1WICA

Solution structure of the msp domain of riken cdna 6030424e15
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
152
structure length
152
Chain Sequence
b'GSSGSSGKKPLSVFKGPLLHISPAEELYFGSIESGEKKTLIVLTNVTKNIVAFKVRTTAPEKYRVKPSNSSCDPGASIDIIVSPHGGLTVSAQDRFLIMAAEMEQSSGTGPAELSQFWKEVPRNKVMEHRLRCHTVESSKPNSLMLSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical Protein RIKEN cDNA 6030424E15
publication title Solution structure of the MSP domain of RIKEN cDNA 6030424E15
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 16
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00635 Motile_Sperm MSP (Major sperm protein) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1wicA01
1Y6KR 4M8VA 5KTEL 4IMLB 4HIEB 3BESR 5E8EA 2F53A 3DTXA 1OOAA 2P8LB 2XNAB 1ORSA 2CRZA 5L6YH 4Q6YA 4Y5VB 1H8NA 4JRXD 5IW6A 5J13C 1A7BA 3HZMB 2NZ9C 1JGEA 4Z6AT 4S1RL 5T1DL 5C0AD 4W81A 1RURH 4ENEC 4D9QE 4FA8A 2DLIA 4GG8B 4R8WL 4D9LH 3PV7A 4UIMB 1ZLSH 15C8L 5CFHA 4PJFE 1S9VB 4AENB 4DEPB 1I8IB 4OUUA 3ARDC 2P8MB 1JHKL 1IBGH 4MWFB 3IDYC 4YJZL 2X4SB 4WW2C 4F15C 1UZ6F 3OG6B 4OFPA 4MQXC 3BEWA 3BIKB 3BYYA 5E2TH 1CS6A 4HIIA 4XBEL 3LHPL 2FECI 3RKDC 2GJJA 1P53A 3KLSA 3SY0A 4NWUL 4YBHA 2R2EA 2QQLL 3UJTH 1F11B 4RAHA 1YDPB 1F58H 3BISA 4U6HB 4X9BA 4CL7A 2UWEE 2GY5A 2EDXA 3CVHL 4LLUB 3VA2C 4M4RA 4J8RA 3O3AB 5E2UH 4UTBL 2XWBB 1Q1JL 5EO1A 3D85A 1OLZA 2CKBH 3EO9H 4RFEA 3BIBX 5E99H 1QLEL 4HH9A 3WHE1 2FIKB 5L88H 2G60H 5I16B 1B4JH 1QFUL 1R5IB 2PW1A 4KHTL 3GMLB 3WSQH 5IIEB 3HI6L 2QBWA 2FEDD 2LV4A 4PRAA 3VI4F 1T0NB 3CFEA 4HXAL 4NYLB 5DA4A 4YHZH 4E5XA 1UJ3B 2NR6D 3ESVF 2X1OA 1NANH 1P7KA 4GLRI 4PJHA 3CDCA 3QUMH 5FV1L 4NHCH 1RJYA 2BFVL 2WUCH 3IDNA 3R8QA 3ULUC 4K9EH 2QV2A 5CSGA 2VWEC 3NOIA 4NPYB 3KPRA 4L3EA 3LRSA 1V8HA 3BH9A 3C87A 1FL5B 2HT3D 4WFGD 4X6CE 3FZUC 1ZLUK 1GC1L 1IGIH 2B20A 5HI5C 4FQ1H 3GIZH 3MLSL 2DICA 4J3OC 2NTFB 1I1CA 4PRPA 1R5WB 2N7BA 5J6GA 5IMKB 2Z93B 3L9RB 5DJCA 1S7WB 4D0DA 1X4YA 4WFEE 4PJGB 5EO9B 3GBMH 3VD9A 4X6DF 3U9PH 1QSFB 2P8PB 5IVXA 3LKOA 2I5YL 3IFPB 1GGCH 2XN9E 4IOSD 4RBPH 2IADB 3ARBB 3GSWA 4LNRA 2ADIB 1RFDL 2WM0A 4UQ2B 1DQML 1KPRA 3QWOA 5IMLB 4Y5VC 1N5AB 3LPFA 5IOPA 2D9CA 2CK0L 2GIYA 4KXZI 5INDB 2YK1L 4Z7VE 2E7BA 4ODWB 2VDPL 3SGEI 1OW0C 4FTVA 5GXBB 3VXRD 4N0FB 2M8XA 2H6PB 2X4PA 2O61B 1T03L 5DQ9A 2Z31A 1RJLB 2A2QT 3FQNB 3MLPA 4HDIB 3OR7A 2GHWB 1CD8A 2B1HL 4DEPC 2VH5H 1CFNA 5A2JH 3FN3A 4Y16B 1J0JA 4C56D 3MUGA 1AXIB 3DO7B 2JCCB 5TF0A 2Q8BL 5HHOB 5FB8A 3V5HB 4BH8B 4PY7A 3VJ6A 3RWFA 4DK3A 4NUGL 2K1MA 3BGMB 4JRXA 1KLFA 1U6AL 5IB2A 1ZVYA 5DD6B 4ODBD 3VFUA 5C0AA 3V6BR 3EDJA 5GHWH 1FCCA 4CN4A 5IWLC 2VITB 3GJEA 3L1OH 4H88H 5CWSB 1FFOB 5LGJB 2QKIB 4LSQL 4XVUD 4LEXH 4KPHH 5FO8B 5IBUB 3NN8A 5GGTA 5FDWA 2GY7B 5GS0H 5DR5H 4OGXH 3HPJA 2R69L 4PJ7F 5ESQA 4L8DB 3A6BL 4QGYA 1IAOB 4JY6A 4RSVA 1MCNA 3FO2B 1J8HB 5AZEH 3F7VA 3I02A 2DB8A 4M62L 3I6LE 4NO3A 3N1GC 4F7CB 4QRRA 5ITFA 3NCYP 3QFJD 4J12A 4NQVB 2VXQH 3W9EB 4NOFA 1X5IA 3SO3B 1BVLB 1ZHNB 1UJ3C 3UZVB 1HIML 1FJ1B 4ODTL 1M71A 4XNXL 1IAKB 2A6JB 1FN4A 3DIFA 3MX0A 4JRWA 5EU4A 2RCSL 2P4AB 4G80B 1WBZA 4P3CL 1BZ7A 5E94A 3L7FA 1MCRA 5GRUH 1GAFL 1KCUH 4P23A 3RI5K 2GKIA 4OZHE 2VMFA 2V5TA 4S1DD 3IJYA 4PJFF 2HT4C 2QSVA 4PGCB 3QA3B 4KRPB 5DJ2A 4D0BB 5I1LB 3SGDH 1DQQA 3T0VA 4WHTA 4PRDA 4HFWB 3OF6D 5F3HA 4LLVA 4LEOB 4KVCH 3O2WL 4Z8FH 1XR9B 4GW5A 2FR4B 5ICZB 5LG1A 4KTEH 3DX6B 3V0WH 3T3PE 1A4KA 1GL4B 1J0IA 4AMKH 3RVTC 1I8KB 3TN0D 4NQCA 3MFGB 4K55A 3HMXH 5D7LB 4X8JA 3VXUA 5KVEH 4WUKH 3ARBC 3FFDB 4MLIA 4OFYD 5CGMA 5F7YC 1LMKA 4XVTH 2UWEF 4ETYA 3WIFB 3VE0B 3UMTA 1ZTXL 4MNGE 2EYRB 4QRQB 1A4JA 4CU7A 1SM3H 4P57A 1ZLVK 3NTCL 2R4SH 3KXFD 5EO0B 1NCAL 3MLUH 5J1AA 2AABL 5D7IE 5JIKA 3VA6A 4DCQB 3O11A 2JK5A 1MWAL 3TO4D 1XGYH 4OM1H 3X3GL 1JL8A 1KF9B 3B2VH 3L7EA 3TT1H 1IKFH 1BQHG 5SWSE 3MRPB 2YPLD 4F9PA 4KY1H 3S3JA 2XY1A 1U8OA 5BJTA 3HC4H 2CPCA 4Y16C 5ID0A 1FNEA 5A1AA 4WO4B 3S88L 1DL7L 2EXYC 1QQDB 5K9JL 2NNAB 5JLZA 5DHYA 3QEGH 3S98A 1AGDA 1QFWL 4EUPH 3OB0H 4LVOB 3H2WA 4MS8D 4X6CF 4F57L 3V5DB 3ZKND 1R3HA 2A6KB 2AK4D 1Q94B 3EOAB 3L5HA 2YOCA 3VXRA 4UT6H 3E3QC 1Z9LA 5HYJD 1B0WA 4JY5L 1SY6L 3SE8L 4FABH 5EN2B 5F7DA 4OGYL 1JWMA 3B5HA 3H8NA 4LIQH 1IGML 2PO6D 3UTOA 1ZHBA 1RZKH 3ZDYF 2MKLC 4J7RA 1ZT4B 5HHVL 1C08A 4LAJH 4RGND 1KLUB 3EYSH 3MV8A 4FQPA 5GGSY 5TE4H 5TGBA 5MENB 4RX4D 4WNQA 1CXIA 4YO0A 1QR1B 3T09A 4HS6A 3T4AA 4JFZH 2P5EE 1U41A 2VE6B 4LP4A 3IDJB 1CQKA 3ULVC 5DK2A 3HUJE 2Q7YB 3SE4C 3SO3C 4ZD3H 5C8JB 3BW9A 1MHCA 4Z7VF 1J1XL 3RUGB 2DQFA 1KENL 3NZHL 2R29H 1CICC 2CH8A 4XPAL 1P6AB 3MXVH 1AQKL 2AJVH 1GXEA 3SE9L 3DJ9A 5TE7H 5I74B 2VLMD 4JREB 4QHMB 3F7RA 3KYNB 5GZOC 1N64L 4KRPC 1T20A 1Q72L 1U92B 4PG9A 1KJ2H 3QO0A 4UQ3A 4Q2ZA 5I8EB 4YK4B 3OKLA 1JBJA 3EO0A 3MJ8B 4JFQB 3VFVA 4WI7A 2XRAH 5DTFA 3V4PH 1MNUL 3DGCR 1DDHB 5I66B 5I8KH 4OB5H 3U0WH 3TIDB 3LDBB 5LGHL 5IW1B 1MPAL 1X7QA 4G8GB 1Z0MA 4HC1A 1MFEL 1RIUH 4HPYH 1XR8B 5C3LD 2PCPA 1M7DA 1E4KA 4MDJA 4FQ2L 4YDVB 2DKMA 3IDIA 3BP7A 1HOCA 4KGLA 4QYOB 1OT1A 5I19L 2D0FA 5JIIA 1INDL 2ITDB 5IKCA 1AGEB 3KJ6L 1J9CT 1NKOA 3U2SB 4R96A 3KYKH 4ZPTB 5F1SA 