1WICA

Solution structure of the msp domain of riken cdna 6030424e15
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
152
structure length
152
Chain Sequence
GSSGSSGKKPLSVFKGPLLHISPAEELYFGSIESGEKKTLIVLTNVTKNIVAFKVRTTAPEKYRVKPSNSSCDPGASIDIIVSPHGGLTVSAQDRFLIMAAEMEQSSGTGPAELSQFWKEVPRNKVMEHRLRCHTVESSKPNSLMLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the MSP domain of RIKEN cDNA 6030424E15
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical Protein RIKEN cDNA 6030424E15
total genus 16
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00635 Motile_Sperm MSP (Major sperm protein) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1wicA01
4KUZL 4JPIA 2YD3A 4P3WA 3C60C 3UPAA 3ZKSD 4HEPG 5C0CD 3SKNA 4X4YA 3PQYE 4KI5D 3NFPB 3VW3L 2PXYB 5I8KL 4WNQB 3GMNB 3FFDB 3OKKB 3GHEL 5KW9L 5IB4A 3GNML 1JPFB 3OAYK 2EC8A 4PRPA 1WBXA 3PL6C 2ITCA 3WHXA 3QFJB 2NY3B 1K8IB 1OAKL 5CJ8A 2YA1A 4MQXD 2HJFA 4N0UA 1OD9A 3IKKA 1X5FA 3HZVB 4PJ5D 3RX5A 4JFDD 5IVXE 4H1LB 3BPNB 1FO0B 4DVRH 4PB9L 3SDXF 1FAIH 1I3VA 5FGSA 3BWUC 4MJ4A 4NNYB 2WZPD 1UT9A 3S37H 1VGEL 3MJ6A 1SJVA 2VO5A 2KUTA 1IAII 1MHEA 3TZVC 3AXLA 4UTAH 1GZPB 2ZKHH 1KFAL 2V5MA 4XRCA 5DXWA 1KJMB 4TOYL 1WTGT 5MEOA 2UWEB 2ZUTA 5FB8A 2VWEC 4M62L 2EDJA 3TH4T 5EUOB 2GY7B 3EZJB 1U58A 1K8IA 5EO1B 4W6WB 5IT2L 2EIBA 1YEFL 3JWDL 5SWQB 2OBGA 4YDVB 3EJYD 3H0TB 3X14A 4LGSB 3KXFD 4HGKC 1JNHB 1BJ8A 15C8L 2CLRB 2DJ4A 5F71A 3GMNA 3OGCB 4TRPH 4PY7B 4DCQA 3IS0X 2X4QA 2I07A 3TBWA 3VD5A 3AGVA 1U93A 4LVHB 4QRPD 1J0HA 1F11B 1TDQA 4H20H 1C08A 5C0EA 4S0SD 3D2UA 3WO4C 5DJ8B 4AIZA 1QRND 1TENA 3I84A 3B5GA 3FQWB 4M7KH 3GSQA 3BPCA 4ZYKB 4OCRL 3DV6A 3KGRA 1GGIL 4ODVH 3VWKA 2Q7YA 1QR1B 3EFDL 1I75A 2BVQB 3SGJC 3H3PH 2HFFB 3OL2A 3QXWA 4F7CA 4GQ9H 4JY5L 5KOVC 2R23B 1CDYA 5ALBL 4RAVA 2X9XA 4RZCB 5CJBA 4NO2A 3O3AA 1XIWB 2DKMA 3S3PA 2H2PD 1BVZA 4GUPA 1MAJA 3UPCA 2XY1A 2XN9D 2J12B 3MBEA 4OAWB 4LDLB 3MLRH 2VLLA 3SDCA 1LP9E 4LKCB 4PJBA 4EI5D 3ES6A 1DLHB 1TETL 4PFEA 1D6VH 4NNPL 1R3KB 4NGHL 3QQ9D 1EGJH 1OWRM 2P8PB 4GG6F 3CX5K 2Y36L 1RUQH 5CMAB 2WSKA 4YGVB 2APVA 3B2VL 4L8BB 2OXHA 4OGAD 2RFXA 5CSGA 2OR9H 4QRRD 1U0QA 3Q0HA 1OGAB 4PV9B 1RZ8B 2P5WA 4YHYC 2P24A 4Z0XB 4OZFB 4B53A 3SY0A 1P9MC 2MPAL 3W11D 4BH8B 1KIRB 3L3OA 3CH8A 1MLCB 2VLRA 2YD6A 2P43B 4XBEL 1A6UH 5EIIA 1IZKA 4J3VA 4N0CC 5AWNL 5KJRH 4BSVA 1FH5L 4HV8B 5E4IA 1QFHA 4P2QD 1JNLL 1X5KA 3DRTA 5IHUH 1UH3A 1I1YA 1UGNA 1NC2B 4JO2H 3CLEH 4P9HC 3V8CA 1CXFA 1BF8A 5FOJA 1G7HB 5IQ7L 1OT1A 1X7QB 2BMKB 2YUWA 3LV3B 3TFKD 4ZQKA 4PJCA 5E2UL 4XPBH 2C3HA 5FDWB 1SYSB 5CBAA 3D39D 3K8MA 1AD0B 1AJ7H 3MRIB 3WUWB 3MBEC 4J7RA 1RZIA 3QP3A 1JPGA 2R0LL 3O3EA 4I1NB 5H37H 3QRFM 2X1OA 4NWUH 2BDNL 3PXHA 3L7EA 1EXUB 1JGEA 4XPGH 1KTLB 1MQKL 3FOMB 3NCYS 2IJ0C 1SEBB 3RNQB 1H3PH 2P8MA 3LS5L 5IR1A 1WAAF 1LEIA 3HRZA 1CD1B 1CXIA 5FHBL 3TYGL 4OT1L 1D5MA 3WXWL 1E6OL 1I9RL 2H9GB 2HT2D 4EXKA 3FZUD 4K8RH 4UB0H 1KT2A 4LCYB 5E8PB 4QWWC 3IXAB 4NO0A 2G5BA 4JGJA 2ESVD 4OBSA 2J3SA 1YPZF 1I8MB 4OGZA 3KPNB 3LDBB 4QO1A 3MJGX 1NBVH 3UJTL 2JJTA 5C6WH 2CO7B 3IJSB 3U79A 4D3CL 1FNAA 1CD9B 1L7TH 4FTVD 3RVVC 1C7SA 1TJHL 3MLSL 2ED7A 2Z31B 4EI5C 4PJGB 1LO3L 1HQ4A 2D9CA 2K7PA 3SGJA 1QVOB 5L2JA 4NUGL 3T77A 5I30H 3P4OB 5EO9B 2QSCL 4MA1B 1YN7B 4MA8H 3RWDA 1Q94A 3RZCC 2AKRA 1RURL 3ARFD 3T4AA 2BVUA 2HFEB 1P6AB 1KNOA 2AEPL 2B5IB 5ABDE 3SO3C 5D7IE 2VDNL 2E7MA 4PLKD 3OMZA 3E3QE 5IW3A 4TSCL 4ODTL 1JUFB 1IGMH 4PRIA 4M02A 1KN2L 4QNPF 4Y2DB 3TH2T 3RVTD 1J18A 5GGUA 5HYJD 2FRGP 2YA0A 1CK0H 1WITA 3KPQA 2V5RA 5GGTA 2WUBH 5EDXA 4N9GB 3SJVD 4DKAA 3IU4H 2CMRH 4MQ7A 2FYYB 3VE0B 4KK6D 2VDRH 3BPLC 2HLAA 3SDAA 5L2KB 3NN8B 4NZUH 3UC0L 1CZ8H 4GFTB 3VI3F 4OCSL 5EBLA 3GMPA 3H8NA 2VXVL 3RWFA 2AJZB 1AFVL 4AT6B 3UTSD 1DEEB 1F6AA 2LE9A 4ZUWB 5D71L 5E56A 2QADC 4I0PC 1S7RB 1QO3A 4GW1B 1FN4A 3DI2B 4FG6D 5TDNB 2P7TA 2XTLA 1WK0A 3QHZH 1DN2A 1OM3L 3MCLL 2WLZA 4NJAL 1W0VB 4MWFA 4GMSL 4X5WA 4LASH 1CE1L 3CU1A 2BC4B 5LBSL 1JZ3A 4MJIE 1EDQA 4KZDL 3L3IA 4TNVK 1E0OB 1KEML 4U1KB 4LEXH 3SJVE 1TZIB 3VFTA 5BMFL 5HHVH 3UJJH 3M07A 2IFGA 3TZVD 4NQXA 4FTVA 4KPHL 1Z9SA 4HMEA 3DETC 4RBPK 3JVGC 4M5ZL 1MFBL 5CILH 1T7ZA 2A74B 1I1AA 4WV1A 3MJ7A 4RA0C 3QDMD 2FHBA 4JKPL 2QSQA 1DFBL 1YY8B 1F4XL 2CDEA 2EE9A 3D85B 4L29B 4NO0D 2ZPKH 2W65B 5IW1A 4ODUB 2X4OA 3ARGB 5J11C 2DQTL 1NFIB 1UCBL 5HD8D 5IESL 2EYRA 3QAZB 1JF6A 5EZJB 5DUMH 1DDHB 2AJXL 3NA9H 4PJ9C 5DVNA 1OAZH 4Z7UE 3UBXB 2LTQC 4DN4H 1ORSA 3BPNC 4FABH 3VWKD 2VKXA 1G7MA 4M1GH 2WQRA 3KDMB 1IILE 1TQCB 4PB0L 5GIRA 4RMWA 2E7LC 1Q9KB 1SM3L 5K9KB 5KVDL 3IVKB 1IEBA 3WEXA 3AROA 3F7QA 4EI5A 5DJ6B 2B5IC 3QIUB 5HHNB 2EXWD 2R56L 1MWAL 5DRWA 1V3LA 1CBVL 4QHUB 3RWEA 4WVRA 3U0PB 1LNUA 3RA7L 5KN5B 3EYQC 3O9WC 1SY6H 4NC2B 1M6OB 4M93B 3ZTJH 3JXAA 2XWJA 1Y0LA 5I16A 2FEEI 5FO9A 1PFCA 1HHHA 3VD3A 5JW5A 1LO0L 3ESUF 4LCIL 4NKMA 2NTSP 3E2HB 2ZZUT 2BCKA 1IC4H 4RNRA 2V5YA 5C7XH 5IVOA 5K9JL 3FN9A 2A73B 2XG4A 1BLNB 2P5WD 2E9WA 2VMFA 3TM6A 3BDYH 1RY7B 3MJ8B 2AGJL 1FO0H 2DQDL 4PJ9A 1QSFB 2Z93A 4P3CL 5HHOB 4OD1L 5FECA 1ZT1A 4QRPA 4IOIB 4J8RA 5SWSA 5K9OB 2HH0L 3PWNB 5KSAB 2C9AA 4E41B 4OB5H 4ZSOE 