5JR1H

Crystal structure of 10e8 ghv-maturel antigen-binding fragment.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
232
structure length
227
Chain Sequence
EVQLVESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVGRIKSKTDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCARTGKYYDFWSGYPPGEEYFQDWGRGTLVTVSSASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 10E8 heavy chain
publication title Developmental Pathway of the MPER-Directed HIV-1-Neutralizing Antibody 10E8.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 42
structure length 227
sequence length 232
ec nomenclature
pdb deposition date 2016-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jr1H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jr1H02
4HUXB 2F53A 3B83A 8CGTA 4ZOCA 3UO1L 5DFVC 2BMKB 5DJ8B 2JF1A 1Z9OA 4O5LL 2GQHA 5CIPB 3L5HA 1AO7B 2VQ1A 1HCVA 4OD2A 2XKUA 4XCEA 2H2PC 4K2UL 4YAQA 3ALPA 4K8RL 4NO2B 4XP5L 2AEWA 1DLFL 4DTGH 2VL5B 4OFYA 4FQ2L 1IEAB 4BUHA 2PCPA 1T5WB 3FB6A 2XIDA 2EDYA 3UZVB 4N8PA 3WIIH 3KPNB 4KRNA 5EN2B 4EDWL 1CWVA 3L5XH 3GBNL 2YUWA 4BFIA 3FN0H 4LRIC 5IMOB 1TZGL 3PGFH 3K8LA 3AS0A 2VXUH 5IEKA 4UT7H 4ZFGL 3ILQD 4B41A 4HKBB 3QI9A 3QNYB 1J0YA 4M6NH 1YMHA 3RVVC 3SDAB 3G5ZA 3TO4D 1Z3GH 1H3VA 3BPOB 2X4SB 2Z93A 2DTML 4FQHA 4M7ZC 4YIQB 1N7ML 1U8NA 4P46A 4YHKH 2CLZB 2X9WA 4GAJL 4OGXH 4CU7A 1QLFB 4Q6IC 1F4XL 3ARUA 1N0LA 2BMKA 4FTVB 5HGAA 5LAXB 1ODAA 1U36A 5CIPA 3VFMB 4PJ5D 5ID0A 2W91A 1AO7A 4N1HB 1ORSB 1MRCH 1UKTA 4PRDB 5TFSL 3H8NA 2B8OT 1CICA 2FIKB 3OPZH 5DUML 1VEMA 1FFOB 4DK3A 1BX2B 1IM9D 1BHGA 1H5BB 1UVQB 1T66D 5FM5O 4LOUD 4JFYB 4X5WB 3TO2B 4X9IA 2GK2A 4WFHD 3KPNA 2GTZB 5EN2A 5FO8B 4Z5RB 3O41B 1OPGH 1TQCB 4YXLL 4ZFOL 5GHWH 2UZIL 4E9LA 3VGFA 5KSUB 4PB0L 5J1AB 2ADFL 1WZMA 4LCIL 4Z78B 4I4WB 4FXGB 3ZYJA 4HKBA 1XCTB 3QRGH 4L3ED 3C6LB 3SDAA 5JXEC 3VG0L 5F6IC 4QHMB 3VJ6B 5GZNC 3UJTH 4P0DA 1PJ9A 2AXFB 2X4SA 4RGMB 5FYJL 1CXFA 3HZVB 4P4KC 4HIJB 4YIQA 4GAYB 1FYTE 3RIFK 1E4XH 5JMRA 4KROD 2CLZA 3MV8B 5I9QB 4IIQC 2J12B 2Z31A 3CC5B 5FA4A 2IMNA 3NFPA 1A7NH 1AQDA 4CVUA 1CDJA 5LAXA 1RUKH 5I1IL 5E08L 4CMHC 3CU7A 3VFMA 3SEPA 3SBWC 3KXFA 4HLZG 4X6CF 3RIFF 5FV2A 2FIKA 2PYED 4XX1G 3T04D 1FFOA 4AH2B 4URTB 12E8H 1BX2A 4P99A 1H5BA 1YYLH 4JFYA 1IZKA 4X5WA 3O4LB 4LHUA 5EZJB 3TO2A 3OHXB 1OT2A 4V1DE 1RY7B 2A6DA 5GJSH 4I8DA 2GTZA 2W60A 1X6NA 5BW7C 5FO8A 4Z5RA 2H45A 3RWHA 5IHZA 5I1AA 3OKDB 2HFGH 3BD3A 1A7OL 5KSUA 5J1AA 1XMWA 5EIIA 4I4WA 5F6HJ 4HWUA 4FXGA 3G9VA 2YKLH 3HB3C 5H37H 3QDGD 2D7OA 4TQEL 3HI5L 5ICZA 1WK0A 2AXFA 2LQRA 4NBYB 3HZVA 4HIJA 3VFTB 4FN0A 4GAYA 1KB5H 3JV6B 3MV8A 4QNPE 3CC5A 1I7TB 4N90D 1FRGH 1I3GH 4JM4L 4U6XA 43C9A 1RULH 3MQIA 1Q9KA 4JANB 2IMMA 4KAQL 4NWUH 2BVUA 1I8LA 4G8EA 4G9DB 2XA8H 3DRQA 4IOSD 4ZSOE 3D1MC 3TJEH 3ME0A 4OT1L 1Q94B 1JJUA 3Q3GB 3QUKA 3U1SL 3O4LA 5EZJA 3DVIA 5GS0D 3OHXA 3OGOE 2FEEL 1MHEB 4DGVL 3V4VH 3B9AA 5C9JB 2BHYA 1LDPL 5E6IC 1NFDF 1URLA 3A6BH 1OD9A 1A1OB 4HUWA 3OKDA 4ZOBA 1S78D 3R06B 3VG9C 4QXUL 3RBSA 5DMIL 3UTTD 3JV4B 4I3RH 4R7NA 1D3CA 1F45A 1TZIB 2DM3A 1F4HA 2AK4D 2RAMA 2OR9H 3MC0A 3W39B 1F3RB 4OM1L 3EDKA 1RZGB 2FJGB 5CD5C 4XGZB 3VFTA 3BE1L 1HHHB 3L3HB 3JV6A 3CX5J 1KGCE 2LAGB 4OD1H 5GGRB 3ARDB 1BJ1H 2MFNA 3HC4L 4NHCL 3VRIA 4JANA 4EXPX 4LSVH 3ULVL 5HHXL 5D7LD 1IT9H 1XGYL 2IBBA 2OZ4L 3V79C 4UT9L 1QBLH 3TFKC 1QFUL 3ZLQC 3BX7C 1NUFA 3Q3GA 4GSDL 4ZO7A 1WGOA 4JFHD 1BBDH 3VRJA 1J8KA 1KTRL 4OB5H 4U1KB 1JF1B 3FAWA 5C9JA 1J11A 1NAMB 4KXZH 1OTTC 2P8MA 4PRIE 4LGPB 3R06A 4N0UB 2Y23A 4F8QA 1FE8H 1DTUA 3JV4A 5I30L 1UWGH 4YC2B 4PJ9C 1ACYH 1TZIA 5D7IB 3CFJA 5FM5M 1NAKL 1CLCA 3MFGB 3WO4B 1CZ8H 1H8OA 3W39A 2MHAB 1G7JB 3VRLE 4AL8L 1ULVA 4IM8A 5JNYB 3L3HA 1HHHA 1Q72H 2VIRB 3BDYH 2DQHL 4PJEE 3QQ3B 3MOBL 3GKWL 1KCUL 1R3IH 3HA0A 3SO3B 4BQ9A 4YX2H 4OFIA 5GGRA 3RU8H 4HJ0C 3SGDH 3TZVC 2AK1H 2NPLX 2ZCLH 1J8HD 1ZLUK 5JHDE 4N0YL 5JDJA 2BJML 1U8IB 5D7KD 5K93A 4M1DL 2MQCA 2H3NA 2BFVH 2CK0L 3HE6D 3PWPE 4IRSA 3VFOB 1HXYB 2ED8A 1V8HA 3NH7H 3ZKNC 1IQDB 1HHGA 4OLWH 1KUMA 2A77L 1OCWL 5HHMD 2BXYA 3EJZD 1T3FA 1EVTC 2DKSA 5CINH 3NCEB 2VNCA 3SJVE 4NP4L 3FOLB 2Q7YB 1MFBH 5D5MF 3FQUB 4U1KA 1JF1A 3F62A 2I60L 4H20H 1DBMH 1NAMA 1QNZH 5D2LF 3O6ML 4NNXB 4G7VL 5C0FA 4JN1H 3D18B 1JZ3A 5T5NG 1BP3B 2X1OA 4P2QD 4JFXB 3IFPB 5AD0B 4TOYL 3LV3B 4KY1L 8FABB 4HW6A 2KUTA 5D7IA 5GS2D 2BVPB 1FNSH 3O2DL 4F7PA 5C0NC 4IOIB 1XGUB 3VMOA 1G7JA 2VN4A 1EJ6A 1HOCB 3TN0D 4HWBH 1CGWA 4G8IA 2ZUYA 2IAMD 5HGDB 5DEZA 2VIRA 1HWHB 2APFA 1BBJA 5FV1L 3QIWD 2MTPA 4JY5L 3MUY1 2CRZA 2YA0A 4Y5XC 5SX5K 3RI5K 5J6GA 2NY4D 4DUXA 2WBJC 2O5YH 1U8IA 4LLVB 4G6AD 1DCLA 3WNNA 3TO4B 1HYSC 3VFOA 4A6YH 1HXYA 1DBAH 1G7LB 2HTLC 3WFBH 5TE7L 1IQDA 3L3GB 3RI5F 5HYQB 5T3XH 4PJFB 5GGQH 4JFDD 1ZHBB 3FOLA 1CE1H 1UXWB 3FQUA 4MQXD 4WI2A 4EI5D 3WCYA 1Q9OB 5EBWB 2R23A 4PJ5B 1BVLB 4KI1A 1T0NB 3HZMB 4KVNH 2PN5A 3D18A 5K9KB 2O5XH 5CFHA 1QPXA 3AB0C 1VPOL 3DTXA 3IFPA 3P4OB 5AD0A 4Z7UA 5DD1H 8FABA 1TDQA 2BVPA 5EH1A 4IOIA 1XGUA 3GEWB 3O2WL 1HOCA 1U91B 5D93B 2VC2H 5LG1A 2PUQT 3VH8A 2P5EE 5HGDA 1BZQK 1U0QA 2HJKA 1I1AC 1NCWL 4PB9L 4XP1H 4YHZH 2ZUVA 2ARJA 1YC8A 1JNLH 