJA 1DN0B 4YBLB 4E9LA 5IF0B 4MJ5B 3HZKB 3UTPD 4BQ8A 1VB9A 4YR6B 4JHZA 3MROB 4XBEH 2B8OT 4C56A 5GRJH 4OCYH 2VITA 2E9WA 5DJAB 1SYVA 1OB1A 4OZGE 1RZKC 3MREB 1K4DB 3CH1A 5DEGA 3MRBB 3UJTH 5IEKB 3S6CA 3O3EB 4RWHA 2GIYA 2XICA 2G75A 5FYJU 3MRJA 4RNRB 3GBML 5IHUH 2DKMA 4XNUH 4B53A 3E8UH 3CVHB 4LHUB 5EFIA 5TQ2L 4QRUB 3CLEH 4A6YH 3HG1D 4YHNB 4WO4B 5D6DC 1DFBH 4Z7UA 3MV9E 5IBTL 3KR3L 5C92A 1CLYL 4UMGA 4ZO9A 5HJ3B 3ZTJH 1R0AH 4FQXD 3G6AA 4GS7B 3K1DA 5MEOA 2XFXB 2EKSA 5JR1H 1FGNL 1MIMH 4OF3A 4XNQA 1CBVH 3KPLA 3QUYC 3QXDB 3SDYL 4DKFH 3D85D 4HUXA 2Z31A 4S1RL 4EKXA 1OQXA 1TQCC 3UBXA 4NN7B 3HNTH 4OLWL 3NH7H 4PGCB 5FGBA 1JGLL 2JB5L 5KTEL 2YC1A 4PP1D 3ZDZF 2AK4B 3GGWA 3U0WL 4U1GB 4ZAKD 4LSPL 4FQJL 4Q6IA 5FGRA 2MHAA 5HPOA 4JFDD 1VFBB 2VLLA 1KTDB 1WIPA 3L3KA 5E8EB 5AD0B 1SYSA 2IAMA 1VEOA 4JCLA 1S7WB 1ZS8B 4FFVD 5CEXA 4NM4L 3G6AB 1F3RB 4HWEH 1ZVYA 1T1YA 2HYMA 4NQCE 5ICZA 4OJFH 4KKCD 2DIAA 4NKIL 1BVKA 5HGBA 2OTUA 1UJ3C 3FO1A 2GTZB 4MS8C 3KYOB 3MRCA 3QI9A 1CFSA 3FT3A 5FM4A 4G8FB 3D39A 5EBWA 3BRDA 1X5AA 5FO7A 1DP0A 4JRXA 4OAWA 4NN5B 5GRWA 3SN6N 4M48L 5EWIH 1F11B 4BFIB 5E6IB 2OM5A 3AUVA 4PJFA 1K85A 1PLGL 1FZMA 4IRZL 2FLRT 5DA0B 3F6LA 2VDOH 3EYQD 3GMQA 1SVZA 1U3HD 4FS0A 4LSTL 5SV4A 5JHDA 3TFKD 1S7SB 5I74B 1GRWA 1MAMH 3FO1B 4KJPC 4X6CA 1H3TA 5FF6B 5HYFA 5I1HH 2AABH 3MMEA 4BFEA 5DFTA 3O9WB 4KZDL 1G9NH 1U8IB 1A8JH 1WTLA 1KB5H 4ZUWB 1RV6X 4HKXB 4LVOC 4HIIB 4BZYA 3ARGD 1N6QL 2VDRL 4X80L 3ALPA 4RFNB 1FJ1B 2L7UA 1F02I 2JIXB 3H9SA 4BSVA 4K8RD 3RAJL 3UYOD 3V95A 2P5WA 3CUPA 2OJZH 2AJSL 1X7QA 4NSKB 4Y2OA 5DRNB 3MXVL 5D7KD 1VGKA 1MREL 5JHLL 1BZ9B 5ID0A 1ZGLA 5FUOL 2RQ8A 4FP8L 4I0PA 1F3JB 4NFDA 5L0QB 2Y5EA 4YO0B 5K9QI 2E6QA 3QIBC 5DO2D 