1UATA

The significance of the flexible loop in the azurin (az-iso2) from the obligate methylotroph methylomonas sp. strain j
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
129
structure length
129
Chain Sequence
ASCETTVTSGDTMTYSTRSISVPASCAEFTVNFEHKGHMPKTGMGHNWVLAKSADVGDVAKEGAHAGADNNFVTPGDKRVIAFTPIIGGGEKTSVKFKVSALSKDEAYTYFCSYPGHFSMMRGTLKLEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin iso-2
publication title The significance of the flexible loop in the azurin (Az-iso2) from the obligate methylotroph Methylomonas sp. strain J
pubmed doi rcsb
source organism Methylomonas sp. j
molecule tags Electron transport
total genus 32
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2003-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1uatA00
1PLBA 4E9VA 1XB6A 1JOIA 1NIEA 1NINA 4HCFA 2HRGA 4YSRA 2OCCB 2I7OA 1FFTB 2HX7A 1SFDA 1BQKA 2MTAA 2YAEA 2Q9OA 2Y69B 1ZDSA 3S3BB 1EHKB 3NYKA 3ABGA 3ASOB 2XV0A 1KCBA 2YAOA 3NJFA 3H4HA 2GIMA 2BHFA 2HX9A 1NWPA 2FJSA 3WI9A 4YSAA 1ID2A 3EH4B 3L45A 1OV8A 5B3SB 5TK4A 4N4YB 2VSKB 2GC4C 2XX1A 2BZCA 2IDSA 4AZUA 4JKNA 2EIKB 4NAJA 4HHGA 2HXAA 1MZZA 3EF4A 2DYSB 5I6PA 1ETJA 1JZFA 3BVDB 3ZX1A 2IWKA 1AR1B 4G70B 4YVUA 2R7EB 2BP8B 2IWFA 4E9QA 5I5JA 4F2EA 2B3IA 2VSMB 3D12B 1E65A 4YVNA 8PAZA 3JT2A 1CC3A 1AANA 1CURA 4WKXA 4JHVA 2ZXWB 3FSVA 3AG4B 4HAKA 3WIAA 1WS7A 3CVBA 4UANA 1L9TA 1A3ZA 2FQDA 3TBCA 5B1KA 2VW7A 3CDZB 2GI0A 1GW0A 1GYCA 4E9XA 1QLEB 2YAMA 1A4AA 4FAAB 5I6OA 1N70A 1I53A 3ABKB 2JFCA 2JXMA 4CSPA 3ZDWA 4F7KA 1FWXA 2PCFA 2XX0A 4L0PB 1GS6X 1WAEA 4DP7X 2TSAA 2DYRB 1URIA 1UATA 2B08A 2VM4A 3AZUA 5A7EA 1AZCA 4AX3A 4DP9X 2IWEA 1L9QA 2R7EA 4A2GA 2HZHA 4YSSA 5I6LA 1W8EA 1ZV2A 2BP8A 3OM3B 4UF7C 5AZUA 1DZ0A 2UX6A 2PPDA 2BW4A 3WNJA 1E5YA 1OCRB 2W88A 3FYIB 4BWUA 3MBWB 3AG2B 1F56A 1RZPA 1JVOA 3FU8A 2HRHA 1OE2A 3CDZA 2AVFA 2WO2B 1KYAA 3NJIA 3NJNA 1TEFA 3FQ1A 5LDUA 4ENZA 1IUZA 2GSMB 5F7BA 2YXVA 3FPXA 3G5WA 1PLCA 3IN0A 1CYWA 2YAFA 4KOCA 4QLWA 1A8ZA 1L9SA 3FT0A 2IDUA 4K9JA 4WTQA 3PAUA 4M3HA 3UACA 3OMAB 3NP4A 2DY2A 3FU7B 4CSZA 1ASOA 3SQRA 1HAWA 1PNDA 3FQYA 1PCSA 3WKPA 1SDDB 4NERA 1GS7A 5D4IA 1MZYA 1E67A 1JZHA 2EIJB 3X2QB 4EF3A 2XYBA 1DYZA 2HX8A 3FU9A 1JVLA 3ABMB 3GYRA 3IEAA 1AG0A 4HZ1A 1A4CA 4E9YA 1KCWA 2IH8A 1IC0A 4KO5A 1PZAA 4N8UA 4FA7B 2NRDA 2QDVA 4DP1X 2FT8A 2FQGA 1E30A 1ZIBA 1B3IA 3ZIYA 4Q8BA 2TSBA 3H4FA 1QHQA 3WNIA 3N2JA 1KGYE 2RACA 3IBOA 2GBAA 1ASQA 4YSPA 1KV7A 4YL4A 1V10A 9PCYA 1BXUA 2IAAC 3T6VA 3N55A 4AI7A 1KDJA 1NZRA 2XXGA 3FSZA 1X9UA 1BQ5A 1NWOA 2H3XC 5B1AB 1KBWA 3S3DB 2BWDA 2Q5BA 1WA0X 2P80D 1J5DA 1OE3A 2BWIA 4A2HA 4BXVA 2FQEA 4DPCX 2WO3B 1AACA 1J9QA 1OCCB 2VN3A 2FT7A 3OMIB 1JXFA 1AZBA 1IBZA 2XUWA 2BP0B 4ZK8A 4E9WA 3EHBB 1SDDA 1E5ZA 3FSWA 4E9RA 1AG6A 1X9RA 2XXFA 3RYMA 5ANHA 1ET8A 1CYXA 4MFHA 1RZQA 1KDIA 3NJGA 2EIMB 3PPSA 3TU6A 3UADA 1A4BA 4E9SA 2XLLA 3H56A 4YSCA 2GHZA 1TEGA 3NSYA 2GC7C 4UAHA 1WA1X 3X1GA 5FC9A 1HAUA 4A67A 1NICA 2YAQA 3OMNB 3SBRA 3KW8A 3FYEB 5I6KA 1PNCA 3C75A 4P5SA 2GB2A 4F2FA 4PAZA 3QJTB 3NJKA 2E86A 1L9RA 5I28A 1GY2A 6PAZA 2PPAA 3NP3A 1IBYA 1OOWA 4GP5B 1ZPUA 3AG3B 2AZUA 1BQRA 2YAHA 4A66A 2FWLB 4W1TA 3T6XA 2OJ1A 1SJMA 3NSDA 2AFNA 3QJQB 4KOBA 2UXTA 2BW5A 4P5RA 1OCOB 1J9SA 3AY2A 4GP4B 3AW5A 5B1BB 4DP2X 4G7QB 4DP0X 4DPBX 4DP4X 2BP0A 5I26A 4E9TA 4BDVB 2XVBA 1HFUA 4DPAX 3BQVA 2XV2A 2VW6A 2H5UA 2ZOOA 4BK5C 1EZLA 3OD3A 4GYBA 1SHXA 5B1JA 1ILUA 1YLBB 1TU2A 2XWZA 4KNTA 4DP5X 1W6LA 1ADWA 1SF3A 1ZDQA 2CJ3A 3QJVB 4AKOA 2MRYA 1SHWA 2XV3A 1AZNA 3NSFA 2IDTA 3ERXA 2DWSA 2PLTA 5PAZA 1JZIA 3UGEA 3MX0B 1QNIA 4BWTA 4PCYA 3T6ZA 2I7SA 1NIAA 3SBQA 4GY4A 1M56B 1JZEA 1PZBA 1XMEB 1L9OA 1ZIAA 1JXGA 3AG1B 4YSTA 1WA2X 4YSQA 4W9ZA 4HCIA 5B1JC 2YAPA 1SF5A 3QJRB 2J56A 5E9NA 3FS9A 2WSDA 3HB3B 4YSUA 1V54B 5B7MA 4HALA 3CVDA 1AS6A 1IKOP 4G71B 3PXLA 4BDVA 4BWWA 1BYOA 3WG7B 2DWTA 3NSCA 1KBVA 5F7AA 2AANA 3TBBA 3HEIB 3S8FB 3PAZA 1XB3A 2OV0A 3TASA 4A2EA 4GP8B 6PCYA 1FA4A 4AKQA 2X87A 5TK2A 4M4RB 1NPNA 3GDCA 4A68A 1JERA 4JHUA 3IN2A 4QKTA 3ASNB 1OF0A 2CAKA 3NJJA 1ILSA 2VW4A 4KO7A 3ABLB 5B7EA 3PLYA 2X88A 1AIZA 5B7FA 2H47C 4Q89A 1PY0A 1W6WA 3T9WA 1BXAA 2XU9A 1BYPA 3V9CA 2FQFA 2QPEB 4G72B 3WKQA 5I6MA 1JZGA 1CUOA 3FU7A 1NPJA 1OE1A 3NT0A 5I5IA 3T71A 2PP9A 3DIVA 1MG2C 4DP6X 2AZAA 4HCGA 4YSDA 5D4HA 1VLXA 3QPKA 2CUAA 2PP8A 1L9PA 1T5KA 5AFAA 4HHWA 1R1CA 3DTUB 3X1NA 3V9EA 1PLAA 7PAZA 2IDQA 2CALA 2UXVA 3EH5B 3QJSB 2PPEA 3EH3B 1SFHA 3OQRA 4YSOA 1M9WA 3CVCA 3QQXA 3X1FA 5D4JA 3UABA 2UXGA 1AS8A 3IE9A 3NJMA 3X1BA 1V55B 5PCYA 3SBPA 1PF3A 2EILB 4KNSA 4KO6A 2FNWA 1BEXA 2IDFA 3PAVA 1GR7A 3UAEA 1RKRA 1J9TA 1NIBA 1NIFA 1BXVA 2Y1AA 2VMJA 1GY1A 1N68A 4AKPA 3U25A 1RCYA 3S3CB 2YARA 3S8GB 3TA4D 2BZ7A 3FPYA 1GS8A 2QT6A 1MG3C 4A2DA 1GSKA 2BO0A 3ZBMA 1AAJA 2PPFA 2PPCA 2EINB 5I6NA 2CCWA 1ASPA 2J55A 3NJLA 4BXSV 3JTBA 1NIDA 4GXFA 1ET7A 2YQBA 1BAWA 2N0MA 2FT6A 1AS7A 4TXVB 3X1EA 2A3TA 2IH9A 2CBPA 1OCZB 2PCYA 2DV6A 2J57A 4HIPA 1PAZA 5I5MA 1A65A 2UX7A 3CG8A 1AQ8A 1XB8A 2JKWA 2PP7A 1NDTA 1ET5A 2YXWA 4X4KA 1NTDA 1AZUA 5IY5B 1JZJA 1AZRA 1J9RA 2UXFA 2FTAA 4A2FA 2QPDB 2I85A 2QDWA 3QJUB 1SNRA 3GXUB 2VM3A 4YSEA 4KNUA 3NJHA 1J5CA 2LLNA 2W8CA 4RH4A 1WS8A 4NB7A 4KO9A 1M57B 4G7RB 3PCYA 2ZONA 5EHFA 4DP8X 3DKHA 2ZWNA 1PZCA 1JXDA 2HLEB 1MDAA 3FQ2A 3UAAA 5AKRA 3CZUB 1AOZA 2P80A 3T6WA 2J5WA 1TKWA 4G7SB 7PCYA 1PMYA 3FSAA 3KW7A
