1WICA

Solution structure of the msp domain of riken cdna 6030424e15
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
152
structure length
152
Chain Sequence
GSSGSSGKKPLSVFKGPLLHISPAEELYFGSIESGEKKTLIVLTNVTKNIVAFKVRTTAPEKYRVKPSNSSCDPGASIDIIVSPHGGLTVSAQDRFLIMAAEMEQSSGTGPAELSQFWKEVPRNKVMEHRLRCHTVESSKPNSLMLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical Protein RIKEN cDNA 6030424E15
publication title Solution structure of the MSP domain of RIKEN cDNA 6030424E15
rcsb
source organism Mus musculus
total genus 16
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00635 Motile_Sperm MSP (Major sperm protein) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1wicA01
5E8PA 3TZVB 4CJ1A 3MLVH 4JFDB 2O61B 2WW8A 3BPCB 4U1KA 3RKDC 3HC3L 1F3RB 1FORL 4J3SA 1G7PB 1Q72H 4YWGL 3TH3T 5C0RH 2EKSA 5D1XA 4PD4K 1XR8B 1GSMA 2R0KL 5FYJL 4QRRD 3TN0A 1CR9H 4Q7DA 4UINH 4DEPC 5L88H 5EB9A 3MACH 4XH2B 3LZFL 3UTPE 4N0UA 3AMKA 1JYVA 3QA3A 4OIIL 5JW3H 4MNQA 2WIIB 3P4MB 4KI1A 2QQLL 1IM9A 3OB0K 4NQEA 3LOWA 4HPOH 4K9EL 5DZNA 3WUWB 1UZ6E 1IQWH 5EN2B 4WFHD 3P9MA 4CN1A 2Y7QA 2ZOKB 3VXMA 4L3ED 1RJCA 4OCXL 4X9GA 3ARGA 3QIWB 1TVHB 3JTSA 3INUL 1JGDB 1MCCA 4OGXH 5EOCL 5C3LD 1M05B 3BD4A 5DQJA 4Q2ZB 1RV6X 5IBTH 3SKOB 4JFYA 4P9HL 4XBPB 3RHWK 1I8IA 5A2JH 2GEEA 1D5ZA 4R2GB 1P69B 3VXSB 1WAAE 1C8PA 3ZSSA 2Y6SC 4OAWB 5EFIB 2E9BA 2ED7A 2AV7A 4PJ7F 5JIPA 5IFHH 2UUDH 4F7PA 3V0VA 4U3XA 1J88A 1U8LB 3GSXA 1F4YL 4JPWL 4OM1L 1U8KB 1G7QB 2PO6C 1MJUL 2IAMB 1G7MB 4WGWB 3DRQB 4LCWD 3QI9A 4NJ9L 4S0TD 5C09E 5CJOL 2FL5B 3MREA 5SWSE 1K4CB 2ZCLH 3CGTA 4CDGC 2Y07L 1IAOB 3SE3A 4GG8A 2YZ1A 5I1LB 4EQ3A 3WFBL 2OXHA 1QUNA 2DLFL 2Y36H 1AP2A 5ESAA 1UA6L 2P43B 4HK3J 4WI8A 4OGAC 4CVUA 3QIBA 4WCYL 1F4WH 3G5XA 4P5KA 1FVDA 3MRHB 1U3HD 2H26A 3EYFB 4JO4H 2CDGB 3QXDA 3G08B 1TMCB 3BMVA 4WW2A 5LBSL 4M5ZL 2A6IB 3QDAA 3VMNA 4EBQL 3H9SD 1DQQA 4K7PH 1XGRA 1UB5B 3TBSB 2X4SB 5C7XL 4V1DB 1A1NB 1F3DJ 3ESUF 1A6ZB 5DMYA 4I3SL 4HV8B 4ELMF 4N1CA 3MRPA 1CICA 5KSUA 3R0NA 1LEKA 4YBQD 1L9MA 3VRLE 5HTSA 2P45B 4LDLB 3S4SG 4HS6A 4LVHB 4RGOL 1ZTXL 4WO4A 4X7FC 4X5XA 5IB5A 3L1OH 4DW2L 1F3DH 1V3JA 5C9KA 4MQXC 3WFEL 3RKPA 3OXSB 2OS7A 5KJRH 3QQ4B 4XXDB 1AGBA 4AJ0A 4PJBE 2MQ0A 2O5ZH 1CDYA 3S7GA 3L95A 4HIJB 1XGQA 2GT9B 1KCSH 2I5YH 4QRQB 4MLSA 1YN7A 2XIDA 3E2HC 1X5FA 1H15B 1ULVA 2QLVB 4Y89A 5EBLB 1DQJA 2QHLA 1KBGH 5C2UB 1ZVSA 3HKFA 3EKCA 3FQNB 2ZCHH 4GRWB 3PDGA 2VDKL 5JXEA 4XPTL 2EH7L 4JCMA 1TCMA 4PJHE 2W0FA 2APBA 5SWSA 2E7MA 1N5YL 2AXGA 3QH3A 2I07B 4QHMB 3H3BC 1RY7B 5DEGA 4HZLB 1AE6L 2BMKB 1MCIA 4XC3L 1FZJB 4HFUL 3MGOB 2BC4A 3JTTA 1KXQE 3FFCE 3QUXC 2OJEB 12E8H 5DO2D 2UVFA 1S5HA 3MSPA 1TVDA 5C0AD 4Z7NE 1U36A 4NQCE 3U0TB 3WUWG 3I3BA 5CIPA 3KLAB 3UTSE 1QHPA 5F93C 3QDMB 2HTLD 2BOCB 4TPRL 4KK8C 1P5UA 3MFGB 4GOSA 1A6TA 4FABH 4ONFL 1GGBH 4QXUL 4NKMA 2NY4B 4DZ8B 4FFVC 1MIEH 3IU3B 4PRDB 1UZ6F 3MUJA 5LCVH 1BPVA 3EIFA 4P2YA 1K9TA 1DEEB 1P7QB 1U8QA 5TDPB 2AQ2A 1JPSL 3VXRE 4X4YB 3PL6A 3MRDA 3FFDA 4O2EA 1CK0L 1RK1A 4LASH 5DJ8B 4MCZB 3UTZB 1QSFE 4RMQA 1MHHA 4B53A 1MSPA 4XCFL 3QYCA 4QO1A 2A74B 2I24N 2D7NA 4Y4KA 1TJIL 1WAAF 2VITB 3GO1H 4CMMA 4XPBH 5J13B 3ZTNH 4PR5B 1R6VA 1PYWB 4X9FA 1WEJH 4PJBA 4IS6A 3EJYD 4HPYH 1MFDL 3NFSH 3CZFB 4ZPVA 5E70A 4AEEA 3RVTD 3LCYA 1YEJH 4UT6L 4PRPE 1NGYA 3DYPA 1V7ML 3HI6L 2DQHL 3BXNA 4Q9QH 1MJ7H 4OCSH 2OL3A 2R2BB 3DNKA 2NY5C 3MNZB 1ZMYA 4FZEH 4LFHG 3V6BR 1XFPA 4KQ3L 1S7UB 4PJHA 1EERB 1KNOA 1S7TB 4YIQA 2AW2A 3RDTB 2A73B 1KYOJ 3ILQC 5A2LH 1E4JA 1ZGLA 4OD2A 1T21A 1ONQA 3PHQA 4J1UA 2X89D 1PY9A 4JHBA 1FNLA 3MJ9A 3QO1A 3UTSA 3KLDA 3NZHH 2AS5M 2P5WE 3KS0J 1KGCD 5IMMB 1YYLH 4LSRH 4N8CH 1DQDL 4I18B 5EZOH 3MTRA 3K4DA 3HLAA 3K8MA 3F12A 2ZUVA 4Z8FL 4ONGH 3TM6A 1UQSB 2VXUH 1RAMA 3NN8A 3ARQA 4PB9L 2ZUTA 5ACZA 4L8BA 1OP5H 1BZ9A 2YR3A 4NM4H 5SX4I 3TBTB 3VRLF 2ADGB 4JO3L 2AGJL 1BOGB 1U6AH 4X6BB 2R9HD 1MJ8L 5I8KH 3AVEA 1NPUA 3P2TA 1DUYB 3DVNA 3KS0H 3JWOH 2Z35A 3QULA 4XNMB 3N85H 1KULA 2VLKB 4HCRH 1LEIA 3T0EB 5D93C 4X4XA 1UJ3B 1QSFA 5E2TH 5D7LB 3O45B 1D5XA 4PJBF 4CVXB 1LK2A 4I2XE 3V5DA 2X40A 4NZRL 3H7BB 1I85C 5EOTB 4DGIH 2DQJL 1SMAA 3F58L 4GO6B 2X4RB 1OY3B 1JNNL 1J1OH 2CO6B 3DROB 5FOBB 1T03H 1EAPA 3F7YB 4O4YH 3O6FB 4PJHF 3GMMB 4PRPA 4QHLB 2GW5A 3SDXE 1D6VL 3BKCL 4DK6A 1IAKB 3SBWA 4WDIB 4D9QD 4ODVH 1EBPA 3NCBB 1WTLA 4HH9A 2YUVA 3HE6B 1S7VB 1CD1A 1RZJH 4KJWD 4E41D 5CJBA 4Z7NF 3O8XB 3UC0L 3BDXA 4RSVA 1XCTB 3HUJE 1KJMB 1WLHA 5C0ND 4DJMA 1MAML 4FFYH 3TVMB 2HFFB 2NY4D 4HKBB 8FABB 3V8OA 1MRDL 1QYGL 4M7JH 3SKNA 3VI3E 2E6JA 4GRLC 4HXAL 5CIPH 1MHPL 2YD9A 1FZMA 1LE5B 5IIEA 4NHCH 4PS4H 2ED9A 5TJWK 4YBHA 5T33L 2NLJB 1G7LA 1FLRL 3NCJH 1CVSC 3D18A 3QIUB 1I9IH 4GW1A 4P2RE 1KCUH 3EOBB 4D9LH 3TT1L 3P4LA 5FKAA 1OVZA 4L8SB 5I74C 4MA3B 3RWIB 2HLFC 3ELAT 4R0LC 3T8XA 1FFPA 3WS6C 3WN5A 3JWDL 1UZ8A 3VG0L 2H41A 3N1GC 5HVHB 3IETB 4R90L 2XTJE 3QDJB 2R1XA 2EH8H 2C1OA 1NC2B 3CFEB 1HSAB 3FB7B 2CMRL 2GQHA 4X99A 1E27B 4B7IA 5IW1A 4O51A 4QRPE 2LVCA 3X12A 2YPKA 1JUFB 4JFEE 2ZUQC 1CDGA 2DD8H 2VDLH 3OF6D 4KRPD 3HFML 5DJ2A 2V17L 3S8WA 1A6UL 2ZUXA 5CGMA 2FJGB 3C09C 4MJ2A 4DGVL 3WBDA 2GUOA 