4Z7QF 5D2NE 4ELMB 3MRMB 2H26B 4PLKD 1ZEAL 4XHJD 1WBXB 1CICB 5TJWK 4G8EA 5CZVL 5JW3H 2AJYL 5SWZE 3G6JB 5DMKA 2E7CA 3GSUB 4HLZH 2XKNB 4JREB 5EU5B 1F58L 1UACL 2XG5A 4HS6B 1YY8B 1MIEL 4MXVF 3WD5H 4FXKB 5EA0H 1LO5B 1LEKA 1U92B 5I8CA 2VSCA 1EO8L 1MCPH 2VISA 4LRNL 3T3ME 2VWEC 2OBGA 2X41A 3ALWA 4BZ1H 4ODXA 4YZFE 1IZKA 8CGTA 1KLUA 4RMQA 3FAWA 5IW3A 3OAUL 3RUGB 4PGZA 3ZSTA 2P5EA 4IIQA 4DAGH 4OD1L 5CILH 1G9ML 4G9FE 4U05A 4PGEB 4I4WA 4KGJA 1QFWL 1WJ3A 1TJGL 5HHMD 3NBNA 1A6ZA 1QTYT 4LEXL 5J11B 3VXOB 4OM0L 4HWBL 3EDKA 4LVNC 3VXSB 4R4FH 4X4YA 4MNGB 1DDHB 3SGDH 4M6OL 5EU6E 3ZKMC 3T1WA 4XCEB 2D03H 2EYSB 2R1XB 1FL3B 5IIEB 5CJQL 1FZJA 5HBBA 1JRHI 3HZYB 4H1LG 3EYUH 5I19H 1OL0A 3M8OL 3DYOA 4X6DF 4ZAKC 3D0VA 3HB3D 4IIQB 4JRYE 3OXRA 4KRLB 5IB2A 4UTBL 1JZ8A 3WE6B 4G8IB 5FCSH 5T3XH 1YMMA 4MD4B 1ZSDA 1YEEH 3C60B 4FFVC 5EIVA 1CT8B 1HXMB 2DQDH 4NBYB 3UJJL 1NGYB 2DMBA 1CFNA 1U0QA 3TWCL 1BQHG 4H25A 3BZFB 4TPRL 4PJCA 5I1IL 4LCWB 4AEHH 5DHYB 5BXFA 1E4XL 5CLWA 1DJSA 4KKCC 3WDHA 3O3BB 3BEVA 1EFXB 1E6JL 3CC5B 3RIAF 3MCG1 5C0DB 1JF5A 1SJEA 4OZHE 4L4VE 4L8CA 4WEUD 1AFVL 4DK6A 3BO8A 4EBQH 3IJYB 3O8XD 2QSCH 4K71B 5FGCE 1JTPA 1NFDF 1T89C 1D6EA 4I18A 1S9XB 3DX6A 4P2RD 5HTSA 3BGMA 4CN6A 1E28A 2IBZX 5F8RC 1LDPL 4YDLB 4Y0GA 5DLML 4XPAH 1BBDH 3JV4B 2HT3C 1Y6NR 2A74A 2OXGA 3O81A 4K7FB 3NCYP 1U8QA 3KXFA 4AT6A 5I9QC 4NRZB 2DQFB 3LEYL 3MRDB 4PJ9B 4PPTA 4POZC 1BZ7B 1IE5A 1KB9K 5F6HJ 1HHJA 3MJ9L 2WBKA 4J12A 5DMGD 2R15A 3TFKC 1RURH 2ZOLB 2SEBA 4NBZB 5H35B 5ADPH 1U95A 3DVNA 4OZFG 2DAVA 1D6VH 2Y36L 1CLOH 3CXDL 4I2XE 5CP7A 4PJHF 4HPOL 4X9GA 4H0IA 2BNQB 2WIIA 4XMKH 4BZ2L 3ARGC 4N90E 5DRXA 2BOBA 1T03L 3CZFB 5ICYB 4NQUA 1EEYB 1J0YA 3I6LD 2YEZB 1U93B 