4Y4FB 2ICEB 3DV4B 3MJ7A 4YDKL 5DUML 3UTPD 5LVEA 1A7NL 2VN4A 2R1YB 3LOWA 5FGCE 3MRFA 3HAEA 5BS0D 1H3TA 1OCWH 2CO7B 4MA3B 1L6XA 3B3IA 1IAII 2IPKB 1FVCB 4KHXH 1HINH 4WO4C 1OPGL 2F74B 1KIPB 4OFYA 3QUXD 1FYHB 5DMGD 2BX5A 2LVCA 2GQHA 4OZHF 3B6SA 1RZJH 3GHEL 3QWQB 4KRLB 4OZGB 3KXFA 5LCVL 3AY4A 4ZFFA 1RZFL 3KPQA 5B8CB 3FOLA 3TO4A 4NJAL 1IQWL 3QIBD 3QNXA 2ZUSA 4GKNB 4EUPG 1CK0L 1G1YA 1OY3B 1CE1L 1NC4D 2W0LA 1UM4L 3EZJB 1SYSA 2LU4A 3WNPA 2YPLA 4K94L 3EFFA 3T3PF 2VTFA 4DGYL 1OB1B 4R4BB 3V2AR 1I7UA 2WNGA 3HE7B 4U1KA 3GSQB 1AD9A 5KVFH 3LKQB 5DD1L 4KTDL 1M7IA 3K2UH 1GIGL 2FL5B 4N0UB 3M45A 2AJUL 4QHKJ 4HCRL 1EO5A 1ACYH 1DBKL 4O02H 4QCIA 2AK4A 3RY6C 1JK8B 1Q0YH 2BVOB 5DJ0B 4YEFA 2X4QA 5D7IF 2AERT 2EZ0D 2XWTA 1YN6B 4ONFL 5I74C 2PO6A 3GMPA 4IDLA 4JREC 4O2CA 1BJMA 3B5GA 2YD9A 5EOQH 3RX5A 5J1SC 3MYZA 1F4WH 1KIRB 5AAMA 3RVXC 4ZOBA 1S7RA 4RX4A 4YK4C 5D4QA 2FJHA 4N0CC 1U8MB 3ARGD 3CAFA 1F6FB 1U93B 1PKOA 4U1NA 5CEZL 3LDBC 1FAIH 4KI1A 1CDJA 4JAMB 1H5BA 3L5WB 4PGBA 1KPVB 4XGZB 3PIQA 4J2XA 3UPRA 4R4FL 4HLJA 3OJDB 1A6VH 4PYHA 1W72B 5GS1A 2WWKO 1HHJB 2EO1A 2EYTA 3LB6C 3FOMB 2XA3A 3EYFB 3EYQD 4PBWD 4NRZB 3U4AA 2H9GA 4KQ3H 1NC2A 3DVGB 3R1GL 4NHUA 2D4FA 4LGPB 5K9KB 1UACL 4YPGB 1CGTA 5FKAA 3ZDZE 4Y4FC 1NUNB 2XIDA 4YBQD 3BVNB 3H7BB 3JVGA 5C08E 1TZHB 3LEXB 3HUJF 1BREA 2UYLB 4F2MA 2FGWL 1RV6X 4G6AC 1Z6JT 4RMSA 3KG5A 1FE8L 3QQ4B 35C8H 2ID5A 3WIIL 1HHHB 4PD4K 3H9SB 1U2HA 4LVEA 2IFFL 5E8NA 4RGOL 4JKMA 1VACB 5IGXL 5F89A 5EWIL 4YGVB 1RULL 5B8CC 1CDIA 1A5FL 1HXMA 4G8IB 2J8HA 5JA8B 5BMFL 4OZFB 4GXVH 4WFHE 4X6CA 1N3NB 2MSPA 1SJEB 3RX8A 3PP3K 5BS0A 5A2FA 3B2UC 3S36X 1N7ML 5DMIL 3DBXA 5CJXA 4H25B 3HE7C 1T66D 3TBYA 1LEIB 4WHYH 5I8OH 2QL1A 2R2CA 5IFAL 1NMAH 1T22A 3OAUH 3L3DB 2ZCLL 1YEHL 1U3HB 4MX7B 3BXNA 4HJGB 3SDCD 4LMQI 2E6QA 5A40E 3D3VD 3Q2CA 3VRJB 1NL0H 3RX7A 2LE9A 4XBPB 4YHKH 5DJ8B 3QIBA 1JGLL 1IT9L 4ZUTB 4TUOB 5B39A 4NZJA 4ELMF 1JNHA 4LARL 1EMTL 5FUOL 4JO3H 1JZ8A 5HGDA 1HWGB 3I3BA 3UPAA 4U7KA 1MQKL 1RI8A 4OCYL 2VQ1B 5DDHA 1CFQB 4IOIB 1TTUA 1NGQL 6CGTA 3ILPA 3C09B 5E7FA 1BHGA 2CJUL 4HMCA 4XH2B 5CBEA 4ZUWA 25C8H 2J6EA 4XHQA 3O3BA 1HSAB 4LCYA 3GMRA 3B83A 5HJ3B 5HI3D 3ROLA 2GCYA 4R7DB 4HULB 4N0RA 2Q6WA 5ADOL 2DQGL 4X4XA 5EUOA 1KCRH 1OT2A 4KKCC 1CU4L 5GGRY 1ORQA 5E8EB 2F53B 3DTXB 4NQUA 4XPBH 4YR6A 1ORSB 3G6DH 1LEGA 5IW6B 2RIKA 2XI9A 4KV5F 1JGEB 3F7YA 4I77H 1QNZL 5IBTL 1FO0A 1JRHH 4LAQL 2P43B 4JQXA 1KLGA 3MRIA 4ORGA 1JPFA 3QJFA 4F33A 3ARGA 5IMMA 4OUUB 2APVA 4MD4A 1WIOA 3CZFA 5HYSG 4Z7NE 3WO4C 3CFDB 1MJ8L 5CMAA 4PJCA 3T3ME 3BEWB 5F7WC 3RBGA 3GSNL 4HIIB 3NA4A 5DZLA 5I1KL 1BGXL 5KTEH 2K3TA 3GJFH 4XCNA 3BKYL 4V2CB 3SY0B 4K8RL 1K9TA 1UC6A 4XBGB 2R2EB 3VG0L 2VLLA 4KI5E 1V3LA 5GS2H 3H9HA 3NCCB 4X7FC 2A6IA 2EIBA 2IQAB 1I8LA 4J8RB 4OZHA 4S1RH 5T1DH 2BVPA 1FZOA 1IM3A 5EO1B 4MSWA 1WEJL 5J7CC 4RFEB 4R8WH 4HH9B 1W0WB 2NY6D 4FFVC 3SBWC 1JGDA 1IGFL 2PW1B 4YBLB 2CDEA 32C2A 5ALCL 1UWEL 1XF4A 4PRAB 4GW4B 1JHKH 1EZVY 5TE6L 4GKOA 4GRMA 3CFEB 3G6AB 4HEME 4E5XB 1AJ7L 1U3HC 5IP4A 3HI1A 4DUVA 2XZAL 1P7KB 4HLZH 4PJHB 4WHYG 1FBIL 1T04A 4RMRA 4JRYE 1I9EA 4XP6L 1FDLL 4XBEH 3LHPH 1JZ3A 5IROC 1PZ5A 1KCVL 3KPRB 3O3EA 4L3EB 3LRSB 3ZDZF 3BH9B 3MO1A 2HRPL 4NWUH 3TBWA 2QQLH 2R0ZL 5F1KC 2MKWA 2IFGA 2NX5E 4ZSOE 1HNGA 2EC8A 4M03A 3B8SA 3CVHH 1T2QL 3C09C 4JFDE 5KZCB 1NCTA 4UTBH 5J6GB 5I1GL 1Q1JH 5DJCB 2O5YL 3EOBA 4D0DB 4HWEL 1R5VB 2DYPD 3QSKB 4XVJL 3BPNB 2QSTA 3UTQA 1QLEH 3OAZK 1MCCA 5IVXB 3SDCA 2GJZA 4KHTH 1QFUH 1FNFA 1BWWA 3HI6H 3PXHA 3KPPA 4LVHB 1OF2A 3GSWB 2EKJA 3MQIA 5JOPE 4HXAH 2QQKL 4LNRB 1BP3B 3QISA 4JO4L 2AEWA 5IOPB 4KC3B 3T1WA 4D0CA 3LN5A 1J0HA 1XIWD 1FNLA 2BFVH 4FTVB 4OCWL 1FAKT 3AC0A 1A1OA 5DQ9B 2Z31B 4U1JA 1GC1H 4U1GB 1XCQA 2QQQA 4J3WA 5CINH 3MLSH 1ZV5A 2C3HA 4J4PD 5KOMC 4DWHA 1CFNB 2YUXA 4ZPVA 3VXSD 1VPOL 1EUUA 1N59A 5TFSL 3MUGB 2IBBA 4IMKA 4ZFGL 1TNNA 1CFVH 1FPTL 3WJLA 5FB8B 2KBGA 3O3UN 4PY7B 3VJ6B 3RWFB 4JRXB 3ZMRA 4TUJA 4NM4H 5IB2B 2EE3A 1KT2A 3QI9A 1Z9OA 3ZT7A 1G6RL 1RFDH 5C0AB 1DQMH 4NOBA 4GKSA 4PRNA 4TVPL 2CK0H 2M1KA 3VFGL 2YK1H 3NN8B 1NFDB 5FDWB 2VDPH 5D2NE 3ZO0A 4F80A 3DI2B 5ESQB 1AC6A 4JY6B 1T03H 2DIJA 2FWOA 2UV3A 3BDYL 3F7VB 2B7DT 3I02B 5IVNA 3CGTA 4NO3B 4YBLC 5ITFB 1PZUB 2B1HH 3GMNA 1UXSA 1EO8L 4HT1L 5DWUL 5EZLA 5CSBA 4KUCF 2BNRE 2Q8BH 3AS0A 4FQHA 3CSYA 1M71B 3DIFB 5EU4B 4NUGH 3P4OA 3D25A 3RZCD 1WBZB 5E94B 1U6AH 3L7FB 1WVZA 4JO1H 4U31A 4P23B 5T33L 1CGSL 4YFEA 4KK6D 1GZQA 2VKWA 3F62A 1CDBA 1R3IL 4PP1D 4LSQH 1DQQB 1S9KC 1F6AA 3P3YA 4Y8AA 4Z7NF 4MQSB 4PRDB 3QFDA 4NUJA 4GRWH 5L7XL 3T3MF 4NZUL 2R69H 2CK2A 4I4WA 3A6BH 2IBZY 3DVFA 4GW5B 4ESKA 2Q86A 2HKHL 3BPNC 1A4KB 4M62H 3D69A 1GSMA 1BZQK 3TC9A 1TJIL 2V2XA 4X8JB 4D3CL 4KI5F 2X1WL 3AFLA 7CGTA 3F6LA 4HG4J 1HIMH 1T3FB 4HUWA 5BOPA 4ODTH 2MMXA 3W9DA 3GZKA 4XNXH 1A4JB 1U91A 4P57B 5FYJU 2FSEA 1OAYL 5J1AB 4P3CH 2XG4A 3UPCA 3O11B 1GAFH 1K4CA 4H0HB 2JK5B 5KSUA 4P5TD 2Z31C 4U1GC 5ADPL 3L7EB 1GGBL 3GIVB 2P5WD 2DYPA 1MFBL 4NQXA 1FORL 2OL3A 1U8OB 1HHIA 4YWGL 5BJTB 1AGFA 5HYFA 3MRGB 5ID0B 1FNEB 1E4WL 3CFJB 5DD5L 3D2UD 3ARED 2E5EA 4ZFOL 1WWWX 5JLZB 5DHYB 5FHBL 1AGDB 1HDMA 2PXYD 