1WICA

Solution structure of the msp domain of riken cdna 6030424e15
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
152
structure length
152
Chain Sequence
GSSGSSGKKPLSVFKGPLLHISPAEELYFGSIESGEKKTLIVLTNVTKNIVAFKVRTTAPEKYRVKPSNSSCDPGASIDIIVSPHGGLTVSAQDRFLIMAAEMEQSSGTGPAELSQFWKEVPRNKVMEHRLRCHTVESSKPNSLMLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical Protein RIKEN cDNA 6030424E15
publication title Solution structure of the MSP domain of RIKEN cDNA 6030424E15
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 16
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00635 Motile_Sperm MSP (Major sperm protein) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1wicA01
4AQOA 4Q9RH 3M8OH 4Y4HC 5E6IA 4D0DA 1F4XL 2F74B 4JPKH 1IARB 4M1DL 1JGVL 5FOJA 5GJTL 5KS9B 4Q97A 3RX7A 1VFBB 1JPSL 3RWIA 4LHQB 5HPMB 1A7QL 4EIZC 4JQVA 3LKQA 4R90H 1L7IH 3RJQB 1CBVH 3FO0H 3LQMA 2FNBA 3IETB 3LIZH 4U6YB 5DJ6B 4YHKL 3INUH 1QLRA 4PB9L 4W4OA 2B8OT 5DI8A 5GS1A 3OGCB 1HINH 5IWLC 1JHTA 4J8RB 2EDWA 1SJEB 4G6KL 5ALCL 1RZJH 1ZT4B 2HT4C 5FKPB 5E8PB 3U82B 5CSGA 3IDXH 1FGNH 5E4EC 4GKOA 3BO8A 5C08A 3I84A 2GK0A 4Q6IA 1IM9D 3VA2C 4HFWB 4PJEE 4NZUH 1JGUH 2AK1H 1KCSH 1J0JA 5EOCH 1FN4A 5ICYB 4Y19B 3MRKB 3NAAL 4OLYH 2EZ0D 4TOYH 2DTMH 4Q2ZA 5FYKL 1KB5L 3SKOB 3JV0A 3FN3A 3X12B 3ZLQC 2Y36L 2NY4C 3QFJB 2A0LC 1QR4A 2QEJA 2C3GA 4Y5VB 3BEVB 4CU6A 4FZ8L 3VXSB 1ZLVH 2HG5B 5I74B 2XWJB 5EH1A 3P4NB 1U58B 3TV3L 1Q72L 5I1AA 1INEH 1HNGA 3QISA 4XBEL 3V0VB 3ULVF 1UB5B 3BH9B 5EB9A 1QRND 4LSPL 4NN6B 3WD5H 2PUQT 2Q76B 5T1LB 4D9LH 1SJHB 5E5MB 5JORB 1EHLH 3GJEA 2IPKA 2OTPA 4PRIB 2Y7QB 5F1KC 2Z91A 5HHOE 1T7YA 1V7NL 3P4LA 3TBTA 5C86A 3M17B 2FJGA 4HGWB 3H7BA 1CU4H 3EGSA 4MB5A 2HLAA 5EUOB 2PXYB 1S9VB 3Q1SH 2FJHA 3OXRB 4NQEA 4HV8A 3Q5OA 3S5LG 1W72L 1BD2B 3L1OL 2R4SH 4JQXA 3FOLB 4PJDA 4TNVK 5SWSE 4OLVH 5IFJA 2A6KA 3C09C 2Q3AA 1DSFL 2EYSA 3ARFC 1QKZH 4KK6C 5DYOB 5EA0L 2VMFA 3KYKL 2WNGA 5LWYL 1INDH 4LCWA 4XCFL 3VRIA 3NCJH 4Y4HA 3LEYH 4R4BA 2OR9H 5C3LD 3TYGH 4PD4J 3NBNA 4OLUH 3MR9A 5JZ7C 5KVFH 4ZQKB 4DGVL 3DUUB 5CSZA 3G6JA 4OSUH 1LK3H 2P5EE 3IKCA 4RFNC 2CPCA 2FH8A 1QBML 3NIFE 4O5LH 2ZKHL 1OAXH 2V5SA 5CEZD 3O6FC 1KCLA 5EU3A 5GS2H 4FQCL 4L29B 3Q0HA 3LRSA 3EOAB 4LARL 5HHVL 1LVEA 2FO4B 1MAMH 5IWLA 4M62L 2VH5L 5I30L 2X1WL 4P9HH 4WU7A 3DARA 3D9AH 1WWBX 1I9RL 1OWRM 4H1LH 1WIPA 3J7HA 4NFBA 5GISH 4X6BA 3BOVA 4CVXB 1K8DB 1A9BA 1CZ8H 4KKBD 3PWUB 3GHBL 4M6OH 3EYFA 4HCRH 3RY4A 1BFVH 1QFWI 4LPUA 4X6FB 5M7QA 2AJ3A 3RNQA 1RIHH 1BJ1J 1FLRH 4MXWH 4OQTH 2E9WA 5HHMD 3MFGB 1FPTL 1HILB 1FFOA 4NM8H 1WBYA 4MA8L 5SWZD 2OJEB 5FECA 1DVFB 2H6PA 4UBDC 1M1SA 5FIEA 1HDMB 4NQVB 4XCNB 1RJLA 4JGJA 1WCBB 2ESVB 5I73B 4YPGA 3MFFA 4GO6B 3WJLC 4WTWA 1EMTL 1U3HD 4XP4H 1KCUL 4FQ1L 4ZO9A 2Q8BH 1QFPA 1UYWL 5TF1H 3EOTH 1RZKH 4G43B 2HRPL 1TCRA 5IEHB 3QFDA 1HHKA 1II4E 1NBVL 2ID5A 1A22B 1RUAH 3NFSL 1RAMA 3BGMB 4UILL 3EFFA 2L4OA 4WI7A 3GO1L 4WENB 2YMXH 3ARGC 4M6ML 2EO1A 3GI9H 4NGHH 5HGAA 2YPVH 2UZIH 3L3DA 3ARFA 5DO2D 5FA4B 2EO9A 4OCNC 2J1KA 4EDWH 5HGDB 1O7VA 2YPLA 4YHZH 1N7MH 2NZ9C 3FONB 4X5XB 4K7PX 4OCXH 1A4KA 2WWKT 2AEQH 4I4WA 1ITCA 1OGAA 5I17B 2XQYG 4GLRH 4TSAL 4D0CA 1KLFA 2R1WB 5IMLA 5I1CL 1G7QB 4HT1H 3OPZL 4DKEL 1U95A 4NQCB 1E4WL 3WXVL 4U33A 2H26A 3QO1B 3LAFA 4Z77A 2JK5B 4U6VH 3QRGL 1ZLUH 3SDAB 5FO8A 3ARYA 1BGXL 4JO3H 2V9RA 3DGGB 1RUPH 4LLVB 4N9GB 1D5IH 3UTSD 1T3FA 1KXVC 3DX7A 1GPOL 3IDIB 2IAMB 4PGCA 5CP7A 4TPRH 4JPWL 4S2SB 3NIDF 4P5TD 5GJSL 4OD1H 4ACPA 3GMQA 5T3XE 4X4YB 4M5YH 1I1AA 1MI5D 4M7ZC 3WLBB 3IFPA 1NEUA 2XACC 2JIXB 4K8RD 5F89B 1N4XL 1YJDC 4LKXA 2O26U 4UU9A 5DUBB 4GBXA 1DBKH 4PTUA 3GMNA 1G84A 1ADQH 1RVFH 5ERWA 1CD8A 1JPTH 3OXSA 2P4AB 3LKRA 1ORSB 4I3SL 2AV1B 4UNTA 4X4XB 4DKFH 1FYTA 2R1YA 1I7TB 1MWAA 1YEDB 5IT2H 5EU6E 4MYWB 7FABL 2HWZL 1YEJL 2BHUA 4K7PH 5EG6C 1ED3A 5LCVL 4JFHD 4ZOEA 1OWWA 1IFHL 3REVA 1TZGH 2KZWA 4OZFA 1OTSD 5CCKH 1DJSA 5DVNA 2GJ6E 4NPYB 3MRLA 1LO0L 1HYRC 1H5BB 2CO7B 3GHEL 3WJLA 5ALBH 3WFDL 2BY0A 3M07A 2DMBA 4MNHA 1JZ6A 4YHOL 1T66C 4HK0A 1RULH 2NY2C 1RZIB 5MERA 3NIGF 4I77H 2AI0H 1GAFH 4EIGB 4K2UH 4PJXF 4NO5A 3WEXB 5I0DA 4LCUA 2WINB 2IMMA 1V8HA 5E6YA 5JOPD 3DO3A 4LVHC 5I1IH 3E2HC 3ARGA 3ELAT 3CFJA 5T1DH 3TEUA 5D1XB 4YDJB 5JA8B 1FNGB 3TN0C 2NX5E 1P7QA 3V4VH 2EDRA 4HK3N 4L9LB 5EBMA 1OM3H 1Q0XL 4IIQB 5DD1H 5GGSY 2DLFH 4KAQL 4JFXA 3HMWL 4QXWA 3KPSE 5CGYC 5HHPA 4X6DE 3V4UH 1B4JL 1MQ8A 1FG2B 4OZ4B 32C2B 3D39A 3X3FL 1GOHA 2L0DA 1OSZB 1L9MA 1MHHA 3MLTA 4HUVB 5E9DB 4RIRA 2WBJB 3UYPA 2X4SB 4BQCA 3THML 1LP9B 4U1GB 1FZKA 4YDVA 2VDQL 3W9DB 2ADJB 1WAAA 2G9HB 1I4FA 5AG8A 3U4AA 3HI6L 4ZFGL 3KPNA 3WLWC 4GAGH 2O5XL 2BNUB 3HE7B 4QGTA 4MCYB 3VGEA 4LGSB 1ZHNB 2LU3A 4RZCB 3QDJD 2QQLH 3GSNL 5DA4A 2NY0C 1P1ZB 2HH0H 2D03H 4M7LT 5E0QA 1I85C 4DKDC 1HIML 2BMKA 5B39A 3HPJB 3OR7B 3UTTA 1Z9OA 3O2WH 5JW4N 3MUY1 5ICXA 4O58H 5HHNB 2UY7A 4ZXBD 1ULVA 2E5EA 5B4MD 1I8LC 1LO5A 4OF3A 1KJ3L 1QD0A 3MOQA 4QHNA 2J7LA 1NBZA 2Z35B 5DMIH 2GTZA 4BZYA 4L1DA 3TA3C 1DBJH 4OT1H 1DE4B 1MNUL 2DDQH 4Y5VC 5C0JB 3QUXB 2CK2A 2BOCB 1NGWB 1LO4L 3VXQB 4A2LA 1F8TL 5DHYA 3DTXA 3ZDYF 