1UATA

The significance of the flexible loop in the azurin (az-iso2) from the obligate methylotroph methylomonas sp. strain j
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
129
structure length
129
Chain Sequence
ASCETTVTSGDTMTYSTRSISVPASCAEFTVNFEHKGHMPKTGMGHNWVLAKSADVGDVAKEGAHAGADNNFVTPGDKRVIAFTPIIGGGEKTSVKFKVSALSKDEAYTYFCSYPGHFSMMRGTLKLEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Azurin iso-2
publication title The significance of the flexible loop in the azurin (Az-iso2) from the obligate methylotroph Methylomonas sp. strain J
pubmed doi rcsb
source organism Methylomonas sp. j
total genus 32
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2003-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1uatA00
4G7RB 4AKQA 1F56A 1ZIAA 1DZ0A 2IDQA 1NPJA 1ASOA 1W6LA 1JZFA 3IN2A 4PAZA 1WA0X 3AG3B 4X4KA 3WNJA 3NSDA 4E9XA 4HAKA 2J5WA 2X88A 2XV0A 1GW0A 4HCGA 5I5JA 2N0MA 4KO9A 2XLLA 3AG4B 3T6XA 4HCIA 3EH5B 2Y1AA 3NJMA 4E9QA 3AG2B 1M57B 1IKOP 1JVOA 4A67A 1SF3A 1MG2C 4W1TA 1PZBA 4BXSV 1W6WA 4KOBA 3ERXA 4FA7B 1SDDA 2OCCB 3V9CA 3GYRA 1ILUA 1V54B 1NINA 4HZ1A 4KO5A 1WA1X 2GHZA 1JOIA 1HFUA 3IBOA 2UX7A 3OD3A 4DP7X 2PCYA 2R7EA 1A4AA 3FU7A 1PNDA 2XUWA 3QJUB 1WS8A 4HCFA 4A2HA 2JKWA 2BP8A 3WKPA 3X1NA 4ENZA 1DYZA 3QJTB 1NIEA 2BW4A 3TBBA 4DPCX 4WKXA 2DYSB 5F7BA 1ZDQA 1X9RA 4M3HA 2HRGA 1EZLA 2HX7A 3SBRA 3FSWA 6PAZA 1QNIA 3V9EA 2BW5A 3TBCA 2UX6A 2DWSA 2DY2A 3FT0A 3OMIB 1PLAA 3DTUB 7PAZA 3CVCA 5FC9A 2FQGA 4JHUA 4KNSA 1B3IA 2CALA 4A66A 4AX3A 2GI0A 2QT6A 4BK5C 1WA2X 3FSAA 1PY0A 4FAAB 3QPKA 5B1JC 1AS7A 2IWKA 8PAZA 2XWZA 3X1EA 4BDVA 1PLCA 5ANHA 5PCYA 1SFHA 4CSZA 1JERA 2DV6A 4DP1X 2FT8A 1KV7A 4Q89A 2Y69B 4F2FA 1WS7A 3S8FB 5D4JA 4E9YA 3S8GB 2IDSA 1A4BA 4GP4B 4GXFA 2CUAA 4YL4A 1AS8A 2VM3A 5AZUA 3PAZA 1GYCA 1KCWA 2QPDB 4YSOA 4DP5X 3OQRA 2FJSA 3FSVA 2PP8A 1BAWA 1JZEA 2A3TA 2J55A 4GY4A 4L0PB 1OOWA 1L9TA 4YSCA 5A7EA 2XV2A 2VM4A 1E5ZA 1N68A 2R7EB 2HXAA 2UXVA 1FFTB 1L9QA 4NERA 3UABA 2IH8A 5B7FA 1XMEB 1A4CA 1JXGA 1TU2A 5PAZA 4DP8X 2H3XC 1BXVA 2GSMB 2IDFA 3H56A 4K9JA 1CC3A 1ILSA 1T5KA 1PZCA 1GY1A 2PP9A 3QJRB 2VSKB 5B1AB 4YSRA 1JXDA 3HB3B 1AAJA 2FNWA 4KO6A 1BXUA 3UACA 3N55A 3FYIB 3NJHA 1NICA 2H5UA 4E9SA 3H4HA 3T71A 1AZRA 3L45A 4KNUA 3WKQA 1BYOA 4DP2X 3IE9A 3FQ1A 1GY2A 3NJLA 3PLYA 3QQXA 3ABLB 2ZOOA 2I85A 2RACA 1JZIA 1FWXA 4N8UA 3GXUB 4M4RB 1AS6A 2B08A 4HALA 2QDVA 1OF0A 5I6NA 1J9RA 1SF5A 4BDVB 2AFNA 1RCYA 2WO3B 1V55B 2XV3A 3CVDA 4PCYA 1PMYA 3TU6A 4A2DA 3SBPA 1NPNA 2MRYA 4BWTA 1MDAA 3BQVA 5B3SB 4JKNA 1NTDA 2DYRB 4F7KA 1RZQA 2YQBA 4DP4X 2OV0A 4E9VA 2IAAC 3D12B 1NIAA 1SJMA 4AI7A 4YVUA 3T6WA 1L9PA 1R1CA 4G7QB 1AZNA 4YSUA 3UAAA 2JFCA 3CDZA 1RZPA 4CSPA 2VW7A 3X1FA 1AIZA 2GC7C 4E9WA 5B1KA 1IUZA 4DP6X 2VMJA 1JVLA 3PCYA 1OE3A 1KGYE 2YXVA 3CG8A 3ABKB 2FT6A 4YSQA 5EHFA 1BQ5A 3JTBA 3FSZA 1MZZA 4N4YB 3CVBA 3WI9A 3NJGA 2J57A 4E9RA 2B3IA 4YSAA 1OCRB 1BQKA 2GC4C 3NJIA 3QJSB 4NAJA 3WIAA 3X1BA 5B7MA 2YAMA 2IWEA 1XB3A 2PPEA 3FQYA 4A2GA 3X1GA 1AOZA 1NWOA 1J9SA 4WTQA 1J5DA 2BZ7A 3NYKA 2AZUA 3G5WA 4GYBA 1M56B 5AKRA 2PPDA 2YAPA 3FU9A 3ZBMA 5E9NA 4W9ZA 3AG1B 5LDUA 2FQFA 4DP9X 1AG0A 3U25A 1GS6X 3FQ2A 2YAHA 2I7OA 1EHKB 2EILB 1RKRA 2BHFA 1ID2A 3DIVA 3KW7A 1ZIBA 4HIPA 3ZDWA 1J9TA 1X9UA 3NJJA 2TSBA 1BYPA 3IN0A 2QDWA 2AZAA 2WO2B 2ZXWB 3ABMB 3OM3B 1NWPA 1SHXA 3NP4A 3CDZB 2HLEB 2I7SA 2XU9A 2HZHA 3ZIYA 4JHVA 3ABGA 2GBAA 4G7SB 4A68A 4BWUA 3BVDB 1GS7A 2UXTA 4KOCA 3T6VA 3X2QB 5TK4A 4F2EA 2CBPA 3NSYA 2VW6A 1NIFA 2BWDA 1BXAA 3NJFA 4ZK8A 3UAEA 2IDTA 3NJKA 4YSDA 4TXVB 4AKOA 2W88A 1AANA 3AW5A 3PXLA 1NDTA 5F7AA 2AANA 1AZUA 1J5CA 1OE2A 2P80D 2P80A 1AZCA 1OCCB 3N2JA 3RYMA 2LLNA 1ADWA 2BP0B 3FS9A 4HHWA 3EH3B 2IWFA 1NIBA 1QLEB 2FWLB 3EH4B 3EHBB 4UANA 5I6OA 3S3CB 1A65A 1CYXA 3DKHA 4DPAX 1E5YA 1OCZB 1TKWA 4YSTA 3ZX1A 4BXVA 1OCOB 3NSCA 2J56A 2XXGA 3PAVA 4QLWA 2HRHA 2JXMA 1AR1B 1CYWA 2ZWNA 2TSAA 5I6MA 5I28A 1JXFA 2YAFA 1UATA 1L9OA 1CUOA 1OV8A 1KBWA 2HX8A 3GDCA 1XB8A 2QPEB 3OMAB 1SHWA 3NP3A 2EIMB 4A2EA 4BWWA 2YAOA 5I5MA 5I6LA 1L9SA 2Q9OA 3T6ZA 1SNRA 2FQEA 2BWIA 2PPCA 4P5RA 3UADA 7PCYA 4DPBX 2FT7A 1E67A 1ZDSA 1GR7A 2UXFA 2YXWA 4YVNA 1VLXA 4E9TA 4AZUA 1ET5A 2PLTA 2UXGA 1A3ZA 3UGEA 1ZV2A 2W8CA 3WNIA 1MG3C 2XVBA 1HAUA 3OMNB 1N70A 4G72B 1SFDA 4UF7C 4G70B 5AFAA 4HHGA 4EF3A 3HEIB 3ASOB 3H4FA 4A2FA 4KNTA 2X87A 5I26A 2BP0A 1KBVA 1XB6A 1AACA 2Q5BA 2PPFA 2XYBA 2BO0A 4YSEA 1AQ8A 2OJ1A 1IC0A 1GS8A 2PP7A 2AVFA 5B1JA 2MTAA 3WG7B 3MBWB 1AG6A 2FTAA 5B7EA 3QJQB 4YSPA 1BEXA 3AY2A 5D4IA 3IEAA 1JZJA 1AZBA 1KDIA 2ZONA 1OE1A 1CURA 2YAEA 2YARA 1J9QA 1TEFA 2PCFA 1W8EA 3SQRA 3CZUB 1IBYA 1NZRA 3C75A 1NIDA 2VN3A 4NB7A 2PPAA 1FA4A 9PCYA 2DWTA 2CJ3A 2YAQA 5I6PA 3TA4D 3S3BB 3PAUA 1WAEA 5I5IA 4MFHA 4UAHA 1PZAA 4AKPA 1L9RA 2EIJB 2E86A 1URIA 3FYEB 3NJNA 4QKTA 1GSKA 1IBZA 2HX9A 1E30A 3T9WA 1ETJA 2XX0A 1BQRA 4YSSA 3PPSA 1A8ZA 4DP0X 3FPYA 1PAZA 4P5SA 2GIMA 3MX0B 5D4HA 1ASPA 1YLBB 2GB2A 5IY5B 2IDUA 2IH9A 3SBQA 3TASA 1QHQA 3EF4A 2NRDA 1PF3A 2H47C 1SDDB 4G71B 3FU8A 1I53A 3ASNB 3S3DB 2XXFA 2FQDA 1PNCA 4KO7A 1V10A 2EINB 1KYAA 1PLBA 5I6KA 1ZPUA 3FU7B 5B1BB 1MZYA 1KCBA 3JT2A 6PCYA 2BZCA 1KDJA 3QJVB 1ET8A 2BP8B 2CCWA 2EIKB 2XX1A 5TK2A 1E65A 1JZGA 3KW8A 4GP5B 3AZUA 1JZHA 1ASQA 2VW4A 4Q8BA 3FPXA 4RH4A 1M9WA 2VSMB 1TEGA 1HAWA 3NT0A 2CAKA 3NSFA 1PCSA 4GP8B 1ET7A 2WSDA