2Y7QB 5JDSA 1KTDA 3IXAA 2XPGA 3KPPA 2VN7A 4FTVE 2NY5H 2MPAH 3OZ9L 5B39B 5IHZB 2VAJA 3WEXB 5ISZA 4TQEH 2AJUL 1N59B 1J11A 4K3HA 25C8L 3RWGB 1J10A 4KGLA 4M6NH 1TFHA 1YECL 3DX8B 5CJXC 5DO2C 3PIQB 4EZMA 3EYFB 1U8JA 3G6DH 3GI9L 4OQ1A 4PLKC 4TSBH 1QNZH 3BIBX 5HHOA 3JWDL 2VDMH 3VCLB 2EE6A 2VB5A 4HHAA 1QRNE 3JVGC 1CGUA 3WBDA 3WSQL 1NAMB 3KYNB 2NQCA 3L3GA 1WSST 2ADFH 3B9KB 3VRLF 4RFOL 4F9LA 2QTEA 4OD2B 4HWUA 5C08B 3BZDA 4HH9B 2BXZA 4JFOB 3QNXB 2VLRE 5D8JH 1TZIA 4HJGB 1DLFL 2V5YA 3PL6D 2PTVA 3KPSE 4MA7L 4XC1L 1L7TL 1IGYB 3ZL4L 5C7XL 3GSRA 3OAZH 1CQYA 1OAYH 4LCIH 1GZQA 5DHVB 2X4TB 4IBLT 1EHLL 2R2EB 2VXUH 3KHOA 1KFAH 3MV01 3WIIL 1RAMA 5TF1H 1K3IA 3PWNA 3TM6A 4P46D 3MV9D 1ZLSH 2AGJH 1RJLA 2NLJA 2JKXA 2KKQA 4HK0A 1BEYH 4KDTA 3AU1A 3P0YL 3SPVA 4OIIH 3D9AL 4N0UB 1YN7B 3VJ6B 4RFEA 1NCCL 2CJUH 3O4LA 4R2GD 5TE7H 4GG6F 4JM2F 5GRYA 2YXMA 4N0FA 3DSFH 4K94H 1R5IA 1A7PH 3OKKB 1W72H 2EYTB 3MRNB 2VLJB 4WWKD 1KTKE 3RU8L 1WIUA 1NMAL 1UYWL 5H94A 5C2BH 2NY3B 1XGPA 1IGFH 1OGAB 4PRIE 4LLDB 4GG8B 4RMVA 2DLTA 1F8TL 3X14B 1JYNA 1NGZA 5JLZB 3QBTB 7CGTA 1NMCC 3MV7B 5JQHC 5B4MD 3EJZD 3H7LA 4K3JL 5DFWH 3RQ3A 3ECBA 2R0KH 5SWSA 4JFFD 3DUSA 1XZ0A 5EU7C 5IBLD 3UEZA 3BFOA 5CUSL 2NLJB 3RDTA 2WUBL 3TZVB 5DD5H 2JB6B 4XWGL 1C08B 1X5KA 1XGTA 4XP1L 3GB7B 5FOJA 1MLBA 4ZOBA 5F72S 3V7MA 3QEQB 4UDTA 1YNTA 4P3CH 1T2XA 3TLRA 1XGYL 1JNLL 3KNBB 3GRWH 1PBYA 2F74A 3BESR 4QXGH 2B2XL 1OOAA 2R4RL 2B1HH 2I9LB 4A2MA 3QDME 3W9DA 2J4WL 5AG8A 3B6SB 3H3KA 1S7TA 3O8XC 3OJVC 4LF3B 1PGRB 1V3MA 5IB3B 4P2QD 4S1SL 1NGZB 4EI5A 3O41A 5J9PA 4KQ3H 4N0YH 3ES6A 2EZ0D 1XF5A 3G5YA 4DQOH 3BUTA 2P43B 1P69B 4X98B 3MQIA 3NZHH 4YK4B 4MB5A 5HXMA 4CNIA 4M1GH 1AHWB 4FQ2L 3BAEH 4ZS7L 