1UATA

The significance of the flexible loop in the azurin (az-iso2) from the obligate methylotroph methylomonas sp. strain j
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
129
structure length
129
Chain Sequence
ASCETTVTSGDTMTYSTRSISVPASCAEFTVNFEHKGHMPKTGMGHNWVLAKSADVGDVAKEGAHAGADNNFVTPGDKRVIAFTPIIGGGEKTSVKFKVSALSKDEAYTYFCSYPGHFSMMRGTLKLEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin iso-2
publication title The significance of the flexible loop in the azurin (Az-iso2) from the obligate methylotroph Methylomonas sp. strain J
pubmed doi rcsb
source organism Methylomonas sp. j
molecule tags Electron transport
total genus 32
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2003-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1uatA00
1J5DA 1A3ZA 3PAZA 1MZZA 1A4AA 1GYCA 2HRHA 1CUOA 2VW7A 3AZUA 1JZJA 2WO2B 2XX1A 4K9JA 4KO6A 3NJFA 2XXGA 2X87A 4PAZA 3UGEA 2FQFA 2QPEB 3DTUB 2GC7C 3UADA 3X1NA 1MZYA 1ASPA 1EZLA 1FA4A 2GIMA 1GY2A 1NICA 1SJMA 2AANA 1GY1A 2EINB 1EHKB 2HZHA 3PLYA 1BQKA 5B7FA 1ETJA 2XVBA 4HAKA 1QNIA 3PPSA 4AKQA 1V55B 2BP0A 3N55A 1SFHA 1RZPA 1AQ8A 2HX9A 3MBWB 2J57A 5I6MA 2XV3A 2FNWA 3NSFA 1N70A 3S8FB 2X88A 2BWDA 3NSYA 3CVBA 4QKTA 3WNIA 1BAWA 4A2HA 1AS8A 1IBYA 1ZV2A 1AZRA 4AKPA 2QT6A 3H4FA 4HZ1A 4JHUA 2UX7A 1SDDB 3AW5A 2YXWA 2IDFA 1NINA 3ASNB 1OV8A 4DP8X 3FPYA 1GS7A 5TK4A 2E86A 3WNJA 3U25A 1SHXA 1AR1B 2GI0A 1BXAA 3UABA 3IEAA 2DYRB 2BW5A 3ZIYA 4GP8B 2ZXWB 1CYXA 2VW6A 1F56A 4E9TA 1CC3A 4YL4A 1IC0A 3TU6A 1UATA 1TU2A 1E65A 1AS7A 2GSMB 5B1AB 4YSSA 1L9QA 1SHWA 2XYBA 1J9TA 3NJMA 3QJUB 4JHVA 1W6WA 2CUAA 5B7EA 3C75A 1M9WA 3NJJA 2YARA 2UXGA 5I28A 3AY2A 5B1JA 3IN2A 4DPBX 2AVFA 4HCIA 5B1KA 2HX8A 1OE3A 1WS7A 2NRDA 2IWFA 3SBRA 3T71A 2MTAA 4G7RB 2AZUA 2PPDA 1L9RA 3S3DB 1KBVA 1ILSA 1KBWA 1HAUA 3KW8A 1BXVA 1NDTA 1WA2X 2YAEA 1AG0A 3GXUB 2ZOOA 2VN3A 3ABMB 4F2FA 3FSZA 2FWLB 1PLAA 1I53A 3ABLB 2FQGA 1PNDA 1B3IA 2XLLA 3GDCA 5PAZA 2PP9A 2FTAA 3FU7B 5AKRA 5IY5B 1SF3A 4BXSV 1AZBA 2XWZA 5I5MA 2WO3B 4DP6X 1ADWA 4WTQA 4E9SA 5E9NA 1A4CA 3JT2A 2W88A 4G70B 2BZ7A 5EHFA 4GXFA 4Q8BA 1AANA 1W8EA 3QJSB 4YSPA 3NYKA 4GP5B 3FPXA 4E9WA 1NIDA 1NZRA 3S8GB 1ZPUA 2FJSA 3OM3B 3NJIA 4CSZA 4BDVB 2IH8A 3EHBB 2EIMB 2YAHA 3FQ2A 1OE1A 2CCWA 4F2EA 1L9PA 4WKXA 2Y1AA 3QJVB 1JERA 1E30A 7PAZA 1BQ5A 2R7EB 3T6WA 2TSBA 3FQYA 3V9CA 4UANA 2H3XC 4YSTA 4AI7A 1KCBA 1AACA 