chains in the Genus database with same CATH superfamily
4FC3E 3QXDB 1ZIAA 4HPOL 2KMWA 1N4XL 5GHWH 5AKVA 2UVFA 4HMDA 4IHOB 1JZ5A 2BSBA 4BH7A 1MCJA 4POZD 4MD0B 3SYPA 2ADFH 2P49B 2G75A 3QCVL 2OI9C 3QCTL 4YL9A 4LO9A 2OMVB 5EUOE 2QELA 4XWGL 1BZ7A 4TULH 4HS8H 1UXSA 5I24A 1IKOP 4FQXC 2VH5H 1WT5C 1N64L 4FQ1L 4G6KL 1ORSB 3DRTA 3IMRA 4RAVB 2APBA 5KSVA 3ULVF 4GH7B 3I02A 2F54B 2NTFA 4JHZA 3GYRA 3Q8EA 2QQLH 1SMOA 3C2SA 4HZ1A 5C70A 1Y07A 3D5OF 1GC1C 1Y7VA 1ADQA 3HZMB 4K07A 3KH4A 4OCSH 2E59A 3HMWL 3KM2A 2A9ML 2UX7A 3CVHB 1I9EA 4FFWD 4Z7QF 2ROYA 4RBPH 3VWJB 5F2FA 1MFEL 3B1UA 4O2CA 3QH3A 3V7AE 3KBFA 4ENZA 3GZOA 2VDPH 4M6NL 4QTIL 1A3LL 4S11A 4MNGB 2OULB 2NYYC 5HYJD 2J5LC 1IGML 2CGYA 1S9XB 4WEBH 4U3HA 3STZB 1NCAL 2L7JA 2WWKO 3QS3A 3RZCD 3QR2A 1XBDA 5AW9B 5J6GB 1A8JH 3MLZL 2FATL 2F74A 5JYMA 3O2DL 2HFEA 4MDJB 3OHXB 2WZPA 4KK8D 4PJEB 5DCCA 5E9DB 4NFCA 1RK7A 3QXDA 5FGRA 3VG0L 1BOGA 3RWCB 5IP4A 2ZUWA 1FP5A 1A7NL 1VHPA 4MXQD 1ODUA 3VXTA 1B6UA 2F1EA 1LO4H 3QEQE 4IHOA 4NUGH 5F89A 3H7LA 5HY9A 1FNEB 1QFWI 4N2FA 4XN4A 3ZZQA 3PHSA 4ELMF 4PJCB 1UD2A 1L6PA 1SHMA 4BQ9A 2DIEA 3UDWA 1CIDA 4BDVA 1CICA 3A67L 1MJ8H 4JQIA 3NPSC 2XA8L 1TQUA 3NZHH 4JRXB 1B4TA 5HVHC 4GKZB 2VLJD 5EWIL 5JTWA 5DO8A 4MDRA 3HMXH 3VJ6B 4GG6B 2IDSA 4DFHA 2F54A 3CK0H 4JQXC 2ICWI 3GLEA 1OTUD 3FONB 1TCRA 4DP5X 4LL9A 3FSVA 4U1GB 3EKCA 1CL7L 1L9TA 3SE9H 4RWYL 4DOHE 3VB9A 2FWOB 2IPUG 1J05B 2F53B 1PG7X 3EOYG 1YEFL 3WTTA 2EUZA 3TESA 4JPQA 1L0XA 1UWFA 3PS6A 5E56A 4AQAB 4WO4B 4XXDB 3O2WL 1BGXH 1DO5A 3ILDA 5F7KC 4R4BB 1FRGL 1FV1B 3H56A 3STZA 1T5KA 2LFEA 3L95B 1GY1A 4P5MB 3QO1B 3QIBD 1RHHB 1NOAA 5J1AB 3CHXA 4YUEL 5D7LE 5EU7E 3UTZB 3UACA 2UZYB 3FYIB 4RMTA 1Y0LB 3OHXA 1D7BA 4QPEA 4OCLC 1BWWA 4PJEA 4WHYH 4MD4B 4PTTB 3IWVA 5KS9E 1MXDA 1EJOH 2NY6B 1HEHC 1FL6B 4M7LT 4NQQA 5KJRL 3LNEA 3PQYE 2XWRA 3CE1A 3ZMNA 3ALWA 5JXED 3I74A 3UPRB 3LIZA 3JWNC 4B9ZA 3DK0A 4WFGE 4KBPA 3FMGL 4MQXC 4O58L 5HGGS 2ISDA 3ESUF 3B5GA 4AGLA 4WI4A 3MR9B 2AFNA 4R7DB 5IHUL 2VE6A 1UOWA 2K8QA 3B7UX 4BK4A 1GC1H 4J3BA 4OFYA 4LRNH 1I85A 1E4JA 4B7IA 4GG6A 4OF3A 1MIMH 1UM5L 1WSST 4CVWA 4TSAL 4PV9A 4Z7VA 4PJXE 1NGXA 1OAXL 4GMSH 3V8OA 4Z3TA 2F5BL 1V27A 2HN7B 2J12B 3TBYB 2PABA 4NSKA 2BJML 2FEDC 2EYSB 1KTLA 3O6MH 4UNIA 1J05A 4LIQE 2CDEA 4KTDH 4C4UA 3VACA 2EH7H 1OL0A 4Y2DC 3FNKA 1UWYA 1ZJBA 4RNRA 4AQAA 2BSTB 1QFWH 2QADC 4R4ND 5HHME 4GSDL 5JPMC 3D3VA 3L95A 2WINB 5E7FA 3V0JA 3QO1A 3CUPA 3O6LH 4FERA 4K55A 2E46A 1RHHA 2YXVA 5J1AA 4N8CL 3UTZA 3IDGA 3QT2A 2UZYA 1Y0LA 4D3CL 3ZE2F 3KDPB 1RZJH 3ETSA 4YJZL 2GY5A 2W0FB 4PJGF 4PTTA 5C09B 1UB6A 3BISA 3Q6GH 1FL6A 1P7QD 4L9LA 2GC4C 5E1QA 2YAMA 5D2LE 3MRLB 4M6MH 2HT2C 2BNRA 3CDGA 3DV6A 2XKNA 3OR7A 4AEHL 3VTTA 4Z77A 1BIIB 1A1OA 2OZNA 2WIIB 4PHXA 2DTMH 3KHQA 3ILPB 4DK5A 3CXHK 3DNKA 2JQMA 1JD9A 2PWHA 3MR9A 1I9RH 4A7VA 5KSBF 1KN2H 2BRRL 3U4AA 2VT0A 4LLUB 5ICZB 1DLHA 1E9PB 1BIHA 1JGIA 1RKRA 2ZCLH 3PJNA 4EUPH 4YHYC 4DEWA 3P9LB 3FZUC 1FNAA 1CI5A 4AJ0A 1W72B 3EGXA 2OLDA 3SPJA 3VRLE 3MBED 3TBYA 4A7TA 2XQ0A 5T1MB 2E4TA 3AQXA 2AAVA 3EXLA 4DN4H 4FP8L 4YFLF 1M1XA 3KDMB 2HLEB 4XC3H 3MRDB 32C2B 3OXSB 1KZYA 5DRNB 3W1ZA 2UUDH 5DEGA 2BSTA 2V9QA 4RAUA 4QHMB 3RVWD 4WU7A 3UZQA 3LN5A 4BKTC 2WINA 4HIHB 2BWDA 5FCSH 1UCBH 1BXAA 1FPTL 2DQCL 1QUNB 2DQFA 4EI5B 5E0FA 3RURA 1H3PL 2EE0A 4FABH 4FXKB 4ONGH 1Y6KR 1T1ZA 3ALXA 1CFBA 4MAYD 5F7AA 2BK8A 4CAGA 2E9WA 3Q6FA 4OZ4B 5IQLA 3DPDA 2R4SL 1PZDA 5C09A 3WN6A 4MRCA 1M53A 2CJUL 3FS9A 1TUPA 5GISH 4PJIE 5ISZA 4HGKC 1OTTC 4PLJD 4ZFOB 5A2FA 4WFHE 1KTRL 2IPUK 5TE7L 3KVPA 5CBEB 1GJWA 3PAVA 4FXLA 4P4KA 3F01A 3ZOAA 3CNKA 2JXMA 2AK1L 2A6IB 3E8UH 3ZYZA 5J3HD 1BVLB 1FG2A 4TVPD 2HWZL 4Y16C 5IJVB 1MCNA 4HZAA 1RK0B 4RISL 5EO9B 7FABL 3UG4A 1IQWL 5DEJA 3EJYC 4U1HB 1MCQA 3OB0K 4JPWH 1AFVH 4H0GA 2LV4A 4AUJA 4AZ8B 2ZKHH 1N0XL 4ONHB 1BAFL 2EIMB 1EDQA 1CBVH 2YAOA 1L9SA 4KJQD 5ESQB 3ZPDA 3P0YL 5E5MB 3GXDA 1JZ4A 3GMPB 3BKML 2YD2A 5DTFB 1QPKA 3MRDA 5F3FA 4Z78B 3OXSA 4OZHB 5A3IC 1YECH 4ODHL 1B0IA 3ZGHA 3NCYP 3W11C 4Y4FB 2PR4L 2R27A 2J6EL 4QHMA 5DUML 5GRJL 1ACYL 2N7SA 4HIHA 3LH8A 3RPKA 3O3AA 4DZ8B 3TEYA 3V4VH 4PRDB 4HD9A 1CFMA 4RMVA 1HHKA 3V4PL 4M1DH 5BUGA 3DX8B 2GUYA 4OFPA 4GUPB 2X4NA 1TR7A 4KNTA 1MQKH 3CD4A 3MRBA 3D34A 3PWUB 4FNLL 2Q5BA 4QRFA 2DI8A 2XYBA 3EHBD 3HRZA 4AQEB 4QRAA 1NBVL 3IDMB 2F08A 5CD5D 1RJZB 4KH2A 2AEQL 1AMXA 3D33A 5D7JD 3SJVD 2WP3T 5FW7A 3BPLC 3MRNB 3S4SB 3NIGE 3LRKA 4BE6A 3HFFA 2A6IA 1I8KA 3QFJE 3EJSA 1BVLA 2HTLC 1J9QA 3P4LA 5LQBL 1IBYA 4NQEE 3EBGA 4NC1C 4X9YA 5DRXB 5F72S 2OTPA 1S3KH 4UT9H 3MBXL 4AZ8A 4P2QA 4MRBA 4KQ3L 4X6BB 2BIOA 2FWUA 1BVNP 4XI5D 5HDWA 4K5OA 4IKLA 4M8UA 5AB9A 4O4YH 1FCGA 3EGDA 2X7LB 3GMPA 2DQJL 3QQ4B 4WI7A 5DTFA 1B88A 3ISRA 4Z78A 2NCMA 4OZHA 3MXVL 4MMZB 3GMQB 3WNNA 4IMLB 3W38A 3TNMA 1I7UB 5K9JH 1PAZA 4MDIA 2FEJA 2VXQL 4P5SA 2CHDA 3CSYB 2ZG2A 4DZ8A 2YD4A 1Y6MR 4H40A 2BMKA 4PWHA 1XL6A 4PRDA 1KELL 5DURD 3HLAB 4N6QA 3QFDB 1JHLL 4EDWL 