5DJYB 2OTPA 1X5GA 5D72L 3MRJB 4YQXH 3B2VH 5KVEL 3OWEA 1UCBL 4RGOL 1C08B 3QHZH 2RQ8A 4OLXH 5FGCE 4LLVA 3VXRA 3RKPA 4M5YH 4L3EB 1LDSA 3OKEB 4LSRH 3TO4A 5I1EH 3LKRA 3BPNB 1G7LA 1N6QH 4JGJA 5L2KE 2GFBA 3L3GA 4KROB 3BKJH 4W6XB 4PJFA 4DZBA 4I2XB 1ZHBA 3X17A 2W0KA 4IRJD 4KI5C 1Q9OA 5BJTA 2VXQL 5EBWA 1LP9F 1NBYB 4PJBE 4XPBH 1T0NA 3H2WA 1NLDH 2EXWD 1W72H 4K9EC 1CLZL 4XC3L 4ZO9A 3P4OA 2PYEB 2WANA 3KYKH 3C8KA 3OZ9L 4XWGL 3P30H 1P9MA 1U91A 2AS5M 4OZIF 4ENEC 1QQDA 1A6UL 4R4FL 2K1MA 1EJOL 3ZHLA 3HLAB 3MRJA 4UI2A 1INDL 1C08A 1HSBA 3SDXB 4IRZL 4HIEB 3HE7B 3OKEA 3FQRB 2EDLA 2HP4A 5ACLA 4HUVB 1U58B 2QHRH 1MJJA 3QH3A 4LF3A 2RJMA 3I6GA 5LWYL 4I2XA 3MRQB 2C1PB 4C56E 1OGAE 4FOMA 1VACA 4GLRH 2IPTL 4M62H 4QXTB 3MRNB 2EECA 1NBYA 2EYRB 4TTGA 4XCNA 5BZWB 3DHJA 4NT6B 3AMLA 1HINH 3MRGA 3GGWB 2PYEA 3E2HB 3K74B 5ITBH 1N59B 4GXUN 4RDQF 4NQED 1Q0YL 2W0LA 5I1GH 2I25N 4BA8A 3EAKA 2A6JB 4BQBA 1RURH 3SE3C 4BYHA 2EKJA 4E0RB 3R8BB 3HRPA 4LSPH 4S0SD 3FCTB 1S7VA 3H7LA 4HIEA 3HE7A 1K5NB 2AK4B 4WWKD 4ZFFB 4GRWE 3UTQA 1CFBA 2BOCB 1U58A 1JHKL 2EDFA 4I18C 4WTZA 5BCAA 1ED3B 1PSKH 1IC7H 4ODUA 4MCZB 3MJ7A 5E9DE 2VITB 3F65A 4MJ2A 1IGTA 3WFHA 2C1PA 5J11B 2EDQA 3QUZA 4YUEL 3UXFA 5E2WL 2GUOB 3K1KC 3BKYH 3MRNA 3NOIA 4H0HB 4QXTA 1IAOB 2EYRA 5E2VL 1JNNL 1D9KD 5D7LB 3O6KH 5BZWA 5KVDL 3IDUA 4NT6A 4JFED 3BD4A 3GGWA 3EZJB 3HNTL 1KN2H 2R0KL 2R69H 1IM3B 3MFFB 1N59A 3JWDL 3EO9L 5CSZA 3OJDA 2F8OA 2FJHB 3UAJD 4H8WH 2DIAA 3PWNB 5DD5L 1WFOA 4KV5E 3OR7A 5EORL 1OAZL 5JW5B 5ID1B 2AP2A 4HPYL 4D9RE 3FFDB 2X2YA 2A6JA 3PHOB 4Q58C 4JPIB 5FDWA 2GKIA 4UV4L 1G84A 5KTEL 2VR9A 3VU2A 3UPAA 3GI9L 4DKEH 2X4TB 1EFXD 2AK4A 4F33B 2BOCA 4XBGB 1NJ9A 1ED3A 1X4XA 2YSSB 2XNAA 4MCZA 2VITA 3QSKB 4Y4HD 3S4SB 4ZOAA 2W07A 2NLJB 3MZTA 2OM5A 2DQGL 3QHTC 5I66B 1ZHNB 1NUDA 4EUPA 4X6BB 1A7PH 2GUOA 1J8HB 4XX1E 5GZOC 4PLOB 4PJXB 5DK0B 5D7LA 5TE4L 3KLHC 2JJTA 3HE6B 4CVZB 3SKNB 4XVJL 4ZPTB 1JN6A 3GSWB 3V6OC 4UILL 1CF8H 4MJID 4LSTL 1DANU 5E2UH 2FJHA 5HHMB 3MLYH 4KH2A 3TNNB 5AG8A 4ZMAT 2R8SL 3VXUD 2E27H 4U6VH 1F90H 2VZVA 5JQ6H 3KNBB 1XF5B 5JW5A 4GQ9L 3FFDA 3P0GB 3X11B 2HMID 4OM0L 1OAUH 3BJ91 4ELKA 4PV9B 5JIIA 1P2CA 2X4TA 3MXWL 4F33A 4O4YL 4LPYA 1MCQA 3GSNL 4FNLH 4XBGA 3TN0B 1T21B 3RTQA 2YSSA 4U3XA 2IAMB 3BZDA 2C5DC 3LIZH 4PJ8D 3N1PC 4XP6L 3RY6A 3S4SA 3QIWB 4P9ML 3O3EB 4Z0XA 5I66A 1ZHNA 4ZD3L 3S96B 1MREH 3IU4H 1HK6A 3BKMH 4X6BA 2NY4B 4YXKH 4JG0L 4PJXA 4B50A 4PPTA 4YXHL 4NQTA 3HE6A 2CO7B 1P6FA 2Y07L 5DD3H 3SKNA 3F7VB 1KV3A 1P4BH 1KLFA 1MCWM 4NNYB 3GMLB 4NQSA 3KWWB 2EEBA 1HKLH 4XNYL 4BZ2L 5H2BB 1HHKB 4YDIH 4JFDB 3VFRB 3RAJL 2R9HD 4EI5B 4TNWK 1LE9B 5E94B 3KNBA 3MBXL 4LARL 4S2SA 2Z4QA 1FVEB 3X11A 4ZAKA 1QFPA 2I9LB 4QNPF 2FYYB 3A0OA 1DEDA 5ETUB 2VLJD 1LILA 2AI0H 4JPWL 3K8MA 3W9EB 4PV9A 1UJ3A 2IH1B 1JGEB 2OK0H 3BAEL 3EHBC 4JM2D 1CFTB 5C0IA 4LCWE 4K07A 3TN0A 1RZFL 4WTWA 5IB4B 2DQDH 2WK2A 2IAMA 3PL6C 5FYKU 2EYSB 4FQLH 2EEDA 3QIWA 3O3EA 3V6FB 1YEKL 2APWA 2YZ8A 1BQUA 3GRWH 2V7NB 2QKIB 1N0XL 4X4ME 3TVMD 3LD8B 1C5BL 3TH3T 3VD5A 3HUJB 2GIYA 4HWEL 1JMZA 1RUMH 5AEAA 5I1JL 4UTBL 1UA6L 4OGZA 4ZNEA 1FNGB 3GMLA 3ARGD 3KWWA 3HI1B 4KUCF 1RIUH 4CMMA 5H2BA 1MCSA 1HHKA 2FBOJ 4P23D 1ZEAH 4ODVL 3SE8H 4XVSH 4JFDA 3VFRA 1XF1A 5FUZL 1HDMB 4EI5A 4JRYE 4IRJB 4PUBL 4GKZA 1B2WH 2DQUH 2I9LA 1PX4A 2FYYA 5I18H 2D4DA 1DBJL 3ZHKA 1AE6L 2EH8H 4JE4B 3B2UD 3UZEA 1YYML 4R0LA 2IH1A 1JGEA 1BFOB 3F7RA 3O3DB 4MD5B 4XXCC 4YBLB 3RWFB 1RZIB 1CFTA 3C60C 5HDQL 3C09B 3BDBA 5AG9A 3FZUC 1R5VB 5DA0B 1T0PB 4R90L 1N8ZA 1RJLB 5ESAB 1UENA 4D2NA 1JUFB 1ZLWK 1MF2L 3NFSH 3IJYB 2XTJE 5IVXB 1X5KA 1QFHA 2V7NA 2QKIA 2J88L 4U1JB 3LN5B 4ALAH 1G0YR 4EQ3A 4JZJB 1FFRA 3HUJA 4DUWA 5ECJE 2RFXB 2F8VA 1FNGA 4OF8A 5DT1H 4JDZB 3ZYIA 1JRHI 3BGFB 4FZEH 1CTNA 5IBUB 3WFZA 1HDMA 3WDIA 3VRLF 4IRJA 1MCPH 3NCYP 4PJEF 2AQ2A 3IF1B 3QDMD 3BDXA 4UAOB 3DO3A 5C0RL 5J3HC 3O3DA 1BFOA 4MD5A 5F9OL 2UWEB 1RZIA 1SYVB 4H88H 5SX5H 4NQEB 5IMMB 1F8TH 4YHOH 4L4TD 4I3SH 3HMXA 5ESAA 1P53A 1I85A 3QDHA 3WIIL 3SDDC 3IJYA 3F12B 5CEZE 1MRDH 1TMCB 35C8H 4JG1H 3L5XL 4GH7B 2OL3A 4JZJA 4FQIH 3ARBC 2ZWLT 4WWKB 3PGFL 1UQSB 1OGTB 2VKWA 4LBEB 3G5VB 1I1FB 5DUBB 5DZOA 2VRAA 2XKSA 4FG6D 4DN3H 1Z3GL 1G9NC 5CKGA 3G5XB 4OFPA 2D7QA 4X7SL 5IBLD 3PGDB 3BWAA 3MOAH 4BH7A 4ONHB 4Z18A 2WMPA 4YHKL 1JCKA 3T3PE 4JGMA 4OGXL 1DN0B 1D9KB 2HTKD 4DZ8B 4Z7NE 1QG3A 3HMWH 4JFEB 3IF1A 1WFNA 4WFGE 4JY6B 5FCUH 3SCMD 2UWEA 4MDJB 2X05A 1SYVA 5T5FH 4UNVA 3W5NA 4NQEA 3DXAE 4UZGA 5IMMA 1D5XB 1M7XA 5L0QC 4IHOA 4YHLL 4ZG1A 2J8UB 1JZ2A 3CSGA 3OG6B 4XXDB 2GT9B 1WIUA 2XFXB 2X40A 1CGTA 1OPGL 3V5DB 1NMCB 2PYFB 1WT5A 2VSCA 1QEWA 1EFXB 2IFFH 4Y0GA 2WAHA 5HI4C 3PWUB 4POZC 3W11C 2F54E 1UQSA 1OGTA 4LBEA 2FEDC 3G5VA 1I1FA 2M1KA 4KK5C 3QRGL 4Y4HB 3EKCA 1XCQB 3N50A 2JLLA 4DOHE 4YHPB 1JPSH 4QLRA 3RJDA 1MCFA 3G5XA 4L3CB 1A47A 2R4SH 2KDGA 2BNQB 2R56H 3A6CH 4U0QB 3U30B 1E4XL 2AVGA 4P4RB 3HPLA 4HJGB 3C5ZC 4X9FA 1A7NL 1D9KA 1H8SA 4JFEA 5DR5H 1RUKL 4JO3H 4JY6A 2GI7A 4MNHB 2JCCB 4MDJA 4MJIB 1F11B 4YEEA 3KJ4B 4HGMA 3AS2A 4CU6A 1D5XA 2V9RA 3RQ3A 12E8L 4ZTPL 1MCRA 4ISVA 5F7NC 5ICXB 4XXDA 4L9DA 3VDBA 5GJSL 1YMMD 2GT9A 3GMNB 4RFNC 