3FQRA 3OAUL 1WFNA 1QYGL 3B8SA 4OCSL 3B4NA 4NN7B 3WIHA 2NY1C 5GS3A 4P2OB 4M43H 1CL7I 3HE6A 4FABH 4I13B 1SEQH 3O6LL 2DAVA 2WBKA 4UNUA 2R0WH 1FO0H 15C8H 4H0IA 3PQYE 3RY6C 1MHPH 4N8VA 2PETA 5D2LA 1FGVH 3BW9A 3G5YB 4YFLF 1HQRB 4KKCC 2IPUK 4NWTL 3P9MA 2F53A 1UB6A 3S35L 1M7DB 1KN4L 1OGTA 5BVJA 2R29L 4R96A 5I1EL 1FFNB 1RUMH 2YRLA 1QOKA 4KWUA 3S6CA 1U8JA 4CADA 2OQJB 3TCLB 1OP3H 3MV7B 4JY4A 4QCIB 3TWCL 4JRXD 3NFPB 3S96A 5ESAA 3MRHA 4X83A 4GFTB 1FL3B 5KTEH 4G8GA 3U46B 3D48R 1DQJA 2QSCL 5B3NA 1DQDH 3IVKA 5JXED 3E6HA 4KV5E 1MVUA 3AS1A 3D18A 1TCMA 1G6RL 5F7UA 1C8PA 4DW2L 3WNLA 2IANA 2OSLB 4K3DH 4XGZB 3DXAD 1MCSA 3HCVB 4AENB 4OZIB 3LS4H 5I75B 3HC0A 5DJ6A 4QXGL 3M1BB 4JN2B 2ICCA 3SCMA 1FJ1B 2PTTB 4W6XB 5F1IA 1DN0A 1LMKA 4J8RA 1Q9KB 3MLWL 5I71B 1PLGH 2VLRB 4AQ1B 4Z8FH 5IB2A 3CFEB 1I85A 4HZAA 4PRDA 2DN7A 4XPTH 5EC2A 1HWHB 2N7BA 3MACL 1KF9B 2RHEA 1A7OL 3QXWA 4NNYB 2VLLB 3CC5A 3RGVB 2DLTA 4QOKE 4GRLD 2PW2B 1N5YL 3UAJD 5F3HB 3HC3H 5GGRY 2J6EH 4MAYD 4PP2B 3SKOA 4LPVA 4JE4B 3QO0A 1Z6JT 3JV6B 2IG2H 4C54A 3TA3A 4X4ZA 1RIVH 2BHYA 5EU4A 1JF6A 1DVFC 5TQ2H 4JM2B 5MI0C 1R5IB 5J12C 3P0VL 3FRPG 4Y1AE 3RL1A 4ZODA 3RP1A 5I73C 1WC7B 4X9FA 3QWRA 4PREB 4IRSA 5FO9A 1INQB 3MOAL 3OR6B 4CU7A 5JMRA 5DK2A 3WV0A 2CJUH 5I66B 1F6LL 5GPRA 3WHE1 1MFBL 3MXVH 2EYRB 1KIQB 1A6ZA 4GG6B 3VXTB 4WV1B 4HZLB 4QF1B 1F11B 3FRUB 4Z7UF 1FAKT 5CS7A 5E2TL 1IGIL 4MA7L 3AM8C 1NMBH 3VG0H 2FRGP 1F58L 1UENA 3MRGA 3ULUD 4U1IB 5EPMB 5KAQF 5KSAB 5EUOA 5F1NB 1S9VA 1KENH 4EEEA 5GZOD 1T80A 4NNXB 5ANME 3WHXB 4BH7A 3TIEA 2CDGB 4F37K 3FFCA 3FOLA 3MA9L 1FORH 1CD0A 1LDPL 3P9WB 2P42B 5CILH 4Y5YC 3O2DH 3RWFB 1ZHKA 1WBXA 4JFDE 4QT5B 1JNNH 3LEVL 1LD9A 3S36L 5C6PB 2AW2A 3FQXB 4NSKB 2BCKB 4NQUA 1BQHB 2BOBA 1EJOL 5CJQL 5JUEH 2HN7A 3DX8B 1TPXB 4ZSOE 1MLBB 2VDRH 1S7WB 4N68A 1BFTA 4OF6A 4XH2A 1AY1L 1YPZA 2ZNXA 2DQEH 3BQUD 3VWJD 4LSUL 5IMMA 3ALPA 4ORZC 4PJ9B 3WNMA 4JZJC 2YPKA 2EC8A 3MLVL 1EGJA 5DDHA 3MCG1 3KWWA 4Z7QF 1OT2A 5JIPA 4XNUH 5DT1L 3C6LD 2IAMC 3MRFA 1S3KL 3ARRA 3HUJF 4JDZB 1U36A 1EDQA 1AFVL 5IK3A 1NQBA 5ITFB 1UWGH 4K94C 4OI9A 4I2XA 3IDUA 1NC2A 2VE6A 3D69A 4AL8H 3K2MC 4KRPB 3TYFB 5L8JB 1NJ9A 3JWDC 2GT9B 3IAGC 3IFNH 4Q9RL 4CBPA 4Y19D 3M8OL 4KJPC 4GKNB 5CJ5A 1JPST 3MJGX 4XWGH 3PWUA 2AABH 4JPKL 4ODTH 3QFJD 5C0AA 4D3CH 4NYLB 4KRNA 4QXUH 1KB5B 1XF1A 1QUNA 3FOMB 3QI9C 3ULVC 1S7XB 5TE7H 1Q8MA 4G9FB 3BHBA 5I2IA 5CZKA 2W9EH 3BWAA 4R90L 4P2YA 3QQ3B 5SV3A 1L7IL 2C1PA 3D85A 5HVHC 1CBVL 1K85A 3FO0L 2JKXA 3LIZL 4B53A 2V5TA 3INUL 4WGWB 2ATPA 5BJTB 4G6AC 4HC1H 2D7OA 1I3UA 2VLKD 5A3IC 4QRPD 1HINL 4UTBH 1H5BC 3BN9D 2H41A 1VPOH 4PRID 1R3LB 2I9TA 1RZJL 4Z7WB 1QZ1A 1J9CT 4JCLA 4MLSA 4JFOB 2EDJA 2N56A 3IDXL 1FGNL 4OB5H 4GMTH 1G1YA 3G5ZA 4Q9QH 1VACB 3S4SA 2PXYD 3VFVB 2IADA 4NZUL 1JGUL 4IOIA 3AM8A 2AK1L 3T0DA 1KCSL 4N5EC 5EOCL 3QUMH 4HW6A 5LQBH 3VRLE 3SGEI 4BM7A 5ABDE 4OLYL 2CKBH 4TOYL 2DTML 3L5JA 3RWEB 3A6BH 4JANB 4DJMA 3SEPA 5I18H 3OGOE 1KCVH 4Y5YA 1AIFA 1QNZH 4L9LC 1N8ZA 2DLHA 2XKSA 1INEL 3OSKA 4I18A 2EYTA 3V4PH 1PQZB 3S34H 1FVDB 3MNZA 4URTB 3WD5L 3ULUF 2DQIH 1MJJA 4HWBA 3B9KD 5EBWB 4D9LL 1HH9B 2WP3O 2ARJB 5JHDB 3GFUA 5KVDH 1CVSC 5L0QB 3QB7C 1YEHH 1NGPH 4OBRA 2GQHA 5EZJA 4HIHB 2X4PB 2WBJC 3DVIA 4JZJA 1WQVT 3N50A 5JIHA 1CU4L 2V17L 5C92A 3Q1SL 3BXNA 1QFWM 4NQEE 2BSTB 4E0RA 2PYEA 3MNVA 2SEBA 5F6IC 1W0VA 2R4SL 4PGEA 3PGFH 3WDHA 5IHZA 2EIDA 4WWKD 2R23A 5F7WC 2CLVA 5LKNA 4OLVL 1EEYB 1YY9D 3DHJA 3HE7C 1C12A 4LL9A 4Z6AT 1QKZL 5F9DC 3WIFA 5BS0B 3KLDA 1JWUB 5IOPA 1INDL 3HAEG 3FQUB 1JHKH 4LCWE 4DOHB 3NCJL 2R15A 1OPGH 3QDGB 1MJ7H 3FTGB 3GSOA 4IOFD 4MXQC 5CAYB 2OR9L 4PJ5B 5BCAA 3ZHKA 4PV9A 3TYGL 5IIEA 5AEAA 5F9AC 4HJGA 4L3CA 4OLUL 4F9LA 5KVFL 2RJMA 4L8BB 4PLJC 3RTQB 4ZYKB 4R7NA 3SJVB 3G6JE 2AV1A 1S7VB 1CK0H 1LK3L 2EE3A 3QI9A 4DQOH 4QRQA 4YHYB 2R4RL 2EDOA 4P23A 5KSUB 3L3OB 1WZ1H 4XPAH 4JHZA 2ESVD 4FQQB 4LLDB 4O5LL 1OAXL 1DFBH 3RDTC 3DI3B 3QUXC 3REWB 4U1SA 4NQTA 2UYLA 1GZQA 1EA9C 1L9NA 2R56H 5IEKB 1VDGA 2FSEA 1MAML 1FRGH 4U7MA 3ZKNC 1MOEA 2NLJB 4P9HL 4NHUB 4JFED 2X09A 2NTSP 1GVIA 3D25A 5IB1A 2I24N 3MV8E 1GL4B 4GOSA 4OIIH 3TBWA 2A83B 4Y4KA 5INCA 5GISL 5C0IA 1KLGB 1CZ8L 4ZG1A 3EOBB 4M6OL 2I9LB 1WITA 5KG9A 4HCRL 4NFCA 1BFVL 1I9JH 4PRHD 1RIHL 3T0EB 3PNWA 3RX5A 1FLRL 3C8KB 5K33A 4MXWL 1G7MB 3VXME 2ZNWA 4JFFD 3RVXD 4NM8L 2V5RA 3TCXA 1FL5A 3O0RH 4WNQB 1PJ9A 4L9LA 1F6AB 4UOW1 1V3LA 3MRPB 4OF8A 3SE8H 1MHCA 1EHXA 1Y18B 3PHQA 4MJ2A 2VDKH 1NL0H 4APQB 3VJ6B 4UV4H 5DUPH 3DJ9A 1FVCA 2Q8BL 4XP4L 4MJ6B 5TDNA 1D5ZA 4XTRC 5TF1L 3TNNB 4YLQT 1XGRA 3EOTL 3QAZB 3QCVH 1RZKL 3KPOB 3PDDA 3GSUB 1J18A 3MODH 3VFRA 1MFCH 2XA3A 3MRDB 3CMGA 1KLUB 2NYYD 4MDIB 1RUAL 3QIUB 5BZWB 1EAPB 3HZYA 3VXPB 1G7IB 4FFWC 1Z0MA 2M26A 4GRWH 3FB8B 2OTWA 2ITCA 2YMXL 1OP9A 2VQ1A 2VXSH 1EO8H 2EC9T 3GI9L 4NGHL 43C9B 5I75C 2YPVL 2UZIL 1D6EB 4HEME 2YPLE 1JTPA 1BFSA 3VXNB 4YHZL 2FX7L 1NCCH 4LGPB 1N7ML 1Q94A 3AB0C 4V2BA 2J8OA 2VAAA 4OCXL 5D93B 2NY3B 5I71C 2AEQL 1F00I 2DM2A 3KGRA 5HYSA 5F8QC 4U7SA 4N1CA 4U4BA 4XCEB 1D5BA 1U93A 3V6OC 2GAZA 4D9QD 3DBXB 4HT1L 2LE9A 2JE8A 1EXUB 3VXRD 4YDKL 4FTVA 5C07D 5EDXA 1OP5K 4EXKA 1U8IB 