chains in the Genus database with same CATH superfamily
2GCYA 3T0EE 3EADA 5HDRA 5TQ0H 2H26B 2VZ1A 2VABB 5T3ZH 4EBQL 5DVOA 2MTPA 4L5FH 5DGQA 1D5BA 2OMZB 3VXQB 4D0DB 1HHHB 1FVCA 2I7OA 3MRJB 4MQTB 1XAKA 3L3OB 4U6YA 4KITB 4MWFA 4Y4FB 3HHSA 1ZSDA 1QW8A 1SY6L 2P5WB 2UUDH 2W5PA 4N87A 3VD5A 1OM9A 3GXDA 2CLVA 5D7SL 5C09B 1G7MB 4XE5B 5IJKA 4HK0B 1G7LA 4HLZH 1R5VA 3K71A 3PHSA 4KJYA 4RAHA 3H9ZA 4WW1B 3DX1A 3EOAB 5KVFH 3Q2CA 2HSIA 2BY3A 3B9KD 4UDUA 1LL1A 2BZCA 4TV3A 3JYBA 4AQEB 4BHUA 5JNYB 1FIGH 2GEEA 4DTGH 4HD5A 4XH2A 2H0FA 4LRIC 5AEAA 4AMXA 4YIQB 3C09C 3FU3A 1QBML 3DTDA 3IDXH 4IS6B 2HN7A 3HG1E 4OCSH 5IG7A 2GVYA 3OX8A 1KIRB 3FQWA 5I71B 2OJEA 5KANG 4EI0A 4P5MB 3KPOB 3UTTD 4Q9QL 4GB9A 4P5KB 4JO1L 3T0DA 3RWEA 5ACZB 1USZA 1T1WA 4QYAA 5KSBF 4LCYA 1JXKA 1BOGB 3QUZA 5KVGL 4MKMA 3REWB 1C5DB 1Z5LA 2F54A 2Q76B 2QVFB 5EO9A 2V8MA 3D7PA 5DR5L 2PTTB 5I6OA 3ASWA 5DFAA 4I77H 1PKQE 4MA7L 5L4MA 2JXMA 2UYLB 3ABZA 3BUYB 1UM5L 2D3VA 4RFEA 1NBVL 2OZNA 3UBXB 2YD4A 1MW1A 4MNQB 3RTQA 4Z7NF 1VEOA 2VITB 2D7MA 2VE6A 4JRYA 2K3TA 1OAQL 4YC2C 5ALCH 1C8QA 4HJ1A 1E7UA 3VXOA 5KEZA 1MUJA 2WVUA 3VD3A 2OJZH 2FUQA 1LO0L 2R51A 4XN9A 5IHWA 4XGZB 2F74B 5D5MF 3JQOB 5I1DA 4FQHA 3RAJL 1O5DT 3ROLA 3IGAB 1F90L 4FL4C 4PV8A 3OM3B 1RUAL 4QRBA 2J7LA 1P7QB 4UF7C 3NSJA 5GS1C 2WXNA 1N5AB 3PREA 1TMCB 3U9PL 1DVZA 4H26A 4EKJA 5E1QA 1DANU 2VTFA 4I7ZC 2XETA 1GMIA 3VI3B 4ANXA 3QAQA 1RZPA 4WSKA 3ZKQD 7FABH 2QZ5A 1BEYL 1NEPA 2NY5L 5EU6D 3BGMA 4R7NA 4KI5D 3QDJE 3OC5A 1MPAH 2EDRA 2NW2A 3OC8A 4JN1L 3WIIH 1N59A 2GY7B 4Z7UA 5JXEA 1LM8V 4CL7A 1O9WA 3MRPA 1E5AA 1GGIH 4CILA 1OL0A 3AUVA 5C1MB 1K8DB 1XCTA 4OZGE 4AL8L 4PS7A 2P9RA 1HJBC 3JTTB 4U4BA 1DQTA 1KBKA 4PJGA 3T3PF 2VRQA 5HPOA 3VXPA 1FYTE 3IJSA 3NQIA 3OMAB 2OAAA 2DY2A 4PJ8D 4CSZA 4M6NH 4KTDH 1CDBA 3RDTB 4NJ9H 4WI6A 1PNDA 4I1RA 1J8HE 1E4XI 3BISA 2EDFA 2KBGA 1D7FA 4DKEH 4NERA 2BS8A 2VQ1A 4K5MA 4OQTH 3LYRA 2GYSA 3Q8BA 5GJSL 2K6YA 4F9PC 3MNDA 5MP6H 1YO4A 3D0AA 4K55A 3K46A 3O45B 2H41A 4LPWA 2COQA 4ZTOL 4HQQL 2FQGA 5JHBA 1M1XA 2OTPA 3KDPB 3SIKA 6CGTA 1H3PH 2ZQKA 5ESQB 3U6XA 3V6ZB 2YK1L 1SEBB 4BYHA 1TJGL 2Y7OA 1DQML 2OMUA 1MQ8A 1SM3L 2B4CH 1BXUA 4FJYA 4W9KC 1W72L 1U4EA 2JCCF 4M5ZL 3ZU8A 4N8CL 4L29A 1X9LA 3CJJA 1TPXB 3GT6A 4ZUTA 3QORA 5AB2A 3CVHA 1X9UA 2V37A 3FSZA 2ZX5A 1U8OB 3F7VA 4HULB 5AALA 4JAMA 5CGYC 4TLTA 1ESOA 2WSKA 4LAJH 1X5GA 3QZWA 1U8JA 3ILEA 1HI6B 4M6OL 4WWPA 3DXAD 2A6JB 1ORQA 4K0OA 3D0LA 1AACA 2F53A 4YO0B 4HJIA 4R5VA 1G7QA 3PF2A 3OR7B 2IG2H 2ODIA 3BPCA 43C9B 4IBLT 4BSJA 2ED9A 1OSZB 4E9WA 5LVEA 3TWCL 4YXHL 4HU2A 1X7QA 1XGQA 3L7EB 1O7DC 4JM4L 3WGUB 3US1A 2WXFA 2I69A 4ZS7L 3RYMA 1CYXA 2V17H 2XC8A 4IOFC 4W9IC 3ZDXE 3DO7B 5ITFA 1JPEA 1E28A 2N7BA 3ESMA 2EAEA 4Q4IA 5DVMA 1OP5K 3WNLA 1T4KB 4OY9A 3VE0A 4WIQA 3GLDA 4RAUB 4G1MA 1NFIB 2XWXA 5HGAA 1CBVH 4MDJB 2A2QT 1RI8A 3FT2A 3LH2H 3RVUC 3SY0B 2D7TH 4A67A 2EIDA 3LZFH 2V2XA 3ARGD 2OYPA 4EN3B 3IXTB 5C07B 5JQ6H 3VFTB 4QKXB 3PWVA 1R9FA 1QG3A 1VFUA 3I02A 4HIJB 4O51A 4G2AA 1KF9B 5CJ8A 2A6KA 4KY1H 4EBQH 2HH0L 3VXRE 4DIXA 3RJOA 2ICWJ 2BNUB 4NUQA 3BIKB 5EEXA 5D7JA 1XGYH 5CD5C 3R1GH 1HX0A 3CFNA 3TH3T 5HJBA 3V4PB 4ESKA 4W9GC 2UXTA 1BQHA 2JKJA 1UOLA 2WHVA 4AMWA 3IB4A 1P7BA 3KM1A 4DP2X 2DYPD 2VKXA 3DVNA 1I85A 4FS0A 1ERNA 3IJEB 5H37G 2Z8VC 2BRQA 3WXWH 4IKKA 4YL9A 1YC8A 1S78C 4XCEA 1TEYA 2JNZA 1FNEA 1NAML 2H5UA 5GRXG 4NJAL 3C09B 2OL3L 4XCYB 4HJJL 4KRMB 5J6GB 1MJJB 5ICYA 4L3FA 4XVUC 2XWZA 1SF3A 1ZDQA 3GI9H 2HFGH 3MV8E 4HPYH 4WJ5A 1DZBA 5J1AA 4NOBA 4F33A 1DEDA 2F7OA 5I1GH 1DN2A 4GUPA 2Z34A 1SLXA 4PN6A 3ATFA 3FJTA 1U41A 1I3RB 1F6FB 1NJ9B 4GI6A 4N1EA 4P9HL 1MH5A 1NC4D 2WANA 2X4SB 4PCYA 4Q9QH 1MCDA 1ZANL 3WAKA 2WLLB 4GKZA 3TBWB 1JZEA 4HIQA 3AT0A 1SUHA 2RH0A 1CICD 3II3A 3HAEA 3T4YB 1UD2A 4KKRA 5AUMA 2HG0A 3AG1B 4P2QE 4G8GB 5KVGH 1I3VA 3LEVH 3T65B 2DWYA 3NIGB 4XAKE 1GPOL 3QUHA 2DQGL 5L4JA 4Y2DC 4WCYL 1RZJC 3BWUF 3VYOA 5HHMD 1BZQK 3BEVB 4PJ9D 4YC2B 1R3IH 2X41A 4MA7H 1OSYA 1HK6A 3FCTA 3DUSA 4XNQA 2BOLA 1FFOB 4GIAA 3D30A 5F1NB 3D2UB 5E0QA 3QXUA 5HD8C 2QVMA 1FA4A 2Z93B 3CZNA 4JZJB 3LVTA 4RSYA 3AXLB 4FL4B 3KNBB 1F1AA 3HE6C 1X5JA 3A67L 4X50A 4GBXC 5GS1B 1LK2B 4FMFA 2XFGB 2XTJC 4KO7A 1ITBB 5E23A 4TVPE 3ABLB 2GI7A 1H0DA 1AIZA 4XVOA 2WOYA 4MD5A 1F90H 1RUAH 1M53A 5IWLA 2QQKH 1ONQA 5GZNA 4PJ5A 5CGTA 5EWIL 4YZFE 4OLVL 4UT6A 3CN0A 4GQRA 3S97C 2FSEB 2UZIH 1FPTH 4Y7MA 5IM7A 2G60H 4U6TA 3WIHL 4MYPA 5DJYA 5EO0B 3UC2A 2NDFA 5GISL 2PP8A 1L9PA 1N8ZB 4KI5F 1FBIL 3ARED 4OF3A 2BY1A 3SDXA 1WZMA 3DTUB 4XRCB 1YEFL 5JDJA 4F27A 3KDMB 3IPFA 4ZX5A 4UOQA 4AQ8A 5INDB 3EG9A 3UO8B 5I74C 3UEZA 3BFQG 3V0VB 5KYWA 3Q44A 4NQCE 3X1FA 4Q52A 3DGGA 1U8PB 2TRHA 2P48B 3NJMA 1WZ1H 3BMVA 4H1LH 4OU3A 4DAGL 4LPYA 4LVEA 1H15A 2ZD0A 5D1XC 4PB0L 2IDFA 2WNXA 1G9NH 5F9OL 1RKRA 3SJVE 4XCNB 3QZNA 3SE3C 4XNZC 3SGEH 4NWTL 1XBRA 4L3EA 1CLYL 1GY1A 2VH5L 1K5NA 4FQLL 3LEXB 3UPAA 5ID1A 4KVPA 4WTZA 5E8PA 1NEZG 