2X44D 1SDDB 1XCTB 3VXSE 2F8IA 2E6JA 2ESVB 2EYTB 2L8AA 3VFVB 3ILQC 3WTVA 3GSXB 3VM5A 3X11B 4MA7L 4G8IA 4CKQA 4KVCL 4PRBA 4LSQH 2Z4QB 1A4JB 1KGCD 2X4OB 1JGUL 2VERA 3OF6A 4JZNA 5KYXB 3E2HB 4AQEA 3N43F 4AVJA 4X7TB 2O5YL 3LRLA 3BUDA 3BWSA 2CBTA 5D7SL 4PP1D 2Y2YA 2JK5B 4LCIL 3UBXA 3F5WA 1OQXA 4Y19E 3WS3A 2QPUA 1VESA 3BVXA 3MRNA 1WQVT 2NY2D 3S4SA 5CJOL 5JZ7D 3QJZA 2NLJB 3Q06A 2YD0A 4NIYE 1IGTB 3NSFA 4PVLA 3KWXA 3ZJAA 3ZU8A 1UWEH 4XBEL 3NQKA 3IN2A 4HUCA 2EC9T 4PJ8C 1Z5LA 2GJJA 1DQVA 4AL8H 3UMTA 1KCSL 2X7LA 3CZFB 1S7QA 4NHCH 3X13A 2ZXGA 1NDMB 2IANE 2XLLA 1UT9A 2RFXB 3WXWH 2Y1AA 3FW6A 4IMLA 1MAJA 3P3TA 2W5PA 4MB1A 1CK0L 2ZP9A 3GHBH 1JV2A 4BXSV 4FULA 4W6XB 4YBLC 2HT3D 3N40F 3QXTA 2HKHH 3QG6B 2JQZA 1U8QB 3N04A 3HLAA 1SQ2N 5IB1B 1FORH 1SDDA 4RGNE 5IUCA 3GXPA 3P2BA 1XCTA 1F00I 1G9MC 1V54B 3OVUB 4XTRC 4JG1L 2ITFA 3TO4A 1HTYA 1CFNA 5HI3D 3VFVA 1JDAA 4ZOEA 1FE8L 2I69A 3GSXA 3X11A 2DQGH 2P7TB 3UROR 1CR9H 4EQ3A 3QUXA 4A6YH 1I1AD 3NN8B 1Q0EA 5FHBL 1U3ZA 5EBMA 5KYXA 1OTSD 5GS1A 1UKQA 1DQLH 3VWKA 2IG2L 3DHJA 4ZW8A 1DJYA 3T8VA 2JK5A 2DYSB 4V2CB 4H8HA 2HRGA 2MCMA 3SBRA 1U3HC 1O6SB 2NXYB 2OMUB 4ZTPH 2NLJA 4ECNA 3B34A 3MLYH 4P9HL 4MJID 1FJ1B 1IGTA 2EE9A 3TBSB 5F88A 5C0JA 1ULVA 4NOFA 4FXGB 4WW2C 3A23A 5D1ZI 2JVUA 3VDBA 3BWUC 4A66A 4AV5A 3FB7A 3IJ9A 4Z6AT 2PWEA 2NOYA 2QT6A 2EZ0D 2W9DH 4QXGH 1QRNB 3BO8B 5I74C 1GH7A 2J1WA 1S7RB 4A38A 5HHQB 3D39D 3A6BH 4YR6B 3MCLH 5EUOF 1NDMA 2V2XB 4F8NA 5DD1H 2WNKA 3ES6B 2Y72A 2KQNA 2RFXA 3D87B 4MKTA 2R51A 3X1EA 4E41D 2E3VA 1Q0YL 4UMSA 3QJOA 1SLWA 3U36B 2GJ6E 1DSYA 5E2UH 1NLDH 3KXFB 4WO0A 2X4TB 1EANA 3M86A 3QG6A 5DU7A 5ETUA 1JI1A 4KNQA 3GXNA 2QKSA 1TPXC 1PSKL 1A4BA 1R3IH 5IB1A 3VXOB 4BFBD 4DGVH 3LNFA 1KULA 4DEUA 5JQ6H 3KD4A 2X4RB 5BRZB 3PPEA 2XWCA 1R5VB 2HFGL 2PP8A 3VXUB 1GYUA 4LNRB 2P7TA 4KJWC 1EHLL 4Z9KB 4KUZL 1MH5A 2WY3B 3LJ3A 3NMEA 3FTWA 3L4ZA 3REWB 1R34A 2LR4A 1CGSL 1C12B 5AZ2L 4FA6A 2V4LA 5GZND 1ZSDB 1JXJA 4TNVF 1HL9A 1NEZG 2XG4A 4NNPL 5CR8A 3TN0B 3C6SA 5TD4A 1AAJA 4N2HA 5L88L 1VKXB 2CGZA 1QZ1A 1H19A 4PH8A 2A74A 1CDCA 3LY6A 2FVNA 4KMLB 2NDGA 4LLVA 3ATAA 2BXYA 2RMNA 5E2TH 4FXGA 4KNUA 4XO4A 4BFOA 3UJJH 2I60L 5F1SA 3I6LD 4XC1L 3SDCC 1ZS8B 3HCVB 4FRWA 5FYLH 3PLYA 3QQXA 4ATTA 1QRNA 2GW5A 3U7AA 4ZFQA 3WE6B 5JA8B 2B9AA 4GRMB 3U30C 4AGOA 2V2XA 2DWEB 4APQC 1DJSA 2QDVA 1T4KB 5K9QI 1MPAH 2BP5M 3PGFH 4Q4IA 4ZMLA 2AJYH 3LXUX 4YDVB 1X5HA 5DD3H 3U36A 3K2IA 1G9MH 5KBLA 4MASA 2ZYIA 3KXFA 5F3HB 3EFDL 4I0PA 2X0UA 4FNSA 3VXOA 1EZSA 5CD3A 4BGDA 2DYRB 4F2MB 3DX7B 2X4RA 3QUZA 4DP4X 1E0OB 2VLRE 5BRZA 4UT6H 1BZDA 4JN1L 2YPVL 1GL4B 5G5DB 1L9PA 1H3GA 3MV7D 2Z35A 4EXPX 3OKDA 4RVBA 3TJPA 2BY2A 2FCBA 1O7DE 1KCVL 4O2FB 2V5RA 3REWA 5HHOA 4B97A 3HBQA 1C12A 1TJGL 2C1PB 3S5ZA 1ZSDA 4ZX3A 1XQ4A 5T3XE 1A0QL 1OE3A 1CE1L 1B4LA 4PVNA 3MLVL 1V3KA 2N4IA 1WH0A 2ILLA 4TLUA 3D85D 1KMGA 5DS1A 5LAXB 4XCCL 5SWZB 3ZDXB 4AK2A 5CCGE 2B0SH 3HG1B 3VXQB 5TQ0H 5KS9F 1XGUB 5KW9L 2ZAGA 1CZ8L 1D5IH 1S7WA 2DLFH 4PJ7B 2LTQB 3CBRA 1IAMA 3C5ZD 3DO3A 5HDRA 1LL1A 5I0YA 3WE6A 2JJUA 5CP7B 2IADA 3HB3C 3BMWA 3G5WA 3HOGA 4YBQC 1TKWB 2ZZUT 2Q7YB 4LBAA 4TQPA 2YRPA 4NENB 4YHPB 2H0EA 1XCQA 4YDKH 3VRJA 4ZMQA 1KPUA 2JKLA 2PCPA 1HHIA 3RWHB 5DVNA 5M94B 35C8L 4PRPE 4PLKC 4PMFA 4TPRL 2FQFA 1BQHA 1WP6A 5C2BL 3KMDA 1NDGA 1OF2A 4OGAC 5IHZA 4FN0A 5EFIB 4JCLA 4PJXF 5I66A 3VCLB 1TJHL 2I7OA 2K8MA 5FKAB 1ZIBA 3HFML 3SYQA 3JUZA 3FKUS 3PQYD 2VDLH 2XIDA 5G5DA 3IN0A 1L4IA 2ZXWB 3IDXH 4QXTB 2WLMA 5KVDE 4O2FA 2ERJC 3MA7B 2X2HA 2XU9A 5ACZB 4ZFGH 1UD5A 3B9AA 1RURL 3ZE1E 4KXAA 4OLYL 2C1PA 2IBZX 3BJ91 3STBA 3UZEC 4LBEB 4DQAA 1U92B 3TX4A 5BMFH 4I2XB 5EU4A 1E6OL 2YJLA 2Q20A 3FT3A 2O93L 3VD2A 1CFTB 2E56A 4N0UB 4Z7NE 2LOEA 5E6ID 5LAXA 4YE4H 1GGBL 4I4WB 3QZWG 1NDTA 2NT0A 3LYRA 2G60L 1XGUA 5C07E 5CEZE 1U8MB 1YNKH 2GPZA 4TS6A 3SKJH 4PJ7A 4U1KB 1AZCA 5CGYD 1VACA 2J25A 1EWHA 4F57L 3F6JA 1P9MA 3CN4A 2VXSH 1YEDB 3QZNA 1IC1A 2OMZB 2IWFA 3AGWA 4HJTA 5D1XD 5KUKA 5AOIA 2E27L 4GBXB 4FNPA 2VNCA 5C8JB 1VCAA 5HHMD 2PTUA 3UP6A 1TKWA 2Q7YA 3ULUE 3GK8L 4N2BA 4NENA 3HG5A 4EN3B 2HLAB 2NX5E 3DX3A 5FV2A 4PJ5E 4YQXL 5I1KH 5IQ7H 5JIPA 2VLME 5SWQB 2VR9A 5CF3A 4L1BA 2CM6A 3EOAB 4S1DC 4PGCA 5FWQA 5FB8B 5J8OA 1WTGT 2AJUL 5I28A 4F92B 1W0WB 1L9OA 3ECUA 4XBMA 5CCJA 4Z7UF 3HNTH 3MCKA 1GTNA 2A9AA 1E8ZA 4A7UA 3HUJA 4B5ZA 1CDBA 5I1GL 3NP3A 1IZKA 1AD9B 1KPRA 5A40E 2BWIA 3RTQC 1G6RH 3MA7A 4NCC2 5ACZA 3CWGA 4WJKB 4NKIH 3FOLB 3VXRB 2VCOA 5JDSA 1H9DA 5DS8B 1UXLA 2XWJB 5C3LD 4PJ9D 3BAIA 2I9LB 3BKCH 3LHPL 4I2XA 3AY4C 2XETA 4HS3A 4PRIB 1RLBA 4XVOA 4UV4H 3HE6B 1ET5A 2ADGA 3HE7B 5CO1A 1CFTA 4DCQB 4FQCH 1KB3A 4G72B 2Y3NA 4XRCB 4BKSC 3MRFB 4I4WA 4L8SC 3SO5A 3GSOB 3QIUD 3U79A 5CNHA 5FEBA 5LNDA 1J86A 1U8MA 2J8UE 4ONFH 3QO0A 4U1KA 1EERB 3GSNL 3CSBA 2HVKA 2V3EA 4PRHB 2WLZA 1HCVA 1X5MA 2J1ZA 2OMZA 5C0AD 3KVQA 3V0VA 5IW1B 3U1SH 3VH8A 2VN5A 1JPTH 5C8JA 4HEME 1NAKH 2TRYA 1A21A 3U1QA 5JYLA 3DIDA 1FF5A 2AVFA 2ZJSL 2MTAA 2VIRB 2ZKXA 4TUKH 3TWCL 1J8RA 1UD8A 5SWQA 1JGLH 2VDKH 5CIPH 4ZI8A 4WKZB 2VAJA 3NJXA 1LDPL 1FH2A 2OI9B 3BWZA 3MUGB 4R3SB 3ROLB 2VO5A 5C0FB 3HC2A 1PD0A 1SBBA 3CSFA 2A9CA 4QTHB 3NRPA 