4U6VL 4G7YH 3MRMA 2DICA 2NNAB 4XPHH 1D5MA 5H35B 1IL1B 3L7EA 5J9PA 3AREB 4ZTPH 4JO3L 4NRZA 1RUPL 3EDFA 3VW3H 1D5IL 2DIJA 4XZUA 3RDTA 3B5GA 2H2SC 1MIEH 1TJGH 1RHHA 4TPRL 4O2FB 5BRZD 4JM2C 3BZ4B 5E1AA 4PRPE 4OD1L 3B43A 4HSQA 2F5AH 3SKMA 2WMPA 3T65B 4M5YL 3LS5H 3VRJB 3VFNA 4NQDD 5BZDA 4J4PC 1BVZA 1QRNA 1JWSA 2OCFD 3SGKC 1DBKL 5D5MB 1XGYH 2DKSA 3BIBX 4K55A 3JWOC 1ADQL 1RVFL 1JMZA 1RK1B 4PJIB 4H0GA 1JPTL 3LEXA 4P5KB 5SX4I 2EECA 5D1XD 3RBSA 2UZYB 1IAII 4IOSD 4P5MB 4XC3H 1A1NB 4DKFL 3NCYP 2EIBA 1AGFA 2VO5A 5IT2L 3G6AA 3V6BR 2XWBB 1OF2B 2B20A 5DMGC 1NFKA 4RA3A 4K7PL 3I50H 4MGXA 5BO1H 1TZGL 4D9RD 5CZXC 4NO0D 3LKPA 5IHBA 4BQBA 5CCKL 2I26N 1L7TH 1U91A 3RUGA 3K8KA 1P7HL 4YHMH 1T1YA 5C2BH 2IWGA 5F7EH 4DUWA 5AUMB 3H3KA 3DUHA 1XCQB 1A0QH 3GSVA 1RULL 2B7DT 2FIKB 3KPLB 4I77L 2QKIA 3NA9H 3KR3H 2AI0L 1GAFL 4U0QB 3WUZA 4K2UL 4ELKA 4M7KH 3TH2T 5D8JH 3SPVB 5TDPA 3QRFM 5HDBF 2JCCA 5AWNH 5JO5B 4E41A 1UH4A 2D7TH 4EUPH 5T1DL 1ZVSB 4AENA 3QPQD 2VNCA 5HJ3A 1S7TB 2XN9D 3V4VL 1SVZA 2JJSA 1FNEA 1OM3L 1WJ3A 5F3BA 1MHEB 5DD1L 1JF1B 1IGFH 2DLFL 2QV2A 4TUKH 1MCCA 1I8IB 3GSNB 3BD4A 4UIMA 3ZT6A 2EDFA 3B5HA 4KRPC 3V6OA 4KK8D 2YA0A 4I8DA 3PABB 2W0FB 1X7QB 1MWAH 4HFUH 2DJUA 1LEKB 3V4UL 1IEBB 4JDVB 3T1WA 5DFWH 5F3HA 4HS8H 2VZ1A 4WO4C 1T7WA 4X7CC 4OZFH 1CD1A 1WAAE 2DMCA 1N6QH 1AGCA 1AKJB 1F13A 4MJ5B 3BP7B 4GAGL 3EIFA 5SWZA 1J1XH 1MF2H 1AE6H 4U1JB 3DYPA 4PJXA 5L6YH 4XBPA 5CZVH 4P2OD 3DXAE 1S5HA 1ODAA 1SBSH 5CD5C 2CSPA 4RAVB 3DRQA 4ONHB 4DN3H 4N0CD 2WUCH 4J4PA 1HEZB 1S7RA 4XXDA 2HH0L 2Y07H 5CGMA 3I3EA 4JFPA 1IGYB 2D03L 1U3HA 4S1DD 3SGKA 4GG6A 2CLZB 1ZLVK 5E8NA 1QQDB 1SM3H 3O2WL 3BJLA 3GRWA 3RVWD 3RWGB 4O58L 3VXUE 2X4OB 1IGJA 1IAKB 5DS8A 4V1DB 2V2TA 3H0TA 3AXLB 3BD3A 4F33B 5EOTA 5DMIL 1UWEH 3RJDA 3TFKD 1DBJL 4OT1L 2DDQL 1A6TA 4TTDC 2ED7A 5D96C 3MV7D 4XPBH 3L3GA 3BH8B 1A8JH 4Y4FC 3ZTNH 2F5BH 4NSKA 3CSBA 4M43L 3W9EB 1FCGA 4M1CC 3MGAA 4FABL 1A3RH 4F2MB 5FF6A 1QHOA 5DGRA 2F8VA 4CVWA 3FT3B 5IW1B 5L0QC 5INDA 1FO0L 15C8L 5DGQA 1CG9B 4ZUUB 4YZFE 1MHPL 2UUDK 3MV9E 1G6RB 4JVPA 3CVHA 3TT3H 1K2DA 2FDBP 4LBEA 5FCSH 5D2LE 5HGHB 1XMWA 1FGVL 2AXHA 5CLWA 2HVKB 3UTSA 1YJDH 4KROB 1NUDA 4JG1H 2VR5A 1NLDH 3TLRA 3V2AR 4P5TA 3IJYB 3FQWB 1AO7D 1RUML 4KMLB 5CBAA 1S7SA 2B4CH 4YHLH 3RGVD 3T2NH 3LKOB 1MI5A 5F7DB 4KZEH 5DVKA 2YWZA 2BERA 5EZLB 3H9SB 3CSYA 2JB6A 2BSED 4G8GE 4OLEA 1VEMA 3BKCH 3CIQA 5EC1A 5D1ZC 5KS9E 4LVEA 4WO4A 1DQDL 3MV01 3TC9A 3H2WA 3CZFB 4NYLA 5DJDA 4EZMA 1YEKH 2VB5A 3FOMA 5IMKB 4ZFOA 1FLTX 1MY5A 1PZ5A 2IANE 1EAJA 4NUJB 4F7CA 1A7NH 3RAJH 1KTRL 5DQJA 4IHOA 3BVNA 3IDGA 1QSZA 3I6LD 1CE6A 4K3DL 5F1OB 2DS4A 3ZKQD 4F8QA 3LS4L 1AQDB 4LU5H 3O4LB 1UCBH 2DB8A 5E8DH 4F58H 3VCLB 1HSAB 1R3KB 3UTPD 3DURA 4JLRB 2AK4D 2O61B 1AP2A 4HG4K 1PLGL 1DQMH 1X5JA 4NZRH 1AD9B 3OAYH 1X44A 4Z8FL 2X89D 1A3QA 1Q9OB 4QYOA 2VXTH 4XPTL 3UX9B 5LGHH 4I0PB 5JW3H 5KSAD 2P5WB 4L9DA 3RA7L 3VFPA 2AXFB 4WJ5A 3VG9C 4DZBB 1FZMA 1EFXB 4OCLC 4WW2C 3QXUA 3HC3L 3TNMB 3UTQA 2J6EL 5DJCA 4NN5C 1KG0A 1OAZL 5A2IH 1I8MB 1YMHA 2YA2A 2GCYB 3U0TB 2IG2L 3ZE0F 1R5WB 5D9SA 1RIVL 4ODUA 4ZS6C 4D0BA 3ARBD 1KSRA 1LO3H 4NCDA 5TQ2L 3VXSE 4NC2B 4QHKJ 3DUSA 3N1QC 5EBGA 1LK2A 3FZUD 2AGJL 2B1HH 2P43B 4WUUB 4Y4FA 4F7TB 2YEZB 1D9KC 2EEDA 1MJ8L 1ZV5A 5IF0B 4CVZA 1N0XH 2JJTA 2CJUL 2QQKH 2C26A 3OG6B 3MXVL 5D2NB 4DKAA 1TQCB 1N2RB 1TDQA 3RIAK 2XQBH 5EZIH 3U7YH 3QIBC 1FV1B 3F6IA 4ONGH 5K9OB 5FCUH 4K7FA 4PR5B 4K9EC 3DROA 1NMBL 2BSRA 3VG0L 5MEOA 4R26H 5EUOE 5CMAB 4TRPH 4FQXB 3AS2A 1KENL 1TENA 1FE8H 2GJJA 4FQHA 1V5JA 4U2YA 1BD2E 4EVNB 3ARDB 3IAPA 3FFCE 2ZUYA 3F58H 3QXAB 5EO9B 1FORL 3D2UA 3SDXB 2IH3A 2G2RA 4HHAB 3L5WA 5CILL 3I6KB 5DJAA 4QWWC 43CAB 2VISA 1ZSDB 2YUXA 1H3XA 2I25N 4DUXA 3F6LA 2QSVA 4ZO7A 1XF2A 3CLFH 2GUOA 1JNNL 5F96L 4WWID 3SDCB 5JQHC 1F3JB 1JN6A 5JHLH 3IDJB 5FHBH 2V9QA 5JUEL 1G9NC 5ACMA 1MPAH 2VDRL 4JRWA 1R5VB 1JWMA 1RZGB 2A6JB 1ZHBB 5D1ZA 1FNHA 5DZNA 3RIAF 3TBSA 1R6VA 2X4TA 1NFIB 2NY5H 3RHWK 4A6YA 1PX4A 1YPZE 1M71A 2DQEL 1IKFH 3KYAA 1U8QB 4GRLC 4HUXA 3WKNA 3UAJC 3MCKA 3AREC 4JAMB 4MMXC 4EUPG 4UINH 4U2ZA 4LLDA 3GSRB 4YPJA 1NGZB 3WFBH 4JDTH 4XNUL 3TPKA 1HYSC 4BFIB 3CDCA 4PV8B 1I1FB 5CKAA 3REWA 3DIFB 4Z7UA 4HJ0D 5ITBH 1UWGL 4HUUA 1SEBB 4AIZA 1MFDH 4LLYA 4AL8L 3BPOC 1KOAA 5HHQA 3VH8A 3IFNL 1A1MA 5IMOA 1URLA 4XWGL 1J1OH 4GS7C 4HIEB 2AABL 4ODTL 5DF0A 4WW2A 3RHWF 3I02B 4OZFG 4D3CL 1G6VK 4QXUL 4P2RB 3C8KA 1HOCA 4I9WE 5TE7L 4BQ6A 2V2XB 4GRMB 3ULUC 5J4MA 4NT6B 3D3VA 2W9EL 35C8H 3O3DA 3GK8H 2E9BA 1SY6A 5GZOC 5GXBB 3C5JA 3R1GH 3TO4D 1MUJB 4L4TD 1UM4H 4U0RB 1D9KA 3PJSA 4HC1L 3V52H 3DRTA 5A40E 1L0YA 5JHDD 4G5ZH 4UTBL 3DSFH 1LDSA 4GQPH 4KXZI 5EUKB 1VPOL 2Y5EA 3IJHA 3LV3A 4QHUB 4HIJA 5IROC 2ATKA 3TZVB 3H42H 3U48A 4JKPL 4P49A 3QIWB 1T83C 1A2YB 1EGJH 3QIBA 4GMTL 4OB5L 3HUJA 4O4YH 4HIIA 4PGZA 5EOQL 3DO7A 1GYAA 4Q9QL 3H3BC 4ZFZA 4MHHI 2FD6H 3PWPB 3QUML 5KW9H 5LQBL 2Z8SA 2CKBL 5CSBA 2DQDH 3BQUC 4HDIA 3VWJC 3RKPA 3QDMB 3A6BL 3GSQA 1GRWA 4GUPB 3LHPH 5BS0D 5I18L 3N85H 3HC4H 4QY8A 3WDIA 1ZT7A 1KCVL 1JF5A 1QNZL 1E4XH 4J1UA 3G6DH 1R3JA 4PJEB 4GW4A 5B8CB 3BN3B 2BRRH 5A1AA 4NQSB 3S34L 3FB7A 1DBBH 