2B39A 1XIWA 43CAA 3EYUH 2VLJE 3OX8A 4PJIF 5IT2L 3VXRB 3KJ4B 4P2OD 4Q9RH 2ED7A 4KROB 1ZTXH 5IEKA 2OZ4L 4OCMC 4NZTL 5F7DB 3NTCH 5GRJL 1JWMB 1NCAH 1MHPL 2X70A 3W81A 1HK6A 2AABH 5DRZA 1MCQA 3RWEA 1XGPA 2DKUA 5DHVB 3VXTA 4J4PA 1MWAH 1AR1D 1D6VL 3VXSA 5M95B 3BRFA 3MV8B 3X3GH 4CVUA 4WNQB 5DJXA 3BX7C 1FGVL 1C12A 1URLA 1JRHI 5I15L 4HS6B 3T4AB 2BY2A 5EZJB 1JV5B 5DK2B 5KAQG 1NBQA 4S2SA 3CFBA 3S88H 1MHCB 1DL7H 3WS6A 5K9JH 2DQFB 3PF2A 3QNYB 1QFWH 2V2WB 4F57H 4P23C 3ILQD 2ZJSL 4P3DA 2VQTA 4WU7A 1LGVA 2I9LA 5DJ6B 5JXED 1BIHA 2NY3D 4YGAB 1T20B 4PG9B 4JY5H 1SY6H 4EQ2A 4A2MA 4KFZC 1CDGA 3SE8H 4UQ3B 4Q2ZB 3EJJX 4OGYH 1B9ZA 4R6UA 3OKLB 4L8CA 4IRSD 1IGMH 1DQTA 4HEPG 3QDME 3EO0B 4IRJD 5I0ZA 4ZTOL 3UTSE 2FEDC 3QFJB 5KW9L 5HHVH 1YYML 3O6LL 4GW1A 1P1ZA 1X7QB 1PEZA 1AY1L 2B1AL 5FYJL 3IFLL 1R6VA 2ADFL 1YECL 1BQLL 1IL1A 1IEBA 2EDFA 2PCPB 1M7DB 4MJID 4MDJB 3RZCA 1EK3A 3IDIB 3NAAL 1QFWM 3BP7B 3FQWB 1HOCB 3S3SA 1J1XH 5EC2B 3V6ZA 2D0GA 5IKCB 5ERWA 3NZHH 4P2RD 4WEUD 2PW2A 5BZWA 3WFCL 2DKSA 4U3CA 4XPAH 4R96B 1AQKH 43C9A 3SE9H 2KL6A 3IVKA 2YC1A 3MJ7B 3HNTL 5E2JA 3FRUA 1N64H 1MEXL 1Q72H 4HHAA 1WBXA 3HAEB 4F9PC 4X4MA 3B3IB 1ZGLA 3NPZB 4DOHE 4ZAKA 3ZYZA 1ZVSA 4UNUA 1FG9C 1IGJA 3ORJA 1MNUH 5LGHH 1MPAH 3MNVB 1NGPL 1MFEH 3MV9E 3B6SB 3WEXA 3KXFB 2HG5A 4ZFFB 4DVRL 4FQ2H 1I3VA 4K7FA 4JG1L 3KJ4C 3KPQB 5MP6L 3EO1A 3TO4B 2V5YA 4YZFF 4KROC 3QNXB 5I19H 1INDH 5INCA 1NCBL 2ZUUA 3QDGE 3KJ6H 1BWMA 2P5WA 3RWCA 4F8QA 1SYSB 5BXFA 2YPLB 4C4KO 3EFFB 3LKSB 5C7XL 1HCFX 4TSBL 4XP4L 1CLCA 4YDKH 1I7UB 1QEWA 2F8XC 3IKKA 4U1KB 2BVQB 1AD9B 5DUMH 1A7NH 3D2UA 4JVPA 2ZCHL 2DQJL 3AREA 2J8OA 1M7IB 5F97E 2E7HA 4S1SH 5F93C 3Q3GA 3ARSA 1FG2A 1IGCL 5GSVA 3T0WA 1BFTA 4KVNL 4QCIB 3EHBD 3S36L 2LAGB 2AK4B 1OPGH 1HKLL 5I0DA 4P2OA 3WNMA 2XWTB 1KC5L 1UH2A 4M00A 3F5WA 1IE5A 4XVUC 3RVWC 3GHEH 2FATL 3H9ZA 5LCVH 1HH6A 2PO6B 3GMPB 4JFPA 4HGMA 4O2CB 1RZFH 1Z3GL 1IQWH 4NJAH 4RGNB 1H3WM 1CK0H 2C9AA 1CE1H 5GRVK 1UM4H 4OQTL 1UFUA 2PUQT 4K94H 4DGYH 4KKNA 2E6JA 4U1NB 5F9WB 1I85A 3CU7A 5DD1H 3GM8A 5GS0D 4KTDH 1JPGA 1IEAA 5JIPA 1GIGH 2VLRD 4KJQC 2AJUH 4HCRH 1B2WL 5GS1B 2G5BA 1DBKH 3SKUD 2XWJA 3N85L 3W0WD 1T0PB 5F7LB 1RK1A 2D7MA 1NCWL 4S1DC 3KHQA 1ACZA 3BRDA 2KUTA 2EDJA 5A3ID 2H9GB 3EGSA 1NC2B 4NHUB 5HVFB 3PDOB 4ONFH 1VGKA 5FKAB 4IRSA 3RWGA 4IRJA 3TBVB 1S5IL 4BSJA 5HGBA 1MLCA 1U8KA 2UUDH 3MZGB 5I1IL 5AAWA 4F2MB 4XNUH 4X83A 3CX5K 3K46A 1AFVL 5EIQA 1QSZA 2CKBA 4MJIA 1VEMA 1ZLWH 1CXHA 3L3JA 3TBTB 2VYRE 3AY4C 4P2RA 4R4FH 5F89B 3HG1D 3MLWL 3MOAL 3NPSC 4JZOA 4JRYA 4M6NL 5C0IA 4TNWK 5IK3A 3TO4C 1HXMB 1QA9B 5CZVH 2A38A 3WD5L 3PWPD 3QUMA 1BD2D 4NKMB 3QXDB 2YKLL 3R1GH 2Z92B 1UACH 2NX5A 5BS0B 3HFML 1QBML 4LLDA 3DBXB 4NJ9L 4O00A 3TBYB 5FDYA 1ADQL 1GGUA 3NA9L 2GI7A 4Z5RA 3SDYL 5L2JA 2Y4SA 3PHQA 3QUXB 1PBYA 1T22B 1TPXB 2FGWH 3H3PL 5F7EL 3BXNB 1WUNT 4MS8C 1FRGL 5I1CL 3ZKNC 1N4XL 3DUUA 4WU5A 1Q9OA 1FE8H 3V7AG 3WIIH 3QIBB 1GVIA 5B39B 1U8HB 3ZTNL 4U49A 1EH9A 1JNHB 2IFFH 3QQ9D 5HGDB 1BFSA 4RGOH 4ZO8A 3PL6D 1XGRA 4UB0L 1NC4B 2PO6C 5EWIH 4XCEA 1RULH 3HNVL 5DDHB 4Z78B 5KS9E 5CAYB 1A5FH 5D6CA 3ILPB 4RGNC 5BMFH 1LNUA 4HQQL 1CGWA 4ZUVB 5IVOA 1KYOK 5CBEB 1NAMH 3O3BB 3OPZH 4L1DA 5ALBL 3GMRB 1CTOA 1YJDC 2DLTA 4KTYA 3S35X 3ROLB 3X13A 1N7MH 4KMQA 4UMGA 3MV01 5DMIH 4W68A 3IT8D 1QRND 1CIUA 2Q6WB 4X4XB 5EUOB 1ORQB 5J89A 1H5BC 3ZKMC 5IFAH 2V2TA 4YR6B 2ZCLH 1YEHH 1GPOL 1VESA 4HGKC 5GS1C 1LEGB 5JPNA 4Q9QL 5CP7A 1J1PL 1I4FA 2RHEA 2HLFD 3F7YB 1JGLH 1IT9H 1QBLL 1EMTH 4LARH 2EC9U 5FUOH 1WGOA 4U05A 2X2YA 1P7QA 1MQKH 1QFWI 2LVEA 4OCYH 1KLGB 3MRIB 4YDLB 4TRPL 3VXMD 1BQSA 1JPFB 4OFVA 2FH8A 2ZSWA 4K3HA 3ARGB 5IMMB 3JVGC 1WLHA 2R0WL 1S78C 4MD4B 2CJUH 2B0SL 4FQIL 1LK2A 2GTWA 3QBTB 3OAYK 2JTDA 3ZTJG 5CMAB 4PJCB 4KWUA 2VLKE 1QPPA 4B50A 5DURD 3DYOA 1O7VA 4JFXB 2XQYG 3E1F1 5ADOH 2DQGH 4FS0A 2JJWA 4RFNB 1MFDL 1CU4H 1RUPL 4XCNB 3W0WA 4PLJC 1FNAA 1FNGA 1QYGL 3MROB 2HTLD 2BNRA 1UVQB 3PQYE 2VLLB 3QCTL 1VB9A 5C1MB 3H9HB 3QDHA 1OTSD 3QXWA 2A6IB 3TA3D 1S8DA 3KR3L 3PG2A 1X5HA 2BVPB 1FZOB 1IM3B 4HUMB 2YXFA 4MSWB 1OVZA 1QNZH 4RQQA 5H94A 5IBTH 2R15A 1N26A 4X6FA 5J6HA 1YMME 4LAQH 2L4OA 5HXMA 2GTZA 5CJXC 1IARB 1JGDB 4TSCL 2CDEB 32C2B 3G08B 3REVA 1GOGA 2B4CL 3SOBH 1XF4B 2YSSA 1SYVA 3D87B 1UB6B 4GRMB 2C1OA 1MJ8H 1TPXC 3QNZA 1MHHA 1X4XA 5AD0A 1EIBA 1HH9B 3GSRB 3HI1B 3BJLA 4J3XA 3GSNH 2VR5A 3HG1A 1T04B 4XI5C 5LKNA 5I1KH 1BGXH 5MEPA 1PZ5B 3QIBC 3TH3T 3O3EB 4LPCA 3MO1B 2AW2A 4YHOH 3BKYH 1EGJL 1K4DA 1YNTA 3C2AL 3PWPA 3TO2A 4K8RH 1BD2A 3HMXA 4XPGH 3TBWB 3DURA 2D31A 3VG0H 1YC8A 4PS4L 3TZVD 1XF3A 1FZKA 1RK0A 3QULA 3LKNA 4D9RE 1WEJH 4WTZG 4PJ5E 5ACLA 2D7OA 4O9HH 3UTQB 4PREA 2WWMD 3T0ED 4QRPD 3OJVC 3SDCB 1IGFH 2GJZB 1VFBA 5ALCH 1RIVL 3D3VB 1UWEH 1AO7E 4PBVC 4Y88A 2LABA 3QHFL 5DUPL 4CMMA 1OF2B 2I60H 5TE6H 4EI6B 3KGRA 2J8UE 1AJ7H 2DWEA 4WTXA 4G8FA 3CPLA 2XZAH 4D0CB 3LN5B 4TSAL 3PL6A 5DJYB 2E7LA 1FBIH 1YQVL 4XP6H 1FDLH 4XTRD 2PETA 3HE6A 2BVYA 1AD0A 4EUPA 2HRPH 3L3KA 4P2QE 3EBAA 3CLEL 3I84A 4MYWB 1A1OB 2R0ZH 2WBWB 1GH7A 1XCQB 2D3VA 1HQRA 3TCLA 4JQXC 4PJEE 4YDLC 3O6ML 3ARGC 1IFHL 1T2QH 3MBXL 3DRQA 1QRNA 4ZPVB 4MD0A 1XF2A 