5DYOA 3ZKXC 4WFEE 1FDLH 3V5DA 3P4MB 2HFGL 5J56B 4XPHH 1FPTH 4PJBF 4OLEA 3CXHK 3H7BA 3O2VH 4JDTH 2F74B 4PJ8B 4Y4HA 1XCQA 4GW4A 4TSAL 4XWOD 4NOFA 1VFMA 2NYYD 3F5WA 2BNQA 3NPSC 1KB5L 1HQ4B 2VABB 1KCSL 2MCG1 3C5SB 4GOSA 4P4RA 4GRLC 4HJGA 2F58L 4BZ1H 2EE6A 4DVRL 5CJQH 4CN6A 1I3GL 1AI1H 5F7EH 5IB2B 3OAZK 4MWFB 2D4FA 1EO7A 4MNHA 4NBZB 3VFGL 4C55A 2JCCA 3PP4L 4MJIA 3UDWC 3H3PH 4RGND 2XA8L 2HLAB 3GBLA 1E4WH 3TJEL 3UTSD 1YPZB 4FQQB 5SV4A 5J12C 5IF0A 1MJ7L 1OW0A 3KHQA 4Y2DD 2OL3L 5ICXA 1E27B 1ZS8B 3E3QE 5FUCE 1NBVL 1MCLA 3V4VL 4WHDA 2PXYD 3F6LA 2JIXA 2VLJB 3A6BL 1XF2B 3O6LH 2EDNA 4WTZG 1RUAH 2YD5A 1Q9LB 3RWIB 5EC1B 1T2XA 4JM2B 1SMOA 5E03A 5DJZB 1FQ9C 5F3HA 4I3RL 1BM3H 4Z7WB 4JPVH 5CKAA 1AO7E 2F74A 5FCSH 1SY6A 2OR9L 3D9AH 2XWBA 5HYIA 3K1DA 4QHNB 3S37H 4K7FB 4ZS7H 5FYLH 1S9XB 1G6RH 3MLVH 1HQ4A 3TF7C 3TVMB 2Z8RA 2EYTA 3MLTA 2XICA 4OD1L 2XPGB 1L6ZA 2ITDB 4M6MH 4XVUD 3PNWA 4KQ3H 4L9LB 4YDVB 5IB2A 4MWFA 2X70B 3ARGB 5EBGA 5C0EA 4LKXB 3R1GH 5JHLH 5DJXA 4U7MA 4P23B 1WUNT 2VJXA 5IK3B 4GRWF 1QBLL 4FQQA 1ROWA 4U0RB 2I07B 1OTUC 2VLLB 1BBDL 3GZKA 4ZUTA 1ZS8A 4JVPA 1GIGH 2Z35B 4O2FA 5D1XD 4J1UB 4OB5L 2OJZH 1FZMB 2VLJA 2XA3A 3KYOB 4BM7A 2ZG1A 3OG4B 3RWIA 4R26H 1ADQH 4FTVE 1FE8L 4JQIH 2LTQB 4UNUA 1DQMH 25C8L 1UWGL 1L7TL 5DC9B 1SBBA 1ACYL 3IRPX 5KW9H 4MLIA 2YPLD 1CZ8L 4PJDB 4YWGH 4RMUA 4EUPG 3GJFK 4MQSB 1SJHA 3RJQB 3WS3B 4QHNA 2VN7A 4K7FA 3C2SA 1Q0XH 1Q72L 2GEEA 5EU5B 3UJJH 1TETH 1ORQB 3O0RH 3TVMA 5CJXA 1C5CL 4ONFH 1IKFH 1UYWH 4KV5F 4YX2L 1KFAH 3RU8L 2DD8L 3V52H 2HH0H 2ZCLL 4JY4B 4L9LA 3OBAA 4K23H 4YDVA 2X70A 2OI9B 3KDMB 3ARGA 3H9YA 1VDGA 3RVXD 3PXHA 5E6ZA 2BFVL 2OCFD 5IK3A 5D8JH 4HH9A 3NH7L 1MI5D 2R29H 3HI6H 4OLWL 1A7QH 5C6TH 3NN8B 1WWWX 2VLLA 4EZMA 5CINL 3OGCB 1KB9K 1LO0H 3SGKC 4HC1H 4J1UA 1MFBL 2ICEA 2NX5D 1RI8A 1HIMH 1L0YA 4AZ8A 1XIWC 4H20L 1DBML 2CUMA 3CVHH 3KYOA 3QDMB 3VD7A 4D9QD 3MV8E 1QNZL 2AJZB 5MERA 3N0PB 4ZXBA 3QR2A 4X5XB 5CMAB 5I6XB 3PWJB 2CKBB 3S4SG 5KSBB 4O2CA 5DQ9B 1NDMB 3X12B 3QJHA 4L4TB 2HT3C 1FNSL 4PJDA 2ZUQB 5DS8A 3KR3H 4I0CC 4APQA 3WS3A 3U36B 4HWBL 5AAWA 1G9EA 5IG7B 4LIQE 2JK5B 1NEZB 3O6FD 5BS0D 5FKAB 5EU5A 3CFDA 1ORQA 4YHYB 5I17B 2QQQA 1J10A 5JIHA 4MS8C 1K2DB 3O4LE 2VQTA 3LVEA 2BY3A 2DM2A 5K9JH 4JR9H 4Q74A 1LEGB 4JY4A 1UT9A 2KZWA 1MWAB 4ZS6D 2O5YL 1CGYA 1UADC 2QHLA 2QSQA 2DLGA 4I13B 3VMNA 1ZSDA 4NNPH 4A6YL 5MHSE 2PR4H 3D85D 1DBAL 4H0IA 4M4PA 4U6HA 4MA8H 2VE6B 3NN8A 2HT4D 3WNKA 3H9SB 3OGCA 5GGQL 5T3XL 3WN5C 1NCDH 1CE1L 1T6WA 1KCVH 2AJZA 4F9PC 4EBQH 1BFTA 4N9OB 3SCMB 4X5XA 1FG9C 5T1LD 4EEEA 1A6TA 4KVNL 3B9EA 3WUWB 5CMAA 1SY6L 2O5XL 3PWJA 1IGJB 5KSBA 3EO1B 5DQ9A 5A3ID 3X12A 5DD1L 3QFJB 2DN7A 4U1IB 2H8PB 3G04A 1PG7L 3IJHB 1A5FH 3AM8C 3PHQB 4KMLB 2LVCA 3U36A 5IG7A 1QUNA 2JK5A 2IAND 1NEZA 4PRAB 4R3SA 5E1AB 5LBSH 1A4KB 1IFHH 2H32B 4XP1L 1TJHH 4YHZL 1JNLL 4OD3H 4YQXL 3B2VL 1NGWB 4PLKD 3IDNB 1MWAA 4KDTA 4NKDB 3QHZL 4OLXL 1DN2A 3STZB 4M5YL 3S34H 1G9ML 3JVGA 5LXGH 5I1EL 3QAZB 1FO0B 5MEND 1NGPH 4Y1AD 3T4YB 1QVOB 4O58H 1N6QL 2VE6A 3WKML 1HEZB 3H9SA 3BKJL 1AGBB 1SJVA 5KSAC 1B6UA 1P84J 4HDIB 4S11A 4FFVD 1MAKA 3SCMA 4XPBL 2BC4A 3PIQB 4G3YH 4J4PA 1A64A 2Q76A 2R0LL 3WUWA 1A14L 1NLDL 1W72L 4HUUB 3EYSH 4K7PY 3U9PH 3EO1A 2R4RH 2E8ZA 1N3NB 2NY3D 3QFJA 2H8PA 3MYJA 2X9YA 3TH2T 5IESH 3ARQA 4JFFB 3HZKB 1G7PB 1S3KH 3EZ8A 4PRAA 1YMMB 5C0AD 3UROR 1A4KA 5EOCH 3KPMA 3CD4A 2BVOB 4D3CL 5I73B 3CK0L 3IAQA 4X9GA 2E9JA 1T6VN 1NFKA 1NGWA 5DRXA 2X4OB 5C70A 3O9WD 4NKDA 3MCG1 2DLEA 3MLUH 3STZA 2Z8SA 4N0UE 3WD5H 3DUSB 4JQVA 1FO0A 5KS9B 3FQNB 2QHRL 4UINL 3T4YA 5D7IE 1QVOA 1T1ZB 4OFKA 2UUDK 3DI2B 1CD0A 4LHQB 1HEZA 1AGBA 1JHLH 1EGJA 4Y16A 5E00B 4KKCD 4MZ3A 5BVJB 3MV9D 4HDIA 3LEYL 3H3KA 3IU3B 5DK2B 1NC2A 2AQ1A 2LU4A 3VD9A 5EZOL 3EYOB 1CG9A 4HUUA 4MX7A 1HINL 2A0LC 4RGNB 3RGVD 3TBSA 1UKSA 3ALWA 3UTSB 2NY0C 4HGKC 5ITBL 2YD3A 4TVPE 4DKDC 4Z95H 1RZKC 4JFFA 3HZKA 4Y2DB 1G7PA 5GGSY 4JPKH 2G60H 2HA1A 5I1GL 5FO9A 4UBDC 1IQWL 1YMMA 2FH6A 1P5UA 1DQJB 3DUUB 4I0PC 2PXYB 2BVOA 2QEJA 4JB9H 3OKYA 5T5NF 2ZCKL 1AJ7L 4NKMA 2YD2A 3F7PC 3N9GH 1RURL 2VTFA 3DGCR 4HKXB 5F21B 4P2CG 4YHMH 4M1GH 5IBUG 3ES6B 2P47B 4KUZH 5DUPH 2DM7A 3VGAB 3OKLA 1FC2D 2FD6L 2BVTA 5KS9A 5MP6H 1PSKL 4KQ4H 1IC7L 1CD9B 3QISA 3LSOB 3KPRD 3QEQD 2DIBA 1TPXC 5E00A 2CUHA 3T0XA 5BVJA 1AC0A 4ELMB 4KFZC 3BKYL 3AS3A 4JHWH 3SE4C 1LWRA 3B43A 1HZHL 5M95B 3EYOA 3O6KL 3QDJD 1PY4A 2DLHA 5IR1B 2C3XA 5JR1H 3G6AA 5L8KB 3UTSA 5J06A 2R69L 3T09A 4U7SA 3ZTJH 5FECB 4YDJB 3NCMA 2F19H 2N56A 2HT2D 4N0FB 4Y2DA 4H8WL 4U2YA 4X8XA 5D1XB 3DMMC 1YEIH 5L8LB 2ITCA 3DUUA 4AK1A 2PXYA 3ULSA 1JBJA 4F2MB 2E7HA 1X3DA 4PJFE 2QSCL 4OLVH 1EAJA 5AZ2H 3T3PF 3VXNB 1SM3L 3PDOB 1H3XA 2PO6C 4Z7NF 2A9NL 4PJ5E 1XGQB 4DKEL 5DGQA 2NR6D 2YPLB 3ES6A 1U92A 2ICWJ 4XPFH 3SDCD 3QULA 3MSPA 4ODWB 3RL1B 3BQUC 2G5RA 2UY6A 1LK3L 4HWNA 3CSPA 3MV7D 2BDNH 5DMGC 2CIIB 4ELMA 1A7PL 1VFAA 1MQKH 1R24A 1NLBL 5FHBL 4Z8FH 2WWMD 5IFHH 2WNGA 4OZFB 2CLVA 5IMKB 1YC7A 1WCQA 4HMEA 4H26B 4FFWC 1CF8L 1MI5B 5L9DH 1Q38A 2JJSC 4L3EE 5CUSH 5FECA 4YDJA 1RHHB 1L0QA 4N0FA 3MLYL 1DBBL 5D1XA 2E27L 4KJQC 5D1QD 2NX5B 4LCCC 1DUZB 1F90L 5F96H 