5C0AE 5ADOL 5ETUB 3TIEA 5IHZB 2BOBA 1BQHA 1T2QH 3N1PC 2R1XA 2VQTA 3JTTA 2HG5B 4U6HB 1T2QL 1CFTA 3D3VE 3TBTB 4HMCA 5T3XE 2XI9A 2UY7A 4U1SA 3F6IA 1RJYB 2EO1A 5JMRA 1YY9C 4U4BA 5IHBA 4PBWD 4Z95L 1QBBA 2C7UA 3KYMB 1EFXD 3MRCB 4OQTL 4PRPD 1M1SA 3QB7C 3HG1B 2XPGB 2WUCH 4YEEA 2X44D 3SKJL 5F89A 3O45B 2DWDB 3FO0H 4EDWH 3Q3GA 3P2TA 4PPTA 4JRYE 5BVJA 1NKRA 5D6CB 1FV1B 2H32A 3J8F7 1T1ZB 5D1QA 5K9JH 5C7XL 2BSTB 3ZDXF 3N9GL 2HLFD 2DAVA 3EYQD 1MHCA 1F8TL 2AQ1A 4LCIH 5D70H 1OPGL 1IGIH 4RWYL 3EYVA 3IDXH 3DX9B 3ARBB 3WBDA 3RGHA 1JGDB 1TNNA 1RZJH 5CIPH 4UDTB 5AEAA 5E1AA 3ARDA 1KPUB 1SJXA 3P4NA 5MENB 2ZOLA 5D9SB 3BMWA 3ULUH 3ILPA 4L9DA 3FB6B 3SGKA 3GMMA 3IDGB 3C87A 5CGMA 4H0GA 1NGQH 5GPRA 4HC1H 3WSQL 3WIFB 2FBOJ 3OKNA 5JDSB 4XHQA 2CKNA 3H6JA 3KAAA 4X5XA 2OSLB 4V1DE 1YEJH 2JIXD 5BXFB 3V7AG 1HYSD 1XCTA 1QFWL 1LDPL 4WI7A 4NQCA 2AXJA 2ZSWA 2NXYD 1FG9C 2LV4A 1BZ7A 1ZS8A 2VDQL 5FCUH 4P46A 3U48A 4LRIC 3LKRA 2E6PA 4BJLA 1DUZA 3KYKL 2ICWJ 4F9PA 3NPSB 4XC1H 2X4NB 4FNLH 3ULSB 2VOTA 3HNTL 3RGVD 3OXSA 5IMLA 3QQ4B 3DETD 1KCSH 3RWIA 4OD3H 4OF6A 4U05A 4JKPH 4WU5B 1JWSA 4TNWK 3LKSB 3WDHA 2O5YH 2CXGA 3VDAA 1A14H 1JN6B 1OB1B 5F7LB 2RIKA 2ICWB 5DHVH 4KPHH 4R4FH 3V5DB 1QQDA 5GS3A 2FJHA 3UJJL 4KJWD 3GKWL 2R2HA 5FYLL 3UZEA 5DJ0A 4HKBA 5D1ZD 1JBJA 2O5YL 2JLLA 1O7SA 4KQ3H 5J9PB 4NCDA 4OD3L 5LGKA 5D1XD 2ZUWA 2E6JA 1KCSL 4G7YL 4ODBD 2D4FA 4KVCL 3V5KB 1MCNA 2BNUB 1ACYL 1JWUB 4TTDC 1ZKAA 2ICEA 3QJFB 2OR7A 1MLBB 4KK6C 4QTIL 1ZWIB 1EAPB 1P69B 1N59A 2DQHL 4GAYA 4IRZL 5HHMD 2A9NH 5E8OB 3UC0H 2ZUVA 4FQJH 3MRPB 1U8KA 1LDPH 3QEUB 3T0WA 4LRIA 4NHCL 3AAZB 2ARWA 3FO1A 4GQPH 4Y5YA 3ULUC 3D0VB 1JGUL 3NCCB 5FM4A 1HWHB 1AXTL 4APQA 1YEJL 1ROWA 1E4WL 5DO2C 4CDHA 5IGXH 4L8DA 4JFYB 3OX8A 4U1MA 1XF5A 4HC1L 3STZA 3WSQH 4PLKC 5C1MB 4G6AD 3ZHKA 3Q6FB 5BS0B 3DGGA 3HPLA 5HDLA 2CR6A 3IF1B 4BZ1L 4PJCF 4ZNEA 2V2TA 3VRLF 4E42A 1QFOA 3QPQD 4TSCH 5F7UA 1NSNL 4K07A 2QJDA 2X41A 3SGDH 3ZKQD 1RHHA 3PQYB 4EUPB 3MLYH 3O2WH 3QDGB 4U6VL 2CUIA 1DL7H 3HS0B 1QLRA 4YHPB 2GEEA 3QIWC 5HJ3A 3RVVD 3DX7B 1J11A 1IGIL 4MX7B 4PGCA 1D5IL 4YHNB 3QQ3A 5D70L 5DMKA 2X4PB 3DVNB 1H8SA 3X13A 1LO3H 3RWHB 1F8TH 4OF5A 2BFVH 1CGWA 1UVQB 4YAQB 1PQZB 1I9JH 4AENA 5I71C 4W81A 2A77L 3OKMB 1Z3GL 2NCMA 5JORA 4NN6C 4X6DE 1JF1B 3HAEA 4HGWA 1P4BL 2QHLA 1KPVB 3FZUC 3F7YB 4WTXA 4G8FA 5JXEC 3SKJH 2WUCL 1BP3B 4DKEH 1AIFA 4E41D 3U2SB 1JRHL 4LVOB 2AV7B 2YMXL 1I7ZA 1DANU 3GJFK 3HCVB 4MLIA 5CJQH 5C9KA 3BX7C 5IKCB 2NZIA 4LVNC 4D9RD 3CJJA 3MRRB 3DTXB 3SEPA 5FHBH 1CFBA 4JO4H 1A7PL 1F97A 1QSEA 3N06B 1UADC 1OW0C 4OM1L 2IPKA 1GIGL 4K8RC 1H3PL 2UWEE 3MGAA 3LSOA 1LO4L 5ADOH 4HFUL 4YBLC 4E9LA 4KI1A 2VTFA 3BVNB 2HH0H 4HWZA 3SCMC 4UUJA 4PRNB 1Y6KR 2PW2A 2VZ1A 2BY1A 4JFPB 3CZJA 4RBPH 5FYLE 43CAA 4X4ZA 2J5LC 4PBVC 3C6LC 3U4EA 4OKVA 1R3IH 3C09C 4RGNB 5DZNA 1A6TA 4M6OH 4N8VG 2FSEB 1H5BA 2BVTA 3KPLB 2Y7QB 3Q6GL 2HMIC 4MDJA 5C0RH 2EDYA 3AM8C 4XNQA 4Q9QL 5FUOH 4XHJD 1AHWA 3SGEI 4P57B 3O8XA 3QNZB 2VLJE 3FB7B 1CFSA 1T66C 5C09D 2M1KA 4E0RB 4LHUD 2NW3A 4FZEL 4LSPH 4NPYA 2V17H 3TYFA 1YNKH 4LHUA 3GJEA 2W9DL 4JRYA 5C0BB 1BVKA 4PJXA 1NFKA 1CI5A 4LHUG 1MWAH 2LAAA 3UYPA 5GHWH 4L3EB 1SYVA 5ACZA 3MV8A 3GZKA 5H2BA 4Y5VA 1CIUA 1SM3H 1V3KA 2FZ3B 1VACA 2QEJA 3HUJB 4QT5B 4M1GL 5E4EC 1N4XH 3GBMH 3QR2A 5IB1A 3KPRD 4KAQL 1A1MA 3TT1H 3AS2A 3ZHDA 4YFEA 5GZNC 3SCMA 2NXYB 4NNPH 1D6VL 1J12A 5DLMH 4ZSOA 5C0AA 5BV7L 1YMMA 5E8NB 1KC5L 4WI4A 4MSWA 2R0KH 1U8HA 4EN3A 4NFCA 5LVEA 4P2YA 5F88B 5B39B 4U0RB 4MJIA 4L3EE 4ODSL 4P4KB 2JCCF 4PJAB 1JWMA 4HPYL 4PJHE 3RKPA 3X11A 5EZIH 4XCYA 4ZUTA 5DK2B 2ZJSH 3BD3A 4FMKA 2D2OA 5JHDE 4ZXBB 4U1JB 3R1GL 1NAKH 2A9ML 2A6KA 3WS6C 5C0DB 5CILL 3WUWG 5IEHA 4OZGB 4KTEH 3UYRL 4RDQF 5E6ZA 1UA6L 3FRUB 4LEXL 2B0SL 1AGBB 4MJ2A 3BT2H 4IRSB 3JTSB 2AK4B 3QHFH 1N3NB 4OIIL 4H20L 3I2CL 5GGRB 1MI5B 5T1KD 4GAJL 2MMXA 3O11B 3G6JA 5K9QI 3DXAE 4OZIB 1AY1H 4TUJB 2ADGB 4OZHA 4NJAH 1QBAA 4AEHH 4HCRL 3MRDB 3M1BA 1DQLH 4JDZA 4GAGH 3TJHC 1NAML 5CCKH 1DANT 1YEHH 1IAKB 5D93B 2PR4L 5J13B 3OGOE 5D71H 1MEXL 1IMHC 3S37X 3MFGB 5E8EA 4NJ9H 3G5XB 4YO0A 3ZSTA 3I3EA 5GS1C 3WHE0 3KWWB 3PHOB 3VFPB 2PTUA 5IBUG 1NDMA 4YPGA 1BBJA 3PGCB 4OFKA 2VDRL 3QJHA 4PJIE 4RX4A 3MFFB 3JV5A 1EZVX 2PTTB 4HJGA 2MHAB 3I85A 1JF5A 5AD0A 3WJLC 4I18B 3WLBB 2EIEA 1Q9OB 4WGVB 5FA3B 3AM8A 3JZ7A 4PD4J 1AR2A 4LLWA 3W0WE 4MJ6B 4MQXC 5D7JA 3OZ9H 5EU4B 1FAIL 4AIOA 3O6ML 5EOTA 3OR6A 1KN2H 1YNTA 4NYLA 4JRXB 3TNMA 4XNMB 2CQVA 5D7KE 4LRNL 5E2TL 3LRGA 2BRRH 4I2XB 4IS6A 4QTHB 3WFBL 3EO0A 1FFOB 3GIZH 4YDLC 1EX0A 2QSCH 2HYMA 1FGNH 1PEZA 4R3SB 4JO1L 2VH5H 1A7RH 4NRZB 2X09A 4KI5C 3STBA 2X1WL 1H15A 5FKPB 4HBCH 2AJUH 3HKFA 1YUHA 2DQGL 4M5YH 1TJGH 3GHEH 2JK5A 3R06B 5KW9H 3WFDH 4OZ4B 3K4AA 1FBIH 1WCBB 2DLFH 4N8PA 4D3CH 4OCLC 2D7TL 1KCUH 1BECA 4NQDA 3UJTH 32C2A 2BSRB 3CFBB 4HXAL 2JJUA 1RQ5A 4KK8D 4CMHC 5JIHA 3NBNA 3BQUC 4KDVA 4P23A 5FOBA 1FVDA 1U8NA 12E8H 3MLTA 4Z5RA 3GJFB 5GS1A 3ZSSA 1VHPA 4JFOB 3MR9B 4DZ8A 1I7TB 1VADA 1OOAA 1I9RH 5INCA 2GJZA 3DXAB 2BNQB 1WSST 4L1DA 3BISA 3PV6A 2XV6B 4PLOB 1HHIB 2GCYA 3HFML 4UBDC 4FFYH 2D4DA 1A4JB 3HMXH 1I1CA 5T3ZD 3QDJB 3C6LB 1C5DB 