5TE4H 4FQXB 4X0KB 5F1OB 1A64A 2XC8A 4G42B 5GS3A 1XCWA 3O6FD 9PCYA 4P5TA 2LQRA 1LMKA 4C56A 1K3ZA 1MFAH 3EO9H 4Y5VC 5I6PA 3RWDB 1QSFA 3VFOB 5I0XA 2QTVA 3MMEA 4WWOA 5ALBL 5I5IA 1AD9A 3CSTA 1JFQH 3KLDA 4MXWH 5FOBA 3QNYA 1HCYA 2HUHA 2DWDA 3MRGB 5IVXE 1NEUA 5KVFH 1I31A 2EDHA 4KX9A 1KEMH 3FOLA 4TVSa 5EOCH 3VXRA 3FB6B 3HMXA 4WQOA 4HOXA 4XCFL 3OKEB 4ZNCD 2FX9H 2WQUA 2XWJA 5CP3H 5I1JL 2XTLA 4G59C 2A73A 3D9AL 3SOBH 2I9LA 3PWPE 3NBNA 5E6RB 4PRIA 3HE6A 1CD0A 2H0JA 3T3MF 1U8JB 2IH9A 3D52A 3SN6N 3SBQA 3TASA 4DO5A 4DSYA 3BLPX 3O8XA 1LWRA 4U2ZA 4DCQA 2D7MA 4XRCA 3MLSL 5C0EB 2BVOB 2ZKMX 3TVMC 3O3BA 3UAJA 1MDTA 1KF9B 2LHAA 3N41F 4IOFC 2MPAH 1J8HA 2XIBA 3FN0L 5EU3B 3ZW3A 2WUCL 3CZLA 3L1FA 3VQMA 3FUKA 5IFHL 3GNML 1T7ZA 1A14L 2F58H 2A7BA 6PCYA 5IW1A 5FAAA 1N10A 4NZRL 2BZCA 3LV3B 3JVGA 1JFHA 4OIBA 1I3GH 4OLVH 4IGBC 2JJSC 3KW8A 3VD1A 1U8IB 5L8JB 4B5EA 3NIGF 1I7RB 4WKZA 1ZLWH 2WNXA 1IGFH 1XVSA 4BKLB 5BQ7B 4H2CA 4WK4B 5BVPL 2ICWB 1TEGA 4D8PB 3HNVH 3IDYC 2YGNA 3NPSB 2WTRB 4R26H 1J0KA 4QTHA 3SE8L 3ISYA 5I17B 2V6HA 3GGWB 5HVHB 3VFOA 4B9IA 5T33H 4X80H 3WNJA 1WA0X 1BJ1J 1HC1A 1DP0A 1KIPB 1A7QL 3BQUD 1GCFA 1P2CB 3O6KL 4PJ6A 3A4EA 3MRGA 4L48A 3HKZA 3AJ7A 1LO5B 2IFGA 5HVFB 1JS4A 1QI3A 2VXTL 3FB6A 4D2NA 2DM4A 3NJMA 1YEEL 3LRGA 1BZ9B 1VRSA 2QKIA 5BS0D 1S2EA 4QHLB 4EUPB 4FZEL 4D94A 4JO1H 4HXBH 5FO7B 4Y4HD 1GPOH 1ZANH 4HOWA 4I77H 1PX8A 5CSZA 2RTTA 5C0EA 1T3FB 2BVOA 4POZC 3MCG1 3FSOA 3OKOA 2ZOKB 3LRMA 4BH8B 1DBAL 4HKXB 1WA1X 1KYDA 4M9OA 1K8IB 1OB1B 3UC2A 5J1SC 1NC2D 4IOIB 2EIEA 4LB8A 2AQ1A 5JIKA 5MEQB 1FHNA 1SMDA 2R7EA 2ZOLB 1CGXA 1KXTB 4FI6A 5KVGL 3RL2A 3QUMH 3UYRL 5FKPB 3QJTB 4F58L 4LRIC 3TBBA 1FGVL 1U8IA 2W91A 4WKXA 3MV8B 4KX7A 1I7RA 4KKQA 2Y6SC 1YG9A 2EDWA 1QLEH 3BSGA 4HBCL 4YMPA 4BKLA 5BQ7A 4LLWB 1F6LL 2F19L 5DS2A 3TTYA 3FT0A 3JUYA 2OP4L 4CA4A 1R24A 4XOBA 3GLAA 2DQUH 4M61A 4BFIB 5HJGA 2GAZB 1QW8A 3FSAA 1P2CA 4WUUB 5EU6D 5B1JC 3QHFL 4JG9A 3BP6B 1AS7A 3GRBA 3OGCB 4NQVB 4QRQA 3RZCC 4PGEA 2XWZA 1JPSL 4HWBH 4QRPE 4WI5A 1M6OB 5KAQF 3ULVC 1BZ9A 2XRAL 5IEKB 1TT6A 4EUPA 2VC2H 1M2VB 4K7PH 4L4TE 3SPHA 5EC2A 5IHLB 5AW8B 2WXLA 2Y69B 4F2FA 3UOAB 4Y2DB 3RFZC 1THAA 4MXQC 2QADB 1ERNA 2ZCHL 4H20H 4DKFL 1SY6L 1DSFL 2CUAA 1A6PA 2BVPA 4YL4A 3X3GH 2ZOKA 4B9GA 5JPMB 4HKXA 3ZTEA 3KYNA 4N2DA 5GRVK 1SJXA 2VITA 4PJAE 4JDEB 3LKOB 4TNGA 1NLBL 3QZPA 3WIFA 5MEQA 1IB5A 2C34A 5IMMA 2CUIA 1Z9SB 2G2RB 2ZNWA 3GHEH 4KITB 1LO3H 5GS0D 3V4VB 3PGDB 1VSCA 3JV4A 2R29H 5FKPA 5PAZA 4JAMB 4GSUA 3G08B 2OZ4L 3VFTB 4R8WL 2PWDA 2ZPKH 1HSAB 4JUTA 5I6XC 1HSBA 2ZXAA 1S9WA 3L6FA 4KO6A 4NKDA 1E4HA 1BA9A 4Y9GA 4XMZA 2APTA 3V0AC 4E9SA 1FO0L 4ZUUA 1MFDL 2XTJD 3KPPB 5FF6B 1U8KA 1GY2A 4PLNC 2GBTA 4W70A 4U0QB 3WN5A 1MAMH 5TDNA 2GAZA 4EQ2A 5HSFA 1OT4A 2I24N 1I7TA 1E90A 2ORBH 4M93C 4WUUA 5GGRY 3OGCA 3QIBC 3TZVD 2B08A 1M6OA 1Z2KA 2QZQA 3O9WB 4YK4C 4ALAC 5IB3B 4E42B 5IEKA 4GKOA 1I82A 3X14A 3K5RA 4XVTL 4GLRI 1O0VA 1QI5A 2XV3A 1FDLL 1PZ5B 1MCCA 1TXKA 3H42L 3D07A 2X1QA 3FT4B 4EO5A 1MDAA 4PV1C 5DVMA 1H3TA 2QHLA 3KJ6L 1CTOA 4Z0XA 5JPMA 4LOFA 5JXEC 2J21A 4PQXA 3TIEB 3BZDA 3MRPA 1E3FA 1F3RB 1F58L 1W2KT 3A5VA 4GJTB 1JZ8A 1JYWA 5SWSB 3L3HB 4BCYA 3LKPA 5JO5B 3KYMB 4NQCB 1KFAH 1A6TB 1RZPA 2H0FA 1QLRB 4K8RC 4CSPA 1Z9SA 3PHQA 3LQAL 1CLCA 1NBZB 3ZMEA 4DZBB 1YEIL 2GJ6D 3G08A 3MN8A 1ZT4B 2E7LC 4OKDA 5LGYA 3VFTA 3HJEA 1HSAA 1IJNA 2UVEA 5LCVH 1MXGA 2X2IA 4E36A 4I9WE 3B2VL 4URTB 4L23A 3ZL4H 5BOJA 5MEPB 4KKBD 1EGJH 4N86A 3BGAA 2BXZA 3MDJA 3MRQA 4HBQA 3UO8B 2GJRA 4Y16B 3ULVH 3GI8H 4NAJA 1VJSA 3OPZH 2LE9A 2C4FU 2IH1B 4EEEA 3FQYA 5FA4B 3D25A 5HBBA 1T1YB 1NWOA 2C7UA 3MRKB 3WGUB 3S36H 4XR8C 2BZ7A 3TM6A 3ATDA 3VTMA 4A2MA 4BQ6A 2F5AL 4P2OA 4W9FC 3B4NA 4KMTH 4HWNA 1W15A 1BVNT 2R2BB 5I82A 1RFDH 2P8MB 4Z7WA 1ZLDA 1PZ5A 3O11B 5GXBB 1XL4A 2BX5A 3GTVA 3QDGB 4NP4H 5I18H 1JNLH 4NP9A 1I8IB 5JW4N 1D7FA 4PUBL 3GTNA 2ZX8A 3AABA 3DIVA 4X6DB 3GLDA 2PO6D 2R1WB 5D1QE 1KACB 3U4EB 1WWWX 2ADIB 5B8CC 5SWSA 2WD0A 3FCBA 2EDDA 5LN4A 4UAOC 4RFEB 2WLHA 5E2VH 3S5LB 1A6TA 4P9MH 1NWPA 1QLRA 1UB5B 2GTWB 3SY6A 4WEUD 2ZE0A 4TF4A 3VFSB 3L9EA 5JUEL 2Z0UA 3MRHB 4GAAA 1VFAA 2ZWKA 5I1CH 1H8LA 15C8H 4QRUB 2X12A 2HSIA 4KRMB 3EGSB 4NGHL 2V5TA 2KLTA 4GKNA 3MBEC 3ZYIA 3KPLB 4OM1H 2X2JA 5ITBL 2BDNH 5KG9B 1WBZA 2ENJA 4P07A 5MEPA 1U3NA 1YVLA 3D48R 3TPUB 4ANXA 2AANA 3BPLB 3PL6D 3QAQA 1K8DB 2HH0L 5TE6H 3TJHD 5EF2A 1S8DB 1XH2A 2P80A 3L9YA 4Y16A 2ZX7A 4IRJD 1AQKL 1E27A 1U8OB 4ALAH 3RVWC 5FA4A 1N5AB 1ZV5A 3ZDZE 1GGIL 3AXHA 2N3JA 1MREL 2E7DA 3COOA 1JP5A 2DEWX 2N7BA 2MCPL 2OL3A 2XXGA 2H3NB 2R2BA 3HPJA 5DZOA 3EXJA 5JOPE 1EZVX 2APWA 4YHKH 3IJHA 3VFRB 3NK3A 2VDNH 2GHWB 5T3ZL 1YYML 1AO7B 3BZ4A 4ODXA 1R4XA 5D93C 3S34H 1I8IA 3ZRSA 2XVKA 3U9PH 1JXFA 5TFSH 4NM8L 1XMWA 1FUNA 3FQRA 3ZSSA 4KUCD 3FL7A 4K8RH 4TL4A 2ADIA 3BP5B 4OBRA 4PLJC 3FO9B 1DL7H 3ZTJG 2IDCA 2VZVA 4M3JA 4P2YA 1IJ9A 3S5LA 2LABA 4TQIA 2PPCA 3H9ZA 2GTWA 5DJ6B 5K9KA 4HJSA 1P1ZB 5EO0B 4W81A 3ZE1F 5L2KA 3FO0H 4JZJA 4P3CL 3HNSH 4OZIE 2Z8SA 1S7TA 3FU6A 5J3HC 5HI5D 2YOCA 2DQMA 3LIZL 3MRHA 4AYFB 4D9QE 4PRPD 1GZPA 4YHIB 3MLWL 1T5WB 4E9TA 1URLA 1UUSA 4Z7NF 1AHWC 3MLTB 2Z64C 3L5WB 