3VXMA 4LCUB 5JQ6L 3MROB 4LCYB 3NFNB 1ITBB 4I2XE 2MCPH 5A2LH 5IB5A 4UNTA 4LMQE 3N1GC 3VXNA 3LEXB 1KNOB 1OAUL 3QQNA 5MEQB 1WISA 2MNUA 1I9JL 4LVEA 1A6WH 2YPLA 1BFSA 4PD4K 2E3VA 3IFOB 4FNLL 4RAUB 4DQOH 5A2JH 2PYEE 5DFVD 1OAKH 5FGBC 4WW1B 1EGJL 3O6FB 4GXUM 5BS0B 3LIZL 3RL1A 2H9GA 1JGVH 1RZJC 1YEGH 5D96B 4GUPB 1KXTB 2N4IA 1V7ML 5F7UA 2H2PD 4QRPD 2EIEA 2ZG2A 1MREL 5CZVH 3EO0B 3BKML 2CIIA 1O7VA 5D1ZC 1EO5A 1IL1B 2NW2B 2BSED 1U93B 2QV2A 1SEQH 3B9KA 5HY9B 3QEHB 3WIHA 2JJVA 4U33A 5IMKA 3V95A 5DD3L 4JO4H 4ZYKA 1RZKH 2DM4A 3D85B 4NN6B 4JFZH 5FGRA 3MRKB 1HKLL 2ID5A 1UZ6E 1M4KA 4YDIL 4Y5YB 5BMFH 2FZ3B 3GBMH 1FVCB 1TJGH 4K7PL 2NX5A 1DUZA 4KK8C 4LCYA 3NFNA 4WNQB 4N90E 3DIFB 3B5GA 2AJVH 3UPRB 3LEXA 5F1KC 3HAEB 1KNOA 2AI0L 2IPUG 1QTYT 3FHQA 2YHGA 2ZCHH 4GRWH 5KN5B 1EHLH 3BO8B 5DJDA 1DFBH 4WW1A 2DQDL 2IANB 1VKXA 3O6FA 3R8QA 3VXQB 5JXAH 4FQLL 1KC5L 3HKFA 4LL9A 5F8RC 1F4WH 1MY7A 3JTSB 4OUUB 3EO0A 3GRWL 3V7AG 4WW2B 2NW2A 1IL1A 2XZQH 1U93A 5EDXA 3OAYK 3GNMH 4M7LH 3FB7B 1RPQA 3EFDH 1IAKB 1QA9B 3QEHA 3FRUB 4KPHH 1RUML 1NL0H 4M6OH 5BZDB 5MENB 1BZ9B 3DROB 3EOAB 4Y1AB 2XZAH 5E2JA 5F44A 2AK4E 1RIUL 4TULH 4F9LA 4MLSA 3DRTB 4HCRA 3CMOH 1ZEAL 3SE8L 2FZ3A 4XVSL 5DJ6A 5JZ7C 4LDLB 1I75A 3VGGA 2QR0B 3U7WL 3TA3C 4XNXH 5ADOH 1KCKA 4KJPC 1B2WL 3HFMH 4K3EH 3GJFH 2DQUL 4WNQA 5JXED 3DIFA 5GZND 5BV7C 5JOPD 3UPRA 4DEPC 3HAEA 3RVTC 3CXDH 4P4KD 4Y19A 2NY3B 4RRPA 4GJTB 5FOBB 3H9ZA 5D7LE 5KN5A 1CDBA 2IANA 2FCBA 1DQDH 2UY7A 1IAIH 3I75B 3VXQA 5C0AB 5C71A 1R5IB 3RVWC 3QG6B 4YO0B 2Y5TB 4JFHE 2K7QA 1P7QD 3JTSA 1E6JL 4HLZH 4GG6B 4OUUA 5DO2C 4WW2A 3QUMA 1TQBC 3B4NA 3O9WB 3SOBH 1IAKA 1QA9A 4I9WD 4ODSH 5IBTH 3TYGH 3NGBB 3FRUA 5CSBA 1BMGA 1T89A 4PIRF 2IALA 4JVWA 4HULB 5BZDA 5MENA 1BZ9A 3DROA 4Y1AA 1ZTXL 4CUCA 3PDGA 4NKQB 2ORBH 2Q86B 5HVHC 1VERA 2VDMH 4ZUUB 2QR0A 1ZWIB 3CFKB 3FB5B 4U4BA 3MV9B 2FX9H 1QKZH 4K3GA 2E6QA 5ALBL 1J88A 1D6VH 1K8IB 3VXSA 3DETD 3PWLB 4HXBH 3U2SB 1CGXA 5T1KA 1J8HE 3D2UD 3RGVB 3MXVL 4PJXE 4R8WH 4JHAL 5D7KE 2OLDA 1IC4L 5E24E 4LPWA 4KKLC 4H88L 4KTDL 5TF0A 1N2RB 1LMKA 1F8TL 4YHOL 3I75A 4I3SL 5C0AA 5HHME 2Y5TA 2DQJL 3IDMB 2BY1A 4GG6A 2D9QB 1MRDL 5KJRH 35C8L 4JG1L 3O9WA 3STLA 4FQIL 4LQFH 3FN9A 5CBEB 1UXSA 1X5LA 4OKVA 5HYSB 3BRFA 1A0QH 3I3BA 4GAFB 4XMLL 4RBPH 4U1NB 4NM4L 4Q0XH 1CGVA 5IROA 5E6ID 5T3XD 1H3GA 4DN3L 5FIEA 3I84A 32C2B 1O7SA 3KPRB 3BOVA 3QEQB 5DJAB 1PGRB 3HTLX 3P0YH 4ZUUA 3KPSD 3LKQB 3MOAL 3LKPB 1ZWIA 3FB5A 1CFVH 1N26A 3MV9A 4Z77B 1RK1B 5IWLC 1NMAH 2XQBH 3D39A 1K8IA 3PWLA 3QDJB 3HMWL 3U2SA 1R3JA 5CD5D 2AW2A 4M03A 3RGVA 3CX5K 5FCUL 5C0BD 1S9WB 1NEZG 2D31B 4ERSH 2K9UA 4HMDA 3WJJC 5T5FL 2J3SA 5EBLA 5IHUH 1U3YA 1T2JA 4ZNEE 4LLUB 4OCRH 5DD0H 4W4OC 2BSRA 3X3FH 4KKBD 2EE9A 2QJDA 3IDMA 4JFDE 1CXKA 1CDYA 4WCYH 1GGYA 2DBLL 4MDIB 4PYGA 4ODHL 1FG2B 4QF1B 5I75B 3BUYB 3TFKD 2VKXA 5EBMB 1A6VL 2RBLA 3TBVB 5HYSA 4Y5VB 2FATL 3F7YB 3IDGB 3SDCB 2D0GA 4GW5A 1M7DB 3QXVA 5J4MA 3C6SB 1OTTD 4X83A 2CLRA 2I9TA 1JPSL 3KPRA 3QEQA 5DJAA 4P5TA 3MV7B 3VGDA 1DVFC 4LP5A 2R4SL 3A6CL 2R56L 3LKQA 3LKPA 3WUWG 5BV7H 1K3ZA 5CP3H 4MNGB 4Z77A 1AR2A 4LVNC 2G5BB 4LVHB 4QRTB 1OB1B 2J4WH 3GKZA 4OIIH 4FABH 4D0DB 3QDJA 4OIBA 2VL4A 1ZXQA 5A43C 1GOGA 1A4JB 3ELAT 1CL7H 3HUJE 1S9WA 3IXAA 2D31A 1TVBB 2WW8A 5FHAH 1G0DA 3E8UL 1YNKH 3TZVD 4LLUA 1T22A 4HMCA 5D1QB 4DKAA 4DK6A 3QUML 1JYXA 3NAAH 1QSZA 1S9YA 1FNLA 2XYCA 4OZGB 5EFIB 4MDIA 3MJ9H 4PY7A 1A2YA 1FG2A 5D6CB 3SGEH 3VWKC 3BUYA 4NCDA 3ZKND 1Z9LA 2UUDH 4LAQH 3TBVA 3FFCD 3W9DB 4Y5VA 2DICA 4XPHL 3IDGA 3SDCA 3CAFA 3QQ9C 3O2VL 4JDTL 1M7DA 3C6SA 4N5EC 1BF8A 2AJUH 4XAKD 5C0JB 5HHQB 4QRPB 2A73B 3MV7A 4GS7C 3CVIH 4MSWB 4L8DA 3RHWF 4HZLA 4MNGA 1DLHA 2G5BA 4KJWC 4HJJH 2A9MH 4QRTA 5C0ND 3BFOA 1OB1A 5KANI 5SWQB 4D0DA 5CJQL 5IVXE 4R97C 4KDVA 1AI1L 5GISL 4PRHD 1KF9B 1A4JA 5E8DH 4X7TA 3V6BR 3MODH 4EDWH 5DGRA 1B4JL 1AD0B 3WSQH 3EJYD 1E4WL 5D1QA 2WBJD 5CEYA 1MCKA 1EEZB 4LPVA 1FFQA 2ED9A 5GXBB 5D7IF 2B1AH 5CD3B 4KKAC 1C1EH 4ZSOA 3S35X 4XB8A 3QI9C 1GXEA 5EFIA 5CEZH 4OZGA 5D6CA 2ZKHH 2HTLD 2QLVB 4M7ZB 4XPGL 3WLWC 1RUAL 3W9DA 1Y18B 3TBWB 4P46C 1N7MH 2M2DA 4L8CB 1YUHA 3STBA 1BM3L 2VWEC 2X4UB 3KVQA 3O4OB 4JPVL 2UWEE 1F4XH 3D9AL 2DI7A 5IOPB 1ZT4B 5ACZA 5C0JA 1KJ3H 4NQEE 3S37L 2A73A 2BCKB 1HH6B 4HHAA 4ZS7L 4MSWA 4L8SB 5FYLL 3L3IB 1FLTX 1G6RL 2VYRE 3MLVL 3O8XA 1CICC 5TFSH 5C2UB 5CGYC 3MPCA 5SWQA 4XBPA 1Z0NA 5DUMH 2VAAB 3EUUA 3FQTB 3T1FB 1UM4H 1I1AD 2RR3A 3BP4B 4RQQA 3TLRA 3NCFB 3U7YL 3R1GL 1EUTA 5JHLL 1A8JH 4LQ1A 3OJVC 1AD0A 3VFSA 1OQOA 4JZNB 4WI8A 1S7TB 1EEZA 1FNEB 3NACH 2I26N 5IP4A 5CD3A 2QQLL 2EDJA 3TIDB 1GIGL 2BY2A 5F6IB 2J6EH 3KYNB 3SDAC 2H26B 5EOTA 2YZ1A 2OJZL 2APXA 3VG0H 5CZKA 4P4KB 1JNHA 4QYOB 4I5BB 1NGYA 1Y0LA 3TBWA 2BSTB 3TYFB 1ADQL 2GY7B 4IIQB 1JMXA 4JFEE 2Z31C 4M00A 4OFVA 2W9LA 2X4UA 4KI5D 5KW9L 5EC2B 1RIHH 3SO5A 1U3HD 4YWGL 1DJSA 1ZT4A 5IOPA 5I1KL 3D3VD 1MHHB 5I1IH 5E08H 1I7RA 3QFDB 1P7QB 2F5AL 1D5ZB 1HH6A 1KIQB 4L8SA 1Q0XL 3L3IA 2C4FT 1HH9A 5IKCB 3UJJL 1TETL 2J8UE 3O0RL 4P3CL 3BYYA 4ONFL 1IKFL 1UYWL 3DVGA 5F1IB 7FABL 3IRZA 1CFSB 3FQTA 1KFAL 1QSFD 4F7MB 4PJFF 3NIGE 4ENED 2HH0L 4X7FC 4K23L 3QPQD 4QRRD 