2XPGB 2O5YL 4HMEA 5CBEB 2Y5EA 4NNXB 1N2RB 1S7SA 1RZFH 3RDTD 5JORA 3VXQA 1SEBB 1BQUA 4PJGA 4JDVB 1AC6A 1J1XL 3BE1L 4M6OH 4ZNCD 1UJTA 1MNUL 2OL3H 3LQAH 1G7IB 3CLEH 2FD6H 4QXWA 1FV1B 5GGQL 4HIEA 5FM5M 4G9FE 5LGHL 4LF3B 5JOPE 1JHKL 2W38A 2I9LB 4IIQC 2DQFA 4JFPB 5FGSA 4F2MA 3LHPL 1BFSA 2XKSA 3ZKSD 3FT2A 3GUTB 4QHUA 1EFXD 4UT7L 2OQJA 4X98A 5J9PA 1L7TL 2X6MA 1KT2B 3ULUH 1NDGA 1DQLL 5FYLL 4LSSH 1UM6L 2VJXA 4I0PA 4ODSL 2LVEA 3PP4H 1JGLL 5FYJD 2HYMA 3Q5OA 5C0FB 4P2RA 2G75B 4R97C 1IC7H 4RMUA 1ZS8B 2B1HL 2FGWH 3IDJB 2Z31A 4XP5H 1MHCB 1W0YT 2BZDA 2G5RA 4GRMA 4QHKJ 4F33B 3RBGA 3S9DB 2R29H 3FO9B 3I9GH 4J8RB 5CS7A 2AK1H 3HR5B 5D2NE 2B4CL 3S34L 4CKVX 2ZUSA 5F8RC 5AWNL 2VLRE 4JGJA 1U41A 3G9AB 4IDJL 2YKLL 1F6AA 1GGCL 4JRXE 3DXAD 5IEHB 3VW3H 2J8HA 4ZYKB 4HG4J 5T1LB 3X14A 5A16A 4KZDH 4WU7A 4ERSL 1BF2A 4QRPA 2NY6C 1C12B 5HI3C 3O6FD 2GIYA 4QYOB 3QFDB 4HUXB 3SDXF 4L4VE 3ARXA 2APXA 5A1AA 4L4JA 2HMID 5GS0C 2ITDA 5KVDH 1IAII 1CLYH 4AL8L 1BD2B 2FJHA 3IS0X 1NCDL 4KFZC 4UOW0 3D3VB 5LGKA 4NBXB 2X44D 4I9WD 5I1IH 5ITFA 2BNQE 5BQ7A 5EUKB 3QQ3B 4J6RH 2MMXA 5CLTA 2IH3A 3C2AL 3HUJF 1ZKAA 4HUKB 3AS1A 3G5VA 1D5BB 2D7MA 2DWDA 3TVMD 2OCFD 3VGAB 2VLJB 4G9FA 3OL2A 4LLYA 3WUZA 4ZO7A 3T4YA 4QHNB 2VABB 3MV9D 4X5WB 2QHRL 4Y4HC 3MYJB 3C60D 4JKLA 3MLWH 3I6KA 4RGNC 1OAKL 1YEEH 1YDPA 3QIUD 2PO6A 4EOWL 4LSTL 1FPTL 3ZDXE 3JZ7A 3L3JA 3BWUC 3RQ3A 3NABH 4PGDB 4XAWL 4WI3A 1LDSA 5E00A 5IM7B 3DBXA 2GTZA 2XFXA 4YDJB 4BZ2L 5KAQG 2A1WL 5IQ9B 3F6IA 3TYGH 3AM8C 4ISVB 4NIKB 3WKML 2W9EL 3IDMA 4M9OA 5EBGA 1NMCC 1ADQA 4HMCA 4ACPA 2RR3A 5MERA 5I66A 3N1FC 1IAIM 1FZKA 4ZMAT 32C2B 3S97C 4X8JB 1ZHNA 4KK5C 5TPWL 1CFSB 2VLRA 4UAOC 4XMKH 2JJTC 5I2IB 1MCOH 4JRXA 1L6XA 3RWEA 1KTDB 4JG1H 1FH5H 2OP4L 4LLUB 1DR9A 4X8XA 2UZYB 1T04B 5DJCA 2GAZA 5L9DH 3QUML 4L4VA 3OWEA 4RWYH 2VLLB 5HHMD 4EI5D 3UZVB 5JOEA 5JPMA 2Q87A 3TT3L 1RPQA 3FL7A 3U7YL 3ECBB 1Z9LA 4HEPG 1KTKE 1P7KA 4K23H 5FXCH 2DWEB 3BP6A 2DMKA 1NCUA 2E9JA 2BNQA 1L7IH 3PQYB 4P4KC 4L4TE 4Y4FD 3B5HA 2EYSA 1H9VA 3NMEA 4AH2A 4Y8DC 4YEFA 1REIA 3N9GH 3O6LH 5BCAA 3LEXB 5C6PB 4LPYA 3L3OB 5D7KE 3ZO0A 2DIAA 3NACH 5DHVA 2AQ3A 1F6FB 4LSPL 4WUKL 4P46B 4P49A 1X5JA 4ODHH 2HFGH 2JB5H 1G7HA 1EZVY 1LHZA 4QOKB 2YRLA 3LIZH 5D1QB 5AZ2L 4LCIL 2DOCA 4XP1H 1NH6A 1ETZA 1ED3B 4BZ1L 4BUGA 4PRIB 3Q5YA 1I1AB 3QXTA 1DZBA 1N26A 4HUUB 2RIKA 1AQDA 1WZ1L 2GJJA 5DUPL 4EXKA 1X5KA 4WY7H 1T0MB 4PGEA 3C6LB 3WO4B 2PYEE 3CCHA 4P5TB 2ICEB 3NVQA 4KJQC 3Q0HA 5T1LD 2XY2A 5IFJB 1YEIH 3B9AA 1OAUH 1NMAL 5T3XE 3ARWA 3MR9B 5GSVA 4ODWB 2GY7B 1BBJA 4PTTB 3GSQA 1ZT1A 4TTDC 3QJHA 2P8PB 2HJLB 3L7EB 2PYFB 5JW5A 4HKZB 4ORGB 4GQ9H 3BIBX 4LSVL 3V0AC 3ZYZA 2ENSA 5DXWA 3AREB 4RAVB 3GIVB 4FTVD 4J3TA 4U3CA 5HI5D 2DKMA 5EO0B 1N5AA 3QWRD 2J1KA 1BQHA 4LRNL 3GBLA 3GDBA 4G8GB 3M17A 4NO0D 5FO8A 3KYKH 2WUCL 2WUBL 3ABZA 3E8UH 3FT4A 2QKIA 5F7FA 2VXQH 4HH8A 2MWCA 5IQ7L 4L4TA 1MFEL 3I6LD 2O93L 3SKMA 3ARDB 1BQLH 1N0XL 2XKUA 5DWUL 1CTOA 3MROA 4GXVL 2JKXA 3ZDXF 5EPMB 1RURL 4RFNB 3KDMA 4ZO8A 2EKJA 2NW2A 4KPHL 1NANI 5DMKB 1NGXB 3W11D 3B5GA 5DGQA 1N8ZB 4FP8L 4LAQL 2VN4A 5DC0A 1T89A 3WIFA 3WNNA 1FFNA 3AFLA 4A2MA 5JIHA 1LO0L 2EIBA 1JZ2A 1BVKA 1L0YA 5J1SC 4PUBL 5EU6A 3IDGB 3ARFC 4S10A 2ADFH 4NT6A 5EU5A 2A6JA 1Z5LA 3FQXA 1CLOH 4YZFF 1EJOH 4HUVA 1SJXA 3THMH 3WIHA 3FB6A 4PP1C 2UV3A 1IC4H 1GZQB 2HJKA 3MJ8A 3OKOA 1JWUB 1N4XL 2OSLA 1RJZB 1RIUH 1D3CA 2GK2A 2GJ6B 3UJJL 1G9NC 1KPUA 4C4KO 2PXYC 4MAYB 4JFXA 3BSZH 3VDCA 2ARJQ 4JKMA 5D70L 1KLUA 1BGXL 5HPOA 3BDBA 2JB6B 4OSUL 2BVPB 3LKPB 2MPAL 5E6IC 4BELD 4OM0L 4MD5A 5GGRA 5ERWB 2CGRL 3PQYD 4HC1L 4F58H 1HILB 3E6FA 1HH9A 4Y5YB 2MKWA 2HRPH 5SWZD 5BW7A 3V5KA 3U7AA 2APWA 1XF3A 3D39D 1I85A 4YX2H 4P46D 4LARL 2YSSB 5TE4L 3F7VA 1A7NL 2DYPD 4D2NA 2BCKB 2DTML 2MKLC 4FQIL 4QOKD 4HIXL 1CLZH 1YY9C 4LLVB 1I3RA 1LE9B 4N8PA 3RY5A 4G5ZH 3ZKXC 5I16B 3T0VA 2MSPA 3U0WL 3MFFB 3SGEH 3LRSA 5DHVH 1MFCH 3MA9L 4P23A 4L9LC 3KPRB 4OCWH 3ME0A 5CWSA 5LQBH 2HVJA 4MVBC 2R1WB 1QQDA 3FO0H 4QXGH 5F1NB 3O6KL 3VWKD 2FHFA 1NCCH 3TA3C 4KJPD 4IRJC 1VERA 4ZQKA 1EO8H 1EO5A 3VXOB 2BNUA 4ZFOA 1TFHA 4S1SH 5AYQA 5ELIA 4HJJL 1OAZH 5FECA 1C5CH 4K8RC 5HYQB 2W91A 4G9DA 4Z76A 1U3YA 1U8PA 2EC8A 3LEYL 2XKNB 4PLJD 3S36L 3ARED 3HMXA 5JHDE 3V6OC 2F53B 3HG1E 5E1AB 5EO9B 2EECA 1HCVA 4LCUB 3H7LA 4WI4A 3VG9C 1DCLA 1QACA 2Y1VA 3LB6D 3B2UD 3MC0A 1A3RL 1J8HB 1QNZH 1T2JA 3FB5A 4JHWL 5IVXE 4C57C 1SHMA 1KCRH 4X7TB 5HHOD 4R0LA 4J4PD 3ROLA 4POYA 4O2CB 1K85A 3WS6A 4MAUL 4Y2OA 1XCQB 4MA1C 2ZPKH 3GSWA 4PTUB 2C7UB 1SEQL 5D72L 4C83B 4OD1L 2Q76A 3O9WC 1ZT4A 3WXWL 5IV2B 1Z9SA 3SPVB 2Q7YA 3VRJA 2XWTA 3VD4A 4DQOL 4NN6B 4TSAL 5FO9B 4EIGB 2IQ9H 4JPKH 4KY1H 3DI2B 1T1ZB 4JDZB 3OKLA 4ELKB 1Q9LA 5E94B 2R0WH 3WFHB 3DURB 4U1GB 4YE4L 1S7RB 5L2JA 4I5BB 5KS9B 3QCTL 3CNKA 5H94A 5LWYL 4EDWH 3DPBA 4GBXD 2ADIA 3OKMA 4PP2A 1TDQA 3LSOB 3BPOC 5FYLD 2NYYD 3L3HB 1LP9E 2NCMA 5J1AA 2R15A 2PTTA 4BKLA 3MJ9L 1OPGH 1P2CB 2H8PA 2NY5H 3SDCD 3STZA 1JNHA 1HE7A 5JO5B 4MA7L 1RJYA 1QSEB 1CT8A 2EC9T 3TCLB 3ZT5A 3G6JB 1SM3L 3MV7B 4X9IA 5DD1L 2GJ6D 1DL7H 5E8PB 5I1DA 3CFDA 1F5WA 3L3DA 3IJSA 4O5LH 5GGTH 3BUYA 1KLGA 3BEWA 1BMGA 