4LSPH 1FSKC 4A6YA 4HCRH 5J6SA 4KJQC 5BV7C 2IEPA 1YA5A 5C0RH 4QOKE 1H5BA 2HUEA 1IE4A 3B9KD 3J2PA 1G7LB 1S8DA 4KKRA 3T0EC 2RHEA 1R3LB 4EIUA 1ZT1B 2A99A 2WNWA 3L1GA 1U8OA 4JX0A 1A6AA 3FTVA 1N5AA 2D9QB 3ARFA 3P4NA 1AACA 4Q9CA 1Z3RA 1X4YA 3HJ0A 4YSEA 1TTUA 5I73C 4X6CB 3ULUF 3GS7A 1KOAA 2B39A 1A7OL 2GSIB 2VZ1A 3MBWB 4Z7IA 5B7EA 2H3NA 2J88L 5DVOA 4F7CA 2BIPA 3VAEA 4Y4KD 5GGQL 3ZKND 4A04A 5EO1B 4NC2B 2BVEA 3CXDL 1OCWL 1AO7A 1FZMB 1I3RB 2XV6B 4JFOB 4MVBD 5CEZD 2DF3A 2QV4A 1P5UC 4TN9A 4KKZA 1NIDA 3AT8A 1XF3A 4TQHA 2CJ3A 4YBLB 3EHBC 4LVOC 5JLZB 1JWSA 4WFFE 4LMQI 2FSEB 4G5ZH 3VGFA 2J44A 3MUY1 4AM0A 1D7DA 4K5NA 5JIDA 5D7JC 4NQDE 5EO0A 3O4LE 1GSKA 1IBZA 2AK4E 3QULB 2H1LM 3NDZE 4PJ5D 2Q2LA 5DWUH 1MLBB 1BQRA 3ZQ9A 1G9NL 5L6YH 2VSCA 3F7QA 1MHPH 2P5EE 2VJ8A 3VWJA 5EEYA 2G3ZA 1QSEA 4Y2OA 3KPSB 1UA7A 3MLTA 4XI5C 2V7NA 5AAWC 3K2MC 1OAYH 4UDUB 1T21B 4ADGA 2J8UF 1QUPA 3FU8A 5D1ZB 1F0LA 5ESAA 4XGZB 4YAQB 1CG9A 1U3HB 5GJTH 1G7LA 2VDOL 3QORA 2QPFA 3MLXH 4KO7A 3VWJD 1E9QB 1XGYH 3CQPA 4XMPH 1KYAA 4OJCA 2G2PA 4HWEL 4FCHA 4L0ZA 2ETWA 5I0WA 2EDBA 1YMMB 5D2NE 4X6CA 4ZW7A 4DQOH 3P77B 1BFTA 4PJ8A 2AV7B 4MXVE 1KIQA 3NACH 4CVXB 2RQ8A 1P4IL 4Y5YB 1AGCB 4CU6A 1G7QB 1HZLA 3UFIA 1FZMA 1I3RA 3H9SE 4NUPA 4LVNC 4P2RB 3P1VA 4X2UA 5E9DD 2H2PC 4A37A 3N1GC 2F9BT 5LLIC 1IBFA 4G7RB 2PCFB 2DMBA 3SY0B 4WDIB 1F42A 5DUBA 1R0AH 5JLZA 2FSEA 4PP1C 1TPXB 3CFDA 1MVFA 3LS5L 3NSDA 4PV8B 5EUKB 2HPOA 4JHAL 4M62H 1DJXA 5IVXF 1SJVA 1TMCB 4XPAL 3SD5A 2X88A 1A9BB 4JQVA 1DBJL 5FDWB 5JZ7C 1MCBA 4X8XA 1U9KA 4JRXD 2ZUXA 4LVHC 2RGSA 4KJPC 4M5ZL 4CSSA 5BV7H 4Y1AB 3EDKA 3ZE0E 1MKFA 3DYPA 1MVYA 3OKYA 4XE5B 4IYKA 4FFVC 2MKWA 4UT6A 4DGWC 2FECI 5EMYA 3S9DB 1HOCA 2VDLB 4BD4A 3CLFL 2EH8H 3IS0X 1FYTA 2CBOA 4V1DB 4ZUTB 5C0BA 3IDUA 3TYGL 3LZOA 1T21A 3OKKB 3IM1A 1WZMA 1WBXB 3JWDC 1ILUA 4WFEE 3BAXA 5ICXA 5BUPA 4N90E 3GM0A 4LPUA 2HAZA 1JOIA 4LPWA 4XAWH 4LEXL 4I1RA 5F7EL 2XFGB 1Q94B 1MW3A 3PIQA 4GW5B 3SQOH 3OD3A 3Q2WA 5MP6L 1N8OE 2F53D 4IBQA 2XN9A 5ICUA 1I1CA 3R06B 4MNQE 6FABL 3QJUB 4HCFA 1UT1A 4OQTH 4WW2A 4IBZA 4WO4D 3VTAA 1YMMA 3SDCB 2Q7AA 1SMAA 3MRIB 3OAUH 4I5BA 4J28A 1HZHL 1NBQA 3MLPA 1MUJB 4CVXA 4ORZC 1Z5YD 6CGTA 1LP9E 3U30B 2N1KA 1INDL 1AGCA 2HG5B 2RA1A 4HLJA 1G7QA 3NTCH 2BIMA 4G9FB 5EZIH 1HOEA 4DVRL 4YNYB 4F9LC 2DWSA 3NABH 1D5BB 1I1AC 2BSCA 1ZHNB 3LB6C 4Q7DA 3U0PB 2G30A 1RSFA 3T08A 1OTSC 4JHUA 4KNSA 4WDIA 4ZOBA 3DK2A 1KNOA 4AX3A 2R23B 1ZV9A 3V0GA 4W9CC 5A7BA 1UXWA 3CN0A 1CU4L 2HRPL 1RZ8B 4FZ8L 1EO8H 1IGYA 3MRJB 4X99B 1A9BA 5IREA 1GAFL 2CPCA 4HJ0C 1QVOB 3ZRCC 1A66A 2YPLB 1YEJH 5DI8B 2EIDA 4H13C 2YD3A 2OPCA 4R84A 2Y24A 1MIEH 2J8OA 3MJ7A 1CXFA 3WIHH 1JVKA 1A6UH 2C3VB 4IRZH 2QVKA 3U9WA 3AU1A 4L29B 2W95A 4Y1AA 1VPOH 3BKYH 4MLIA 4Q89A 2OSLB 3VXMA 3D0AA 3WY4A 1RPQA 1WS7A 2EDJA 4LCCA 1GZQA 2ITDB 1OGAB 1U8CB 3SDXE 4ZUTA 2BY3A 2EZ0C 2DYPB 3NZSA 4ERSL 1YUHB 3KPQB 1NUFA 1WBXA 1G6RB 4HUMB 5FW6A 4OCWL 2VLKB 2YA2A 2D2CC 4JRFA 4AXWB 4GEJA 4JM4H 5IM7A 2VUKA 4GW5A 5LBSH 5A1AA 5GSRB 2NNRA 3R06A 3TBWB 3KM1A 2DQEH 1EHNA 2Z8WC 3Q5OA 1E5ZA 4OGXH 5HYQA 5ES4B 1Q72L 2HXAA 1DN2A 4HSQA 2C3GA 3VE0A 1EBPA 4OAWA 3FHAA 3MRIA 1J11A 1L6XA 1UGKA 4X7DC 5DT1H 1SVCP 2ENPA 4X8JB 1MUJA 1FNGA 1PKQE 2X28A 4GRLC 2HG5A 3FK3A 4APQA 3HB3B 3QUGA 2ZUYA 4YNYA 1L5GB 1F86A 3U0PA 1KB5A 1JMZA 4TMPA 1LD9B 2ENYA 1BYOA 1IBGH 4HVBA 1DVFA 2YK1L 3BH8B 1LXMA 2BINA 3W9DB 2PYEE 4KGLA 1RZ8A 2R0ZH 2VDKB 5CIPB 4C83B 2VMDA 4RWHA 3GMLB 1QVOA 2AF2A 3APNA 3DROB 1OF0A 1A7BA 2ZT9C 1FVEA 2C3VA 1JZDC 3X12A 2WBXA 1S7VB 4L29A 5DVPA 2NY3D 2WO3B 3JWDH 4FQQB 2ERJB 2OSLA 3L8QA 2D7TH 1Z9MA 3CGTA 3CVDA 4G7VH 4P04A 1UZ8B 2Z1KA 4XPGH 4YDIH 4LDLB 3AXLA 3WHXB 4Z3JA 1OGAA 1U8CA 4BWTA 3I6KB 2WN2A 2DYPA 4MJ5B 2MJWA 1YUHA 4F7KA 2AJVH 1G6RA 5HPOA 3WNOA 1XR8A 4PJAF 1DANU 2H32H 1QQDA 2VLKA 4HPYH 3WMSA 4AXWA 3IDIB 3NVQA 2XZQL 3IU3A 4G7QB 1JNNH 5BJTB 1Q9LB 2CNZA 5GSRA 4HYTB 2FGWL 2COVD 3TBWA 2FBRA 1X9LA 3MACL 5IMOA 2Z9TA 3FBKA 5BPPA 3EZ8A 4NCDA 4MX7A 1OAZH 4QXUH 1NANI 3QUKB 2UY7A 2CLRB 1SUHA 4PS4L 4L4VB 4P48A 2GT9B 4EI5D 3F58L 1DHKA 3MJ9H 5C2UB 3KJ4C 1F90H 5AD0A 1P84J 1HT6A 4AQ1C 3QPXH 3ABKB 1MCOH 4RFNC 4LCWB 2BFGA 3V9FA 5EOTB 1YDPA 4QD2E 1T0NB 4Z0BH 4FQIH 3UTTA 1BBJB 2WLNA 3VXNB 2QQKL 1XEUA 4GAJL 4Y9FA 3BH8A 3VGEA 3FO2A 3NJGA 2J57A 5HD8C 5DVKA 5LG6A 5JHDB 3W9DA 1YSOA 1OCRB 1BQKA 5DMIH 1WCBA 5F3BA 1ZLVH 2Z93A 5CIPA 3W5MA 4LLMB 1GKEA 1O75A 4TNFA 4P06A 1ANUA 1J8KA 3VM7A 3DUUB 4PWIA 5EIIB 1UJ3C 3B8SA 5JIHA 3STLB 3U6RA 1PLGH 4M8QB 1S7VA 5EOCJ 3GBLA 1E5CA 1WG3A 4QWWC 5IT2L 2D7NA 1AG0A 4UT7H 1FNSL 3WHXA 2WBJA 3RILA 3EBAA 3FQ2A 2MQGA 3WEOA 1IC7H 2C3HA 3UZEA 4MJ5A 2W65A 4ANWA 3H55A 4HGWA 2C7FA 4WZ9A 2QGBA 5FX3A 4NI3A 5E08H 3IK2A 3NJJA 2AKRB 1UT2A 4KROD 2AW2A 2XJKA 2Y5QA 4L1SA 1MFCH 3O0RH 4DIXA 4BFKA 3OM3B 4XPFL 3ZIYA 4Y4FD 5EU7C 1JPEA 3TBVA 4AYGA 3ARZA 4MJ2A 5E2WL 1MRCL 4M1GH 4UINL 4YHLH 4KXZI 2GT9A 3CFCL 1AXTH 1G0XA 2D4FA 3G5VA 5HHVH 3WKNA 3VD9A 4R0LA 1BVOA 4U6HB 4AEIH 4OD1L 3KPMA 2R1XB 4HZLB 3RKDD 4E5XG 1HYSD 3DI2B 4J6IA 3SGKC 3PJSB 1U2CA 1WHOA 1RZ7L 3VD5A 4RGOH 4MA8L 1XX9C 5JXAH 1T0NA 3JVFC 3PXLA 1CXLA 3U2IA 3VXNA 4YFEA 1AZUA 3PP3H 