5AUMA 3QEGH 1QACA 1S9WB 3RZCD 2D4FA 3QJHB 2ZNWA 4GXVH 3P4NA 3LHPL 4LAQL 3ULUH 3VA2C 2MQ3A 4Y1AE 2ZSWA 4AENA 1RUKL 2DM4A 3MV8E 4ZPTA 4XI5D 5DMGC 1WITA 5D5MF 4Q9BA 3S34L 1YJDH 5IESH 2WW8A 4NQXB 5B8CC 4D9RE 2QHRH 2VUOA 3RWCA 2XWTA 2Y23A 2EE9A 2BCKA 1JGVL 4N0CD 4MHHG 3TO2B 4KTEH 4OLYH 3T2OA 4MNHB 4OKVA 1JP5A 3EOTL 5I1CL 3NIGE 4KJWC 5EORL 5KJRL 3ZDYF 5KSAC 1BQLL 2DQUL 4QWWD 5C0CD 4DGYL 3MODL 3NIFE 1KELH 1CDIA 1E4WL 2CLVB 2DMCA 2VLKA 1UZ8B 4JDTH 4B7LA 2V5RA 1CK0H 2YUVA 3GHEH 2H3NB 3WL9B 1KEGH 2FYYA 3TV3L 4NZJA 4PUBL 2H9GA 4F37K 4BQ6A 5GGRA 2I26N 2Z35A 2BFVH 4J2XA 1ZHNA 3BXNB 2AXGB 1DSFL 5DK0B 4LMQE 1NCDL 4RGOL 5CEZH 3QDJE 4PRHE 4URTB 1XR8B 1Z0MA 4NQSA 2HA1A 2R23A 1J0HA 1JRHH 4LU5L 5SWZD 4GRWH 1QBMH 4FZ8H 1JK8B 2JCCE 1QSEA 3GBNL 2VDPL 2DM2A 2OZ4H 3HZMA 4PJBB 5D7JD 3VI4F 2FX7H 4D0BA 3DTXB 2P45B 3DV6A 4A6YB 4XNMA 4M7LH 1CZ8H 2I07B 3TN0D 4AEFA 5MENA 4EXPX 1ZA3A 1UA6H 5CSGA 2GSGB 3PL6C 4D9LL 3RY6A 1AQKH 1NCNA 1BIHA 4L29A 3HE6B 2CGRH 5IFAL 1U3YA 4ACPA 4HKJB 3MTRA 2LTQB 5F9OH 4L4TA 4RZCA 4G9FD 1T2JA 2FR4A 4NRYB 2IQAB 4MXWL 4P46C 4DK3A 3DVFA 5HYQB 1KCVL 2W92A 2A6DA 1N3NB 4EDWL 3B5HA 4ENED 1JYWA 3QFDA 4R2GC 3A6BH 2YOCA 4HDIB 3L3HA 3BZEA 3FTGA 5EU6D 4WCYL 1A2YA 2J3SA 2BRQA 3KPNA 5E9DA 4JO3H 3QCUH 3BT2L 4WWKC 4U1MA 2PXYB 2XTJE 3LN5A 4LNRB 35C8L 4V2CB 5DVNA 1FFOA 2FEEL 1BVLA 3EFDH 1H8SA 4IMKC 1R3HB 3RWIB 4I13B 2WAHA 5E95B 2BHYA 1FE8L 1QYGL 2X1QA 4JRYD 4IOIB 3O3DA 3EJZC 5B4MC 1VKXB 1X4ZA 2FR4B 1U2HA 5B3JF 1MHHB 1FFRA 2GY5A 4N0RA 1NLDL 4QOKE 3C6LD 3CH8A 4E0RB 1I9EA 1KB5A 2Z92B 5IFJA 4CDGC 4R90H 2AJZA 5ITBH 1KIPB 1FVCA 4Z78A 1HOCB 1IL1B 1MFCL 3IDYB 4PTUB 5IW6B 4ODUA 3GMNB 1NFKA 4MCZB 3X3GH 4L1HA 2YKLL 4L4VD 1N2RB 