1T7YA 3VJ6A 2R29L 3MJ9A 3QXAB 4HZLB 4ZOBA 5EU6A 3U7YL 3G9VA 5DMGD 2OP4L 5I8EB 4HT1H 1FNEB 5I1LA 5IFJB 3WE6A 5SWSE 3ZDZE 3V79C 1GGCL 1Q0XL 5BZDA 3I75B 3RP1A 3PWLA 5GGRY 4NC1E 5HGBB 2H6PB 4JCLA 3ZO0A 2VUOA 2NY3D 4HKJA 2P5ED 2XQBL 5ADPL 2QQNL 3N1QC 1A2YB 5BZWA 3SKMB 3GDBA 1DVFB 3KPOA 5KVGH 1WV7T 2V6HA 3G08B 3T8XB 5IHUL 1YNLH 1ZT4A 3S3JA 2ATPB 2NNAA 1CTOA 4TSBH 5HI4C 3OR7A 5AWNH 5GS2D 5T3ZE 1BGXL 4XCFH 1JTTA 3V4UH 3F12B 3NAAL 1NANI 1FNHA 3F12A 2W92A 2NX5E 4I3RH 4R26H 1SQ2N 4W4NA 1IBGH 2ILLA 1WFNA 3MGOB 3UZQA 1KB5H 4TUKH 4WJ5B 1NCNA 1DVFA 2A6JA 2F53E 3KPOB 1W8OA 4M4RA 5I1CL 3REWA 3UTSB 5SX5H 4XMLH 1RUQL 2VISA 1OAUL 4LNRB 4PRAB 1T5WB 5D7JC 4M9OA 3PUCA 4L8SB 3B5TA 3S4SB 1XF3A 5GZOC 4K9EC 4MDIB 5I8EA 2ZP0T 2CDGA 1RZKL 4FQPA 3JV0A 1Y6MR 2IC2A 3AU1B 5LGHH 1I85C 3SQBA 2CLZA 1X4YA 3KG5A 4GLRI 3BDBA 1RU9L 4WI8A 2ZG2A 1KTDB 3NIGE 5FO8B 3UTPD 5DRXB 2LFGA 4M61A 3NZHL 1S7QB 3GMQA 5F9DC 5B3JF 4EIGB 2R0ZL 3BN9D 2PO6A 5SV4A 1BD2D 2ERJB 3BIKB 1YN6B 4H25A 4ODVL 4LLMA 4XP9L 4GG8B 1VADB 4DZ8B 5F9OH 3HAEG 4EJ1C 4L4TE 1FVEB 3ULUF 4WTWA 3FB8B 3MLTB 3EOYG 2IMMA 5IOPB 3CNKA 1YC7A 1FCCA 1XH3B 2PTVA 1CLOL 4I3GA 3P9LB 4DK3A 4P2CG 3BP5B 1H15B 5FKPA 6CGTA 1I9IL 4UIKH 4NRZA 5HHOE 5DD5L 4LCCA 3O41A 2ADJA 4Z77A 5HVGB 3LAFA 4B7IA 1HK6A 5EH1A 1JK8B 4G7VL 1TQBC 2Q8BH 5GS0L 1U8JA 4LLVA 3NCJL 3C60A 2P4AB 5TF1H 1HHKA 5KSBB 3ARED 1CXEA 4I0CC 4BFEA 4XTRD 4Y4KD 5EU4A 4LPXA 1NCUA 1NMAL 1MJ8L 1T21B 4PJBF 3WLBA 2VRAA 4EQ3A 5AD0B 3HZMA 4DZBA 5T3ZL 2X4RB 3U36B 4KV5F 4RGNE 2EECA 2CKBH 4GW5B 1KGCD 3S96B 5DJCA 1KLGA 1A6VL 5F8RC 3U46B 4Q9RL 1L0QA 2G75A 1QFWI 4YPGB 1E27A 3VFPA 3PHOA 3UEZA 3V6FB 1D9KC 1NFDB 3P4MB 5LAXA 4M7JH 2B2XL 4GW4A 3G5XA 1T2XA 4LPCA 1YEKH 4WCYH 1RIUH 4WY7H 5F1IA 3L5XL 2FJFA 3CSYA 5I1GL 4N8CH 5HYJE 2VDKH 4WO4B 1S7SB 1OSPH 1IAKA 2YC1A 3MC0A 4Z0BL 2QHRL 4U1HA 4X7TA 3V52H 1ND0A 5I1HH 3N1GC 4G8GB 3GMOA 3W2DL 2V2XA 4AEEA 2MKLC 5JPNA 1I4FA 3QWRA 4ODWA 4S1SL 4TUJA 3TZVA 5IMMA 3BP7B 3QIWD 3ARTA 1S7TA 4P2RD 2A0LC 3EOBB 4Y19A 2YXMA 3BUYA 1VGKA 1MELA 1MI5A 4KKNA 3QUXA 3VI3E 2D03H 1LD9B 1AGBA 5L6YH 2O26U 3L3DB 2IG2H 3QUMH 3WNOA 3ULVC 4K7PH 4X83A 4QHLB 3T2NH 2OYPA 5IEHB 1SBSH 4YDJA 3BH9A 4G8GE 4FQ2L 3RVUD 3MLZH 5ICYB 3CXDL 4NO5A 3BFOA 1MCWW 3TBYB 1A5FH 1X44A 3QWOA 4MD0B 1WEJL 3VDCA 4EQ2A 4DGIH 5C71A 1WZ1H 3UTQB 2QSVA 1KEGL 4X6BA 2NZ9D 3WL9A 5DK2A 2NW2B 4XCYB 4ZUTB 4A6YH 1O0VA 3SGEH 1KYOK 1REIA 4PJAA 3UP1A 1P5VA 1RZ7L 1GZQA 3T3PE 1N5AB 1U8HB 4HIIB 4MSWB 4D0BA 3V0AC 2XFXB 5JTWA 1O5DT 3PHQA 1TPXC 3BH8A 5JA9A 1CL7H 4TN9A 4ZAKD 3MV01 3SCMB 1QR4A 5C09A 4HS8H 1AO7E 1PG7L 2Y5EA 5C3TA 1KCLA 1MJJA 5TQ2H 2BNQD 2W0FB 2WMPA 3HUJA 3IJYB 4LSTL 3S34L 3AC0A 4JZOB 3TF7C 2W0KA 3JWDC 4JZOA 1YZZA 3CCHA 4KK9D 4OLVL 2P8LA 1DJSA 3ARFB 5I1DA 3W5MA 5ISZE 1R5IA 1F42A 4ONOA 3I3DA 4XNUH 1IQWH 5EOQL 2VAAB 5GJSH 2D9QB 5D2LB 5FYJH 1INDH 1CN4A 1WZKA 5IF0B 2OTUA 1GC1L 3B9EA 4JKLA 1FZOB 1CL7I 1L6XA 3FFCE 4JDTL 4M7LL 2DB8A 3TJEL 1GC1H 4XH2A 1AI1H 3G5VB 3HG1D 4P57A 4XC3L 1MCIA 1Q0YH 5JIPA 1Q1JH 4POZC 4MA7L 3UJIL 3O9WB 4XNUL 1F3JA 4Z8FH 4MDJB 2DQJL 3NFSH 1H5BB 2X4UA 3JWOC 5ICYA 2F19H 4XCNB 4YDJB 1MIMH 1A6TB 5M94B 3NTCH 1IAIL 5DT1H 3P9MB 2NY7L 4JO3L 2HRPH 2LU3A 3LRSA 5DJDB 5TQ2L 2X05A 3WS3B 3BKCH 5MP6L 4ZFOB 1QA9B 1PG7H 3JUYA 4PBXA 43CAB 5K59E 1PDKA 3DYMA 2J8UE 4KMLB 4Y4FA 2AABL 4NQVA 1R5VA 5BQ7A 3P9WB 2DWEA 2O5XH 3EOBA 4Y19B 1EUUA 2F54B 4UMGA 5JOPD 1QBMH 5DK0A 4XNZB 2F58H 3B9DA 2V2XB 4XP6L 4ERSH 4G6FB 4GG6A 3VWJB 3BEVA 1PGRB 5F9JB 5F1IB 1DR9A 5BO1L 2QQLH 3QFJD 4FHBD 4U2ZA 3IETB 3LN9A 1A5FL 1RFDL 4M48H 4JRWA 1S78C 3GHBH 4LKXB 5IVXB 4X7SH 4G8FB 4FQ2H 1MVUB 4V1DB 4AM0B 2J4WH 5EUKB 2G75B 1WIPA 4XZUA 3MBXH 1S5IH 2HJKA 3VCLA 4GBXB 1A6WL 1J86A 1P4IH 1A7OL 3N0PB 1MH5B 2FIKB 4HDIA 5I18L 3U82B 2B1AH 1J0ZA 1BQSA 3MGTA 4IRSD 3IKCB 1C5BL 2FEDD 4XAWL 5TQ0H 2XZAH 2X4TA 3O2DH 3QDGA 3WFEH 4Z7QF 4S1RH 4EUPA 3S35X 1UJTA 5SWZD 1R24A 2BRQA 2EICA 1RUAL 4M1CD 1QSEE 4Z0BH 1YY9D 4ONFH 5EOCL 2FX9H 4KUCD 1FNFA 3BZDA 3MRHB 4WY7L 3RIAF 5C07D 3FO9B 4Z77B 1PKQE 1TTFA 5EU3B 3IS1X 5T5NG 1ED3B 4FQLH 1RIVL 3Q6FA 2YSSA 3LD8B 1IEAA 1GPOL 4OTXH 1G7IA 4Q9RH 1HNGA 4JHWL 3P0VL 5LQBL 5I75B 3KXFB 1XH3A 2CKBL 3TC9A 3LEXB 4PGBB 5LQBH 3ORJA 4P2OD 1QHPA 3D0VA 3KS0H 3PP4H 3AAZA 3TIDB 3O2VL 2BOCA 3N1MC 5FUZH 1GPOH 3RZCA 1QG3A 1P53A 1VEOA 5E8OA 5GRJL 1NMAH 2EDQA 1G7LA 1YYLL 2BXZA 3HZYB 4I3SH 4Q7DA 2FX9L 4X6DF 4ONFL 4KFZC 5EOCH 1IT9H 5FM8A 5C08B 4CN4A 5IWLA 2HFTA 1JWUA 3U1SL 3U83A 3V5HA 4G7VH 3VFOB 2XZAL 1S7QA 4YXHH 3HZYA 4CVZA 4KHTH 1MRDH 5H94A 1XGQA 1B3JA 4PJ8C 1I3UA 1KTDA 2G60H 4UZGA 3RZCB 3DSFL 2J5LB 5DJ2B 1JNNH 2PF6A 4I4WB 1CDJA 2EEAA 2YN5A 3P0YH 4CAGA 1F13A 4CUCA 4PGBA 3LEXA 2FJHB 5F1SA 3FTGB 1QQDB 3OKYA 4H8WH 3SOBH 4JHZA 4G3YH 4YHKL 3MLUH 3CVHA 4L8SA 2FGWL 3PGDA 2XXMB 4HIJA 1OB1A 1JN6A 2CXKA 5D7IB 1FNGA 4I0PA 1T5WA 5T1LB 3T0EE 1W72L 1IFHH 4Y4FC 1WT5C 2IH3B 4AH2B 2Z4QA 2XIDA 3UTSA 3UO1L 3QEQE 4J4PD 2JIXB 3SDXE 1NCAL 4IIQB 3NZ8B 4UU9A 2VDLH 2R9HC 3MUY1 2R0ZH 4FQCL 2X89D 1BWMA 4OFYD 4WWKC 4ZUVA 4PJ8B 4X99B 2ZSWB 5DF0A 2VLKD 2C3XA 1F4WH 3FOLB 5LGHL 3LKOA 3P30L 1BBDL 2FIKA 