2P44B 1QR1A 5I6XB 2DQIL 4I3RL 4U1KB 3EO1A 3WIHH 1PEZA 1BAFH 4OZHE 1A0QH 1RMFH 1AKJA 3Q1SL 4NJAH 3W0WB 5ECJE 2EKSB 5D1XB 5DJDA 3TN0B 5JHDA 5HYIA 3OZ9L 3HG1A 3WDJA 5D1ZC 4N0UB 3DGGA 4NKOA 3QA3B 4MNQB 3RWGA 2WBWB 4WEBH 5K59E 1IM9B 4XNZC 5CHNA 5CILL 4PB0H 4NQEB 5MP6H 2FLBT 4XNUL 2VXVL 5IVXA 3P9MB 4KDVA 1H8SA 2Y7QB 1KELH 4M00A 3CU1A 3IFLH 5D7IF 3VXMB 3BT2L 2J88L 4XWGH 5E56A 5BOZG 2V5RA 1UVQA 1PLGL 2DQTL 3ARGB 4Y0GA 3V4PL 3JTSB 3QNZA 2EDEA 4UNTA 3L3GA 5CP7A 5B21A 3VJ6A 1R5WA 4JFYB 4KVCH 1FAKT 1I8IB 2NY7L 2A83A 4MJ6A 1D5ZB 4Y5XA 2PW2A 2AV7B 5F71A 4X6FA 3OGOE 5LXGH 4F7PB 3NOIA 3T0XA 3V0VB 5HVFB 3BDYH 3GSXB 2DQUH 3B2VL 4YO0A 4JJHA 3QI9B 4M6ML 1EHXA 5E8DL 2IBZY 2Q7NA 1GC1L 1T66D 3MREB 3P73A 1LP9A 2QSVA 4QTIH 3MCLH 1M1SA 3CX5K 1JJUA 4GG8B 1MEXL 2YD3A 1AP2B 5ESAB 1R3IH 4UQ2A 5I1GH 4ZAKD 3PNWA 3QIBB 1XGUA 3G5XB 4O02H 4P5KB 1FVDB 4UV7L 4X6DE 2F53D 2H26B 2NY3B 2XZAH 3QXDB 4OZHA 1CU4L 4WW2B 1A6VL 3S5LA 5DI8A 4NNPL 4P4RA 4JFZL 1DQQB 3O41A 5EWIH 1B3JA 3ZDYF 1XGRB 5I18H 3CFCH 1KPRA 3MMEA 4OB5H 4RIRA 5IVXF 3RX5A 1BECA 1RUQL 3UTTE 5F9DC 5FEBA 3AM8A 1TQCC 5T5NG 5E2JA 2Q6WA 5DLMH 3MRPB 1CICB 5KSUB 3K0WA 4FQ1L 1UADC 1LEKB 5CD5D 2APTA 3KPQA 1KTLA 5GGSY 15C8H 3MNWA 4OZIF 1U3HC 4HS6B 4WO4B 3R8QA 1P9MC 4ZUUA 4JCLA 1AJ7L 4X5XB 3RTQD 5IB5B 2HH0H 2MHAA 3WJJC 2JJTA 5C0BD 4YHPA 2R4RH 3UBXA 3GI9L 4LEXL 5ILTH 5IB3A 3R8BB 1M7IA 5B3NA 2F54D 1AGBB 1IAMA 2M1KA 4TVPE 5E2WH 4FQ2H 4IHOA 1TZHA 3L95B 1YMHA 5KW9H 3BGFB 2DDQH 4OLWL 1XGQB 4M7KL 3SDYH 5GS1C 4BQCA 2O26U 1WFTA 4YBQC 3TJEL 3BWAA 3TGXA 5KOMC 1DQJB 1LP9F 4NYLA 1ZVSB 1AQKL 5BVPL 3D85A 2ERJC 3HRZA 1QSED 5DQDH 2D7QA 2W0FB 5SWSB 3FQUA 4YHLH 2AXGB 4K3JL 1XGYL 3QH3B 5DEGB 1H8OA 3FMGH 4JHAH 4X7SH 5JXAL 1T2QL 4LKCA 1PKQA 2BC4B 3LKRA 1MCPH 3JTTB 4U1IA 1QG3A 1S5HB 2VRAA 3SCMC 3IRPX 4M3JA 5CIPB 5L0QC 6FABL 4W70A 3AUVA 1CFVH 1R3HA 1UG9A 4X6DA 1RFDL 4OLUH 2QQKH 1A6TB 4JZJC 2DJUA 5K59F 4OGYL 4NKMB 3LKNA 4Z6AT 3QNYA 2Y25A 4TNWF 5M7QA 5IG7A 2JELH 4KU1A 2NZ9D 3UTTA 1U8QB 3H2WA 1EGJL 1CXKA 3WDHA 4XPGH 3PL6B 4AEIH 3MRDB 3FFDB 1F8TL 3U36A 3ARGD 4O2EB 3GHEL 1RK1B 5E6ZA 5EOQL 2H1PH 4P3DA 2HTLC 1MHHB 5FV1L 4OQ1A 2ORBL 3MV11 1ZHLA 4I13B 5CJXC 4JDTL 4Y4KB 1CF8L 4HBCL 1MFAL 2IJ0C 2VN7A 1R3LA 4CMMB 2VC2H 4OF7A 4KHTL 2AI0L 4GKOA 3QEQD 4PJBB 2YD6A 4IS6B 5KVGH 2PF6A 4OLEA 4FQHA 4ZOBA 5DR5L 2NZIA 1NKOA 4ZPVB 3HB3D 4Z7OE 3AY4C 4FNLL 3CUPA 1NJ9A 3KYNA 1NGYB 2YEZA 1SJHA 5GS0H 3BXNB 4NRXA 5BRZA 3MBXL 2OL3B 4L5FL 1J1PH 3Q6GL 4PLOB 1C08A 4HJ0D 5KVEL 3CLFH 2VSDA 3BKYH 3L6FA 4PJHB 5I30H 2IGFH 4CJ0A 1KNOB 3MCKA 5JR1L 4YIQB 3P11H 4U31A 5L8JB 1JBJA 1ZEAL 1TZGH 2DQEL 1ZGLB 3AB0B 4AEHL 3L5JA 4OD2B 3EJYC 5GRZA 1T21B 1ONQB 3PHQB 4J1UB 3RVTC 1L0XA 3QO1B 4N8VA 2QADB 3F5WA 3UTSB 3ZHDA 5FUOH 3DSFH 3HLAB 3F12B 1UCTA 2HFTA 2VIRA 2ATKA 3VFPA 1ADQL 3KVQA 3E1F1 4S1RL 5ACZB 1BZ7A 4PFEA 4L8BB 5HYEA 1BZ9B 3CVHA 3W2DL 3U83A 3ARFA 1UKTA 3VH8A 3TIEA 4LLMA 3DVNB 1RVFH 4YHKH 1FYTE 3GSOA 2Z35B 4IOFD 4PJIE 1LEIB 4ZTPH 5B22A 1UB6A 4OKDA 4X4XB 4JANA 3ETBF 5KSVA 1QSFB 2EDWA 1D5XB 1LK2B 2BX5A 4J3OC 3V5DB 2AK4E 3C87A 3PWPE 4I8DA 4KKBD 3GRWA 2PXYA 3TBYA 5D96B 1A7BA 3V6OE 5CLWA 43CAA 3NBNA 3PXJA 1Q94A 2LU7A 1MCKA 2R9HC 2V7NA 4LVHC 4OZ4A 5DURD 3QBTB 3IF1A 1EAPB 5C09D 2YUZA 5JXED 4PRPB 4G7YH 1DBKH 2FDBP 5I8OH 1D9KA 3HNVL 1YNKH 1JYNA 2EIZA 4X4ZA 4HH9B 4PBVC 5KSAA 1CD1B 1FQ9C 1KJ2L 4MWFA 4UBDD 4OLYL 3S37H 1A14H 4NGHL 3EUUA 4ZUSA 5E8NA 3TV3L 1YJDC 1DBJL 1UH3A 2ZKHH 4YPGA 4JRYA 3QHTC 4I77L 3B83A 5JPNA 5ANMA 3C8HA 4MSWA 3SKNB 1RIVL 3LS4L 1JNLH 1T20A 3G9VA 1FZMB 1WCBA 4NZDA 4L9LA 1JTOA 1NCAH 4KV5E 1QLRA 1PVHA 4HJGA 1Z3GL 1G7LB 1MY5A 2FH8A 4KJWC 3D18B 3PL6D 2SEBA 1UM5L 4GW1B 4PJ5E 4HS8L 4P3CH 2IFFL 2NQCA 1OP3K 4P0DA 3RVWD 5FKAB 1CS6A 3TA3A 4AIZA 4U6TA 5C0NC 4KC3B 3VFTA 1P7HL 4LHUA 1FYTA 1TJGH 1U92A 2E9WA 3T8XB 1FFPB 4NQTA 2NY4C 5GJSH 4B50A 4KDWA 4PJIA 4U6HA 3WN5B 1UZ8B 4IRSA 3U1SH 4H20L 3HZMA 4GMTL 5BMFH 2JJVA 4KMTH 1BJMA 1FN4A 3GBML 1SBSL 2R1XB 2C1OB 2JCCE 4AIXA 2AK4A 1YNLL 4X99B 1PSKH 3MXWH 3LS5L 3PWPA 5IW1B 4O51B 3V6OA 4Z7OF 4DUVA 3X12B 2YPKB 4LIQE 1RUMH 5DYOA 2CD0A 3MUGA 2N7AA 1Q0XL 1EUUA 5DJ2B 1R0AH 1RUKL 4Z7WE 5DJYA 5FV2A 1TVBA 3OTTA 1LO2L 2GUOB 1PY4A 4OF0A 1S7SB 5F70A 5JORB 3VXQB 4PJGB 4Y16D 1INDH 3C5ZA 2HT2C 2OZ4H 2ZP0T 4F57L 1I7RA 3FFCD 4QRRE 2V5YA 1X3DA 3TNMA 4RMWA 1YEHL 1S7WA 5I1AA 5GHWH 2VNCA 1NL0H 4NQCD 4HIEB 1MWAL 1RK0A 5CZVL 1OTTD 1MVFA 4PJDA 5L6YL 5FGCE 1NUNB 2DQFB 4JY4A 4F2MB 2HJFA 5TF1H 1PKOA 2LTQB 2ZG1A 5JIIA 3FT2B 4WTZG 3KG5A 4N0YL 4QHUB 1MELA 2OQJB 2RGSA 4X98B 4YDLC 5J9PB 3B8YA 1C5DA 2NX5D 3RDTC 2GI7A 1NDGB 1CGSH 1FO0L 1M6OA 3V79C 4HLZH 1LVEA 1G6RL 1Q9WA 4I0PB 4YXHH 4W4OA 3VXRD 4NQXA 4PJ5A 1F4AA 3C08H 4P2RB 5HPMA 4PJIF 3EDEA 1CDCA 1P4BH 2Z31B 3S35H 2DL2A 5T3XL 3TWCH 2VISA 4GRMB 2GCYA 4L8CA 1QSFD 4I18C 43C9A 5BO1L 4P57A 3VXUE 3D2UD 3U30B 4NC1C 4QXTA 3KPOA 4TUJA 5E8OA 5K9JH 1GAFH 3LV3A 2XTJB 4NBYB 1F6AB 1YC8A 2JCCA 5C71A 4ALAH 2PR4L 1P4IH 3GB7A 3X14B 4DEPB 4XMLH 5A16B 2FX9H 4WU7B 1G9NH 4QRPB 1W72A 5D1ZA 3GRWH 4JREB 1A7RH 4U2YA 1UJ3C 1CQKA 2ITDB 2FX7L 3AU1A 4FHBD 4XVUD 4K9EC 1HINL 2BHZA 2FJHB 