2DQIL 5L2KB 4PGDB 3OAZH 1MFNA 3UPCA 4NQCE 4ONFH 5KVDL 1HWGB 2PR4H 4J6RH 3RY5A 1NGPL 2NNAA 4GRLA 1DEDA 2OBGA 3O8XC 1A4JB 2CXGA 2AJYH 1HHGB 4Y7MA 2MNUA 4JN1H 2RGSA 2GK2A 4MAYA 1QHPA 4HUKB 2PYEE 4KFZC 5I8KH 1PD6A 4M6NL 3EHBD 3R4DA 3PGFL 5HD8D 1CDIA 5B39G 1IE5A 5C71A 1BVLB 2AV7A 2VLJD 1EZVY 4KMQA 2VDPH 5DEGA 1JHKL 4WU5B 3MJ8B 3RWJB 4H1LB 5C0FB 1OPGL 4JKMA 1MJ7L 4YAQA 5H37H 3T0ED 3GBMH 3WMSA 3VD3A 3ZE2F 1BX2A 1IM3B 3QUZB 4QRSB 4P5MA 3KYMA 2GY5A 4G9DB 2A6IB 4TVPE 5SWSB 1CK0L 4ORGA 3V9FA 3ULVE 1TITA 2IQAB 3OKEA 4P3DB 4DQOL 1WBZB 2GSGA 1NAMA 4JFZH 4BFGA 1PZUB 2Y6SD 1WZ1L 4XPAL 3HMXA 3Q5TA 1UA6L 3S37X 4K07A 4W70A 4QRUA 4WFFD 4APQD 4QRTA 3VFTB 1DFBL 5I1DA 4HWBH 1I75A 3CFDB 1ZWIB 1J5OH 4OCWH 1YNTA 3BT2L 3WDJA 3QHFH 1FRGL 4DZ8B 2AJUH 4RWHA 1C16A 2DL9A 1RZ8B 3MBEC 2XI9A 5IROA 3RVTC 2H32A 2IBGA 1MCWW 3SKJH 1ZHLB 4N8VG 4LP5A 4PJGF 5DRWB 1T83A 3KPRD 1IRAY 4OIIL 1J8HD 3QIUD 5IBUG 3B2VH 1UQSB 1IC7H 5D6CB 3X3GH 3RI5K 4P2CG 3RWHB 1S7UB 1I9JL 4AH2B 1U8KB 3B2UD 3BQUA 3VWJA 4K94H 4YBQD 4NIKB 5EORH 1ZLSH 4PY7A 4X5WA 1QSEB 4LNRA 1GGYA 4WI5A 3JWDH 4IEFB 2NY3D 3O0RL 2QADC 3C6LA 1CT8A 3RL2A 3SE8L 1YMMD 5DQDH 3CUPB 3PDGA 2VDKL 3DETD 1OQXA 1NL0L 3JWNC 4RGNC 3UEZA 4UV4L 5DUPL 3ZYZA 5MHSD 2G75A 5MENB 1K9TA 3VMNA 1RK0A 3O4OB 5HI3D 4TVPH 3VDAA 5JOEA 4Q0XH 5T3ZD 1T20B 4HMDA 3ULVH 1DEEB 1GSMA 3QCVL 3MRBB 2VITA 3UYOD 3OB0K 1QSFD 1FHGA 2EE6A 3W81A 3MODL 5E9DE 1MFCL 1YY8A 3O8XA 4OTXL 4R3SB 2XA8H 4HMEA 2NXYD 1LP9E 2OX5A 1K4DB 2FEDD 3G9AB 1H3UA 3HI1A 1PY9A 4G80A 2UWEB 5IB3A 3MRNA 2VXSL 1EO8L 4KJWC 1HI6A 4J3UA 2EDNA 4WW1B 2HAZA 4I5BB 4QHMB 1NCCL 3HG1A 5T1KA 1I1RA 3PV7A 1XIWD 3QQ4B 2VLKA 4QRPA 4S11A 3LN5B 1U8LB 5CGTA 5L88H 3E3QC 3NN8B 1DQLH 1X6NA 3KHOA 3VWKD 4O2EA 4Y5XB 3C60D 4MZ2A 5EOCJ 4JFQA 4I0PC 5I16A 4XCYA 1G1CA 2VN7A 4UDTA 2IALA 4BELD 5DD6B 4FTVE 4G42B 2XT1B 3WN5B 2A73B 5JW5A 4G7YL 1XF5A 4XPHL 5GGQH 2BNQB 1CIDA 2X1QA 1KIPA 2ZSWB 5J06A 5FGSA 5IQ9A 1ND0B 4ZTPL 3VW3L 3LSOB 1GGUA 1JHLH 4LEXH 3OKOB 4PFEA 1MIEL 5F8RC 3AGVA 3EZ8A 1TJGL 4N0RA 3RVXC 4JVWA 1B6DA 2OP4H 4Z78B 3MBEA 4YBLB 3LS5L 1I3GH 5TJWK 3U30B 1U8HB 1BBJA 3BYYA 1JPFA 2KQNA 2Z4QB 4Z95H 1KPVB 3W9EA 1U42A 5FDWB 3B9KA 1TQCC 1XGYL 5BQ7B 2J5LB 2KBGA 3L9RB 5E08H 2WWKO 3ILPA 5I1KH 3OX8B 4POZC 4PJBF 4QHLB 4XC3L 2XWTB 3PWVB 2LFGA 5D7IB 3JTTA 4FQXC 1DR9A 1ZOXA 2WLZA 1A7BA 1KCRH 3FT2A 3ARDC 3G04B 3I50L 4E42A 4QRRA 2VLME 5BO1L 3P73A 2QSTA 4L3ED 3RUGE 1L7TL 4HWNA 5KVMC 1WTLA 2DQFA 3KLAA 1H3TA 2H45A 5D7JD 4YHML 5C2BL 4F8TA 1C08A 5F7EL 1A14H 2APTA 4YHPA 3SDCC 4YK4B 4W68A 1A0QL 4JFYB 3CDFA 1F45A 1KC5H 3DMMC 3MLZL 3KR3L 3NA9L 1HSBA 2PCPA 1IVLA 5JTWA 4M7KL 5D8JL 2VIRA 4JKWA 5CD3B 2CIIB 2FECL 3GIVA 3RWDB 4LKCA 2EXWD 2JCCE 1JPGB 3RQ3A 5AWNL 3C5ZB 3LKNB 3VGAB 4ODWB 4E41E 1JK8A 2D7TL 2E7CA 3NCMA 5FV2A 1BLNB 3MCLH 3KXFD 2I07A 2BC4A 2HJLA 1U92B 3EJJX 4OZIE 1ORQB 2WIIB 3TIDA 3HB3C 3Q3GB 4HLZH 5IW3A 3VCLA 1IGFL 5C8JB 4TUKL 1RUKH 2VLRE 3QWOB 1CFSB 1Q9WB 4PRNB 4OKVA 3CFCH 3V6OE 4JFEA 2C4FT 5F7FA 1NMCC 4HFUL 1CICC 1AHWA 1T5XA 4HH9B 5C0CB 1GGCL 4V1DD 1LGVA 1FP5A 2KDGA 1U9KA 4TN9A 2NX5B 5GIRA 1CFBA 1LEIB 5FYJD 1HXYB 4NQXB 6CGTA 1ZGLP 4YDLC 1PBYA 5DA0B 3HTLX 2ZCHH 4PRHA 3RPIA 3V95A 1NDGB 1UKQA 3MUZ1 5D5MF 1N6QL 4JFFA 4S0SD 2WUBH 4OBSA 4RQQA 1J1XL 1MF2L 3KPPB 1AE6L 1BOYA 4PJXE 4HKXB 3TH3T 3VGDA 1B9ZA 5L6YL 1QR1A 5CZVL 4RSVA 4U0RC 3S4SG 3HNTH 4OZHB 1SBSL 3VFWA 1HH6B 3AFLA 5D1QB 2VSDA 4DN3L 1B4RA 2WUCL 2H9GA 5TDOA 3QUYC 2Y07L 2YUVA 1FVEA 3LKSA 3TZVC 4AT6B 1G7PA 3UTPE 5DZOA 4UUJB 5H37G 4GG6E 4O51A 4DVBA 2J8HA 3QIWC 4S1SH 2WLYA 3K8LA 1SM3L 4L5FH 3BPNC 5K9OA 1RU9H 4Z7OE 2OLDA 1FZJB 5EU7C 5FB8B 4CNIB 2FR4A 4EN3B 2O5ZH 4PRAA 4KROD 5DMKA 1UJ3C 2J3SA 5CEZH 4WGVB 1NANH 1UXWB 2XTLA 3O45B 2X7LA 1XR8B 2G60H 1OTTC 2BNRA 1NBQA 1UWEL 4I1NB 4Z7NE 3V5KB 4ZFFB 4PJ8B 1H15B 5IESH 4TYUA 1JZ2A 4XPBL 3W0WD 2H1PH 3H9SD 1ZVHA 1RD6A 3ZTNL 4DVRH 3FO2A 2F5BL 1OD7A 2H8PB 4ZDHA 5JMOC 1CFNA 3IDJA 4KDWA 3OKKB 4RNRA 2XTJC 3DMMA 4XI5C 5KVEH 5LAXA 1A3RL 4DCQA 3UZQA 3FL7A 2VL5B 3MA7B 1L0XA 3VXRA 5E24E 2CD0A 4I3GA 1U8QA 4PLOB 5C07A 3TT3L 4LEOA 1HHIA 1H3VA 4EI5B 4KKNA 3O4LD 5EIIA 2CRIA 1NDMB 2PO6C 1YJDL 3UC0H 1BAFH 3EYOB 4JG1L 5HDOA 1NLDL 1JGDA 3KG5A 5DMYA 2HJFB 5BRZA 3PIQA 4MD5A 2F54B 4LMQE 1KBGH 1M6OA 1MCBA 3GRWH 2WWMD 1T22A 5EFIB 4HX1A 2B4CL 4YHLL 4MX7B 3PQYB 3T2NL 4F7EA 2GKIA 4X99A 4KZEL 1T2JA 4LOUC 5D71H 1P4LA 1CICA 1A6AA 4NQDA 4H88H 4FQPA 2GJZB 1QO3B 4ZAKB 4PJAB 4AEIH 4S1DC 3BKCL 5DRXB 1AC0A 5TE4H 1I3RA 5K59F 3UBXA 1ZA3B 4LPCA 3ZDYE 3NPSC 4XX1E 5C0DB 2MMXA 5KVGH 4P2RA 5FYKE 1WIUA 1YEKL 3MXWH 4G9FE 3OJDA 3FFDA 2CK0H 1A7NL 4UQ2A 4XWOC 1NFDF 3QEHB 4LU5L 1G7HA 4WFHE 3TPUA 1UCBL 4HAFA 5E8DL 4F58L 5C0BD 4NO0A 1KTLB 5EUKA 3U2SA 3QUYA 4Z7WE 1T7VA 4NZRL 4D8PB 2H3NB 2C9AA 3TZVA 3QBTB 5DTFB 3CVHH 3PL6C 4L8DB 5C0ND 5LGHL 2ADGB 2X4QA 5JW3L 1RZKC 2XFXA 4MXVF 5A16A 1BZ9A 4KVCH 5M95B 1XGUB 4HPYH 3W39B 4XP6H 3MO1B 5E8EB 1S9XB 4PRBA 1UJ3A 2NW2A 3JV4A 2WP3T 2WQ8A 3LD8C 5HY9B 4FQJH 4HMCA 3U9UA 3KYNB 5DJXA 3MUGB 4RX4A 3W82A 1ZS8A 2Q3ZA 1SHMA 1VSCA 2P47B 3VXOA 3OB8A 1LO3L 1EVTC 4DGYH 5FA3B 3AMKA 3HPLA 4K8RH 4QXTA 