4HDIB 1MH5A 5BXFA 1A02N 3SDCC 1G1YA 5FYKD 4ZS7L 4CMMB 1A7QH 3CVHH 4JO3H 4D0DA 4EI6B 3ARBD 4KGJA 5JDSA 5TE4L 3ARSA 1BQLH 3C5SB 1EO8L 3VXME 4R9HA 1R5WA 4N8VA 3NFSL 4YC2B 5KAQG 4NDMB 1NLDH 3ILPB 5JO5B 3EYOB 1L6ZA 3TA3D 1XEDA 3CK0H 5FA4B 4RFEB 3VXPB 1P9MA 4ORGB 3KLDA 1IBGL 4F3FA 5FUCE 5KZCB 4WO4C 4LSUH 2F54A 5ICZB 3PP3K 5EORL 1JYXA 3QDJA 4X5LA 4WUUA 3NAAH 5GJSL 4LSQL 5HGDB 1FE8H 2QADD 4I0PD 5IBLC 2AV1B 3ZYIA 2WP3T 1CICC 2VLKB 2EKJA 1MPAH 5F1OB 3WS3A 1HHIA 1IM9B 1P4LB 4JQIL 1YNLL 5CEZH 1T0NB 2GJZB 3GKZA 5KVGL 2B1HL 4GKOA 4G6FD 4XCNA 4G42A 4WWKA 3QUMB 4Z7OE 2XQBH 3B8YA 3T04D 2XWBA 4KKBD 4HS8L 2ORBH 2GJ6A 3GJFA 3O9WA 3VXSE 4J1UB 4UV4L 2VZSA 1INQA 4NSKA 4XH2B 3BXNA 3K1DA 4U1SB 2AXGB 3QEGL 5F1NA 1J1XL 1UKSA 3RVTC 2CO6B 3EOAA 4TYUA 3MA7A 4XVSL 3SDXB 3WKML 4XT1C 5ETUA 4ZDHA 3RPIA 2IQAA 3TIEB 2R29H 4A6YL 1YUHB 2XY2A 2FL5A 1H3GA 3G6DL 3X3FH 3F7PC 1M4KA 1ZLWH 4R3SA 3QDHA 2Y07L 3RZCD 4OCMC 4FFVC 3B9VA 1BD2E 5DD1H 3WD5L 3RUGA 5KSUB 2KQNA 2GFBB 4OBRA 4HUMB 1XFPA 4G8IB 2VR5A 3QAZC 4WI2A 3MV11 1BLNA 4URTB 3T2NL 4JRXA 5HVWA 1MJJB 2Y25A 3OR6B 4LHJB 5EOTB 3M8OH 1PD6A 4L8SC 5M7QA 1CU4H 5DTFA 2B39A 2J8UF 1YQ2A 4IHOA 2WIIB 1FZMA 1VFBA 4NP4L 5FA3A 5E6ID 3RPKA 3QULA 1HHHB 1ZANH 4PUBH 1D6EA 2D3VA 2NYYC 5SX4H 2AS5M 3WO4B 6FABL 2DLFL 4HF5L 1BFOA 1M6OA 5BS0D 4OLUH 3I6KA 3W2DH 3VFWB 5CINH 4G9DA 3IB4A 4X0KA 2QHRH 5J3HC 2DQGH 4YHLL 2IANA 3GSOA 2HT2C 5HHOD 4K3DH 4W68A 4NRYA 4ZD3H 5D7LB 4UV7L 5DEFB 1MFEH 4EBQL 3NOIA 3L7FB 5JIKA 2W9EL 2B2XH 1ZTXL 5FKAA 2J6EA 5CP3A 2BRRL 1NGZB 4R97B 2DL2A 5E2TH 1FL3B 1CT8A 5HGAA 4JDZB 4Z7WB 2DM3A 3M1BB 2JE8A 2W0PA 3OJDA 1MI5E 4LPYA 3LB6C 2XN9A 1VFOA 3MBED 1FDLH 1LD9A 5T3ZH 2I24N 2NY2C 3O11A 3VGGA 5C2UB 3QUXB 2QQKL 3VXRB 3VXRA 4WHYG 4YC2C 3HI6L 3QG7L 4NBXB 4BQCA 3BUYB 3REVA 3JTSA 3D69A 5C0ND 3ZE2E 1NJ9A 1NUFA 3BKJH 2GSIB 5IG7B 3T1FA 1KXQE 1LE5A 4MAUH 3OXRA 3STLA 1BX2A 3GMOB 4G8GA 2EYRB 3D48R 1EV2E 1N7MH 1OQOA 2PETA 2Q8BL 1NFIA 3EDFA 4QOKD 5GS0H 2VNCA 3VDBA 1S7SA 2YC1B 4LAQL 2D0HA 2W65A 2ZSVB 3QPXH 3L7FA 4AMKH 2NY1D 5FYKU 3A67H 5FYJD 3GRWA 4Y2DC 3MJ7B 4H0HB 4KKAC 4NKIL 2IANB 3GSOB 5E08H 1YEHL 4HLZH 1FSKC 4BSJA 5IIEB 5DMIH 4JN2B 3VMNA 4GAGL 3I6KB 4NQXB 3T2OA 1E4XH 5JZ7C 4MJIB 3MRLA 1JYVA 2IADB 3VXSA 2Z31D 4ZSOB 5C0AB 2HT4D 4DJMA 1RSFA 4XVUD 1KB9K 2WIIA 1QKZH 5C3LD 1X6NA 2AK1L 3QI9D 4CMHB 5F9OL 5KSBA 3CX5J 2CKBA 2P7TB 2UWEF 3QQ9C 3VFRA 2UVEA 4KTEL 3ZYOA 1I8KB 3T08A 2XXCB 1MNUH 1UH2A 5KSUA 1DEEA 3RUGB 2H2SD 1JYWA 5C0CB 1AXIB 2ADJB 1XR9A 3RTQA 2DQIH 1RMFH 5GSRA 5D2NC 3KLHC 3HNVH 4JRYB 1HIMH 3BP4B 3HE7A 2QSTA 2P5WE 3SDXA 4HPYH 4NPYB 3E6FB 5F1NB 1A1NA 4LPTA 5IOPA 2AEIT 3L5JA 1MCLA 1F90H 2IGFL 3KPQB 4GXVH 5BV7H 2BSED 4DW2L 4NWTH 5C0CE 3CDCA 5ELIA 3FB8A 4XNQB 4JR9L 4WUUD 4RMVA 4Y2DA 3QUMA 3MV7D 1A0QL 5JXEA 4J6RL 5C9JB 3NIDE 4M8VA 1Z0MA 5EU6E 4LLMB 1FLTX 3EIFA 4K3JL 1HOCB 1MCOH 1CD0A 4ZFZB 5GS2H 4R4ND 3VFUA 4UQ3B 1BHGA 3O4OC 2H2SC 3EDJA 3P4OA 3S8WA 3V9FA 4UUJB 4PJGA 1WFUA 1JCKA 3EJYC 2VLMD 1KCRL 3QSKB 5F6HJ 4PTUA 4TVPD 4AZ8A 2V17L 1FIGL 4LNVA 1MCBA 3OSKA 1AKJD 1XF3B 4EOWH 1TQBB 4D9QE 3S4SA 3S88L 5I73C 5HYJB 4D9LH 2YD8A 5D4QA 5SWZE 5CD3A 4FQXA 2IBZY 3SE9L 4BUGA 1FHGA 2MQ0A 2QQNH 3J7HA 4PRAA 2BP3A 2W60A 3IXAA 4Q9QH 4NDMA 1AIFB 1MJ7L 2OL3A 1CD8A 4R7DB 3HE7C 1MIEL 3REWB 3L5HA 2H9GA 2O93L 3IFNH 3EZ8A 4MNHB 5T3XL 1AHWC 1JF1A 1T1XA 4R96A 3LH2H 1CD1A 1G0XA 1WWCA 3C5ZB 3LQAL 2CDFB 4J3XA 2EYTB 2VLJB 1S7WB 1XGTB 3L7EB 1OHQA 4M43H 1VFUA 1LO4H 2OZ4A 1NUDA 4ZUVB 1N26A 4IM8A 4OM1H 5HJ3B 4QY8A 5IROA 5LWYH 1ZT4B 1AD0A 3VXMA 3EW3B 1OLLA 1RHHB 5T5FH 4K71B 4LARH 5BZWB 1CICB 2HKHH 3SKMA 1CFQA 2QKIA 4PJHA 4PJCB 2XNAA 3WIHL 4WTZA 5C6TH 5LG1A 3QFDA 4HKJB 5HYEA 3ZKMD 12E8L 5B4MD 4TUOB 1FNGB 2QADB 4I0PB 2NQCA 4LDEB 5BZDB 2Y5TB 1CYGA 4FN0A 1XF5B 4WUUE 3C60D 1UJ3B 2D7TH 2YZ8A 4C4KT 2R39A 4K2UH 1X5HA 4Z7QE 1S9YB 5I6XC 2ZCLH 1TJGL 1GHFL 4I4WA 3MV7B 4QKXB 1DBAL 1KG0B 4OJFH 3L3OB 1KIRA 3CUPA 1A7RL 4HZAA 4HSQA 5D2NA 5HYFA 1MHHB 3DIFA 3UX9B 3GIZL 3KYAA 2NY0C 1WUNT 2P5WB 4GRLC 2AXFB 5GRZA 3H42L 3VFOA 3WFBH 1CDCA 1QFPA 3MLYL 3TWCH 3DXAA 3HHRB 4WU7B 3M17B 2NY6B 3AREB 2DIBA 5C08A 1XGUB 2P8PA 4U3CA 5FYKH 1X5JA 3SO3B 1NC2D 2OK0L 1Q9LB 2DLHA 4PP2B 2VWEE 4QRPE 2PNDA 2NY1B 5F7YC 3OHXB 4JGUA 2UV3A 4PJBB 4F15C 4Z18A 3OAZK 4HMDA 4X4ME 5E9DD 1NQBA 3EYFA 3V7MA 3VGFA 4WEBH 4MCZB 5DURB 1CGXA 2NX5D 5EIVA 1F4YH 3FN3A 4PG2C 1A3LL 3R06A 4P46C 2ICWA 3QIBD 2YSSB 3ELAT 3OQ3B 4BM7A 2X1XR 3FO9A 2DF3A 1OP3K 3MRHA 1EMTL 4FFZH 5T1LD 3OXSB 4IS6B 3VWKB 4AEIH 1X5GA 1FZJA 1J1PH 1DUZB 4HCRH 1YNTB 3BIAX 1N0XH 5TDOB 4QYOB 1AY1L 4JY6B 4PV8B 3SDDD 3SBWC 4I77H 1NGYB 1C08B 5C0EB 1HQRB 1WJ3A 3MGTB 1CLZL 5FYLH 1J0YA 2MHAA 3HI5H 2I07B 3TBWB 2HN7A 4PY7A 3WUZA 2XQYK 4X5XB 1NFDE 4N0FA 3S36L 3QJHB 1XAUA 4Y5XB 5C07A 4Q2ZB 1MVUA 3PGFH 3KWWA 2C1PA 3IDGA 5KSAC 4JRXD 4WO4D 1ZV5A 2EDKA 1N6QH 4XXDA 1QHOA 4I9WE 3W0WA 5FGBA 1KSRA 4IJ3C 5EUOA 1YMHA 5EZIL 4UDTA 4CVWA 4XC1L 3T0DA 1CXKA 1JGDA 5IROC 3KYKH 3OAUH 4PG2A 5DK0B 4JZJC 2NY2B 1EFXB 4HFWA 4CJ1A 3G6JB 3AXLB 1MHEB 2DWEB 3S5LG 4FQ1H 3ROLA 1LO5A 3FHAA 1R5VB 4MHHI 3VXUA 3QRGL 5JMOC 5GGRA 3IJHB 1BD2B 