2MQ3A 4F7CA 1C16A 4RDQF 3D25A 3FRUA 3RGHA 1VACA 3IT8D 5ITFB 5BQ7B 2L7UA 3RAJL 2IH3B 2UY7A 3FB8A 4QRRA 1AC0A 2R1YA 5J57B 3PGCA 4I48A 3G5VB 1ZE3C 2DWDB 3O6FC 3SJVD 4G9FB 1T83C 4LLYB 2P5WD 2D7PA 1NAMA 4P9HC 2EYRA 3T4YB 4LHJB 2HMIC 1UACL 3KLSA 4KKLD 3PWJA 3MLZL 3VXNA 1Q72L 4KV5F 4TULL 5HDLA 5TE7H 5F21B 4CU8A 1PZ5A 4HK3N 2HT4D 3I6KB 4FFZH 1YDPB 2PO6B 4L3EA 5HI4C 3O8XC 4HT1H 1E6OL 5MI0B 4ZD3H 3L3JB 3F7QA 1K3ZA 1FGNL 5GJTL 5E00B 1P53A 1X7QA 2XOTA 2GTZB 2XFXB 3DBXB 4CN4A 1VB9A 1IFHH 3BD3A 4OFPA 3TVMC 2DBJA 3IDMB 5IBUB 1CGWA 3VFNA 2BVOA 1WITA 5FCUL 4E42A 3GMRA 3CSGA 4EQ2A 3GHBL 5MERB 4WTWA 5I66B 3VXUA 4LKXA 5IEKA 1PD6A 1MLCA 3C60C 4PY7A 1FZKB 5ICZA 4LCYA 3QIUC 3QAZC 1ZHNB 2VLRB 2LV4A 4RBPK 4PLNC 5DJ6A 1P6FA 3PP3K 5SX5K 4JRXB 3RWEB 3W9DA 4K8RH 3HZKA 1ZANH 1AI1H 4Z7WF 5J0BA 3TFKD 4RX4D 1DQML 5DJCB 2GAZB 1QKZH 2B20A 1C5BL 4U6VH 4L4VB 5DEFA 1IAIL 1FL5A 5C0AE 3PWUA 5JPMB 3G5YA 1FVCA 3RPIA 4ODUA 5A40E 1P7KB 2XG5A 1RZIA 4LPUA 3BP6B 3V52L 1KB5L 1P9MA 2BNQB 2EC9U 1NCWL 2G5BA 4IMKC 2GKIA 4MX7A 4KAQL 2EYSB 1R5IA 5KBNC 4X6CE 1HH6A 1T1WA 2UZIH 3VFGL 4AH2B 1RD6A 3HAEA 1KEMH 3H42L 4XBEL 3B8SA 3NAAH 2AXJA 4EI5C 5GS1A 5DHVB 3N1MC 4QTHA 2QL1A 3KJ6L 3L5IA 2DQDL 3PV7A 1HYSD 1YEDA 2Q20A 1G7HB 4F7MA 1LO5A 7FABH 4OZGE 1HHKA 1A6AA 3HPJA 3ZHKA 1KPVA 4M1DL 2YXFA 4Y4FC 1ETZB 1Z9MA 3UO1L 4Q9RL 4HWNA 2X9XA 1FIGL 4S1DC 2FO4A 1AQDB 1OM3H 3VFUA 2DBLL 2LAGB 1F02I 4DN3H 4PGEB 3EOYG 3CCHB 3NGBB 4JO2L 4P9ML 3L1OL 4C55A 2J5LB 3IU4L 3MRKA 3JXAA 3SE8L 1C1EL 3ZYJA 4LPXA 5KJRL 1DN2A 5IK3A 4JFED 4R4FH 4XAKE 3WE6A 2OXGA 5GSVB 3MLUH 4W6YB 1BBJB 2IPTL 3GSQB 1ZT1B 3ZE0E 5E5RB 3QJHB 3VGEA 4ZO9A 1KCSL 1AIFA 5CEYA 4J3UA 5JW5B 3FOMA 3JV5A 2X4OA 2ICES 3LAFA 3O2WL 4EEEA 2W92A 3OPZH 1HXMA 1W72H 4EVNA 3BVNA 1NLBL 5DUMH 2OK0L 1N5AB 5C0AA 1BQHB 1J86A 3GKWL 4PJ8D 3M17B 5T1MB 5FO8B 4FQLH 4ZSOA 3FT4B 1QFUL 2QKIB 5DMIH 5IMOA 5CJXA 5C8JA 5JOPD 4L4TB 3OX8A 1NGPH 5E08H 1XEDA 2B2XH 4MDJA 12E8L 3T1WA 3SKMB 5J12B 3NCYP 3L5XL 3MROB 1BBDL 1OP3H 1GIGH 3JUYA 5HI5C 2MCPH 5IBUG 3KDMB 1NAMH 3HC0A 3OKNA 5HGHA 2NW2B 4RZCA 3AY4A 4NNYA 1LO3L 4HBQA 1MIEL 4QGTA 3MRRA 4YXLL 2XTLA 3P30H 4KQ4H 2LU4A 4J3WA 3WIFB 3VGAC 1FFNB 4QNPE 3O3AA 1NLDH 4M48L 1VFAA 3BKJH 35C8H 1BVKB 4GW5A 5D2LA 4IOIA 5EU6B 3L3IA 4NT6B 5EU5B 2A6JB 1Z5LB 3ARTA 3FQXB 5C70A 4P59H 1MIML 4HUVB 4JN2A 5EIQA 2D31A 1UXWA 3FB6B 4JRXD 2HJKB 3MJ8B 3OKOB 1J18A 1I1RA 2EE2A 2OSLB 4HXBL 4U6XA 3W11C 4DZBA 4FQJH 1KPUB 3P0YH 5CEZH 1CN4A 4X80L 4L4VD 4G6KH 4JFXB 3WLBA 3QUYA 4UB0H 4E41E 4TNVF 1NFIA 2KDGA 1KLUB 2D0GA 3AROA 1ORSA 3ZT7A 3GGWA 4Q9QL 2ZG3A 3HI5H 1R24A 4MD5B 4XBGA 2BNQD 5GGRB 3RL1A 2X89A 4FZEL 3DHJA 5DVNA 3QG6A 5FDWB 1HNFA 4LL9A 5IB1A 4P2QE 4X6CF 1DTUA 2AJVH 4QRSA 1OAXL 1HH9B 3E6FB 3NH7L 3EDKA 1A4KA 5CCKH 5GPRA 1NFDF 3QFJD 3V5KB 1JPGA 3GMQA 5HDQH 3OJDA 1OT1A 1XF3B 3RGVA 1YN6A 2Z8SA 1FG2A 2B39A 2HAZA 2PUQT 4G80A 4NQDE 3F7VB 4KMQA 3HAEH 4OZGF 1I3RB 1XF5A 3LKOA 5D6DA 3CX2A 4MXVE 5TQ0H 4ZO6A 4GAYA 2OTWA 2M26A 3JV4B 3P0VH 3LRSB 4XWOD 2F5BL 3EJZC 4P23B 1EEYA 1ES0A 2XV6B 4TRPL 2WNGA 2C3VA 4TVSa 3GJFK 4GH7B 3F62A 5CWSB 3NPZB 2HVJB 3RUGF 4Q0XH 1TQBC 1QQDB 4L1HA 2BY1A 2P47B 4PPTA 4RQQA 4Y19E 4GG6E 4P46C 2EO1A 2RCSL 4LOUD 4YGAB 1EEZA 1ITCA 1A64A 4ZQKB 2BNUB 4XP6L 2AXHA 3VA2C 3WFCL 4ZFOB 1UWGL 3MRNA 3ZE0F 5AG8A 1KV3A 3RI5K 3G6DL 5H2BA 4TYUA 2HKHL 5FECB 1BQHG 1SY6H 2L7JA 2EDLA 3M8OH 3GSVA 4G9DB 4Z76B 1U8PB 4NWTH 5GRYA 3T2NH 3EHBD 4E41A 3SQOL 4XPAH 4N5ED 4LPVA 4N1HB 4KJPC 1XT5A 2EXYD 4JFFD 3FB5B 3P4OA 3ULVE 4P2CG 3ARBD 4R0LB 3ROLB 4P2QA 5FUCC 1RZJL 4G3YH 3JWDC 3GSWB 4TVPL 3TO4D 4FFWD 2AEPH 3P77A 2Q76B 4K2UH 3BN3B 1ZT4B 4YHOH 4PLJC 5ITBH 2Q7YB 3AREC 3REVA 2XWTB 5D7KD 3VRJB 5ENWA 5K93A 4R8WL 5FYJE 3LY6A 4Z7UE 3DX9A 4KH2A 2VTFA 2ZUQB 3LB6C 4FZ8H 4TUKL 1QRND 4WJ5A 4NQDA 3B2UC 3OKLB 3DUSA 3H9ZA 4XC1L 1Q9LB 5SWQA 4KI5E 5K9QG 2FZ3A 4A6YL 5L2JB 2F8XC 4QNPF 4J4PC 5DRWA 5DJZA 5H37H 1VPOL 2W1NA 5H94B 5INCA 5ALCL 1AD9A 1XH3A 2ADIB 3OKMB 3P9LA 4PP2B 4DFIA 3IDIA 3DXAE 3FQRA 4RBPH 3O6MH 5J1AB 2PTTB 3PP3H 4JM4H 4BKLB 2H8PB 3STZB 5SX5H 2PYED 1JNHB 5EZIL 4GG6A 4XPFH 1T6WA 1RJYB 5TGBA 5KVMC 4NBZB 5GZND 1CT8B 2RBLA 3V95A 3OF6A 3AAZA 5GRXG 1KC5L 5T3XD 1HHJA 5I1DB 3CFDB 2DRUA 3L3DB 3IJSB 4KVNL 4XCCH 3BUYB 1KLGB 3BEWB 3EAKA 4XNQA 1QR1B 1BEYH 2AJYH 1JL8A 3EO1B 3HTLX 5H35A 5EBMA 1AKJB 2VDLL 1ZAGA 4KXZI 4WI2A 1M7XA 1RQ5A 5DJDB 2NYYC 1QBMH 4UU9A 4XNXH 3SDCC 3HG1B 3GI8H 3DGGB 4NKOB 5D71L 5F9OL 4ZFGL 3MGTA 3RWGB 4R97B 3V7AG 1RU9L 3UZEA 5CHNB 1HN1A 4QGYA 2E8ZA 5EO1A 3SGDH 2R39A 3CFJA 1CZ8H 2YRZA 4KUZH 3MV9E 5IVXB 1JK8A 1ZA6A 4AMKL 3QEHA 1CL7H 3LQAL 5JZ7C 1EFXA 3CLEL 5TE6L 1P1ZA 2B4CC 1A7QH 1S78D 1UVQB 5BOPA 3GJFA 3V9FA 3L3KA 3QNZB 1BQSA 5CP7B 3L3GB 3VJ6B 1PG7H 4MXVF 4O58H 1R5WB 5F6IB 5FA3A 4JGUA 1NGQH 1FHGA 3IAQA 2A83B 4MJ6B 4P23D 4Y5XB 4JFQA 5B8CA 2HKFL 1BIHA 2RJMA 4YDKL 3ORJA 2PW2B 4Y5YC 2ICWI 4X6FB 5HDOA 2QQNH 1LDPH 3S36X 2QSCL 4YO0B 3RU8L 3X13A 4GG6F 1LGVA 4YH6A 1CFNA 1T7WA 2YMXH 3DXAA 4RMRA 1AXSA 1X5YA 1YEGH 3P73B 4N68A 2BFVL 3MOBH 5F7UA 1YY8A 3NFPA 3BD5A 1J0IA 1WVZA 4U1MA 1CGUA 4NRZA 2M8XA 1GHFL 3I9GL 1FDLH 