5JR1H

Crystal structure of 10e8 ghv-maturel antigen-binding fragment.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
232
structure length
227
Chain Sequence
EVQLVESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVGRIKSKTDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCARTGKYYDFWSGYPPGEEYFQDWGRGTLVTVSSASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 10E8 heavy chain
publication title Developmental Pathway of the MPER-Directed HIV-1-Neutralizing Antibody 10E8.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 227
sequence length 232
ec nomenclature
pdb deposition date 2016-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jr1H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jr1H02
4U6HA 4AT6B 4CVWA 5IJVA 4GRWH 3ROOB 1CDGA 1EPFA 1NBQA 2CRMA 4WNQB 3WDJA 1JPFB 3PHQA 4V2BA 3QIWB 4QOKE 3VFRA 1OGAB 1V3KA 2AV7A 2BY2A 3S97C 4XBPA 1LO0H 2NY4C 2EDFA 2B20A 3QXUA 2VXTH 3MLRL 5L2KD 3SQOL 5DRWA 1Y18A 5GISL 4QTHB 1WAAF 1EEUA 1AIFB 1S7UA 4UNTA 4Q6YA 1FRGH 3OF6A 3ZE1F 2X4TB 4HBQA 2V5RA 1IGTA 4MCYB 5AWNH 2GJJA 3F5WA 5AYUL 1NCAL 1KACB 1D6EA 3MNVB 3IJHB 4HWBA 5E6IC 4JY6A 4ELKA 5CZVL 1DQML 4ZS6C 3QG7H 5C08A 3SJVE 1BOGB 4E41B 1W0VB 1ZTXL 2Y4SA 1SM3L 3U0TA 2G60H 1ZOXA 5EIQA 2MPAH 5TQ2L 1C5CH 1G9EA 5BQ7B 4J3VA 1C12B 1JGDA 5J57B 2HVJB 5GS1A 1BM3L 4TSBL 4F3FA 1HHJB 4WO4C 2XXCB 1DBMH 2F5BH 4PTUA 4P2RB 4FXKA 5D7LE 1FZOA 1N4XH 1S5HB 1EEYA 3KXFA 1U8LB 1OTSC 2KZWA 1AKJD 2VDQH 4ZFOB 2OBGA 4OM1L 1A7PH 4ALAL 5FM5O 4OLXL 4WEBH 5GZND 2A73A 4H8WC 4XRCB 3TIDA 3FFCE 3M07A 5IEKB 2V9TA 1LQSR 1AQKL 4EEEA 2JCCF 5GRVL 2Z93B 3FN3A 1P7QA 3DXAD 5C0BA 1CBVH 5FFLA 5TPWL 2AJYH 3CSYB 1HIMH 4GRLD 4XZUB 3MV9D 4C4KT 1AD0A 4Y89A 4I8DA 4QGYA 3RWJA 4N0RA 4ZUUA 1JF6A 1G9NH 4ERSH 4JFYA 3I50L 5DFTA 5HTSA 1ITCA 1YNTB 3IXTB 5HHNB 1QSFD 5C0GA 3KDMB 4OFYD 4H8WL 4OGZA 4S2SB 4TUOB 1MCOL 1ZT1A 2BSSA 3FB8A 3CFDB 4YC2C 2ICWB 3ARQA 4QOKA 4GFTB 3HAEG 3LD8B 3MRHB 1K8IA 1RQ5A 3L6FB 1X4ZA 1WZ1H 3V0WH 4M6OH 2EXYD 4HFUH 4LMQI 3U9PL 1J05A 1JWUB 1P1ZA 2COQA 1JPSL 4MX7B 4ELME 4IOIB 4JHWL 3GMPA 5IB4B 5EO0B 1EJ6A 4K8RH 1MCRA 1QRKA 4M48H 1ACZA 1I8MB 2IPKB 3C6LD 4ZXBD 2C3HA 2EE6A 2VITA 1HKFA 3QNXB 4EDWL 3LDBC 3PP3H 5IR1B 5FO9B 4WU5A 3RVWD 1A5FH 1D9KA 3C9NA 4R4BA 5BS0A 5EU4A 4OQ1A 4HUVB 4FZ8L 2ZKHL 5I1JL 1RZFH 1KB5B 1FFOB 1JYXA 3KPRD 1OLZA 4DGVH 5IFHH 1IAIL 4ODSH 1N64L 3EFFB 4Y88A 1YEKH 1RUMH 5JHDE 5L0QC 5D9SA 5GZNC 4D9RD 3G5XA 1ZE3C 4KI5C 4HUWA 2VWEC 1OW0A 4O5LH 4GRLC 2B1HL 3RX8A 1R3LA 4OFVA 2X1QA 4U2YA 4RX4D 3SKUD 1U8QB 4EI5D 1EFXB 3MFGB 5HDBF 1FG2A 1HCFX 4MHHI 3P9MB 1KG0B 2OI9C 1MCPH 4HGWA 1FNFA 4WGWB 4BUHA 1YN7A 3QI9A 4B0MM 4DTGH 2GFBB 2NLJA 2OP4L 1AE6L 1RU9L 3RGVB 3ZHLA 3BD4A 4P4KD 4YUEH 4JRYB 1MRCH 2Q8BH 5DYOB 3LKPB 3MZGB 1LP9B 4KTDL 3LEXB 4X80L 1BBJA 1FBIL 2GCYB 5DLML 3SKMA 3NOIA 5IMOB 2QQKH 3GSNB 4JKPH 1MIEH 1F58H 1MCJA 2EXYC 5J6HB 3SN6N 4HH8A 2CDGB 1NBVH 1F3JB 1DANU 4FP8H 5LKNA 2GK0B 4RGOH 3FO2B 1PEWA 4BZ1H 1QFWI 1FYHB 1AXIB 1B6UA 3I6LE 3AU1A 5GGSY 1NJ9B 4N8CL 3C6LC 4ZXBC 1I3GH 3WLBB 4WGVB 2C3WA 1KENH 4YHIA 2NCMA 2AEQH 3RVWC 2LQRA 3NCBB 3VXTB 4ELMA 2JB6B 1IRAY 5MEPA 4Z77B 1MLCB 4UOJA 4YZFE 1A7RH 3UO1L 4GBXA 4OBRA 1PSKL 2OLDA 3BKML 1DDHA 4Z7WB 1JL8A 4PJIB 4PP1D 4X7CC 1H15B 3S34L 3RVTD 1EEZB 4HDIB 2XFXB 3F6IA 4XGZA 5HHOE 4X4ME 4D9QD 5LGJA 5DJXA 4XP5L 5ANMB 5E9DB 3BPLB 5IMMB 3T65A 1IBGL 4XP9L 4FNLH 4QRQA 3NACH 3TN0A 3DRTB 3VWKA 1RFDH 4OLUL 1OGTB 5IB1B 3BQUA 4EI5C 3RVUD 3E1F1 2IADA 5ABDE 1QBBA 4NCDA 3THML 3QCTL 1J18A 2OTPA 4JVPA 3QNYA 3MLXH 5JHDA 1ZGLB 2BVTA 5E94B 3WFEL 2DQFA 5EZIL 2ORBL 4GXVH 2Q86B 5TH2A 4JO4L 4WI5A 2XKUA 4PJEF 2P46B 3FQRA 2VSCA 4P4KC 4FTVE 4P23D 4Y1AB 1K4CA 3NA9H 1RUPH 5DUBB 3BWUC 4D3CH 3BYTA 2QEJA 5MHSE 4MQ7A 5F3HB 5A3IC 2IJ0C 4V1DD 4GAJH 3JV6A 2YUWA 2VISB 1V8HA 3RWEA 5EORH 1JZ7A 1AGDB 2FB4L 3HMXL 4OZIB 3U0PA 3MRNA 2ED9A 4Z7UE 1XCTB 2CUHA 4LIQL 5F7EH 1N5YH 1RVFL 4ZTPH 2XZAH 12E8H 2AV1A 4NM4L 1DEEA 2D0HA 3PHQB 1N3NB 4F58L 3OXRB 4UT6L 1KPRA 3RUGB 5I0ZA 1CLOL 2MJWA 1E4KA 2HJKB 3BEVA 2BFVH 1JK8A 2EIDA 1PY9A 2M26A 4FQ1L 1JZ2A 1R3IH 2ZCLL 3BIAX 4PP1C 3M45A 4OIIL 4AM0A 4P2QE 3RVTC 5I8EA 3F58L 1MCLA 5F7MC 5IP4A 2BNQD 3Q1SH 4WEMB 3MV7D 1U93B 3RWHA 3QDAA 4MB3A 8FABA 1RAMA 2AJUH 3PP3K 4KQ3H 4D2NA 5IFAH 1XF2A 2XRAL 2LU3A 4TVSa 2C7UB 5ID0B 3RVUC 1Z9LA 4XI5D 4OZGE 3C5ZA 3RTQA 2C9AA 1T83A 1TQCB 4LLUB 4YDVB 5HHOA 4X4MA 1Z0NA 3P2TA 1GOFA 3ULUE 1A1OA 4PJXF 4HPYL 1CICD 4LU5L 4OZ4B 1Z3GH 1QSFA 2VXQH 2HFGH 3L5HA 4GRWE 1JGDB 5C0ND 3TPUA 5GS1B 1RIVH 2D03L 3HI6H 1JGVL 4L4TE 5SV4A 4FXKB 1HKLH 1MUJA 2L7UA 1M71A 3LZFL 4K7PY 4OZFH 3QDMB 2AXFB 1MHCB 4BSVA 4MHHG 5E2VH 2KBGA 2LV4A 4KJYB 1A3LH 3EYFA 3IDXL 4MB5A 4F9LA 1I1RA 3CDGA 1AGCA 4JGUA 2A73B 4FTVA 2UY7A 3HZYA 5JHLH 1CU4L 3P0VL 3EDDA 3F7YB 4M3KB 3VFOA 4BQCA 1CGSH 3FN0H 1S9KC 5F9AC 3ULVH 5FKAA 5GGUB 4OUOA 4YDKL 3AB0B 1AD0B 3CAFA 5B38A 4U1SB 1UFUA 2JJWA 5DEGA 5DI8B 3FQTB 1X3DA 4O9HH 4OCXL 1JE6A 1YQ2A 3RZCC 3G5VA 4JZJA 5F3BA 2VLJB 1LMKA 5D7IF 4FQLL 1S7SA 3SOBH 15C8H 5ICXA 1I8IB 4LAQH 5BZDA 4X83A 3TFKD 3PGCA 2HVKB 3FB8B 5D6CA 5IV2A 3MRPB 3OV6A 4MAYD 4WUUE 