1ID2A 1PF3A 2MRYA 1R1CA 3CDZB 3QJQB 4F7KA 1X9UA 3KW7A 3ZX1A 3WIAA 3PXLA 2PCYA 3QPKA 1OCCB 2VM3A 5I6LA 1DYZA 2YAMA 1JZFA 4RH4A 4Q89A 4A2EA 2P80A 4HIPA 4DP2X 4HCFA 1MG2C 1JZHA 2IWEA 3OQRA 1XB3A 2FT7A 6PAZA 1BYPA 1E5YA 2IDUA 1W6LA 2UXVA 2BWIA 3FSVA 1QHQA 1JOIA 3NJKA 4YSOA 1L9OA 1SNRA 3FU9A 4KNUA 1AAJA 2PP7A 3QJRB 2B3IA 4YSEA 3ABKB 2ZONA 2A3TA 1BEXA 1NIBA 1E67A 2IWKA 4GY4A 4BWUA 5B3SB 3NP4A 3EF4A 4A2DA 3PAVA 1TEGA 2H47C 1OOWA 3TASA 3X1BA 4P5RA 1SDDA 1NWPA 1GR7A 2YAQA 4GP4B 4E9YA 2HLEB 3CZUB 2QDWA 1PCSA 1L9SA 2BP0B 3T6XA 1PZCA 3AG4B 2J55A 2JXMA 3OMNB 2VM4A 2EIJB 2FQDA 1CURA 3ABGA 5TK2A 1XB6A 2BO0A 1JVOA 1PMYA 3T9WA 1ASOA 4UF7C 3IE9A 2PP8A 1DZ0A 3NP3A 3CG8A 4KOBA 1RCYA 1TKWA 4YSDA 3ZBMA 4YSCA 1NTDA 3NT0A 1JZEA 1AG6A 2XV0A 3FS9A 4BXVA 2BW4A 2VMJA 4KNSA 4BWTA 2QPDB 2VW4A 1ZDQA 4NAJA 1XB8A 1IBZA 1J9RA 2BP8A 1ZIBA 3ERXA 3AG3B 3WKQA 2GC4C 3H4HA 1CYWA 5B1BB 2N0MA 2IH9A 4TXVB 4DP1X 2EIKB 1GS6X 4E9QA 3QJTB 7PCYA 2B08A 3BQVA 1MDAA 3G5WA 3EH3B 4X4KA 2CJ3A 1OCRB 4W1TA 1V10A 5I6NA 4E9VA 3MX0B 3NJLA 4E9RA 3WG7B 3EH4B 5I6OA 1T5KA 1JZIA 3OMAB 1ET8A 2OV0A 2PPAA 3JTBA 3OMIB 2DYSB 1PZAA 1URIA 4YSAA 4FAAB 2AZAA 1VLXA 3BVDB 4A66A 1A8ZA 3FSAA 1GSKA 2JKWA 3DKHA 1PY0A 1AZCA 9PCYA 1AZUA 3FQ1A 3EH5B 2QDVA 8PAZA 2PPFA 4YSRA 1J5CA 2GB2A 1PLCA 1L9TA 3NJNA 3ASOB 4GYBA 4HCGA 3TBCA 3FU8A 3FYEB 2EILB 5I26A 3X1FA 2CALA 3T6VA 4YSQA 4BWWA 1SFDA 2PCFA 1BQRA 1FFTB 2DY2A 3S3BB 4KO5A 2Y69B 3X1GA 4YSUA 3FYIB 4A2FA 1PNCA 1V54B 5AFAA 4A68A 4DP5X 1QLEB 4L0PB 1OE2A 2FT8A 4QLWA 2YAOA 2HRGA 2DWTA 4M3HA 2UXFA 1KCWA 1KV7A 1HAWA 5LDUA 1JVLA 2UX6A 5I6KA 2JFCA 2CAKA 3PAUA 4G71B 4AKOA 1GW0A 2LLNA 3RYMA 5ANHA 1XMEB 1E5ZA 2PPEA 4N8UA 4NB7A 2YAFA 2OJ1A 3PCYA 4DP7X 3HB3B 1NPNA 2VSKB 2YQBA 5F7BA 3N2JA 1KGYE 3FSWA 1J9QA 2ZWNA 1AS6A 2IAAC 4UAHA 1OCZB 1BYOA 4KNTA 3AG2B 5A7EA 3CVCA 3NSDA 4DP9X 4DP4X 1JXFA 3TA4D 2Q5BA 2BZCA 4KO7A 2TSAA 4BK5C 1NIAA 3UAAA 2I85A 4AX3A 1ET7A 1NIEA 1MG3C 1ASQA 3T6ZA 2OCCB 1NWOA 4M4RB 1RKRA 3L45A 3V9EA 4DP0X 5D4IA 1OCOB 4ZK8A 1A65A 2Q9OA 1M57B 4W9ZA 4A67A 4AZUA 5I5IA 2FQEA 3SBPA 1PZBA 2I7SA 2PLTA 1WA0X 3DIVA 1ZIAA 3HEIB 1A4BA 2XXFA 2GBAA 3OD3A 3S3CB 2P80D 5I6PA 2IDTA 2PPCA 3TBBA 2I7OA 1BXUA 1PLBA 2YXVA 4N4YB 5D4HA 3D12B 2DWSA 3WI9A 1TEFA 2W8CA 4G7SB 1SF5A 1KDIA 4PCYA 4E9XA 3WKPA 1KDJA 1AZNA 3X2QB 5B7MA 4G72B 4NERA 2WSDA 2IDSA 2XUWA 2UXTA 1JXGA 3SQRA 4A2GA 1N68A 3UAEA 5FC9A 