3BP4A 4D94A 2A6IB 3MCKB 4H5SB 5EOCJ 1V7NH 5L7XL 3ZT5A 1T1YA 4JZNA 2R29L 3HI6L 4EKXA 3T0EC 5C6TL 3LPWA 4QOKD 3K2MC 1LO0L 3INUH 2H26A 2BNQE 2HFFB 2R2CA 1U8JA 3NA9L 2EDXA 4XI5C 3D2UB 4QYOA 4I5BA 3L6FA 1CDHA 3TYFA 4IIQA 2YWZA 3K4DA 4HK0A 3MRCA 4G6FB 5KVMC 2JCCE 4MJIE 5EU7E 3HZYB 3KR3L 5AZEL 1MHHA 5C6WH 4KAQH 4GKSB 4ZUVB 3VE0A 2OMBA 1D5ZA 1I8LC 1KIQA 1U3ZA 4E5XB 4OZFG 2DBJA 1Y6NR 1NDGB 4NQDD 3VA6A 3ZZ1A 2NCMA 3RRQA 1I7UB 4IDJH 3GIZL 4A6YB 4OT1H 5K9JL 4JR9L 4NPYA 2Y1VA 2V9QA 1RJYA 2PW2B 3OKNA 2G75B 5E6IB 1T2QH 5F9JA 5BW7A 2C3VB 2EC9T 4H5SA 1NGXA 5ENWA 3VG9B 4NNPL 2DOCA 2PR4L 1IRAY 4M7JH 4QXUH 4FFYH 1FN4B 3KPSB 4MA8L 3DURA 4PJHB 1F00I 3QXTA 4X8JB 3X3GH 1T4KB 1NCDL 4WI5A 4KHXL 2HFFA 4KGJA 1JYVA 3V0VB 5IQ7H 1NFIB 4LLDB 4RSVA 3D2UA 3V5KB 1C16B 5C0BB 3UBXI 3P2TA 1AY1L 5C0CD 5CIPH 5CLTA 3VFNA 4YPGA 3GSVB 1GZQA 4K55A 1FJ1B 3OAYH 2OYPA 1WF5A 3V7AE 1A5FL 3HZYA 1BWMA 4BSJA 5C7XL 5JOEA 4NHCH 5B22A 3S7GA 4GKSA 2X4QA 2GCYB 3Q1SL 4AM0A 3OKMA 2I5YL 4E5XA 1YPZE 1NDGA 4EDXB 3EW3B 5LBSL 2XWTB 1IFHL 2QADC 1JI2A 1TJHL 4FS0A 1I7UA 1XFPA 1G6VK 4UT9H 4L5FH 2HN7B 3PQYD 4OD3L 4PFEA 2VLKA 4MXQD 2VLJE 2BHUA 4NO0D 9CGTA 5E6IA 1J1PH 4R4NC 2C3VA 4NRYB 5INDA 3S34L 3CLEL 4JFOB 5IW6B 5LXGL 3BN9C 4NUGH 4WI3A 4Z7WE 3KPSA 1ONQB 1B0RB 1FIEA 3RX7A 3K8KA 3MRFB 3HAEG 1VFBB 2RHEA 4X8JA 4RRPG 3MLRH 1ETZB 1PLGH 1NAKH 3KJ6L 5L2KA 1HILA 1GPOH 3V0VA 5B4MC 1NUNB 2DL9A 1NFIA 4LLDA 3V5KA 1R5WB 5C0BA 4G3YL 1XGTB 3EYSL 3MOBH 4TUOB 5FM4A 3U9PL 2R4RL 3GKWH 1KCUH 5LQBH 3TZVB 5I1LB 4PJBA 1V3LA 2DKUA 3GSVA 1FJ1A 3UJIH 4XNZB 5GZOD 4WHTA 5IESL 3MV01 3IDIB 1MCOL 3KLHD 2EDKA 4N0YH 1S3KL 4PYHA 1ES0A 1RJCA 4IRSC 3N1MC 2XWTA 5EOCL 3VXPB 4ONGH 2O5ZH 3FFCB 2HN7A 2AABH 5C8JB 1T1XA 4KKNA 2NY7L 3IB4A 4ZUSA 3BW9B 3SPVA 4QT5A 4EVNA 3MLUL 1U8QB 2P44B 5EO0A 2H41A 1KG0B 4FZ8H 5IW6A 1G7HB 3CXHJ 4JFOA 2KL6A 4PJ7B 4NC0B 1B0RA 4PJDE 4YC2C 3I02B 1J0HA 4KC3B 1VFBA 2QSTA 4YDLC 3WO4C 1ETZA 4WDIB 5IMLB 1JPFA 4PRPD 5A2KH 4PRHB 4FMKA 5HDOA 1R5WA 2D0HA 4KMTH 5E8OB 5HVWA 4CVXA 5CBAA 5F7DA 1LO2H 4TUOA 4Y5XB 5I1LA 1JGLH 2VLMD 4OCNC 2WBJB 2ERJB 3IDIA 3GJEB 4LNVA 3WNLA 4HIXL 4JPKL 2G60L 3QJFA 3B9DA 5TDPB 3VXPA 3ET9F 1QRND 5F1SA 4JB9L 1N6VA 1ZVYA 3FFCA 1V5JA 5E1HB 5HI5C 3N9GL 2X89D 3V2AR 1GGIH 3QDME 3NABH 3L95A 3BW9A 3FMGL 4M1GL 3TIEB 4YHML 1U8QA 2CGRL 3KPQB 1KG0A 4KUZL 3MNWA 1UEMA 5KSBE 4PJXF 3MMEB 5MI0C 4IEFB 3V0WH 4FQXA 2VERN 5MP6L 4KQ4L 4L4TE 4PJ7A 3AB0B 2EDRA 3I02A 3MZGB 1A1MB 1Z9MA 5IMLA 1YEDB 4MAYA 3O2WH 1ZHKA 3PL6D 3BHBB 4JHWL 1K4DB 4IOFD 3FT2B 1I1AB 5E8OA 1AXTH 3OX8B 5FYKH 4PB9H 2W1NA 2GAZB 4RISH 5JR1L 5EA0H 2WBJA 2MQ3A 4MJ4A 3RWEB 2DMCA 3GJEA 1MNUL 4NFDA 4F15B 4S1RH 1YEIL 5HYSG 3TO4C 3F7QA 4WI7A 4LLYB 2VQUA 1XZ0B 5LGJB 3H9SE 3ESUF 1XR8A 4CRPA 1DE4A 1CN4A 1PYWA 4CN4A 3LS5H 3QCUH 1U8PB 4EOWL 1Y6KR 3U46A 3I3EA 3KPQA 1IGYB 1W2KT 1U3HB 2ZUTA 4XPFL 3VFVB 3D3VB 3MMEA 3QFJE 1MCHA 3VD3A 1NEUA 3OAUH 3ZHDA 2OTUB 4WI6A 3UC0H 3MYZA 4XC3H 4NN5C 3V4UL 1A1MA 3C60D 3OZ9H 1P9MC 2EC8A 1YEDA 4LOUC 1QSFB 4K71B 5CAYB 2L7UA 1MQKL 3BHBA 4GMTH 1K4DA 1RZ7H 4QRRB 4X7CC 3IS0X 1NCAH 3OX8A 4QHKI 4R4FH 2GAZA 3FN3A 1YN7B 2ESVD 1WIPA 5L9DL 1KTKE 5CUSL 2W9EH 2V2WA 3RWEA 2NXYC 4QOKB 2NQCA 4IRZH 2Q3ZA 5F96L 1KB9J 1T20B 1XZ0A 4LDEB 3RL2A 4ZDHA 1MLBB 1CLYH 4L8BA 1EEQA 2B1HH 1NAMH 4G42B 3BWUC 5C92A 1FNFA 5HHPB 5LWYH 3KGRA 2W0PA 3ZKSD 1IGYA 2CR6A 1U3HA 2IPTH 1QFWI 3VFVA 3HUJF 4DQOL 5I16A 2ZSVA 1OAKL 3R4DA 4Y4KA 2DYPD 3LQZA 2OTUA 4JAMB 5J3HD 4NQDB 4OFDA 4F7EB 1HHJB 1YEGL 2X1QA 4JFFE 3OXSB 1U42A 4NC2B 4CU8A 1YMME 5CZVL 3Q5YA 4X0KA 5LVEA 1SEQL 3MBEA 5FOJA 4ZPVB 1Q0YH 5I8EB 2FECI 4QRRA 2WSKA 1J1XH 2MKLC 1CS6A 5HI3C 1RMFH 3SDDD 4HS3B 4OF0A 1FL5A 4PG2C 1YN7A 3TV3H 1RZKL 4JFZL 1TTFA 5DXWA 1UH2A 3ARBD 3BISA 3PJSA 5BMFL 3UPCA 5KS9E 3BESR 3HE7C 5DMJB 1TJGL 3GSQB 2YUXA 2OTWB 3QB7C 1YNTB 1T5XB 4RX4A 1T20A 3K4ZA 4NKOB 1JHKH 1MLCB 5J7CC 2YD6A 1MLBA 1IJ9A 2AJVL 2FRGP 5HHPA 5C0CB 4DFIA 2NTFB 1TZHA 1J5OH 2DRUA 5IVXF 3QUZC 5A16B 2ZCHL 5FYLD 3NTCL 4YUEH 4Y8DC 1CLOH 2V7HB 5E2WH 1I1YB 4RGNE 1DFBL 3V5HB 1X5HA 4OI9A 5E2VH 3UTSE 3CFBB 1NQBA 3LKNB 4NQDA 1UM5H 3E2HC 4LHJB 3HNTH 4M8QA 4TPRH 5F72S 1F4WL 4F7CB 1AHWC 3EO9H 3PQYB 2V2XB 1EK3A 2XZQL 4UIMB 2BNRB 3EYVB 3GNML 4ZPVA 4MA7H 4M7LL 3EFDL 4KPHL 4M6OL 4X4MA 2Q3AA 4HS3A 3K81A 1OAZH 1S78C 1NCNA 3K2UH 4HPYH 5D6DA 3SE3A 2E6JA 2XZAL 4JKPH 3CFEB 5DRZA 4AIXA 2OR7A 3KPPB 4XHJD 2UWEF 4FA8A 4POZD 3W11D 4GRMA 3WIFB 3GSQA 2OTWA 4LSSH 1YNTA 1T5XA 2FEDD 5IVZB 2CO6B 5ADOL 4NKOA 3BD5A 1ITCA 3VFWB 1MLCA 2FHFA 4MNQD 3QWOA 2ATPA 2Y4SA 3BYTA 2XRAH 4ELME 3CXDL 3DX8A 5KVGH 2NTFA 1JTPA 1I3RA 5A16A 1MH5B 5B3JE 2DWDA 3UBXB 4LSUH 5DVKA 4P2RD 3V5HA 2JJTC 1DQDL 1IAIL 3CFBA 3LKNA 1TNNA 1WWAX 5ELIA 2E7LA 4PLJC 4J6RH 4JHZA 4XVJH 2DLFH 1AGFA 2B5IC 4RAVB 4F7CA 2FNBA 2XOTA 4LSTH 4MCYA 1OP5H 2BNRA 3TT3L 1L4IA 4LSQH 3SOBL 5HJ3B 1Q9WB 4YFLI 2R8SH 5ADPH 3Q6FB 3TYGL 5IBTL 3ZO0A 1JIBA 5FUOH 2CMRL 2YPLE 3QBTB 3CFEA 2EXYD 4W68A 5LCVH 2ORBL 3KPPA 3ECBB 1OP9A 2XN9D 3WIFA 5FGSA 1KEGL 2VDML 4A2LA 5IVZA 1JZ6A 4PRPB 4FFZL 4M3KB 3RTQC 2FX9L 1QKZL 2QBWA 1FHGA 1EVUA 3DV4B 2J8UF 3RY6C 1D6VL 5C08D 4HXBL 