4JFQA 2HT3D 1ES0B 3BPOC 3VXRD 1NBZA 1DN2A 1RURH 1JF5A 3EIFA 5MENE 1NCTA 3I2CH 5E8OB 5ILTL 1ZLSH 2HRPL 4ONHB 5DGQA 5KS9E 3B6SB 4S0TD 1XF3B 3D69A 4XI5C 2YZ1A 5DTFA 4LCIL 1IGJA 4P2QA 5FGRA 1GOHA 1IARB 4IHOB 4RMSA 1AXTH 1X7QB 3CFBA 4G9FB 3TO4D 4XWGL 3EJYD 4NQDE 2VITB 1CICC 4M7KL 1H3VA 3HG1B 4UILH 4CMHC 5IHUL 5C0NC 4BYHA 2VR9A 3QO0A 1Q0XH 1WIUA 4RGMC 5M94B 4R4BB 4WV1A 4M02A 1CN4A 5BS0B 5GGVH 5C0AB 2PCPB 4OZGA 4MNQE 3GBMH 3GSOA 3ALPA 4X98A 3S37H 4E5XA 5FO8A 1CFNB 3PL6A 4NQEE 2YOCA 2W59A 1Q94A 3BEWB 4NHUA 3O6FC 1IT9L 1V3JA 4RA0C 3FO9A 1MH5A 3G5XB 3IF1A 5I0DA 1BZ9A 3MNZB 3GGWB 4HUWB 3TV3H 2C1OA 4F57H 5HGDA 2O61B 2FO4A 1AQDA 5D5MB 1R3LB 2WQRA 5FDYA 1RZIB 3FHQA 3V4UH 4XC1L 3WSQL 5DK0B 3BSZH 1FG2B 3QZWG 5E08H 1TITA 2BRRL 4L1DA 1S78D 1VGKA 3VRLE 1S5IH 3E6HA 1EAPA 2OQJB 2VLRB 1YN7B 3QI9B 3LKSA 4X4YA 1C1EH 1H8OA 5AEAA 1T0MA 1ADQL 2UUDH 5HYEA 1PKQB 1CL7H 3GMQA 2R8SL 1N2RA 4MAYC 5HGHA 4G8GB 5ITFB 1IM3B 4H25B 4UTBH 3SGEI 3K2UL 3CFCL 3FN9A 3KYKH 4EJ1C 2B5IB 1WCBB 1HSBA 2Z0BA 5E6IB 3LEYH 3LCYA 3ZT7A 1KEML 3HCVA 4E42B 5BW7A 3SE4A 4WUUA 2IBZX 1CF8H 1MREH 2A9NL 4OCWL 3TO4C 2MHAA 3S7GA 1SYSA 3EJYC 3LAFA 1HQ4A 4L8SA 4XPTH 1MI5B 4CMMB 3B9AA 1T5WB 3KLDA 4GXUN 3RIFF 4JFFB 1F4YL 3MROA 4CADA 3QEGL 4RDQF 1QKZH 5LQBH 1R5IB 1HNGA 4N8VB 5C07D 3ZKMD 5F1NB 2J4WH 1DDHB 3Q0HA 1UWGL 4KDWA 4J3TA 4NQDA 3HC0B 4R4FL 3NFSH 4J4PA 5DJXB 1A9BA 2BX5A 3EBAA 4S11A 4FABH 4UTAH 4MD0B 3O3AA 1XF1A 4KVCL 2QSTA 4RAUA 3ZKXC 2X4QA 2BHZA 5EZOH 4BZ2L 3GMMA 3TCLA 1LO3H 3QQ3B 3I84A 3D3VE 3STBA 2IADB 2VXSH 4NGHL 2DDQH 4YH6A 3SY0A 2X4UA 2R0KH 4HXBH 3ZDYF 4NQEA 2FDBP 1S78C 2YPVH 2V5SA 1ZVSB 2JCCB 3HRPA 5L2KB 1P2CB 2HTLD 5TH2B 4CJ1A 1CCZA 3MRQB 3FQRB 3MGTA 5HVHC 2N4IA 3DV4A 3LN5A 4UDUA 5J1SC 5C9JA 3KNBA 5LJYH 3O4OC 3ARYA 4JM2D 3QRGH 1DBJL 1E28A 5AAWA 3B4NA 4KHTL 3T8XB 1C7SA 2P8LA 1F00I 2Z31C 3EHBD 4P3WA 4J3WA 1OP9A 2B1AH 4MJ4A 1KXVC 3MRKA 2ED7A 1PY4A 2X44D 1FYTE 1QNZL 4MJ5A 1DQJB 4D9LL 1DEEB 3V0VB 1XGTA 2G75A 2JJTA 1W72B 4JDVB 1P69B 4K9EC 3H7LA 2GT9A 1KPRB 2GEEA 4PG2A 4CDGC 3MPCA 1OWWA 3O6KL 3EZ8A 1ZA3A 1HOCB 3NCCB 1MEXL 3BEVB 3MLRH 3ZKMC 3ZKND 5E95B 2MKWA 2W0PA 2VLKE 2XQBL 1NAKH 3DX7A 2JK5B 4AM0B 1AKJB 5TE6L 3VGFA 2P43B 3GRWH 4APQD 2Y9RT 3MACL 5A43C 4BKLA 1FSKB 4Z78A 2V7HB 4K9EL 4N0UA 5T5FL 4DW2H 3VA6A 4N90D 5EN2A 4BM7A 8FABB 5KSBE 3GSUB 2BCKB 3DROB 4RMRA 3DXAB 4PIRF 2WINB 4GRLB 5DT1L 3MRJB 3C5ZB 3SBWA 5CZVH 3AS1A 5EIIA 2DQDL 4JM2F 2HTLC 2OI9B 1INQB 1ZTXH 3L3DA 1AP2B 5JQHC 5CLTA 1QSFB 5JA8B 3L5WB 4J23A 4DVRL 1JHKH 4I3GA 2BOBA 4X6FA 1BM3H 3HB3D 4TSBH 1DBBH 1YNKH 3D3VA 4XCNB 1GPOL 1QPXA 1M71B 4L3EE 2X1WL 4XCCL 3EO9L 4BSVB 4HG4K 3MLWL 1T20B 4JN1L 4JO3L 4O2EB 3EHBC 1NQBA 2FECL 4PJAE 1CLZL 3QFDB 3R0MA 4ALAH 5IVZA 2W91A 3IDMA 4OLXH 4ZPTB 4KQ4H 3EDJA 3U2SB 2F53E 5HGBA 1J8HE 5AUMA 2GTWA 5DC0A 1F4AA 5TPWH 1C16A 2UUDK 3C6LB 3OGCA 1A9EB 3P73A 4HPOL 4ZXBB 5B38G 4FXLA 2ZZUT 2H2SD 4MDJA 4G8IA 3PDGA 3G5VB 3IDGA 4WHYG 5MERA 1U8MA 5T33L 1M7DA 3ARGD 4LVOB 1FYTA 3PP4L 4YHZL 1MCOH 5GQBA 3KPRB 1H0DA 4FZEH 3M17A 4EN3D 3NAAL 3O45B 4JFQB 1J87A 2YRZA 3K1DA 3PABB 4FQQB 1M7XA 5DK3A 1NBZB 1M4KA 2N56A 3OTTA 3G6AA 2AJ3B 4PJHF 5JPMB 4U1NA 2DM7A 1DQQB 3QUZA 1J5OL 4EZMA 3U9PH 4XPBL 4I0PA 3DOSA 2ARJA 1FGVL 1JPSH 3KYMB 1A6WL 4P9HL 4X9HA 4JHWH 2VR5A 4EI5B 5FA3B 4JCMA 4YGAB 4RMVA 2D7QA 2X9XA 4FFZL 3RHWF 4PRDA 1AGBA 3WXWH 4OB5L 2H8PA 4PGDB 2ATKA 4EDWH 3MRDA 5KSBA 1F4HA 3C60A 4ZS7L 4FFVC 3ULVE 2VLMD 4P4KB 3HB3C 5F8QC 1UM5L 1FORL 4C56E 5J06A 3T4AB 4FZ8H 3KLHD 2KPNA 2ZKHH 1OAUH 4NO0A 1OM3H 4ZUWB 5LXGH 1IFHH 3QDGD 4JKWA 3U4BL 1IAIH 4PJEB 1A6PA 1CQKA 3SE8L 1RPQA 1VA9A 4NHUB 1IKFH 3FO9B 1U3HA 4UIMA 5DJ0A 3MGAA 5IFJA 2A83A 1V05A 2HN7A 1YEHL 2FO4B 2R9HC 1CIUA 3PE9A 1FO0L 3BX7C 2MOVA 2B1HH 1D5XA 3CVIL 4H88L 1RK1A 4G7VH 3L1OH 1JN6B 1FZKB 5DJ6B 5FYKD 5IW1B 3H0TA 3EOBA 4PJAA 1EAPB 1JWSB 1U8NB 3EDFA 3LKSB 2VE6A 4OZHE 3ARGC 1UWXK 2F53A 1RZJC 4X7EC 2OP4H 1AE6H 1RU9H 2Z91A 4HK3N 2LAAA 4EN3C 3G9VA 4MJID 5C0RL 5ID1B 4LLQA 1FNLA 2EH8L 1OHQA 4KTDH 3VA2C 3JUZA 5FO7A 3W11D 1FBIH 3N1MC 3IB4A 4JFOA 3BMWA 2GJZA 1WF5A 4CKVX 1B0RA 5BOZG 1FFRA 4HS6B 2ED8A 4I4WA 4JAMB 3S8WA 1HSBB 4BH8B 1I8KB 1RZJL 3S98A 4G6FD 2B4CC 3HCVB 3GO1L 4I2XB 3SDYL 2X1XR 1QRND 1RD6A 4WWKD 5HVWA 4RZCA 1OSZA 4N8CH 2AKRA 4LHQB 1HQ4B 5GZOD 3RIAF 2R1YA 3I75A 4RFEA 3SGDH 1DSFL 4LOUC 2DMCA 4QRRD 4O58L 1T04B 2VH5H 4P23B 1T03L 4OZFA 4Z7VE 1LK2B 1MJUL 1QSEE 5JZ7D 3KLHC 1UVQA 5JTWA 3JV4A 4JM2A 3HI5H 3LS4L 5TE4L 4PJXB 3F6LA 5LCVL 2ADIB 4V1DB 3BKMH 2B4CL 2QR0A 5I76A 4JPWH 3WJJA 5GS2D 1NAML 3VXME 1ROWA 4NWTH 2JE8A 4NJAL 1A9BB 1QQDA 5E8EB 2PYED 2RGSA 4NYLA 4WHDA 4XP5H 1MPAL 3O3AB 3T0VA 2X4QB 3O4LE 4C56A 1A14H 4Y4FA 3QUYD 3TESA 4WHTA 2X4OA 5D6DA 2DMBA 1L6ZA 2OM5A 1LK3H 2Q6WB 1VKXB 5IGXL 5DMKB 1CDCA 2X4UB 3QCTH 4M1DL 3H8NA 1RJCA 3V6OC 3WFEH 1CD9B 1NBYA 5T1LD 2LE9A 5EZIH 1NSNH 2ORBH 5IIEA 1U8PA 5EB9A 1YDPA 4M62L 1BQHB 3DV4B 4UDUB 3NPSC 2EE3A 1XIWD 2FEEI 5C9JB 3KNBB 2AK1L 2I60L 1DVFD 2BNQB 3JUYA 1WBZB 3QXTA 3W11C 3W2DL 4OFPA 5GRVK 3VMNA 5D7IB 3BHBB 4TUKL 1J8KA 1T1WA 5FYKL 1QLRA 4OZHA 3IDYB 3HMXH 4X7DC 5FCUL 1FDLL 3MRKB 