4MFHA 3NJHA 3CVDA 4DPCX 2AFNA 4DPAX 2HXAA 3FU7A 4JKNA 2HX7A 3AG1B 2XX0A 2XU9A 1M56B 4YVUA 2BP8B 5F7AA 1OF0A 2IDQA 1JXDA 1AIZA 4CSPA 1GS8A 2BHFA 2RACA 1IUZA 4HHGA 2J56A 3GYRA 1ET5A 5AZUA 5B1JC 4ENZA 4P5SA 2DV6A 3IN0A 3FT0A 3NJGA 3X1EA 2XV2A 1JZGA 5PCYA 1RZQA 4KO9A 3NSCA 4BDVA 4G7QB 1WAEA 3ZDWA 4KOCA 3H56A 5I5JA 1ILUA 1X9RA 3IBOA 4EF3A 1ZDSA 4FA7B 6PCYA 2GHZA 2FT6A 1NPJA 2R7EA 1IKOP 3UACA 2J5WA 4HALA 2YAPA 1FWXA 1YLBB 1PAZA 4HHWA 1KYAA 1HFUA 3CDZA 3SBQA 2VSMB 3QQXA 1WS8A 4YVNA 2CBPA 2H5UA 1NIFA 1AOZA 1WA1X 1J9SA 5D4JA
chains in the Genus database with same CATH superfamily
3LPFA 4XPFH 1HS6A 3FO0L 4PYGA 2AK4E 3EFOB 4L4VE 5BRQA 4KK9C 2ZXCA 2GSGB 2PCFB 3Q44A 3IKCA 1EBAA 4N0CC 3ULAB 3UADA 4OCRL 5CLZA 3HNSH 4I48B 2MQGA 3BVNA 3DGGB 3THMH 3FT2A 4NZUH 4F93B 4PVLA 1D9KB 3QG6B 4PRHA 4APQC 4ZW8A 2YEVB 4LKCA 2X40A 3B9KB 5ABDE 1FDLL 3SDDD 4WFEE 4HS3B 2HVJB 4S0TD 5TE6L 3E2HB 3N55A 5EPMB 3SDCC 3UEZA 3W1ZA 3CFNA 2J57A 5I6MA 4UILH 1CZ8L 3Q2NA 2VL4A 3C6EA 4HMEA 4ZFZA 1BHGA 4QGYA 5CSZB 4YAQA 1AZRA 1LEGA 3ARDC 3S35L 2BIIA 1PL3A 4NNPL 1ZPLA 5SWZA 2HPTA 2J8UA 1JV2B 3GMLB 1IBBA 1A6UL 4O9HH 3EO0A 2BS71 2YGPA 2WOBA 1F58L 5JOPD 1WZAA 2E4FA 1ZMYA 3DVNB 4H1LH 5LBSL 3FONA 3VMPA 1DO5A 4C56D 1KXTB 2DM7A 3TPKA 5C0EA 4TTDC 1CD8A 1MCPH 4TNWK 1NCCH 5GGSY 2LTQB 3C6LB 4DN4H 1YEIL 1JXKA 4PLKD 1ORSB 5I73C 2NLJA 1ECYA 1HHIA 2XVGA 3A47A 4O5LH 4M1GH 1JK9A 4N25A 3U9WA 1NPUA 4G8GB 3T8XA 2LU5A 1F3DJ 4X5LA 3UPAA 4YL4A 1OHZA 3G6JB 1NAKH 2CDGB 5CN2A 2NY3B 1JWUB 4G6KL 4NXKA 1LILA 3VACA 3C5JB 5LAXA 3S34H 3NJMA 3ULUH 1PG7W 2AI0L 4XGZB 3MX0A 4DQOL 4PCKA 5C86A 4C4KO 4DPBX 4ABVA 2WXNA 5SWSA 1P1VA 1WS7A 3UG3A 3MUY1 4ONOA 1JCVA 1MFDH 3FQWB 1OF2B 5CS7A 3ARGA 2H6PB 3VI3A 4G6AC 1WA2X 2W65A 2DRUA 4FMFA 4QXGL 3RZCA 1CTOA 3EFDL 3GXUB 3MOAH 4F2FA 1I4FB 2WQRA 2AV1B 1RURH 3O4LD 2P8LB 1I53A 3P3YA 4OT1H 1L3NA 3GHEH 5FB8A 3GMOA 5PAZA 1BVLA 1MIMH 5GSRB 4L4VA 5CEZH 1AZBA 5AW5B 5T1LA 1BF8A 5FHBH 2BP3A 2NX5E 3FKUS 1BFVL 4W9IC 4YEEA 5C9KA 4JNXA 4JRLA 4L9DA 1XH0A 1AXSA 2EH7H 3MUZ1 4NQED 4DEWA 2QL1A 3K8KA 2BZ7A 2ZSWB 4L9LC 2MOVA 3SYQA 4K7PX 4WFFE 1IGML 5KBMA 3RWCB 3ZE1F 4E9WA 4E68A 4XODA 2QHRH 5A2JH 2CCVA 3RTLA 2QQNH 1MPAL 5ESAB 1W2KT 4OIIH 3GFUA 5AYTA 2Q6WB 4HA1A 1FVEB 1BVKA 3FZUC 5J4MA 4AYGA 3FTVA 3QZLA 3F3HA 1BOYA 3WD5L 2YUXA 5IBUG 3GSVB 4G2AA 5KS9B 1N26A 2H26A 1BPVA 4NP4L 4FE9A 1AH1A 4PW9A 1SBSH 2WZ0A 4M48L 