4QRSB 1EV2E 2P5WD 1F97A 1J0KA 5AWNH 2AKRB 4N1EA 2WWKO 4G9FD 4QRQB 3B8SA 1MH5A 3NIGF 4R8WL 3UBXA 3ARFD 1D5BA 3JUYA 4M1CD 4JG0H 2OQJB 3AUVA 1MI5E 5EPMA 3TESA 3I6KB 2Y7QA 3LKSA 1QRNB 4RAVA 5GRYA 4BZ2H 2NX5E 5KJRL 1AP2B 2BVYA 4D9QE 1Q9WA 4LQFL 3Q6FA 2OP4L 3SDYH 3TCLB 2X1WL 5ABDE 5DWUH 4C57C 4Q0XL 1OF2B 4ZAKC 5EULV 1MELA 5DZNA 1OSZB 5INCB 4FHBD 3GMQB 1ZT1B 2R1XB 1N5YH 3RVUC 4M61A 3T77B 5IB1B 1UJ3C 1G7MB 3LDBC 2JCCF 5F3BB 3P0YL 5BS0E 1UFUA 1YQVL 3AU1B 3BAEH 4PRPA 4BQCA 1GGBH 3PL6B 1KJ2B 2IAMC 1NMAL 3GMPB 3QIWC 5JPMB 1F3DJ 1YEKH 4J3XA 4D0CB 4C54A 4QRQA 4ERSL 2NY4C 2PF6A 2IPUK 4QKXB 2Z91A 2JELH 3QUYA 5IHUL 5I8KH 4G6AC 4OCRL 2OQJA 5DSCB 4DN4H 1AKJD 3I6KA 3DXAA 1QRNA 1ZLSH 3U4BH 4WCYL 1MIMH 4CAGA 4X6DB 2Q6WB 1AP2A 1FSKB 5E0QA 1BIIB 2H6PB 5DC4B 4EI5C 1OTUD 1MAMH 1TXKA 3MGTB 5FUZH 3TCLA 3WFEL 1WBYA 4PUBH 3MGOB 1EHNA 1OF2A 2IJ0C 3GMQA 1ZT1A 2R1XA 1CFNB 1BQLL 3T77A 4R0LC 1G7MA 3MUZ1 1JZ5A 4F80A 3C60B 3S97C 2IANE 2P7TB 4U1LB 1CK0L 3AU1A 5BV7L 1T83A 1KJ2A 5C6PB 1YPZF 3OJMB 2J4WL 3GMPA 3LRSB 4OIIL 4FABL 2A83A 5I0ZA 5IHBA 5JPMA 4EUPH 1IGMH 4S1QH 5B39B 2ESVB 1CL7L 5JIPA 5E4EB 1IKNA 3SGJA 5F7WC 5EB9A 4J8RB 5MENE 3CJJA 2R1WB 4JM2F 4Y1AE 2R1YB 4D8PB 2AJ3A 4KZDH 3OB0K 4Z7WF 1K85A 4Q9CA 3WE6B 1ZOXA 2LU7A 3NAAL 3BP5B 3MJ9L 5DDHB 5H94B 1YDPB 4UQ2B 2P46B 3JBG7 3PWPD 1BIIA 4JRXD 2H6PA 3PABB 4LAQL 4B7LA 4XMKL 1KPVB 2FIRT 3MGOA 2IBZY 1XIWD 2EXWC 3GO1H 2DYPB 3F58H 4PD4J 1YEEL 5GS3A 2DQFB 1A9EB 2AJUL 4XXCA 5C0RH 5BOZG 1RZ8B 2P7TA 4LSDA 3CVIL 5F9OH 4U1LA 5C0AE 2FH8A 3C2AL 4HJJL 2A9ML 4JDVB 2PTVA 4GG6E 4F7TA 2LFGA 4HBCL 5M94B 3DPBA 4FP8H 3SDDB 4AIOA 4YGVA 5B39A 5E8DL 3D0VB 2ESVA 2WV3A 4MS8D 3QIUB 3MODL 3TBYB 3ARBB 4JZJC 2IG2L 4J8RA 3WSQL 1K4CB 2F9BT 4K3DH 2CDFA 3MLSL 1QBAA 2ZUXA 3ZKMC 3DX7B 5BXFB 1X7QB 4JKMA 2B1AL 3RA7H 1C1EL 5I8CB 3HHRB 2VISB 1QSED 4PJDF 1BOGB 3BP5A 5CEZL 3BGFC 3IFNH 5H94A 2ZKHL 3MV9E 3P9WB 3QO1B 2WWKT 3PABA 4LMQI 4X7SH 3D5OF 3D39E 2Q7NA 1KPVA 1ZANL 4RFEB 6FABH 3GMOB 4HUXA 2YC1B 3NCYS 4W81A 2DYPA 1IC5H 1MVUB 1U2CA 4UAOC 4J23A 4PGCB 2DQFA 4IMKA 5DJ8A 3T2QA 1A9EA 4J3VA 4CADB 1KJ3L 4LP4A 1RZ8A 1ZHLB 3E0GA 3W2DH 5EU6D 1A7RH 4NO2A 5L0QB 3V4PH 2OBGA 2VL5A 1IEAA 1SEBB 1T5WA 5AYUL 5EWIH 4JDVA 4YHLH 3TEUA 2D7NA 1S8DB 4LEOB 3SDDA 4X4XB 3PV6B 1UM4L 3D0VA 2AXJA 3QIUA 3HC3L 2PTTB 2BRRH 5B3NA 3TBYA 4LPTA 3ARBA 1WT5C 5J6HB 3PE9A 5KOMC 5TPWL 3U4EB 5IMOA 4EN3D 5KSBF 3LEVL 3NACL 3DX7A 3KPOB 5IJVB 5I8CA 3KPRE 2JTDA 4QHKJ 3QEQE 3E6FB 1BOGA 2J6EL 4MNQB 3QNYA 5E5MB 1F4AA 1UEYA 4XNMB 4CDGC 2VUOA 3QO1A 3TWCH 1RUQH 4PGEB 4YJZL 3QDJE 4RFEA 3FB8B 4P2RB 1P84K 3GMOA 4R96B 3W5MA 1PKOA 4RA3A 2YC1A 1QLFA 4R4BB 1MVUA 1RIHL 4FTVA 3K4AA 4CADA 4IMLB 2DL2A 2FHCA 5KANG 4XCCH 1ORSA 5HYJD 4PRDA 4AEFA 4ODTL 4NSKB 2GJZB 1SEBA 3TC9A 2L0DA 3NIDE 4O02L 1M71B 1ZVHA 1UVQA 1S8DA 4ZTPH 4LEOA 4X4XA 1WBZB 2DDQH 4RFNB 4JQXA 3ZKXB 4GAGH 3P77B 1WBXB 1GL4B 3O41A 1V7NL 5J6HA 3CVHB 2GY5A 2XN9B 2XY2A 3L3DB 4XP9H 3QNZB 4Z78A 3KPOA 4X99B 5IJVA 4ACPA 2ZUSA 3E6FA 3MV7E 4MNQA 3FT3B 1XCTA 3INUL 4Y4HC 2FLRT 5C08B 3C6LA 2P5WB 4XNMA 5CWSB 3OQ3B 4QHMA 5GSVB 4MNGE 3VJ6A 1FP5A 4XCYB 4U1MB 4TSAH 4G9FB 3I50H 1FZKB 3ARFB 1KCSH 2MKWA 5I74C 4R96A 3WEXB 2F58H 2HKHH 3WLBB 4R4BA 4DVRH 3TPKA 1OGAD 5ILTH 1JWUB 4IMLA 2GSIB 3VFGH 1AGEB 3PP4H 3HMXH 1DDHB 2EDWA 4NSKA 4UDUB 2NY0D 1LNUB 4NRXB 5IM7B 1ZT7B 4G80B 4IDJL 4AH2A 4HUKB 4OZGE 3GSOB 1MJ7H 3S5LB 3QZWB 4UBDD 4XMPL 1WBZA 3G6DH 2OL3H 4NC1E 1CXHA 1T2QL 3UX9B 3WXWH 1NBVH 5BOPA 4MAUL 2G9HB 3P77A 1J0IA 4PJCB 2XN9A 5D71H 3WJLA 4M7JL 4PV8B 4MQTB 3DUHA 4FFYL 4PP1C 3QNZA 4X99A 5GGRY 3X3GL 4QRPE 1HNFA 5D2NC 3FT3A 4N8VB 3ZT7A 5C08A 2P5WA 1MFCH 5CWSA 1QSVA 5IQ7L 5GSVA 3MJ6A 4XCYA 4U1MA 4G9FA 2VO5A 4MJ6B 4PBVC 2I24N 1NMBL 2D2OA 1QP1A 1IAMA 1FZKA 3ARFA 4NGHH 3S9DB 1P7HL 5GSRB 1I7TA 3WLBA 1CVRA 3ROLB 1PDKA 5IVOA 2W9DH 2ZUUA 3CSYB 1JWUA 1AKJB 2GSIA 2W59A 2EDEA 1DDHA 4XZUB 5T3ZD 4GO6B 4G9DA 5KS9F 4YEFA 1LNUA 1IGCH 1ZT7A 4G80A 4HEPG 4L5FL 5FFLA 1G9MC 1Q94A 3MLPA 1J87A 4WHCA 2F5BL 3S5LA 3DMMD 3QZWA 2L4OA 2X10A 3O3UN 2NY6C 4G6JH 1J1PL 1MHEA 4HWZB 2G9HA 1GJIA 4LKCB 2N7AA 3GDBA 4OI8A 1A1OA 4HSQA 1KENL 4NUGL 4PV8A 3TNMB 25C8H 4OF3A 1L7TH 1J86A 1HYRC 3MLRL 4N8VA 1PLGL 1BPVA 5JORB 2YRZA 1GPOL 1DQLH 1RZGA 2FJGA 4RMSA 4XGZA 3BQUD 4MJ6A 4OKDA 1PKQB 1AXSB 1KXVC 3TVMC 1J0JA 1I8KB 5F1NB 1C5CH 5GSRA 3ZE1E 5LQBL 3ROLA 3UJIL 3ARDA 2P1YA 1HI6B 2DD8H 1JK8B 4L9LC 3CSYA 1C12B 1NGQH 3ARGC 3QUXD 3BIAX 3MRLB 5K9OB 5L2JB 3NIFE 1YY9C 4U6YB 1BGXH 4ONGL 3PWPB 4B5EA 4JRXB 4U0RC 2O5ZL 3EYQD 1MHPL 2X1XR 2AABL 3CZJA 2C9AA 4Y2OA 5JW4N 5JOPE 4TNVF 4KJQD 3QP3A 4QHUB 1E4JA 5T33L 2WLYA 1XIWB 2VMFA 4YLQT 1KULA 4HWZA 4ELMF 1MCBA 1H15B 4FZ8L 1CD8A 3NPZB 3QCTH 4ZXBC 3NA4A 2YXFA 1AFVH 5B3JF 4X6EB 4N0UA 3T0DA 3TNMA 4F57H 3K80A 5CHNB 4QTIH 4OCWH 3VFPB 1LEKB 5JORA 4APQC 4WGVB 3UBXG 2MHAA 3V8CA 5KVFH 3WL9B 5JNYA 4KMTL 4I9WE 5EO1B 5D7JC 2Z92B 5DJ2B 3QQ3A 1I8KA 1LO2L 4YBQC 5F1NA 4I1NB 1JGLL 2C3GA 1C12A 1S7WB 2D3VA 1QSEB 5K9OA 5T1MB 2Y6SC 5KOVC 1GOFA 1GGIL 2WUCH 3NABL 4QHUA 3RWCB 4KK8D 1XIWA 2Q7YA 4XVTL 4N1CA 1H15A 2Q87A 2YWYA 3V0WL 4NNXA 5I6XC 4GW1B 2XWJB 