2VQUA 4D94A 2H32A 1OW0A 4AQOA 1IARB 3FN0H 4M1CC 1DLHA 2PO6C 5ETUB 1KPUA 1FORH 1I7ZA 2EZ0C 3QWQB 1A1NB 1DQJB 2AW2A 3VGAC 3G04A 4QHNA 3W2DH 5CD3A 4PGDB 3SDDB 1MCHA 3G08A 3W0WA 4NO0D 3RZCC 2UZYB 3KPRB 1KBGH 3IFPA 3B5GA 4Z78B 4U1LA 4CN1A 3BH8B 4XTRC 2M2DA 4UNUA 3GJFH 2VYRE 3QZWA 4XI5C 4CAGA 4Z76B 2RCSH 2MFNA 2VXQL 2CDEB 2ENSA 2K1MA 3FFCA 1DQMH 4FQQB 2FBJL 4CVZA 2YRLA 3IS1X 4JFZL 1H3VA 2Y4SA 1MOEA 4GKZA 4N0CC 2O5ZL 1A3LL 2X09A 3NIDF 4N90D 4CMHC 5HGHA 3D0LA 4I0CC 5GS0H 2DQIH 2Q8AL 3GUTA 1MI5D 4G6AC 1ZLVH 3EHBD 3V6OE 1GCFA 3LOWA 4FTVD 1PSKH 1BGXH 4FQXB 4LDOB 2B1AH 1QBAA 1WBYB 4Y19D 3WJJA 1L0XA 4NNYB 1IGIL 1BFOB 4JHWH 1X4YA 2FBOJ 3MR9A 4YHYC 4F58L 1IAIM 6CGTA 2ADGB 3UTSA 5C0FA 1ACZA 3MJ7B 3QDHA 4CVZB 4F7PA 3IDMB 5D2NC 4MMZC 4ZNEA 1XIWC 1I3GH 4JFXA 1N5AA 4G80B 1TMCB 1WWCA 4N5ED 4UQ3A 5C9JA 3VDCA 1KJ3H 4PTTA 1QRND 2WP3O 5I8EB 4PRPD 5HGHB 1OP9A 3EJYD 5TE6L 4R4ND 1PFCA 3ETBF 1A7QL 1NC2D 5C6PB 2FX8L 3MLXH 2K9UA 4KJYB 1KIQA 5E2TL 1FYHB 3TN0C 2NY0D 5IK3B 2DI9A 1XMWA 1HZHH 2EH8H 2WANA 3LKOB 3BQUB 3EO0A 4G6JH 2EDWA 2FB4H 2R4SH 1DQDH 4MQ7B 2BX5A 3MUHL 4MGXA 5D7LA 5DJYB 3MRKB 4U1SB 1B4JH 1Q9KB 4X5LA 3MLTB 1LE5A 1ZV5A 2QQKH 4XHQA 4OKDA 1P5UA 1KCRH 1Z3GL 1HN1A 1VADA 4ELMF 3LQAC 4Y5XB 3P77A 1BQHB 3PWUA 1AO7E 3CX5K 3O11A 4GG6A 4JM2A 1FFQA 4WI6A 2GW5A 3W11D 4ENEC 1KGCE 5ALCH 5BW7C 1MFAL 1XCQB 4MJIA 3NCEB 4I3RH 2G9HB 3L3DB 5CSZB 5L2JB 1Y0LA 4X9FA 1O7SA 3UTTD 2BOCA 4NQDA 1J1XH 2PW1A 2NY7L 5J6GA 1FAKT 4MJ6B 2XKSA 1U3HB 3S98A 1YPZB 3GMRB 4QRPA 4FFYL 4PJXB 3RUGF 2X1OA 5BVPH 1FGVH 1KXQE 1YY9D 3QIWB 1KULA 1AGFB 1IT9H 3D18A 3S5LG 3VXTA 4U1HB 2P8PB 5J1TC 4EXKA 5KVFH 2V7NA 5FM5M 5IOPA 3C6LC 4KI5E 4Y4KD 4NM8H 4P2CG 4XXDB 1IJ9A