1S8DA 2J8UF 1FFPA 3X3FH 4BSVB 2R0KH 3ZX1A 1G6RH 4LVHB 4RQQB 5DS8A 5F7UA 5I6LA 5KVDH 2X42A 5D7KD 5EA0H 3O3EB 2JI3A 3L95A 3N1GC 5DUBB 3RNQA 1Q94B 1W6LA 1IGIL 1KELL 3L5IA 3CK0L 1OPGL 3NEOA 4XPBL 1UB5B 3JTTA 4OLUL 4IKIA 1KZQA 3EYQC 4WI3A 3LS4H 1KBGH 2WP3T 4M1CD 4AEIL 1FGVH 3STZA 1NGZB 1D9KC 5KJRH 5DMKB 2VSDA 5GRZA 3JVFC 3B9KC 3MOQA 1LO2L 4QOKB 3A22A 5CU9A 2YEZB 1DBML 4RA0C 3E2HC 4NKMA 1R9FA 1TEGA 4ODXA 4NRXA 5CILL 4QHMB 3DPDA 3X1BA 1VADB 3BAJA 5FWRA 3HVDA 2X2YA 3TXAA 4TUKH 1PG7X 3ZYZA 2HLEB 4FABL 4DKFL 5IBLD 5IFHL 4IRSB 1CFBA 3GRBA 4KMQA 5DMGD 5I8CB 5JHLA 1MVYA 3L6FB 4JBSA 2YD5A 3W9EA 2V33A 3VI3F 2ADYA 4LIQH 1UD3A 3D4YA 3ET9F 4H26B 3ZT5A 1FLRL 4R7NA 3GDBA 1OB1A 4GOSA 5D1XB 3V0IA 5FA4A 3S88H 4TVSa 3SE6A 3VXRE 1T66C 2D31B 3MXVL 2D7TH 4U3CA 3ZE0F 4F37K 3KLHD 1F4XL 4KOBA 3LJ3A 3ZKMD 3C6LC 3U0TB 3JWOC 1BZQK 4PPTA 3OPZH 4U1KB 1EHAA 3CX5K 4D0DB 2NX5A 2OMTA 2XV0A 2OXHB 4G6JL 4LRIC 4BXVA 3L3IA 2UY6B 2VMJA 3HG5A 3H2WA 3VGDA 3VI4E 2HKAA 2BS8A 4LHUG 3CZLA 4U1GB 2NY3C 4I13B 4OJEH 3UTSA 4NAMA 1KNOA 2QPUA 1DVFB 2WLIB 3GWJA 3UAJA 3CXHJ 4KKBC 4AC4A 3FQUA 4Z5RB 1JG9A 1SN2A 3NIFE 4W9JC 4LLYB 1GS6X 3RRQA 5EU4A 3BPCB 2DIAA 4QXVA 3GLZA 3EH3B 1CGTA 3ARXA 4IIZA 3VDCA 1CD0A 3SYPA 2YPLB 4F7EA 3NEEA 2J88L 5I8EA 1HCZA 1KGUA 3QXVA 1U8CA 4M5YH 4WEMB 3PUUA 2BSRB 3D0VA 4AIXA 5JNYB 3U1SL 2Z93A 5SX4H 1KPRB 3QP3A 5IQ9B 4AZ8B 1NCAH 1DLHB 3EJYC 3P0YH 1IFHL 3CHXA 5JOFB 3I85A 4QAMB 1K8DA 4L8DB 1BGXL 3NJVA 1E3XA 2XZAL 1CXIA 4KKLC 4X9FA 4YBLB 1PQZB 3MRLA 1CFNA 1QRNB 1QTPA 1DQML 4F5CA 3NPZB 1F8TL 2YQ3A 5JHLL 4BZ1H 1M1XB 4CDHA 5I1DA 1H8SA 4U7KA 3TH3T 3NIDB 4JDTL 3MV11 4BWWA 5E24E 4I0PD 2FBRA 1KZYA 2WXKA 4PTUB 4KC3B 5F7KC 1G0XA 4J3OH 2XJKA 2CUHA 3L3OB 4CADA 1KG0B 3MLUH 4YDKL 1MEXH 3VD4A 4RETB 3VA2C 4AVHA 1MLCB 2BC4B 5IQNA 3LNEA 4BFIA 2HLFD 3TYFA 4XVUD 4YUEL 2XXMB 1U95B 5EOQH 5L4JA 2WVSA 5CJBA 1NFKA 1I8IA 3SKMB 3WIIH 3EYSH 1SJEB 4MA8H 2A6DA 3CVHB 5FGCB 3IMTA 3LQAC 1GW0A 3RYMA 1RUML 5DU7A 3AAZA 2DM2A 1JK8A 3P3RA 3DXAD 3MGAA 4LEBA 5IBTL 4YH6A 1GHFH 2NCEA 4BK5A 3VJ6B 1A14H 3MRPB 2GABA 1BMZA 1G7IB 1G7PB 5GPRA 1SJHB 5IWLC 2EC9T 1DQQB 4Q74A 3VI4A 4HFWB 1QSFE 4U4IA 3AG2B 3AU0A 4JREB 4M6NL 1R3KB 2NT1A 4L29B 1FLTX 2BZCA 2EUZA 4IBLT 1WFMA 3OKOB 5ANMB 1LP9E 1NC2B 1PS3A 1U8PA 1UZ8B 1AGEA 4L4TE 5J8OA 4DZBA 2Q76B 4W9ZA 3SE8H 4IRSC 5JLZB 2XWBA 1TVBB 4JO3H 5DHVA 1OTUD 2AGJH 1A4BA 4UOQA 1HYSC 4HT1H 