3SE3C 3GUTA 3OHXA 2XN9A 1YEFH 3SY0B 1XH3A 2B1HL 4NZJA 4QOKB 4OAWA 3HRZA 4AIOA 1QBAA 1N0XL 2X70A 3T3ME 1J1PH 3A6OA 1S9YA 2QQKL 5DWUH 2D7NA 4KJYB 2NW3A 1VERA 5JHDE 2HT2C 4NKQB 3R06B 1ZGLA 2XQBL 5EZIL 5GHWH 4P4KB 2K9UA 3BAEH 4ONGL 2XOTA 5DRZA 5FCUL 2YN3A 4MAUH 3U1SL 2P46B 4GAYA 3C5SB 3NGBC 1BF2A 1H0DB 3JVGA 3HR5B 3QH3B 4MDJB 4R26L 5JDSB 4TRPL 5TPWH 3MUJA 3DOSA 1FE8L 2RBLA 3ES6B 3GBNH 4ZOCA 3BZEA 5HYSG 3TBYB 2PO6A 1MH5A 1IAOB 2AS5M 3HZVA 3F58L 4W6YB 1QA9A 4FXGB 5DLMH 1JNJA 2OXHA 3ARWA 4CMMB 5C70A 1A02N 3LOWA 2D31A 3CFBB 2HTLC 2DYPA 4FFYH 3GGWA 3PGDB 3U4EA 3CLFL 4DOHE 4HS3A 3QDGE 4GW1B 1V05A 4XVTL 5TH2B 5JHLL 3EDKA 5FHBL 4GSDL 4PJ5E 3CH1A 5ANMB 1IM3A 5DJYA 3SJVE 2J8UA 2NY5L 4PTTA 3BIKA 1JI2A 2C3VA 3RVVD 1IKFL 2HFFB 4RMTA 3QCTH 2LTQB 5IW6B 1VEOA 2I5YH 3G08B 1WZKA 3GMPA 2FYYA 4UINL 1DDHA 1UFUA 3WFBL 3LVEA 4CW1A 4M61A 3K81A 3V5DA 3ZDZF 3QNZA 4Z7UE 4HLZG 4LCIL 5ENWA 1JVKA 1OARH 5DSCA 3FO9B 3L5IA 4ZSOB 5ITBL 3BP5A 3L3HB 2DL2A 4YBLC 5I8EB 1MFDL 1BEYH 5I1LA 1CQKA 3DX6B 1VHPA 1EERB 3OKDB 3PL6A 5JIIA 1P7KA 3QEQB 4LSRH 1OAQH 2HTKD 4PIRF 4R97B 4Z18A 1F4WH 3GSWA 3QSKB 1IQWH 5DMJB 1J11A 4P57A 1J1OL 4OGXH 4HKJB 4HUNB 3QDMD 3QUMB 4GJTB 4U1MA 1FNSH 5IVXB 3T0EE 2CKBB 4GXVH 2MQCA 1T21A 1AXSA 2DWEA 4U1LB 2BFVH 5EZOH 5IR1B 1F4YH 2Y06H 3D3VE 5L8KB 3GMRB 4RWYH 35C8L 1AQKH 3GK8L 1NC4B 5KOVC 4Z0XB 4Q6YA 1JZ7A 1N0LA 3R1GL 3LRGA 4NO3B 1XF4A 1T5WB 3SE3A 3QNYB 5C0EA 5E6IB 4D0DB 2NQCA 4LAQH 3V52L 3T77A 4G5ZL 3VFUA 3DSFL 4A6YH 2R69H 4PP1C 2R2HA 1AO7A 3ZT7A 3RWIB 3H42L 3SDXF 1OTUD 2HJKA 1EGJL 3HUJE 4O4YL 3LKQB 2YXFA 3RKDC 4R9HA 5J1AA 1BZQK 2FD6L 3LDBB 2ICWJ 5GS0C 4LASH 5KW9L 3L5HA 5DI8B 5GS1B 2DQDL 3C5ZC 1JHTB 4LLQA 1FAIH 3MYJA 3U7WH 3LHPL 4KHTH 4LQFH 5HHOD 3HC4L 3N85L 1LEGA 4RMUA 4F7PA 3BO8B 3CU1A 5C08B 5ID1A 2GK0B 1E4XL 3FQNB 4Q6IB 4EDXA 1XT5A 3G6DL 2BRRL 2X4RA 5CIPA 4PY8I 5JNYA 2AK4A 1FN4B 4PJCF 3UPRA 5GGSA 1DBBL 2CUIA 3Q2CA 3NTCH 1SVCP 4QNPE 4NO2A 4Q2ZB 2X89A 1GZPA 3CDYA 5SWSD 1CL7H 5FO7A 4OD3H 1U8PA 2IH1A 2BVOA 4ONFL 2PR4L 4J6RL 1B3JA 2EH8L 2HFEA 3ZTJH 5E99H 2EEBA 4G8EA 1SY6H 5FUZH 1FIGL 4P3WA 4LCCC 5GRYA 2AJYL 4G3YH 3AROA 4JN1L 2RAMA 5I1AB 2GFBA 3QXDB 3DVGA 3CVIH 5I8KL 4H5SA 4HGMA 3ARBA 2X1OA 4Y16B 4J3SA 2P5ED 1UGNA 3HZKA 2NR6C 2IPKB 3GJEB 3TO4C 1J10A 3VDCA 3SHSA 2Z91B 4DK6A 4K9EH 5I0ZA 2VDPL 5D1QC 3TBTB 1KPVA 3H7BB 3EGSB 2HLAB 1SYVA 3F7YA 2FJHB 2PYFA 1IC1A 4LLWA 1CIUA 1DLHA 3GBML 1AGEA 4HV8B 5JPNA 5F7HA 5FGCB 2UY6A 1S9WA 4PJDB 5E8OA 2V5YA 3MROA 5ETUA 2ARJQ 4YE4H 5IFJB 1A6WH 2EYSB 4FOMA 4GLRI 3B6SA 4JFZL 1VGKA 4LCWB 3VRIB 1LO2H 1BQHG 4HWBL 3VFMA 4Y4HB 1RY7B 1W8OA 1G9NH 1J5OL 3P30H 4R4BB 4OCWL 1MFEH 3QHFL 5FHAH 2AJUL 3MR9B 2P48B 5CSZB 2HFTA 2QL1A 3SKJL 4JZOA 3IKCB 2APFA 2EXYC 5C09A 4FXKA 1KJ2A 2IBBA 3LPGA 3B2VL 3CU7A 5B21A 2W38A 1IC7L 4PJEF 2I27N 1R3HA 2A77H 5HI5D 3X3GL 2ZOKA 5EU3B 3MGOA 4R4ND 3EO0B 3LRSB 4UT9H 1T1WA 3MJ7A 4K94L 1S78D 1EIBA 3S9DB 5EORL 1BBDH 1UACH 4GRWB 1ZLSL 4WU7B 4QGYA 4UMGA 1KIRA 4KKLD 3JWDL 4NRXA 4P2QA 5A2FA 5E4EB 3L3IA 2AXGA 4X6BB 3EHBC 5DQDL 1A9BB 4NCC2 4RMRA 2CQVA 3EYFB 4FFZH 5ISZA 4JR9H 2AEIT 2AJ3B 3RNQB 5IB4B 4TVPL 1PY4A 2NY4B 2WK2A 3ULVL 2VXVH 3ULUH 5D7LA 1NAMH 5C0CA 1FFOB 3HMXH 1U3JA 4ZO6A 4ZAKC 1WBYB 1UZ8A 4C56A 5FECB 4EI6A 3RU8H 2H6PB 4LCCA 4NQXA 3PDOA 1RZFH 2XA8L 1RJLB 1DBMH 5ID0A 2W9LA 4PJGA 4YPGB 5ADPH 2HT3D 4RMQA 3MFFB 4H8WH 4NKDA 5DHVA 2VC2L 2H32H 1I7ZA 2Y6SC 3CX2A 4XMPH 3TO4A 1ZA6B 4YC2C 2GY7B 2G5BA 1T1ZA 3HG1E 4L4TA 3S88H 1TCRB 3QFDB 5F1SA 1R0AH 1HHKB 3ZDXE 3N9GH 1AI1H 4FQIH 4F15C 5SWQA 1DQLL 1T89A 3EFFB 5CKGA 3W5MA 4JY5H 5LXGL 3QHZH 4PB0H 5T3XD 2L7UA 4K3HA 5HGAB 5BXFA 5J56B 3L3DB 3X14A 5GGQL 4ZOAA 2FB4H 2YPLB 5HI4D 3FQTA 2NZIA 3BMVA 1TETH 1A4KB 4IS6A 4JREB 5CHNA 5GGRA 4I4WB 1JHLL 4LVOC 4LGRB 1OGAB 4AG4H 4YFDB 4D0CB 5IMLB 4PGBA 5FOBA 2D2OA 5KSBB 2OP4L 2IPUG 1U95B 3MRRA 3FAWA 5EIVA 5C9JA 2H26B 4NNPH 1I3GL 4QTHA 5EU6D 4QO1A 4Z95L 5IHLB 3W5NA 2J4WH 1T3FB 4MS8D 3U83A 5E08L 2GJ6D 4UAOC 3DX7B 4PGCB 5CP7B 2NCMA 5I1KL 3GBLA 1DQTA 2CRMA 4GKSA 2OR7A 3GMQB 1TVHA 2ICWA 3ORJA 1S7QA 1I1AB 1SMAA 3DVNA 3S97C 1KCRL 3H9YA 3IFPB 1E6OH 4HWUA 4X5LA 3ZKXC 2FEDC 3MQIA 4LKXB 4QRRE 3TT1L 4M4PA 1NSNH 4UU9B 1PKQA 4GBXB 4XMKH 5J3HD 4PTUB 3QHTC 3GMNB 3GNMH 5FM8A 2V2WA 4RGNE 2DRUA 5ERWB 2IBZX 4PLKC 3OXSB 3LKRB 1MCOH 2VLJA 5LG1A 1A14L 5BV7H 1KB9K 2NX5D 2Z8WC 3FT4A 1FYTB 2R1YB 1XIWC 1MWAB 2C1OA 4B7LA 1O7SA 4HKZA 3IXTA 3LQAC 4H26A 1KC5L 2VRAA 3CDGA 5F70A 2IFGA 3VWKC 3C60C 4UV7H 1ED3B 4OGZA 5CJOH 3REVB 4OZFB 1A7PH 3KPSD 4ELMF 3KPQA 3HI5H 2LTQC 2XKUA 3MRLB 3MCLL 4M3KB 4G8FA 4XXCA 4CN6A 4MNHB 3PWJA 3VH8G 4HK0B 4IMLA 1Z9LA 3CX5K 3O4LE 1MCDA 5MERB 3K4AA 1R0AL 1YC7A 4OD2A 2Y25A 4M02A 1A6PA 2VYRE 3K3QA 4PJBA 1RUKL 4NO5B 1PYWA 1GHFH 2MPAL 3CFCL 4LCUB 3FAXA 4FFVD 2PW1A 1KEGH 4LAJH 1CTOA 2APBA 2P5WE 3ARGB 4UTAH 3KPRA 1MREH 3CFJB 4R97C 1WV7T 2ICEA 1J8HA 1UKTA 4ZNEA 3DI2B 4BFBD 1P7QB 5LBSH 5EBMB 5C7XH 3IJSA 4YIQA 2ZCHL 4Z5RA 2VXUH 4PJ8D 1RJYA 2MJWA 2CLRA 4JFXB 2D0FA 4P46D 1E27A 3OG4B 3QNXA 5D6DC 5HHPB 2WUBL 2QR0A 4MSWA 4MNQA 5E6IC 3STZA 4WUUE 3D39B 4C4KT 3HNTL 5DC4B 3BYTA 1PG7X 5IP4A 