1T83A 1DE4A 5DD5L 1EVUA 4UQ2B 4OIBA 5ESVA 2AEQH 2OLDA 5F1IA 4GAGH 3PNWB 3DUUA 1XGUB 3VW3L 1YJDH 4HW6A 3H3PH 4G43A 4OFKA 3IGAA 2BDNL 4GRWH 4MQTB 4NQUA 4KZDL 3AC0A 3PUCA 4OZHB 2P8MA 1O0VA 2VERN 2DF3A 2FATL 5F7EH 1B2WL 3S5LB 4M61A 5DI8B 1T66C 3FKUS 3O41B 4P4RB 4J7RA 4TOYL 5EZLA 4Q97A 4HLJA 2EDQA 1KPRB 5F7NC 2G60L 3MMEB 1FBIH 4RIRB 5KVDL 3ULVF 3VE0A 4RAHA 1I9RH 5JHLL 5IHUL 4XP9L 2ZG2A 1JPTH 5L8LB 4KKNA 1JRHH 2Q6WB 4KWUA 2BVEA 4LDEB 4O9HH 4RISH 1QFWH 2AQ1A 2VE6A 3U7WL 5T1DH 3MV9A 2VKWA 4ZPTA 4ZAKC 4B0MM 4OJFH 3KPQB 1KTLB 1J8KA 5C86A 3MNWB 3C60A 3MLYH 2VLME 4Z7UF 4MNHA 5B38A 4ZUUB 2MHAB 2UZXB 4UAOB 4YHPB 2DB8A 3ZKMD 3UBXB 4KI5F 5IB3B 4JRWA 1M7IB 4IHOB 4D3CH 1TZHB 2XWBA 1YMHB 2X1QA 1GGIH 1OF2A 3TF7C 3REWA 1MCQA 4OLVH 1MPAL 1D5IH 1KFAL 3BWAB 2WP3T 2YHGA 4NYLB 2J4WH 4GKNA 1M4KA 4NN6C 5DRNA 4R96A 3K2UL 3RTQC 3D85B 4CAGA 3HRZB 5ID0A 3T3ME 5JNYA 4NZTL 3FQUB 4IMKA 2EE3A 4U1GC 2P46B 4JG0L 1MOEA 3FTGA 3HZVA 2BSSA 4HF5L 5E4EC 4LKCB 1PKQB 3LKRB 4U1IB 4X9HA 5GRWA 3GK8H 1VFUA 2CIIA 4OD3H 4MD0A 4EI5A 3BFOA 5CZXC 3I50L 2DQGL 4Z95H 5EU7C 5JHDD 1R3HB 1UYWL 3MODH 1FH5L 4X6DB 2JLLA 3L5HA 5JOFA 2XN9D 2A6KA 4YQXH 3UEZA 4G6FD 3LKNB 2H32A 3QNYB 1HYRC 3O2DL 5IG7B 3I6LE 4Y4FA 1NMBL 4RWYL 3KPMA 1BM3H 3UTTB 2NTSP 3MBED 2CKNA 1DBMH 2C5DC 3PE9A 4NDMA 1HKLH 1I1FA 1FRGH 4HD9A 3U36B 1L7IL 4AQ1B 1XIWD 4YLQT 1Y6KR 4P3DB 1AO7D 4LIQL 3LMJL 2E7BA 2EYTA 3F65A 4FN0A 2XWJA 2V5SA 1ZHLB 2AJSL 4JKPL 2N4IA 3I3EA 1II4E 1EJ6A 2A38A 2WANA 3D48R 1R3LB 1MHEA 5GISL 3GJFH 4N9OB 1HHGA 2DMBA 1NBZA 3HC3H 1L9NA 2NZ9C 4UIKH 4YWGH 2EEDA 5D9SA 4FQHB 5FYJH 2R0KH 2V2XA 3UTQA 3OGCA 1FNHA 5ALBH 3ARGC 3CUPB 1NJ9B 4BQ9A 4OIIH 4XP1L 3KYNB 2YEZB 1SJHB 1J5OL 3M1BA 4NRXB 5E03A 2VB5A 5BRZB 4K9EH 1C08B 3BQUA 3WNLA 3L6FB 4WY7L 1WC7A 3MCKB 3EFDL 5DTFA 1T1YA 4OCXH 2V7HA 5FA4A 1KUMA 3INUH 4FTVA 5EOCH 1E4XL 3QI9C 3HB3C 4N8VB 3QWRA 1IJ9A 2CUIA 4P9HH 3F5WB 3E3QC 4NO0A 4HJ0C 2FEDD 4M6AA 4APQD 2VIRB 3VFPB 2ATKB 4OM1H 1EA9C 3UBXG 5C08D 1BZ7B 3O4LD 1F97A 2Z0BA 3CVHB 5GIRA 5M95B 2CKBL 4LCCC 4MXWL 4NJ9H 2E7LC 4HMDA 4NO5A 5DT1H 4FOMA 1YUHA 5CJOH 3ARFB 3VH8B 3MNVA 3TIEB 4LLMB 2Y07H 3GSOB 2FEEI 2X7LA 3WFBH 1MFNA 1UB6B 2DLFH 4JANB 3RPKA 3ZYIA 5KSVB 2P49B 25C8L 4HSQA 1UA6H 5DK3A 1WIOA 2RFXA 5EUOA 1FJ1A 1Z0MA 1NBYA 4Y7MA 4WCYH 3TBYB 2PXYB 4HWZA 3GMNA 5E6YA 4MXQD 5C0IA 1XF2A 4OFDA 43CAB 2R4SH 4R7NA 5LBSH 4M5ZH 4EBQH 1Q94B 3BPNC 1EBAA 2V7NB 4OZ4B 3QHFH 3IF1B 4IOFC 3T3MF 1JHLH 2I60L 4MNGE 4I3SH 2LAAA 5DK0A 5T1KD 1D9KB 3UYPA 5E4IA 3KYOA 2EIZB 4CW1A 4KKBC 3BGFC 5KSAB 4MWFB 3L9RA 3ROOA 1ZTXH 4M4RA 3ARRA 3FO2A 4ZUSB 5E8NB 4DW2H 1I7TA 5I0ZA 1W8NA 5AD0A 1QSZA 1X5XA 2EZ0C 1ZLSL 1JHTA 4AM0A 1IGTA 4YPGB 4JRYB 5JXEC 1ZWIA 1NCBL 1LNUA 5DRZA 5GS2D 5JPNB 5ANMB 4MSWB 5F44A 3H8NA 1T20B 4LEOA 1WCBB 3UTTD 4L9LB 5AYUL 1QLRB 5SWZA 4HJGB 1QTYT 4UBDC 2SEBB 4XNYL 2R56L 3D39A 3FHAA 2VDKH 5E2UL 1J0HA 2EH7H 3TA3B 4AIZB 2XXMB 4F58L 2DYPA 2W59A 3VFTB 2YA1A 2HTKD 4LHUB 3TPUA 1FYTB 1U92B 1V3KA 1XAUA 1AE6H 2HRPL 3BKML 4XC3H 1TETL 4PJIB 4U6HB 3TC9A 4HFUH 4FMFA 4IRSB 5DHXB 4K55A 3HZMB 2YK1H 2D7TL 3WS3A 1FN4B 1RUPL 4LNVA 4TVPD 4XRCA 2NXZD 2XQYK 2AK4B 3EYQC 5B3JE 4NM8L 5CD3A 3PWPB 3Q2CA 3PL6C 5IMKA 4TPRH 1CXIA 5DYOB 3VWKA 4LSDA 4HGWA 4WI6A 4ONFH 4RMTA 1YYML 4QXUH 3MUGB 5CEXA 4XPHL 5LJYH 2B7DT 3VI4E 2X1WL 5DJYB 1TVBB 2Q86A 4N8VG 4WTXA 4UILL 4PJ9D 1JPSH 5CGYD 4HLZG 3SEPA 1WK0A 2H2PD 3I6GA 1D6EA 2NY1B 1CK0H 3C5ZB 3AXLA 1I7RB 4WFEE 3TNMB 1S7WB 3KYMA 5I1AB 3AGVA 1P6AB 5FYKL 4XCFH 5DMJB 1RK0B 1C5CL 1M71A 4PJDB 1B0GA 1CDIA 1TJIH 3MOAL 3OR7A 3RP1A 4KTDL 3QCVL 4JY4B 2HJFB 3CC5A 2LU3A 2W0PA 4K7FA 5HHOA 5INDA 4BM7A 3MRMA 4TSBL 2V9QA 2VDRL 1C5DB 3PGFL 5GSRA 4K7PY 3PG2A 1MFDH 4Y16C 4M7LL 2Z91A 3PGDA 2X5PA 1M6OB 3AB0C 5IUSA 3BPOB 3EYSH 3QUZD 1Q9WB 1V7MH 4YK4C 3HI6H 2DQHH 4NQXB 4PJ5B 5HPMB 3I2CL 4N9GA 1KCRL 3HR6A 1IGML 1OTTC 3D0LA 4KQ3H 4WUUE 2RQ8A 5HGAA 2VISB 2GCYB 2IANE 3TH4T 1VFBA 5JA8B 43C9B 3RWFA 4WI9A 4P57B 5CMAA 3LEVL 4QXTB 3KPOB 4OZFA 4TUJB 5E8OB 4NZUH 1Q0YL 2QSQA 1S7QA 3LV3B 1AY1H 1FE8H 4GBXA 4NO2A 2IQ9L 4JPKL 2JCCB 5IB4A 2VYRE 4CBPA 2VZUA 2VSCA 4F7TA 3GB7B 5FIEA 3RL2A 3DUHA 3SDCA 1DQDH 1W72B 5D1ZB 4PRAA 1BFVH 1OSPL 1W0WA 3VWJD 1E6JL 1FNSL 3OKEA 4Z8FH 4XNZB 3SE9L 2BP3A 4EDWL 5I15L 4PB9H 3AU1B 5DQ9A 3JVGC 3U0PA 4F7CB 1C16B 4JO3H 2IADA 5F97E 2AGJH 3D25B 1Y18A 2XNAA 3FRUB 4UV4L 2F58H 5F89A 1T3FA 1MJ8H 2FX8L 3SHSA 1VACB 5EZJA 5EA0L 1OWWA 3VXTA 4FQCL 2XYCA 4K94L 1OD9A 3KPSE 2K3TA 3FB8B 4QRRB 2R1YB 3PGCB 4I48B 1X4YA 4O5LL 1NAMB 4DKFH 2EYRB 2WLZA 4NZRH 3PWJB 3Q48A 4YGVA 3VXNB 1BAFL 4XVUC 5IGXL 3IJHA 2DQJH 4O00A 5DD3L 4NJAL 2NY2B 3F58H 4LHUG 4OQTA 1HKFA 1PZ5B 3QP3A 3D87B 3B9KD 4L3EB 2YBRA 2ID5A 3MLXL 5B39G 4XMPL 1N6VA 3T0BA 1N6QL 1Y0LA 3OJVC 1CLCA 2V2TA 1X7QB 2D0HA 3N1PC 2NW3A 3V5HA 1GC1C 1D6VH 4I0KA 1FYTD 3MRJA 2P5ED 4WENB 4X7DC 2ZSWA 1YPZE 3CFBA 1HWGB 3VFNB 2BVOB 2F5AL 4KKLC 4E42B 3GMRB 2DJSA 2EDDA 1IGCL 3UC0H 5B3JF 3MUZ1 1J0YA 2AK4D 1U91A 4LKXB 3VXUB 4YNYA 5IEKB 1IL1A 3IAGC 1MLCB 4PY7B 2HT4C 3PWPD 5ICZB 4LCYB 1T5XA 1T80A 3MX0A 1MAMH 5DJ6B 4KVCL 4N5UA 4MMZC 1JZ5A 4NFBA 2COQA 3UJTL 2C1PA 