3LCYA 1J0YA 5I1GH 4KK8D 1N59B 5DC4B 3MUJA 4MCYA 2O5YH 4NCC2 3P4MB 1JF5A 3MUHL 4XVJH 4HWEH 4MNHA 3EDFA 4DTGL 4ZG1A 4Z9KB 1JMZA 3D5OF 3HZKB 1DTUA 1T4KA 4IIQB 2P42B 5GRYA 2QQKH 5FO7A 3LD8B 2C3XA 5KS9F 4GKSB 4JO4H 5J11B 3ZSTA 3WJJC 4LKXA 3GSXA 1I3GL 4FN0A 4YBQC 3TYFA 1R24B 3C6LA 4M7JL 1I8LC 3DX7A 3CC5A 4OCWH 1J5OL 3OV6A 1LQSR 2OJEA 2BNUA 2FWOB 5DJZA 4PJXA 5CZXD 3K8MA 2DIAA 1G7MA 1CD0A 3GMNB 3UTSA 5EU7C 3HC0B 1KJ2A 3N50A 3T1FA 5DQJB 2H3NA 1VPOH 1A47A 4H8WL 5TFSH 4ZFGH 4EEEA 1FPTH 2Z91A 2E8YA 1YZZA 2YD8A 4K23L 2I25N 1ZT7A 3P4OB 3D25B 4U6VL 4DAGL 2Y5EA 2VZ3A 2XYCA 5DHXB 4MXQC 1ED3A 3P77B 5IHUL 1G6RH 3EZ8A 4U1LA 2KPNA 1UYWH 4TYUA 5E8PA 5D7KE 1BMGA 1F6AB 3VFGH 2NY6B 1YNKL 4NUJB 2XICA 1T66C 5JR1L 4KU1A 3WLWD 2V6HA 1SMAA 5CIPH 5FGCB 3BDYH 4GRWE 2AJ3A 4HFUL 4PJ9D 3SDCC 1X5JA 3VFRA 4XPTL 3R0MA 3BHBA 4LHUG 5EBMA 2ZCKL 1WFTA 5F71A 1EO8H 1OGAD 5HGHA 1C7TA 4HT1H 3MREA 1WWBX 5DWUH 1KTLA 4XP1L 2IAMA 2ZUXA 5C71A 4HUWB 4AT6A 3OXRA 3W9DB 1U91B 2FSEB 2FH6A 4ZS7L 3TZVA 3QXAA 3TVMA 3KPTA 1JI2A 1TNMA 1K4CB 1V3KA 2BVUA 5T33H 2AEPH 5KSUB 3QDGA 1MRDL 1R3IH 5HI3C 5C2UB 2DYPB 4NQXB 2Y1VA 4XPFL 3T0EA 5DGQA 4QRPA 2OL3B 5D9SA 1HHIB 5IM7A 1AGFB 1Q9KA 2KKQA 5L7XH 4NZUH 3U7WL 3WL9A 1T1YA 2CUMA 4IMKC 3OHXB 3FKUS 2HKHH 3WJLC 1EXUA 4ZOCA 3QDAA 4UBDD 3O4LD 3A67L 4O2FA 1QHPA 3P4NA 5SWZE 1XIWB 43CAB 1TJIH 2EEBA 4KKBD 2W9DL 3LQAC 3OX8B 4BFEA 5FM8A 4D3CH 5DGRA 3QI9C 4ONOA 4AIXA 2WUBH 3LD8C 3CX2A 2CLVB 4W6YB 3RZWA 3WMSA 1DN0A 1OGTB 4K7PY 3K4ZA 4JZJA 5IEKB 3OKMA 1OAYH 3IDUA 4M9PA 3P30L 5DRZB 3INUL 3RWEB 5LQBL 1XGPB 2P48B 3FO1A 2ATKA 2FB4L 4UDTA 3VXSB 3AS2A 2AKRA 3OKYA 1GGBH 3WNLA 3ARVA 1MFBH 4HK3N 2D7NA 4ONHA 4ENED 4UV4L 1FORH 8FABA 4BUGA 3BH8A 2XZCL 4M9OA 2PYEE 1RZ8A 4S2SB 3CFBB 1E4WH 5DD5H 1SEQL 1I3RA 5D2LE 1T7YA 5KOVC 3ARDD 4NKDA 5FHBH 3EAKA 3VH8G 5AWNL 3F58L 3RL1A 2DLFH 2O5ZL 2V17L 1M6OA 4CMHB 4P3DB 5JHDD 3BAEL 4WU7B 4KDTA 4PJEF 1UADC 5IT2H 3WIHL 2YWYA 2I9LB 4QOKE 1QBAA 3K4DA 5IJKA 2HA1A 3M8OL 1YC7A 1DLFL 2OZ4H 1I7ZA 2NY6C 4JO2L 5GRJH 4JHBA 4L8CB 1MHPH 1IRAY 1CR9L 3DHMA 3FB5A 4AK1A 3LRGA 5GS2D 3FT3A 1D6VH 5HYSA 4HK3J 3K81A 1KJVB 4GW1B 4UT9L 1P1ZB 4HUUA 3VXOA 5T1LD 2XG5A 3CSPA 1IL1B 5I15H 1IEBB 1U36A 4P4KD 4POZD 3RZCB 4PY8J 5T3ZD 4G7VL 3V6ZB 2KZ1B 4WI3A 4M43L 5F1NA 4EI5D 2NXZB 2PW2B 5BZWB 3LEVL 2WINA 2DMBA 4FZEL 43C9B 2ZJSH 3SDXE 3IVKB 2YC1B 5IR1A 4L5FL 4FQXD 5TDOB 4Z95L 4OZIE 4JQVA 3FRUB 5BV7L 3ULUD 4HHAB 1WBXB 4MMZC 8CGTA 5JPMA 1KGCD 1P4BL 2QADD 4PJ9A 3EIFA 1ZGLB 1HYSD 4ZTOH 4ZAKB 5HI5D 1HE7A 1ZVSB 5KW9H 1YYMH 1VFAB 1IGJB 4PD4J 3O6LH 3LZFL 4CRPA 4CVZA 4Z7QE 1FLRL 4XP5L 3V8OA 1AY1H 2B1AH 5FYJH 5I75B 1KTRL 3IFLH 2ADFH 4CBPA 1YECH 1BQLH 2VZSA 1XIWC 5DEFA 2HG5B 4M5ZL 2WMPA 3K0WA 3NAAH 1AXSA 4NZRL 5C09E 3EO1B 4PJAA 4KKLD 4H1LH 2WBJA 4R90L 2W38A 1NUGA 4JEGB 5TH2B 4G42A 5HVGB 4XMLL 2P5WB 2WIIA 1JWSA 3RWCB 3WFCH 5BXFB 4J4PC 4OLZL 4QRUA 4KRMB 1QEWB 3K74B 3HNTH 3NIGE 4RMUA 3CDGA 1TLKA 1T1ZA 1T1WA 5MEQA 3D2UB 4NC1E 3AREB 4M8QA 3EOTL 5E08L 1NLBL 3GI8L 1FG2B 5GSVB 4KJPD 1G7QA 1CL7L 3GO1L 3O6FA 1KNOA 3WS6C 4NT6A 2F54D 4P2OB 4KZEL 4DJMA 1NGPH 3F5WB 3RGHA 2X6MA 3WV0A 1LP9A 4BFIA 4CMHC 1X5LA 4DVRH 4JPVL 2DBJA 1OP9A 3ECBA 4JG1H 5MP6H 3TGXA 1B6DA 2XT1B 3QEHA 3KPLA 5MEOA 5TDNB 4MDIA 4X5LA 1A6UH 1NCBH 4MJ2A 4IOFD 1ZEAL 3OKKA 4NO2A 3PGDA 3GMOB 5E6ZA 3BZDA 4FQJL 3L95A 5C7XH 4TSBH 4XP4H 1G6VK 3I6GA 4LK4A 1BFOA 4PRID 3T2NL 4PTTA 3PHSA 1CWVA 2IPTL 1VA9A 4NQTA 4Z7WE 2ZCHH 2DQJH 4Y1AE 1JPGB 2ZSVA 3X12A 2VLKA 3WDJA 1SMOA 5BCAA 1IGCH 3WCYA 3RZCC 1WAAF 1FFPA 1TENA 3S35L 1T5XA 2F9BT 4KVNH 2G5BB 3S36H 4JFOA 1LWRA 2XWJB 5JHDA 5EFIA 1HKLH 1CXLA 4N8CL 1RK1B 5E2VL 4XRCA 5CGYC 1KC5H 2A9ML 2NY3B 1LO3L 3EGSB 2NXZC 3PQYA 4PP1C 5KVDL 3GJFA 2FATH 3QIUD 4IRSB 3RWGB 3BSZL 4IRJB 5D7SL 2CLRB 1Z3GH 5IB3B 1XAUA 1MLCB 5KSBE 3IXTA 2OMNA 3UJJL 1U8KB 2V7HA 4NFBA 4L4VD 1JTTA 5T1LA 4OQTH 2C5DC 3SE3C 3REWA 2OR9L 4MB4A 3G5VB 4ZAKC 2CKBB 2WQRA 1RHFA 4P4KA 4MJIB 4QHUA 4WUUE 4L4TE 5I75C 1C1EL 2W0KA 3EFDL 3LN4A 4XAKE 4OJFL 4EI5A 1RMFH 1QBBA 4P2RB 5DSCA 4I9WE 5K59F 1B2WH 1F45A 2P24A 4JZOB 1YEJL 5C0IB 1D5MA 5IK3B 2O5XL 3N85H 1UM6L 1ZE3C 1JTOA 5TDPB 1JWUA 3LQZA 1NCWH 3QUMB 2FDBP 3ARBD 2DRUA 2EDHA 4ZNEE 5JNYA 5HGAA 2BY0A 4BK4A 1MCSA 3VXQA 1HI6A 1S5IH 4JJHA 5D5ME 3AREC 1MJJB 4Z5RB 4PJ5A 1DQJA 3S34L 3CVHA 3PHQB 5I1IH 1BBDL 5FA4A 4P5MA 4UDUA 1AFVH 1U58A 4L9DA 2GJ6D 3DUUB 1AO7A 1Q9OB 3V9FA 4P2OC 2PR4L 3IETA 2J8UA 2PF6A 4Y16D 3SDXF 4PGEA 4OZIF 2ZUVA 4FFYL 1FFNA 1VFUA 4JFEE 2EXYD 3U82B 3I3DA 2XTLA 3MLWH 4YDJB 3MOAH 3UJTL 1MJUL 4M6NH 1HEZA 4EXPX 1AR1C 2DL2A 5DVKA 4A6YA 2VQUA 5D6CB 1CI5A 1LNUB 4MXVF 1BQHB 5AUMA 2YKLH 5E2UL 2GW5A 4Z7QF 3HFMH 1QBMH 3X13B 4NJ9H 2AI0L 1I9JL 1F02I 1N0LA 1KJMA 1OSZA 1I85C 4NSKA 4ORZC 3GJFK 1B4JL 3WSQL 3NA9H 3SDYH 2V2TB 5FYKH 4OIAA 3KLHD 1ZS8A 2UVEA 2VNCA 3H3PH 5EBGA 3GMMA 4H0GA 2YZ1A 5I1CH 5JPNB 5CP7B 1HYRC 1KB9K 1N4XH 1NH6A 5ECJE 2NLJA 4BQBA 2VISA 3ULVD 3ZTNH 4L8SA 4LSVL 3O2DL 1P7QB 4O51A 1CDYA 4IRSC 4UB0H 4XCYB 1M05A 5FM4A 4IRJC 3HNVH 2ZSWB 1CICD 5ANMA 2CDFA 2GYSA 4PRIA 1QG3A 4HQQH 4LSUL 4AIZA 4LPTA 1LK2B 2GTWB 3QPXL 3VU2A 