4OF5A 1UKSA 3B2MA 4OCXH 4Q0XH 4AK1A 1UB5B 1PZSA 4LSVL 3O8XC 1Z9PA 4FJZA 3QT2A 3WJMB 1R46A 3QO0A 1IEAB 3LKNB 3Q8FA 2K9UA 4HEMA 2N0MA 3PL6A 2CPCA 1AS7A 2VLLA 2W38A 3E3QE 5K9OA 2FWOB 5LDSA 1A65A 3CG8A 3DI2B 1ZS8A 5E6RB 3QEQE 1ZHLB 1IU1A 2J2ZA 4HJ0C 2G4EA 4I85A 1W72H 5DMGD 2VDNB 1VFAB 5BOZG 3AM8A 2W0KA 1KN2L 4Y4HD 5L9DL 4AYBA 1YA5A 2H8PA 5F3HB 2ZNWA 3ARWA 3OKOA 5FFGA 1NFDE 2A6IA 5EBMA 5GS2D 3SKMA 4XOAA 4IK7A 5DD0L 3OB8A 1WS8A 4RH4A 3UZQB 1B9ZA 3L8QA 4H5SB 4DGUA 4UNVA 4J3XA 2ZONA 1P4BH 5F6HI 3PABA 4NAMA 3UYOD 4DP8X 4NZTH 2EIZB 1KEML 5C92A 1IIIA 1U92A 3NIFF 1K2DA 2JTDA 1FL6B 4N24A 3E0GA 1OGPA 1GZPA 3MO1B 3QZPA 1RJZB 3G3LA 4QRSB 2VMCA 4N3UA 4NSKA 5DZOA 4MAYC 4R5TA 4CADB 3LPWA 4HFUL 4MX7B 1FNSL 4U7KA 4QAMB 1I8KA 2FAUA 5BO0D 1UOKA 2OCCB 1DJWA 2GEQA 3FONB 3ECVA 1CU4L 1G9EA 2WLNA 4P4RA 5DJCA 4Q56A 1VB9A 3KPMA 5SWZE 2J8UB 5HDBF 5IVNA 5IIEB 4BSWB 2EVFA 3GRGA 2HH0H 1DFXA 3FTVA 2LR4A 5FO8B 1N19A 5GS2H 3PV7A 4MS6A 1UZGA 4TQPA 5JHDB 5AWNH 3U83A 3CDGB 3P54A 4OZIB 4JG5A 2VDKB 3VXPB 2EZ0D 3KWWB 3AADB 1RUPL 1BLNA 1UWYA 2EIKB 3VCLB 1N3NA 3KHOA 1WV7T 2CE6A 5D7IE 1UWFA 4X4XA 1P0SE 4DKFH 5DK0A 2OL3H 2J1XA 5B39G 4FGMA 1LNUB 3R0NA 4ZXBC 3NZHH 5B8CA 2GTZB 2VSMB 2W1NA 4PRNB 2DMCA 1MJ8H 1RZFL 3QFDB 1F2QA 3B9VA 2ED7A 1IAOA 3SDDC 4C4UA 3OV6A 5HGDA 3ILQC 3GLZA 4MAUL 4J1UB 4U49A 4XWGH 1A3ZA 3C87A 4OJAA 1ZK5A 5IMMA 3CDZB 1ZD6A 1ZANH 1VZIA 1IKNC 1QLEB 4Y2DB 4F7CB 3GQFA 1N70A 2JFCA 5J9PB 5DDHA 5K93A 4O9HH 5KSBA 4LL4A 2VLJE 3SE6A 4YNYA 2QFPA 4PGBA 1GS6X 2CDGA 1FO0L 1QRNB 4KH9A 5AOIA 3ZZ1A 1FDLH 3BDYH 2WTOA 3NCXA 4PQXA 2E46A 2IALA 2JE8A 3OPZL 3QIBC 5TH2B 4DZ8B 4FFWD 1YPZB 1J05B 5SX4H 4LARH 5AD0B 5F8QC 3BT2L 5K59F 3J7HA 3FO1A 2M8XA 3ME0B 4PRPB 1ZXKA 2GFBA 3HE6B 1UASA 3L3KA 4IKIA 4GBXB 2C3GA 5BS0B 4ODUA 4N2KA 5JOPE 3V4VB 4XN1A 1CG9A 1S9XB 2XTJB 3RX7A 1JGIA 1B6DA 3KZ8A 5AKTA 1MRDL 4YFLF 1XQ4A 5E8NA 1M6OA 2UUDK 4NKDB 3A67H 1IGFL 1OT2A 1EAJA 1CFTB 1I1CA 3S96A 4E9LA 2C9VA 1G5GA 2ADIB 1PD0A 3GSNL 4FFZA 4TNVK 5D5MA 5IFHL 4ODHL 3FU8A 5T1LB 3AAZA 1DBMH 4Q6IA 3MFGB 5CBEA 5FECA 1G6RH 1WWCA 1AH1A 1K8IB 4N6QA 2X9YA 3GXFA 1UUNA 3P4MA 4X9YA 3ZSSA 4R4FL 3LZOA 2C9AA 2VLKB 4R7XA 7CGTA 5IVZA 1MDTA 2KL6A 4P4KA 5DZJA 1Y0LA 2IAMC 2BP5M 4TQ8A 4H8QA 4NO2B 4NZUH 5I74B 5I1KH 3TCLA 4PCKA 5ANMB 3Q5TA 3IU4H 4E5XB 2WINB 2ZXCA 5GGSY 1T6BX 2HPTA 5IBUB 1ZHNB 5FOBB 5IHZB 2BVPB 4S1DD 3L5WB 5E6ZA 3SQRA 2D7NA 1F4HA 2KQNA 2ZPKL 4OGQC 4XNZB 3D3VA 4OFDA 1F1GA 2R69H 3GXNA 5LN4A 3IXAB 3P9LB 3EYUH 3MBED 2OLDA 4Y0GA 5FGRA 3HE7C 2BHUA 2R2HA 5FM5O 5F9OH 5GGVH 5ILTL 4GJTB 1QI3A 4OZFA 1O6SB 4YAQB 5ESAA 1DQJB 2QADC 3O8XB 4GUCA 2NRDA 3LMJL 4FXKA 4LPTA 4ZOEA 3V6BR 2W0PA 5F88A 1UCBL 5E2WL 5IVOA 4NDMB 1AO7A 4WI0A 3THMH 4ANWA 1UA3A 4G6FB 1CK0H 1ETZB 1MJUH 4Z7IA 4F37F 3BH9A 2QSTA 2GK0B 3FU5A 2CKBH 2DM4A 4IOSA 4TRPL 5CINL 3D69B 2VDPB 9PCYA 1RMFL 1LVEA 3IVKA 3FUDA 3SQBA 4V2CB 4PV9B 3VWJD 3DTXB 3V0GA 3DA0A 2X2UA 1TJMA 4PUBL 2APSA 1XH3A 2H3XC 2XQBL 1OWRM 1WA0X 3FTUA 3BPNC 1OTSC 3F2LA 2NQDA 4P2OD 2YOAA 3PUCA 4TQIA 4A2HA 5AL8A 3WNKA 3KPTA 3L3DA 5DJ8B 3C5ZC 4Y2NA 3Q43A 5EB9A 3WE6B 3NFSL 2JCCA 1KN2H 2BNRD 2DICA 3FTZA 4ZW5A 3CFUA 4O02H 5D2NA 3IMBA 1OLLA 1S7RB 2IAND 2WW8A 3DDFA 4M5SA 4BH7A 1OK0A 1X9RA 2O5YL 3HN3A 4QPEA 5EIIB 1M05A 2F58H 4KQ4L 4ZTEA 4KJWC 3IK2A 4PG2C 2I9TA 2EO9A 3DHPA 2RJMA 3MRCB 3OZLA 3UGXA 4AEIH 3H56A 5DRWB 2JJTA 3K7UA 5T5NG 1TEGA 2FJHA 1IVTA 2CH8A 4I0PC 4MAYB 1IAII 4MA8H 4IDLA 5IB5B 2AI0L 1KEMH 3HS9A 4Z3HA 4Z3JA 5HDQL 5IVXF 5LNGA 1XF1A 4XMXA 3LV3B 5IOPA 5C0CE 4P5SA 2X4RA 3CLFL 2BZDA 1EO7A 1EO8L 2VXQL 3BUIA 4HS8L 3VJ6B 3RUGB 2ZP0T 4BHUI 1F97A 3UP6A 3OXSB 1N6QL 4AJYV 2A0LC 3KPSB 4HS6B 3NABL 1ZT1B 1BVLB 3DJRA 1EEYB 4L3CB 4PR5A 1U8HB 3HI5L 4UM9A 3CTTA 2AMUA 5AVVB 5ITBL 4OIAA 3RX8A 3CFBA 3QJQB 1DUYA 3SZ6A 5ERWB 3WGVB 4Z3IA 7TAAA 4Z1PA 1RK0A 5HHQB 5HYSA 3NCYS 3HRZC 4ATWA 3FFCE 1EFXB 5I8OL 3TX4A 4MCMA 1XSKA 2MCPL 4N6RB 1CXFA 4BUGA 3H54A 4BK5C 1SHXA 3VFVB 4FG0A 3DPBB 2KH2B 3QCVL 4AM0A 4AQAA 5H94B 1W6LA 3DC0A 2R8SH 4ZXBB 4IW4C 2B2XH 2E4FA 1T3FB 1U8LA 3ERXA 5KVEE 2JKSA 3WNPA 2O5XL 4AIZA 5ENWA 4JDVA 3SDDB 1QBLL 4RIRA 4AGLA 3B9KA 3US9A 1CL7L 1DHKA 1XF2A 2AQNA 5C3IA 4WNJA 1RZFH 3GNMH 2YD0A 4QT5A 4RGOH 1CE6A 4KZEH 3DX6A 4M1GL 1JGDA 1YG9A 1H6UA 4A2LA 1LO2L 1TCRA 2AQ3A 4TUJA 2E56A 1CYGA 2HVBA 3UTTA 1DFBL 1JZDC 4BINA 1B88A 2J56A 3BQUC 4FNLL 4UILL 1TTFA 4D3CL 5CKAA 3EO9H 1PFOA 3CVDA 5K5YA 2DD8L 2JKIS 2WTRA 3QIBB 2IGFH 2ZWYA 3IFPB 5E6ID 1HKLL 3GIZH 4C4BA 1UWXH 4F7PB 4UQ3A 3A4FA 1HZLA 1TZGH 1HQ4B 2XN9B 3CXDL 3HPJB 3CSGA 4HUXB 4IDJL 3W0WD 2IOIA 2OFQA 2VXSH 4NC2B 5E5LA 2C3HA 1K4DB 3RFZC 1JMXA 3A6CL 1JDAA 3CK0H 4GKLA 3WFBL 4C4KO 5ACLA 5J1TC 5DURB 1COBA 3BT2H 2PXYC 1G0YR 4BJLA 2UV3A 3EFFA 4YGVB 4NI3A 5E99L 4ADIA 2ZCLH 3O11A 2WZ5A 4Z77A 2ZCKH 3DBXA 3TNNA 5B7FA 1CFQB 4AVJA 4POZC 1IQWL 5JW4N 3JWDL 1TFPA 1BM7A 4G72B 5E1IA 3QQ3A 3FT3A 5E6YA 1U8IB 4WSGA 1IMHC 4RESB 3T2NH 3S3PA 1MFCL 3ARSA 3BRFA 1FNFA 4PLJD 4UTAA 5I5IA 1IIKA 2X0UA 2P24A 2ZKXA 1MG2C 1HOEA 1SJHB 2BSRA 3BVNA 4QHLA 1R47A 3ARBD 1GJWA 4OLEA 3RVXC 1ZKAA 3NN8B 5CP7A 1HKFA 4ODHH 5IFHH 4MS8D 1CIDA 3RJDA 5ICZB 3EUDA 