1X6LA 5EU6B 5CS7A 1SY6H 2YA1A 2FGWH 4JFXA 4Q9RH 5HPOA 3LV3A 1GRWA 3OKOB 4WEBL 5E2TH 1NBZB 5CJ5A 1PG7H 1LEKA 3QRFM 1IM9B 1VFUA 4AQOA 5ESVB 3OB8A 3WL9A 2ILLA 2Z92A 3IFLH 5DJ2A 1AXTL 2AEIT 5F93C 4H8WC 5FYKL 2VLKE 4RISL 4YBHA 5EA0L 1FGVL 4EN3B 2WZPD 2C4FU 1D5IL 1S7UB 1X4YA 4FG6C 4S1RL 1QSEA 3N1QC 3KPSE 1A22B 1IVLA 1G9MH 2AV7B 2ADGB 4PJHE 3FRPG 1CU4H 5CZXD 5HBBA 3BRDA 3AAZB 4LU5L 4JKKA 1OM3H 3LS5L 3QCUL 3ULUE 5JZ7D 5GRZA 5HYQA 3WKMH 3RWCA 4I0KA 4OCLC 2VDLH 3TA3D 4CJ0A 5C0BE 1JFQL 1UXWA 1NGZB 3FOMB 1L0XA 4BK4A 4J3SA 4HG4K 4O9HH 3SCMC 2EIZB 4J4PC 4PJ5A 1BVLA 3BT2H 1QO3B 4GW1A 3HZMA 4LLQB 2R0LH 3OAUL 3RVTD 5HYJB 1A14H 5K9KA 3UC0L 3O3AB 1A3RH 3OKOA 1NBZA 3HPJB 4NZUL 5DEGB 1IM9A 3D25B 5IQ9B 5ESVA 4GMTL 4JCMA 1RZ7L 2VXTH 3LN4B 3E6HB 3RVWD 1NCAL 3OB0H 3VA2C 4D3CH 5DQJB 2ZP0T 3CK0H 5DO2D 5CSGA 2WIMA 1T7YA 5DJYA 3RPKA 5HYFA 1GZPB 3QPXH 4EN3A 2FX7H 4MXWL 2W9EL 4Q7DA 1N4XH 2XZZA 5DHXB 4L3EA 3QDGB 2APVA 2AV7A 2XACC 2ADGA 2WQRA 1IMHC 4S0TD 4UINH 3I3DA 1CLYL 3AAZA 2EDHA 1DUYB 1HNGA 3VDAA 2B1HL 2EC9U 1NAML 4WIQA 4Y16C 1P4IH 1WVZA 3BH9B 4WW2F 5GS1B 1KEMH 3LEYH 4K8RD 4AIZB 1FZOB 3G9AB 1OVZA 1QO3A 1YNLL 5EZOH 5HYJA 3QEUB 4OTXH 2XKNB 3O3AA 3ZSSA 3BH8B 3LS4H 4XH2B 2NY0B 4M43H 4NZTH 1WTLA 3HPJA 3FJTA 4KKLD 5DEGA 4TN9A 5B39G 4KU1A 5TE6H 3D25A 5IQ9A 2Z8VC 4MVBD 1UH3A 1XGPB 1PD6A 1IQWH 3FFCE 4GXVL 5KG9B 2X9XA 1J1XL 4YNYB 5I73C 2GITB 5DQJA 1HSAB 1RMFL 4PRBB 3EOYG 3HS0B 3GUTB 2IQ9L 4LPCA 3BKCL 3TV3L 4F37K 2ZCKH 1AJ7H 3V8OA 3HLAA 3UTTB 1CVSC 4TVPL 1DL7L 4E42B 4XT1C 4X5LA 4XAKE 2X4RB 3SDXA 1X5YA 4PJ7E 4G8FB 4GQPH 3JXAA 3QDGA 3BZEB 3FQRA 4HUVA 3RNKB 2UYLB 2FD6H 4OZHB 3P9LB 5DTFB 1QLEH 4F37F 1DUYA 3T8XB 1N5AB 3Q5OA 4LNRB 2ENSA 4GG6F 3MRQA 1J5OL 4PRHE 1J1OH 5GS1A 1CLOL 4X9BA 1FZOA 1FL3B 1HZHH 3T0WA 2KBGA 3QWQB 1UM5L 2XKNA 1QRKA 3BH8A 1MCEA 4OF5A 4TPRL 3CDFA 5LGHH 3ZDXE 4NCC1 6CGTA 4D9LH 4Y2DC 1FNAA 1EEUA 3DMMB 4NM8H 2VOTA 3BSZH 1XGPA 4MA7L 1CGUA 1I1RA 2PXYC 2GITA 3FO2B 3WNOA 2BNUB 3GK8L 1OAQL 4PRBA 1MWAH 3K2UL 2QSCH 3UTTA 4JKPL 1BREA 4E42A 4E0RA 1MJ8H 4OCSH 4OQTA 1SM3H 4CBPA 2X4RA 3FCTA 2A9NH 1PG7X 5FYJD 1K5NA 4ZFFA 4LSSL 2EZ0C 1MCNA 3RNKA 2UYLA 4BJLA 1JRHH 4OZHA 3SKOB 3BQUB 5DTFA 1GC1H 3T8XA 1N5AA 2XRAL 1LK3H 1DVFD 4LNRA 3VMPA 5KVGL 3PGCB 1NANI 1V05A 3ZSTA 2EO9A 3SE4A 1A3LL 4LSUL 3BP6B 3DHMA 3PF2A 1NLBH 4OCYL 1NCCL 1JPGB 5FHBH 5E70A 1IAOA 3QUXB 2FR4B 1JP5A 1FL3A 1S9VB 2E7BA 3B5TA 2P45B 3QXUA 4J6RL 1QLRB 2DLFL 4YE4H 1IEBB 5DFTA 1IM3A 2BSSB 1UB6B 3BI9X 3MFFA 1G7IB 2D03L 5D1XC 4LSQL 4HZAA 4LCCB 1DBBH 4YGAB 2DQIH 3CU1A 2IH3B 3LH2H 5ADPL 3PWNA 4M48H 4OAWB 5A40E 4HH8A 1LGVA 1YEFH 1OD7A 5FUOL 5ID1A 3VWKD 3PHOA 4JPIA 4KI5E 1YY8B 4P2QB 2AGJH 5DI8B 5LCVL 1FO0H 3D3VE 4HUMB 4J3OC 1I9JH 5GGTA 4GG8B 3UTOA 2F53D 3QQ9D 4HKJB 4N5ED 3SKOA 1EGJH 3BQUA 1QSFE 1R3KB 5KSVB 5AWNL 1GAFH 1V7MH 3HCVB 3NIDF 2NLJA 3C9NB 3PGCA 3WHXB 4QRRE 4QTHB 5CJOH 4Y4FD 3TT1H 2W38A 2VUYA 3B9KC 1JPTH 1JPGA 1J8HA 2Q8AH 3QUXA 2FR4A 4OGAC 3RVXC 1S9VA 5DK0A 2EDTA 4W70A 1G7QB 3ZYZA 2D7TL 3KLDA 4CVZA 1KBGL 4ZPTA 1IEBA 2JJSA 3L5WB 4QOKE 3GSWA 2LE9A 3PWVB 1MEXL 2BSSA 2BVQB 5I15L 2VDKH 3T2OA 2H1PH 1G7IA 4F58H 1Z0MA 2EKSB 4LCCA 3TNNA 4H1LH 4K7PH 2IH3A 3SDYL 2ZNWA 4KKAD 4OAWA 3QI9D 4MA1C 5DWUL 1XF5A 1PQZB 4YFEA 4MD0B 1TCRB 3X14B 2HRPH 4N8CH 4P2QA 3WLWD 1BFVL 4OGYL 5DI8A 1N5YL 3I9GL 2ICCA 1XH3B 3BUTA 4GG8A 4QRUB 3BEWB 4NQDE 5FGBA 1GGBL 4NCC2 1T21A 1FCCA 3WDHA 1J12A 1NSNL 1P1ZB 5FK9B 1R3KA 5KSVA 1KC5H 2FBJH 4KRPD 2R2HB 3HCVA 3C9NA 2IWGA 3WHXA 4OZGF 1CICD 3S96A 5CGYD 1UH4A 3ULVD 4ZTOH 4JO1H 3P40A 2JELL 5I8KL 4WVRA 4BH8B 2XZCH 1MUJB 4P59H 4DN4L 1EZVY 5DHYB 3S5LG 3MNVB 3F7VA 3QZWG 5DD6B 1ZLSL 5GS0L 3L5WA 4TSCH 4NNYA 3U4BL 3PWVA 4S1DC 1MIML 4F9LC 2EKSA 4G8GD 3MRRB 5AUMB 3TA3B 1MAML 3U83A 3U7WH 1LE9A 1SYSB 3VI3F 5E94A 3SDAD 5C0CE 1FVEA 4DEPB 4MD0A 1TCRA 3X14A 4N8VG 3J8F7 5C07D 2NTSP 1W8NA 5ETUA 3IGAB 1I8MB 3C8HA 3W9EA 4NOBA 2BZDA 2Z31D 4WO4C 3BEWA 1AGCB 5IB4A 4WFFD 1S7XB 5SWZD 1ZLUH 3KXFD 2EYSA 3PQYE 4RNRB 2R2HA 2BNRE 1IGML 4S1QL 3V6FA 5GQBA 1E6JH 1U8LB 1TQBB 4WW2C 2BX5A 1NPUA 2X4NB 3Q6GL 2FWOB 5J13B 4PTTB 1LE5B 4PGJA 4LHUD 2C1OB 4BH8A 2YPKB 2XG4A 3GHBH 1T89C 5DHYA 4KZEH 4XC1H 4KZDL 4NRZB 4PR5B 1ZTXH 3HI1A 2Q20A 4PRNB 3ARPA 5HVHB 3ZT6A 5AUMA 3MRRA 3TA3A 3T0ED 1SMAA 4R2GC 4FFVC 4D0BB 1SYSA 5ALBH 5CCKH 15C8L 1CCZA 2DQCH 3GO1L 4LAJH 5GGTL 1S5IH 3F58L 1KPUB 1ND0B 4XI5D 3ZE1F 4GBXC 3IGAA 1JYWA 3MXVH 1QPPA 4JHAH 4WI4A 3RWFA 1IC4H 4ZUWB 1DZBA 4KTDH 4DCQB 1AGCA 4HEME 1R5VA 4R7DB 3NIFF 1S7XA 2FL5B 1RJLA 5SWSD 2EH7H 1JUFA 4FP8L 4L1DA 4JFQB 1CFQB 3V7MA 2DQJH 4X7EC 3RY5A 3WIHH 5IVXA 2X4NA 1F5WA 4U1JA 3LN5A 5DRWB 2FWOA 1LE5A 3NCJH 5C09D 3NGBC 1FCGA 4K3DL 2RFXA 4L3AA 3JV5A 4XMLH 4NQUA 1J05B 5IROC 4NRZA 3QT2A 4NM4H 3RA7L 4PR5A 2MPAH 2HWZL 3IFNL 5JPNB 4JDZA 1X5AA 3S88H 5E4IA 4PRPE 5CILH 1SBSH 4KKCC 3G6JB 4RA0C 4ZNCD 5I19L 1BLNB 5EO9B 6FABL 2FDBP 1WZ1H 3RX8A 1IC5L 1KPUA 5K9QG 3JTTB 2VDPL 1T7VA 4PJIB 5AYQA 3W2DL 1A7RL 4DCQA 3V4PL 5FYKD 1QRNE 4K7PX 3IYLW 5EWIL 3TCXA 5DEFB 4M02A 4ZFOB 3MOQA 4JFQA 4PG9B 1CFQA 1OLLA 3F12A 2QADD 4ZODA 2DBLH 3CFIC 2BRRL 3AREC 4ODHH 3BRGC 