1LNUA 3CXDL 4LCUA 4LIQH 5DMIL 3H9SD 4MJ5B 3TH3T 5J6GA 4WWKC 1XGTB 4NM4H 1YUHA 3ARDA 4NUJB 2V5MA 5GZOC 2R2BA 5ICYA 2VDOL 2P47B 2GT9B 2OMNA 4YHYB 3FOLB 3G6DH 2DQTH 4MNGE 3PWPE 3QA3A 3OXSB 1DFBH 5CJXC 4RGMB 4NCC2 5C0FA 4F15C 1PD6A 4FQ1H 1MHHA 2FWOB 4PJBE 4L3CA 3VGBA 2ZCLH 3T1FA 3EJZD 3VCLB 3DX7B 4MB4A 4XP1L 3OKDA 4KTYA 3GSXB 1CTNA 2R2EB 5DMYA 1IAOB 1L0XA 2H26A 3TP4A 3QQ9D 2X89A 3SDDA 3FFDA 1MCIA 4Z78B 1GGIH 4N0UB 5EN2B 3HNVL 3KJ4B 5DJZA 5I15H 3EYQD 1CWVA 3K2MC 1QSEA 3QUYC 4NKDB 4GG6F 2MCG1 1MOEA 3K81A 4WI4A 2XRAH 1K6QL 4RWYL 3JTTA 2J6EL 4P5KB 4RAVB 5EZJB 4JLRB 4PY7A 3VXMA 3MCKB 2WSKA 4Q7DA 2H41A 3QPQD 1CIDA 1GIGH 3HFML 2Q76B 3NBNA 5I1HL 2ERJC 3L3DB 1KJMA 3REVB 3O4LA 3VXSD 4LLDB 1JZ6A 1GXEA 2VO5A 4CN1A 4X9IA 2BOBB 2OZ4L 1XIWC 1PG7W 4MAYB 1X6LA 3CUPB 2RB8A 5GGRB 1TCRB 1CLYH 3OJDB 5DQDL 2L7JA 5FF6B 5CBEA 1MCHA 3IFLL 4XBGB 3IDXH 5K9OB 1DBAL 4HZLB 3T0DA 1N0LA 2EDJA 3D9AH 4WTWA 2YD5A 5F9JA 4KY1L 1Q9KA 2Z35A 5C6WH 5D8JL 1V7NL 1CE6B 3K3QA 5CIPH 1RZ8A 1C16B 3TO4B 3P73B 1VFUA 4U7KA 3VWJA 4YDKH 2IFFL 5SX4I 4POZC 4HWZA 1FGNL 2YPKB 3EYOB 3HE6D 3STZB 2DM4A 4UBDD 1HDMA 2DQIL 4H0GA 2Z4QA 3EJZC 1U8KA 5CD5D 2B2XL 2X6MA 3L7FA 4QRPD 1NGXA 4CRPA 3O3DA 1BGXH 3QQ9C 3LEVL 2RHEA 1T3FB 4A6YL 1CT8A 1E27A 4RMQA 3PJSB 3G6AB 1G7PA 3PWPA 1Z9OA 3QUZB 3ZKXB 1BQSA 4M00A 4QF1A 1T2JA 4TOYL 3UJTH 4ZPVA 5ILTH 2XKNB 4PJBA 4I0PB 2NNAA 3MZTA 1SY6L 5IHBA 1UM4L 4JPKL 3ZTJH 4YBLC 5E24E 1U8IB 1FNSL 3CZFA 4NQXA 4MXVF 4PRDB 1AGBB 3RA7H 4RAHA 2ATKB 5L2JB 3BGFC 1VGEL 3Q48A 2VDNL 4TVPH 5CUSL 1VFAA 5IHUH 3IFOB 1EZVY 5HVHB 3HPJB 4XAWL 3DIFA 1GRWA 2NMSA 3H7BB 2WW8A 3DUHA 4GW1B 3W5MA 3G08A 3OPZL 3CIQA 3MODH 2EDBA 3UYOD 1CL7I 2FX7L 5C0IB 3FT3A 1MJJB 3VFUA 2CDEB 1KF9B 5K59E 1IT9H 1U3HB 1TJHH 4P5TA 1T0NA 4K71B 4NFDA 1QO3A 2UZXB 4TQEL 3UTTE 4PRID 4XNUL 2XTLA 3T3PF 3WXVH 4KUZL 3MRIB 4F7PA 4NBXB 1Z5LA 3VE0B 1FVEB 1ZHKA 1RK1B 3WSQH 2DWDA 5FA4B 1DUYB 3HE6C 4LCWE 3EOBB 1MAKA 2FGZA 2A0LC 4NBZB 4UBDC 4HMDA 1BPVA 3MUJA 3QBTB 5C07B 2F53B 4ODXA 2KZ1B 3O11A 1ULVA 3GRWA 4K3GA 1ADQH 5CD5C 4WFHD 1IC4L 3KS0H 4FFYL 1FLRL 2CKBL 1KIPA 4LLQB 1EHLH 2JELL 3QEQE 1FLTX 2C1PB 2P8MA 3GB7B 4P46A 4Y16A 3K2UH 1G1CA 4PGEB 1RUKL 5C6TL 2FHFA 1B0RB 3CFCH 3WO4C 3G6JF 4OCMC 1J1OL 4I4WB 2XZCL 4I77H 4WU7A 2VKWA 3UTPE 1BD2E 1U2HA 1JNJA 1NLBL 5CZXD 3WUWG 1LD9A 3RBGA 1HILA 1OSZB 4OCWH 4LHUG 2AKRB 1FAKT 1VB9A 2VIRA 1YEJH 3I75B 5LBSH 1JZ4A 1M6OB 4U0QB 2IAMA 4U0RC 4FFWD 1P53A 2FYYA 4L9LA 5IHLB 4N9GB 3WHE0 2E9IA 4IS6A 3V5KA 1D5IL 1DVFA 4JM2B 4OFDA 4ZSOB 5TDNA 5INDB 1UWGH 5HYQA 3S4SB 3QNZB 5JOPE 3D85A 1GVIA 5F7DA 4JRXE 1SJHA 4R4FH 4X4XA 4DVBB 1EO5A 3ZE0E 1QQDB 1ERNA 1RV6X 5GJTL 4L5FL 4U1KB 1T7WA 4I48A 4KVCH 4KI5E 3JVGC 3IDUA 3H9SA 1E6JH 4BZ2H 1FJ1A 2EEBA 4LP4A 5I1KL 1UXWB 4P3DA 3MV9E 3MCLL 1UCBL 3D18A 4JEGB 4U33A 3U46B 4JG0L 4G80B 4WHTB 4OLYL 5CEZD 2APBA 1IJ9A 2YWZA 4ONGL 5B39G 4W4NA 3RY6A 2CLZB 4Z5RA 1ZKAA 1UYWL 1TJGL 5I16B 2CIIA 4LSRL 1Q9LB 3UTTA 4Z0XA 1U8PB 4DGYL 1LE9A 2XN9E 2DM3A 2OYPA 4M5YL 5DVOA 5FM8A 1GOGA 4APQB 4GAGH 3A6CH 2W92A 2WWKO 4LCWA 1T1WB 1Q0YL 3DX9A 1QLRB 3G6JE 5IB3B 5DZNA 4TYUA 1A7QH 3LPWA 5BVPL 3MXVL 5EC1B 4NNPH 1W0WB 2A6JA 4Y19E 1GGBH 4HW6A 4BK5A 3T0EC 3EYVB 5CZXC 2OJZL 2WMPA 1A47A 1IMHC 4DZBA 4PJHB 5J6GB 1QNZH 4D9LH 5I1GL 4EVNA 4WVRA 2ZSWB 1JYWA 4NZTL 3N1GC 5ICYB 5JXAL 2R1WA 5F9OL 3BPCA 5JLZA 1MWAB 4R0LC 5JW4M 4Z9KB 4WENB 1LEKA 1A6AB 1D6VL 4FFWC 4BSJA 1LE5A 3QA3B 4Q2ZB 3LKRA 1PFCA 5D72L 3DX6B 3I6GA 2YD4A 4D94A 1MEXH 1BD2A 4R2GB 4WI2A 1HK6A 4PRNA 5IBUB 2R0WL 1CXLA 1FO0B 2A77L 2CK0L 1IGML 5EULV 3T1FB 1VEOA 5TE6H 5HPMA 5JW5A 4QXWA 4YQXL 3MXWL 5CSBA 4QXUL 5D2NE 1YMMD 4M43H 4JKLA 3BP7B 3N0PB 1GHFH 3JWOC 1FFPB 1S9VB 5F1OB 3SPVB 43CAA 3SE9H 4ODTL 4XMPH 5KVEH 5CILL 5DT1H 5HYSA 5F89B 2YD7A 5EU6A 2NY5C 4JRXA 1QTYT 2EDWA 3NVQA 4I0KA 2P49B 1FFQA 2P5EE 2J88L 5FYKU 4LIQE 4U1MB 1W8OA 4XH2A 1MCBA 3ARGB 2A38A 3AROA 1P7KA 4JM4L 1QG3A 5D1ZD 1MCDA 2VZ3A 3PQYD 4WCYH 5F7KC 4DVRH 3JWOL 4EN3B 5GGRY 3PHOB 1F42A 3O6ML 5EC2B 4X5XA 5H37H 5CEZL 5T5NF 1CFSB 3BGMA 3VGDA 1XGPB 4XCCH 3S3SA 3ZE2F 4XPFL 4ACPA 3RAJL 3MLWH 2NY5L 5I71C 1DBKL 3VMOA 4ODBD 3PWJA 1MHEB 4PJ9A 3RL1A 5CEXA 2XN9A 4PBVC 3B2VL 4RGNE 3N1QC 3KPQB 5F9JB 3EJJX 1LVEA 1IQDA 2WIIB 5I1AB 5F1KC 3QXAA 4PJDF 1UWEH 4UT9L 2ADGA 1RZ8B 2V2TA 5F7HA 2F8OA 5ETUB 1NAMB 1S7VA 4HPOH 1YY9D 3G6JA 2RJMA 2WBJA 3BO8A 1WBYB 3PG2A 4M6NL 4NRXB 4R97C 4ZUSB 1MHPH 5FGBC 4Y19A 3QB7C 4HD9A 4P9ML 4RISL 4R96A 2FNBA 2NY0B 3FAWA 5EZLA 4U6TA 2Z4QB 1U8KB 2D0FA 3VXOA 3U79A 4N0FB 2A6IB 4ODWB 3PP4H 4YHZH 1NGXB 3LKQA 1QBML 3QDGB 1KJ2A 3NAAH 3QAZB 1PG7L 2FX9H 1JNLH 1YEFL 4LLYB 1XF5B 2NZ9D 2Y7QA 4YGVB 5E8PA 4QF1B 1J5OH 1KCUL 1JWMA 3WDIA 3RPKA 2BVUA 1IAII 1TCMA 1NH6A 3WN5A 1FGVH 3O2VL 4KV5F 1A6WH 4P9HH 2LTQB 2J5LC 1TJIL 5H8DA 5I19L 4YHML 2BDNH 3G5YA 4NQXB 5EA0H 1U95A 3EOTL 2P24A 3SDXF 1IC1A 5D2NA 5E99L 4FFZH 4FQ2H 5D1ZC 5J89A 4MNHA 4ZS7H 1HHGA 1U91B 2NTSP 3KGRA 3MV11 4WW2C 3HMWL 1RZGB 1AXSA 1UM5H 4CU8A 5C0DB 1FORH 3WFCH 3ZDZF 3V5HA 2FX8H 5C71A 3I9GL 1B90A 4JKMA 3HMXA 3PWLB 5CGYD 5T3ZL 5KTEH 1SJVA 4HGKC 2FR4A 2FIKB 2P5EA 1YPZF 2X1OA 3DRQB 