4UBDD 2IAMB 2OXHA 4D9LH 5K9JH 2Q7YB 1QEXA 4OQTA 1TTRA 4WNSA 4R4FH 4ALAC 3FU6A 4L8CB 3EJYD 3DUUB 2IBGA 1NCCL 3U46B 3BW9B 3PV6B 2I60H 2PNDA 5E4EC 1WTLA 4WNQA 4H20L 1UGKA 3RIAF 4PBWD 1RULL 3B1UA 4X8GA 3SPGA 2VIRA 5EU6A 5A3IC 1A0QH 1TTUA 3ZDYF 3DHMA 4JRXD 2ADYA 2ITDA 4QD2E 5C08E 3GZPA 4AENB 5GGTA 1FL5B 3BKJL 3QHZL 2F2HA 4LLMA 3GFUA 4A2MA 4NUGH 2DLFH 4U1HB 3HE7B 2A9DA 1I3GL 2XIDA 1JPSL 4GMSH 4H8WC 2CU9A 3BYTA 3NPZB 5CCHE 5IFJA 1Y7VA 2YS4A 3FFDB 4JHZA 5C6WH 1D5XB 2C7UA 2YARA 3VA6A 1AKPA 2QADB 1B4JL 4ZNEA 4M61B 3JWOL 5FYKU 3X3FL 2WXGA 3QDME 1R17A 2FZ3B 4HIIA 4PJ8A 2E7DA 5B1CA 2FHFA 3X14B 1GGBL 1TVHA 4WDIA 3LMJH 5F89A 2G2NA 2APVA 4AG4L 1JI2A 4UT7L 3G5VA 2A3TA 3AROA 4P3DB 4ZUVB 4JQXC 1BZ9B 4ERSH 2PP7A 1NDTA 2Y72A 1ZVSB 2ZOLA 1KYOK 4Y19D 5DO2C 4A7GA 3BPNB 1MHHA 1RMFH 4JQVA 3BLKA 2DDQL 1BFTA 2WXOA 2QDWA 1ZA6B 4KMTL 4MCZA 4PUBH 3EJJX 3FOMA 3C5ZB 3JZ7A 2BX5A 4U1MA 3VI4F 3CN2A 4HUVB 3I2CH 5HI3D 4LDLB 4PIBA 1C08B 4OFVA 1WAAA 2HKHH 4PRIB 3TA3B 2OSYA 4IQHA 3U2SB 1OGAD 4BFGA 3OTTA 3TZVD 4F2ME 1F58H 4ANKA 4XBGA 1URLA 3CC5A 4QWWC 1UD8A 4BUQA 3IFOA 3QUYD 4LEXH 3ARDD 2DW5A 3L95B 4I0PB 5AKRA 2R1XA 4TOYH 2J5WA 3DXAA 1FZMA 5SWSD 4CKQA 4KQ4H 4ZYKA 2AKRA 5DJAA 1N26A 3HZKA 1KC5H 2L4OA 4JFYB 1TYEB 2BOCB 2YGOA 1T6WA 1UB6A 4FNTA 4YSRA 3HMXA 4ZS6D 3CHQA 4YDVA 2WQSA 4PHXA 3U1PA 3MLZL 5CZXC 3RWFB 5INCB 3MAWA 4OBSA 5A2LH 4QRRD 4DK3A 3LKQA 1B0GB 1QFWH 1J1PH 3ARTA 4HS8H 2ZWKA 5FXCH 1UZ6E 4UOW0 1UACH 5F9JB 2KS0A 3DRQA 5I1AB 2BHFA 3CFCH 1N6QH 4LOUD 2JWYA 3I9PA 3MVSA 1BHGA 1OV8A 5GGRY 3ZRFC 1T5WB 3HRZB 3ARGA 5D2LB 5B3SB 1MCBA 4L4JA 1IGML 2NTSP 3S34L 2DQFB 2WXHA 3I6SA 4C56E 3NCMA 1HHIB 1WEJL 5HHVL 1DP0A 1TJIH 4Y9EA 1YAZA 2XPGB 1JNNH 1Y6NR 1PJWA 3K8KA 1A7QL 3MRHB 4J2QA 3LAFA 5HI4D 5H35B 1AXTL 2H2PD 2YUZA 1KIPB 4YWGL 2MCPH 4O5LL 4FG6D 5CEZL 1EBAA 1UXWA 3OKLA 4NKQB 3T6QC 1S7TB 1T66C 2DYPA 1A7PH 3T0EC 2EE0A 5FDWA 2OMTB 1ACZA 1OSPL 1M42A 4U3CA 2E27L 5BO1L 3WENA 2WWKT 3V0WH 5ADPH 5EZJB 4ZFOL 2UWEB 4LNVA 5HGGS 1I1FA 3FSVA 3VXNB 1M2VB 1XZ0A 3F05A 1E5CA 3QCUH 4ZDHB 1TMQA 5B1KA 2B1AH 1F4YL 4Q2ZB 4WTXA 4A38A 3CZSA 4H0IA 1E9PB 3T3MF 1AJ7L 4OFIA 4MJ5B 3BQUB 2QL1A 2BRRL 2YEQA 1OPOA 4GH7B 4HC1H 5IB1B 3L3IA 4M1GH 4Z7OE 4N0RA 3O41B 3PHOA 5DJ2B 5H37H 1L0YA 2HFTA 1G7HA 4OAWB 4G6ML 1NC4A 2CNYA 4L4TE 1QLFA 4LNRA 3C6LD 3LKSB 3BGFC 4D3CH 3UROR 3SO3C 1CICA 2DD8H 3CFKB 3RFZB 2X40A 4O4YH 4MNGA 4F37K 1CVSC 1OAXH 1YNTF 4KJQC 3TH2T 4A6YH 4DP9X 5EPMB 5DTFA 2PXYB 3VTTA 3WL9B 1C12B 4YSSA 4R84A 2XY2A 3KPRE 3UO1L 4IMLA 4GXVL 2VR5A 3A6OA 3R19A 4PJ9A 5E9DD 2WXLA 4N2LA 4LGRB 3BPOC 4AH2A 4KX9A 4S0SD 1KLGB 2JB6A 4OD2A 2SEBB 1L7TL 2ADFH 3K4AA 5IT2L 3V6OE 2X4UB 4PCTA 5B4MC 1F4AA 3GBNL 3QFJB 3VFPB 4JPIB 4AEHH 2FH8A 1V3LA 3VMNA 4L8DB 3IDNB 1JF6A 3P0VH 5D96B 1C1EH 3BRDA 1NDMA 1BQLL 3PQYB 1I1AD 2ZUXA 4H1LA 4AT6A 3MROB 1IUZA 3MYJA 1MFCH 1QSEE 1JBJA 3ECQA 4KFMA 3CFJA 4WK2B 5T3XD 2QELA 3WOVA 4M9PA 2WBJC 3V95A 4BK8A 5E4EB 2YOCA 4OUUA 3ZGIA 2MQCA 4JHAL 1FLTX 1ECZA 2DQUH 4MZIA 3TBTB 2R0KL 4OZ4A 4DSYA 4YHOH 4QLWA 2EE3A 2GAZA 4PS8A 4WVRA 2IBZY 3T5WA 4BE5A 1RP9A 2LU4A 3SDAC 1DSFL 3HZVB 3QUKB 3UACA 2CSPA 2HUEA 4BK4A 3V5HA 4NO3A 2UY6B 5I1IH 5GIRB 2R4SH 2WBKA 3MLUL 5LCVA 1AKJB 1RULH 4JEGB 1L3NA 3W39A 3F85A 2DKMA 1BBDH 3AREA 3FQYA 1SLVA 4AV4A 3L4TA 4AVHA 4DHLA 5JIQA 3SCMD 4R3SA 1AGDA 4JDZB 4POUB 1FZOB 4FI8A 4UINH 3P77A 5TF0A 4KZDL 2OYMA 3GYRA 2QGBA 3BKJH 3QHZH 1XGTA 3MBWA 4XMWA 4N0CC 1Q0XH 2D2OA 3IRCA 3SGJC 1KCWA 2PTVA 2QSCL 4L48A 2QHRH 4PRHD 2E7LC 3O6FB 3GINA 4ZX3A 4PY7A 1R3HA 5LNDA 3BVUA 2UVFA 5E5MA 1B4JH 5EF2A 2OCJA 1F6AA 1IJ9A 5DHVH 1U3HD 1KFAH 3FB8A 1MCRA 5T3XH 1FF5A 2FJFA 4JVUA 1BVNT 1X5FA 2P52A 4W4OC 3LRHA 2H6OA 1A6VH 4JFFD 3CUPA 2F54E 3FRPB 2Z8SA 4U1IB 5DMKA 5HHNA 2EIEA 2H2SD 1B6UA 4JPKL 3KPNB 5HHPA 1TUPA 1QVOB 1T83A 2P80D 4OCWH 4PVLA 5GGUA 3T0XA 2ROYA 1H3VA 3AMLA 3MRIB 4ZUWA 1RHHA 1AGCB 4N0YH 2VN3A 1D5MB 1VCAA 1IBZA 5CN2A 2DBJA 3VVWA 4D9QD 1J5IA 1J11A 3LNIA 4X8CA 2CRZA 4GQPH 2XXFA 2OMXA 1MF2H 4PW9A 4ZX6A 4XWOC 2PYEB 4NPYA 2NYZA 4YUEL 3OKYA 3G5XA 2AJSL 3RWGB 2A1WL 3UTSD 2VDQH 2X0VA 4JJHA 4NCC1 4Y4HA 5CGBA 1SXCA 3TVMD 3MUGA 4MA1C 4DGIL 3WN5A 2ITCB 1LILA 4NQTA 1UWGH 1RP8A 5HVWA 1J1XL 1Y18A 4J7RA 4GOSA 5CEYB 5DO8A 3GZOA 3DECA 3FYEB 5BQDA 2O6DA 1DO6A 5JW3L 3SOTA 4OV5B 4B96A 1F6LL 3ZTDC 1AE6H 1YN6A 1RUKH 3KLDA 4RSVA 2VDMB 2GUOA 5I66A 4HJGA 4PGEB 2X89D 2AS5M 1IGIL 3RX5A 3KBHE 2CA4A 4GRLD 4FA6A 2WLJA 5IVXA 4QDGA 2YGPA 3VXMD 2L8AA 3D6GA 2WBWB 3NAAL 1CLOH 5DMYA 4E42B 1MVFA 3C08L 4AZ8B 2DOCA 5FV2A 5TE4H 5I26A 3DRTB 5TE6H 1KGCE 2X7LB 3I3EA 4QRPD 5CCKL 2H9GB 4QHUB 1GHFH 1IL1B 3IWUA 3F12B 1WEJH 4OFYD 2VXVH 5HHVH 4U0RC 2B77A 5E03A 5LGHH 3HZMB 4WY7L 1DLHA 3T0EB 3IAGC 4UMGA 4Z7QF 1VGKA 1E7VA 3QJVB 4YWGH 2NUPB 2EDNA 3B7TA 1RPUA 1CPUA 2VDRB 2ZWLT 5C0FA 3RIAK 5IJBC 3B3IA 4F93B 1YECH 3FQTA 4DJMA 1NGXA 3ULVC 3BZEA 2B0SH 4G6KL 3NDZE 5BPPA 4WGKA 2E27H 2XA8H 4MMXA 5JIIA 1I7TA 3L9RA 4JFEB 2EH8H 1UWEL 1I8LC 4LKXA 2WPGA 1VA9A 2EUVA 1U3ZA 1HQRA 2MNWA 2DQEL 2DWEA 4GRWH 1WBZA 4GI9A 2F7PA 1RSFA 1SBSL 3QJZA 4DN3L 1AP2B 3BGFB 5IMKB 5EZPA 4BDVA 3IFNL 1DR9A 1Q9LB 2E75C 4LP5A 4OQ1A 