3HZKB 3W9DB 1IRAY 3Q5TA 3VI4F 1QYGH 3CH1A 2BVUA 2FJFA 2LABA 3ALWA 1CD8A 4HXAH 1CE1L 1K6QH 3RWJA 5DEFB 1TQCB 5T33H 1FLRH 1EK3A 1NUGA 4K3DH 1FL5B 3PWUB 4PG2C 2NY1D 1AGCA 4ZAKA 3C5ZD 3G5YB 1FVCB 3TT1H 1ERNA 3RPIB 4EN3A 4ODUB 5CINL 1OCWL 1RZIB 1DEDA 4RRPG 3LN4A 2NPLX 4LBEA 3IYLW 3S98A 2G5BB 2JTDA 4BJLA 3JWDH 4MX7B 1A6PA 3VG0H 4JJ5B 3KPSA 1R5IB 3TFKC 5ISZE 1HH6B 1GJIA 1T1WB 4R90H 3T77A 3CDFA 3HAEB 1MH5A 2CMRH 4BH8A 4FQXA 2K9UA 4GSDL 3HI1A 5GS1B 3WXVL 2NXYB 3QUMA 2VDQL 4QTHB 4Y5VA 3BPLC 1OP5K 5EWIL 1I8KA 1YEDB 3HFMH 4F7MB 1LO5B 1HHHA 1HHKB 4U1SA 1A6AB 3RTQA 4DGVH 5I17A 1KPVB 2ZSVB 1DBAL 5C0BA 2O5YH 1N3NA 1GH7A 4FXLA 3SOBL 1F4XL 5DVKA 5DZLA 2P48B 1VEOA 1XF1A 2WQRA 3QEQE 2FO4B 2F54A 1DANT 1J1XH 1YZZA 1UT9A 3BE1H 3VFUB 1KTRL 1MNUH 3H6JA 2Q3ZA 4AT6A 1U0QA 2K7QA 4WHDA 4J3XA 4M43L 3R0MA 5GGQH 4J3VA 3MRKB 3HZYA 1HYSC 5LGHH 4PJ7A 5L0QB 4JFDE 1JHKH 5IK3B 3E3QE 3PIQA 2IQAA 3WE6B 4DTGH 2VXSL 3LHPH 1DSFL 4MYWB 3ULVL 2FO1A 4UT7H 1AIFB 1KF9B 1L7TH 5CEYB 3FOMB 3IFNL 4POZD 2X4OB 5FYLH 3U30C 4PGJA 1UM6H 5GRJL 2AABL 1HXMB 4EVNB 3BVNB 3QT2A 5IVOA 1JGLH 2XTJC 3SDAD 2QR0A 5C0AB 4AYFA 4PRHD 2VMFA 2B1HH 2E7HA 1TPXB 4P2OA 5I19L 2FNBA 4FMKA 4ZSOB 1VHPA 5IMOB 4X5LA 4JREC 5C8JB 2RB8A 1EAJA 2EDJA 3OX8B 1ZV5A 4MDJB 2B4CH 3S34H 5AWNH 3EYOA 4QCIA 4G7VL 1CGYA 2NY2D 4IDJH 1J9CT 3EYVA 1W2KT 2YKLH 1HCFX 3B3IA 4GXUM 1QD0A 1CFVL 1KXVC 3N0PB 3VXSE 1KLFA 3VFOA 4ELMA 4ERSH 1WISA 3HC0B 3OKNB 5HGHB 4RZCB 3S4SA 4NNYB 5HJ3A 5HYSA 1KJVA 4BSVA 4PJ8C 1XZ0A 3MRRB 2JELL 4U0RB 3ZKND 1HIML 3U9UA 1YPZF 3O3AB 3MRFA 1NCDH 4OCNC 1VFAB 1B6UA 2EDHA 5IJVA 2BJML 5IMLA 4GW5B 1JZ8A 5FHBL 5D2LB 4IOIB 3ARZA 3VXUD 5L2KD 3QEQA 2FR4A 1HDMA 1JGUH 3BX7C 3L3IB 3C2AH 1DLHA 1SYVA 2XRAL 3BIAX 4JN2B 4NQSA 5MI0C 2VO5A 1IGYA 2D31B 1UXWB 4DKDC 1X5GA 4ODXA 1MREH 3CDCA 5I0DA 4U6XB 4PV9A 4UTAL 3S6CA 1INQA 4DZBB 1I8MA 3WKNA 1G9ML 3QO0A 3FONA 4IJ3C 5JUEL 5FDYA 3GSNL 3WLBB 3QUYB 1OAKH 4JQIL 1NFIB 3VGGA 2DIBA 1KENL 4V1DE 4LSTH 4EOWH 2BRRH 1FPTH 5F6HI 5I1JL 5MEQA 3FJTA 5CGTA 2E7LA 4LCCA 3HAEG 1HI6A 2EDNA 5D2NC 3KXFE 1ORSB 4XAWH 5C92A 3GGWB 1R24B 1OGTA 2A1WH 1INEL 4XBGB 3RL1B 3MPCA 5ACLA 1ZK9A 3QG6B 5EN2A 3LDBC 5IB1B 4WU5A 3WKMH 3CMOL 2R0LL 2W9EH 5IHBA 1X5AA 5TFSL 4QRSB 3P11L 4TQEL 4LMQI 1A4KB 2D4DA 1I1YA 5DRXA 2CRMA 4OFYD 4RFOL 1JPGB 3GMQB 3RWHA 5J3HD 1FC1A 2E27L 3OJDB 2NXYD 3RGVB 1YN6B 5IOPA 1BLNA 1FG2B 4GAJL 5IT2L 5FUOL 3RX8A 1WBZA 1VKXA 2OP4H 1KEGL 3TP4A 1XF5B 3LKOB 3HA0A 1NUFA 2V5MA 4GAYB 4OGAD 2OTWB 4DVRL 3BYTA 1X6LA 5T5FL 3QUMH 4HC1A 4WI5A 1EEYB 1ES0B 2C3VB 3EFFA 1A3LL 1IKFL 3TT3H 3BJLA 2D9QB 3U7YH 3BZ4A 5KVFL 4GMSH 1Q1JL 2D3VA 2YA2A 1WAAA 4RQQB 2AXFA 1J11A 2XZQL 2CH8A 1EEZB 3S96A 3VFMA 2P42B 3NCMA 1JFQL 5C07D 5C09A 1P84J 3MRNB 2GITA 4LLAA 5BZDA 3E6HA 5H2BB 3BRGC 2H2SD 3QDME 4XWOC 3RRQA 4XGZA 4XXCC 5HDBE 4GLRH 3U9PL 3TJHD 1UFUA 3GSVB 4U1HA 2DLHA 4LSPH 1B4JL 4JAMA 2XA8H 3Q6FA 4KTEL 4E41B 3NGBC 4WVRA 2CK2A 3R06A 2J5LC 4AG4H 4HG4K 5AZ2H 1NGZA 4LCIH 4L3AA 1DBKL 3KXFA 4LDOB 4CGTA 4D0BA 5C2BL 3P4OB 1LO4L 4BZ1H 5H37G 1IBGH 1MJJA 2R0ZL 4LQFH 1IC1A 4P2QB 1WZ1H 5DUPH 1WT5C 2WSKA 1F58H 5HGDA 3NZ8A 2NX5E 4YXKL 3P77B 4MA8H 1S9WA 2YN5A 3REVB 2CR6A 5ENWB 4XCEA 3EHBC 1NMAH 4QF1A 4H1LA 3DX9B 4JPIA 2P1YA 1BIIA 4HUNB 3C8DA 4NQDB 4WJ5B 5FYKD 3DUSB 5SWQB 1E4WL 3QUXD 1UM4L 2FZ3B 3RY4A 3LPFA 3ARBC 2H9GA 5DRWB 5DJZB 2APFA 4LSVH 5INCB 1AD9B 4B41A 3DIFA 3KPNA 3TO4C 3EZ8A 4FFWC 5J12C 1XH3B 3P9LB 1W0VA 4DKEH 3IDIB 1N0LA 3FQRB 4Y8AA 5HYFA 3MLRL 3JUZA 4YHYB 2WUCH 4GG6B 2WUBH 4RWHA 5GJSL 5TGBB 3ARVA 1SVZA 2K1MA 3AAZB 3CDGA 4KRPB 5D8JL 2BY3A 5IQ7H 1H3TA 3BN9C 1YEKL 1J05A 1HHJB 4XAKD 1T89C 3DMMD 2B8OT 4I0CC 2C3XA 1PSKL 1N0XH 5DWUH 4XNQB 3QUYD 3A0OA 3CDYA 4YDLB 4GXVH 5H35B 5EBMB 5ICXA 4Y16A 1RURH 4KPHH 1N7ML 2PETA 4UU9B 4CRPA 3QXVA 3FFCA 2EE9A 1KIRA 2OMNA 3MGTB 4FP8H 4LAQH 2Q8BL 4NQCA 5GZNC 3SJVE 1A5FL 5EO1B 1LO0H 3CFJB 2DI8A 1JK8B 1ZA6B 1DDHA 4YFEA 4PUBH 4NPYA 2VLKE 3QEHB 1XGPA 3T0EE 2WP3O 3WSQL 2OJZL 1EFXB 1P1ZB 5AG9A 3F7RA 3RGVD 2NX5A 1N64L 3BJ91 4Z77A 2X4NA 5GHWL 5CBAA 3GJFB 4UZGA 3GMLA 3L3KB 2YD7A 3VXRA 1U58A 1JF5A 1K2DA 1JF6A 3SN6N 5FA3B 5TF1L 3UJJH 3C5JA 1QPPA 4JFQB 5B8CB 3JVGA 4Y1AD 1BGXH 4U7MA 5BW7C 3D2UA 4OSUH 2FYYA 2MPAH 3X13B 2E6PA 2EDRA 3GSUA 1S78C 3B6SA 1CFNB 2CGRH 3DXAB 3BEVA 1AXSB 3J8F7 1YY8B 2Y5TA 3NFPB 4U1MB 4C56E 4NRZB 2KL6A 2B5IB 4UUJA 4NWUL 1DE4B 5K9JL 4P23C 4ZDHA 5HDBF 1GAFL 5ESVB 5F1IB 3G5ZA 3DUUB 5I9QB 4LARH 1P4IL 1S3KL 3C9NA 4G43B 5TE4H 4KRNA 3IGAB 1I7UA 2DTMH 4FQIH 3KR3H 1G9NL 4HIXH 1Q9KA 2P8MB 1HQ4A 4IMLA 3CK0L 4M61B 3U0WH 5I1EL 4UDTA 5EZLB 4U2ZA 4H26A 3FZUD 2R69H 4NFCA 3VE0B 3MLTA 4M5YL 3SJVA 4P2QD 2CDFA 2P5WA 1NAKL 2O5XH 5C0CD 3HRPA 4OF3A 1JF1A 2VE6B 3O6KH 3MV9B 3BAEL 4ZPTB 1RZ7L 4UT9L 2C26A 2Y06L 2ZUYA 4S11A 3C60B 3N1QC 3QDGE 4MB3A 4MNHB 5B38B 3QAZB 5IROA 3QDJE 5F7HA 1GGUA 2YZ8A 4NQDD 2IG2L 4HJJH 4X83A 5F9JA 2VAAA 3UP1A 1WFNA 1H3PL 3HNSL 4KTYA 3IRZA 2UWEE 5GRVK 1X5HA 2CQVA 5I1HL 4HZAA 2XWBB 4LMQE 3LEYH 4H1LH 5L8KB 1OF2B 4XP4L 5C1MB 1OW0A 3REWB 4TSCH 4PG2A 4I2XA 4XZUA 3WHXB 2YRPA 4GKNB 4QRUA 5DEZA 1A3RH 5DRNB 5KTEH 4R96B 2AJZA 4YHNA 