2D3JA 3KAAA 1IVLA 1KLFA 1YEKL 4MQSB 4NO3A 5JHDA 1J1XH 3SOTA 2LLNA 3OF6D 5AYQA 4NUQA 3M1BB 5IBUB 2CM5A 5F9OL 2XY2A 4QHUB 4YXHL 1NAMH 3MGTB 1O6VA 1QLEB 4X4ME 1AKJB 5I1DA 4PB0H 4KGJA 3H7BB 1YYLH 4J7RA 4Y5VB 5DGRA 4FQPA 1X5KA 3KR3L 4FLSA 3HPLB 4P99A 3SKNB 4DPAX 1RJLB 1XGRA 3ZX1A 2AS5M 5EIIA 4L3CA 1OCOB 4KKPA 5D7IB 5E6IC 4CKVX 3QA3B 1RZKC 4M8QA 4F3FB 5L8LB 1QR1A 1II4E 2FYYA 1MI5B 3RTQA 4IRSC 4JPIA 5I1EH 4L0YA 1ND0A 2AXFB 3TH3T 4EAEA 3JWOL 4BM7A 1A3RH 5CGYC 5F7UA 1CGVA 2VL5A 1Q0XL 3NSJA 2DD8H 1NMBL 1XXFC 3RWIB 3L4TA 4XP4H 3AY4A 1HI6B 3GDCA 4QYAA 5D1XC 4JY6B 3FQWA 4F8QA 5EV7A 3N85H 2AKRA 3PP4L 3RY4A 4BWWA 2DDQL 1DN0B 4GI8A 4M3KB 3TP4A 2VC2B 3TVMB 4L8SA 5B4MC 2A9NL 3UADA 2I07A 1NCJA 5ANMB 3KLLA 1TVDA 3DXAE 3PV7A 3KPNB 4XO9A 5GRUL 4JR9H 1F1GA 1IAII 4MMYB 1XF1A 2OJZL 1IVTA 4QRTB 3KPRE 3PV6B 4H0HB 4HJGA 4ANVA 3TH4T 2WK2A 3RVUD 2P5WB 1A3ZA 3I84A 2R1XA 3TEUA 4YHNB 3LEVL 3R0NA 3PJSA 5D1QD 4HJJL 4IGBB 4NJAH 4LU5L 2ESVD 1KB9K 3BAKA 1VADB 4DKAA 3GMMA 3LZQA 4OU3A 3WUWG 1YEWA 2DL9A 3HS9A 3QUMA 5CKAA 1H3WM 1IKNC 4MZIA 4P4RA 4JO4H 5AVQB 3M1BA 3IDYB 3ZDZF 3HI6H 4QHUA 4HULB 5DUPL 3G5XB 5LGJB 5KVGE 2UY6A 1AZZC 3GZPA 3RWDA 4Y5VA 1OK0A 3SKNA 3HPLA 2OJ1A 3KS0H 4JCWA 1RJLA 2HJKB 3QZMA 5D7IA 1B2WL 3QNZB 4JFZL 4F3FA 5EPMB 1YY8B 1KBKA 5GQBA 3VFMB 5JR1H 4XN1A 1RZFL 3IEAA 5F7DB 3BH4A 2IBGA 1AR1D 1XSKA 2IBZY 4J3VA 2DQHH 5I1HL 1MJUH 3H85A 4OLWL 1JF1A 2ATPB 4HWBA 2R83A 3S3BB 5FM5O 1WAEA 3IDJA 1F18A 1MFMA 3CXFA 3R18A 1L9RA 4ZUVA 5C08E 4PIRF 2EP6A 1V5JA 4NO0A 4OZIF 5ANMA 2UWEB 3FN9A 5IFAH 2E4FA 4MMYA 1BD2B 4XH2B 3QYNA 2YN5A 3ZTCC 3FCTB 4PJFA 2XPGB 5MENE 4JPKH 1S7SB 3KEDA 3PHAA 1ZRUA 5IFJB 1X4XA 3RUGA 5JPNC 4PMEA 3AS3A 2ZUSA 3O6FC 2FX7L 4YHNA 4JJ5B 4OZGE 1K5NB 4UCFA 4IGBA 5AVYB 2JJSA 4PBDA 3MJ8B 5T1LB 3SBWC 4OW6A 3FUJA 3RVXD 3ZT7A 4HGMA 1NEZA 3V6OE 2VDQL 1B0RB 1PDKA 43C9A 2ZF8A 4OZFG 4Y8AA 1V7ML 3ASWA 3CMOH 1YEGH 1LWHA 1YNTA 1OEZW 4N5EC 5DSCB 2EUVA 3HVDA 1KJ2A 4ZXBD 5B1BB 3G5XA 1M05B 1ZD6A 4D9QD 1UYWH 2DKMA 4NBZB 1A6ZA 2FHFA 5CWSA 2HJKA 3RJOA 1AGBA 2BSRB 4LIQH 2IH3B 3FTXA 4IU2B 2NXYD 1ASQA 1U8LA 3FPXA 1MF2L 5DQDL 1IAIH 1S78D 3HI5L 3N40P 3DECA 3RGVA 5FGBC 4ANUA 3W82A 3VFNA 2V33A 3MLUH 3DX6A 4FNUA 1TTGA 2J20A 3RFZB 2PYFA 3UG3A 1JDDA 3SZ6A 2DW5A 1C7TA 3IMBA 3BCFA 4X4KA 4F8PA 4Z7QB 5I16A 4TUJA 5J11C 5H8DA 2Y7QA 4KZCA 5I0DA 5I5JA 4XH2A 2IPTL 4JB9H 5CINH 4NT6B 2ZP0T 3LS4L 4XVSH 3FRPB 2RBLA 1JHTB 5D6CB 4XVJL 1Q9KB 4JFEE 3GSWB 3KXFD 4JDVA 4XP1L 3UC0L 4M6OH 1WEJL 4UTBH 1HEJC 3MA9H 5GJSL 1RK1B 1QOKA 4LRIA 1K5NA 3DVGB 1N3NA 1JYNA 3N50A 2R0LH 4GFXA 2XZZA 3BQUC 3MJ8A 2OCCB 3V9CA 5DR5L 4WFFD 2DEYX 2KZKA 4FMVA 2H1PL 5DJYA 1B0RA 3ABZA 3VXUD 4GAGL 5I30L 4RRPM 3SQBA 2YKLH 3PU7A 1OSEA 1U8PB 4QAMB 2YA1A 5DSCA 4ZG1A 1UWGH 1SBSL 1TYJA 4PSRA 1PNDA 4J3OG 3V4UL 4ELMB 4BHUI 1YPZE 2XQBL 1EFXB 4D0DA 4H26B 2K3TA 3TA3B 5LCVA 1LTXA 1M05A 1TNMA 4MXVF 4AMKH 5CLTA 4TSCH 5FK9A 3TN0D 2DJSA 2IH3A 5F7BA 5HYJA 4JKWA 2EDOA 4JN2B 1S9YA 2NSMA 2Y3AA 5CKGA 1CLOL 5DK2A 4RFOL 1NSNL 1SDAB 4IBLT 3RZCA 1B4JL 3QIBB 5C0CB 3I9IA 1WUNT 3CHSA 3G04A 4IHBA 4YK4B 3X3FH 1SXNA 1NCWH 3IRPX 5G2NA 2DJ4A 4LFHG 4XNYL 4UOZA 2YZ8A 3RFZA 4JZOA 1WA2X 2VR8A 1PY0A 3GRWA 2CXKA 5HJ3B 4OD3H 2VDPL 2MCAA 2VDNB 4HETA 4HC1H 1E4KA 1MWAA 2EACA 5ANHA 1QW9A 4OJEH 1FH5L 1Q9KA 1QPXA 3ZE0F 2WXHA 4B6ZA 5L9DL 5EOQH 3GSWA 1R3HB 3GB7A 1R47A 5AW2B 1X5GA 2CKBH 2CJTA 4BRVA 1RK1A 2VLJA 1KY7A 4LCUB 4JVUA 4XBGB 1L7IL 3TCLB 5D72H 2P5PA 2FD6H 5AZUA 3FC8A 4HIXL 3ZZLA 3G5ZA 3QQ9C 1LO4L 1KCRL 1KLUB 2V2WB 1YYCA 3AADB 4L0PB 2D3LA 4QLRA 2ZUQB 1FL3A 1U8PA 3ZO9A 2DLTA 4ELMA 3QZWA 5DFVD 4YSCA 2XV2A 3FTYA 1T89C 1NUDA 2IFFH 4PBVC 5FM5M 5CXPA 3WD5L 1RIHH 5GGSA 1P4UA 3K74B 3KCWA 1LP9F 2CLZA 1JCVA 4JN2A 5LVEA 2CCLA 1M6UA 4HXAH 4BSVB 4CGUB 1D3CA 3QIBA 1KIUB 1OD7A 4JBSA 3GQFA 4OCYH 4NRZB 4GUCA 5SWZD 2WQXA 5IR1A 1E6JL 3JYCA 4NZFA 3HG1D 4WFED 1NICA 2H5UA 5KJ4A 3FFCE 4YGVA 1ONQB 3ULAB 3CHRA 3DX9B 3S98A 1ESOA 2CHWA 3VGBA 3WKQA 5GS0C 1YN7B 2XWTB 4F7PB 2VQ1B 4ZX4A 2CBMA 5CGBA 2A6JB 4Q9RH 4WHTB 3A4FA 1S5IL 5JXEA 1MEXH 4TOYL 3KNBB 3SE3A 2KLRA 4HK3J 1UA6H 4JK0D 4PR5B 5B8CB 5JW4M 5C92A 4B96A 5IBLC 4KDVA 2O6CA 4RGNC 4UAOB 1TZIB 4MS8D 5T8IA 1R3HA 1FIGL 2O30A 3KGRA 3L3DB 1CWVA 2YQ2A 3SDXF 4UQ3A 5T3ZE 4A2DA 3ZL1A 3SYCA 5FUZH 2W0LA 4IK7A 1JNHA 3KLHD 1SLXA 3TCLA 3ZE2B 4UOW1 4K7PX 4MBRA 1EJOL 1FC2D 1MRDH 3QCUH 4PJGB 1GTFA 1OAUL 3PXJA 3NA9H 1GRWA 3FAWA 3JZYA 3KE0A 3TZVC 2VN7A 3VA2C 4NUJB 3F12B 3IMSA 4FOMA 2LAAA 2JFCA 1WITA 2BSED 3X1FA 3PUCA 2CA3A 1AGFA 5AW5B 2NSXA 2VRQA 5J89A 2OMTB 3POHA 4HIQA 5IMLB 3V0HA 3WV0A 1HILA 4HCRA 4V2BA 5CJXC 3Q7JA 4H8UA 3KGUA 1TU2B 4KRLB 4IIQC 5KSBB 2WQAA 1JL8A 3L17A 4H0LC 1LE5B 3QRGH 4NRZA 4QYOA 4EVNB 4L3EB 5EHFA 2MSPA 3JTBA 2VISB 2B15A 2Y1ZA 1AY1L 3AMKA 4M5YL 1YN7A 1BF2A 5J4MA 1S7UA 4DTGL 2CUMA 4IEFB 4Z7VE 1P7QA 4GBXD 4WHTA 5F6IB 3QJFA 5TF1H 5DMKA 1OD9A 3GI9H 3KNBA 4W6YB 5B8CA 1ITCA 1DUZB 4EN3D 5IBTH 1YMHB 4MA3B 2C9VA 3MODH 2SEBA 1TZIA 3WKMH 1JE6A 4KKBC 1IKFL 2WXGA 3GIVA 1KGUA 1L7TL 5C0GA 3DDGA 1I1RA 4DP9X 1JGDA 5AQ0A 3U2SA 1LQBC 2X6BA 4J6RH 2FJUB 3BH9B 5AG9A 4FEMA 3D3VE 4NIKB 3ARED 4APXB 