2X05A 5ALBH 3QXTA 3UTTE 4Y19E 2DD8L 3WN5A 5C0DB 3U6RA 4OGAD 1JYVA 1J05B 2ZUWA 3W0WB 4WFFD 1A14L 4DFHA 2APXA 1FNGB 4GG6A 2VSDA 4W4NA 1OARL 1GPOH 1D5ZA 4G9FD 1KCSL 4Q9QH 3SDDD 3QIUA 2RB8A 1J1PH 1YPZE 5L2KD 2J1KA 1S8DB 5IVZA 5D7LD 3V4VL 4UIKL 5H94B 4RQQB 4K9EC 1QBLH 4U7SA 3SKNA 4JFFE 5LGKA 4X6FB 5EUKB 4L4VA 5J6HB 4MZ2A 1A8JH 2GTZB 4Z7WF 4TRPH 3REVB 1QFOA 3H3BC 2R0WH 1UZ8A 2YSSB 1SYVB 2B0SH 1PD6A 1TZGL 2C1OB 3X11A 1MHHB 5AD0B 4PUBL 1NBZA 3SKJH 3FHQA 3HG1B 4JFHE 1BLNA 5DRXB 5F9DC 4LHQB 1T7VA 1MFDH 1RUPH 4I0PD 1QYGH 3PWLA 1K4DB 1YNTB 2YEZA 4XWGL 3PWPB 4Z7UA 3TO2B 1BD2B 2HFFB 4WO4D 1AP2A 3DURB 1MFAL 2D31B 2OCFD 3QQNA 3QCTH 3TBSA 5C0GB 1U8IB 2ATPA 5KSBF 5C6WH 2GSGA 1WICA 5GZND 1XF3B 3KR3H 3ABZA 1RK0B 3QULB 2O26U 3LKNB 1TTFA 4MNQD 3F7PC 2EC9T 4I2XE 4PREB 1EEQA 1C5DA 2OTPA 1EDQA 4OIIL 4TSCH 5JO5B 3EHBC 1VFBB 2C7UA 2GJ6A 4MA7H 2B4CH 5C0CE 3V6FA 5MHSD 1F2XK 4CMMB 2BSSA 1JZ6A 3CUPA 5DI8A 1GOFA 1X6NA 3U0TA 4LSSL 1QP1A 4G8FB 3CPLB 3QEQD 4RISL 1P9MA 3S4SA 3PL6B 3N0PB 3IXAB 5EC1A 3PV6A 1AD0B 4MHHG 5ENWA 4EUPB 3L3KB 1EGJH 3C2AH 1OAKL 1R0AL 1KG0A 1HQRB 3TCLB 3B9KD 3TPUA 5D5MF 4PS4H 1QRNB 4MD0B 4MCYB 5GS0C 4NNXA 5I17A 4P5KA 1MWAA 1DZBA 4GXUN 4MNHB 1NBYA 4JM2F 4N90D 3RVXD 1XT5A 1QOKA 3VMOA 5GS3A 1RIVH 1UCTA 4AMKL 1N6VA 3QHFH 1TVHA 5DUPH 3BFOA 1CD9B 2VDML 5D2LA 5FO7B 4BSWA 4Y1AD 1P84K 5A3IC 4XT1C 5C2BL 3LV3A 2CIKA 4X6EA 2AEIT 4PJBE 2ERJB 4TSAH 3E8UL 3NCMA 4LKXB 3GSXB 5CZKA 1OM3L 2AV1A 1YQVH 1UCBH 4P9HL 3TYFB 4POYA 1ZT1A 3CC5B 3DX7B 3MA9L 1I1AD 2DQCL 3DPBA 4QOKA 3W82A 1AI1L 5E6YA 2OJEB 4LCCA 5DJZB 5GGVY 5EU6D 3CXHK 3O6MH 4PJXB 5J56B 5DURB 1IFHH 1G7MB 3UTSB 1SY6A 1KJ2B 3AXLA 3T1FB 2H3NB 1YY8A 1I1YA 1TJGL 1GYAA 4EN3A 3PWUA 2YPKB 2Z91B 3WNNA 3RWJA 4DTGH 4CADA 4LCIH 2VR4A 2I26N 1F13A 1ZT7B 1G84A 1EZVX 3SDDA 3IFOA 3TA3B 1ED3B 4NCC1 3UC0L 1CGVA 1AQDA 4U1LB 1E28A 5FOBA 5HD8D 5CEZD 4HKJA 4XAKD 5CLWA 1RY7B 5E8PB 4K3DL 3SPVB 2NY1C 1KSRA 2YXMA 3MV7E 2H2SD 3U0PA 4WEMB 2NY2D 5DK0A 1J5OH 1YEFL 3TFKD 3MMEA 3PDGA 3OKDA 1P4IL 1EHAA 2AJ3B 3BKCL 4W4OA 3VFRB 1JHTA 3BHBB 1F4HA 5EBMB 3UEZA 2J4WL 3WXVL 5HGHB 3MREB 3B2UD 4H8WH 2IAMB 4I0PA 1T7WA 4A2LA 4BZ2L 4AT6B 5FAAA 2H41A 3PL6C 4YXKL 4HS8L 3VI3E 4K23H 2E7LC 2W0FA 4U6VH 3RFZC 4DAGH 3TZVB 3QXAB 1D5IL 3TVMB 3U4EA 3HE6C 5IHUH 4BFGA 1MFNA 2AV7B 3RJQB 1U8JA 2X4OA 3ZYOA 5TE7L 2ZG2A 1TTGA 3QDGB 4MNQA 4YAQA 4LPWA 4ODHL 4EVNA 3T0EB 4QRPB 1YNKH 5D9SB 1EBAA 3DHJA 2QSCL 5IM7B 1Q9KB 3WL9B 5JR1H 2AJZA 1T1YB 1RZKC 4JN2A 3BDXA 2ZWLT 4G6FD 4LCWD 1EXUB 4UOJA 4HFUH 4WY7L 3U0WL 4O2FB 4XPTH 4OT1L 2ZCKH 3QEQA 1CD1B 4U1IA 5KG9A 5FF6A 4HPYL 4PJDE 3BN9C 4XP1H 4L9LA 4ZYKB 3QZWA 1KEML 3OSKA 4MAUL 3FRPA 1DN0B 2NY5L 4YHIA 4AL8L 5CS7A 4OFKA 4JZJB 2ERJC 2EDWA 3B9KA 4ZS7H 1TETL 2X7LA 3FO1B 3HC3L 4E0RA 2ATKB 4EOWL 4UDTB 2H2PC 1DBBL 5EU5A 4HV8B 1FV1A 3DETC 2AKRB 2A1WL 1MRDH 4S10A 1A3QA 4XPFH 4ONHB 3D39D 3VRLE 2YA2A 4BK5A 8FABB 3ELAT 3BH8B 4CU6A 1IM9D 1FLTX 3U7WH 1RZGA 1RZ8B 3IRZA 5F9JA 5E03A 4JKLA 4MA8L 2HTLC 2ESVD 4K07A 4Y1AA 3RGVD 1NDGB 1F97A 5I1DA 2EH8L 3A67H 5FGBA 1S7UA 4CVWA 4NKDB 2IG2H 3P0GB 4G7YL 3FT2A 3RL1B 3ARYA 1OTSC 2Y07L 4WJ5A 4HIXL 1M6OB 4MA1C 3G5ZA 1OWWA 3MOBL 1I1AA 5HHME 4HCRA 2OMBA 5EU6A 2J3SA 3UX9B 2Z4QA 5H2BB 4IJ3B 3P30H 3INUH 5LQBH 3FB5B 4YH6A 3BQUA 2FB4H 3FT3B 5HYSB 1AKJD 4M3KB 1MVUA 2XV6B 1UKSA 4JFFD 4E42B 4HUUB 2GAZA 4JCMA 3VXOB 3BPCB 4J1UA 3PJSA 5DRNA 1TQCB 2IBZX 2XZCH 4WUUA 2QR0A 3KDMA 1FYTD 4PJBF 2IAMC 9CGTA 5T5NF 1SEQH 4L4TA 4FFZL 3T0BA 3OZ9L 5JW3L 2BOBA 2HN7A 3ARTA 5KSAA 5F1NB 3RHWK 1EEUA 5AWNH 3ZE0F 3F58H 3TZVC 2O5ZH 2V17H 1PX3A 3TVMC 5C0NC 1A0QL 5T3XH 3P0YL 1RZJC 1DCLA 2DLGA 3BAEH 4OF3A 5HHXL 4DZ8A 5IR1B 1A21A 3WIHH 3STLA 1ZANL 4LGRB 3BUTA 1ZHLA 3M8OH 5E6ID 1DLFH 1AE6L 2HVKB 2WWMC 1NCCL 4MJ5B 4JO2H 3T0EC 5JPMB 5JQ6L 4PJ9B 1C16A 5HHPB 4K8RD 1SJXA 2FJGA 3VGGA 4ODXB 2X10A 2D2OA 4CVZB 4UT9H 3SJVE 2YMXL 4LHUD 4NBYB 3JWDL 4JPIA 5DEFB 3QDJE 5E9DE 2BNQD 4WI2A 4XTRC 3S96A 1AXSB 4PJAB 1NCDL 4P46A 4G7VH 5BQ7A 4JZJC 5ESAA 2X40A 3QXVA 3UYOD 2AXGA 4G42B 2DTSA 4M43H 4JFEA 1JWSB 4PRHE 3P9MA 3LEVH 4FZEH 3S3PA 1A6TA 4QRUB 4L5FH 4Z95H 4Q74A 4KK8C 4WTZA 5D1XA 2EDEA 2J2ZA 1T1ZB 1T1WB 3VFTB 5BV7H 3VGHA 4LCWA 4M8QB 1P4BH 1JPSL 3FB6A 4IRZL 1G7LA 1U8PB 1DJSA 4QHNA 5JORA 1G7QB 1KN4L 1KNOB 3VI3F 2AQ1A 3LZFH 4NT6B 4XP5H 4QXGL 1AGCA 5TJWK 1KV3A 1ZLUH 3JTSA 3SEPA 3BGAA 3UJIH 1LP9B 1ZGLP 4RMWA 4M5ZH 4KDTC 3ECBB 4NZRH 3G6JE 4LBEB 1KYOJ 5E2WL 2DM7A 3QEHB 5MEOB 5IJKC 4R90H 4MDIB 1H8OA 4OLEA 3X14B 3OXSA 2UUDK 1MI5D 4NO2B 4XMLH 3PGDB 5CZXC 1OD9A 5D70L 3D39A 3L95B 5DYOA 5FO9A 3WHXA 4DN4L 4OLZH 3I6GB 4Z76A 2Z8RA 1BFOB 4PTTB 3BP6A 4NGHL 1NDMA 5JW5A 5SV4A 2K7PA 2ESVA 5FHAH 1IC7L 3RGVA 2ZSVB 3D85D 3EOTH 2VLKB 5E08H 3MCKA 3ARDB 1NLBH 3GI8H 1TQCC 5EIIA 1JZ7A 3GO1H 3W2DL 4F8TA 1WT5A 5EFIB 5JHDB 2H26B 4XRCB 4OCSL 4KZEH 4M1CD 2F5BL 1D5XA 3GJFB 2HJKB 2DQEL 2BC4A 1I1FB 4NKIL 4MJ6A 1RZIB 4DUXA 1YPZA 4JPVH 1WZMA 4JQVC 1W0VA 3KPSE 3WLWC 3WDHA 7FABL 4WI6A 3EKCA 1CXEA 2EH7L 3IXTB 4HWZA 2V7HB 4JFFA 1ZEAH 6FABL 4M7LL 1N2RB 4PJ9C 5T1LB 4UT7L 2OSLA 3REWB 4FQJH 4U0QB 2DL9A 1F3JA 4P4KB 2D4DA 4LRNL 4OLXL 