5DRWA 1EDQA 4AEHL 3CDCA 1U8HB 2YEZB 1A6VH 4PJAB 4WWKA 2FATH 5EZLB 1RVFH 1J05A 4HCRH 2A38A 4UTAH 4W6WB 4X7DC 5ITFB 2DF3A 5DUBA 3BPCB 3BN9D 3MA7B 5DRNB 3FHAA 3RPIB 1IZJA 1DVFB 4P5TC 3HR5B 3TWCL 1RUQL 2DS4A 3PGDA 4X6FB 4ONHA 4UOJA 3HAEH 1BLNA 5EO9A 3LZFL 1DN0A 3L7FB 4DZ8A 4NO3B 3ZTJG 3H3BC 3AY4C 3K7UA 4XCCL 3P9MB 1A6PA 1NKOA 2VZOA 3F8UB 4BSWB 1RIVH 4H25B 3BZFB 3E8UH 1MSPA 3MRIB 3VXUB 3EGSB 3D69B 4PJHF 2C26A 2J8UA 1PVHA 4X6DE 5K59E 1OARL 3QUMH 1OY3B 3I6LD 1VGEH 4PG9A 1J9CT 4IRSD 2DDQL 4M4RA 3VWKB 3QQ4B 3ULUF 5IJKA 3CUPB 3IDYC 3MX0A 2XV6B 4GAGL 4LFHD 2MWCA 2XFXA 4Y5VC 2PYFA 4PJAA 3V9FA 1EFXA 4JREC 2F53B 5EZLA 3PWUA 4XP9L 2E9BA 2D7MA 3CIQA 1H0DB 5ITFA 3BPCA 3MA7A 5DRNA 2VQ1B 4YAQB 3RPIA 4YHPA 4GS7B 4V2BA 2IF7A 2FO4B 4L3CA 4WRLA 2PCPB 3I50L 4X6FA 5F89B 4Y4FB 4TVSa 5DVLA 5B8CC 4R97B 2HKHL 3AGVA 2ESVE 1YA5A 4NO3A 5ILTL 2B2XH 2JJWA 1BF2A 2ZG3A 4WEMB 5SX4I 5GISH 4JCLA 4BFIB 3P9MA 3HMXL 1F11A 4BSWA 4H25A 4NFCA 1B4JH 3MRIA 3VXUA 3EGSA 3D69A 5GRJH 3QI9B 1YMHB 3G6DL 3G5ZB 3VWKA 4AEIH 3QQ4A 3WXWL 3CUPA 4TUJB 2Z93B 3GMNA 4LRNH 3MR9B 3ZL4H 4MHHG 3B8YA 5HI5D 4XPGH 3WV0A 3MTRA 5JW4Q 3ETBF 3P4MA 5D71L 1YQ2A 4Q2ZB 4DAGH 3AVEA 5HGAB 4Y89A 1H0DA 1X5FA 3K46A 1EBAA 4PJ8A 5ID0B 4I48B 1MFCL 4KRPB 1WTGT 2FO4A 1CICB 5I8OL 3WFCH 3O8XC 5F89A 3U0WL 4Y4FA 2VABA 4NGHL 3C5SA 1JTTA 4TTDC 2W9DL 1ZA6B 1MCJA 5GGVH 3UTPD 4YZFE 3U7YH 2CR3A 2X41A 3BZ4B 1IGCL 4PJ7F 2HLAA 3L9RB 4G8GB 1YPZA 1DEEB 4CNIB 3VXRD 2QQLH 1E27A 4G6JL 4TUJA 5C07B 5FYLE 3MR9A 1G1YA 1XF2A 4FXLA 3EIFA 1U9KA 2QTEA 1Q9LA 3ZTNL 2Z31B 4Q2ZA 5EC1A 5FA4B 3VWJD 3NFPB 4JM2A 1AQDB 5DJZA 1KCRH 4OCXL 3O4OC 4Z7WA 3R0NA 5SWZB 4L1HA 2NXZC 3KXFB 4I48A 4Q9QH 5I1KH 3TH4T 1DQLL 3ZDXF 1HCFX 4QXGL 4L8SC 1FLRH 2F5AH 5F7FA 4KVCH 3IDXH 1S9XA 5DA4A 3DYMA 2VB5A 1INQB 4P3CH 1INEL 1FBIL 4Z0BL 4LPXA 3QCVH 4BFBD 3DO7B 4LHUB 4YK4C 7FABH 2OZ4A 3MGAA 1ZA6A 2XPGA 2A6DB 1FH5H 2ITDA 4C58B 1NGQL 4TYUA 2W60B 1BQSA 3RWHB 4PGZA 5IHZB 2WQ8A 5I1AB 1FL6B 2CKNA 4LKXA 3ALXA 4YR6B 4P23A 3ILPB 1BGXL 3BZ4A 5EIIB 5L7XH 3L9RA 4G8GA 4G6KH 5LKNA 3T0EB 5D7SH 1DEEA 4U3HA 4MNQE 5C3LD 2NXYD 2I07A 4CNIA 3MRMB 2LAAA 5ICZB 2Z35A 2HRLA 4P48A 4NKIH 4MB4A 5C07A 3NA9H 1S7QB 1FZMA 5D70H 4P2RE 3QCTL 5JDSB 1AFVL 4U2ZA 1YEHH 4F57L 3KAAA 2EICA 3REVB 1G1CA 4U6XB 1YJDC 43C9B 4QTIL 4RZCB 4OCWL 1Q9KB 2ZOLB 4ZO6A 1ZAGA 5SWZA 1RUPH 4OQ1A 5SWSB 5AZEH 4G8EB 5KVFL 4E41D 3DRQB 2ZPKH 2X7LB 5JUEL 3U7AA 1INQA 1OAYH 3WXVH 3DO7A 1CGSH 1CBVL 3QUKB 4PTUB 5C09B 4M7KH 2BXZA 3GIZH 1ACZA 3HG1D 4KI5F 3JWOC 2XN9E 3KDMA 5HI3D 3OKKB 2VXSL 4HUWB 1FL6A 2B20A 2KPNA 3V6ZB 4YR6A 3ILPA 3KPLB 3DYOA 1HXMB 3T0EA 4IJ3C 4R7NB 3EOTH 5C08E 2P5WE 3QDAA 3MRMA 3HE7D 3FO0H 2WUCL 4LVOC 4G9FE 3DETC 1CDIA 4KHXH 1S7QA 4HAGA 4WUKH 3O2DA 3QDMA 1DSFH 5JDSA 3VDCA 4PS4L 5DQDH 4OI7A 1OSPL 2FGWL 2CKBA 3QUZD 3REVA 4Q9RL 1AY1H 1NDMA 5E2TL 3VRIB 4RZCA 4L4TA 1KT2B 1OAXH 2ZOLA 3IXTB 1SQ2N 5SWSA 4G5ZL 5C7XH 3KG5A 4KRMB 4XRCB 3Q1SH 1VENA 2CIKB 1CXIA 2I5YH 2ZUWA 2X7LA 2QADB 5FKAA 2OX5A 5F9WB 3IFLL 5I17A 4M93B 1BZ7B 1K2DA 5I71C 5EG6C 4PTUA 5C09A 2BRQA 5J89A 3VRJB 1K9TA 1UKQA 1LEGA 4PJCE 4KK6D 3OKKA 2P8MB 3V6ZA 3CLEH 3KPLA 4R6UA 3S37X 1CU4L 4NJ9H 1HXMA 4N0CD 1OP3K 1OM3L 3CFJB 4UB0H 1HHIB 1X4ZA 1JL8A 2VDLL 4JHBA 3ULUC 1C7TA 3KJ6H 1KLGB 3I2CH 1WAAA 1UB5B 4L4VD 4O9HL 5DHVB 1IBGH 3KPTA 3BT2L 1ZLWH 3WHE1 4HBQA 3IETB 2NY1C 1AH1A 1IGJA 1A3RL 1KT2A 4U1IA 4KKBC 3IXTA 3IJHA 3HC0B 3O11B 3PHQA 5I76B 2EE2A 3MRBB 2H3NB 1MCOH 1FGNL 4XRCA 2YD4A 4ZOEA 4IRSB 2CIKA 4GT7A 2VXTL 4P49A 5JW4M 4PJGB 4PLJD 2XTLA 2ZJSH 5E1AA 4G43B 3REWB 4UIKH 1BZ7A 2H32A 1D6EB 1HHGB 4ORGB 1ZGLB 5BVPL 1T3FB 3QPXL 1F6FB 2FX7L 2NY7H 3WHE0 4J2XA 3IDNA 1N4XL 4LGSB 3WUZA 2DMBA 2I27N 3DJ9A 3QO0B 5C0FB 4O00A 4UV7H 1CI5A 2HLFD 4YDLB 1T1WB 4F7PB 1HHIA 3CH1B 2BK8A 1P4IL 3HNSL 4NDMB 3AC0A 1EO8H 1PKQE 4G8IB 1KLGA 4WWID 3RTQD 5TJWK 1UB5A 1KEML 4RWHA 1BBJB 5DHVA 3PIQA 1YJDH 3IETA 1JGUH 1EPFA 3GI8L 2Z0BA 4OTXL 3LS4L 1MFEH 4M43L 1N3NA 4M9PA 4NZTL 5J6GB 4YDKH 1B9ZA 3GB7B 4XNZC 5KZCD 3HC0A 3O11A 5I76A 1KIRB 5TE6L 2AV1B 3MRBA 2VXVH 3OXRB 4HIXH 4JRXE 4PJGA 5KAQG 1EH9A 4G43A 4KTEH 3REWA 5IVNA 1D6EA 4ORGA 1ZGLA 1H9VA 3BPLB 3JWOH 5MEPB 2QQNL 3RZCC 1E4XI 4U1GB 2X4OA 3FMGH 1BEYH 2R23B 2CGRH 5F71A 3QO0A 4HPOH 5MI0B 4GFTB 2Q8BL 4ZAKD 4AQ1B 3DUSA 4FQXC 3FQNA 3DTXB 4WV1C 3CCHB 4Z7UB 2OXGA 4TRPL 1QLEL 3RVUD 1T1ZA 3UCRA 1T1WA 4WUUD 3CH1A 4NDMA 1ZGLP 4MAYC 2E9IA 3KS0H 3KHOA 3VH8B 1J1OL 2VR5A 2CKBL 1L9MA 3RDTC 1D5MB 2HJKB 3ARZA 4X80H 3SKJH 1L9NA 3IU3A 5DK2A 1IEHA 2ARJB 1PAMA 1IGIH 4G7YH 1AIFB 1K3IA 4LASL 3EJYC 3S3JA 1SHMA 3GB7A 3TP4A 2D9CA 2VZ3A 3MUHL 5LGHL 1QSEE 3LB6C 1MHCB 2ERJC 1KIRA 2AV1A 3VXRB 4D9LL 1QR4A 2NY2D 3S36L 1MNUH 4NM8L 4HT1H 2WM0A 3OXRA 3BSZL 3TJHC 1O5DT 4OSUL 5IW3A 5IHLB 3LKRB 4IBLT 1DQJA 2H2SC 3PXJA 4QGTA 1U8MB 3O81A 2GFBB 1MWAL 5F1OB 4IDLA 4DZBB 1ZMYA 1KIPB 2HG5B 3VWJB 5MEPA 4HKXA 4EOWH 4MB3A 1MJ8L 4OCSL 5BJTB 5F9DC 1II4E 5EU6E 1QBML 1JRHL 3CCHA 3J7HA 1GC1L 4NN5B 3C8KB 2J5LC 3ULUH 3LSOA 4XNUL 3V4UH 4QXWA 3CSBA 4WFHE 4NO5B 1QQDB 4B0MM 3L3OB 4EIGB 1D5MA 1JZ7A 2ICES 1B3JA 4O2EB 3M1BB 3WS6C 4F3FB 1AIFA 5IR1A 3RKDD