1EHKB 3WLBB 1HXMA 2UZIH 4JG0H 5E4EC 2ZWSA 4PGDA 3RPBA 4F91B 5I1LB 3MBEA 4NUJA 3F12A 1J0JA 1FSKB 2D0HA 1I9JL 4K23H 1LILA 2BCMA 2WBWB 3LXBA 4K3EL 4XNMB 4Z5RA 5BV7B 2Z0BA 3VXRD 1DVTA 1XGTB 2I7SA 4NN7C 5HGBB 3ABGA 4KKLC 3UBGA 3VD3A 2P8PA 3T0EB 2X4UA 2BNRE 3ZY7A 3DYOA 3T6VA 2UXTA 2J4WL 3X2QB 2HCZX 5TGBA 5IMLA 3RNKA 4QR7A 5F7YC 4IW4C 3HE7D 1SEBB 2X89D 5GS0H 4ZK8A 5DZLA 5I73B 1ZOXA 1GMEA 5C0NC 3H6AA 4AKOA 2YMXL 4M00A 2FL5B 4OGYH 2IIJA 4MAYA 3CX5J 4XB7A 1I8LA 5GGUB 4ODSL 4HKJB 4PRHD 2EVGA 4U1NA 4WRLA 5C9KA 4JVWA 4OR1A 2RH0A 3EHBB 1ZHKB 4LVOB 2IAMC 1MN4A 4PP2B 4HDIA 4OIFA 1T83C 3D09A 2R4RL 4KX8A 4F5CA 2X1XR 4H25B 3UZVB 5D7JB 4G5AA 3S36X 2K6YA 4BSJA 5DJ2B 1FG9C 5BZWA 3S7GA 2XA3A 2C8NA 3TJHC 2MNWA 3BH9A 5GGTA 4EBQL 4FQXD 3H3KA 1NL0L 1YAIA 1O7DC 3CH1B 4FDWA 1CUOA 3OJVC 4APXA 7TAAA 1OV8A 3R8BB 1S9VB 1IAKA 2DI7A 1AQMA 1I1FA 1OARH 1YNLL 3BPNC 3LD8C 4N2AA 3WJLC 5I8CB 2X6MA 5I1LA 1AHWA 1WFNA 3BP4A 3F65A 5HGAB 4XNMA 1P6AB 4Q6IA 1G9HA 3MRRB 4AENB 3Q3GB 3MVSA 4F15C 1SNRA 1UD4A 1Q1PA 5E1HB 3MOQA 3QP3A 4HISA 1A6WL 3BLBA 5HGBA 4JO3L 5AAMA 3ZHFA 2AJXL 4JFFB 1X9QA 4ZQTA 5ISZE 4GG8B 2OYMA 3WSQL 3GXTA 1E3XA 3CVIL 3QPQC 4H2AA 4HFWA 2Q87A 5CSGA 3E8UL 2FECL 1SEBA 3FUDA 1QFUH 2NYYD 1CE6B 2FJHB 2DQTH 1OAQH 1SFDA 1CMOA 4HT1L 1PG7H 1H3VA 1E9OB 2CRMA 4U6VL 4OQTA 3U46A 4G8AC 3GXFA 1RPUA 2CE6A 3LPGA 2E7MA 3HEIB 2YPKB 1BX2B 2WLYA 4LVNB 1NCDH 3BUYA 4KQ4H 5HI5C 3BESR 2KBGA 1LQSR 1P5UA 5A2BA 3EG9B 3QDMB 2X10A 1DBKL 5CEYB 5DHDA 1FGNH 3Q9PA 1ZHKA 4AYDC 4HUXA 3EYUL 2EICA 5LBVA 1FAIL 3UO1H 3NCJL 3CC5A 3PYCA 1PS3A 1X6NA 4OF8A 3SKOB 2A4CA 5AW4B 4AIZA 1P5VA 3WIIL 4H25A 3UZVA 3ZIMA 5D7JA 2DJUA 5FLUA 3SJVA 4CJ1A 4LQFH 4UTAA 3B9KC 1FVDA 1JZJA 4NS0A 3WJMA 3MHZA 4PGBA 1PYWB 4LVHB 2G9HB 3CH1A 1BEYL 1S9VA 1KYOJ 1PJ9A 5ID0B 2YAQA 3CV5A 3KGSA 5EBLB 4K3DH 4XPBL 5AAWA 5BZDA 4I87A 5HGAA 4HHAB 4ZSOA 2ZYSA 4NZUL 2Y0SA 3KPOB 5DRWA 2X42A 3UJTH 3BUPA 5CZKA 3N43B 4Y4KC 2K7QA 3ZKNC 1YEHL 2QVFB 3CCHB 4XXWC 5BXFB 1KT2B 1JHKL 2FWSA 4K4KA 3TWYA 2NZIA 2FX8L 4MVBC 1A8ZA 3RJQB 4LL4A 1Z32X 2YBGA 3MYJA 5CLWA 2GB2A 2H32B 4YE0A 4FG6D 4PN6A 1QD0A 4PVMA 3MNMA 1AR2A 3BPOC 2D7OA 3W39B 5A2LH 4PY8J 4HV8A 1SEQL 1PFOA 3QGVA 3MUHL 3RX5A 4G71B 1EZVY 4DKEH 5F1NB 1BF5A 4LLYA 5C6PB 1QEXA 2D03L 2FZ3A 2VR3A 2HJLB 3V52H 4EI6B 3U48A 3L9RB 1V10A 2FBJH 3IDNB 4LK4A 3GD1C 1PX3A 4Z8FH 1PLBA 4G6MH 3K0WA 3DXAD 3D4YA 3EG9A 4P2QE 1IV8A 8FABA 2MHAA 2R0WH 4ENED 2AC0A 1AD0B 3MV8D 4Q58C 3OB8A 2YHGA 4BFEA 2DICA 2ICES 3CC1A 4A7SA 1RLWA 1ZK5A 3MZTA 1DQIA 1KYUA 3LZFL 4GI6A 3LEXB 3C8KA 1PYWA 1Z0NA 3QWOB 2G9HA 4YPJA 5T3XH 3QNXA 2EYRB 4RRPA 1T1XA 4L2YA 3V0EA 2ATAA 5IESH 1C1EH 2NZ1A 4WWKC 4AVKA 1J0IA 1W6LA 4WUUD 3K2UL 2G3NA 5TDOA 1FHGA 3NIDE 3S4SG 4HHAA 5KSUA 3LNDA 4B50A 4OJAA 4MZ2A 4GXVH 4WJG3 1OT1A 1VERA 3DO7B 1CDHA 3CCHA 5DZNA 3RU8H 3OJDA 4XPTH 4LT7A 4E9QA 1ZXQA 3C5JA 1M2OA 5A16B 4U6XB 4Y2DD 3QYCA 1J1OH 3BEVA 4KI5E 1RUPL 1SYSA 2YRLA 4OZGF 4POYA 2A1WH 3ERXA 5DC0A 4FA7B 2VOTA 4PW4A 4RSVA 4DUVA 4M48H 2OL3L 4HU8A 1XD1A 4KPHH 3ARBC 4FKEA 4KTEL 5F1NA 1HNFA 4XCYB 4BRJA 4GRLB 3BUQA 1JK9B 1AMYA 1SJEA 1U6AH 1HFUA 3IBOA 4K2UL 3VFUA 4Q56A 5C08D 4C58B 3IDNA 4CC1A 1KZQA 1F8TH 4F9LA 1I1AA 5DZAA 3L5XH 2I25N 3BIKB 4ZMPA 1BJMA 2OW6A 4OD2A 5EUOB 4U31A 3N0AA 4OTXL 4CMHB 3OKMA 3X1NA 2HT2D 5AVTB 2KPNA 4OFQA 1VB9A 1QFOA 1OW0C 3CJJA 3FUMA 1I9IL 5TH2A 3R7RA 5KVDH 4JKPH 1HH6A 3O0LA 4M3HA 3H2WA 3BRGC 2CZNA 4F7TA 4HLZG 4YEFA 4J2XA 3AS1A 1XF5A 1C16B 2YN3A 4LDOB 4YHOL 2BIQA 3DGGA 4EIGB 5IHBA 2EYRA 1NAMB 5IROD 4P59L 3B2PA 4LAJH 2P3YA 2VGLM 4A6YL 2I9TB 3OJ2C 2WXPA 4XAKD 1SN0A 5DEZA 4KFMA 4UUJB 5CEZH 3TOPA 3D39A 3HC4H 4M7KH 3DO7A 1JF5A 3O9WD 3DUHA 1ROWA 4XP9H 4E41A 3AITA 1HCZA 4BZ1L 2RCSL 4XNDA 5A16A 3N9GH 1DCEA 4U6XA 5I0VA 5DJAB 4PYGA 5DJCB 4ZMYA 1E8YA 1KV7A 1Y1DA 1LEKA 3T1WA 3CFTA 5INDB 3ULUH 3S8GB 4P3DB 2JLLA 2LGNA 3HR5A 3IBEA 4NYLB 2XHNA 2M26A 5DF0A 5I8OL 1ETA1 3ETBF 2VM3A 1KBGH 4L8BA 2C4XA 4JO8A 1LLAA 4NKOB 4DN3L 2ATKB 3KJ4B 4QXGL 2Q8AL 4AQ1B 3QEQB 4NQCD 5FLVA 4RFNB 4PCSA 1XT5A 4S1QL 3GFUA 3NCCB 4Z3FA 1XFPA 4HF5H 4LPCA 1IILE 1YPZF 2GFBA 4HPOH 1IEBB 3HC3L 5DDHB 3F7PC 4MHHG 1N68A 1YC8A 1CDGA 2ODIA 3IKKA 2G5RA 3NGBB 4NERA 2JB5L 5GZNA 4DGYL 4OBSA 3DV4A 3QCVH 4S2SB 2GSMB 4X5PA 3QCTH 5HVGB 1KTCA 2DPKA 3T65B 2IDFA 3BD4A 4CN1A 1CC3A 3IJSB 3P69A 1PZCA 5E6UB 5AW0B 2VSKB 4DAGL 5C6TH 2APSA 3IFLL 4XWGH 1C16A 4F8LA 5I76B 5IGXL 3QEHB 2NCEA 3D85B 4JY4B 1QP1A 4TNWF 1UJ3B 1N64H 3BVUA 4FQ1H 3SDYL 4G6KH 1WFUA 4QHKI 4N0FB 4Y16D 1YY9C 1ZTMA 5HJBA 3V6ZB 4EMZA 2EVIA 1MCFA 3NJLA 5IOPB 3Q1EA 4DOHB 4N2NA 1NGWA 3L4VA 2BHYA 4W9LC 2H26B 3HMWH 2H2SD 5AYUL 2A9MH 4L8CB 5EB9A 5LDSA 1QFPA 1GOGA 1V3MA 4KDWA 4U3SB 1MFEH 3FT1A 5DJAA 3E0GA 3QDGD 1KN4L 5D7LB 4QTIH 1T4WA 4M6NH 5INDA 5FO8A 2F1BA 4P3DA 1IGMH 1QTPA 4W9KC 1NCAH 1X7QB 5CUSL 3BLKA 5E5UB 5KS9B 3QWQB 3MLZH 3P4MB 2FATH 3O2DH 4AQ1A 3PQYB 4AYSA 1JGVL 3NK4A 5I8EA 5J1TC 2MOVA 2V8MA 3MV7A 2DL2A 1OHQA 3VG0H 1QHOA 3QQ3A 3RL1A 1XAUA 4Z3HA 3DTXA 2NY3C 1A7NH 1FN4A 2RR3A 1Z9NA 1QRNE 4E9WA 2XG5B 5B1KA 1IUZA 1XSOA 1H15B 1XGQA 5CMAB 5DRZB 5ESVB 1UC6A 5TPWL 1G9ML 3EYFB 3RX7A 3T65A 1HHHB 