4QHUB 4TVPD 4LHJB 3VD5A 5HDOA 1FYTA 2W92A 2IPTH 4OV6F 1FCGA 4PRPD 3BUYA 2WP3O 3VD3A 3ALPA 3LN4B 3NBNA 4EI5B 3VGFA 5DSCB 2Z0BA 2Q20A 5IMOA 3S35H 2D0HA 4WWKD 1EBPA 2NY7L 4OF6A 1D5MB 3P9LA 2WBJC 4FQXB 1OQOA 4N8CH 1JWUB 3LQZB 5E2VH 1ERNA 3GSNA 3RVVD 2A9MH 1LO3H 3AU1A 5E6IA 3SO5A 5KVDH 2QADB 5JNYB 2FCBA 5HGAB 3BSZH 3H42L 5DD3L 5D7SH 2ZKHL 3VXQB 5E5RB 1ETZA 5CJQL 1ZAGA 1DQDL 1AXTL 3DUHA 4XP9L 4Q9CA 3UJJH 4UBDC 1DQJB 4HWUA 3CVHB 3G9VA 4LHUA 4I2XA 4P5MB 4UDUB 4XAWL 4LVNB 3AS1A 2OR9H 1U58B 3O6FC 4IHOA 4KKBC 1TCMA 3JV6A 2BNQA 3C9NA 5JA9A 3PABA 1AO7B 5AYUL 4WW2F 1FL6A 3IETB 2J8UB 1C1EH 4PGEB 3EFDH 4OJFH 3HS0A 4YUEL 1QSFE 4F7EA 3RDTD 4IBLT 1YEJH 5DUBA 1HEZB 1OP5K 2O5XH 4Q0XL 1UM6H 2ENYA 4A6YB 1BEYH 1KB5L 3MJ9L 1P2CA 4PGJA 1W2KT 5AUMB 4L8BA 1QUNA 1RQ5A 4HD9A 1T80A 3MJ6A 2DI9A 3MCLL 2ICWI 1XGTA 5GJTL 2EYSA 4U6XA 1PQZA 1A2YA 1KJMB 5A43C 1OSZB 3P11L 4NSKB 1HILA 4NQEE 4DFIA 2F54B 2JJTA 1EAPA 4JGMA 3S34H 2UZIL 1BBDH 3RIAF 2CRMA 1ZS8B 3I9GL 2W59A 3GMMB 2IH3A 4IDJL 3O3DA 5FYKE 4QRRD 4N8VG 5J9PA 2NLJB 2VRAA 4OIBA 2PR4H 2XXCB 1EFXA 3F12A 3NIFE 1MI5A 2JCCE 2E7CA 4FFYH 1LO5A 4O51B 5HHOE 4ZODA 1M05B 3WE6B 1MJUH 1CGYA 5ANMB 2CDFB 4PRIB 4AIZB 1S7SA 4P23D 3PWNA 5A2IH 1XH3B 3E3QE 2RAMA 1MUJA 3PNWA 1DLHA 3WN5B 3U6RB 4P4KC 3BN3B 2AI0H 1I9JH 4POZC 4JGJA 2DJUA 1P69B 1EUTA 2VJXA 1Y0LA 1ES0A 4NC0B 2P49B 1JZ5A 4KUZL 4GG6B 1Z2KA 3G6JF 3VH8A 4EI5C 1J8HE 4HMEA 1A1NA 2AJSH 3QIUB 4QWWD 3IGAA 4FQXC 5I30L 4NQCD 2ZNXA 5IVZB 1VKXA 3VXUD 4FQQB 5F44A 3RIFK 5J1TC 3SKNB 4LSVH 3O2DH 4L4VB 2R2BA 2QADC 1NFKA 4M48L 3ARWA 1HYSC 1EA9C 1G6RA 5A16B 3OKEA 5CINL 1U95A 4X7TA 2ZOKA 3ROOA 4LSUH 1LD9A 2JJSA 4V1DE 3NGBB 3QPXH 3SKMA 3MGTA 4ALAL 4LVNC 4GRWB 3X11B 4DVBA 2DD8H 1RHHA 1NBZB 1CFVL 2XKNA 3NIDE 5HDBF 3ZDYE 4B53A 4J3SA 3ZYJA 4WWKA 5CIPA 3GB7A 4XC3L 4I0KA 3NCFB 3PXJA 4KKLC 1A14H 4LDEB 4NM4L 3I3EA 4Z7UB 3FQRA 3PWLB 3JWNC 2YEZB 3QYCA 1AP2B 1OARH 1NJ9A 3TBSB 1B6UA 1KCSH 2ATPB 5FYJD 1XGUA 2GSGB 3GRWL 3X17A 3V4VH 5E8OA 4UIKH 2HWZL 4RMVA 5C9KA 2COQA 3K1DA 3DV6A 2VXSL 4KROD 2X9XA 4NRXA 4KJPC 4TUKL 1C5DB 4GAJL 1GC1C 2C7UB 2GJ6B 2A83A 4P2CG 5DT1L 2VDOL 4OD2A 2BSSB 3V5KA 2JJVA 3CUPB 3NVQA 4AEEA 5DI8B 3GNMH 1TZGH 3U0TB 3HLAA 3Q48A 5BRZD 3MV8D 5HYIA 2FIRT 4PUBH 3SDAD 4YHNA 4YIQA 1JVKA 4HKBA 4PJDA 3RDTA 3DUSA 3K8LA 2PTVA 4U1MB 5ENWB 4XWGH 3MJGX 5F72S 4JO1L 4L8SC 1EVUA 2CRYA 4IOFC 4LPYA 1MFAH 2A73A 2RGSA 1KTKE 1KG0B 4S0SD 3QEUA 4ZS6D 4HZLA 5FGSA 3BKJL 3RVWD 3E6HA 2FGZA 1K8IA 3ZE1E 3DXAD 4CNIA 3VFWA 3GDBA 4NNXB 5I17B 1MWAB 3WN5C 5DHVH 1RIHL 1NBYB 3QJHA 1J1OL 4WTWA 4UV7L 3FFCD 4OIIH 1T0MB 4P2YA 3KLAA 4PJGF 2BVEA 5D2LB 2Z8SA 4WDIA 4BSWB 2UY7A 2VC2L 4LLAA 3BP5A 4LSSH 3LV3B 2CIKB 4X6EB 3RNKA 4HUNB 4L3CA 4RISH 3QIUC 4MJ4A 1CL7I 2HMIC 2AGJL 3K80A 4ZFOA 2Q76A 3UTZA 2M2DA 2VAAA 1ZT1B 4Y5XA 4KJQD 1CICB 4OD1L 3LKPA 4U6YA 4NKOA 4QOKB 2VDQL 4R97B 3UO1L 1OAKH 1PAMA 1R0AH 1XGQA 2C3VA 4LCCB 3RUGE 4CN1A 3O0RL 2YD5A 2DDQL 1S5HA 3BD4A 2OZ4A 3AXLB 1I1YB 4ODSL 2R9HC 3NGBC 4EN3B 1R3LA 4D8PA 4MMXC 4Z77B 1K2DA 3HA0A 2J12B 5SX5K 4KGJA 4ETQA 4G9FB 4FQCH 5EOCL 1E4XI 1IMHC 3SDDB 3IFOB 3NIFF 5L2KB 2JCCF 1Q0XL 5DVLA 1AQDB 1D9KA 1P4LA 3EYUL 5I1JH 2VDMH 3IRPX 1UXWA 3MNZA 5JW4Q 1E28B 5ACZB 4OI7A 5C2BH 4G8GE 4Q9RL 3E8UH 2ARJQ 4H26A 1OM3H 3U0PB 4P9HH 4AG4L 1KIUA 3LKRA 3MA9H 5DK0B 2DQCH 2EIDA 4MLSA 2A74A 1AI1H 4K71B 3MMEB 4XNQB 3OKDB 4BKLB 5HSFA 4TNVF 4R7NA 5HTSA 3ARFA 1GJIA 1U42A 2Z35A 2P46B 1MQ8A 2R1WA 3GHBL 4JHAL 4MB5A 3FQUA 4CJ0A 3RQ3A 1TJGH 4F37K 2XTJD 4I0PB 4PLOB 4CDHA 4CUCA 4XX1E 1HQ4A 3RU8L 3MR9A 5K9OA 2XA8L 1P9MC 2W65A 3EUUA 5DZOA 2AJXL 1MCHA 2EEAA 2W0FB 3IAQA 5EDXA 3V0VA 3TF7C 1CF8L 5DO2D 3U4EB 3T0AA 3UC0H 5E95B 3VWKD 4CJ1A 1NMBH 5IFJA 3U46A 1HHGA 1U8JB 2X4OB 2RBLA 5IEHA 4MNQB 1Y6MR 2R0KL 4YAQB 3RPIA 4K3DH 4PRHA 3F8UB 4H1LA 4NQDE 4EVNB 1U2CA 4OZGE 2WBKA 4DN3L 1YEFH 2AJZB 5DEZA 3NIDF 4JN2B 5CEXA 2GITA 2JB6A 2FX8L 1P4IH 4J23A 4YLQT 3KLHC 5BRZA 4OCLC 1MIML 4DZBA 4D9QD 3BKCH 3FCTA 4Z7OE 5IF0A 4F58L 3QEQB 3DROA 2J4WH 4U1IB 3SDAA 5KG9B 3WXVH 3ZKQD 1MOEA 5FF6B 4MD5A 5C0EB 3QH3B 3VFMA 4L9LB 3QZWB 4F7TA 3B9DA 3K4AA 4BZ2H 5HGGS 4YHIB 3BI9X 5DXWA 2W0PA 4KAQL 5C07E 1QLRA 4YXKH 4HS8H 3PP3H 3ZKMD 4H5SA 4N0UE 3SQOL 2ARWA 3B9KB 4LL9A 1D5IH 4CKVX 2X7LB 3G6JA 3EJYD 4R97C 3UDWA 5L8KB 1F00I 2EIZA 5EU5B 3DXAA 1FV1B 2MWCA 5HHNA 2HJLA 4LCCC 5B3JE 4I13B 4ODHH 1NC2D 1TXKA 4OGAC 1KIQB 2YRLA 3LRHA 1C8PA 4LLWA 3FFCA 4OFDA 2QSCH 2VO5A 5JIHA 4LCUA 1RZGB 4EN3C 4HBQA 5F9JB 1OW0A 1K3ZA 4Y1AB 5I1DB 1S78D 4GG8A 4RFOL 4WY7H 1S7UB 3BEVB 3FT2B 4OT1H 4B41A 3SDDC 5BO1L 4JANA 4WJ5B 1A3RH 1OD7A 2CUHA 1II4E 3LN9A 2OXHA 2XACC 4LQFL 1KEMH 2FBJL 1I1AB 4MAUH 4C58B 4CW1A 3STZA 2NY5H 4AL8H 4X6DA 2X4SA 4PLJD 3ZE1F 5EU6B 2D03L 1P5UA 2Z4QB 3IJHB 3UXFA 3PWVB 1TETH 1NANI 3KPSA 4AY0A 3BQUB 3HC3H 4EOWH 4UOW0 2J5LB 1DBBH 4K71C 1MVUB 4ELME 1HXYA 3RHWF 3PHOB 2A1WH 2GAZB 5GJSL 1KXTB 4W4OC 1MRFL 5SX4H 4J1UB 2R56L 3DOSA 3PJSB 5DRNB 1IAIL 2OYPA 4S1SL 4WUUB 2WIMA 2QR0B 5B3NA 3KDMB 4I0PC 4OQTA 1UT9A 1SEBB 4MA8H 4V1DD 1P7HL 4L4TB 3O2VL 3MOQA 3IDGA 2BOBB 3BWUC 3CLFL 3V6OE 2HN7B 1WITA 2EH8H 5KSAB 1PKQB 3OBAA 