1MHHB 3MLTB 4W81A 1YMMA 2R0KH 4RIRB 3KPTA 3R0NA 5I8OL 2E7HA 4KDTC 4MD4A 1EK3A 5D2NE 1ETZA 1FZKB 4YDVB 3GI8H 1F3RB 4S1SL 4JQVC 1I4FB 2LAGB 3HNSH 1L6ZA 4L5FL 3PXHA 1RU9L 3KPNB 3LB6D 5E00A 2FHFA 4LNVA 1QSFA 1CQYA 2O5ZL 4UIKH 1OP5H 4M7ZB 5E5UB 1Y6NR 2G60L 2BNRE 3UMTA 2HMIC 2CKNA 2FBOJ 2CO6B 1N3NA 5J13C 1LHZA 1T1XA 4FXGA 3PQYD 5AYUH 3MX0A 2BMKB 1EBPA 5B39B 5IESL 3UTTB 2HA1A 2H1PL 5FXCH 1VGEH 3PGDA 5ICXB 1JZ3A 1Q9LA 1X5XA 3WJJC 2D7PA 4OLXH 5J6HA 2P24A 5DRNA 1XIWA 2APXA 4NKMA 1WUNT 1LO5B 4M4RA 4QHNB 5KVEL 1NBZB 5IQ7H 3VWKA 4OCYL 3C60A 2GTZB 2V6HA 1DLFH 1ZK9A 3DTXB 3FQRB 2CMRH 1ZAGA 1VKXA 4OCMC 4MA3A 4KKAD 2Q6WA 4EQ3A 3O41A 3IFOA 3UC0L 2NY2B 5FK9A 1BAFL 1QVOA 3HE6B 2RFXA 2BHZA 1JNLH 4Y16C 2KH2B 3EJZD 3PWLA 3CXDH 4N90E 1KBGL 5ILTH 3GRWL 1UCTA 4QKXB 3B9AA 4NHCH 1U6AH 4N8VB 1XGTA 5JPMA 5D71L 3QEQA 4X6DF 3QG6A 4H88L 3NZ8A 3BW9B 5IBUB 5SX5K 2Q20A 1JCKA 4AEIL 8FABA 3QPXH 4IJ3C 5TE4L 1CR9H 4YHNA 3P9MB 2F53B 3GDBA 1UB6B 5KZCD 3QEGH 4P2RE 5KVGL 4ZNCD 1OGTB 5BVJB 4R96B 3MXWL 4OJFH 2CK0L 4MQXC 4N8PA 4WTZG 1U8JB 4CADB 4QOKD 4CL7A 4JY4B 5K9KA 2VZSA 1RJCA 3S96B 2AQ2A 5ESAB 3MRHB 2DQCH 3NACH 4G8GB 1JYNA 1KGCE 1S8DA 1DQJB 4L3EA 3IVKB 3E6HB 1MVUB 4XAWH 3D18B 4KDTA 5D7JA 3HZMA 5DFVC 3CVHL 2IANB 3QQNA 4Y1AD 5EU7E 4HPYL 4K3EH 4ETQA 4XP6L 3PWPE 5J6GA 3FB6A 3HC0B 4PJHA 4LIQE 1TXKA 3NCFB 3SDDD 3SCMB 5KN5A 2FHBA 1N6UA 5F1IB 4FQJL 1DN0B 4JPIA 3QDME 2EDLA 2ENYA 5F44A 5AG9A 2NY0B 4G6FB 3CJJA 1JRHH 1FFPA 5IB2B 3KXFA 4PRDB 4KJQD 5D72H 1O5DT 5EC2B 4NC1C 3C9NA 2CXKA 3FQNA 1YEFL 3CC5B 3WJJA 3DPBA 5L2KE 1MCHA 1J1PL 2XTJE 5DWUL 1X5AA 2WWMC 4D2NA 3QO0B 4WVRA 4ZFOL 5KSVA 1EO5A 5GHWL 4RFEA 5HVWA 4P0DA 1NFDA 3TA3B 3BAEL 5EU4B 2BXYA 4JFDD 1KJVA 1ZLWK 4MAUL 4HWEH 2DOCA 1KJMA 1IAIH 2DWDA 1T0MA 5FUOH 3RL1B 3AAZA 3S5LA 5TPWL 5DURB 3MLYH 3TJHD 4KI5D 3QXDA 4L4VA 4I48A 3GBNL 2Z31D 4IRSB 5FO9B 2NY1B 1I7UA 1WSST 5DK2B 3LZFH 1NEZA 3QULA 3EUUA 4Y16A 1YA5A 1A6ZB 4HAGA 5DLML 3EBAA 1ACZA 1B90A 3G5VA 1XZ0A 3CZJA 3GJFK 2EIZA 4FFYL 1IZJA 3MRGB 4LIQH 3ZKMC 4HUWA 4OCRH 2X4UB 4HQQH 1KIUA 2EKSA 3MRIA 4BH7B 5EIQA 4OZGA 2J8UE 3TIEB 5C0NC 3A6CH 3FFCB 1QP1A 1UM6H 3BKJH 4KV5F 1NC4D 4ZO8A 3QCTL 1IGCH 1UH2A 2I5YL 1ZHKB 4Y2DD 1WBXB 2UUDH 4L1HA 4JREC 5GRWA 1LD9B 2O5YH 5L7XH 2BOBB 2EDBA 3MPCA 3VA6A 1OARL 2HN7B 4JGUA 5E2WH 3LN4A 3HLAA 3QCUH 4PJFF 3W0WA 1BEYL 1QBBA 4XH2B 1YPZB 1YQ2A 1W0WA 4ENED 1GJIA 5IMMB 3RNKA 2YPKB 4LSRL 5DDHB 4BUGA 1OAQL 1ACYH 3KWWB 1GGIL 4J12A 4JY6A 5F9WB 1F4WL 1IQWL 3WO4B 5EWIH 4OGXL 5GRZA 3MRFB 4FZEH 4R7DA 3ROLA 2A1WL 1FNSL 3OKLA 3EO0A 4GXVL 5IK3B 3B83A 1G7JA 1TFHA 2BFVL 3BEWA 5FKAA 5EZOL 1F4YL 4I2XB 1QSEE 2Y06L 1I1AC 1NC2B 1SJXA 2VE6B 3D69B 4YGAB 3BI9X 5IBLD 3UZVB 1NJ9B 4BZ1H 5C6WH 1A6VH 1EO7A 4U1HA 4GBXC 3KLHD 4R2GD 1JV5A 4LAQL 2IPTH 1PKOA 4RDQG 4YWGH 5C0AB 2EH7L 5HXMA 5MENE 4A6YL 2R69L 4LVNC 5IB4A 4LHUA 3QDHA 2W65A 3SQBA 3EYQD 1Q1JH 3BHBB 5I2IB 3BWAB 3RVUD 1KN2H 2C1PB 3D85B 5MI0B 1QEWA 2YSSA 4N0UA 4OFIA 4YNYA 1BIIA 3U0WH 1NCTA 5J12B 1CN4A 4LASL 1IC4H 1CVRA 3STLA 4GAFB 4C57C 2ATPB 3IAQA 4N0YH 1G7LA 2UWEE 2I9TB 1FAIL 5DHXB 4Z7VA 3U7WL 4KHTL 4LQFL 1K3ZA 1EEZA 1FH5H 2NXZC 4XVUC 1A1OA 1ZA6A 3G5ZB 2ICES 1XF3A 4YQXH 3S4SB 3ZKSD 2IADB 4WHDA 4IOIB 5I76A 1M7IA 2BRQA 1HQ4A 5C0BA 4NQED 3WFCH 1JZ4A 5B3JE 3NTCL 1ZT1A 1X5KA 1MCLA 3RPKA 4RAHA 1YUHA 4OD3L 2N1KA 3DWTA 4ZUVA 5E99L 3O6KH 5FUZL 1UC6A 4Y5YB 5FUCC 1TZHA 4LCWD 2BNQE 1AIFB 5JXAH 3DX9B 1N8ZB 3QA3A 4H25A 3TBVA 4I18B 2P49B 2EYTB 4WI9A 4KH2A 3MNZB 1MJJB 2BVTA 4KUCD 1BIHA 2VR4A 4NUGH 1YEGH 2G5RA 4DUVA 3WFZA 5KSBA 4M3JA 1GC1H 4OM0H 2VABA 3OJ2C 4K9EL 4PUBH 5EZJB 5J8OA 4JZJB 3O3EA 4F7MA 5F9JA 1CGTA 1EV2E 3BXNB 1J0YA 4E0RB 2PYEB 3WFEH 3MNVB 1U8OA 2SEBB 3MNWA 1W0VB 5IJVB 4PGEB 5IHZB 1T2QH 2R23B 4M8QA 2CLVB 4P9MH 4YE4L 3ABZA 1JL8A 3P9LA 5D7IE 1C12B 1A6WL 4PJCA 1P5UA 1KYOK 3MV8D 4ODXA 5IFAH 3WIFB 1Y0LA 5CINH 5IOPB 5JOFA 3QQ9D 5HVFB 5CIPH 5HYJB 4N5UA 1X5FA 1LO2L 3IYLW 4UT7H 5L9DH 1NCUA 2Y4SA 1G9NL 4PYGA 3GSOB 3P30L 1JUFA 1RFDL 1MFEL 4JRYA 2EICA 3L5XH 2NY4D 1MQKH 4PV9B 5IIEB 5FHAL 5A43C 2A0LD 4HJGB 4L3CB 3QG7H 3VXMD 4R7NB 1B0GA 1J05A 2B4CC 3QI9B 1YN6A 4QRQB 1NUNB 5C09E 4P23B 5ICZA 5J1SC 3E6FA 5HVHB 1E6JH 4HH8A 3D5OF 2A77L 4U1SB 2UYLB 1GZQB 3L6FA 1KB9J 3VRLF 1RIUH 2FSEB 4MNGB 5BW7A 1U8NA 3T0AA 5GZNC 1BBDL 1UACL 2OTUB 4XNQA 1XCTA 4X6CA 3D25B 4P2QE 5IB1B 1M7XA 3WS3A 3HE6C 3TBWB 4Y4KB 5INCB 5C0IB 3FKUS 2W9DH 4EQ2A 3WBDA 4ESKA 4XNXH 1SYSA 2X6MA 3UBXG 5KG9B 2VJXA 5ISZE 4FFZL 4JR9L 25C8H 2YD5A 5AD0A 1C5DB 4XB8A 1AD0A 4C83A 3PNWB 2VXVL 3CX5J 5D7LE 3ARFD 3LCYA 3ULUL 1NAML 5C0CE 2YPLD 4YHKH 3HMXL 4C56E 4LSDA 1IAMA 2NY6B 4M93B 2W92A 3T0VA 2R0ZH 3RU8L 1FL5B 1RZFL 1V3KA 5GSRA 1DBML 1D6VH 4HUMB 3UO1H 2YR3A 1MHCB 5ADPL 3PHQB 1CTNA 5B22A 1FL6A 2D7QA 1HHHA 5JZ7D 3D0LA 4H8WL 1FVCB 1U3YA 2VZTA 2CIKA 5TDNB 1D5ZB 4XMPL 1K5NA 1XGRB 2HLFC 1KJ2H 3N1PC 4OZHE 2FECI 2KL6A 1ITBB 3S88L 4HJJH 4FQ2H 3VFRB 4RMSA 3IU3A 1TVDA 3RZCD 1FBIH 1H3GA 1T04A 2ENSA 3DV6A 5F7YC 2Q8AH 3ZE1E 5GS0H 3N9GL 1FZOA 5CEXA 3E1F1 3U7AA 3O6FD 3TVMC 4FQIL 5FFLA 1WEJH 3PWNA 1QFUH 3HZYB 4OFYD 4JY5L 2ZP0T 3QHZL 3EJYC 4PRPD 