1QTYT 3K80A 1QA9A 4LF3A 1BJ1J 3TT1L 3L3HB 2H32B 5A3IC 4ELKA 4XP4H 1K2DB 5J6HB 3ALWA 4MS8D 4X7DC 3FFCB 3O45A 3RWJA 2PW1A 4OZGE 4OF8A 4WWKD 4OGXH 4I9WD 2OZ4L 3MRCA 3KYMA 4FQXD 4WW2B 4RAHA 5TF0A 3JV6A 4ZO7A 5JW4R 3U30C 1RZJL 3WJLA 4GBXC 2DTMH 5I19L 3SDYL 2JJSC 1QSVA 3IDXL 4P4KA 4LSPL 1TQCC 2R1XB 3JTTB 2X1QA 4YXKL 1FZOA 5HHME 3B9KD 5CUSH 3WV0A 4EZMA 1UKQA 2OTUB 1OY3B 4KRPC 4XVTH 4U1LA 2NY4B 4V1DD 5FFLA 1XIWC 5FUOL 3O6LL 4QRPB 3Q6GH 5I1DB 5EZLA 3ZDZF 3RDTD 4EEEA 3MJ8A 1J1OL 4M6OL 3C5ZD 2Q6WB 2W0FA 1G9NL 1SYVB 2IAMD 1CR9H 4CN1A 4L3EA 1OF2A 3GSUA 1AR1D 3O6FD 4BSWB 4Z95H 4MLSA 2GI7A 4JFHE 5I76A 4HWEH 4HIEA 3PHQB 2XFXA 4XWOC 1N2RA 2WNGA 4HFUH 5FO9B 4YQXL 1MFDL 5FAAA 1Y0LB 1GIGH 1FL6A 1NCBL 5JQHC 1BVLA 2K3TA 1HINL 1S7VB 4MNQB 1A7PH 4JPVL 3VMOA 5KN5A 3RX8A 4MXQC 1KENL 1F00I 3TNNA 3WL9B 4X6BB 4RFNB 4U1GC 5DRWB 1AHWB 5GRWA 3VA2C 2FLBT 5JOEA 2GK0A 4FP8H 1CR9L 1FGVL 1EO7A 4LGRB 3RI5K 4WFFD 1R3JA 3ARXA 3QDAA 1J1OH 2LU4A 4NN5B 5GIRB 2OJZH 3DI3B 3U4EB 4HWBA 5T1MB 2A77H 5ID1A 1S9XA 3GSNL 4Y8DC 1GYAA 2CPCA 2VXTH 2PW2B 5TGBB 3O6FB 4ONGL 5EBMB 2GJJA 4KHXL 4Q6YA 3HZKA 4S1DD 5E2JA 4PJDA 3LSOB 2G9HB 3X12A 3BP7A 3TZVB 4FXGB 1AO7D 3W9EB 2H41A 3VRIA 5I19H 2X70A 3RA7H 3TN0B 1WC7A 1IGJA 1UYWL 3TV3L 2R56H 1RZKC 4YR6B 3U2SA 5JOPE 1N64L 3VG9C 3ZMRA 3VGBA 4GSDL 2EZ0D 3KJ6H 4Y4HB 4P2QB 4FXKA 2HP4A 2YWZA 4GJTB 2BK8A 4O4YL 4HGWB 4XP4L 3HAEB 4PB0H 1PLGL 4DGYL 1KLGB 3H9SE 3S96A 4Q6IA 3U46A 5HPMB 1S7UB 1JGUH 1BFSA 1EGJA 3A6BL 3HZMB 4DZBB 1HSBA 1A4KA 4LVEA 5FGRA 3WLWD 1LMKA 3U9UB 2C26A 3UTTE 4L5FL 4F2MB 2DQHH 4PRHE 4X5WB 2ESVE 3DX7A 1W0VA 4MWFB 4QTIH 4YHPA 3KYNA 3BRGC 4QRUA 1R3HA 4LLVB 3ET9F 2QQQA 5T1DL 1FN4B 5IESH 2PXYC 5CHNB 2WWMC 3V0WH 1JK8A 4EN3D 1W0YT 35C8H 2AJZA 4OCWH 4HWUA 1V7MH 4XX1E 1JHLH 2HLAB 4U7SA 3SDAB 2FX7H 3WMSA 2YA2A 1SJEA 5MI0C 1HH9B 5C0IB 4M5ZH 4JGMA 4LQFH 2DLGA 5BMFH 3PJSA 4R4FL 1XZ0B 1EO5A 2EIZB 5IW6B 1CLZH 5C8JB 3MLPA 5IQ9A 3QEUA 3MRPA 4LLAA 4YBQD 1JVKA 1ZOXA 1WFTA 1WISA 4XCEA 5EWIL 4GAYB 5J6GB 3EDEA 3QZWG 3ZDYE 5DVMA 5BV7B 2R4SH 4IDJL 2E9JA 4JQXA 1SVCP 2JCCE 1DBBL 2Y1VA 1WWAX 3QJFA 3GEWB 4Q6IC 2RAMA 3G6JF 3CH1A 3FN0H 1YN6A 4H25B 5F93C 3V5KA 4Q9CA 3BAEH 1EMTH 5I71B 3QEHA 4PJIB 4L5FH 1CZ8L 1R3LB 1HQ4B 5F7FA 1FLRL 2W91A 4U49A 4NUJA 3A6BH 3QISA 4RQQA 2EE3A 2JF1A 2P49B 4HGMA 2FECI 3V5DA 4DGYH 1UB5A 1J8HD 4CL7A 1NBZA 2GSGB 5D7KD 3CSPA 4ZTOL 4YJZL 5T33L 1T03H 2PKDA 2KPNA 4WU5A 1OTTC 2SEBB 2VISB 4I18C 2E3VA 2EYSA 1KT2B 4LCYA 4YFDB 3TV3H 3QUZA 1A8JH 2F8VA 5E1HB 1EJ6A 3B9AA 5IMLB 3FT3A 4KTDH 4OLXH 5J0BA 1P7QA 2Y4SA 2AK4E 4CVXA 1V7NL 1JI2A 1RURH 5EC2B 1LWRA 3VFMA 3FOMA 1KELH 1BZ7B 1ZS8B 2KDGA 5CBEA 4LSSH 3MRQA 3B5HA 4OCYH 4ONGH 3WNLA 4XPAL 1GHFH 1JRHI 3FQRA 3B9KB 1RPQA 2VR4A 3OR7B 5IMKB 3ALXA 2KBGA 5CGTA 3QCVL 1L7TL 4PJ5B 2OMNA 1OARL 3VG0H 2WV3A 4S1DC 3ZE1F 3BZ4A 4EDWL 5LCVH 2Q76A 2Z92A 1JHKH 1FGVH 1TITA 1S9KC 2WBJC 3JV4B 1JZ5A 2FB4H 4PS4L 4DTGL 1SJHB 4JFFD 4KJQD 3HG1E 3P4NB 4PRHA 2OLDA 4ZO9A 3I75A 1RUPL 5I1KL 1G84A 3CMGA 1WIOA 1FNEA 3TYGH 5I1LB 1IAMA 1WGOA 4IOFC 1J05A 1DE4A 1MFDH 3ESVF 2EDXA 4OB5L 1ZEAL 3QXAA 1ZHKB 3L5IA 1UXWB 4WFHE 1MHCB 4Y16B 3MQIA 1RD6A 3T0ED 1QUNA 3GMLB 5DC9B 3U6RB 3LH2L 1K3IA 4YXLH 1DN0B 2AGJH 4Y16D 1PG7W 5T3XH 2EC9U 2MOVA 3DYOA 3IDMA 5J1AA 2DWDA 1KJ2H 4OCXH 2Q7NA 4BZ2H 5I15H 2GKIA 4L8BA 4K71C 5E2UH 3BKMH 3CFCH 3FKUS 5CMAA 2IAMC 1K4CB 2R1YB 4MA3A 1DBKL 1FVDB 4M1DL 5T1KB 4WHTA 4GXUN 1LO0H 5E5UB 5E94B 32C2B 3V6OC 1JNLH 1UB6A 3TPKA 5ESVB 3HB3C 3SE8L 3WCYA 4LPVA 3UBXI 4WW1A 4PJDF 4I5BB 4OZ4A 4YK4C 3SN6N 3PP3H 3F5WB 3DMMC 4JE4B 1A22B 2XTJC 3KJ4B 4J8RB 2AJYH 4JB9L 3LPGA 4LCWE 4K7FA 1ZT1B 3E3QC 4OLWL 2OZ4H 4M6MH 2ARJA 4AYFA 3RFZC 3EO0B 4GBXD 1KIUA 5I17A 1PZ5B 1UZ8B 1I3RA 3WN5B 4W6XB 4QGYA 1DP0A 5B8CB 4XNMA 1DQQA 1J88A 2OS7A 4F8QA 3K4DA 1TMCB 3WDIA 2Y36H 5M95B 5DJ8A 4AIZB 2BCKB 1YECH 3D2UB 4TSAH 2NPLX 3VXQA 2J2ZA 1RIHH 3IXTA 3BGMB 1WF5A 4YDIL 3H9HA 1I85A 4HJGB 1ZVHA 1J9CT 1OGAE 5DURD 5EB9A 2CLRA 1U41A 1KPRB 1BBJB 3TA3B 1JV5A 2P1YA 4L1HA 4DFHA 1D5BA 2VXUH 4UTBH 3HNVL 3WJJC 4WDIA 4HEME 1CLYL 5DC4B 1DFBH 1INEL 4M6NH 3U7AA 1N6QL 2FLRT 3ISWA 3F7RA 4X80L 5SWZA 4CKVX 2DQEL 4RCAA 1QACA 1GGIH 5FB8B 5EC1B 1F45A 3MRDA 3ZHLA 1CDIA 2WANA 2ADGA 3MUJA 4OZHB 3RVWD 3S7GA 3HI5L 4HS3A 2NTFB 3DUSB 1DLFL 5HDBF 1YEGL 4B41A 5LBSH 4ELME 4LGPB 1CE1H 5EN2A 4R8WL 3BW9A 3FRUA 1KV3A 3KVQA 1DDHA 1FO0A 1OM3H 1A6PA 1J1PL 5DZLA 5E9DE 1RK0A 1U6AL 4OZGA 3P77B 4H5SB 2EO9A 3KPRB 5BRZA 2VE6B 3QUZD 4NKIH 4ODUA 4I8DA 4YE4H 4LFHD 1AFVH 2A6DA 1OTUD 3QFJA 2CDEB 5IT2H 3QO1B 4GRMA 3TBSB 2DDQH 4NZUL 4CN6A 1CIDA 5HDOA 2C4FU 3WYRA 1ZLWK 1A3LH 2CMRL 2MQ3A 3OKKA 4OIAA 1WICA 3QEQD 3PWPD 4XNYL 2RQ8A 2F53D 3QUYB 5KG9A 5A2LH 4EN3B 5DI8A 1J7VR 3ABZA 3O4LB 4D8PB 1CK0L 3H9SA 4WENB 2VLJD 5IM7A 2AI0H 5D93C 4DVRL 5J13C 1UM5L 1EA9C 3H9SD 3BEWA 4ODTH 2D7NA 2GW5A 3WFHA 2VDNH 3NCEB 1R0AL 1XF1A 4UBDD 4JFXB 3HPJA 4C56B 2VUYA 4RGMC 4MA8L 2W9EH 1I3GL 4HIXH 4JFEA 2NY5C 5I30L 4NUGH 4PRHD 3QXDA 4O51A 4ZD3L 2D0GA 3NN8A 5IB2A 5L2KA 2R15A 4TPRH 3IGAA 1TJHH 5I8OH 2NY0D 2DQFA 3KLAA 3B2UC 3VWJD 3MOAL 6FABH 4E0RA 3HC4L 4DGVL 4RMRA 