1F4WH 4KJQD 4U1HA 5HPOA 1AC0A 1TPXB 2ZUXA 3HZKB 3RWCB 3PIQB 4G6FB 3RWDB 2OTWA 5ADPL 1YEHH 2IPTL 4EBQL 4WWKB 2ZG3A 1ZHKB 3KPMA 1BFVL 4GUPB 4F2MA 1VFOA 1OTTD 3CVIH 3GHEL 4H88H 4RFOL 4C59B 1T0PB 2YUXA 2IGFL 4NT6B 4QRRB 2VDPL 1WTGT 5ALCL 2VB5A 4WWID 1RSFA 5JXED 4Y5XB 2DI8A 4GJTB 4NQSA 1OD9A 4GRMB 3VRJB 5I8CA 1B0GB 1ZT7B 1A64A 3VI3F 4OM0L 1KLGB 1KIPB 5C0RH 2DQUL 3ZO0A 5I2IA 3KYOA 2P1YA 3MV7E 4TVPE 3U4EB 2EH8H 2P8MB 4JQVC 5CWSA 5J13B 4I18A 4ZDHB 3LS5H 4JFEE 2MTPA 2NZ9C 1BZ7A 4ZG1A 2X9YA 2PR4L 1TZIA 3QUYB 4AENA 1JRHL 2W9LA 4CN6A 2CH8A 2IANE 3WLWD 5GS0C 2NXZD 4WU7B 4KUCD 4YHOL 2P44B 4LSVL 1BX2B 5TE7L 1NANH 2YEZA 4ODUB 1RZJH 2GSIA 4XVSL 3WIFA 4X6DE 2FH6A 1I7ZA 1LO2L 3GO1H 4H20L 2JJSC 2ZUVA 1KBGL 3RL2A 4PRHE 4WI6A 4Y5YC 3CVHL 4GG6B 1J0HA 2F9BT 5T1LB 2CJUL 3WCYA 2HLAA 4MLIA 2IAMB 3F7VA 1D5ZA 2ZCHL 3OL2A 4DKEL 2ESVD 2MSPA 4L9LB 4O58H 1T03H 3U7YH 1XIWB 5GS0L 4LPWA 5DHVA 4IS6B 2DQEH 1YJDL 1DVFB 4U7MA 5LCVH 3WS6A 3HPLB 1SJHB 4XNMA 1IEHA 4PV8A 4KJQC 3L3HA 3S5LB 5CIPA 3LY6A 4NN6C 4FQJH 4LGSB 1MPAH 3D39D 2CXKA 3H9SB 5F44A 4NZUL 1FJ1B 2GUOB 4JZNA 5E1AA 1KSRA 2NY3D 4JFPB 1JHTA 2YSSB 1NDGB 3W39A 4A6YB 4CU6A 1KLUB 1B4RA 5B3JF 1Y6NR 3R06A 1OTTC 2EYRA 1KPVB 5FOBA 3S88H 2F19H 5IGXH 1WZKA 1S9XB 5BV7H 1C8PA 3DGGA 4N8PA 3E8UH 4PJDA 1XR9B 2CIIB 2Q8AH 4Z0XB 1A6UL 2NW3B 3GSWA 4M62H 2BERA 3MA7A 4YHPB 4KUCF 4IRJD 3VXRE 3RU8H 4KHXL 4G42A 1WCQA 3OHXB 3IDNA 4KFZC 4QXGL 4DK3A 3RZCA 3W2DH 1S9YB 3ZYJA 2DTSA 3SDCA 2X4NB 4OD2A 4JN2A 5JW3L 4KXZI 5FV2A 2A6JB 2AI0L 3VXQB 2VDKL 2NXZC 4LSDA 4RBPH 4JREC 2I26N 3WD5H 3ARXA 1FDLH 1YY8A 2W65B 1QHOA 1GYAA 2UZIL 1OTUD 1BEYL 1U8JA 5DMIH 4DFHA 1KEGL 2R29H 4MA7L 4EVNB 5CJQL 3TBSB 4WI8A 4I0CC 1F11A 4JFEA 3IYLW 3VXSB 3U6RB 3BGFB 3KPPB 4N5UA 1LE5B 5ESVB 4IRSC 2IANA 5F71A 5I1IL 1O5DT 2E7CA 1SVCP 3MLSH 1VFMA 3CFEA 4X6DA 2DB8A 3UEZA 3FT4A 1B6DA 3ILPA 1YEIL 1IC7L 4XP1H 5I30L 1AI1L 2W60A 1J0YA 4PRHA 3BH9B 3VGAC 4XP6L 3C8DA 1KC5L 4EXKA 1IM9D 1BVKA 2MFNA 4PLOB 5JA9A 2FBJH 3CGTA 2CLRA 4L4VD 1G6RB 4LLWB 1BLNA 1N59B 3IT8D 2EDEA 3DMMC 3SDAA 4IRZL 2Z92A 4OV6F 2W0FA 1AO7E 2CKBB 2NY3C 4YFDB 3VG0H 1Q72H 1MCFA 4WFEE 4X9GA 1K6QH 3V6FA 5BCAA 4G5ZL 4R90L 3VI4F 5EU6B 1N6QL 2WWKT 5I9QC 3HE6B 4HXAL 2XIDA 35C8L 2Y23A 2BVOB 3FCTA 1NGWB 2CRZA 1DLFL 4XH2B 4UB0L 3L3JA 3VFSA 4QCIA 4PJFE 2QHLA 1JUFB 1A3QA 4NCC1 4IRJC 4WY7L 3RWFA 2ATPA 4PUBL 3LN4B 3P77A 1BIIB 3VDCA 5JDJA 3I3BA 1DL7L 1FPTL 3WO4B 3IDIA 2JIXA 3BUYA 4TRPL 4JPIB 3DUUA 1EDQA 4NN7C 1IQDB 4KY1H 4NZDA 4PRBA 3IFPA 4MSWA 3ZTNL 4K7FA 4ZAKD 3UTQB 5JR1H 4OKVB 5FYJD 1FIEA 1IGFL 3CPLA 2X05A 2PW2B 4JDZB 2J3SA 5ECJE 1S7VB 2NX5D 3MA9H 1OAXL 3G6JB 2WBJB 5E56A 3BO8B 3B83A 5E00A 1WK0A 4JR9L 3O8XA 5I6XB 5C1MB 2XNAA 5I1LB 5KG9B 4R96B 5D96C 1E4XL 2V7NB 2XT1B 5DD0H 1IE5A 4GG8A 4JDTL 2XOTA 5DD6A 1R5VA 2B2XH 3ARWA 1P4BL 1UJ3C 4J6RL 1KJ2B 3HZMA 2GK2A 1I1AC 5ESAB 4W6YB 4YWGH 1EO8L 3QEUB 2BSRA 1FVDB 3OJ2C 4LRIA 1JWMB 4PRIB 5D2LE 2I9LB 3JTSA 4QXTA 4NP4H 3TCXA 4D8PB 2FJFA 1UM4H 4JPKH 4M8VA 3UXFA 4UZGA 3G5YB 4FG6D 3UDWC 1FNSH 3HN3A 5T3XH 1N5AA 1KB9K 3O3BB 3E0GA 2R56H 4RRPG 3DI3B 5JXEA 4P0DA 1G0DA 1BVZA 4LLMA 3ZLQC 1UQSB 2VDNH 4MNHB 4NN5C 4WUKL 1AO7A 3TNNB 4DQOL 4PJ5D 5IW6A 4I1NB 1AXSB 3DVIA 3RDTD 4XTRD 4XAWH 2JJUA 3REWB 1RHHA 4YDJB 3RGHA 1YYLH 1ZLVH 5F6HI 3OPZH 3EYSL 1TLKA 3KHOA 4LEOA 1CXEA 4Z7NF 4WTZA 3RIAK 1WTLA 2FX7H 4NQCE 2QV2A 3VFMB 5DA4A 2VABA 2VXUH 3AXLB 3H9YA 4FA8A 4PJFA 1VSCA 1OCWH 1S7QB 4TQEH 3RWGB 3GBLA 4U1LB 3GZKA 4XNUH 2IF7A 2VQUA 5H2BA 4JJ5A 5MEQA 3KPMB 4ZQKA 4JFXB 5DQJA 3U83A 4M8QA 3IDJA 2Z31A 1BAFH 4WFGD 5DZOA 1I3RB 1UZ8A 2CK2A 1NPUA 1D5MA 4LFHG 3HAEH 4X7TB 5F9WB 3O0RH 3AY4A 3B9KA 5F88A 3QUML 1N8ZB 5BO1L 5I8CB 5HYJE 4XNZC 2AQ1A 5IB5B 4OQTA 4KI1A 2QKIA 5GRJL 1K8DB 5SWQB 4RBPK 5FYJL 1FLRH 1K5NB 2HKFL 1QUNA 3VXUE 4Z7QE 3BESR 5J56B 2JELH 1TVBA 5CWSB 4HUXA 4N90E 3UTSE 3IS1X 4C83A 2BC4A 3V5DA 1MRDL 3ELAT 4HJ0D 1BZ7B 2R0ZL 4NIKB 4AL8L 1HXMA 4OLVL 1TZIB 5C6TH 5CKGA 3LKOA 1XGYH 2AJVL 5CSZA 3I02A 3MUY1 3WIFB 5IG7A 4PJCF 1I7ZB 2B7DT 3IU3A 4AH2A 3RPIA 1HH9A 3RI5K 2A9ML 2APFA 2WK2A 4QY8A 3O3EB 3FQWB 3ARED 2A6KB 2HLAB 1D5ZB 2ID5A 2D7PA 4GAYA 4ZFGL 4WI7A 3RDTC 1HHIA 5DHVB 2QSVA 3KJ6H 3RJQB 1D5IH 2C26A 4KRLB 5FHBL 2ZCKL 2Y06H 1E6OL 3OAUL 4ZFFB 5I1EH 3UZEA 1TQBB 4MWFA 2DLHA 3DX8B 3FHAA 4X6BA 4U3HA 1DE4B 4XNMB 5A1AA 5GPRA 3KVQA 3B9DA 2ZNXA 1EJOL 5GJTH 1U8HB 1D7FA 3QUKB 4HFWB 4L5FH 4H1LB 4JO1L 3MLTA 5B8CC 1ED3A 3DBXA 4JZNB 2NY6D 4OCNC 4UI2A 1EHAA 4BQBA 3W39B 5I1KH 1UCBH 2XTJD 4HIHB 3RZWA 4JG0H 1KT2B 3MBED 1HHHB 4OSUL 4NM8L 1ND0A 4NQCA 3GIVA 1T7VA 1ZHBB 3DGGB 4PJDB 1RIUH 1QLFA 4HK3J 4QHUA 3MRFA 4LSRH 5HDQL 1IEBA 3SGJA 3CLEL 3S35L 5BRZE 3GSWB 4OI8A 3ULSA 1RUAH 4LKXB 5FM4A 2YD8A 1YEEL 2EYSA 4NKMB 3TBYB 4EIGB 1OLLA 2EIBA 3EOAB 2YR3A 3AM8A 4URTB 1IGIL 4JFDA 3T2NH 3W9EB 1J0KA 4OD2B 3DUSA 1KCSL 1T6WA 1WQVT 2CO7B 5C09D 5BVPH 4QRSA 5HYJA 4PJCE 3HNSL 1OAYL 2GSGA 3QFJD 5KVFL 1S7RB 2Q20A 4LQ1A 1YY8B 2ADJA 1P4IL 3D0LA 4BH7B 2J7LA 3BN9D 1NDMB 3VXUA 2J5LB 3BZEB 3U82B 5I1GH 3UTSA 4Q6IA 2ITCB 4LPXA 4NZTH 5JXAH 1F11B 3WNOA 3BKYH 1P84J 1VACB 2K9UA 4OLWL 4X6CE 3ARTA 4OF5A 5D1ZB 