2OTWB 2ITCB 4PB0L 4WEBH 5F6IB 2VQ1B 5ESVA 3WE6A 3PHOA 2M2DA 4KUCF 1HN1A 3G6JF 3PGCA 5HHXH 2QHRH 2BY2A 2FLRT 2FB4L 1RJZA 3SCMC 5K9QG 1Q94B 3QDAA 2VAAB 5ECJE 4C55A 5HYSB 3D6GA 4AG4L 4ZS7H 1D5BB 1U93B 2FX9H 3T1FB 2GAZB 1RZ7H 3T0BA 2FX8H 5HHOA 3B9VA 1G0DA 1V7NH 1CDCA 5TF0A 2FJFA 4GW5A 2X5PA 3VE0A 4FTVB 1R24B 4NNPL 4OFPA 4HXBH 4XNYH 1CLOH 4NBYB 1K3IA 2BP3A 3MRMB 3IGAA 4UBDD 1D5MB 4X4MA 3L7EB 5J9PB 3BUTA 4NRZB 2J4WL 4PG9A 1J8KA 2MKLC 4XZUB 1J88A 3RDTB 5DHVH 2MHAA 2NY5C 5D7KE 1RHHB 5E1AB 2W60A 3FMGH 3CGTA 3L3KA 3SKMB 1EUUA 1T4KA 4BKLA 1E6OL 2XRAH 3VFNB 1P84K 4IRSC 4H1LG 5BZDB 1QRNB 1JWSB 1PKQE 1NSNL 4KRMB 4XMKL 3GNML 2F54E 4KRLB 2P5EA 3LEXB 3ARGD 2H2PC 4IRJD 2OR8A 1MCOL 3GIZH 5CWSA 3VGHA 4YFEA 4X7TA 1QBMH 2QBWA 3JBG7 5BV7L 1OLZA 4JCMA 1BVKA 1AGFB 1CF8H 3HRPA 5F7MC 3AMLA 4PJAE 3HS0A 3SQOH 2E9JA 4LHJB 3G6AB 2KPNA 2C3WA 4W4NA 2FL5A 3Q6FA 4LARH 4ZUWB 4JZNA 3MC0A 3LPWA 2A9NH 1GIGH 5CJOL 1UVQA 1A7PL 1B6UA 2V7NB 3LKPB 1C5CH 4KMTH 3HI5L 1U91B 3RUGB 1CS6A 2JJUA 2PKDA 3WXWH 1T1YB 4LLUA 1VFAA 2OMNA 3GSVB 5EN2A 4KZDH 2YD2A 2QKIB 5I8CA 4PJ7A 3WO3B 3BP4A 5GGTA 3B9EA 3BZFA 4ELKB 3PV6A 3NPZB 1OT1A 1Z5LA 1GHFL 2LAAA 3TVMA 1KEGL 4U1KA 3CNKA 1QLFA 5TDPB 4OLZH 2JCCB 4E41B 4UTAL 1PDKA 1MREL 5F9WC 3WO4C 2NTFA 4DFIA 5HJ3B 4PYHA 1FNEB 5LBSL 5C7XL 3OB0H 3JTSB 5F3BB 3AB0B 1EMTH 4G8IA 3TH4T 2VXUL 4LCYA 3UTTD 1LE9A 1R3IL 4UIMB 4RBPK 3SO5A 4YGVA 5C3TA 3F7VA 3VXUD 4MNQE 3MLXH 3MSPA 5GRVK 1FYHB 2W1NA 3QUKA 1LQSR 4LLMA 4OIBA 4PBVC 5J3HC 4ELMA 4O2CA 2R0KL 1BZ7A 3KPMA 1QPPA 3IF1A 3GMMA 1CD1B 3ILQD 2R2BA 1F3DH 3GI8L 1RSFA 1TTUA 3HNSL 1AGCB 1ONQA 1IGTA 3NZHH 4MJIA 4P99A 4YX2H 5SWZB 4PJXB 1T66D 5DXWA 1NCBH 2NY2D 3MRCA 4XBPB 4UIKL 1S5HB 3FJTA 5I19H 1A5FL 3DRQB 4N8CH 4KK9C 3OPZH 2DKUA 1S7RB 3QZWB 4XXDB 1UWXH 1QFHA 4JFPB 4OFDA 1U3HB 3EYUH 4Y0GA 5AYUL 4ZPTA 2LVEA 3MV9D 1KXTB 4XRCA 5E8NB 4YR6B 3FHQA 5IG7A 4N9OB 1F90H 3ZHLA 2F19L 1VGEL 1WTGT 3TN0D 3T4YA 4OLXL 3U36A 3HFMH 1IGJB 4OLWH 5DS8B 4LFHG 2V2TB 5DD3H 3H0TB 2X4UA 5EOTB 5IQ7L 3VFSA 1V3JA 5DJZA 1A6TB 2CR3A 4PD4K 5CGYD 2ED9A 2YD6A 2EEAA 4MLIA 1DLFL 1JNHA 2BDNH 2BY1A 3L3GB 2CMRL 3FN0H 5J0BA 4I18C 4G8GD 2ZZUT 3GMLA 1F4HA 4HWZA 4RRPA 3VFGH 2R9HD 1CDUA 4KI5E 1HKLH 3Q6GH 5SV4A 1Z3GH 1X6LA 1JNLL 4I3SH 2BVPA 3K1KC 5F71A 5F88A 5T3ZH 5FF6B 3CLEH 4KHXL 2IAND 3CXDL 5INDB 3WLWD 4NHCL 1U6AL 3T4AA 3LQZA 3CVHB 1K2DB 5EU6A 2F8XC 3QEQE 4LBEB 5LCVH 4NJAH 1VADA 1VB9A 3PP3K 3W11C 2Z8VC 4P3CH 3QPXL 3UTSB 2IJ0C 1CR9L 4J2XA 5C0GA 2GJ6A 5IVXE 4G6FD 3QEGL 2XNAA 1KPUA 1OAKH 4MMZC 3LB6C 4DEPC 2GW5A 4HKBA 4P5TB 5CBAB 2P8PA 4GG8A 4FMKA 1S7SB 1MI5B 2GEEA 5L2JA 4TSBH 2B2XH 1Z9MA 3MZGB 2VOTA 5DD0H 3LQAH 3CSYB 2JB6B 1IEHA 2DQCL 3NACL 3S98A 2AJZA 1TTGA 1WVZA 2C7UA 5EC1B 4F9LC 4PS4H 4ALAH 1A6UH 4WO4B 3QR2A 5E5RB 3TA3D 4XAWL 4L8SC 1EPFA 5DJDB 1NGXA 3PE9A 4OV5A 2ZCLH 1A47A 4ZFOB 3VXSD 3I75A 1PZ5B 1WLHA 4MQ7A 4P23C 4F7CB 3UDWC 1VFOA 5DQJB 3WNPA 4IHOB 3BVNB 3IDGB 4XCCH 3T8XA 1CE6B 1X4XA 3K8MA 1HCFX 4HPOH 4PJHE 2NY1D 4CMHB 4WI2A 4OGAC 1NBYA 5T1LD 2YC1A 1I8KA 4TULH 3A67H 3NABH 3DURB 2OI9C 1AP2B 4X6DA 3BRGC 1IBGH 1JRHL 3O9WC 4QYOB 3U79A 5D72L 1V3MA 1KTDA 1NMAH 5C08E 4WFEE 4WI8A 5DVMA 4Y4KC 3MBXH 1OSPH 1ZXQA 2M8XA 2D7MA 3QJHA 2ADFH 5HYQA 3VFPB 2VDQH 1FNLA 4WJ5B 3EJZC 4KKCD 3CK0H 4ISVA 1FZMB 1BD2D 3FFCD 3L95A 3UTQB 2VXQH 5DJCB 1KG0B 1FO0A 1WIOA 1YMHB 2Q7NA 3X13A 1NFDE 1A3LH 3F12A 1QACA 4JPVH 1K4CA 5D9SB 4ZPVA 4ODUB 4A2MA 4D0BB 2NY6C 4M93C 3WYRA 2YUWA 4HWEL 5D96B 1CXKA 1EEUA 4YZFF 3DUSB 1IAIL 1LK2B 3DX9A 4AM0A 5FUOL 3S35X 3UZEA 3BPCA 2DD8H 4Y4FB 1NCWH 3MLYL 4L4VE 5D2LF 3TJEH 4CVZB 2Q1EA 2OL3A 3H9ZA 5GSVA 4RMVA 3MLPA 4BH8A 2A74A 4P46A 1EHLL 2DM7A 3HAEA 1T0NA 4HS6A 5D7SH 4K7FB 3UYRH 1L0QA 1ZEAH 4NKIH 3DROB 2OZ4A 2BSRB 5MEOB 4AIXA 5IBTH 1NGYA 5MEPA 4W6WB 4LIQL 1ZANH 1DUZA 2AJSH 2GSIA 3CFKB 4OCRL 2Z93A 4HQQL 4FQHB 3CPLA 5FGCE 4OZGE 1QPXA 4ZUSA 5IJVA 2E27H 3A6CL 5KS9F 4PJDE 3MRQA 3D2UB 4XBGB 2IH3B 2G2RB 3L5WB 5DJAB 1IZKA 2VISB 3BMWA 1IGCL 4OCSH 5JW4Q 4YHIA 1XF2B 2GUOB 5HYJA 2O5YL 5L7XL 2HKFH 5AZ2H 2OXGA 2Y72A 1JN6B 1CDGA 3LEYL 3RGHA 4S1RH 5IFHH 2GIYA 1DUYA 3SO3C 1QG3A 1MCKA 5E2WL 1TZIA 1JWMB 5D1ZB 3TBSB 3QCUL 4X0KA 4I9WD 2X4TB 4A6YB 3RRQA 2V9TA 1M71B 2OMBA 4L8SA 3D85D 4OSUL 4CAGA 1CFQA 1DVFD 1ZVYA 2F15A 4HUXB 5FYJH 3UDWA 3MCKB 1ACYL 5DJ8A 2EZ0C 1X9QA 4GQ9H 5JLZA 5E94A 1BQLH 2FH6A 4O00A 1N26A 5EWIL 2B39A 1NPUA 5I1EH 4JHWH 4Z7UB 4MNGA 4HUUB 1TIUA 4GRWE 3R0MA 3OJMB 4AIZB 2XXCB 4U3XA 4LLYB 2OTUA 3O9WA 3D9AL 4F57H 1S9KC 2RQ8A 4TUOA 5HHQB 1PEWA 3P11H 4NC1E 5F97E 3VH8B 4BZ1L 3DVFA 1A1MB 1A6VL 3EZJB 5IMOB 4N0FA 4PLNC 2IPTL 4YWGL 4YO0A 3VG9B 4DW2H 4WW2B 1C5DA 4X8JA 1X5IA 4NN5B 5DJ0A 1HOCB 1SBBA 4OQTL 2VUYA 1Q1JL 3D3VB 3BJ91 3O3DB 1YZZA 1KN2L 3CXHK 4N0UE 4LPWA 2LVCA 4OUUB 4YXKH 3C5JB 3U0WL 3SKNA 4PJFA 3GJFA 1IC4L 4NDMA 3MOBH 4XAKE 5B38A 5EUOF 1D9KB 1EHNA 3PJSB 3DRTB 1DQQA 3NOIA 4LRIA 4E9LA 1U8MA 4N0YL 4EOWH 4NQCD 4Z7VE 3IJHB 3LV3B 4Y2DC 4HIJB 2ATKB 3UP1A 3RWCA 2CGRH 1FH5L 3SDAD 3S36X 1DBAH 4X7FC 1F02I 3QIBB 3HUJB 4HIIB 3DO7B 4XPFH 4YQXL 4ZFZB 1LE5A 4YDIH 4TNWK 3V8CA 2PYED 4K71B 2IAMD 3IDNA 5DEFA 1C7SA 