4LMQI 3O8XB 3QNZA 1DQMH 2Q86A 5KVFL 3WFZA 4KUZH 2XZQH 1FYHB 1QYGL 1MCDA 3K4ZA 2CRZA 2HVKA 3GI8L 4HUXB 5DUPL 2Y7QA 2ED9A 4PLJD 4IRJD 2HKHL 1NCWH 1HHJB 4UB0L 4LVHC 3DJ9A 3HN3A 4TTGA 4J3UA 4L4VE 5J1SC 1GSMA 3PDOA 3IDIB 4YNYA 3ZYZA 3SE3C 2DM4A 7FABL 1ZHBA 2DD8L 4XPGL 4MGXA 5L2JB 4M43L 5CEXA 3K8LA 2FJGA 3KPPA 4PJCE 5A43C 2GITB 1MOEA 1KIPA 5E2VL 2V2WA 4G6ML 3OF6D 1FL5A 5LXGH 1J8HA 3L3KA 4K94H 3PIQB 4JVUA 3QEGH 4YUEH 2DJUA 4HQQL 1KIQA 3RWGA 1CFNA 4K3EL 1OP9A 5FUCC 4ELMA 3QNYB 2ORBL 3DVFA 4NRXA 5F3HA 1IJ9A 2J8OA 4KRLB 3O4LE 5CZKA 5LJYH 4MAYB 1U8PB 3F7YA 4C55A 3MTRA 1JL8A 4EOWL 4S10A 4XXCA 5JORB 2EDFA 5D2LE 5FYJE 2D7QA 4QCIA 2MCG1 2ZWLT 2YK1H 5EULV 5FM5M 5IJVB 5EORH 5IJVA 5DMJB 3QQ3B 4X8JA 2MPAH 1VDGA 3QDME 3EJZD 4MXWH 5EU7C 4CU7A 1QEWA 3JWOH 4TULH 3TVMD 1MCOL 3GBNL 2QV2A 2KQMA 4V2CB 3R0NA 3FAWA 4K3JH 4S0TD 4TQEH 3O3BB 4J23A 4RGND 3UROR 2CK0L 2BSSA 3B2VH 4LPUA 1CTNA 2AERT 4PGDB 5F3HB 3GSWB 1X7QA 2BMKA 3DX6B 3DGGB 4NWTL 3KR3H 5BS0A 4NGHH 2ADFL 1EO8H 4ZOCA 3MYZA 1P84J 4JM4H 1F58L 5C08D 5KVEH 1WAAA 5I8CA 3DXAD 1ZA6B 4HWBH 1WBYA 1YPZE 1U8OB 3RQ3A 1VKXA 1BBDH 4HUKB 4Y5YB 3CXHK 1F4WL 4NN7B 2VLRB 1MLCA 4KKLC 2F74B 3BE1H 3RHWK 3S5LB 3EFDH 2NY5L 5D1ZA 2HKFL 5E8DL 3RY6A 5I74C 1T80A 3ZZ1A 1BJMA 1OGAA 3RY5A 1JHTB 1XGRA 3IFOB 2BNUA 5CZXD 1HHJA 4A2LA 1PKQB 2GAZA 2VYRE 4K94C 1I1AC 2RBLA 2EEDA 4YGVA 4PJBE 4PREB 4X98A 1OSZB 3ZL4H 4QXGL 3IYLW 4HX1A 4C83B 2FGWH 1KJVB 3MLUL 1UEYA 3MODL 3SOBL 1E4XL 3HR5A 5D72H 1ZVSB 4BELD 4I0KA 3KLAB 3T4YA 2DQFB 4NO2B 3SE3A 4RZCA 4RRPG 5KTEH 4J2XA 2YD1A 4LIQH 3DSFH 2G60L 5D8JH 5F1KC 4F7CB 2HFFA 3JWDH 3I3BA 1T3FA 1U91B 3FAXA 2Z8RA 3AMKA 4XMKH 4PJXE 2W1NA 4JFXA 4ZNEE 5BVPL 2R1WB 4E5XB 2GUOA 2X4NA 4Y2DD 3LHPL 1T22B 4XB7A 4R2GB 4H88H 4U7KA 4XPFH 4ZYKA 1PBYA 4MAUL 3V0VA 2CD0A 3BP6A 1YYLH 1KFAH 1GXEA 3LKRB 1IGCH 1QNZH 5JPMB 2EE2A 4MD4B 3HE6D 5HDQL 1S7XA 3QG7H 2R4RL 5GGSY 3S37L 4TVPH 4D8PA 3O4LA 4QNPE 5DI8B 1A3QA 4FQHA 1H0DB 3HR6A 3NABL 1VCAA 4KU1A 3OGCA 1AKJA 3VGDA 3UCRA 1JZ6A 4GT7A 3WIFA 2FBJL 4RDQG 4YDVA 1UG9A 4P5TA 3W0WD 5JR1H 4K8RD 5HYSA 3NIGF 3FB6A 5IWLC 1OP3H 5EO1A 1DBML 4Y4HC 2GTZA 4FOMA 1KPUA 1TVDA 3QDMB 4R90L 3VG9B 3RTQC 3GNMH 4H5SA 2UWEA 5MEOB 4HULB 1U8MB 3DX9A 2J88H 3E6HA 3VW3H 2YD7A 5DD3H 5JXED 3MV9E 1HN1A 4KROD 3TN0C 2UZXB 2GTWB 5J3HD 3KJ4C 2PYED 1VPOL 2EZ0C 5I9QC 4IEFB 4UIMB 1UJ3C 4QRRE 1CU4L 4HJ0C 4HS3B 1P4IL 4NM4L 1P7HL 5D6CA 2DQUH 3CFDA 1L9MA 3WO3B 2WW8A 3BUTA 3ZKXB 3KHQA 4P4KD 1URLA 3HZVA 3RL2A 1EIBA 1QBLH 3WNPA 1HSAA 2FGZA 4ODXB 4XPTH 4LSRH 4M48L 5DD1L 5JW4M 4NN5C 5BO1H 4LLDA 1T0MA 4OLYH 1FPTL 5IVNA 1D5BB 4JQVA 1RJYA 1RK1B 3H7BB 5DUBB 3WKMH 3IAGC 3FFDA 1BQHG 4WNQA 3LY6A 3B6SB 1BQHB 1F6LL 4X4YB 1NMBL 5D1QC 1DQTA 1T7WA 3DLQR 5I9QB 5JW4Q 2Z9TA 3OKLA 4JRXE 1ETZA 2PYFB 3P3YA 1IVLA 3DO7B 3ULUD 4HAFA 3WDJA 5IJKA 4KTYA 1JFQL 1DQQB 2NY7H 5DT1L 2B1HH 3MRKA 1U9KA 4OI9A 4HPOH 4CVUA 1I3RB 3MMEB 1PZ5A 1UZ8A 5H37G 3MREB 4OFVA 4UT6L 1VESA 1SY6A 2DBLL 4KKBC 2GT9A 3IDJB 3DO7A 1H3WM 3P73B 4Z8FL 3NIFF 1FE8L 1Q1JL 3DRQA 3MNZA 4OLEA 4NKMB 2ED8A 1GJIA 4RGMB 2H1PL 3BMVA 3TJEH 4N68A 5D1XC 2HTLD 5JW3L 1PY9A 2EDWA 1KJ3L 5C0GA 1YYML 1RK1A 3H7BA 5DUBA 3U0PA 1INDL 2VLKE 3B8SA 5FYJL 5K33A 3RY4A 8FABB 3CZFA 4WHTB 3TO4C 4LLDB 1N8ZB 5DJ6A 4L4TD 4N0RA 3WFCH 4DN3L 1IEBB 3MJ9H 4XMPL 3C2AH 3IDMB 5J1AB 5TE4H 4NO3A 4ZFFA 1RVFH 4ORZC 5CZVH 3RIFF 5L88L 1TJIH 3RUGF 4LSTH 3CFDB 5DRNA 3CMOL 5CKAA 2V9QA 1MSPA 3VU2A 1K5NB 1U3HA 4NZTH 3RGVC 2C1OB 4H8WC 1ORSB 5DVOA 2VZ3A 4YX2H 2BXYA 3MACH 1ZHKA 4FZ8H 1FNLA 4RISH 2Z8WC 5IJKC 3QIBA 4U2YA 4NBYB 4FQXC 4DQOL 5GGVL 2QBWA 3MUGB 5JNYA 3L95B 2E7CA 4J3WA 1NBYB 5FK9A 2AW2A 1HYSC 1FIEA 5HBBA 4WRLA 1JZ2A 5E6IA 2FDBP 1W72H 4BZYA 4P9HL 2IBZX 1QBLL 3KNBB 2WLYA 5D1XA 4Z7WE 1SBSL 2EH8H 4G3YL 4YHKH 3GK8L 3V6BR 3GGWB 4FTVB 1HDMB 2WBWB 4Y4FD 1HHGA 4PJ5A 1DBJL 3D1MC 3OKDA 3QDJD 4LLUB 3S3SA 1EHLH 1H0DA 1KB5A 4U1KA 5I74B 3VXMD 1JNNL 3DROB 3CFEB 3SQOH 4HKZB 5J4MA 2NX5B 2R69L 1HXMB 4O9HL 1YEEH 2N1KA 2VDPH 4HK0A 5D7SL 4ZTPL 5DD3L 1EPFA 3NACH 4Y5YC 3V0VB 4JQVC 1BREA 3QZWA 2EH7H 5HYSG 3HE6A 4CVXB 4KUCF 5I2IB 5J57B 4E5XA 1OSPL 2N7AA 4N8CL 1U3HC 3CVIL 4I3SL 3SDDB 1UACL 1YEKL 1KACB 2EYSB 4WCYL 3RGVA 3UZVB 3KYOA 4KDTA 4N5EC 3GMPB 5GRJH 3BD4A 2YD4A 3O3DA 1UB5B 4ZUSA 2Y06H 1ZVSA 1EERB 3W9DB 4NQCD 4Y8AA 5DJYA 4RQQB 3VXOA 4AL8H 3IRPX 5HVFB 2ZG1A 4NUJB 4Q0XL 1KJVA 4TVPL 2R4RH 4FQLL 4CW1A 3ZT5A 5HDQH 4PJIA 4R4BB 1M71B 3OBAA 2CJUH 1U8IB 3NCJH 3VXUD 3P11H 5L0QB 1RJLB 1XGRB 1RJLA 1KNOB 3O2DL 1YEIL 1T7XA 2EH7L 3CLFL 5B39G 2XG5A 1A9BB 4JPWL 5ERWA 2MSPA 1M71A 3D5OF 4XCEB 4O9HH 1S9WB 4NFBA 2F74A 3SQOL 5IQ9B 5C8JA 2B1AL 4U6YA 5IW6A 4D0CA 4UNUA 3QHTC 4BH7A 1U8OA 1B0GA 1VKXB 5DJYB 1CLOH 1EHLL 3W9DA 2FEDC 4NQUA 5CIPA 3MBXL 1OQXA 4IRSC 2Q1EA 1OW0A 3DWTA 3ZL4L 4OIBA 1RFDH 5FHAL 2HT3C 3DX6A 1HYRC 3Q2CA 5ILTL 2D7MA 3MRGB 1OGTB 3RWCB 1IKFH 1NGWB 1W72B 3QZWB 5GGVH 1LEIB 5HGGS 2XKSA 4XNXH 1ZSDA 4X9BA 1QBML 3NZHH 5F9AC 2YR3A 2XICA 4X8JB 1K9TA 2O5XL 4HK0B 3EYUH 4P4KC 4WIQA 5E6YA 4Z7UB 1A4KB 1KBGH 4N1CA 4U0RC 3DO3A 4QXTB 1JPGB 1KB5B 1RZKH 1PKOA 1QSED 1S7UA 2BVPB 4WHYH 4HJ0D 4JFHD 