3X12A 3SO3B 3VTAA 3I6GA 3QQNA 3ESPA 3C5SB 3QUXD 3CFDB 1HL9A 1R3LA 2R27A 4R2GB 1XH1A 3HG1B 4K3JH 4U3SB 4U1LB 5D1QE 3VFUB 4EIUA 5C0BE 1BDYA 1G6RA 4LCWB 5LBSL 4A7UA 1IAKB 3Q0HA 4J12A 3ALPA 3BPOB 4RA3A 4ONGH 1MW0A 1UD3A 3SE9L 3D07A 4RGNC 3BWAB 2GJ6D 3VG0H 2VSCA 1VADB 4Q89A 4FJ6A 4X5LA 1BVZA 1D5IH 2WQXA 2ATPA 1AIFB 2VR3A 5LBVA 1E4JA 5T5FH 3I6KA 2FEDC 4ISVA 4H25B 4WHTA 2G30A 4G7YL 4DKDC 4S1QH 3EGXB 2AK4D 3M8OL 3T71A 2I5YL 1L7TH 1PKQB 4YSDA 2J6EH 2VDOB 2ADGA 1QAWA 4HEPG 4KX8A 3GBNH 1AQDB 5EUKB 4N5UA 15C8L 5F70A 2HT2C 1I4FA 1OW0C 2DL2A 1NUDA 4OB5L 3WIFB 5EBGA 1T22A 1I9JL 3I50H 2EC8A 2WCGA 2MSPA 2N1KA 1RIUL 2R69A 3DLQR 3W11C 4RGMC 4TUKH 5E2UL 3VU1A 4PH8A 3HW7A 1DQIA 3HG4A 4K9EL 3EH3B 3UAFA 5BRZB 3V0FA 1MLBB 3NIDF 4NQSA 1MXDA 3SDAB 4FNQA 1DBBH 3LSOA 5K33A 1FV1A 3BGAA 5HBBA 4PYGA 4ODWB 4J4PC 2D9QB 1MELA 1TIUA 5HXMA 4PMEA 1RZKC 4JY6B 1HYRC 4N0UE 3Q9PA 3UAEA 1PY9A 3DHJA 2CKBA 1WUZA 3SB3A 1KG0A 2VMJA 3RZWA 3B9DA 1D5ZA 2NSMA 5MI0C 5IEHA 3EO1A 2TRYA 4JFUA 4APXB 4HG4J 4M5TA 1SOQA 3MRNB 4NN5C 2MIZA 5F71A 5F6HJ 1QPPA 3BSZA 1X6NA 4QOKD 4FA8A 1QD0A 1QBAA 3AQDA 5MEOA 3U4AA 1R3KA 3SYAA 1NDGB 3KVDD 2X4PA 4JQIH 4QRQB 4IM8A 1K4CB 3SQOL 4CVZA 1UKQA 4Y4FD 5KOVC 3MBEA 4XVTL 1UWXK 3X11B 2VLMD 3LS5L 4O02A 2DV6A 1A1MB 3M1BB 5EIQA 1Q0EA 4OZGB 2CJSA 2ZOUA 2V7HA 3G6JB 4RETB 5DJDA 2JKWA 3LKOA 4PGCB 5IJVB 2L7JA 1U8NB 1JZJA 1G9HA 3BP4A 1ECYA 4ZW8A 1FYTB 2FTAA 4R7DA 1ZLDA 3WXVH 3O3AA 4MNHA 4E41B 1MVYA 3N91A 3BH8B 3MRRA 1T2QL 4OD1L 1VZHA 4PRAA 5TGBA 5B38A 4WUKL 1XZWA 1UD6A 3WBDA 5LN8A 1IZJA 3L4ZA 5HVHC 3GMOB 4YHML 3TBSB 3LQMA 4XC1L 1H8LA 5L4FA 4LVOC 3VWJA 5DYOB 3WUZA 5IEKB 3FUNA 4UIKH 2VB5A 2XV6B 4MA1B 3WD5H 2Z91B 3QZBA 3VI4A 3T6WA 4HWEH 4M6MH 4P2OA 4LAQL 1UJ3C 2FJGA 3T2LA 4YUEH 1HSAB 4I4WA 2AJSH 1NSNH 2A1WH 4KZ0A 3T4AC 4Q4EA 4Q58C 4WV1A 2X12A 3V4PL 4WW2C 5LXGL 1NC2D 2BNRA 3ZJAA 3TN0C 4ZFZB 4EDXA 5J56B 2IANA 4NEHB 3RIFF 4FFYH 1TQSA 1R5IB 4PJ5E 1JD9A 2Z92B 5FO9A 4LLUB 5C0EA 1DJHA 2XV0A 4JM2B 3EKCA 5CLXA 2ZJSH 2ZUWA 5CHNB 3NJFA 1CN4A 4ZMOA 1JN6B 1YQVL 2PW1B 1W15A 3TO4C 3W56A 1JWSA 4MXWH 1T5XA 3FO9A 4NNXB 4OLYH 5SWQB 1X5LA 1WBXB 4U0QB 5FA3B 2VSKB 1EZUA 1ZWIB 4S2SB 5KJ7E 2X2IA 4GRWF 3BIBX 5DEFA 5F3FA 2WGXA 5LHDA 2XBTA 4GAAA 2K3HA 4HA1A 3ZDXB 3EJSA 3OHXA 4PP1C 3C08H 1CFSB 1XXDC 3GUFA 4UB0L 5IROC 4U0RB 5EU7E 2HXAA 3NA9H 2YFNA 5ABZA 2JJSC 2IQAB 3N42F 3Q06A 3I9IA 4PRDA 2DS4A 4ZUUB 5CCKH 2Q3ZA 2IWKA 2AK1L 5D9SB 1LP9F 2ODHA 3LN9A 2EDDA 4XMPL 3SBWA 4F2EA 1HESA 1Z9SB 3H0TA 4WUUD 3UC0L 3D12B 3N85L 1P1ZB 3QDJD 4JDEB 1CC3A 1RPQA 3EDEA 3UH8A 4JHVA 3VXRB 4L37A 3JV4B 4LLVB 2YUWA 4FXGA 1BD2D 5IKCB 2Y7LA 4DUXA 3CZJA 1EO5A 4G6JL 3L13A 2DEXX 4ATTA 4CSPA 3AB0C 2KDGA 4HH9B 3VH8B 1UWEH 3BFOA 4HEME 1GGYA 1N9PA 4K3DH 4CSSA 1SRDA 1JNHA 1YEIH 2DQEH 2J1KA 5E1AB 1FI8C 1J8HD 3SOBL 2CHZA 4DK5A 2G2PA 4GAGH 2HVKB 3SE8H 1JUFB 1I1RA 2AXGA 1EEZB 3IFNH 5EOTB 3GS7A 4YQXL 4YHZH 1PZ5B 3BOVA 4QTHB 1T04A 2FHBA 3MA9L 5D72H 5FUCC 3NDYE 4RGNB 1A2YB 1X5ZA 3SDCC 5LBGA 5E6IA 1UENA 2ICEC 4YJZL 2GSIA 2X6VA 3MOAL 4CC4A 5F7DA 4M8QA 3W0WA 2R0LH 4HK3N 3VSQA 2D0FA 4MJ6A 4TM9A 1XTLA 4PJHB 3KLHD 1KB9J 3CV5A 1AD9B 1BX2A 4XP5H 3ULUE 4KK9C 1L3WA 5FYJE 2VZVA 4KXAA 2X44D 4MMZA 5BVPH 4KRLB 2I5YH 3ZHKA 1BFSA 1KTLA 3WS3B 3NFPB 4X7EC 4RGMB 5F0PB 5T1KB 1UXSB 4JG9A 4BKLB 5A2KH 1TTBA 1OQXA 2O6PA 3QJHB 1GTNA 4RMWA 2NCMA 5C0JA 5ISZE 1L9SA 4K7PL 3RA7L 4TSAL 2I07A 1N18A 3H9SB 1GAFL 3K6SA 3ARBA 3NVQA 4YHIA 4K94C 4HX1A 3JV0A 1G5AA 5ADOH 1JZHA 1ODUA 1DYZA 1PQZB 4PG9A 1RU9H 1EXUB 3IEAA 5MI0B 5DJZA 4G82A 2Z9TA 4QJ3B 1MNUL 2OULB 4LQFH 4NN5B 4UDTB 1QACA 4OVVA 3WV0A 3MRMB 5EOCL 4JE4B 2DKUA 1IGYA 2XWBA 1CGSL 3GRWL 3HC4L 4JRXA 1YHPA 5DI8B 2W65A 3HC3H 1KTDA 2VDNL 3ISRA 3RWHA 4LZKA 1KGYE 4IOIA 2DJ4A 3N41F 2G3MA 4YSPA 3QG7H 4MQXD 3WTWA 5KJRH 4JREC 2D7PA 4YDKL 3EFDH 3Q05A 35C8H 1URZA 2ZOTA 3MGTB 3FRUA 2BM3A 5GGSA 4KAQH 4OLUH 4X5PA 5B1AB 3GUTA 2QKIA 3C8KB 3LS5H 5CLTA 3CFEB 1WGVA 2E47A 4TNGA 2C9SA 4AQ1A 1NBYB 1BFOA 1WH0A 1ID5I 4O2EA 3RRQA 1JGVL 1NMAL 1ZE3C 4TUOB 4BCYA 3EYVA 3CSYA 1G4MA 4X83A 1CT8B 5HVHB 4G9FD 4X5WB 2OW7A 2LVCA 3GMPB 4HF5L 3MV8D 4LVOB 1SDDA 1WIUA 4X5XB 2PW2A 1KPVB 4IRZA 1PL3A 3VGEA 3VFWA 3KYNB 3WKNA 1THCA 2YC1A 1M7DB 3LRLA 4Y19A 1KXVA 3TU6A 4YHKL 1UJ3B 4JMXA 4NHUB 1F11B 3CFTA 5CU9A 2Z65C 4UAHA 3I85A 2CD0A 3T4AB 4FQIH 4GSXA 4X2UA 4WW2B 4Z23A 4JKLA 5D7LB 5T5NF 4P2QD 3TN0B 4DGWC 1SMOA 3RI5K 5I6KA 4CJ0A 4XAKD 2WXRA 1OGAA 5HDOA 3TZVA 3N6YA 4ZQKB 3VTMA 5EC1A 2I26N 3QEQB 4XX5A 3KWTA 5LXGH 3O4LD 2NX5B 4PSRA 4QRUA 2OR9H 4F15C 4OCRH 2BDNL 1WK0A 2GPZA 3QUYA 2VDKL 3ARDA 1WZAA 1MIEH 3GS4A 3GSVB 5D5ME 4ELMB 1ADQH 3TO4B 3F83A 4I89A 2BW5A 5SWSA 4C57C 2ZAHA 1PZ2A 4GG6B 3QDGD 3SPHA 3QDHA 3CN4A 3FFOA 3O3EB 4NNYA 2CMRL 3IE4A 4DP4X 3S37L 4OLZH 1YQVH 3QEUB 4HKZA 2ZYIA 5KJ4A 1TETH 3CWGA 4M43H 1VFBA 1HILB 1EDHA 1LD9B 4F58L 3ZR5A 4TVPD 1H9VA 2F1AA 4QRRA 3OD3A 3D4YA 3RHWF 1YYCA 1V7NH 3LCYA 5CLYA 1NBQA 3BAEL 3PP4H 4F20A 1JGUL 5MENB 4XPTH 1NLBL 4UB0H 2CHXA 3FCSA 3SGDI 1A6PA 2L7QA 3ZKXC 5IQNA 4IIQC 1A4KA 5E9AA 3D3VE 4HC1A 1Q94A 3HLKA 1QLEL 3TYGL 1RZJL 5H37A 4XMPH 1HEHC 3BUPA 4N25A 3UIZA 1L7IH 4BWTA 