4DUWA 1AFVL 3PQYB 3V7MA 3EFDL 1F6AA 1CGWA 5TDPB 3CFEB 3T4YB 4UIKL 3SDXB 4JB9H 2NW2A 4R6UA 3UJIL 2CK0H 1IGMH 3ILPB 4FS0A 5D1QA 4ZTOH 5EOCL 1NGPH 1OVZA 1YECL 3HZVB 4G8EA 2H32H 4YQXH 5FUZL 1F6LL 2XA8L 4QXUH 2CMRH 4GLRI 1RIHL 2R1XA 4EQ3A 4F37K 2W0FB 2NY6C 3M1BB 4X4ZA 5J0BA 4QLRA 2Y72A 3PHSA 5JOFA 2XTJC 1QACA 3O2WH 1YPZB 3PWVB 1XF4A 2QSCL 2FECI 4ODTH 2UYLA 2OK0L 3X3GH 5E1HB 5FYKE 1MFDL 5J9PB 3KYNB 5LG1A 4U6YA 2AEPH 7CGTA 4TNWF 3RBSA 2R0LL 3GNML 3UJJL 2X40A 1QFUH 2WUBL 3UZVB 4X99B 1ZLVK 3CFIC 1YYML 2P45B 4L8BA 3VFSB 4OCLC 4MJIE 1HXYA 5JQ6L 4U3CA 3QDJD 5HHMD 1ITBB 3E6FA 3QIWC 3CVHB 1T1XB 4LL9A 1EO7A 5C7XH 5JPNA 3OAZH 4Y4HA 3MRGB 1FL5B 3P77B 4QYOB 4NPYB 3RAJH 1RJLA 5D1XD 4QNPF 5CCKL 1DBKH 1EXUB 2CD0A 4NRZA 1VFBA 4XPAL 2JIXB 3HNTH 2D9QB 5SV3A 2DQJH 5BRZA 5HI5C 3AGVA 5A16A 1G7QA 1QRNE 1JYNA 5IBTL 5KSUB 3IVKB 5C9KA 5J3HD 3PGDA 1SEBB 2A6DB 1MFBH 4Y5YB 4YX2H 4KKNA 4YDLB 5E00B 4HJJH 5DQ9A 4LSSL 5AZ2L 2FD6L 4YHNA 1P6AB 4PJCA 4PJ5A 4RISH 4WW1B 5EPMA 4Y8AA 1KNOA 1CD1B 2EC9T 4N0YH 1A02N 3BDYH 1A3RL 1A6TB 5L6YL 4OI9A 1OSPH 4Y5VA 1QBMH 4Y4KA 3VFVA 2B39A 2J12B 4NKIL 4X6CA 1U58A 2BNUB 2BNRD 4YLQT 1S3KL 2BSRB 1TZGH 1MJ7L 1YEFH 5T1MA 3ZSTA 4ETYA 4NN6B 3PV7A 3QHTC 5E4EC 1CVRA 3JTSB 1KCUH 2FHCA 1YEDA 1A7OH 3U0WL 3GBNL 1KCRL 5MI0B 5IVNA 2DQGL 1KTKE 2DLFH 3WFDL 1HZHL 1K9TA 1TJIH 4LARH 5I8KH 3NTCL 5I19H 4YHMH 3BT2L 1G7LB 1A4JA 5CFHA 1ORSB 1MCSA 2QHRL 4KMTH 4R9HA 1BVLA 4ONFH 3ESVF 4ZMAT 1WC7B 3QIBD 1AO7B 2WZPD 4YR6B 4JANB 3C5SA 3VRIB 3E3QC 3R8QA 2EDNA 3DTXB 2J2ZA 3BI9X 1LEIB 1RHHB 1ZSDB 4XPGL 3OKKA 4JQXA 4WTZG 4K7PL 5T3ZH 1MVUA 1Z2KA 5D1XC 3W9DB 3GK8L 2VLLB 4D0DA 2VABB 3PGFH 4N5ED 9CGTA 4MDIA 3FB5B 5ERWA 3EO0A 4XB7A 1JV5A 2DIBA 5J1AB 3QULB 1JPTL 4U6VL 3LD8C 4PRPD 5J3HC 5H2BB 4MA3A 4OGXL 1DP0A 1I7RA 1HI6A 2EZ0C 3TH4T 2DKUA 1BFVH 5DQJB 4M8QB 3IDJB 1FZJA 2F74A 3CK0H 3Q3GA 4HWNA 3AREA 5CP7A 4W4OC 1ZWIB 2IGFH 4R7NA 5DHXB 4LLVB 5ALCH 1J1PL 4OGYL 5F88B 4F7TA 1KJ3H 3CDYA 4LVHB 4ESKA 5GGQL 5T3XE 1JNHA 1EUUA 4LCCA 1TFHA 3VGAB 2DQUH 3T08A 5IWLA 2V9RA 1IZKA 2R15A 3RKDD 2D31B 1B88A 5FK9A 1N6UA 2XQYK 5CJXA 4M7ZB 3X11A 3VFTB 1L7TL 3GSQA 3NZHL 3D39B 3G9AB 1ZXQA 3RNKA 5C92A 4KGJA 2PR4H 3LKOB 2NY3B 1LGVA 5CSZB 3OG6B 4YHOH 4LSVH 3T0BA 5TE7H 5DUMH 3SCMA 3IU3B 4NO5A 1HH9B 3RPIB 5IVXE 2ENSA 1RI8A 1MJ8H 3QEHA 3VXPA 3BJLA 5I9QB 3QXWA 1N0XH 4HWEL 6CGTA 5IQ7H 5H37G 2R4RL 4IIQA 3WBDA 3QIBC 3DURB 3BP6B 3JWNC 3PNWA 3S36L 3UTZB 1XZ0A 3P40A 5GS0H 3BWAA 1YJDH 2UWEF 4XCEB 1HQRB 1T4KB 2UVEA 3QHFL 4P2YA 4Z95L 1RUQH 4X6BB 1L6XA 5DS8A 1BQUA 2VDLL 4LSQL 4O00A 5IW3A 5L9DL 2XPGA 3L95B 1NCWH 2A1WL 2XKSA 4TTGA 4XVTL 3FO0L 1KN2L 2ARWA 4C4KO 4KU1A 1ED3B 3DBXB 4NN7B 5LAXB 1IL1A 2MCPH 2D7NA 2P8PA 1MNUH 4LGRB 2E9JA 3U1SH 5IT2H 2FGWL 1MFEH 2E3VA 4P4RA 3WNNA 3BW9B 5FYJU 3SO3B 3ECBA 4X5WA 2EYTB 2CO6B 3GIVB 1WGOA 4ETQB 1OT1A 4JGMA 3OAZK 3QPXH 4U1IA 5GSVA 1G7HA 1A2YA 3B5TA 4TUJB 5DJAA 4RNRA 4PJ8D 1AHWA 5TJWK 3FMGH 5IQ9A 4QRPE 2CRYA 5KW9L 5CSGA 2R23B 5FUOL 3ULSB 1I9JL 3ZT6A 1UJ3B 4D0BB 5HGAA 4ZUVA 1R3JB 4KHXH 3CFJB 3GSNL 1PVHA 4L4VB 3EUUA 4HSQA 4JFDB 4J3XA 1G7MA 3DUSB 3KWWA 3SKJL 5HYJB 4YAQB 5ACMA 1MF2H 1CTOA 4PP2B 3D5OF 2VRAA 3BAEL 2GSGB 3JXAA 3OKOA 1FN4B 3P4MA 3D25A 3CU7A 1BEYH 1KEGH 4Q6IB 5D71L 3BZFA 1WIPA 4XMKL 1DCLA 5L8JB 1H3PL 1JGEA 2WUCH 1HE7A 5C70A 5FEBA 4N0CD 4NN5B 4YFEA 2VQ1B 2Z9TA 1F6AB 5I1IH 3LKNB 3B3IB 1Q8MA 3A67L 2XWJB 1QVOA 3C8HA 5IVXA 4HJGB 5LWYH 1YEIH 1IC7H 1J0ZA 4JRWA 5C08D 3MREA 1GC1C 5DD5L 3DHJA 1I8LC 5TFSL 3X14B 4JO2H 5A2FA 4DAGL 2VC2L 3QUMB 5BVJA 2ZOLB 2BSTA 2XY1A 5E5MA 4LSTL 5JORA 2D3VA 3DSFL 3R8BB 3P4NA 5IMKB 1ZT4A 5ISZE 4ZAKB 5FECB 4KK6D 4L8DA 4IRZH 5JOFB 2FZ3B 3KXFD 2EDRA 3LQAH 3QWOA 4H26A 3HAEA 5L88L 1CZ8L 4O4YL 3CLFL 4R90H 1C5BL 4DKAA 1N6QH 1GC1L 3DVNA 4HXAH 35C8H 4XWOD 1LEGB 1DLFH 5DSCA 4AEHL 4G8FA 5GIRA 1CXKA 1HH6A 1URLA 4U2ZA 1A8JH 1ZLUH 1P7QD 1AJ7H 4AIXA 5C0BD 2YBRA 3ARFD 1OPGH 3E6FB 4HHAA 2K3TA 1GL4B 3PWNA 4EOWL 2BNRA 3RX7A 2R69L 4PUBH 5JDSB 1H5BA 3GJEA 4GS7C 4CVUA 2V6HA 1PLGL 4R7DA 1T21A 4G7YL 4HUKB 2E6QA 4NRZB 3MLYH 1DL7H 1FPTH 5IJKA 5ACLA 1JNNL 3T0EE 5BRZB 3JZ7A 2EIEA 5E2JA 4OT1L 4HZAA 3V6ZA 3KPLB 1HINL 5CJOL 4LPTA 2GTZB 1UB5B 4YXHL 3ZTNH 4QOKD 4HQQH 1OF2B 3KPOA 3WHXB 4LBEA 3RNQA 4OD1L 5KVDL 2GJ6A 5DQ9B 3WEXB 2ZUUA 5B4MD 5EUOE 2O5XL 4N0CC 5C3TA 3CCHA 4JR9H 2YUZA 3RJDA 3GMOA 1ZV5A 4JFHE 4PJCB 4EUPH 4PJ5B 4B50A 5FDWB 4I9WE 5EPMB 2CRIA 3TO2A 2VXVL 4YO0A 3RDTB 4X6EA 1G7IB 1TQCC 3CSGA 3IRZA 3B9VA 4JDTH 3KPNB 1TVHA 3OAYH 4Y4KB 3VFVB 3MLZH 1X5KA 2D7TL 3ARZA 3MRCB 4KZDL 5GS1C 4O2FB 3OZ9L 2CIKB 1BBDH 1D9KD 3P11L 5DMGC 5B8CB 5BS0D 4HWBL 5FXCH 2DQHH 2Q3AA 1YEGL 1F02I 5FB8A 3HUJE 4XCFL 1DQDL 4PG9A 1KTDA 3H42L 3SJVD 4PB0L 2BMKB 2VL4A 2YD9A 3ZKQD 3MC0A 2ICES 1FZMA 2XI9A 4OLZL 4ZYKB 1FNHA 4XWOC 5JIIA 3L7EB 1X5XA 1BVLB 4JFZH 4NOBA 4KAQL 2EEDA 4NNXB 1KTLB 5ISZA 1V5JA 2IH3B 4WUKH 3KAAA 2AK4E 3AB0C 2OXHA 1KPUB 4HX1B 5J11C 1GZPA 1NMAL 4PYGA 1WITA 2QQNH 1KYOK 2HTKC 2NR6D 5K9QG 4KK9D 1MVUB 2YS4A 4G6ML 3LRSA 3FFCD 4ENEC 3VFPA 2DIJA 3SGEH 3S9DB 1SMOA 3EO0B 1JV5B 3MV8E 5I17A 3WKML 4WHYH 3BIKA 3FB6A 1M7IA 4JY5L 3IKCA 