4NC1C 1LP9F 1V8HA 2ZOKA 7CGTA 3GGWA 4KVNL 1TJIL 1IAIH 4JM4L 4FXKB 3ZDYF 4P2QA 1BZ9A 1HXYA 4XMPH 1U8PA 4KROC 3TN0D 4XX1G 5GRVK 3KR3L 2DQJH 3GSRB 4B0MM 1S3KL 2VLRD 3MRJB 1OAUH 4JDVA 3UTSE 2VITA 1PJ9A 5E99L 4ELMB 5JHLH 4UILL 3D3VD 2L0DA 1J0KA 4TQEL 4WGWB 1NC2A 4Y5VC 3DRTB 3L95A 4EVNA 4BK5A 4RAUA 5HVHB 1JGVH 3HE6C 4M7LH 5MEQB 3VFVB 3W9EA 4NM8L 5JW3H 3JWOL 1FL5B 3QIBB 5EU7E 4K3HA 2JKXA 4PJDB 2AJVH 3CD4A 5DEGA 1BF2A 3SPVB 3KPPB 5ENWB 1JNJA 2YKLL 2C1OA 3B83A 3ULVH 5INDB 3K74B 1IQWL 5EOQH 3D9AH 2PCPB 5CJ5A 1S9XB 2MNUA 5DRNB 1JPST 3KPSE 2R2BA 2AJSH 2FO4A 5EBWA 5DS8B 2RFXB 3O4OB 2KZWA 3V6ZB 4HXBL 2BY0A 4DKFL 3ALPA 1EJOH 4P9MH 2NXZC 2VABA 3ES6B 5C08E 3A6CH 3SDCB 1KTKE 4YUEL 1RZ7H 4HT1L 1G6RA 5TPWH 4Z7WF 1XIWA 4KKCD 1CGTA 1MFCH 3IDNA 3MOBH 2XT1B 1ZMYA 3QCTL 2R23A 3ZKND 1ZXQA 5I76B 1ADQL 3HMXL 1BIIA 5ESQB 3D2UD 2WBKA 3QXVA 3P73A 4C57C 4IIQC 4JFEB 5CGYC 4C4KO 3MRFB 4LVNB 5F96H 7FABH 1A47A 3MRBB 4JKWA 1Y18B 4JN1H 2WK2A 4KMTL 3GUTB 1FORL 1UCTA 1NCWL 3BEWB 3BPCB 4G43B 4NM4H 5TFSL 1CFVH 4QHMB 4OZHF 5L6YL 4ODHH 2DI7A 1I1FA 1JPSH 3H9SB 2XZQL 3CGTA 3NGBC 4HXAH 4L4VA 5DQ9A 1MAKA 2R0WL 1U93B 3MV7E 1KCUL 2X4QB 1SMAA 1LEGA 3W5NA 1FBIL 2OMBA 4JZNA 1JNHA 4LU5L 5F6IB 4M5YL 4TPRL 3QEQA 4XAKD 2FWOA 3JV6B 4HBCL 4JKMA 5KS9A 5I1GH 3QO1A 4GRMB 4JO1H 3F6LA 2OQJA 1XF4B 5IB5B 3I9GH 1MUJB 3EJZC 2X9YA 1HSAB 4P49A 1KJMA 4QWWD 4JFDA 2AI0L 2JCCA 4JREB 4UIMA 1GVIA 4HJJH 2CLVA 3P0GB 2CLVB 2X9WA 4KXZI 2GTWA 3DUSA 2NTFA 2XZCH 4HFWB 3ARGC 5J11B 3H2WA 3LKPA 4LCWD 4ETQA 4DUVA 4YK4B 4U31A 4JPKH 5TF1L 1TTGA 2VLME 4H1LA 2CK2A 4BFIA 2HJFB 4N0UB 5BVPH 2JJWA 2GTZB 5IB5A 4Q58C 4X6DB 2FATL 5ICXA 3W0WB 5GGQH 1XF4A 2W0LA 3TBVB 4L8CA 2X10A 1MEXH 1NCCH 1I9IH 5DSCA 2C1PB 4DOHE 2PR4H 3QEQB 4O2EA 1U2HA 3FQUA 1BEYL 3TA3A 5CP7B 4EIZC 4UOW0 4HHAA 4PR5A 4N0FB 5B38G 4AEHL 1RAMA 2Z8VC 2DI8A 3H9HB 2NY0B 2BJML 4L4VB 2JELH 4PY8I 4OIIH 1NGYA 1EBAA 4PV8A 3NVQA 2B0SH 4PRBA 4UAOC 3T0XA 3UAJC 3O8XC 5CJOL 5JUEL 1FZJB 2BNRB 2ZCHL 4YHML 4XP9H 1F2QA 1T22A 5ACLA 2GUOB 2YUVA 4N5UA 1OAQH 2HA1A 3ULVF 4RRPA 2GQHA 1NAKL 2E7HA 3R1GH 2ARJB 3TLRA 1V3MA 2VC2L 5EU5B 3VWJC 5ITBH 5ESQA 4TVSa 1NEUA 1ZE3C 4XNZC 4JREC 4Y89A 3IDNB 1T6VN 4PLJC 4LLYB 3FONA 1JP5A 5ESVA 3HR5B 3R8BB 5EG6C 2I5YL 5E94A 4YDIH 4WFGD 3OHXA 2YPKA 2VABB 3LN5A 1K4DA 4NQTA 1YECL 3G04A 4MA3B 2H2PC 4X98B 1JZ4A 4PREA 3OPZH 4X6CA 4FFVD 1JJUA 2ITDB 3ECBB 1N4XL 3GBML 1MVFA 2CK0H 3V6ZA 4P4RB 4UDUB 3IFOA 3M17A 4WU7A 1KB5L 4TUKL 4WW2C 3T3MF 5C6PB 3PDGA 3IAQA 1MCHA 4DVBB 2R2BB 2W9LA 3MRMA 4NZJA 4TULL 3DIFB 3RI5F 1MHHA 4M6ML 5F8QC 4I3RL 1GGBL 3GSXA 4GLRH 4Y16A 4MQSB 3BHBA 3K81A 2DQCH 2J8UA 3NFNB 1J05B 1DE4B 3HLAA 4TSBL 4W70A 4FZEH 5MEQA 2ATKB 3V8OA 2N7BA 4MNQD 2YPLA 5DQJB 5GSVB 5AG8A 5I1JL 1H3XA 3S4SG 1VA9A 3TCXA 4PRHB 4KQ4H 3TP4A 4JDVB 2BERA 3LS4L 5C0RL 4MMZC 5AAWA 1FVCB 2BSSB 2PO6D 2Q76B 3BESR 4OCXL 1BZ9B 1I8IA 3KPSA 4JZJB 3TVMB 3BZ4B 2PO6C 4XB8A 3CFJB 1R3IL 3PF2A 4QY8B 2ZOKB 1CDHA 4QRRB 4WUKH 1OTUC 5LXGL 2BVPA 5DJXB 4CNIB 4NQCE 3FQRB 5E2VH 1TZHA 2NXZB 5BRZE 1UH4A 5EFIB 4Z7UA 3QA3B 1AC0A 3W39B 2CRYA 8CGTA 5CBEB 5L8LB 1NEZB 4ETYA 2DD8H 5HYQA 3QXTA 1S7WA 1XGTA 25C8L 5DMGC 4MNGB 2VLJA 2EYTA 1ZSDB 1Q38A 3HRPA 3TA3C 4JO4L 3F7VB 3IFLL 4P2OA 4YZFE 1PX3A 1NGWA 3MNVA 4MNHA 1QP1A 3VXUE 1MCRA 3FT3B 3WXVH 1K8DA 2I26N 4MVBC 5CJQL 2EDHA 3L3GA 1CGYA 3GI8H 2VIRB 2SEBA 5B38A 2FH6A 3MYJA 1JRHH 4HUUA 4DKEL 1C12B 4ZNCD 4FQXB 4HS6A 1B88A 3KPTA 1NBZB 2GSGA 1CFNB 3A0OA 3MO1B 2DMCA 3C8HA 1I7RB 4JCMA 5HI5D 3HC4H 4DGVH 4S1QL 1Z3GH 2ENYA 1J8HB 3L3KB 3N85L 4RWHA 2P45B 4PTUB 3CDYA 4BH7B 5JHDD 4OV5A 4XVJH 3QI9B 5HHQB 5CEXB 4KJPD 5HHPA 4J4PC 1D5IH 4X8XA 1FGNL 4X7EC 1QFUL 1ZHBB 1KJ2B 2VXSL 1U2CA 4J3OC 1RI8A 3X17A 1H3UA 2XZZA 5FO7B 1R0AH 4OLXL 3TO4B 4GMTL 1NSNH 2X6MA 1OP5K 1U8IA 4E41E 2EDEA 3PWUB 1AH1A 3TGXA 2HVKB 3HMXA 1YJDC 3OZ9L 5JHDA 4PJ7E 4CW1B 5T33H 1T03L 3FMGL 4ZTOH 2ICWI 1TLKA 4YIQB 5IGXL 3KPMA 4J3SA 4OFDA 1XZ0A 4PJ8D 5KANI 2GYSA 5IV2A 2NY6C 1ZLUK 4D2NA 4YHOH 2AEQL 5C0IA 3QH3A 4NHCH 1SJEB 3DMMD 3IGAB 1C16B 3BP4A 5KZCD 1UZ6F 2DDQL 3F65A 4Y16C 5I75C 1GOGA 3QUXC 2ADIA 2C3VB 3SDDA 4YE4L 1MCKA 5CHNA 4ISVA 5EPMA 1CWVA 4QXWA 1I8KA 3FN0L 3THMH 4K23L 1JYNA 1U6AH 1DQLL 2RCSH 2QR0A 2ARJQ 3EKCA 1GH7A 1OAYL 4QRTA 3O4LD 4J4PA 4Y88A 3PABB 3VXSB 3CFEA 3C6SB 1YEGH 3PWPB 3QIWA 3QHFL 5D6DA 2FECL 3BT2L 3JUZA 2BY3A 2EDDA 4LLUA 2VJXA 3ARGD 4GKNA 3QUKB 4MB4A 5E03A 1LVEA 4G9FD 5EU6D 3SJVB 3C9NA 3KNBA 2IPUK 1A14L 3VXNB 1TTUA 2MCPL 1VFAA 3IDUA 5H35B 3CPLB 3TBSA 4IOFD 4NOFA 1INEH 5ITFB 1CLYH 3GI9H 5E6IB 4YR6A 2R2CA 2A6DB 3OG6B 4ZMAT 2R8SL 2F54E 3V0WL 5JW4N 5FK9B 3F62A 4FNLL 2DS4A 1WC7B 3P77A 3DVGB 1RK0B 2X70B 5DRZA 3U9PL 1IE5A 1BX2B 3STLB 5LGJA 1AD9A 1LE5B 4F37K 3UTTB 3BW9B 2Z35B 3D69B 3HMWH 4QXUH 3GB7B 1FJ1A 1RIHL 4TNVF 4K9EH 1BFVH 4LSVH 5DLML 2DTSA 1QFWH 4TSAL 1Z0NA 4PJ5E 1GC1C 2XN9B 1T4KB 5EO0A 1U3HB 2OTWB 4LEOB 5GISL 1YDPB 2QL1A 3MNWB 4NQDD 5I73B 4I48A 4XCCL 4Z7WA 4Y19D 5HGAB 2EDBA 4X9FA 1U36A 1YJDH 1R3JB 4ZPVA 5SWZB 4HUVB 5FKAB 1N64H 2VZUA 4IRJB 4MCYA 4DAGH 1RHFA 1B0RA 3B43A 4JFFB 3PWVB 5GHWL 3BN3B 5F7MC 2AJYL 3BGFB 3EDDA 