4Y19D 4GRLD 4JHWH 5ID0B 3ZKMC 2IC2A 3DV6A 1A1MA 2N7BA 3GBNL 4MAUH 5JNYB 3S88H 4N0CD 1CXHA 3DWTA 3FTGB 3HZVB 1SEQH 5KN5A 2BSSB 4RX4A 5D72H 4C56A 4OD1H 3IKKA 2BVTA 4LGPB 3WXWH 4F9PC 5I8CA 1HSBA 3V6ZA 1MCJA 3SDXA 4NCC2 4MD0B 2HLFD 5HHMB 4EI5B 4TSAH 4WWKD 4JY5L 1KN2L 1V3MA 2PNDA 3OXRA 3X3FL 1UH4A 2X70A 5JOFB 4XHJD 2A6KB 3IDNA 1UWXK 4YE4H 2X4PA 4F37F 3QCTH 3X17A 2H32B 1AFVL 4BQBA 4Y4FB 3CSYA 3HUJA 5LWYH 2CDEA 2OTUA 3KPMB 3ULVD 4I4WA 1EHLL 4NUJA 3H9YA 1FC2D 4L8SA 4NDMB 1I1FB 3MJ9H 3IS1X 1FGVL 4MA7H 4NO3A 4KGJA 2JF1A 3QDGA 2EYTB 4F8TA 2XWJB 3DARA 1IZJA 1G6VK 2BERA 1T7VA 1Q38A 5GGVY 2J8UE 1MHEB 4KI5D 2DQIH 4I3RH 1HHGB 5FUZL 4U7SA 1NBZB 3Q1SH 3MBEC 2UWEA 3QNXA 1IARB 1HWHB 3TPKA 5D9SB 2ZUUA 3O0RL 2V2XB 3DGCR 3UTQB 1GL4B 7FABL 3OGCB 3OZ9H 1EGJA 1C7TA 4WHCA 3MV01 4GW4A 3M1BB 5CILH 4MQSB 3QSKB 2V5TA 3TNNA 5F6IC 4XNUH 4JFEA 2VXVH 1AD0A 1DP0A 5E1HB 4M6NL 5JQ6L 2XACC 1WC7B 4Y5XC 4MHHG 4R4NC 2J6EL 4OQTL 3NTCL 3BT2H 2J88H 3A6CL 1T1YB 5DTFB 3T2OA 2DQTH 2V7HB 5FA4B 3O11A 3FT3A 3V4PH 3V4UH 2W07A 2IF7A 1JPFA 4FTVB 4X6EA 3MJ6A 4S0SD 4F7EA 5IWLA 5F7DA 3SKUD 2AKRA 2NY7H 4JB9L 1B88A 4PJ8A 3WL9A 2OR9L 1JMXA 3QQ9D 3O4OC 3PHSA 3MUHL 2JIXD 4NO0B 4Z5RA 5B38G 4YHZH 3FAXA 3QFJE 1A8JH 1HXYA 3UJIL 3B2VH 2HVKA 3RX7A 4XT1C 5GIRB 3GMOA 4M6MH 2NY6D 4NO5B 1YUHB 3U46A 4ZS7L 3MNVB 4OI8A 1GC1H 2DLGA 3IDXH 5T3ZE 2XZCL 4U3HA 2KQNA 1NC4D 2X7LB 3T65A 1MEXH 5KAQF 1S9YA 1WBYA 2QJDA 3OG4B 4MDIA 1OAYL 2BK8A 3K3QA 2ZOLA 2UWEF 2FEDC 2RFXB 5EUOB 4APQC 1FJ1B 4D0DA 1NBYB 1GCFA 2J8UA 4HWZB 4D94A 4UV7H 3GMNB 4OI7A 3EDDA 5C0IB 1XF2B 3IXTA 5ID1A 1CU4H 4R7NB 5D2NA 4NNPH 4JFZH 1ZGLP 4KQ4L 4YZFE 1RUQH 3WCYA 3MXVL 1I7ZA 3MOQA 4QKXB 2FECI 2A9ML 5DK0B 4RMSA 3BKJL 2ZJSL 4GS7B 3KYOB 4H8WL 4FQ1H 1DANU 1NDMA 1CE6A 2BNRD 4JN1L 4FXKA 4CW1B 3L9RB 3ROOB 4QWWD 5IFAL 4MXQC 2DIJA 3FO2B 1MCLA 2AJ3A 5FYJU 1AJ7H 3CVIL 4MB5A 1WCQA 3OJMB 1I7TB 2KUTA 3FN0L 2ENYA 5AD0B 4JFFE 4LEXH 1JHTB 4AM0B 1IGTB 4GLRI 3PHOA 3JV0A 1ZWIB 5JW4R 5CEZL 1LNUB 5DRZB 5HYJE 4OLWH 3VGBA 4LEOB 2FGZA 1TJHL 1ZT7A 2I26N 3FCTA 5IHLB 3TJEH 5SWZB 5DK2A 4D9RE 5IESH 2HLAA 3QFJA 4KROB 1TQBB 1UEYA 5HHVL 1UKQA 2J3SA 4PRIE 1EDQA 3D39B 5BVPH 1KJ2A 2YC1A 4R26L 4H0IA 1QRNE 2DYPB 2VLMD 1RUAL 4K3JH 1XGYH 5GGRY 3TPUB 3DV4A 2FEEL 1U8MA 2DLIA 5HGGS 2J8UF 5JXAH 1T2QH 5DD6A 4Z9KB 4BFIA 5CZKA 3WS3B 3WO3B 1D5MA 2E5EA 5KZCD 2YUWA 4XXCA 5CP3A 5DZOA 4XRCB 1U3ZA 5CD3B 6FABH 4P4KD 5FK9A 4KRMB 5IMKB 4X0KA 1RFDH 3VWKB 5FF6A 1QFHA 2HWZH 2VXTL 4HGWB 3PV6A 1S8DA 2DI9A 1W8OA 4OGYH 3P0VL 5CEXB 1JYXA 5HXMA 1WTGT 2HTKC 4IOSD 3NIGE 4F9LC 4ENED 4KKCD 3BQUD 3MCG1 6CGTA 2HT3D 1NEUA 2DJ4A 2Q86B 3B43A 4OV5A 1KN4L 4QRTA 1EGJH 5JLZA 4DOHE 4G8GE 1UWEL 4IRZL 1JZ4A 1WT5A 3DX7A 3LRGA 1PJ9A 3I75A 1QVOA 3I6GB 4NKIL 1D6EB 1F8TH 2NXZC 3GHEH 3NIDE 3RZCD 3AXLB 3IFPA 4P48A 2K7PA 2D4FA 3WIIH 5DC9B 5JIKA 3KYMB 1O5DT 2ORBH 3T2PA 4PBXA 1M71B 4JDTH 1SY6L 4KUCF 1B0GB 1CF8H 1MFAH 4HBCH 3OR7B 4JFFA 1NUDA 1SMOA 4JQXC 4KHTH 5DUBA 2AI0H 1TCRA 3CC5B 5ADPL 3D9AL 5IJKA 3ARBA 4K7FB 5HHOB 5INDB 2MFNA 3MRMB 4JR9L 4NWTL 1BREA 3K8KA 4PJ9C 3TYFA 5CGYC 1CFBA 5HYJA 2Y4SA 3TO4A 3UZQA 2Z91B 2H2PC 3PGDB 1MY7A 3VMPA 4ZXBD 2ED8A 2X4TA 4FNLH 1NBVL 3PABA 5F72S 3MBXH 1GPOH 3V0WL 4L5FH 3WYRA 3Q6GH 2GHWB 4N9GB 1NCTA 4PJXE 3D0LB 4HWBL 5HGAB 1QRNA 1I3GL 1MWAA 1T22A 1VFBB 4MZ2A 2V2WA 2AEPL 3RWFB 3ZL4H 5CMAB 3CPLA 2X41A 1ZEAH 2DQEH 4JO1L 2OMBA 4OZFB 4AEHH 3T1FA 1PX4A 1S7QB 1YEFH 2FWOA 4GBXB 4NO2B 5IB4B 4R4BA 2R2EA 5D7JD 3RJQB 3QUZC 2JK5A 4F7TB 1FO0A 1G6RA 3RL2B 3TCXA 3SDCB 2PYEA 4PRAB 2YPLD 1W0WB 3I02A 4PLKD 5FB8A 1I75A 3OKEB 1ADQH 4OV6F 2A6DA 3QHZL 4S1RH 5DQ9B 1EMTH 3SKJL 1T2XA 4LGRB 3U0PB 3W2DH 2IADB 1T5WA 2EDKA 4LSUL 1AGFA 1Y18B 2XNAB 5F89B 4JM4L 1T3FB 3RNKA 1JI2A 1QBBA 1ZLUH 1L0QA 3GNML 1KJ3L 5EZJB 3VXTB 1UWXH 1A1OA 4NP4L 1YMMD 3ET9F 3VD7A 1MVUA 2AP2A 4U6YA 3VWJC 5MEPA 3RNQA 4XCCL 1G0YR 1MAJA 1D9KC 4YGVB 2DQCL 1KIUA 3IJHB 1I8LA 1CFQA 2IPUK 3VXPA 4HQQL 4PP1D 4KROD 5KSAC 3QPXL 5D7IE 2HP4A 2YBRB 1YQVL 2PTUA 3KPRE 1A7OL 5GGVH 4JFHE 5HHXH 1Y0LB 1U3JA 2WBJD 2WM0A 3QZWA 2V2TB 2NW3B 3PDOA 4URTB 3V5HB 2OR8A 3HNVH 3MRJB 1FL3A 1JMZA 2ZSWB 4K71B 4LK4A 1A9EA 3EO9L 2YS4A 4PJXA 5I8EA 5IW3A 3IB4A 3CFBB 3MLSH 2P7TA 5K33A 1EEQA 4OLYH 4NGHH 1U91B 4MJ4A 4NHUA 4YNYB 3TV3H 4LGSB 1IL1B 1T5XB 3B9KC 3HMWL 1DBJH 3RVUC 1YQ2A 2JJUA 2C1PB 1NGQL 4I77H 3MJGX 5KG9A 1V7NL 5CP3H 3NIGF 3CH1B 2FJFB 4ODTL 1RIVH 3LS4H 4RNRA 3LRHA 5JQHC 3OKKA 1K8IA 2QQNL 4IRSC 3RWJB 1DBBL 3NPSB 4LU5L 4G8IA 4YBLC 1Z3GH 1QO3A 1FFQA 1UM5H 5AZEL 3K4ZA 2EIDA 5BZWA 2IFFH 3MGAA 3NIDF 3T0WA 1AGCB 4ZAKB 4K3EL 4EN3B 4H88L 1MFBL 4MZ3A 2XN9E 5H8DA 3LN4B 3ISWA 4LBEB 1ZHKA 3LVEA 3QWOA 3KPSB 4H20H 3ZDYE 3EYUL 5D5ME 3T77B 3ZE1E 1CFTA 3GBMH 4GAGL 1SBSH 1MH5B 3O3DA 4AEFA 4S1QL 1YNLH 4BH8B 4FQXB 3LS5H 1EVTC 3WD5L 3HI1B 3QUMB 4Y5VB 2NY1C 3C5ZC 2FBJL 1I8KB 4PGCA 1AO7E 4OZFG 2FBOJ 1Q0XH 1U2HA 1XR9A 3DRTA 5D7IA 1RUKH 4OZIE 1HHHB 4F80A 3MRCA 2A77L 3KPRA 1E0OB 3QWQB 4PJXF 4U1SB 3RTQB 4JPVH 1LO2H 5I17B 4UOW1 5C0BB 1KB5A 1FAIL 1N3NB 3K1KC 2X9YA 4TNWK 4M62L 4OLZL 4OJFL 2F54B 3DLQR 2X09A 1TXKA 5E4EB 4LAJH 4F57H 1B9ZA 