4G7YH 4WFED 2Y07H 4LSRL 4HIXH 5GZNC 3R4DA 3RUGF 4DZ8B 2XN9D 2NY2B 4BZYA 2W1NA 3STLB 3MOBH 2CGRL 1GHFL 2EDQA 3VMPA 3VGEA 4DQOH 4XI5D 1T2XA 1SHMA 3H9SE 3KYOA 5T3XE 1YMHA 1MAML 2NTSP 3TESA 5DK3A 1KPUA 3M17A 1C16B 2FJGB 1WZKA 3HZYA 4KV5E 1EVTC 4PBXA 1QLFA 2AXFB 4W70A 2BHUA 4OD3L 2QHLA 1CDUA 4JPIB 2IMNA 4JN1L 3RRQA 5C6TL 3EDDA 3Q5OA 4PJ7A 3S96B 4LPXA 4L9LC 5EBWA 3VWKA 3MRKA 4FFZH 3OZ9H 5BQ7B 5JW3H 5ESAB 1S7WA 3IDXL 2AXGB 2GK0A 1ZSDA 4CN6A 3SQBA 3B9KC 4APQD 4RDQF 3P9MB 5FUCE 4UU9A 1DBAL 2FHFA 1A0QH 3IFPA 1A6TB 2WWKT 3P0YH 5HHXH 4K7PX 4OF5A 1MY7A 1ZANH 2IADA 3MRQA 1FL3A 3E2HB 1AE6H 4G6FB 4LCWB 1NCCH 1EV2E 3OTTA 1N5AA 5JQ6H 3FB6B 2C4FT 4JDVB 4QHNB 5JORB 4XNUL 5INDA 4GKZA 1SVCP 4KZDL 2HRLA 4K94C 1FNSL 4NQEA 1B90A 4PJFA 4WHDA 1AGCB 3BD3A 2GT9B 2YMXH 3L3HA 2XZZA 2CO6B 5FGBC 2O61A 2ORBL 3JWDH 1DANT 1ADQA 4F7MB 3I6LD 5DEGA 4JGUA 4NM8L 1I1AC 1NCDH 5D71L 4OZGF 5CZVL 3IS0X 3F65A 2NYYD 5HHOA 2V9TA 3BZ4A 4BZ1H 3OAZH 3VFOA 3OKOA 2YN5A 3D39B 4WCYL 3JWOL 5DYOB 3BQUC 5FO9B 3WHXB 4PIRF 2J5LC 5JZ7D 4Z7OF 3E6FA 1IM9B 4BFBD 2UWEA 3BP6B 4R4NC 5DD6A 1NDMB 5JW5B 4MAYA 4PV8A 2ESVB 4P9MH 1PDKA 3RGVB 1LE5A 1JPSH 1FFOA 4R2GD 1Y18A 1KB9J 5EIIB 5ESVB 4IRZH 3QUKA 5FO8A 1JF1B 2A0LC 3WO4B 3FT4A 3D0LA 3SGDI 1KN4H 3AMKA 5DC9B 4AQOA 4K2UL 2R0LL 2VL5A 4QXGH 5HD8C 5KSAC 2V5SA 4RAUA 1D5XB 1DSFL 4M1GL 2H2SC 4M7LT 1YPZB 2NY2C 5B3JF 1S7XA 5E2WH 4NQVA 2VZ1A 3TFKC 3W9EA 3CU1A 1AKJB 1U8LA 2J88L 2MHAB 3ME0A 4MXQD 4RMQA 4JFFB 1IC4L 4UZGA 1G9ML 2OSLB 1NAML 1VGEL 3PGFL 2HJFA 1NPUA 3OPZL 5D70H 2FLRT 1F3JB 4P59L 4DN4H 1FYTB 4J3VA 4NGHH 3FHAA 1BVKB 4ODVL 4V1DA 3BUYB 1IC7H 4EBQL 5E24E 3RA7L 3I50L 1P6FA 5IMOB 5SWSD 4LKCA 3MYJA 3W2DH 1IZJA 4P46C 3P9LB 5C0JB 1H3VA 2XN9A 3GSNB 1XR9A 4X98A 1ITCA 4OCSH 2F5BH 3AU1B 4XNYL 5E6IB 2DQEH 4NKIH 4N9GA 1FVDB 4PJHE 4BQ8A 1ETZB 7FABH 4Z7VA 3E2HC 3FO0L 3KPRE 4L3EE 3U1SL 2EH7H 3R06A 1F4XL 3JBG7 4M7LH 6FABH 4LHUB 3C5SA 4I2XB 4NNYA 4UT7H 3O8XD 4RMTA 1CFTB 3WBDA 5D7JD 1EX0A 5I73B 4LRNH 4OLXH 2A77L 2BNQB 2PKDA 3JV6B 2FO4A 3PABB 1FL6B 1V05A 1EJOL 4PB9L 3DMMD 4PV9A 5A2KH 1U3YA 1N5YL 3HS0B 3P0VL 4APQA 3C5JA 4F7EB 2NY7H 5FOJA 2P5ED 1JYXA 4N5UA 1WISA 4JR9L 1OP3K 1H3UA 1P2CB 2Q1EA 1JNNH 3QI9D 4L8BB 3UZEA 1QSEE 4WHCA 4PRBA 4ZOEA 5KJRL 1XGTB 1EGJA 2EYSB 4U6XB 1PQZB 3H42H 5DD3H 1A2YB 1H9VA 2ZKHH 1Q94A 3EOAA 5CJQH 1CXFA 1DQDH 1HILB 4FTVE 1AXTH 4YFLI 4XP9H 4FZ8L 3RGVC 3SOBL 4TVSa 3U30B 4XAWH 3CH1A 2CD0A 2IH3B 1WFOA 1ZHKA 4LLQA 1WT5C 2I27N 5J9PB 1ZA3A 5AYUH 1BIIA 5DFVD 1V7NL 3V95A 4H20L 1H3PL 2OX5A 3OB8A 4MGXA 2LAAA 1MI5B 4YHOL 1LO5B 1UG9A 2BJML 4YUEH 4LDOB 4XPGL 2VE6A 3IDJA 3QPQD 3EDKA 1FNHA 4JRXE 4Q0XH 2R8SH 2QJDA 4ZMAT 3HTLX 1KB5H 1S7SB 3PWNB 3MJ9H 3NFPA 4GAYA 3WKML 5E56A 3C8DA 5C0AE 4ZXBA 1MUJB 3RUGA 3PNWB 1MVFA 1A6ZA 2G2RA 3D85B 3MCLH 3WUWG 5GJTH 2N4IA 5M7QA 3VD4A 4JY4A 1CLYL 4O9HL 3P11H 1NFDE 4P3WA 1P84J 3T77A 1Y0LB 1ES0B 4HF5H 2V7NA 3BMVA 2UZIH 1CFBA 3VH8B 2I60L 3IKCA 4JHZA 4FMFA 3I9GH 1FC2D 1A1NB 3FL7A 4IDJH 3A6OA 3CSGA 3IGAB 3H3KA 1MRCL 4JFQA 1RJYB 3IDNB 1DDHA 3TIDA 3X3FL 1U0QA 5E6IC 4G8GA 5FEBA 2QTEA 2R2BB 1DE4A 3UYRL 1OAZL 4K8RC 4MNGA 4PJIE 3OKEB 1U95B 2D7QA 4X7TB 1G9NC 5D7IA 5JOEA 1LD9B 1B0RA 3G5XA 1XF5A 4PRPB 5BZDA 3MGTB 1PLGL 5IV2A 3ALXA 4XHJC 4DVBB 5CD5D 1RHHB 5I73C 2XKNB 1M4KA 5SWSA 4WWKB 5CIPB 4DGVL 3KS0H 3LKOB 2ICEA 1WWCA 1T6VN 3IS1X 2XXMB 2JF1A 3MNWA 1OL0A 3OQ3B 3FQRB 2VDRL 4KUZH 2R1YA 1BPVA 1KPRB 3QWOB 3C2SA 4GLRH 1XGUB 2YUVA 5I30H 4BQ6A 1IGTA 2F74A 5E8OB 4GBXD 2ZUQB 1DVFD 4WFGE 3DV6B 4M48H 1L7TL 2X4PB 4FOMA 4NQDA 4NRXB 4TOYL 3O8XA 1TJHL 1BOYA 5D7JA 2SEBA 2A83B 3H6JA 3OR7B 5EG6C 4OD2B 5CLTA 1Z5LA 1T6WA 3U30C 4DKFL 2APBA 3HLAB 4ALAH 3DMMA 2G75A 1RD6A 4YHNB 4YIQB 4PJDB 3RDTB 4XC3H 3KWWA 5IFHH 5JW4M 2P5EA 5J4MA 4Z18A 3PE9A 3FQTA 3HUJA 5FM5M 4PJHF 1A6AA 1UQSA 2A73B 5C07A 3VFUB 1IEHA 4JZNA 1NMCB 3QEUB 1UYWL 3GJEB 4HZLB 5D6DA 5ID1A 3GRWH 3C8KA 2HTKD 3E6HB 4XPHL 1K8IB 4GSDL 1FIGL 2Q8AL 2ICWA 4CNIB 3VFWB 2HWZH 3KYMA 3VXRE 5ICYA 3HPJB 1Z0NA 2VXSH 2Y5TA 5DMYA 4TUKH 4GAJH 5F6HI 3MRNA 5BVJA 1YEIL 3VGDA 3RI5F 4QRRB 2K7QA 5DT1H 2VDOH 2AEQL 3JZ7A 5IVXF 4Y89A 4WDIB 1TVDA 1KIRA 1F3RB 4M1CC 5C08D 3BP5B 4C56E 1CGXA 1WZ1L 4L3CB 5F8RC 4PGDA 1U8MA 3MXWL 4ZFOB 2Q76B 1FN4B 3TJEL 2X44D 3UTZB 1T83A 2VAAB 4Y5XB 1NSNL 3LKPB 4U6YB 3T8XA 1BZ7B 1V5JA 4NN5B 5JMOC 5T1MA 3S5LG 2AEPL 3RBSA 4K3GA 1XGQB 3HNSL 1KPVA 2PNDA 4DK6A 4WEBL 3IJYB 4HLZG 5CGYD 4KKAC 2VKXA 3FN0L 5DJ2B 2NXZD 3OJDA 5ITBL 1S5HB 2MTPA 4FXLA 3BKJH 4WHTB 4YZFE 2DM4A 2JJSC 4ELMA 1XZ0A 5F3HB 4LLVB 2Q3AA 1M1SA 2ZG3A 4LGSB 5C0RL 1JE6A 1K2DB 1RIHH 4WFHD 1J1OH 4ZQKA 3CFIC 4UV7H 4WWKC 4BM7A 4X5WA 3QB7C 3BVNA 3QFJE 4NQCB 4E41E 2NY0C 1D9KB 1P4LB 1MH5A 4ZAKD 4KH2A 1TZHA 3VXUB 1UXWB 3MNZB 3RVVC 2VC2H 3V6OA 2WUBL 1NGYA 3LQMA 5KANG 4H26B 2AGJH 3EOYG 3GMQA 3LKRB 3WO3B 3ET9F 4OD1H 2ZUQC 2VDQH 5DQDL 5FKPA 4U2ZA 3QQ4A 2A74B 3QAZB 3UO1H 3H9SA 1NFDF 2VABA 4R7NB 4HUVA 3KPMA 3O0RH 3WIHA 4ONGL 3CMGA 2Z35B 3GM0A 5F1OB 4AYFA 3HI5H 1KTDA 2R1WB 2DDQH 3LEYL 3FQUB 4Q58C 1JNLL 3DI3B 1TZIA 4ODSH 5C6PB 2DAVA 3JV4A 4KK5C 5LWYL 1LO4L 1SJVA 3N1PC 1HQ4B 5K9OB 3MR9B 2YUZA 