4MAUH 1CU4H 2PTTA 5FM8A 3OBAA 4FQ1H 1LWJA 4P5KA 5CEZD 5EUKB 3BW9A 3I50L 3ZZQA 5GHWL 4D8PA 2IDTA 4HJ1A 2V6HA 5D1XC 3V7AG 1BXUA 1N64L 5DC4B 4B9YA 1ES0B 2QVMA 4Y2DD 5JIKA 4ZJ9A 1NL0H 3LRHA 2DWSA 5GGSA 4YXLL 1QHOA 3LKRA 4LBAA 4LSQH 3JVGC 3FT4A 1H6UA 3SYAA 1MVUB 1KDJA 5B39A 1OL0A 2JK5B 4OGQC 3UFIA 4KKCC 4APXA 2G4GA 4MBRA 1RV6X 4EQ3A 2P28B 2V3DA 4JRYE 4U1GC 1UWXK 3C2AH 4GKOA 4OJAA 5FW7A 1D5RA 3W0WE 1INEH 4PR5A 1DVFC 4MCYB 5KN5A 2BSED 4N87A 4O58L 5D4QA 2IADB 4Y19A 3S96B 3TPUB 1DQIA 1M56B 4BGDA 1Q72H 2BMKA 4HJGB 7CGTA 4F3FB 3U2SB 3TBSA 3OTTA 2VABB 2P5EB 4I1RA 1QMUA 3GRGA 3VG9B 3F5WA 4KDWA 4DVRH 3P02A 4F20A 2NSMA 4AJYV 2WUBL 2J56A 4NCDA 2M26A 4WI5A 3ARED 5T1KD 3AJ7A 1OP5H 3EYFB 4YE0A 5I15H 4TQEL 4MB4A 5ACLA 2LU3A 2CHDA 2BNUB 1UWXH 3T0EE 3OKDA 1FYTE 3B2PA 1RH8A 5T3XH 1NBZA 1NBYA 2YEQA 2NY1B 3RZWA 1HL9A 2AEPH 3GBNH 2HVKB 4WUUE 3UGXA 4YHPA 1J5HA 3N85H 1IGFL 1MF2H 4R90L 4WO4C 1IT9L 5HYQB 4FHKA 1UWEL 4X6EB 3F6JA 5HI3D 4YBLC 1N5AA 4IRZH 2JQZA 4K8RD 4BFGA 5DDHB 1A66A 3E6HA 3GSUB 4RMWA 2LAGB 3QQ3B 3LKPA 4M5TA 1UACH 1F86A 3ZO9A 4JPQA 3VI4F 3Q6FB 5IB3B 1Z9NA 4U1SA 2PW1B 2YSTA 4E41A 3DSFL 1T0OA 1QSFA 4YBQC 3MCKB 1U8LA 2F53B 1UOVA 4GPVA 2CO7A 2HJKB 4M6OH 1QZNA 2CXKA 1LP9A 1Z9LA 3L3OC 4JLRA 5DD0H 4QD2E 4XPGL 2FECL 3WTUA 4L4TA 2ED9A 4JFFB 5B3JF 1MZYA 3LH2L 4X9GA 4PJAE 4N8VB 1F4YH 3MKGA 32C2A 1YMMB 1U8MA 1ZAGA 5HGDA 1GZPB 2IPKB 2AJUL 5A2BA 3MJ9L 5C0BB 2CDFB 1K5NB 3P77B 5LQBH 4NQDE 3AY4A 2I32A 4DVBB 3CFQA 1SMDA 3BEVA 2DD8H 2KPNA 4PJ9D 5AKSA 2FNWA 3MGTB 1HEJC 3IDMA 5IHUH 3B5HA 3U4KA 3KLSA 1CLCA 4JRYA 4XTRC 2H0PA 5KSUA 4F2MB 5MEOA 2WKGA 1KB3A 4JREC 1UVQA 3W0WA 4ALAL 1IGYA 1EJOL 1WWBX 4CW1A 4GLRI 4M56A 2KBGA 3QUXD 2XOTA 4PRPA 2FX7L 5AQ0A 5FXCH 1XIWD 2N7AA 3CUPB 2BIOA 2ZSVA 3VXTA 4KK8D 5HHOB 4XWOC 4JN1L 4UZUA 5DMIH 1AQDB 2QPFA 5I0XA 1LL1A 3K8MA 2UZXA 1K9TA 1LNUB 5J9PB 4PB9H 4GXUN 1XCQB 1IM3A 4LSUH 2XWRA 3CWGA 4JRWA 3VU1A 3H53A 2EDHA 1TJHH 4LPXA 3E9UA 3DO7B 4I9XA 5E1QA 1IE4A 1PGRB 3MLRH 5L9DL 2NY4B 2A1WL 4UT9L 1V7ML 5EBGA 4PP2A 3U48A 2PWEA 4GRWE 5B1KA 3UO1H 1N7MH 1LTXA 4JHBA 4YHYB 1PPIA 3KYNB 2QADB 5BO1L 5E8DL 1P6AB 2VERA 2VN3A 3KH4A 2E7LC 3EJQA 4LGRB 2W81C 3BJLA 2L04A 3W38A 3FK3A 2KERA 1H3PL 3VG9C 4W4OA 1MREL 1LP9F 1JHKH 2FEEI 4HDIB 3TFKD 1IJNA 4RGNB 3L9YA 4U49A 1P9MA 2BP5M 3DHPA 3W5MA 2WKOA 4DP6X 2D3JA 4L8CA 4G6FB 1RIVL 3ILEA 4BZ2L 1BFOA 1YNLH 4MX7A 1A7PL 