4JB9H 1T2JA 1NGXB 2UUDK 5D6DC 4PJFB 3MXVL 3CZFB 5D7LA 1H5BC 1JV5B 3FQXB 5D2LF 1D5ZA 1UWGL 4G9DB 4PJEA 5C0GB 3R4DA 5DHVA 3VFWA 1U3ZA 4B5EA 4MNQA 1S7VA 1G6RL 1PSKH 4C58B 3VD7A 3MX0A 5CSBA 4X7CC 1RJCA 3O6KH 3T0EB 1FZMB 1VFBB 4YHZH 5C86A 4JANB 2H3NB 4XBGA 3CFCL 4BZ2L 5I15L 3MREA 4IMLB 2OJZL 1KLFA 4XP5L 2NXZD 4L3ED 4DFIA 4KGLA 2GFBA 2YPLE 4X4MA 5MI0B 1ETZB 2PYFA 1CXLA 1NEZG 1TVHB 3DX8A 2VDML 1T04B 4WFED 2VSCA 5CEYA 5TH2B 1ZEAH 4BKLB 3QCUH 4JFQB 3MLVL 1OL0A 4I5BA 5F3BB 4CDGC 3SCMD 4KK9C 4YQXH 2WWMD 2HRLA 1FNSH 1RUPH 5I1KH 4O58L 1T0MB 3BSZH 3DUHA 5T1KA 3RBSA 2R1YA 1S8DB 1IGFL 2GJ6B 4UOJA 3FQNB 3FRPA 4ZFOL 2FCBA 2F8XC 4P3CH 1G9NC 2PW1B 5LCVL 1FO0L 3VXTA 1FAKT 1T20B 5DWUL 4ZAKC 2XN9E 4DEPB 1K2DA 3V4VH 5J6HA 1DN0A 1CDGA 5D5ME 1CGVA 2QLVB 3CFKB 3P40A 1IM9A 4NZDA 5FGCB 4LAJH 4BQ9A 2MKWA 2FO1A 4X4XA 1CDBA 2FIRT 3FL7A 3BZFA 4YHZL 4BYHA 1BD2A 4PJXF 1AE6L 2DL9A 4WUUB 4NQSB 4JM2D 1LO5B 1YPZB 3ROLB 1IL1A 1TIUA 4P5KB 2ZUUA 2B8OT 4ZUUA 3H9ZA 1G6RH 1SEQH 1G9MH 1DL7L 1UXSB 3U0TB 4R6UA 4CU6A 5MENE 3HAEH 2ID5A 3OAZH 4RFEA 5BCAA 1YMHB 3WNMA 1CVSC 4KROB 2NMSA 3BI9X 1ONQB 4L3CA 1XCQA 2C5DC 2MJWA 4XXCC 1ZGLA 3T0AA 4PJDE 3MLXH 4MD5A 5KVDH 5IEKB 1CGUA 4Q2ZA 5F7WC 4Z7VE 4P5MB 2V7NB 4CMMA 4PJAF 4GRLB 4Z76B 3FOLA 1HQRA 4FQJL 3G5ZA 5KSBF 1FLRH 4WFGE 5TE7H 4PJ8A 4IRZH 3DVIA 4X99A 5FEBA 1VB9A 4MD4A 5JPMA 3NA9L 1U92B 3GMRA 1MHPH 5I6XB 5EC2A 5D96C 2RHEA 1MAMH 4F9LA 3FT2B 1LE9B 3UDWC 2DQTH 3T1WA 1DBBH 4HKXA 1ACYH 2EKSB 4Y1AA 4KVCH 1AQKL 5DD0L 4G7YH 2YRPA 3AVEA 3GI9L 3ARYA 1RZFL 3DNKA 5T1LA 3QO0B 5CSZB 1XF2A 3Q1SL 4TTDD 5BS0E 2LVCA 3VH8B 1E28B 3CVHB 4G80A 1H3TA 2F9BT 1D7FA 1EEQA 4JHBA 1U8LB 4WHDA 4XPHL 2YUXA 4NNXB 5HHVL 4WTZG 2BY2A 1BOYA 1KEMH 3LEYH 3EYFB 1FFQA 1JHLL 1G7QA 1V7ML 3E1F1 4N0UE 4MJ5A 5E7BA 2UY6A 2B4CC 3MXWL 4PG9A 1OAYH 3QEHB 3G6AA 5DD0H 3QUXD 3MCLH 1P2CA 4QF1B 1PKQA 2GAZB 1XGUA 3QHZL 2VKWA 1NCTA 3CH1B 1HILB 5T1DH 2IMNA 3OAYH 1G9MC 5AG9A 3B9KC 1X5AA 4M7ZB 5D1ZB 1U3HD 4OCSH 5IUSA 3S5LA 2VDQH 5FCUL 2UZIH 1FZKA 4NHUB 1EH9A 4OUOA 5ISZB 3TIDA 1CCZA 3RDTC 2EIZA 4O5LL 3ZYJA 4J12A 1F4YL 3D3VA 1ZA6A 3V6OE 5I8CB 1XIWD 1LP9B 2NXYC 1D5XB 1UJ3A 4IOSD 5EZOL 1GOFA 4Z7VB 4GSDH 5DFVC 5E4EB 4MS8C 3H7LA 3BN9C 5FYKL 3GSWA 2FEEL 3OB8A 4PGDA 5J7CC 2XNAB 4G6KL 1CICA 1F02I 1IM3A 4LBEA 3O3BA 2WM0A 1UYWH 4KJPC 4OM0H 3VXMB 1F3DJ 2A83B 4NQEB 4O2CA 2VXSH 1QFUH 3L9RB 5HYIA 2HFGH 3IKCA 4AIXA 5HI5C 2IH1A 5GZOD 2DMBA 2UYLB 1ZLUH 4U3XA 1Z2KA 3N9GH 1Y6NR 1X6LA 4QCIB 1OAXL 2CDFA 4K2UL 2LU7A 4MNQE 4Q6IB 5HPMA 4XZUB 2XA3A 4MVBD 5DWUH 5DZOA 4Y4HA 2APBA 4PLNC 1G7JB 2BX5A 2JTDA 3VXRE 4OQTH 4OV6F 2ZCKH 1IGFH 1UWXK 4X6CF 5JQ6H 2W60B 3C09B 2APTA 2GJ6E 5F9JA 1WCQA 3WXVL 2L7UA 1FNSL 1IGJB 3TN0A 2ZG3A 1DQDH 3IFLH 4F9LC 3PIQA 3VGAC 4A2MA 1NCBH 3LS5H 4M4PA 4ZOEA 3RIFK 5I0ZA 5FGCE 1A6AA 4G9FA 1YEDA 1BZQK 1GL4B 5TJWK 3O6FA 4NWUL 1BJ1H 5EBMA 4Y4FB 5F70A 2R0LH 5ID1B 3VFNA 4UQ3A 3VFUB 5T1MA 3CDGB 3LQAH 4JVWA 2DQDH 5DJDA 3LRSB 3PDOB 1AJ7L 3JBG7 3PWJA 1AQDB 1VFMA 1B4JH 4L9LC 1PX4A 4XPBL 2DI9A 1MJ7H 2WIMA 2GK0B 4HUWB 2Q8AL 1F3JB 5C92A 1IC4L 4NN6B 1JPTH 3AUVA 3FO2A 3C2SA 4XVTL 2XWTB 4O2FA 3G5VA 2A1WH 2E8YA 1AXSA 2Z91A 5MHSD 1G7PA 4KJYA 3E6FA 2VL5A 1WTLA 4LQ1A 1BVLB 1FIGH 3FFCD 2HVJB 2BVOA 2DTML 3LEVL 3QIBC 1XR8A 4JFEE 5D1QD 3I6GA 1CQYA 2AEWA 5IB2B 4Z7NF 5GRXG 5GSRB 2O61A 1A3RH 4WI5A 5E7FA 5ISZD 4ELMF 3ARFA 3GJFH 3RDTA 4PTTA 3AB0C 2Q6WA 4LCCC 1TXKA 3WFHB 4XBPB 4XCCH 2EXWC 5EZLB 4ZO8A 5GISH 5IM7B 1DSFH 1QRKA 5MERA 1MF2L 1RULL 3BIBX 3MRNB 4DW2H 3HUJE 4FABL 1BFVL 4GXVL 5IBTH 1TETH 3PDDA 4UQ2A 5F72S 3HMWL 4QXUL 4YFLF 1OAZL 5GRYA 2E5EA 1JGLL 5F7HA 3GFUA 3OAUL 5ID0A 5DUML 1X5IA 1JZ7A 4QRQA 2WP3O 2UVFA 4OFIA 4Q74A 4WFEE 3OB0K 4PJ9D 2ZPKL 3I02A 1RMFL 5CWSA 2DQIL 3O8XD 3UAJD 5E9DA 4JKKA 1MNUL 5HD8C 1D9KA 5KS9F 3BH9B 1G1CA 1S9VB 2VE6A 3KPRA 5BRZB 4GRWH 4HLJA 2ZCHH 2Q3AA 4YHMH 1OWWA 3S36H 1Z6JT 5GGVY 4ELKB 5JUEH 3ZKMC 1ES0A 3EFFA 4QHLA 4XAKE 3UYOD 4M7KL 2E9BA 2GSIA 4LF3B 2AAVA 1ZGLP 2X7LB 1IAOB 4G8GD 5EN2B 4BUHA 5I1AA 3BWAB 3VXUB 4W4OC 1A21A 5FIEA 1IARB 1MCCA 4LASL 5DJZA 4GMSH 4YFLI 3OJDB 1N0XL 1UFUA 5B3NA 2X40A 4N1EA 1HH6A 1IGTB 5ALCL 5C0JB 1IC1A 5EC1A 1ZAGA 1FL3A 2DMKA 3QQNA 4K23H 4WO4A 2AK4D 1YEFH 2VXVH 4AMKL 4F7MA 5MEPA 4XXDB 2FATH 3QPXL 5FV1L 4JHAL 1NFDA 3P4MA 3T3PF 4LAQH 1NL0H 1U95B 1FRGL 3GSNA 4ALAL 3QBTB 5C07B 5TE6H 4Y5XA 3W82A 1N7ML 2AEQH 1KPRA 1MJUL 1JTPA 2JB5H 1BFOB 2PYEB 1EK3A 2IAND 2HN7B 3ARQA 1HNFA 1NCDH 1FC2D 2X4RA 4PIRF 3HI6H 4Y7MA 1T21A 2X5PA 3FMGH 2QQKH 4YLQT 1FDLL 1FFRA 4HH8A 3AS3A 4JY6A 4HIHB 4NQDE 4QOKB 4QYOA 5TDOA 4U6XB 4G8EA 5BJTB 1RUMH 4AQ1B 4BQ8A 4KDTC 4G8IA 2N56A 5TDPB 3H42H 5I17B 3RNKB 4M8QB 4R4NC 3K7UA 1CE6A 1I1AD 1E4JA 2ZNXA 4K7FB 1MFEL 3BO8B 3O41B 4EBQH 4LCCB 4L4TA 1WZLA 1XT5A 5EIQA 1KN4L 2IPTH 1RV6X 3F5WA 3P9LA 3ARFC 2VR9A 4ZDHB 5CINL 4F7TB 3LMJH 5GZND 2DKSA 1KXVC 3G5YB 1UB6B 1NBVL 4WEMB 5DVLA 2Y23A 4B50A 1RZGB 2BZDA 1EEZA 4P59H 3LKQA 4NP4H 4PP2A 5A2FA 1Q9LA 1QLFB 5KSBE 1K4CA 5I1IH 3F58H 5DD6A 1KLUA 4WWKB 4LARL 3OV6A 5T5FL 5E0QA 4RGOH 1Z9MA 2D31B 1FFPB 1Z9OA 3NH7L 4NKOA 3ZKNC 4KMTH 2OR8A 1W2KT 5LWYL 1HWGB 2AXF