4G5ZL 4NWTL 5EOCH 3RDTC 1JP5A 4UNVA 4BA8A 2WANA 4G9DA 3SBWA 1Q0XH 1WCQA 2DLFL 5IFJB 1Q9LA 3U46B 1HHGB 3W11D 1R3HB 2VDNL 4GBXA 2BK8A 5IEHB 4NRYA 1DVFA 2X4NA 3RPIB 1KELL 2FHCA 1NMCC 4PRHB 2CQVA 4MX7A 3U36A 4OF8A 1GGYA 3KXFE 4OQ1A 4AG4H 3VRJA 1B4RA 1FZMA 1IQDA 2HFGL 1NBVL 4KUCD 1ZHBB 3QUZA 2YD6A 1ZA6A 5C3TA 5CEXB 1I8MA 1AHWA 3BT2L 2JB6B 1C08B 2YR3A 5BRZB 4F7PA 5KVGL 4XZUA 4DZBB 5TGBB 3FCTB 5IF0B 2IPUG 4M5YH 3DROB 3SDAB 2YPLE 3GHBH 4JHAH 4YO0B 4MD5B 3VFMB 1Z9SA 4F7TB 3RU8H 4B7IA 2XA8H 2VDLH 3BW9B 2AJXH 4XCCL 1IAMA 2BP3A 4Y5XC 1CF8H 4NN7B 5CUSL 4YXHL 1PG7W 2AK4E 4NN5C 2EIZB 3MLVL 3MRDA 3JTTA 1JZ4A 3DXAB 5HHNB 2HJLB 5HYJE 2R0KH 1UJTA 1DR9A 3KPNA 4KI5D 4LLWB 3QO0B 3TWCL 3FFCB 5FXCH 4DN3H 4LCUB 5TQ2L 1FH5L 2DQIL 3VFVB 4K7PL 2GUOA 4KQ4L 2FX8H 4RGNE 5DTFB 5C08A 1MIMH 4EJ1C 4F58H 5T3ZL 3B4NA 4JANB 4N8VA 4QWWC 4WVRA 5I71B 1D9KC 1FP5A 3TJHD 4ZUSA 4QO1A 4M6AA 1WIUA 3WFEL 2K9UA 4CW1B 3STZB 1J0ZA 3KPOA 4X6DB 4KAQH 3CFDA 1J88A 2WV3A 3SQOH 2HKFL 3O41A 1CXKA 3KPSB 4OTXL 3ULUL 1CVRA 4JRYD 3QAZC 2KDGA 2VLME 2JELL 1HXYB 3MSPA 3DWTA 1W0YT 1QACA 3ARFC 4RIRA 3UYPA 4XBGA 4HWBL 5IJVA 2OBGA 4C4KT 2NX5D 3MRFB 3MFFA 2X09A 2Y7QA 2OLDA 3R0NA 2DI7A 2IQAA 4XCFL 4JFDD 3LVEA 4X99A 4PLNC 3IDGB 1DN2A 3GK8L 4RFOH 1OTUD 4JQIL 1C7SA 3U83A 1W0WA 1ODAA 2PN5A 5BO1H 1RSFA 4HUXA 4FRWA 4N1CA 2X41A 1UH4A 5KANI 2CDGA 4LQFH 2FBJH 3S4SG 4GW4A 2CKNA 4XMPL 3NPSB 3G6AA 3FOLB 3KYOB 5JOPD 3OAYH 1YMHB 1EFQA 1K6QL 2D03H 4A6YL 1A6UL 1KPUB 3M17B 3Q1SL 3HZYB 4GH7B 1OAUL 1QLFB 3QG7H 3VXNA 4OUOA 3VG9B 2XTJB 2YD3A 5GJSH 3UTPE 3L5XL 1MRFH 4Y2OA 3UBXG 2R56H 2A9NL 3SDAC 3MRCA 5BS0E 2G9HA 1IAIH 1EEYA 2NXYD 4PJ7B 1QRKA 5I6XB 5EBWB 4YHYB 4NBXB 4WGWB 3VWKB 3GGWA 1CE6A 4XB8A 5E7BA 3MRKB 5F9OL 3O2VH 3CLFH 4U1HA 1MLBA 2GK0B 1ZSDB 1R5VA 1MELA 1PG7X 2X4QB 4LP5A 2IGFL 4LSRH 4ZS6C 4NN7C 4UU9B 4X5XA 2OR8A 1U8NA 3UDWC 2CR3A 5FYKU 3B9VA 2QQNL 3F7QA 2VR9A 2ENSA 4LRIA 4NO0D 4C59B 2CGRH 1GHFH 3MRQB 1FL3B 4HJ0D 5EPMA 1QSEA 2XKSA 4Y2DD 1HNFA 3C5ZD 4TULL 4OM0L 5I1AA 1MAMH 4NZDA 1UM5L 4M61A 1S7RB 1P7QD 3ZT6A 2KQNA 2FJHB 4GKZB 4NKQB 4NQEB 1YN7A 1IAIM 3NCBB 4PJFB 3L3HB 5F21B 3RJDA 1U3JA 1WV7T 4OD3H 5CBAA 4JN1H 1H5BB 4PGBB 3ZHLA 2OI9B 5C6TH 5I71C 5DEGB 3PIQB 1DBML 4EIZC 1I9RL 2AP2A 1RMFL 3UPRB 1E4KC 5KSVA 4PLKC 5CJOL 1CG9A 5EUOE 5MERA 3K2MC 3IDXH 5AG8A 1QSVA 3MA7A 2EYTB 1HWHB 3BZ4B 2BNRD 4JVUA 3VFOB 3OKOB 1DFBL 1DBAH 2H8PA 4DGIL 3ARUA 3E6FB 4N0YL 5TPWL 1MY5A 1T7ZA 1WC7A 2UWEB 1J18A 4MAYB 4PV8B 2YD7A 1LE5B 3GSOA 2C26A 1Y18B 4ZFZA 5F7HA 3QUKB 2IALA 1MCWW 2H32H 3FT4B 3D0LB 4KZDH 1NFDA 4X7SL 5LAXA 4GRLD 4OSUL 1FNSH 4OCXL 2VL5B 3WFDL 1RJCA 3MLXH 2DWDA 2ORBH 4RAUB 3VXPA 4PJCE 2DN7A 3LS5L 1GOHA 5E8NB 3QRGL 4K3JL 1S7XB 3ZKXB 4E41D 2LU3A 4NM8H 1YUHA 5D71H 1U8LB 4G43A 5E0QA 3NFNA 1CLOL 4X6CB 2HJFB 2EECA 5ETUA 1D7FA 4WCYH 4PJIA 3JWOH 4QNPE 3O2DA 4JKWA 4X9GA 4ZSOA 2NY1D 3VG9C 2XTJC 4JFDA 4V1DB 3IDMA 3MLTA 1W8NA 5HPMA 5FUZL 5FYKL 5I6XC 5DO2C 1CCZA 4YHYC 4LKCB 3MYJB 4K2UH 3VWKC 2R0LH 5EU7E 2XN9B 3GI9L 2BRRL 4X98B 4OLUH 1DSFH 4M1GH 4N9GB 3QZWG 1EEZA 3FRPG 1BECA 2DF3A 3PGCA 4Z7VB 2J88H 1YEKL 2VLJD 3HE6D 3R06B 1T3FA 1MREL 1IC4H 3C5SB 1G9MH 4NNYB 4ZUWB 1VGEH 3PGFH 4LCYB 1VENA 4P59H 3UBXI 4XNZB 2FO4B 4QHLA 2GCYB 4ODVH 4KDVA 4WV1A 4P0DA 1NCNA 1QVOA 3W5MA 4PV9B 2IH1A 3T65A 4EBQH 3I75A 1A1MA 3RA7H 3GIVA 3I50H 2OI9C 4APQB 5E00A 3C5JB 2YS4A 4GQ9L 1J0KA 4GUPA 3ULVL 3EJYC 3D3VE 3MRGA 3QHZL 2X4RA 4NO0A 3CFJA 3N1FC 1NKRA 3BN9D 4KK9D 4XNYH 4Y2DA 4PRBB 3C5ZA 4NFDA 2IQ9L 1FO0B 1KN2L 5B38G 3TNNA 2BY1A 1JZ2A 2BHZA 4ORGB 3C6LD 4LASL 5LBSL 4MAYC 4OLYH 3FO0H 3QJFB 5D2NA 3U1SH 4F33B 1F4XH 2H2PD 3CZFB 5T5FL 3CH1B 3L3IA 3ZZ1A 3DETD 2A77H 1ZHKB 4LLQB 1AR2A 3SKJL 3QDMD 5DHVA 1ZA3B 3ZHKA 4JE4B 3UTSD 1BIIB 4GT7A 2YUWA 5JTWA 3MRLA 3LH2L 5B4MD 1FFRA 1B88A 1EJOH 4PB9H 4C56A 3WNOA 2X89D 1N5YH 4X6BA 4JCLA 3P0VH 3ALWA 3ZKXC 3FO9A 5EZJA 1JV5A 3NCJL 4HS3A 1WCBA 3RNQA 4JR9H 3NFPB 4GAYB 3MLRL 5LXGH 4OZHB 4ZXBB 5F7NC 1D5BA 4ZTPL 1A6ZB 2G2RB 3A6CL 4KMTL 3NH7L 4LSPL 5KJRH 3QNYA 1B0GA 4HAGA 4R2GB 2V2WA 5K93A 3UROR 4JY4B 1N0XL 3S37X 4GRLA 4LNVA 3DSNA 3C8HA 2WSKA 5DJ6A 4FZ8H 3T77B 2ILLA 4MA7L 2V7NB 4RBPK 1YYLL 3IKCB 2CSPA 4I3RL 3OG4B 1BX2A 5EUOF 5HY9A 2HFTA 4EDXA 4Q97A 1WFNA 2VSCA 5F1IA 2ZOLA 3QFJA 4U7MA 4E41A 1V7NH 4H20H 1H3PH 3WNKA 5E5MA 1L6ZA 2IAMD 4N1HB 5JUEL 2B8OT 5CGTA 2BJMH 1DE4B 1JHLL 4UNTA 1VFMA 3MV9D 4MNGB 1S3KL 5F96L 3P73A 2ZNWA 5D7IB 3FQWA 3TVMD 1B0RB 3QT2A 5C0ND 3G5XB 3WKMH 1XF5B 5BZDB 4X0KA 5IV2B 5EC2A 4NP4L 3QDGD 1LO0L 3EOBB 2ZUYA 1CLYH 3MGAA 4XNZC 5SWSB 4PJCF 3OF6A 5F9AC 3MNWB 1TCRA 4Y0GA 5CILL 2LU7A 3KPPB 2B4CC 2BMKA 3JXAA 4APQC 4ODUA 5L0QB 3VFSA 1DEEA 1MRCH 3TN0A 1IGTB 1H3XA 1UCBL 2XOTA 5FECA 2VLJA 4O4YL 3A0OA 3X3FH 1CIDA 4QNPF 2YHGA 3MNVA 4X8XA 1BM3L 2YPVH 3BD5A 4S0TD 4NQDB 4I48A 4P99A 3UYRH 1OAZH 3O8XB 4LVOC 1EHXA 4U1JB 2OTUA 3BMWA 1Q8MA 5D7JB 4M7KL 2SEBB 4Z0XA 1JNJA 1Z5LB 3VRIA 3TLRA 1PLGH 1E27A 2EDRA 1HSBA 3DMMB 2G75B 2DM3A 4I1NB 1VEPA 1N8ZA 2DJSA 4DGVH 3LKSA 3H0TA 3KWWB 4LCIL 2P5EB 4KJWD 4M4PA 4TUJB 2BVQA 3RWDA 3FQTB 4L1HA 3HUJB 2VDRH 1A6AB 1KT2B 1NAKL 1UQSB 2NYYC 3QI9B