1HI6B 1I7TB 1JGLL 2IG2H 1LDPL 2P42B 1CR9H 1J86A 3Q3GB 5B4MC 3AREB 4YXLL 3KPTA 2F58L 3CMGA 1A4KA 3BDXA 4ZUTB 2PTTA 1MSPA 3TM6A 4NC1E 1LILA 3FT2A 5DUPL 4LLAA 4WRLA 4EI6B 2I5YH 3GSRB 2C5DC 2H32A 5GRJH 5IF0A 5D7KD 5E6ZA 4LCCB 3MO1B 4E0RB 1Y0LA 2W9DH 3W0WA 4R0LA 2HKFH 4YEEA 4PGCA 3WYRA 1YMME 2BVEA 4N68A 1JJUA 5EUOA 4P5MA 3CC5A 3MRLB 5C8JB 1GCFA 1WLHA 3OKNB 5F8RC 1D9KC 3GSQB 1MRDH 2IQAB 2R0ZH 4AL8H 4OLVH 4UQ2B 1LWRA 2NY6B 4KMLB 4GBXD 2KQMA 1EGJH 4PS4H 3UZQA 5DJYB 2XTJB 2DYPA 2AJVH 5IVOA 5T3ZE 3SCMB 4DOHE 3MBEB 4PR5B 1A0QH 3UC0L 3QQ4B 2A9MH 4HS8L 3K4AA 3BP4A 1WEJL 4BQ6A 5F7NC 1IQWL 3D2UA 1NEZB 5DJDA 4IIQB 3HC3L 4PJ8A 1NGYA 1SBSH 4BJLA 3ES6B 4A2LA 4GAFB 2FEDC 3HUJA 1P4LA 3TN0D 1CI5A 3TBTA 4K94H 3LHPH 1MY7A 3GI9H 3VWKD 1YC7A 4MCZA 4UDTA 3BQUD 3BWAB 4LKCA 1J7VR 1WZLA 2PO6A 4JZOA 3QSKB 5FHBH 4MVBD 2ZCKH 1YMHA 2NR6C 3OAUH 4KK9C 4S10A 5JHDD 1XMWA 2EDXA 3L3OA 2LVCA 1KTRL 1ZGLP 3QI9C 3T2OA 5LGHL 2HJLB 5C09B 4LEXH 1PQZA 1WWCA 2NTFB 4GW5B 1FP5A 1EJOH 3QFJB 2FCBA 2AK4A 4EIZC 2XWTB 1FIGL 5HDOA 1BIHA 4ZOBA 1ZLUK 5D7JD 1L7IH 3S5LG 1A1NB 2P5WE 4CAGA 1E4WH 1F3RB 4OV5A 4OSUH 5J7CC 4IMLA 4NM8H 2B5IC 1QD0A 5K9JL 3X13B 1A2YB 5DJAB 5SWZE 4RNRB 3MV8A 5HDQH 4XAKE 4ELMF 3BH8B 1I1CA 3S35H 1S7WB 3IJSB 4F33B 2WWMD 2GAZB 3MLVL 4ISVB 5HGAB 5T1DL 1QOKA 3WIHH 3U36A 1WFOA 2V2XA 4PTTA 5E4EB 1KCSH 3AMKA 5AAMA 3PUCA 5IEHA 5J8OA 3ARBA 4HS3A 4IMKA 1D5BA 3HNSH 1OAYH 2F54A 1XCQB 5KVFH 4GKNB 1T5XA 2LVEA 4WFFE 5FGSA 1P4IH 3RWIB 3U48A 1I7UA 1IAMA 1GZQB 4RQQA 5I75B 1K2DB 5ELIA 2E7LA 3OAYK 4OCSH 1NCCL 3TZVD 3BXNA 1AFVH 3TN0C 5HHMB 3QDJB 5KBNC 4IOSD 3ARFA 1LO5A 3VWKC 3EFDH 3BQUC 1SVZA 2ITDA 3C5ZD 5EBWA 1QVOB 1S9WA 4MVBC 3RTQD 1NC4A 1FL3B 5HHOD 5EBMB 4GKZB 5EOCH 1I85A 1YECH 5D1XB 1FNEA 4PJ7E 3BGAA 4M7LT 5CINL 2XA8H 3VFWA 1QA9B 3MR9B 3B43A 4WW2A 2X10A 3O6LL 4QWWD 3GJFB 5E8NA 4QKXB 4L8DB 1DUZB 1T1ZA 1RULH 3FRUA 2WLYA 3I6KB 1VEMA 2QSCH 2OK0H 5BJTB 5DK2A 1HYSD 2QQLL 4S1RL 1BOYA 4TTDD 4LF3B 1WT5A 1I1YA 4PGZA 4DZ8B 1KIRB 1A6VL 4KWUA 3FQUB 3GNMH 3UJJH 2OX5A 5K9KB 3BRDA 4PB9L 4CDHA 2WUBH 4FTVD 5GIRB 4O51B 3VFNB 5ACZA 2O26U 3G5ZA 4GW4B 1YYMH 2AP2A 2OTUA 5MHSD 4N1HB 2WWMC 1JMZA 5JQ6H 3STLB 1QEWA 7FABL 3WFHB 2OL3H 4M6ML 4GKSB 4LP5A 2BNRB 4F9PA 1UH3A 1MCWM 1E4KC 3GM0A 4UV4L 4R7DB 4X0KB 5SWZA 1RJYA 4XPAH 4HG4J 2V17L 2I07A 4YZFF 3SJVA 4UU9B 4OI7A 4XNYH 4DGIH 1FSKC 1W72L 2DBLL 5E8DH 2GJ6B 4G3YH 1BMGA 1CK0H 4L29A 3MNWA 2JF1A 5I66A 3IS0X 3VH8A 5AZ2H 2IH1B 2FD6H 3QIBB 5FAAA 2H9GA 1HCVA 3HR5B 4ODVL 1TDQA 4HWUA 5D7LA 5AZEH 1QR1A 3TO2B 4YO0B 1EH9A 5C0JA 3C5ZC 5I18L 3MYJB 4P2QD 1T83C 1MRFL 2JJSA 2LU4A 3QO1A 4NHCH 3NN8B 3QUXA 3MRMA 4HIIA 3QZWA 5FGCE 3VXNB 3FFCA 4LSPH 3L3GB 3SE3C 1ONQB 1S3KH 1ZHLA 3E2HB 4QWWC 1UKSA 3BYYA 3DO7A 4DUXA 5ALBL 2UWEB 3A0OA 2H1PL 1NUNB 4PRPB 3S37X 1KCRH 3UBXI 4TTDC 2DD8H 1PKOA 2YUVA 4KGLA 1OB1B 1SJEA 3ULUD 2DQGH 3WFDH 4PJ7A 1NGQL 4HK0A 3TH2T 3PL6D 4F9LC 1H8NA 2DF3A 5TQ0L 1H8SA 5IK3A 3NIFE 5CD3B 5GSRA 4NKOA 2DLIA 3NIDE 1BP3B 1Q38A 1YA5A 4L4TD 5DJ2A 1X9QA 4Z7UF 5EO1B 2BXYA 1XEDA 2EDHA 3A6BH 2GI7A 4XPGH 1JGUH 5L7XL 3P9LB 4OBSA 4I5BA 3OB8A 1KULA 4K7PH 4JZJC 5EOTB 4PREA 3DVGB 5IESL 1NUDA 2XQYG 3F7QA 3GK8H 4AEFA 4LVOC 3F7PC 4WJ5B 3K1KC 3QJHB 4GQ9L 3MRRB 4HC1L 3EGSA 2RCSH 4XNQA 1UXSA 1JRHI 3ME0A 3UPRA 5DFWH 1K4DB 2FJGA 3KHQA 2FRGP 3TBVB 3OX8B 1FAIL 1ETZB 4N1CA 1J1PH 2E5EA 4OGYH 5IMLA 4TN9A 1IEAA 4WUUD 2HWZL 4JY4B 5E2UH 5GGQH 2FJHA 1Y0LB 3QH3A 3W0WB 4OZGF 1PZUB 4HIJA 4HIEA 5CKAA 3P3YA 4PGCB 2W38A 3NCJL 3T77A 3FJTA 4P5MB 4K23H 3C6SB 3NFPA 3ULUF 1ZANL 2YWYA 4GQPH 2FSEA 1X4YA 1L7TH 4WV1C 4GRWF 3BZDA 4R3SB 1S7XB 3SKOA 1BFSA 2H6PA 2X41A 4M4PA 2IQ9L 1NC2A 3P30H 5D7JA 2L4OA 3ULUC 4NQDD 3OKLA 1MCEA 4Z76B 4BFGA 3MSPA 3PL6C 4J1UB 4M1GL 4J4PD 5DEFA 1OAZH 2W0KA 1MCQA 4HWEH 4PJ8B 2HA1A 1I9RL 4U6HB 4P2OA 4DN4H 5IJVB 4LCYA 2IALA 2YA1A 5IHZA 1F97A 4U05A 3S36H 1ORQA 3QXDA 1OAKL 1TVDA 2W9EH 3VFRB 1KB5H 4LKCB 1MCCA 4YBQD 2ZJSL 2ZUQC 2PO6B 3HLAA 2EDQA 2AV7B 4XBPB 3ULUL 4NQED 4GS7B 4XB8A 4MQSB 3QHFH 1SYVA 4Z95H 1F13A 5DRWB 3AAZA 1YZZA 1Y18B 2VDLH 4DWHA 4LSQH 5L9DH 4F8TA 4JG1L 2A1WH 4HKZA 4XVTH 1S7UB 2DRUA 1EX0A 4MXWH 1LO0L 1DLHA 4A2MA 2FGWH 2VXTL 1IGTB 3LV3A 1HSAA 3MUGA 5I1DA 5KSAA 4I13B 1CG9A 3F5WB 2G5BA 3TZVA 5JNYA 1D6EB 1NMBH 1IGYA 4K8RD 5TF1H 4JY6B 5SWSE 4POYA 4ELKB 4LDLB 5KS9F 3SE4C 2Y5TA 4GSDH 4BFIA 5C08B 4L8SC 1I1FA 3T1WA 5EBLA 2E7MA 3H6JA 3U0TB 3CFKA 3BKJH 1QYGL 1RZKH 2JLLA 3GSNH 4P23C 3U36B 4F3FB 3Q6FA 3QP3A 3SKJH 4PTUB 5IEHB 5HI4D 3QG7L 4QHNA 4HS3B 1FZOB 1D5BB 1EVTC 1EEYB 3KXFB 4B5EA 2F54B 3K0WA 2BOCA 3S96A 3KR3H 4KKCD 1R5WA 3P0YL 4Q0XL 3L3IA 1C5CL 1T89C 4LK4A 3BP5A 4AQ1B 4J4PC 5D71H 1KOAA 4P59L 1G7JA 1DBML 3VFGH 1G0XA 3TIDB 3P9WB 4G6AD 1H3PH 1N7MH 3V4PL 2HKHL 1P7QB 4OTXL 5C0BB 3ARFB 2VDQL 1NGZA 4NQUA 1G9NC 4YBQC 3JWDH 5J11B 1S9WB 3A67H 1A7PL 3UBXG 5AYQA 2HH0H 3RWJB 4ZUUB 3BISA 2ZOKA 1KGCE 1FNEB 4JFYB 4Z7UA 3I85A 2CLVA 1CBVL 1NCDH 5C0GB 2AJYL 3V2AR 3VRLF 2VC2H 4LSTH 1EMTL 1MQKL 1XGRA 1ZT1B 1AC6A 2BSSB 1LHZA 1PBYA 1LO4L 8CGTA 4QOKB 3D3VD 2ADFH 4AYFA 2NYYD 1K8IB 1C08A 4ERSL 1BFTA 5BMFH 5L88H 1S8DA 4TULL 3CD4A 2PN5A 