1LILA 3OKNA 5MEQA 4ENEC 4HDIB 2D4FA 1NGQH 2FATH 5FM5M 4TQEH 4Z76A 3GSQB 1CXEA 3ZO0A 3EDJA 4Y1AA 3O6KL 4QY8B 1YPZF 1SMOA 1ZT7B 2JIXD 2X9WA 4EDWL 5JXAL 2JJSC 2ZUSA 4J1UB 4KJPD 3SDDA 1R3JB 4GW4B 5FYLE 3T3PE 1OGAE 5M94B 3FB7B 4ODSH 1IC5H 3HR6A 3SOBH 3T1FA 5J11C 1MLCA 1KELH 4NUGL 1B0RA 1YEGL 5DVOA 5KSBE 4TVPD 4JO1H 3HA0A 3ULVD 1GC1L 2X4NA 2FWOA 1OLLA 4OM0L 4IBLT 1R24A 2MTPA 1IM9A 4R0LC 3K4DA 2MCPH 4UOW0 4PUBL 4GRLB 4KKBC 4TNWF 3OTTA 3MA9H 3ARSA 4G6AD 4MAYB 1KT2A 5A3ID 2XZQH 3V5HA 3JXAA 5T1MA 3WFEL 4CUCA 1HHJB 4QTIH 1ES0A 1T2QL 4P9ML 4WDIB 2AV7B 3I6GA 1MRCH 2YBRA 5CINL 3BPOB 5DEGB 1OW0C 4FXLA 5ESQA 4UT7L 2Z31A 5L9DL 3VI4E 2Y5TA 1HCVA 1U3HC 4YAQB 2YUZA 3ZL4H 4JRYE 4GS7B 3L5XL 1MSPA 3KJ4C 5ACLA 7CGTA 3QG7L 1BX2B 3IXAA 3KYMB 1P84J 1FYTE 4ORGB 3OKEB 3O3AA 2F9BT 2ERJC 2GSGB 3UTZA 1NAMB 5DQ9A 5CJ8A 5EULV 4ZUTB 5EU5A 5FYLH 3EO1A 1E6JL 4ZUWA 4QRUB 5HPOA 4QRTB 5I1DB 3OKMA 2YD3A 1LWRA 2V7NA 4G7VH 1MY7A 1RIUL 1YNTB 4ODHH 5DO2C 1C16B 4MD0A 5ALBL 4Y2DA 1JI1A 4HEPG 2H32B 3ALWA 4X6CE 3P4OA 5E9DD 2WBJD 2GI7A 2A6DA 1E28A 2MQ3A 3E8UH 2ORBH 2W9DL 1P4IH 4XNXL 1MCRA 2JB5H 25C8L 3NFNA 2DQTH 3BQUB 3VWJB 1PEZA 5I1IL 3HE7D 1RPQA 2XPGA 5MP6H 4PY7B 4X5WB 1KPRA 4PBWD 4LNRB 5FUCE 2R0ZL 2DI8A 3C6LB 1JMXA 3JTSA 1CT8B 1D6VL 3RL2B 3UO1L 3BUYA 4MXQD 2BK8A 1V7MH 3GM0A 4P5TC 3T0XA 1I1CA 2G75B 4PLJD 5ACZA 1RK0B 1FNFA 2QHLA 3BISA 4FTVD 3BZDA 1D5XB 4LPTA 4ZTOH 3QQ9C 4K8RC 2J2ZA 3D39E 1KJ2L 2VITB 5CBEA 1K6QH 5HBBA 4IDLA 4HJJL 4R0LA 3C2AH 4FQ2L 3VD5A 1FBIL 2Q8AL 5GS0L 1YY8B 3O8XB 3B5TA 4ZD3H 3RDTD 1IQDA 1HXMA 3QUXD 3GSXA 1WEJL 1EH9A 2BX5A 1QFUL 4LDOB 2F58H 3ZKND 3HI1B 3KS0J 4G80B 4WEBL 5IB3B 3MRNB 3G5XA 3N06B 3MREA 1HI6B 4DAGH 2DIBA 4LP4A 3V0AC 5HHXL 4EBQH 2QHRL 2EDKA 2VUOA 4CMHC 1EBAA 1NAKH 1I1YA 3BX7C 3HG1B 3EYVA 2EDDA 5HGBA 2VDNH 1OTSC 2XKNA 4P4RA 5T1KB 2QQLL 1OW0A 2VLKB 1OAUH 4M9OA 4B0MM 4QRPB 1OB1B 2FEEI 2W07A 3QZWA 4ZS7L 2FX9L 3BSZH 4O2EB 1RZ7L 2V7HA 2FX8L 3P77A 4KK5D 3UTTE 4YR6A 4JFQB 1N5AA 5I16B 4XCYB 4UDTB 2IALB 3IB4A 5IB5A 3EW3B 2EC9U 5H2BB 4HXBL 2V17H 4XNYL 1CLOL 1WZLA 3I2CH 5JW5B 5BV7B 5DUMH 1XF5B 3I85A 2QSQA 4X4ME 1KIPB 4DK3A 2VLMD 5IQ9B 1DL7H 1EUTA 3H3PH 5HDQH 1NEZG 4J3WA 5EO0A 1P69B 3FMGL 3VGBA 4XTRD 4ODVH 1E4JA 3MBEB 1UEMA 2GITA 1UZ6E 1BBJB 2XRAL 1JPFB 3EOYG 2JJTC 1CXHA 5FM5O 4XPGH 1A7RH 1SEQL 3B9KB 5L8LB 4FFWD 4E41D 2R0WL 5DJ2A 2K7PA 3K4ZA 1NANI 2R4RH 3GIZL 3ILPB 1A64A 3OZ9H 3RZCC 3BDYH 3JTTB 1CF8L 3W2DH 4X80H 3SQOL 4TNVF 3FT2B 3BE1H 2F53E 2VLRD 2QADB 2DM3A 2XV6B 4QRRB 4E42B 2A9NL 4X6EA 1GIGL 3P73B 5C2UB 1C5CL 1LP9F 4KMTL 3ROOA 4WWKB 5AAWA 5K9JH 4JJ5A 4RGNB 2DQFB 3KLAB 4XB7A 4MWFA 1KNOA 3MV8A 3WXWL 1M05A 3ME0A 1A9EA 1C08B 1KULA 4YHPB 2FIRT 5DFTA 4KZDL 4GKZA 4PJ7E 4WFGD 5KTEL 1F2XK 3PF2A 1HSBB 2PCPB 2ITDA 3GMOA 4NKOA 2AAVA 2H2SD 3VXMA 2VIRB 3GIVB 5TGBA 4JM2D 4LKCB 4NWUH 4J3OC 4OLZL 4WHTA 3VI3E 4CN1A 3V6ZA 1JK8B 4ZXBC 4POYA 5B4MC 3T0WA 2I07B 2BC4B 2Q86A 2HJLB 3P4MA 3WIHH 3TIDB 4J4PD 4U6TA 3WIIH 1LNUA 1PVHA 2YRPA 4WCYH 4BQ9A 3DGCR 5GRXG 4OKVB 2ADIB 2XG5A 3KYOA 4LHUG 4JFEB 2AKRA 3MLXL 2B5IB 5IVZA 1AHWB 1T5XB 3UJJH 4NRYA 2COQA 2HP4A 4ELME 3IT8D 3ULSA 5I1HH 3EKCA 5DMGD 5GIRB 2ZUXA 1BFOA 3WFHA 5CJBA 4KPHH 4BSVA 5CZXD 4IRJC 4PRHB 3RPIB 3SGDH 1RUQH 3TGXA 2DBLH 4JFFB 1KCKA 4MJIE 4EXPX 2FX7H 3NZHL 3ET9F 4YX2L 4RQQB 3HKFA 3S8WA 5GQBA 1QR1B 1NCBL 1WISA 4KGLA 3VFWB 5I19L 5GGTH 3HNVH 4N8CL 5TDOB 2H9GB 1FVEB 3LKSB 1G7PB 4YDKH 3EYUL 4U3CA 4O51B 4DVBB 4PJ9D 3T2PA 2X40A 2Y9RT 4E5XA 2QTEA 3FB5A 3RUGF 1F90L 3O2VH 3RIFK 4X98A 2FR4B 4JQIH 2VDLH 4LMQI 1KFAH 3RZCA 3HFML 4K71C 4PRAB 2FO1A 4OLWL 5DMKB 2XXMB 2LU4A 5JXEC 3CFKA 2CUHA 3O6FA 5DD3L 2X7LB 4C4KO 2ZJSH 1T2XA 2BNRB 4OFYA 2CDFA 1DCLA 4PRPA 5IV2A 4HBQA 4L4JA 4XBGA 2ZPKH 4KRPD 4EUPA 3O2DL 2MCG1 3NH7H 1X5YA 2JCCF 5F93C 5A2KH 2BDNL 1JP5A 4KTDH 4AEEA 4M8VA 4KUZH 5I6XB 1MCQA 3FN0L 4U1NA 3FO2B 3QDJA 1J87A 4OZIF 4ZDHB 4WO4D 3IFLH 3VFGL 1CFNB 3P0YH 3UCRA 2E8ZA 1HKLL 3Q6GL 4RNRB 3DMMB 1Z3GL 4MCZA 5FYKD 5LAXB 4DCQB 5DK0A 5T3ZL 1YQVH 2DIAA 3CLEL 4G9FD 5IVOA 3VXRB 3RIFF 1GOGA 1EZVX 3C6SA 3PXJA 3V6FA 1AR2A 3BP6A 5C07B 2DQHH 3T2OA 4LEOB 2HKHH 1HHIB 2DQJH 4ZXBA 5C1MB 2BVQA 4IDJH 4JVUA 1BECA 5LGJA 2I60H 4YFLI 4NJAL 4WFHD 5EIIB 4MAYC 5CD5D 4P3CL 4DTGH 3ISWA 3ILQC 5CEYA 3VDBA 2A9MH 2MFNA 4CKVX 1OAKL 1JGDB 5BRZB 1AGDA 2P7TB 3PIQB 4MD5B 4I2XE 4B50A 1OCWH 2ARWA 1M6OB 1BJMA 1T22B 4HX1B 2JLLA 4F7EB 4X99B 3MMEA 2Z92A 4TSBL 4JM2F 1NMCB 2B2XL 3BPLB 1P4LB 1CICB 5FYJU 1A6AB 4JHAH 4NQDB 5DD0L 3LQAL 2DF3A 1JGEA 1YN7A 5C0AE 3U4BH 4G6JH 4PS4L 1I3RB 1A6UL 4ALAL 3UBXB 5T3XH 1YEEH 3QJFA 4TTDD 4YDLB 4IRJA 2YZ8A 2ZCLL 3ESUF 4GG6F 3OJDB 3FFDB 1DN2A 3AC0A 4XCCL 4Y4FD 4OUUA 4Z7OF 2P1YA 4UQ2B 4HPOL 1K8IA 5E7FA 1DZBA 3D0VA 3DLQR 3U9PH 1G7HB 3TPUB 4BSWA 1HNFA 4M1CD 4TULL 5H94B 3A67L 3NABL 4NO0B 3FO1A 3LH2H 3U2SB 3QUYB 1IBGL 4H8WC 1NLBH 2P8LA 3CXHJ 4XP1H 4Z7NF 4GAJH 1NMAL 2XZAH 2X4QB 3BPNB 4JRXA 2XFXB 1PX3A 2R9HC 5A16B 2R2EA 1BZ9B 3MBXL 1OSPL 2ADFL 4K7PY 5T5NG 3CK0L 4PRBB 1UJ3B 2NW2B 3JV4B 5JXEA 1A21A 1AGBA 2VXQL 3D2UD 1YECH 3DECA 3U9UB 5DJXB 3KNBA 1P2CA 2EIEA 2CDEA 3B3IA 3TO2A 1ZS8B 1A3LL