2LE9A 3S9DB 3L3GB 4X6FB 5SWZB 3QNYA 4ZPTB 2FO4B 3N85H 3T3PE 2BNQE 4CMMB 2ZG2A 5JXAL 2NLJA 2Y36H 1X5MA 2XZAH 2R2BA 3CH1A 3O6MH 1OY3B 4WU5A 4XPBH 4L1BA 5E5UB 2WNGA 4A6YA 1S7WB 3KPLB 1MAML 4JJ5A 3WU1A 2NY2C 3O2DH 5TDOA 3MN8A 4NQCD 1KEGL 1Z0MA 1FGNH 3MFFB 3F7YB 1IZKA 4YSUA 4K8RC 4HALA 3VRIA 3MUY1 1IKOP 4FQQA 2FLBT 3V4VL 3AWGA 3OF6D 1KLFB 4F91B 2P8MA 2EACA 4N28A 5CP3H 1BYOA 3WG7B 3SJVD 4JFTA 2VZSA 4YBHA 4QXGH 4EIZC 4YDNA 4WI9A 2WQWA 2J72A 1FCCA 1QQDA 4UT9H 4FQCH 5AAPA 4AXWB 5JHMA 4IJTA 3GXPA 2DQJH 2YJLA 1KGXA 1LE5B 5AOKA 4A68A 3L81A 4N8VB 1EV2E 4FMVA 2J12B 3S5YA 3TYFB 4YFLI 2OX5B 5T3ZE 2JCCE 3VXUD 3EAKA 3SDCB 1NCHA 2C4XA 4JG1H 5B7EA 1OIOA 3T2PA 2ICEB 4Y4KC 4DOHE 5DJ0A 1YY8A 3SGEI 5T1DL 2XU9A 1R5WA 3C6LA 3RWCA 4F8OA 2BFVL 1DBKL 3TCTA 2LOEA 2F19H 4PWJA 4JN2A 4XXCC 2R23B 3B56A 1DQQB 4K2UL 8CGTA 4G8EB 3QXTA 3BKMH 2IPTH 1S7XB 3MLRL 4YPGB 5I0XA 4RDQG 4DW2L 3QPKA 3T8VA 4OKVB 3FN0L 5F96H 3I6LD 4GAFB 2VLJB 3M17A 1T03H 5E9DA 2OKMA 3RLSA 1DSWA 3LKRB 5FGBC 3FRPG 5KVFE 5JYMA 2J6WA 2ITEA 1JZ7A 1UFGA 1I7ZB 2Q8BL 2VL5B 2FSDA 5IV2A 3MJ8B 1DVYA 2XJLA 1X4XA 4G1EA 4JZNB 4OD3H 4UM8A 5D71H 1JPST 1JYWA 4Y9CA 4TPRH 4RQQB 3PWPD 1SN0A 1A6UL 4G5AA 2UXGA 1AS8A 1KLUB 2XWDA 5CJXA 2O93L 1I1AA 3K1KC 2J73A 4NZJA 2OSLB 4UWQB 4J3VA 5DHVA 4QNPE 4I8DA 5FM5M 3GBLA 1IGTA 2HT4D 4JL1A 1N10A 2B7DT 1BXVA 1KCUL 1Y07A 2ICWA 2NYYC 4NQEE 5ECJE 1N68A 2EYRB 3MRKA 3P3YA 3BESR 3QWOA 1QUNB 2VR4A 2MHAB 3IMRA 2MPAH 1GKEA 4M1CC 2D7QA 2VDPL 3L16A 5HY9A 3E7JA 3MLWL 3O2WL 1MHPL 2A9NL 4X6CF 3KCPA 5E2VH 2QT6A 5JIHA 5EG6C 3PP3H 2UY7B 4L8SA 2QPFA 4AYID 4KKLC 4YX2H 5BZWA 4I48A 4N2BA 1NKGA 4IBVA 4N5EC 3V7MA 4GXFA 3SCMA 1ET7A 3ZE1F 3GRWH 3ZOAA 1UH3A 4JREB 4N22A 2KYIA 2QVIA 5A16B 3UG4A 2YFOA 5SX5K 5I5MA 2JIXB 1J18A 4CJ1A 5KG9B 3PIQA 3LKPB 2R1WA 3TIEA 5HHOD 3TPUB 4PRHA 5EDSA 2LV4A 3UTZB 1QHOA 1YN7A 2UXFA 3K72A 4LASH 3TBVA 5J0BA 4JW3A 2I85A 1NEZA 3X3GH 1R24A 4GAYB 3MV9E 3FT4B 3NRFA 3Q01A 1P7KB 1S78D 3LRSA 2VC2L 4TNEA 3UTTE 1U3HA 4FI7A 3A47A 3IU3B 4GO6B 3GBDA 4LEOB 4NM8H 3ZIMA 1MAJA 1D9KD 5MHSE 2DQ6A 1OGTA 4YFDB 2FEEL 1P7HL 3PGDA 2AJUL 4JFFA 4FLQA 2FGWL 4AIOA 4U6VL 1OALA 1KPUA 2VM9A 2ZG1A 1TXKA 5BVJA 4AYFA 1A7OL 2P80A 1QR1B 3FMGH 2Q1EA 5GPRA 1PD6A 4XNBA 5JHLL 2O26U 5AOLA 1R0AL 4KU1A 5DUPH 4JS7A 1ROCA 5D70H 4HZAA 3H42L 1ND0B 3EHBD 3IJYB 4BFKA 3O2VL 5FYLL 4WWNA 3OVUB 4F15B 3IDGA 3V55A 1KY6A 5I1EL 5BMFL 3CLEH 3D4CA 4PY8I 1Z7JA 1UKTA 3ABGA 3ASOB 4FLOA 2WZ0A 5I1HL 5IW1B 3IMTA 1OTUD 3NESA 5DWUH 5IBLD 3H9HB 2NQ3A 3UTSA 4BD4A 2CLZB 3TVMA 5E4AA 2CO3A 1S7SA 1NWPA 2ENYA 3ARVA 5AG8A 4U31A 3WI9A 5BXFB 1TVDA 1DVFD 1Z9MA 1XR9B 3EJUA 4NGHL 2JI2A 5CO1A 1AR2A 1VACA 1UM4H 5IMOB 4KQ3H 1OP9A 3QEHB 4NT6B 5F1KC 1IX2A 5DZVA 1C5CH 5K1JA 3BP6B 2CMRH 2Q86B 3B34A 4ZJ9A 4U33A 3ZE0E 1JZ2A 4HHGA 2X89A 4JBSA 3HE6D 2CG9X 3J27A 4LDCA 1MFBH 4L4VD 2DYSB 4GBXD 1HL8A 5SX4I 4GRLA 5A43C 5JOFB 4G70B 1PAMA 3DURB 5EU6E 3ZKXB 5E4OA 2K70A 3VXMA 12E8L 4KI5E 5G2NA 4M7JH 5CD3A 2B3IA 4OIBA 4Y7OC 1MSPA 4YZFF 1A3RL 5C0CB 3VDCA 4OJDH 5EU4A 4GSDH 1JGEB 1ES0B 4QRTB 2BOBA 2ADJA 4QRPA 1OTTC 4QYOA 4WU7B 3WIAA 2H32B 3T04D 1QLEH 1VGEL 3Q3GB 3TYGH 3WNNA 1RZJH 2FQDA 4OFYA 4M8RA 1LP9A 2SODB 5KSVA 4DGVL 1W0WB 1FJ1B 5GQBA 2X2HA 1VKXA 5GGRA 2NY2B 3JTSB 2JMRA 3Q48A 4TMPA 5IB3B 1IBDA 4G3YH 4F7KA 2XKUA 5B39A 1FL3A 2PCFA 3FFCB 3OKMB 1KBGL 4XPHL 4XMKH 3Q13A 2UZPA 4OF8A 3VU2A 3G6AB 1E0OB 4XPGL 5IQ7L 2VM4A 2VQUA 4NXKA 4U1KA 1FRGL 1AC0A 2XQYK 3QA3B 4PTUA 1NUFA 5D1XD 5AVSB 5T5FA 3GTVA 3V4VH 1YDPA 4D0BA 1JTPA 2NW3A 5EF0A 2ATKB 2G9HA 2WXKA 3T1FA 2YWYA 2P42B 2JI3A 3KJ6L 1XGUA 1X5XA 2J6EA 3LQZB 4Z76B 2BP8A 5GHWL 3BZ4A 1RK1A 3U36A 4Y4KB 1Q72H 3WNJA 4MCYA 1YYMH 5LAXA 5DQDL 2IPUG 3MJ9A 4JFQA 3ES6A 3O8XD 3QWNA 1DDHB 3P2BA 5K39A 3QUXA 3L4WA 3R18A 1G9MC 2VSDA 4P46C 1DBKH 3DXAE 4LLYA 3GI8H 2EDJA 5G55A 3FQ1A 5FUZL 1RJLA 4PTTA 4V1DB 5GS0L 3HCVA 3W81A 2YEZB 2BMKB 5E6UB 3UZEC 4QTIL 4V33A 3H85A 3FUFA 3ZRSA 3E6HA 4Y1TA 4DW2H 3KR3L 1YMME 2GJ6A 2VZ3A 2Y5TB 2P7TB 2XBDA 3L7FB 3FN0H 3DI3B 1CTMA 4FZ8H 4PJ6A 1YEGL 4AC4A 1WCQA 2E9BA 3BZFA 1G7JA 2Y25A 5MEPA 3LZQA 4Y9FA 1G0DA 2AK4A 3PPEA 3AJ7A 1MCQA 3CU7A 3SPJA 3STLA 3E8UL 1XR8B 5I0VA 3TEYA 2V7NB 2FB4H 2VQ4A 2X4QA 3NP4A 3QIUC 5I30H 2QQNH 1TJHL 3CHRA 2YPKA 1W8NA 5MERA 4JQIA 5IQLA 1CLZL 1GS7A 1O9VA 3P9MB 2Q8AL 3BFWA 2N3JA 2Z35B 2DN7A 5ESVB 4U1JA 2XYBA 3ZZLA 4BA0A 2XICA 4P9HC 5HDBE 4CDGC 1J0KA 5DZLA 5FKPB 4ODXA 4ONFH 4U05A 2VYRE 1I8MB 5DHMC 2WM0A 1KCUH 3K8MA 4HKXA 4A7SA 4DP1X 5KVGE 2K1MA 4A7QA 4OLWL 3OBAA 3US0A 2K4WA 1U6AL 3X13A 3MLWH 2AF2A 3O2WH 1BBJB 3H4FA 5DMIL 2XOTA 1RUQL 1S5HA 3RHWK 1ASQA 1S9WA 2GJJA 5HJGA 4L9LC 1YUKB 2NY4C 2RCSL 3E6FB 5L6YH 2X6UA 4WAFA 3NCJH 3UBHA 2EC9U 4OGXL 2ZSVB 3JV6A 2WVTA 2PCPB 4H2CA 5IMLB 1GGCH 1UT1A 1ZPLA 3F5WA 1A47A 4LSSH 2XWJB 2DM3A 2GKIA 4QOKA 3APNA 3ZT5A 4FP8L 3TJPA 1QWHA 2WO3B 5IJKC 5J12C 3MREB 4JB9L 4XMUA 1NGWB 2E7CA 3VYPA 3T08A 2V2WA 5D7IF 1TDQA 4EPSA 5EZLA 1JRHL 3EDJA 1RFDH 4NYLB 4Y4FA 2N0KA 4WI3A 3BSGA 4Y1AD 1YYLH 4P23D 3DV6A 3BCDA 2G9KA 5CWSA 1PZ3A 5E8OB 3VXTA 3K4DA 4FFYA 3ISWA 3QUMB 3LNDA 4B5EA 1FVDA 3F6IA 4LHUB 3NTCL 3QDMB 1MVUA 1QBBA 3CMGA 