3LHPL 1D5MA 3ZVVA 2EH8L 4PTTB 5EG6C 4PJAA 1MN4A 3C5SA 3VFRB 4EN2A 4S1DC 4EKJA 4XCNA 3R8BB 3ZRFC 4JFXA 3WEOA 2NY1C 1MFAH 1E0OB 1PG7L 1X7TA 4OR1A 4UDUB 1VA9A 5E8EB 3TJHC 1Q0YL 3GXFA 3N1FC 3UTTB 3D9AH 5TE4H 3GXNA 1XGPA 1B2YA 5I9QB 3FJTA 3K5SA 4NQDA 1ZLVK 2UUDH 5AZ2H 3ZUNC 1XCWA 1XDTT 3FB5A 1X4XA 2EABA 2ZWLT 3OC5A 3QHZH 3N41F 3DVGA 4IMKC 3SE4C 2OJEA 5DURD 5DLML 5B38B 1RVFH 4QTHA 3TEXA 1D2PA 3CN3A 3QIUB 5E08H 5I1CH 3NGBB 4Y16D 4LCUB 4UIKH 5HYEA 1HINH 2MPAH 3BAYA 4YSTA 2BCMA 2NMSA 4OFDA 5GGVL 5B38G 2V5YA 3D69A 4LSSL 5JQ6H 1T0NB 2V2TA 1JGUH 5BJTA 4PJIE 1I8MA 3AC0A 1CXLA 5H4ZA 3KLKA 5GJSH 1WWAX 4JFQB 1YEKL 3QPKA 4GAGH 5DZLA 4BRVA 4HK3N 3D4CA 5L2KE 2BJML 3KPQA 4KI1A 1DQKA 3L4YA 4A2EA 2YD6A 1UD2A 4PJHB 4DKEH 1U91A 2NNAA 1E5YA 4IGBD 4PV1C 4XPAH 4NKIH 1IZJA 2E9IA 4WV1B 1OSEA 1JOIA 4HS8L 4IIQA 4WW1A 4HUWA 5C92A 1WGVA 4R26L 4HLZG 4WGWB 5IT2H 2NCMA 5LGKA 3GUTA 3HMXA 1KCSH 4B9PA 4MMZB 4MAYB 3SDYH 2BOCB 3ULVC 1O6SA 5EBWA 5JW3L 4BWUA 1YZZA 4WENB 4P2QE 4A2DA 3BZEB 1KXVC 5DZPA 3AXLA 2IV8A 3CSTA 4RDQG 2VDMH 1SDDA 1QSZA 4P04A 1NCGA 2ZQKA 4RMUA 3T3ME 3BGMB 5ADPH 4Z7OB 3NK4A 4I18B 4LHUA 3SPGA 2V8LA 3WIFB 3H9SD 3P11H 3OMNB 4O02B 3VGAB 1DUYB 4XP1L 1E8XA 3CFMA 1DL7H 2FQDA 4UIMA 2YK1H 3ZKQD 1HDMB 1HOEA 3EDFA 4YGAB 4ZO6A 3DJTA 1T1WA 3MV9E 3D34A 4Q7DA 2JF1A 2BWQA 3CG8A 2BFVL 4I9WD 3ZSSA 4EE2A 2G2PA 4FL4B 1YEDA 2VDOH 1XXDC 2WKOF 4PRHD 3AS1A 4AIZB 1DVYA 5ALCH 1ZDQA 4PJAF 4O51A 4H25A 1XB8A 2XWTB 4OCLC 2EDLA 3ML9A 2PETA 3F58L 1JGLH 3D85A 5DRWB 1IC7H 4M7JL 1EAPA 1I9RL 2NY4C 4OZFA 2JTYA 1U3HB 2Q8BL 3G08B 5HGBB 3TJEL 2B08A 2WAQA 3PABA 1MDAA 4D8OA 4GMSL 4UV4H 1A6ZB 3US9A 5SWZD 4FADA 4YHYC 3AS0A 3IJYB 3RWJB 1OVZA 2QADC 4A7SA 4FG2A 4N2EA 4XMZA 1VACA 3OL2A 3TZVB 1X5YA 3DYOA 3V0WH 4PJCB 4NO0A 4ONHA 5HI4D 3CXHK 1DQJA 3FL7A 1JGEB 3MO1B 2GBUA 4KJYA 2WYTA 4P8QA 2B1OA 1U8NA 5GISH 3OKNA 5E70A 1M42A 3D3VB 4ZOAA 4XMKL 4NKDA 4DJMA 5D1ZB 3QDGE 4RGNC 1OALA 1A8ZA 3F65A 1RULH 5MEQA 3U1PA 1RIHH 4QF1B 4I3GA 2VN5A 3FFOA 3TBYB 1J5IA 1SMOA 5E8PA 3BP4A 4AW7A 2BVPA 3MN8A 1RZ8B 2H6OA 2IVFC 8PAZA 4NRZA 4GBXA 4G5ZH 1KC5L 2EACA 2ICCA 4NM4H 5E00A 5CGMA 5GJTH 5IQ7H 4GYBA 3ZDZE 4QXUL 4PJ7E 3MRHA 4IKNA 3FUHA 4B0MM 2Z91B 4WUKH 4QT5A 3INUH 2MHAB 3CC1A 2QR0B 5SWSD 4AVKA 3FOMA 2B2XL 3MKKA 5TDOB 1UUNA 4KK5D 4P57A 5I9QC 4P2QA 5JPNB 1INQB 3B5TA 3ARGD 3QCVH 4ZOBA 3RKDD 3CQFA 3IJSA 3RZCD 2P5PA 3NACL 5K9OA 5E6UB 