4AT6B 4F9PA 3G6JE 3QCUL 3MV7E 2BVQA 1YEHH 1LEGA 3FAWA 2BY2A 4AENA 3HZYB 5C0DA 1MWAH 4PJ7B 5CZVH 1OSZA 1FL6A 3C6SA 4W4OC 3S3SA 5D7SL 3PIQB 3W82A 2IQAB 4MGXA 5F3BA 2FHCA 3A67H 3O9WD 5TQ2L 1AR1D 4N0YH 1WWAX 3M07A 2VDPL 4N0UE 1A7PH 5DD0H 4P3WA 1FO0H 1MRFL 3BZEA 4XVTH 4LVNC 4NQEE 3MRQA 2QR0B 4QHKI 3ALXA 2A2QT 2HN7A 1QHOA 3S3JA 4P2OB 5EH1A 5T3XH 4WFED 3KPLA 1G9EA 3WFDL 4JLRA 3QEGL 2XN9A 2BY0A 3CXDH 5ETUA 1OP9A 5BO1H 3B9VA 1ZGLM 5DF0A 3WJLA 2WAHA 2XQYG 1EZVX 3UPRA 5C08E 3O4LE 3EOTL 3EYOB 4QCIB 5D5MA 5F1KC 2MCG1 1KACB 1S5IL 3EYVB 5E5MA 3B3IB 3MBEA 3MODL 1AHWA 4YQXL 4ELMB 3VFOB 3DO3A 2GSIA 1CIDA 3S4SB 4GKSA 3WLWD 2CUMA 5HJ3B 1KJVB 5HYSB 1L4IA 2LQRA 4BSVB 4Y2DD 1XIWA 1XZ0B 3N50A 4YR6A 1AO7A 4XVJH 4OZIA 5DQJB 2FX7H 3NCFB 1HINH 4Z0BL 3U9UB 1IT9L 5MEND 3MRFB 3OV6A 4WUUD 4YEEA 2IAND 5IJVB 4H0HB 5IMLB 2NY2C 4G8EA 3L5WA 3QEQB 2FR4B 1HDMB 3RAJH 3C8KA 1DLHB 1SYVB 4XX1G 1IILE 4MJ5A 4NQSB 3TBVA 2VDNL 1IGYB 5BS0E 3MUY1 1SYSA 5I73B 4U1JA 2YD5A 4ODXB 1RJLA 1QLEL 1OGAD 3MQIA 1UACH 4PV9B 4M8VA 1INQB 3BMWA 1I8MB 4UIMA 3MLZH 3QO0B 3ZKNC 3FONB 5J11C 4UIKL 4TULH 2H45A 1RSFA 2AEWA 2DAVA 3HPLA 4G8FA 5ALBL 3BH9A 3CSBA 5MEQB 1E6OH 4LCCB 4EN3D 1HI6B 1FGNH 5GJTH 3UPAA 1OGTB 2OX5A 4WFGE 3H0TA 2G2RA 4HGKC 2VDMH 4WU5B 3F6LA 2IEPA 3KPSD 4OKVA 5D5MF 5AEAA 3ZE1F 4HIHA 5T5NF 5FCUH 3IKCA 5EC1A 4BK5A 3GHBH 3HMXH 1I1YB 4APQA 5DRXB 1CBVL 4FQXD 3RWHB 3OAUL 3O4LA 5C08A 3QG7L 5KS9F 5IOPB 1BLNB 3HE7D 3BPNB 1WBZB 1VKXB 4GFTB 1FNAA 1DQMH 2QTEA 1VGKA 2FB4H 4KDTC 4WRLA 1C5BH 4L1DA 1JZ7A 5CEZD 2OYPA 4UTBH 5AUMA 1CDHA 5DJAA 3EFFB 1IAIH 2XQBL 5DT1L 5DDHA 3PWLA 4KK6D 3BZ4B 5J3HC 3G6JF 3MYZA 2M2DA 4NKQB 4WV1C 2VH5L 2NXYC 3O3EA 1CGVA 1YN7B 3V52H 2AXFB 5TDOA 1KB5H 1U93A 3U4AA 5F3HA 2A9NL 2E7CA 1NSNL 3S96B 1NCWH 3VFMB 1RIHL 1FP5A 2APVA 4KAQH 1UCBL 5HBBA 4YDIH 5DURB 4Q6IC 3VFGH 3KNBA 5C09B 5BS0A 2DMCA 1X4XA 2GITB 4CUCA 4DUWA 5BZDB 3E6HB 3H42H 5E2VL 2Y9RT 1FNEA 4XBEH 4ETQA 4XGZB 5T1KA 1G0DA 3GIZH 2R4SL 4U1HB 1FCGA 1MQKL 3KJ6H 4M1GL 4JAMB 2DQDH 2FRGP 1ZVHA 3Q6FB 3QHFL 4HWEL 3MRLA 5KSBE 3R06B 2IBBA 1NGZB 1X6NA 1JHLL 4P2OD 2BSRA 2IPKA 3KXFB 4M1DH 4E0RA 3IDUA 1NGWA 4HCRA 4D0BB 3UO1H 1RI8A 4ZS6D 4Q9RH 4YUEH 4BSWA 3LN9A 2HG5A 1FIGH 1MJJB 5FCSH 3FO1A 2Z4QA 2H2SC 1IGFL 5HYSG 2DBLH 4CVZA 5ISZD 5CJQH 3NZ8B 5HGDB 3TJHC 2ZCKH 4JO2H 1S9WB 4P9MH 4F3FA 3BESR 3IU4H 1Q9OA 5B4MD 1IGIL 2WBKA 4XVSL 4XCEB 3SE8H 1C1EH 1YA5A 5DO2C 4QF1B 4H1LB 4JPIB 1BIIB 1TPXC 1MI5E 2IPTH 5F88A 2B1AL 1NQBA 1DLFL 5C6TL 3SCMD 4F9LA 5JMOC 3ILPA 2H9GB 3ZDZF 3O2WH 1I9JL 3WNKA 3T4AA 3DIFB 3KPNB 4M02A 5SV3A 1NLBH 5J1TC 4CADA 2OK0H 1W0VB 1MRCL 1QEWA 2IALA 3GKWH 3CAFA 1F00I 4H0GA 1IC5H 3W0WD 4AK1A 3RJDA 3TZVD 2R8SL 1QFUH 3DHMA 3CDGB 3O2VL 1KB9K 2YK1L 4JFDD 3FOLA 1J05B 4U0RC 4WW2F 2I9TA 4JQXA 1MCSA 5JA9A 3MLPA 1JGVL 1UKSA 4ZUWA 3ULUE 4LRIC 4A6YA 4MJIE 5TDNA 1CDBA 3L5XH 1BBDH 4PJ9A 4DCQA 5ICXB 2EIEA 4Y16B 3MA7A 1AH1A 1LO3H 4OCYL 1R3KA 3ARPA 3FFCB 4YK4B 3TLRA 1KIRB 4YXLH 4NCDA 1DVFA 1U95A 4ZTOL 3OG6B 4U33A 5KSBA 1DFBL 4NQCB 1S9XA 5FHAL 4Q9BA 4KZEL 4M48H 2YPVH 3Q3GA 3DMMC 4OT1L 5E9DE 4EZMA 1DDHB 4HULB 2QBWA 1IKNC 2WINA 4NPYB 3QIWD 1E4KA 1XGPB 3QRGL 4NN7C 3QUYC 3NN8B 5HVWA 5CUSL 2NX5B 3QB7C 1MIMH 1NKRA 2X4NB 2Z8VC 4Z77B 5CBAB 2BSED 5GRUL 3GMLB 3PDDA 3LPGA 3QUZA 4R2GD 3VXRB 3VXSD 4HDIA 1U58B 4HXBH 1K2DB 3QULB 2P5EE 4R9HA 4RMVA 4M4PA 3C5JB 3X11A 1JP5A 4GT7A 1MI5A 1R3JA 1BJ1J 4JZNA 4X80H 4BSJA 3ZSTA 2IAMD 1EUTA 4DGYL 3D2UB 3FRPA 3EYSL 2DTSA 5MHSE 2FYYB 3GSUB 4X7CC 1YECH 5CJ8A 1FFOA 3RGVC 3B6SB 2F74A 4WIQA 3KHQA 3BEVB 3SGEI 4NUGL 1UGNA 4K94C 2Y5TB 1BJ1H 5J56B 4DWHA 5D6DC 1OTSD 2Y23A 4DVBA 4LLDA 1OAXH 3NH7H 2NTFA 3VFWA 1LK3L 3VWJA 5J7CC 2VDOL 4KHXL 4NZUL 4UUJB 4ZDHB 1TENA 2V9RA 4LFHD 3S37X 1RZKL 1AY1L 1FE8L 5FFLA 3G5ZB 5TH2A 3R1GL 1BP3B 5EDXA 5F9WC 3C9NB 4OTXL 2P24A 5I1KH 4MJIA 2C4FT 4PV8A 4ZFFA 1I7UB 5KSBF 4V1DD 1Q9KB 2VWEE 1BFVL 4U1LA 3RHWF 3X3GL 1HQ4B 3WEXA 4IMLB 3DSNA 3OHXA 3KXFD 4YHML 1NANH 1OB1A 4UDTB 5T3ZL 4H26B 2F5BH 2VUYA 4TRPH 3PWNA 3MLTB 3UAJD 4H1LG 3SJVB 2CDFB 1PQZA 2P5WB 2FIKA 1PEWA 2DKSA 2F58L 1X44A 1JF1B 5BV7L 3BIKA 5IIEB 2GSGA 4WTZA 5E9DA 4HAGA 1X5LA 2RCSH 5F8QC 3B9KA 3VFRA 4PJCE 4XP6H 3UMTA 3WFCH 4DN4L 2JJWA 5GS2H 1UWGH 4G6ML 4DKFL 3G6DH 2HKHH 4WHTA 3FZUC 2VAAB 5F9JB 2CK0L 4OLXL 1MF2L 3OMZA 5EORL 5JMRA 2IBZX 2P5EA 2YUXA 4PY8I 3BP4A 1HZHL 2D2OA 3PWVA 4OFIA 4PD4J 3SQOH 3SE4C 4I2XB 4XZUB 4ZODA 2Q8AL 1JV5A 1E28A 4QRUB 2AJZB 4YHNB 1AGEA 3HC4L 4L8DA 4YHIA 4PJGE 3DV6B 1A1MB 2AJXL 3HS0A 3IXAA 3BUTA 2JJSC 3K81A 4TVPH 5KN5B 4C56B 1H5BC 3ULUF 5KANI 3CD4A 5E8EA 5I8CB 1OARL 1HSBB 3QDMD 4U05A 3V6ZB 3SDXB 3RA7L 4R8WH 3JSSA 1H3GA 1GGTA 3OB0H 1X5ZA 3OXRB 2CRZA 4PRHE 3BPLB 4TUKH 3T0DA 2X70B 4MMXC 4XC1H 3IDNB 4FQPA 4YHYC 1WBXA 4ESKA 2X4PB 1JTTA 4A6YH 3KPPA 1WJ3A 5K9QI 1P7QD 1K6QL 4KRPC 1VPOH 1CD0A 1H3WM 5ALCH 5EC2A 3HNTL 4N0CC 3CSYB 3HUJB 3SDDA 2CDEB 2OTUB 4K3DL 3HN3A 3WMSA 4I4WB 5JW4M 3VFSA 4NUJB 4HFWA 4JM2A 1KIQA 1T6VN 4WWKC 5EZIH 1T4KA 4NO3B 3S35X 3VD3A 3WNMA 5E99L 1OT2A 3QDGB 3G6AA 4V2CB 1KC5H 4XHJC 4M1CD 2W0LA 2R2CA 4PJCA 1VGEL 2XZZA 3NA9L 5MEOA 4KKAD 2DM2A 4KVNH