3O6KL 5F7EL 3HR5A 3EJCA 3FO2B 1HEJC 3DSNB 4NQDE 1N64L 4WFHD 4LCCA 1Z2KA 5FO7B 1R0AH 1DVUA 3VFGL 2B59A 3QUZC 4IS6A 3OKDB 3P0YH 3ROOA 3WNMA 3H42H 2R83A 1KIRA 5FYLH 3KPOA 5BMFH 4MCNA 3NBNA 1ZY9A 4NAQA 4ZUSB 4P5RA 3QQDA 5FYKL 2YSSB 4HWZA 1AGEA 1H3GA 2LU3A 2QQLH 1NC2A 4NHCL 4BZYA 4GO8A 3HI1B 3RTQC 4WWKD 3QUGA 5KN5B 1QEWB 1HFUA 2VKWA 1DEEA 2WCSA 3PUUA 5C0GA 3W9DA 1CTOA 2Q76A 3GEWB 4PIRF 1QOKA 2KPNA 3MV7D 3TL5A 2YPVH 3GWJA 3HNTL 1MKFA 3NQKA 2ITFA 4CN1A 1YLBB 3BUYA 1WG3A 4K71C 3VFOA 3UG3A 3MCKA 3FK3A 1KGJA 3TFBA 1P9MA 4HIEA 2D4FA 3IDIA 3UJIL 2X38A 4AKOA 4I3SL 1JGLL 5KANI 4MDIA 2D4DA 2DWSA 4IU3A 3DX8A 4ZO9A 5KS9E 5EO1B 4JO4H 1HZKA 2RMNA 4GY4A 3GO1L 2IMNA 1XMEB 4NM4L 3QWQB 5KW9L 3EGSA 4LCIH 1KZQA 1L0PA 3ZDZB 3DX7A 4TYUA 4QEGA 3WSQH 1NCDH 3L5JA 3VFMB 1TVBA 4OM1L 2DEYX 3O3DA 2M83A 1G7IB 2G5BB 4WUUA 2DBLH 1OAUL 2WSDA 3VFRB 4C56B 3VM7A 5B7MA 3QDJA 1LEIA 4OTXL 5C08D 3ZHNA 5GRJH 3HMWL 5JXEC 3FB6A 3LN4B 2BSSB 3MGAA 1IGCL 1QUPA 1DL7H 1IT9H 3WUWG 1BD2A 1KBGH 4UTBH 5ICXB 1OT4A 5DUBB 4XO4A 6PCYA 3VMPA 1FRGH 3MLVL 4OV6F 2VRKA 3VD1A 4HOXA 3QPXL 4O2CA 3CDYA 3HTLX 1S9VB 2GTWB 4WQOA 4K3EH 4J39A 4PM1A 5F9WC 3QHFL 1J8HA 4QY8A 5AVUB 1KELL 5I1LA 3JSSA 2Y5QA 4MJID 1KENH 2V5YA 1FFPB 4HUWA 4ALAL 4M8VA 4P46B 1WQVT 2P5EE 2CR0A 3RL1B 3KCWA 5DVLA 3V8OA 4Y5XC 5L8LB 3HZ3A 1Q4NX 2CUAA 2HWZH 4YE4L 4Z7OB 4TSBH 4XNMB 4IU2B 4LSPL 4CNIB 5DFVC 2FX8H 4KKBD 1DQVA 2XRAL 4YHPB 2BINA 2YXMA 1HNYA 2DTMH 4EI5A 5AW2B 1SFHA 4YN3A 4H8WL 3TEZA 2D9CA 3C5ZD 3EH2A 3VO0A 4YZWA 3QIUB 5ESQA 4JY4B 2NUTA 3ELAT 5IVXE 4MDRA 1SEBA 5KVDL 1FYHB 3FQUB 5PCYA 3SBPA 1VEPA 4XZUA 4AYEC 2EILB 4R96A 1CF8H 4DVRH 4PV1C 5L2KD 3EJTA 2JVUA 5CILL 3E8UH 1WO2A 1J9TA 2WQ8A 4PGDA 3EJZC 3WS6A 4JE0A 2AEWA 4KJWD 2XXMB 3ZTNH 1Q9WA 1PLGH 3DIFB 4MSWB 3OJMB 4M03A 5KYXB 4YEEA 3EDFA 1CLZH 3U25A 1F3JB 2Q8AH 1WISA 3EOBB 2A6JA 3BPLC 3RL2B 2Q6WB 3RKDC 2GCYB 4MB5A 4A2DA 1DANT 1INDH 2OK0L 3QCTH 4KDTA 2AEPL 2J55A 1D5BB 1SVBA 2NY4B 1FVCB 1LO3L 3DO3A 4U6YB 3ELQA 4MWFB 5K1NA 1T4KA 1ZSDB 3HHSB 3OLGA 1QHPA 3CQPA 1AQ8A 1RUQH 2EXYC 3GSXB 2L04A 4X6CA 3VG9C 2CLVB 5D7JC 2IIJA 3OWEA 1BFVL 1QFWI 5J12B 1G7LB 1R5VB 2RFXA 5I9QC 4EOWH 4FEIA 1INEH 4LCVA 4KJYB 3K71B 3L9BA 1OLZA 5AW4B 4JPQA 3NJHA 2FWUA 3OSVA 2LLLA 2AHIA 2IMMA 2WLMA 4MZ2A 4ZMNA 4UDUB 2R4RL 4JB9H 3K6DA 1F86A 3NH7L 3R4RA 3HI6L 4PJCE 4ZT1A 2N7AA 4XH2B 2F7RA 1JXDA 3OPUA 5I0WA 1XF5A 2HN7B 4UIMA 4AE0A 1A6AA 1BW8A 3OX8B 2VDML 4G7SB 2OJEB 1ADQA 2P8LA 4AIXA 4AV0A 1NIEA 3Q2VA 2AJZA 4G9FA 3L4YA 2FIKA 4OT1H 4X80L 3RWEB 4AYDC 3BLPX 1T1WB 3FO0H 3MV8A 3AGVA 4E36A 5AZEH 4LCYB 4FHBD 2Q20A 3QUZB 4DKTA 5F7EH 1J0HA 4HXBL 3RVWC 1M7XA 2YRBA 4UOJA 1Z5LB 5EF1A 2DIJA 4L4TD 1MFAH 5EO9B 1OEZW 5IGXL 3QQ4B 5GJTH 3GJFH 5GSVA 2AJVH 1CL7I 5LNEA 4WI2A 2JXMB 2ORBH 1A5FH 1P5UA 1ZLEA 3L45A 4RFEB 1I3RA 1IFRA 4P2QA 1NJ9A 3RDJA 3RJQB 3RTQB 1RZIA 4RBPH 2MFNA 4ELKA 2VE6B 3EJPA 4JRYB 4B9YA 1BYNA 3KPRD 2CR6A 1P6FA 2K8MA 3O4LA 2VDRL 3VXOB 3U6RA 4NHCH 4Z3EA 1MUJB 2WV3A 4KI1A 5ACMA 4K71B 4N8VG 3PP3K 1GSMA 4ABVA 1O6TA 2M1KA 3ZX1A 2EUWA 3WJLA 1HIML 2HTLD 2OZ4L 4FQHB 4QHPA 5I1DB 2EICA 4LOFA 3ROLB 2ESVD 2IWFA 1AQKL 3FW6A 2OI9C 3QDGA 4PV8B 2XG5B 3O2DA 3D1MC 3JYCA 4KPHL 3LEYL 4YVNA 3VB8A 1IE4A 4H26B 4PS4L 1BZ7A 1QSED 1YVLA 2A74A 2DI9A 4HBCL 1XH2A 5CP3A 3TONA 2Z93A 4P99A 5GZNC 4WWID 3ZDYE 4UNIA 4KRPD 3BGMB 4UT9A 5IZ7A 4R7NB 3GO1H 3WTSA 4NM4H 1GW6A 4MMYA 2NW2B 1HHJB 4DQOH 1OT1A 1N59B 3L4XA 1BAFH 4Z7UB 1MRFH 4HMCA 3HB3C 4OGAD 3MRPB 2C9PA 3IJ9A 3IKCA 4Z7VE 3CZEA 1T0MB 3LJ3A 1XCTB 1L9MA 1A9EA 1RJYA 3QAZC 2DKSA 5ECGA 4AQ8C 4PJGB 5DZAA 1EDQA 1X5AA 5EEUA 4LB8A 1KV3A 1AKJD 3IJSB 2HFFA 2X4OB 2NCEA 3BO8A 3RGVD 4BFRA 1RAMA 1L9QA 1T80A 2HZHA 4ABWA 3SGKA 4NQCA 4UQCA 2Y4SA 4WEBL 5I5RA 3Q1SL 2X1WL 4JFZH 5F9WB 2LTQC 2VQ1B 1YEEL 2VDOL 2P8PA 4OF7A 1J86A 2PTUA 1FLRL 5INDA 3OF6A 1OCRB 2CO7B 2WLHA 1XSIA 3SJVA 5K9QG 3MU3A 5JQHC 3AG2B 1IARB 1ZLUK 1U8PA 4HMDA 5EU5A 2D73A 5C0RL 4UNTA 3VI4E 3IDJB 4LIQH 1M1XB 2WLZA 3NJNA 1CDJA 3Q5OA 2GJZA 1FNAA 1IAIH 3RU8H 4F9PA 3DJZA 2A9MH 4MTMA 5C2UB 4N1CA 2CJTA 3VXUA 4JFPA 4BKSC 3PL6C 4FZEL 5KUMA 4L29B 4N2NA 3OL2A 4ZUTB 2ICWI 3CVHB 4HV8A 4R7LA 1HSBA 5IJDC 4OSUL 3F7VB 2MQ3A 3EO0A 1JHKL 1UB5A 3IMVA 4JAMB 1AFVL 3RVTD 1Z5YD 3QZWB 4E2OA 1U8JB 3IJHA 2EDQA 4U1SB 5FOJA 5BV7C 1ORQB 3AM8C 3D0LB 5IB4A 2F53B 1H3WM 1G7QB 3EYSH 3BPCB 4X7SL 3LIZL 4H44C 1X7QB 1XGQB 2PKDA 2FBJL 3BN3B 1YJDC 2W92A 1NCOA 4Y5YA 1TFHA 3IWVA 5CILH 5ITFB 1E28B 3BPLB 2IH8A 1IC0A 3A24A 3VE0B 2D03H 4CN6A 2VWEC 1KTRL 5C86A 1T21A 5HGAB 4ZMZA 1LE9A 4P8QA 3PWPA 1NCIA 4M56A 3FT2B 3GSWA 3KL0A 4UOZA 1B3IA 2FL5A 3ZE2F 4MD4A 2V2XB 3H6JA 3KJ4C 3VD7A 3PWVB 1GCYA 1XMWA 5D4QA 3GHBL 3I02B 1UZ6F 3FUMA 1MLCA 4O51B 4EAEA 1RH8A 1MCSA 2OTWA 2A6KB 5CJOH 2AQPA 4J6IA 1AQMA 3T6VA 3A5VA 1NZRA 3VG9B 3FUKA 2ROXA 4YXLH 5D7JB 4EDWL 4NC1C 1KGCD 2Q5BA 5I9QB 2AC0A 1J5DA 3WFCL 1BQHB 1ZV9A 4EI5B 2WQAA 1A3LH 5J89A 4EE2A 3DVNB 4NQQA 2FT7A 3P0GB 1AGBA 4JPWL 2F7QA 4XO5A 5G4MA 4ZAKC 1Q0YH 1NGQH 3KWVA 2W9DL 4XCEB 3RWDA 4E9RA 4KVCH 1FNEB 1B2WL 1V5JA 4YPJA 4ZMPA 5ANHA 32C2A 1RZQA 4HXAL 4WK0B 4FRWA 5HHOA 3PPSA 5ICYB 3T3ME 1A4BA 4LOEA 5FO8A 