1UOKA 5EZIH 3QIUC 5I18H 5JA9A 3NGBC 1RI8A 2QQKH 2HRGA 4OLEA 3QDHA 4JPWL 5F0PB 3VSUA 5INDB 2DLFL 3KJ6H 3Q1SL 2D7QA 2B1HL 5T1LD 3AUWB 1ZK9A 3Q7JA 2ICEA 1YC7A 4E5XB 2F19H 1OW0C 3MV9A 1L9MA 1E4KA 3ARFD 1NGWA 2XTJE 3RL1A 4RRPM 3SY0A 2NYYC 1P7HL 5I1GH 3CH8A 3HB3B 5MENE 3Q6GH 5IROA 4WV1C 5KZCD 5KBKA 4M7KL 1ZANL 3FT2B 1M7DA 5HYJE 2YQBA 3WY2A 4NZJA 1TTUA 4P59H 1TJGH 3VB8A 4MMZC 4MAYC 4K2UH 3ZMEA 1UA3A 1TFPA 4DUXA 3QJHA 3UBXB 3D07A 4KNTA 3I9PA 4OGXL 5CZXC 3BSZH 5TF0A 1Q0XH 1TQBB 4OTXH 3TNMB 5EU3A 2EZ0D 4KO7A 1NFDB 5DK0A 5AW0B 5IEHA 2V7NB 3KLAA 1X7QB 3VA6A 3MXWL 4Y4FD 2Q2LA 3D33A 4M4RB 5D5ME 4FXGB 4OZIE 4I18C 2B8OT 2P5WA 5IP4A 5IFAL 1WF5A 4NUGL 3VGAC 1KPVA 4AYDC 5I0DA 1GJUA 4OU3A 3ROLB 5KSBB 3TT1H 1E5BA 2F54D 1OAXH 5ACZB 3Q01A 4L1LA 4QTFA 1BOGB 3L3DB 4OH2A 3AABA 4GO8A 3UG5A 4Q52A 2G75B 5D55A 4UU9A 4TL5A 3RA7L 3STLB 2CXGA 2X10A 3N1QC 4FL4C 3WKPA 1HHIB 1AZNA 1PX8A 4H8VA 5E6ZA 3AACA 5ETUA 5FA3B 1A8JH 1KLUA 2UXTA 4Q9QL 4NUQA 3FFDB 4M5ZL 4MFHA 3U46B 2VC2H 3K6OA 4AITA 4OF0A 3VE0A 3FUMA 2V17H 2NXZD 3HC0B 1VFBA 5E51A 4W68A 2KI6A 2KC0A 1U3HC 3GB7A 2V5SA 2BNRE 2RR3A 1XGYH 3BZ4A 2CUIA 3VQLA 1S9VB 3K72A 4XPTL 4HHGA 1N0LB 3EOAB 1MRCL 3TZVC 1TZGH 1KBPA 1SOQA 3H55A 1K5WA 2YQGA 3T3MF 2QEJA 4GXVL 5M95B 5F3FA 1F45A 5ECGA 2Y4SA 4F8OA 1BVLB 1KFAL 1YAZA 2AK4B 3RUGA 5CEYB 1TNMA 5I5JA 5D1ZC 2FWOA 4EF3A 3GIZL 5C0IB 4DSYA 2GHZA 4M8QA 1PW3A 3MTRA 2FT6A 3GRWA 1JCKA 3SYOA 1WFJA 2DIBA 3UTSD 4S1SL 1T1ZA 3Q3GB 1M05A 3SEPA 3W2DL 5MENA 3UAJD 2IC2A 1OD9A 4JHZA 5JW4N 1P53A 1SQMA 1HILA 4PMFA 4X7CC 3V6FA 2P7TB 4NIKB 4URKA 2O6CA 4AT6B 4IHOB 5DEZA 3BQUB 3ZYJA 3NCCB 1S7SA 3G5ZB 2VZTA 5JPNC 1FGNL 1GYCA 2HRHA 2KMWA 2R0WH 2HWZL 5A2LH 1MFNA 1WH0A 4IKKA 4P3DA 1KY6A 2VW7A 1JNJA 4K9JA 2XZCH 2OR9L 2H26B 2J5LB 2UY7A 3GK8H 4M3JA 4TQHA 5D5MA 3HI6L 4OZIA 3A6BL 4U3SA 5D93B 1ASPA 5ESQA 4QXTB 4PS4L 2DWEB 3LN5A 1JF5A 3H9HB 1R3IL 5DS8B 3FW6A 1E6JL 1U30A 4Y5XA 1QFWH 3H3BC 3PLYA 3RIKA 5KSVA 2V2WA 3H0TB 5E2VH 5K59F 1DHKA 4FLHA 3QWOA 3M8OH 5GGRB 1RZPA 3HB3C 2HX9A 4U6HB 3UDWC 3LXBA 3ALWA 4P2RD 3CSPA 3DYMA 3D52A 4XOAA 5IB4A 3GEFA 4P46B 2PTVA 3HFML 4TNVK 4GSUA 5CBEA 4QLRA 5T5FL 1HHGB 4APQD 1KIRA 5DHDA 5TE7L 5E6IA 4BFKA 1QR4A 4WW2A 4XNXL 2J6EH 2WWMC 3H4FA 1T1XA 4ODXB 2UX7A 3ZDZF 5CJQL 3PDDA 4YE4H 2KUTA 5DYFA 4B6ZA 5EIQA 3OKEA 4PJGF 3MBED 1A9EA 3REVB 3SDAA 1SLUA 1X7SA 4FXGC 2L7UA 4F7MB 4GAJL 3M17B 4WWID 4JO5A 