2VMJA 5T5FL 4E2OA 3KS0J 4Y7MA 2R1YA 3A67H 4GXUM 1KGYE 3KLAA 4MQ7B 2FB4L 3S96A 2JLPA 2KDYA 1HINL 3D85A 4JY4A 4PJXB 1RVFL 1UJ3A 3NH7L 2RB8A 3DJTA 1G7IA 1UQSB 5EWIH 2UV3A 4IRSB 2UZPA 2G5BB 3VD4A 3WI9A 3V6ZA 3KYAA 4UBDC 1EMTL 2K45A 4HUKB 2BRQA 3C5ZA 1HIML 2NY1B 5FUOH 4A2GA 2J8HA 2CRYA 1SYVB 1WV7T 3F83A 2H26A 5DXWA 1LEIB 3NFNA 2JNZA 1D7CA 1CL7H 2IF7A 4L8CA 2QBWA 5HHMB 1HNYA 4KVPA 4PBWD 3BAWA 1FZOA 4RWYH 3REVB 2JV6A 2O5XL 2YGOA 2OTUB 4TUOB 5E70A 1GIGL 4XODA 3ZBMA 2CCVA 3GSQB 1YEFH 5HHOE 3UPCA 1AC6A 5IIEB 4HUWA 1WFTA 3U25A 3O2WH 3UTPD 5HYSB 5KWYC 3FFCD 1FRGH 3LVEA 5F8QC 5CSBA 4S1SL 1ZVYA 2O72A 1UUNA 3PWLA 5KS9A 3IJ8A 1OSPL 3J8F7 3P4MA 2OW7A 4N6RB 4YUEH 5FOJA 3SCMB 3PQYA 5HDQL 2HP4A 4GI9A 1WAPA 2WO2B 3SGKA 4XT1C 4ZODA 5ID1A 3ALPA 1E2VA 3DBXA 4N28A 3MPCA 3IF1B 4PRNA 4LSDA 5KJRH 1IO4C 2VLLB 5HHXL 1GS7A 1H15A 5ESVA 5IB4A 2AITA 3TNNA 3FMGH 4O58H 5JW3L 3DYMA 4MQ7A 5FGCE 1NCOA 3GSVB 3QXAA 3NJKA 4JFVA 2X9WA 4KROC 4PJXA 4DK3A 1T7VA 5E6IA 5IHUH 2Q8BL 4Y1TA 4HH8A 3TIDB 2EO7A 3DJRA 4Z7UB 3CZNA 4Z7VF 1UM5H 3ZHNA 4F1ZA 1XH3A 2CO6B 4TSAH 5K1VA 1I7ZA 5L0QB 2CWRA 2H4EA 3WFCL 1OAXH 3ML9A 1AGDB 3FHQA 4G6FB 4BFNA 2F5BH 5D1XA 1NIBA 4GFTB 2WHVA 4KAQL 2K4AA 2BJMH 3PWJA 4UANA 5BOPA 3P30L 3RKDC 2PWGA 3DKHA 1XGPA 1HYSC 4YSTA 2OTUA 2ITCB 1U3JA 4LSRH 3ELQA 4YGAB 4M9PA 5FYLD 5IIEA 3PNWB 1J5OL 4DH2A 1XDTT 1PG7W 3IYLW 4GSDH 4JDTL 1XR9B 3MGOA 1NH6A 2WP3O 3SKJL 4DO6A 2COQA 3HTLX 4GQRA 2BSDA 3DHPA 4X5WB 4H88L 5JPNB 1U0QA 3QHZL 3PABA 1F2QA 1XTLA 4D3CH 4RESB 2SODB 3DOHA 1KB5L 2A2QT 4I1NB 5B21A 1MNUL 4ONOA 4NQTA 3LDBC 4UTBA 2CKBB 3EZJB 3ZR6A 2VXUL 2ZF9A 3ZDYE 2QSCL 1E67A 3RJDA 1PY9A 2YXWA 4PJ9A 4XZUB 2ITEA 4AEHH 3KPSD 1P4BL 2VDRL 1VAHA 5FW8A 2PLTA 3BFOA 1JWUA 3JV5A 4UZSA 3L3KA 5JW5A 3G6DL 1W8OA 5D1ZD 2C1OA 4C4KT 2YEQA 1U33A 4UF7C 3T0BA 1U3HD 3HAEH 1FFPA 2BRRH 2VR4A 4Z7UA 5EG6C 3BRFA 1JPGB 3GMRB 2BM3A 2MIZA 5F1IB 3L7EB 4PTUB 3Q43A 1XCXA 5CJ5A 1DQJA 4MAUL 4YBHA 2NUPB 2Q76B 3TEZA 1FCCA 3O81A 1AGDA 3LSOB 3HN3A 1AI1L 4LSUL 3HUJE 4U1MB 5C0AA 1BLNB 1NPUA 1UOVA 3RVUC 1ROCA 1A7PL 2GJPA 4Y88A 3BXNA 2KUTA 2AXGB 4Y5XC 1P53A 2GEEA 4FP8H 3IU4L 2WLIA 3LH9A 3RX9A 5TDPA 1T03H 5D1QC 5CLZA 2ITCA 2ZXDA 5J11B 1HHJA 3EJRA 3AY2A 3BVWA 4QO1B 2Y7OA 1SXCA 3T3MB 2B3RA 4P2RD 4AEFA 4L1HA 4ODVH 1J5HA 4KK6D 1RUML 1OLLA 2B9BA 3BAEL 2P26A 1BECA 5ILTL 5J06A 1FPTH 1GMIA 2N0KA 2OKMA 3DJ9A 1QA9A 3N41B 5JPNA 1S7XA 5ALCL 3O6FA 2VAAB 2OCFD 1H3PH 4ZFFB 5HP5A 3TA4D 1UFGA 2JSFA 2CO3A 3BQUB 2FLRT 1CVRA 4HOZA 1GXEA 43CAA 2R4SH 3C8DA 3MV9E 2O6DA 3NJNA 4WNQB 5HGHB 4XZ4A 5DJXB 1BW8A 4I3SL 1AR1C 2ZX5A 2CJUH 4Q0XH 1DQML 1JGLL 2EO1A 3JV6A 1D5MA 2XX0A 2M2DA 4XZUA 3H3BC 4L1DA 2WKOA 3NIGB 5KYUA 4JE4B 4YLCA 3QFJB 4ZS7L 1LO2L 2WVTA 1INQB 3ARYA 3BN9C 3IJEA 4V1DD 1KIRB 4WENB 4WHDA 5TE7H 3HRPA 4M03A 4A7QA 1CXKA 2UZXB 4NM4L 1JI2A 1OLZA 3NCXA 1RU9L 4LPYA 2IGFH 3BD3A 1HQRA 4NQEB 5TE4L 1DLFL 1IGCL 2AK1H 1JPGA 4B27A 3C87A 2YBRB 2HWZH 3K6NA 1JFQL 2QGEA 2XXFA 3L7EA 5F1IA 3VMPA 4RISH 7FABH 1IQWH 2NUPA 2Q76A 5GIRA 2I5YL 4BZ2A 3LSOA 4C56E 3MV11 3SDCD 1HL5A 1MZYA 4U1MA 1BLNA 1QSFE 3BRDA 1N0XH 3DX1A 1BAFH 4R6UA 3BMVA 1ET8A 1XSIA 2AXGA 2ZUTA 3P0YH 1DQQB 3BKMH 4YEEA 3U2JA 2LVCA 4ZUWB 4G9FD 4ODHH 1SM3L 5E8NB 3KLSA 2PR4H 3EFFB 4F37F 4K5LA 1M9WA 2J6EH 5GRJH 5E03A 2JKXA 2HVBA 1HAWA 1ACYH 3UTOA 3VXSB 3OKNA 4ZXBC 2WSDA 3AM8A 5G4NA 1QEWA 4MB3A 2Y06L 4I3RL 4HX1B 4WHYG 2F58L 4U4BA 2WANA 4AH2A 5C3IA 4KY1L 1RMFL 3BQUA 1J8HE 1BF8A 3RNQB 1LEGB 1I3GL 2YPLD 3P2TA 3WO3B 4ZZFA 5LNGA 5DEFA 1SLUA 4WNQA 5HGHA 5DJXA 1S78C 3AG4B 4R7NB 1INEL 4RMQA 1BLIA 4P2CG 5BS0A 3QJXA 4LP8A 1NBVH 1KIRA 2AEQH 4Y4HA 5ADPL 2UZXA 1ZHBB 1MHCA 3QZLA 4NJ9L 1TJMA 3K8KA 1U91B 4OLZL 2NTSP 4FQHA 2VTFA 1D2PA 5T33L 4JRYE 1G9EA 4KO5A 5E8EB 1K9TA 1SDYA 1U3YA 4U7MA 1NC2A 1ODAA 1UHVA 3P11H 5LQBH 4H8VA 3MBXH 5GGRB 1OM3L 2IANB 4KQ3H 2X4QB 5JHBA 2YWZA 4NZDA 4FFYA 4P9HC 5DC9B 3L7FA 2EDLA 1DQQA 4FLHA 3IFOA 2DQJH 3GEWB 4DPCX 3UGUA 1OGTB 4P23C 1AQDA 3MXVH 4WUKL 5JW4R 1PU0A 1M7IB 5E8NA 3ROOB 4F9PC 1R3JB 3EFFA 4C8XA 6PAZA 3V9EA 3CAFA 3S88H 4BFJA 3RVTC 4RGNB 2VXQH 3MQIA 3OMIB 4DKDC 2E7BA 1LNUA 3K71B 1GYAA 4OGAD 1KELH 1P7BA 2CALA 1JHLH 1G94A 2EXYC 2QL1A 3NIDF 5DQ9B 4CC4A 1IL1B 4FKHA 1VFBB 3PXHA 4JREC 5DLML 5EU6A 1LEGA 1T6WA 3QUML 3HS0A 3VFGL 3L9BA 4MZ3A 4UQ2B 4MA7H 1WZ1L 4KVCH 1N9PA 3TZVB 4TL5A 3RIFK 1JGUH 1SFHA 3WGVB 4RZCA 4RBPK 2KZWA 5B1CA 4KI5F 3U9UB 5F7HA 5EBWA 5A2KH 2O5YH 5D6DC 5D7SH 4LCIH 4LSSL 1BWMA 2HYMA 1IBDA 1ZHBA 3EUUA 5EEVA 1NCNA 3CSGA 4PG2A 2BY1A 1Y1UA 5CJOH 5D2NC 4BFFA 1BFOA 4IIQB 5E8EA 1KCWA 3HZVA 4LMQE 5C0IB 3LKQA 2IXQB 1Q9OB 4EUPG 2FJSA 4E5XA 4QCIB 1QATA 1OOWA 5H4ZA 5GGRA 1PCXA 3WEMA 4XBEH 2P24A 1YUKB 2Z8VC 4WI6A 1HE7A 5FYJL 4NQSA 3WUWB 4UILL 1X4ZA 4L4VD 4QJ3B 1SQMA 1U93B 3UABA 1KCSH 4NDMB 3RAJL 2H3XC 2GJ6B 1OGTA 2IBBA 2PTTB 4NKMB 5T1KB 4Z3GA 1C5DA 4LCWD 5DZVA 3ROOA 1R3JA 1DFBL 4UYQA 5CU9A 3RWGB 4GO6B 4HLEA 4LKCA 1CK0H 1OT2A 3SDDC 4Q9QL 1E4WL 3K71A 5DFVC 2F7IA 2C9AA 4C55A 1J10A 1ZVSB 3FQ1A 3KWWA 1MHHA 4KWUA 1C5CL 5JMOC 4JG1H 1MCPL 4PD4J 2XFXB 1FE8H 5E4EB 3FH7A 4UQ2A 3NG5A 3NAAL 3OAZH 1ZA3B 3CFKA 3LZNA 1S3RA 3TZVA 2WXMA