1CZ8H 5KSVA 1I1YB 1C5BH 3IDYC 1J05B 1P1ZB 4K8RC 2Y36L 3X12A 3QCUH 2AXGA 4LVEA 5HHPA 3EOYG 4KROD 5SX4H 5KN5A 4AEHH 2YA0A 5HYIA 3GMPB 3G5ZB 4YPGA 43C9A 4PJGE 1NL0H 1WZ1L 2JJTC 1QEWB 1MFAL 3TBWA 5F96H 4HIXL 2QQQA 4R26L 4YHYC 4NUGH 3HE7A 4PG2C 1E4XI 2R69H 3PV6A 2BY0A 4WU5B 1EGJA 4JQIL 3GI8H 1D9KB 3C9NB 1AR1D 5SWSA 1PLGH 4K8RL 2FL5A 5EU4B 4CN4A 4G7YH 1X5IA 1X5AA 3QJFA 3TA3D 4GH7B 1EEQA 1JNNH 1FYTD 4NOFA 2YPLE 3D87B 2I07B 4OT1H 3Q6GH 4KKCC 3SJVB 3V52H 5I73B 4QRTA 2Z8WC 1HINH 4KTEL 4DKFH 1Z9MA 2H3NA 2LABA 1WIOA 3QHZH 3NABH 3VDBA 3ZZ1A 1A5FL 4FXGA 4XNXH 5D9SB 4OD1H 3VH8G 1UENA 5KVDH 1G9MH 4G6AC 3KJ4C 1RZFL 3N85L 3QUZD 2O5XH 2J8OA 4L4TA 3GMRA 4HMEA 5D7LB 4I0PD 2VLKD 1FCGA 2B0SL 4DGVL 1JHLL 5IFHL 4WEUD 1C5DA 1ACYL 4ODSL 2VXVH 4UQ3A 4DCQA 5C0JB 3SBWC 3GSVA 5KVGL 5J12B 4XPHH 3WNLA 3IETA 1A6ZA 4BSWA 1CS6A 4HGWB 4Y2DA 3INUH 3FFCB 4O5LL 2NLJB 3C60D 5CJ5A 4KZDH 3TFKC 3OZ9H 4GXUM 3MJ8A 2BVYA 3P11H 4KVNL 1YEGH 2HT3C 4ZOAA 4XCFH 1MCPL 4PV9A 5EU7C 1RK0A 4NO0D 3LRHA 1BBJB 1DQDH 4L9DA 3SKMB 1XGUA 1SJEB 4PB0H 4ZO9A 4NNYA 3MUZ1 4OLZH 4CVZA 4YUEL 3CXHK 4OGAD 2Q8BL 1DN0A 2WM0A 4KROC 1AD9A 1U3HD 5GHWH 3VD5A 3O41A 2MQ0A 4KAQH 2NY2D 4R8WL 3U4AA 5CBAA 2P48B 2JB5H 3AU1B 2ZPKH 2QQKL 3WIHA 1MIEL 1Q9WA 4PPTA 1OGAE 2HFEA 1P5UA 4G6KL 4F7MA 1NMAH 5E5RB 1NBVL 5MENA 4OAWA 4YHIB 1A1MA 4I5BB 5KS9A 1AR1C 4ELMB 4BZ1L 2V2WA 5MEPB 3WDHA 4G6MH 2F53D 5EU3A 4YHKH 2NPLX 4GBXB 2E27L 4PJGA 2Q7YA 1NLDH 5JO5A 5GGSA 4GKOA 3WKMH 1KENL 3WV0A 4ODHL 2AEQL 2WAHA 4JY5H 4XGZB 5LGJB 3N9GH 3NA4A 1JGLH 3FL7A 5IB2A 1FE8L 3QUZC 1A7RL 4JHZA 3R4DA 5IROA 3T65B 4V2CB 4YNYA 4I0PC 4XC3H 1IAKA 4QRQB 1F2QA 3TN0B 1OOAA 2YPLA 4FN0A 5IMLB 5KSBF 1KCKA 2ICEA 3VWKB 4MNQA 3BQUB 5JUEH 2EIZA 2EICA 2AXJA 3QH3B 3QNYB 4E41E 4HIJB 4HIEB 4LVNC 5JHDB 2DQFB 2APTA 3T77B 1NFKA 3NACL 3NFNA 3TT1L 3SGKA 1RFDL 4RMTA 5E2TH 1K4CB 2DWEA 2X4RA 4P2RE 1X6NA 2H6PB 4MQ7B 1UACH 3MLXL 1NC2B 5D7JB 2R2HA 3JV6B 2YN5A 1Q9OA 3RWEB 1UWXH 3CX5K 3ALXA 4HS8H 5BXFA 4OGAC 1U3HC 2UVFA 3NA9L 3EO1A 2QADD 1RUPL 3U0PB 3ULVD 4D3CL 4K71C 2NY2C 3MRNB 3QYCA 3MGOA 3O9WA 1H3UA 3HC3H 2ZG2A 4PJAF 4C56D 4P2OB 2O5YL 2OL3A 4Y4FD 3E3QE 2HG5A 2AV1B 1UH4A 3LQZA 2PXYA 4H0IA 3HLAB 4HBCL 1WWBX 2HT4D 1KIQA 4ZFZA 5C6PB 5L8KB 5TDOA 4J3SA 5F7EL 1SYVB 2AAVA 1N5YL 4IM8A 4ZTPL 1RZ7L 1T66D 1JK8B 2XZAL 5LGHH 5F7UA 3SQOH 5GISH 4WNQA 1JPFA 1VCAA 1CYGA 1OGAA 1GAFL 2VZUA 1FIGH 5I8EB 4EUPG 1A7NL 2HFFA 3RWHB 4F7CA 3TZVB 5AYUH 1NCAH 1XF2B 4JCLA 1P9MA 5C0EA 3RTQB 1INEL 2X4TA 1CE1L 1QFWM 1R3KA 5HHOB 1DQMH 3ARDD 3MRBA 4MCYA 3VD9A 2DJ4A 1A1OB 2DKMA 3OGOE 3MLVH 1O0VA 1SM3H 3MNVA 5DZLA 5T1DH 4WHCA 3IJHA 5TQ2H 3JBG7 2VQTA 2YMXL 1U42A 3TPUB 4LDOB 3CNKA 4P3CL 4PD4K 2YXFA 4R2GD 2VZTA 3ULVF 4JM2C 3KPSE 1MUJB 3GDBA 3WS3A 2K1MA 3VD3A 1BOGA 2EO9A 3B8YA 4E41A 1W0VA 3FQNA 4ZODA 1R5WB 3EAKA 3WJJC 3WJLC 1RHFA 5HHQA 2VXQL 2HFGL 4IBLT 2X89D 3EYFB 3SDDD 5BQ7A 1RIVL 1C12A 3HI6L 4OM1H 3CDGB 2QADC 3ULVC 1AGCB 1HHJA 5GRYA 4FTVB 3HZYB 1NEUA 1HKLL 1NCCH 4P2RA 3VFOB 4Y4FC 1QSED 1AQKH 4FRWA 1F3DH 5E2VL 5FKAB 3NIGE 5C0CE 4ZFOA 5ADOL 2HT4C 1UT9A 1O7SA 4OUUA 5B38B 3VXMD 5DEGB 5D70L 4PLNC 5IEKA 1T66C 4JZJB 5F3BB 3ZKNC 4Z7UB 3I50H 3O4LD 1S7SB 3TA3A 3ULVL 4KJPD 4HAFA 1DEDA 2XZQL 2F15A 5ICXB 5BZDB 4JRYE 4H8WH 4OZHF 3CSYA 3PGCB 4XZUA 3O6LH 5D6CB 5DJ8A 3GIZL 1LP9E 5IV2B 3K8LA 4APQC 3MBXL 1U92A 4O9HL 2A2QT 3C09B 1S8DB 5HJ3A 2QQLH 3SOBL 1F8TL 4LAQL 5HHNA 5KSVB 2G2RA 4S2SA 1A6VH 2FBOJ 2VLKA 5HHPB 5TGBA 3D69B 5KN5B 2ICWA 5DTFB 4EDXA 1YQVL 1IGJB 4BA8A 4P2QB 4FQXA 4YPGB 3MRHA 3K4DA 3ARDC 3L6FA 2RQ8A 3CFBB 4JHBA 1RURL 3VWJD 2ZNWA 3I2CL 3HE7B 1ZLSL 4K3DL 1AR2A 1JWUA 1YC8A 4KDTA 3QO0B 4R2GC 4WV1B 5EO0A 2FL5B 2NY0D 1AXTL 4OZGB 5A2LH 5I1JH 4Z7WE 4PJIE 4Z7VF 1I8MA 2IPKA 1GGTA 4ONOA 4Z0BL 3GSOB 4X98B 4QRTB 3QNXA 2WIMA 2BY3A 2WANA 3UPCA 3SDDC 5L8LB 4E5XB 1N64H 5FO8B 5IR1A 3PL6B 1W72H 5ANME 5FO9A 1MWAL 1Q94B 5HD8D 4UNUA 4GRWB 5E9DE 3ZDXE 3PWPD 4NO2A 5GGVL 1MH5B 4ZO7A 3IF1B 1WICA 4HUVA 1KB5A 1FFOA 1BZ9B 4L4TB 4YEFA 2C1OB 5HGDB 3GBML 3KPSA 5F6HJ 4ODVH 1AQDB 1EA9C 3KS0J 4L3EA 1C5DB 3S37L 4W6XB 3EFFA 5I18H 2ZUQB 2H2SC 3MMEA 1ZEAL 5F7LB 3C87A 3WNKA 2DICA 1VGKB 3E6HB 4MQXD 2DTML 1T6VN 4X4YB 4G6JL 3TV3L 4F57L 4KJPC 4QGTA 1T0MB 4IOFD 4Y1AE 1EVUA 4QHMA 1J8HA 3OG4B 3V4UL 3GMQB 3ZMRA 2C3VA 1N2RB 1U8QA 2C4FU 1EFXA 3BSZL 5C0CA 5HGHB 4PV9B 3K4ZA 3P9MA 1KG0A 4X80H 2QSQA 5DLMH 3ZL4L 1I9IL 3QIUA 1GSMA 4OZIE 1NGQH 3RGVA 1TETL 3TC9A 1DN0B 3FOMA 1AD9B 5TQ0H 4P5TD 4HCRL 3FQXA 4MD5A 5DYOA 4QTIL 1LP9A 5CBAB 4UTBL 3LEXA 4WUUB 3BOVA 5IMOA 2MHAB 3MJ7A 1SYSB 3WUWA 2KL6A 3VWJC 4DKDC 3MOAL 3TVMA 4L8SB 3L3KA 3RUGE 3KYKL 4LHUA 3GHBL 1F45A 5MENB 3MROB 2CDGA 1SHMA 4Z7OE 1UADC 4CADB 1A1MB 1Z9SA 5KS9B 5L7XH 2AQ2A 4POUB 1OP3H 2NY0C 3FO2A 2ICWI 5EU3B 1NJ9A 3UO1H 4XPTL 2Q7YB 1KIUA 1PSKH 5JO5B 2VUOA 4PJBF 3WLBA 4NQDB 4X7SL 4HC1H 3S34H 1U2CA 3ZYIA 5HD8C 3QAZC 4S1DD 3VXTA 4P46D 4Y16D 5LQBL 5IB2B 2VERN 4HT1L 4RAUB 1MLCA 3K8KA 2J4WL 1QBLL 4YNYB 1IAKB 1IBGH 3GMMB 4XP9H 1FAIH 3QWRA 4PJIA 3TCLB 2ICEB 1U6AL 2W07A 4MNQB 5HYFA 4OLUH 2LTQC 5LVEA 2EIZB 1EEZA 1YNLL 2XFXA 3BFOA 4HDIA 3SY0B 3THMH 4NQEB 5ANMA 