3RPIA 2OR7A 5E6SB 4TSCL 1NOLA 4WJ5B 3CDGA 5E2TH 4F33B 2DWDA 4XT1C 5D7IA 3KYAA 4FG2A 1HAUA 3PHQA 5C3TA 2XACC 5B8CC 2KKQA 4KROD 2CDFA 5DK2A 5BRPA 4CVWA 2EXWD 1FAKT 4PAZA 1CBJA 1MH5B 1D9KA 1KPRA 1KYOJ 4LL1A 3VAEA 1GY2A 4RNRA 4GKZB 1CXIA 3N1FC 4MB1A 3BWSA 1W0VA 4ACPA 1UA7A 1RJCA 2F5AL 4GSRA 5DT1H 3W0WE 4ODVL 1OPGH 2AZUA 5AUMB 1E5BA 3MPCA 1LNUA 4K5PA 2OJ1A 4LSUH 3G9AB 5IR1B 5D1QD 5DC2A 2H3NA 4ZO7A 5IGXH 4JR9L 1PPIA 2IH1A 5DRNA 3EJRA 2AGJH 5HTSA 5C0BD 2X2YA 3UEQA 4UV7L 2HVJA 3FCTB 3DUSB 4XNQB 5IF0A 4DPAX 2J1WA 4KJQD 5B3JF 4N2AA 5CSBA 4XODA 4FQJH 3ULVL 1OQOA 1BJ1J 3TO2A 4LCWD 4F7CA 2AMGA 2BPBA 3B7SA 4B9ZA 4X6DF 2X70A 3D9AH 2OI9B 4HCRL 5DFTA 4HPHA 1AR1C 3CQQA 1DVFA 1GGTA 1AZNA 3P4NA 3D06A 1NMBH 2X4TA 4JHBA 5CM1A 2PLTA 1H0DB 3OZKA 3S4SG 4XP9L 4DZ8A 4MD5B 4GINA 2WC7A 1ONQB 1SN5A 2IWGA 4B9PA 2WOBA 3NEEA 4RMUA 3HE6A 2BVOA 1ZIAA 2G75B 4L4VA 4M62H 4GBXA 1RVFL 5IM7B 4OLXL 5KWYC 1TJXA 5DJYB 4N2DA 4Q6IC 4I0KA 3I9GH 4HWBA 4PJAF 9CGTA 5I23A 4JRXE 1P6WA 4DZBA 4IYKA 4W9ZA 1VCBC 2BIQA 2YAPA 2AJ3A 2WBJD 1GOHA 3QJRB 3SDXB 5FYJU 3HB3B 4Z95H 5HVGB 3QXAA 3WLWC 4HJSA 1NLDL 1AS6A 1EAPA 3QAZB 3SDAD 2NXZC 3QFGA 4K07A 2C3XA 1JP5A 3KHQA 1C8PA 3EG9B 3MLSL 1CFVL 3F58L 4MA3B 3K2UH 4O58L 1E8WA 5KYWB 1XB3A 5FKAA 3TASA 1A9BA 3DGGB 4GP8B 4LRNL 3ZT6A 1H15B 1RLWA 4YBQD 2LTQB 1VF5C 3TJHC 1K9TA 1S7VA 4NX0A 3QQ9C 3KLLA 5FW6A 4L3EB 1LQSR 1RERA 1KWGA 3MX0A 3ETBJ 4I13B 2K8QA 3V9CA 1K5NB 1T7YA 2WINA 5FW7A 2ZSWA 5ID1B 1NH6A 5I16A 4Y19E 1G1YA 5E8PB 3OGOE 5IHZA 5D1XA 4NBZB 1UHVA 1A4JA 1IBFA 3QH3A 4XHJC 3L5WA 1WBYA 3CSBA 3SE3A 4YHLH 4FXKC 1U30A 2E8YA 1YQ2A 4NKOA 2J43A 3QO0B 1F0LA 4ZMXA 1TQBC 5AFAA 5C0RH 1H3TA 2MEJB 4KK6C 1PG7X 1LEGA 1MWAL 1R1CA 3BVVA 3PL6B 4RDQF 1RZKL 4CVXB 2VLLB 3UP1A 1OGAE 43CAA 4HOZA 2IDQA 5K9OB 2X3BA 5HHXL 4UYQA 1U8MA 1KY7A 1ZS8B 4FKEA 4KK8D 3C9NB 3N50A 3O8XA 2C4FT 2J2ZB 3BP5B 2Q3XA 2CO6A 4E41D 5LG6A 2JELL 1MHEA 5BV7B 1FCGA 1ORSA 1MCFA 2HJKA 1ETZA 4NO5A 3X1BA 4PJIF 3TGXA 2WKLA 3OKOB 5SWSE 5TFSL 5EBMB 2A6IB 2XN0A 3SKMB 1S7QA 4NENA 3UXFA 4HEPA 2N59A 4OIIH 3HPLA 2ZYRA 4XWOD 1N0XL 2H4EA 2VLRE 2Y1AA 5D2NC 1RD6A 4B3VA 1RCYA 1RZ7H 2YBRA 2YMXL 4CBZA 1U92B 3R06A 1K2DB 5TQ2L 1HINL 2CHWA 4X9GA 1GZPB 3FAXA 5DJ8A 2Z6FA 4IHOA 4TULL 1SQMA 3KJ4B 4RA0C 1YY9C 1MQKL 1AAJA 2CCWA 5GGQH 3BE1H 2A77H 1H19A 1I8KB 1K6QH 1WF5A 2D2CC 5KUKA 1EIBA 2R56H 3NGBB 4W9DC 3VA2C 2WB7A 5EA0H 3QXWA 2BIOA 4P4RB 5DJCB 5DU7A 3SYQA 3KPMB 4HPOL 1ZGLA 3L2NA 2YZ1A 2CUMA 3HBPA 5I82A 2L3BA 3BYYA 1ZHBA 5C8JA 4LSTH 2MOQA 3BDBA 3WFZA 2QPDB 2AJYL 3ECWA 1KB3A 2CPUA 2NXYD 4PD4J 1SNRA 4EDWH 1D6VH 2VXTH 2WYHA 3LOWA 1EHLH 1B4TA 3G6DL 3HRPA 4ETYA 4ZAKB 4AE1A 3O9WD 1H3UA 3HFML 2CDEA 1HJCA 4HG4K 2Y06L 1KJMA 1BLNB 1ZT1A 5CGMA 4EIGB 2AQ1A 1N3NB 4R4BB 4OR1A 4S10A 2WWOA 4NNPL 2WWMD 1IKFH 1L0QA 3ZY7A 1B2WH 1HZHL 1MCOL 1XIWC 5DK0B 5AVXB 1U93A 3FSAA 3KW7A 1KB5H 5IBTH 5B8CB 5J4MA 4HCFA 1I8IB 2FD6L 2WN3A 3C2AH 3WDJA 4IRSD 4OZHF 4Y1AA 1FFTB 4P23A 5FM8A 2Q9OA 2Y6SD 3B9KC 3RNKA 5HGDB 1G7PA 4FKKA 1S8DA 2VR7A 4KY2A 5H94A 5C2BL 2Z0UA 3FHAA 2YPVA 4PJDF 1GTFA 2MJWA 5I19H 1KJVA 4XP4L 4TTDD 3VXSD 1JV5A 2HRPL 4M5YL 3PAYA 2F5AH 5DDHB 1ID2A 3EH4B 4X8XA 4MYWB 1H6EA 2ZKHL 1EWHA 5KSBB 2LGNA 4YNYB 4PGBB 2CDGB 3OLEA 5E9DE 2O72A 3LY6A 4LSQL 5DVPA 1DN0A 4PJXF 5C0DA 4N9OB 1NCJA 1IKNA 4Z9KB 1OAYL 5KYNA 3GDBA 3KLAA 4P9ML 4APQC 5HJDA 2XWTA 3WO3B 2PMZA 2DQIL 3FO1B 4BZ2L 4CGTA 2FIRT 4BZ1L 2GFBB 1AR1B 3L3KB 1DQLL 4IMKC 1N6VA 1FFRA 1ZTMA 1KIUA 1C16A 3BWUC 4RGND 1JZ4A 1BPVA 3U7AA 1CG9B 1Q1JL 1ZXQA 4Z7NB 4HCRH 1M6OB 4WWKA 1O9ZA 3ULUD 1UM6L 4M29A 1HDMA 3NIDE 4G7VH 2E6PA 2QFRA 3S96B 3MV7A 3TPKA 4XP9H 1EPFA 5E00A 4UTBA 3AAZB 4Q6IB 5CBEB 5FECB 1JHTA 2VDLB 2A38A 1JV2A 4ZOBA 2QJDA 1DO5A 3P4MB 5ISZD 2C1PA 3DX9A 5IVZB 1RVFH 2V5RA 2CGRH 2D8KA 4P4KB 1OANA 1UT2A 3SPVA 1T20A 1XL4A 4NUJA 2NXZB 4EMZA 4C4KT 2R29A 3APMA 3FQRA 4XMVA 3Q6FA 3TCLB 4X9HA 1U8QA 4X7TB 5L88H 5DC9B 4PRHE 3H9SD 1E3ZA 1D3CA 5IFAL 1YMHA 3DGCR 4L1TA 4M7KL 4WEMB 4A39A 3S35L 4NO0B 4O58H 4A2GA 1V3MA 4C54A 4WF7A 5F7HA 5I8CA 4KI5C 1P4LA 2XKSA 3D3VB 4I0CC 5A40E 1G43A 2H1LM 1H5BA 1DZ0A 3MLXL 4XNUL 4OM0L 3ULUH 1ED3A 2BIMA 2APFA 5C08A 2YXFA 4IBQA 2R2HB 3BKCL 5AW7B 3QXDA 2B4CC 3QYCA 3T3PB 4R0LA 4OGYH 3HOGA 1J1OH 4JFFE 3TV3L 1F56A 5ESAB 3GJFK 3LZRA 3GGWA 4HJTA 4FXKB 4WRLA 1EZVX 3N9GH 4X0KA 3MJ7A 1KJ2L 2VO8A 4YGAB 3ZXAC 1TQBB 1AO7B 4WI0B 5IHUL 4KGJA 2CWRA 4PJ8C 4UCFA 1FH5L 1JPGA 4O2FA 3GSOB 5F7BA 3BH9B 3GB7A 1INQA 4X0NA 4KKPA 4X5QA 4K94L 1KJ3H 3SQBB 4DUVA 3TNMB 2NZ1A 3UYRH 3T77A 4MJIA 1RZKH 1RIHL 4AJVA 1A8ZA 1CWVA 1RURL 1IBGL 1GIGL 4JQVC 1G1CA 1PYWA 5DD3L 5JUEH 3L3DB 4ORZC 3MRDA 1BIHA 2JCCB 4ZUVA 3RY6A 3FBKA 3L6FA 5DQJA 4AEEA 1FFNA 1KCVH 1FVEA 1B3JA 1E67A 2EIJB 1OZUA 4QXUL 5D2NB 3X2QB 4BH7B 5CEZE 4P2CG 1N4XH 1VDGA 3WY1A 2V3DA 3D25A 4RFOH 4UTCA 1M05B 1KB9K 4EJ1C 2I9TB 1DJYA 1ZRUA 4NQXA 1ZA6A 3INOA 3C5ZA 3T8XA 1ZTXH 1AQHA 2FJHB 4OUOA 1QKZH 3IF1A 2ZCHL 3UMNA 3CFMA 3SKNA 3VXME 1SPDA 3HG2A 1UC6A 4UOW1 1A14L 5L2KA 3EOYG 2BXZA 5AW8B 2C1OA 3H3PH 3WNIA 4Y8AA 2O5ZL 5IOPB 2X4RB 2V3FA 1IFHL 1KV7A 2NX5D 4WLCA 2Y24A 3D4GA 3FUEA 4H2AA 4KHTL 2BHYA 5I15L 1CE1L