5E9DA 4MQXC 5B39A 2RR3A 5EZOL 4IOFC 3NFNB 1LO3L 4JO4H 2IAMD 1X44A 5F70A 1ZANH 3DRTA 2NY7L 4Z6AT 5IB1A 1UCTA 2DWEB 3MGTB 1CGUA 3LN5B 1MLBA 1HWGB 2R0KL 3QDME 5B22A 4W81A 1E28B 1ZGLA 1UZ6E 5E94A 2R2HB 4B7LA 1V7ML 1I8LA 5CP3H 3D85D 2P8LB 1OARL 1UJTA 4M1GH 2FB4H 4Y1AA 1TPXC 1PYWA 4WO4D 5DUBA 3MGOB 4HV8A 3DECA 2OL3B 4Q58C 2YK1L 1I9RH 3QRGL 5F3HA 1RVFH 2G75B 3LQZB 5AG9A 4F58H 1UH2A 2Z8SA 2K7QA 4ZFZB 4UT6H 2ZJSH 2KDGA 2B1AL 5JW4R 3CU1A 1AY1L 1ZA3B 4K2UL 2VLJE 4E9LA 1JYVA 1CLOH 4Y5XC 1XCTA 5JZ7C 3UTTD 3H3KA 1V3MA 2X4PA 3GKZA 5D7SL 5EBGA 2GITA 3NPZB 3H9ZA 1N3NA 4JG1H 3RY5A 2O5ZL 3OXRA 1PDKA 4OIIH 5BOPA 4KXZH 3RUGA 4BKLB 3F58H 1BECA 4S1DC 5J13C 4P46C 4Y16C 2HFFB 4LCWD 2XG4A 2HJKA 2LAGB 2DAVA 1XGQA 4F7CB 4Z7VA 1SQ2N 1NAKL 5EG6C 2JJVA 4UINL 3GRWL 2KQNA 5C0EB 2DLEA 3DYMA 3T3ME 4DW2L 4G9FE 5EIIB 1R3KB 3QEQD 1U93A 3MRBB 2CXGA 4UNVA 1XH3A 3HG1E 5HSFA 3O81A 4HPYH 4LU5H 1QYGH 2IAMC 4ORGA 1JIBA 1X5GA 2C7UA 4L9LC 5BS0E 5C0AE 5ID0A 2D03H 4X6FB 2G5RA 3UTPD 1BD2D 1JGVH 3DPBA 3D3VB 2AERT 3QQNA 1DVFC 1JMXA 4LLUA 4YDVA 4NFBA 3WS3B 4KK8D 1I4FA 1EV2E 3LZFH 1JP5A 3FQNB 5E7BA 1NUGA 4OZ4A 4M4RA 5HHQB 3P0YH 4Q0XH 4U7SA 1JHKL 5IVZB 3F62A 1DBBL 4P59H 3IDMB 1YNKL 4KROB 3FRPG 1FV1A 1CU4H 3P0VH 3KLAA 5HGBB 5K59F 4RFNB 5AUMB 2GTWB 5D5ME 3RVXD 1WSST 3QDMA 2AW2A 2HKHH 4OTXH 3V4PH 2AXFA 1MHCA 4MAUL 1OL0A 3OGCB 4KJYA 3NZ8A 2ZUSA 4OUUB 5JOPD 4J12A 3I3DA 3PDOA 3RY6C 4MDJB 4G8IB 5EU6D 4JRXD 4KQ4L 2VLRE 4OCXH 3IDGB 3F7YA 5MERB 1U8MB 1M7DB 4KI5D 1GGCL 3TA3B 4FQLH 1PKQE 1FYTB 5GGUA 4HKJA 5JOEA 5FYLD 5DWUL 1EMTH 1MQKH 1JF1A 5DJ8B 1H0DB 3M17B 4G8GE 3N1FC 1LO4H 2F5AL 2CSPA 4W6WB 4U1SA 1U92B 5DI8A 3FQTA 1PW3A 4MNGA 2Y25A 5HJ3B 2VLJA 1WAAE 4YK4B 4U1NB 4TULH 3HC4L 3EYQC 3PDDA 1I8IA 2G2RB 3ZE1E 2VLKB 4FZEL 4PJ9D 2HRPH 2HVKA 2Y36H 2ARJB 2XN9D 5TGBB 5LGKA 1X4XA 5KAQG 5F72S 5CMAA 1CVSC 3MRPA 4RCAA 4EDXB 1CGVA 3J7HA 4FQXB 5D7KE 1OP3K 4LCIH 4AJ0A 1ES0A 4CW1A 1W2KT 3QPQC 3MV01 1MI5E 5EIVA 1MFAH 4XHJD 4LVNB 4XWGH 4JFFE 2I27N 2WBJD 2H8PB 3CX2A 4HIXH 4M7KH 4R26H 5E8OA 3V9FA 4Q9QL 3MRDB 2GW5A 4ONHA 5KSBB 5AG8A 3B6SA 3C60B 1XF3A 1Z0MA 4Y19D 4JQIH 3SEPA 1BWWA 2EDDA 1UB6A 1VHPA 2HT2D 4IHOA 1X7QA 4KK8C 4QT5A 3MJ9L 4G9FA 3IAQA 4NO0B 5MP6L 2VUYA 3WXWL 4YJZL 2OMBA 3HG1A 4KTEH 2ZWLT 4NO2B 3U30B 2VJXA 1MELA 4CGTA 4UIMB 5C0AA 2PCPA 3MLUL 5DJ0B 2NY2B 4EXPX 5IFJB 3HHRB 1OAUL 3N85H 3ZE0F 2A83B 3RVXC 1OM3L 4GO6B 2HN7B 4U4BA 5LXGL 3KPSB 1IFHL 4L3EB 4KI5F 2B0SH 1JHLH 1ACYH 1D5XB 1NMCC 4X5LA 5HHVL 1CFNA 3MMEB 4XC1H 1IKFL 3BEWA 5KVGH 3TNMA 1H3XA 3H0TB 2JCCE 1KCVL 4PJAB 5L2KE 2YA2A 2BRRH 2VE6B 3MNZA 1G6RL 3GGWA 2O61A 4U6XA 3I3EA 4QHMB 1J8HB 3O3UN 5D5MA 2Z91B 1RZIA 4G7VL 3L1OL 2IPUK 2C3VB 5C0CB 2R8SH 1ZAGA 5DK0A 4KVNH 2RAMA 5FO7B 2OQJA 2VLRA 1E0OB 3BPNC 1MIML 3UX9B 3QIUB 4JFOB 2GJZB 2NY1B 2P5ED 5E03A 4PJ9C 1U36A 2PNDA 1PKQA 4Z18A 3FOMB 2EXWD 4MD5B 2GY7B 3FQXB 3ARPA 4G8GA 1F2XK 4JGJA 4R8WH 5FYLL 4CJ0A 5ITFA 1KEMH 1IM3A 1KB9J 4H25A 5A3ID 1CDYA 2A9NH 3MJ7B 3TT3L 4XHJC 4RZCB 3WUWB 3TVMB 1EBPA 2WBJC 3L3KB 4H5SA 2R1YB 1WAAA 4G6KH 2OXGA 4LHUB 3EYUL 4RFEB 1F4YH 1WCBA 3BMVA 5I6XC 5DURD 5E6IA 3QEGH 4OZFB 5FUCC 4LFHD 4LQFL 2HT2C 2R39A 4RGND 3ILQD 4E42A 4WI9A 4U3XA 1UVQB 1WJ3A 3JV4B 2DL9A 2E27H 4CMMA 1MI5A 5FHAL 1T5WA 2QR0B 5I76B 4JFFA 2VTFA 1CFQA 3GUTA 4ODHH 3UP1A 2VH5L 1EK3A 1QSZA 4NYLB 2QADB 1R5IA 5F7WC 4N8VA 4WO4A 3TYGL 5D4QA 1FE8H 4OD3L 5F1NA 3DXAE 3HI5L 4C56B 2VWEE 4Y4FB 3WN5C 1F90L 2JTDA 4JPWL 2XYCA 2X4OB 3HC0A 2BY1A 4S1SL 4NWTL 4NGHH 2ICCA 5D2NC 1KJ2L 1P5VA 4MD0A 1U3ZA 5B39B 1CD8A 5T1KA 1A14L 1NBYB 1QSFE 5DFVD 3UROR 5IIEB 5INCA 1J0JA 3QQ3A 3TT1H 1YDPB 5HDBE 4AK1A 1TNNA 1LK3L 2L0DA 4MYWB 1MLBB 2HRLA 5FM5M 1DBJH 1ZVSA 2JCCA 5L2KA 1P2CA 2ENYA 2EO1A 1NSNL 2PYFA 2EKSA 4KHTH 2FLBT 4OZHB 3MRQA 2EXWC 5EUKA 2DMKA 1PYWB 4MD4A 4HV8B 1LNUB 4AIOA 4LCUB 2O5YH 2D7OA 3QEQA 1YUHB 3ARDB 4YBHA 2R2BB 3T8XA 1SEQL 4HBCH 1INDL 3ORJA 1BJ1H 4MJ6A 4AG4L 3O6KH 2VN7A 5F9WC 4RGNC 3ILQC 5C0FB 1RZ7H 2UY6A 4P2CG 1MHHB 1DQJA 2EDKA 2X4PB 4L3CB 3V0VA 3KPRE 2GITB 4UAOC 1W72A 4JDVA 3T2PA 3OKDB 2XQBH 3G6DL 2DQTL 1GAFH 2H26B 3MACH 3SDDB 3FFDB 4D9RE 4I18C 1DFBL 4KH2A 2E8YA 1HOCA 5C86A 1A7NH 4K9EH 5T5FH 3RZCD 25C8L 5HHXL 1XGQB 3SDCD 3F12A 3TGXA 4Z7VB 5DJZB 4DJMA 1QSEB 4JKKA 3QCVL 2JK5A 1AKJA 1UM6L 3JTTB 1GGIL 2V7HA 4PY7B 3VXMB 1INEH 1CE1H 4TVPD 2C3XA 1L9NA 1XH3B 5I15L 4X8XA 2DQDH 5DFVC 4JFED 3VJ6A 3GSUA 1KJMB 2BCKA 3O4LB 3DROA 3DXAA 4ORGB 2HMID 2WINA 2YMXH 2IAND 4GRLA 3MV9A 1DQTA 3MRJA 5DHYA 4P3CH 2VAAA 4C58B 1FVCA 1GPOH 1GIGL 1I4FB 4GLRH 1JZ5A 5IUSA 1FG9C 2CPCA 3HKFA 3WS6C 1INQA 3EO9H 1TQBC 4PJEE 2XICA 4PRHD 1AP2A 1G1YA 4AEEA 4JN1H 5CBEB 4JO3H 2DS4A 3SE3A 4OFYA 2X9WA 3L5WA 3RX5A 1CLZH 1CGXA 1I3VA 3HA0A 1FV1B 4XCNA 3ZKSD 3KLAB 1TZHA 1Q9KB 1H3WM 2Z35B 5C2BL 3SDAD 1CLYL 4KKBD 3B5HA 3ABZA 1T20A 2C4FT 2MQCA 3VWJB 3NZ8B 4O2EA 5ADOH 3PDOB 3O2DL 4HWZB 3QFDA 3D9AL 1KELL 1N6VA 3O6FD 5FV1L 2XZZA 4ZPTA 3SKNA 3U2SA 5D70H 5SX5H 5T33H 1HDMB 5M7QA 1QR4A 4HC1A 2XZQH 2IC2A 4HKJB 3C6LA 1A9EA 3L7FB 4ZXBA 1JF1B 3GIZH 3O3DB 2Q7NA 1CT8B 4D9QE 5A2IH 1E27B 1V3LA 3MBXH 4MNGB 1G7PB 1I9EA 3PWPB 3SDCC