2GI0A 3W9EB 2FBJL 2MKLC 1Z9OA 2QFRA 1H9VA 4YNYA 1MRFL 1DDHA 1NC4B 2EIZA 3CDYA 4XC1H 4E9TA 4HIQA 4WWKB 2XPZA 1RPQA 1QLEL 2VLKA 3PWLB 3QFGA 1FVCB 1PYWB 1HZHL 2FSDA 2VMFA 1JV5B 3EDEA 2NY7H 2E8ZA 3RUGF 5IHZA 4AUUA 1X3DA 4OLYH 4WI0B 4Z8FH 2W0PA 1AQKH 2NX5B 2OMTB 2VLJB 5FUOL 2BVTA 3QEUB 3U7WL 4K9EL 3QZPA 1BG9A 1E4JA 3LQAH 3M88A 5E56A 4GEIA 2CM5A 4X6FB 1KN4L 5AVQB 2W80C 3RGVA 2YGVA 3AQYA 5AG9A 1S7XB 1RUKL 1CDJA 1PIGA 1L9RA 3ALXA 2ZNWA 1B0RA 1K6QL 4NYLA 1ZHBB 3PJNA 1CF8H 4NT6B 2VKWA 1YC8A 4AEEA 3S98A 3FRUB 4LCYB 3LN4A 4BYHA 1REIA 5BMFH 3I9GH 1CXHA 5I1KH 2UWEB 1I7ZB 2WP3O 1SF3A 1C16B 4OCXH 3TCLA 2E46A 3QUML 1PDKA 2HKHL 5AVUB 2HG5A 2DBLH 2JCCE 5K9JH 2I9LA 5BRZD 2C1PA 4WTQA 5D5MF 4F7CB 4G6AD 5CIPB 4OZIF 1O9WA 2X6BA 3HFFA 4MD5B 4Y5YB 3DIFA 3V0VB 3DPBB 5CNHA 1EVUA 2P52A 1HN1A 2Z8VC 5FUZH 1EV2E 2OCJA 4FNLH 1U0QA 1S9WB 3HLAB 3KEHA 4Y5VB 4ZTPH 2O26U 3ZXAC 5G4NA 2AABL 1CGYA 3L7EB 3MRRB 5A6LA 2YAHA 2P47B 1OE1A 4HPYL 1AIFB 4TNFA 1IKNA 1EQWA 2WVTA 4ZNCD 2ADIB 4HUVB 3QNFA 4ZUTB 5IVXE 3QJVB 4Y19D 5GGRY 1XGQB 4XXCA 3TNNB 4RFOL 1U8HA 1Q1JL 3MRKA 3M1BB 1XGTB 4HJEA 1QQDA 1M1SA 3HE7D 2X09A 2H3XC 1TVDA 3BQUC 4WW2F 3WTTA 1P7QA 4ZX5A 4UBDC 3QQ9D 4KUZH 3U4BH 4JKWA 5C0GA 2XTSA 5DO8A 2MSPA 4X4YA 1GYUA 3IFOA 4BBWA 3DOSA 1B4JL 1E6OL 2P80A 5DYOB 4HIPA 2DMCA 2FEEL 1WBXA 2IBGA 2J5LC 1MG2C 4XP5H 4NKOA 5D93C 1I8IB 1YNKL 3N44F 1WP6A 2ZUVA 1SNRA 2YD4A 3IPEA 3LB6D 4O2EA 3BO8A 2PP7A 4PUBL 3ETTA 3VXRB 2E4TA 3HC4L 1JK8B 2CIKA 1QW9A 5DFAA 4LEOB 5I1LB 3L4UA 2R1YA 4WHDA 2J3SA 2FR4B 4HU8A 3OKMB 4MDIB 1SXBA 4P0DA 4GKSA 2ERJB 3LQZA 2VLRA 2N7BA 4P46C 4E41D 2C3VA 1QSFD 2BP0B 4GFTB 3VGBA 3ILQC 4YDIH 2BHUA 2J55A 4JFUA 3OWEA 3SGEH 4QRQA 5CHNB 5D7IB 2FB4H 3QC5X 3NIFB 2Y07L 1JVOA 4F92B 2YZ1A 4C83A 4D7BA 5FPIA 2EADA 4R4FL 5FO8B 1A3RH 2DQTL 3LSOA 2R69A 4DZBB 4FZ8H 4B7LA 2PP8A 1MKFA 3V4PB 1DZ0A 2YPKA 3EBHA 3BCFA 5ISZE 4OKVB 4Z0BL 1J0ZA 4FYTA 2IH3B 1JZ5A 4GFXA 4YHLL 1AJ7H 1WISA 3ZBMA 5LDSA 4Z9KB 2JCCA 4P5KB 4G3YL 4D8PB 4AQ1B 5DHYA 4YFDB 4CMHB 4DGVL 1QBAA 1VSCA 4WWKC 2ROYA 5KTEH 1U92A 5AW9B 1PFCA 3QJFB 1ZXKA 4LHQB 1EK3A 3PGFH 1I1AB 1RK1B 2EDKA 3B8SA 3UL4A 1JP5A 2C9VA 3CVHH 3C6LD 3HC2A 4L3FA 3RY4A 4D94A 1A1NB 1MHPH 4F91B 3J2PA 4GW4A 4HJ0D 4JRYD 4H13C 3PNRB 1DSFL 5KVFL 4QRRE 1JGVL 3B3BA 3HZVA 3W0WD 5KVEE 2NDGA 1I8AA 1OT2A 1KGCE 2NY3D 1R5IA 5DJYB 1PZ5B 4AV4A 1MFCL 2AJSL 4G8IA 4KMTH 4NBZB 4PRPD 3IMSA 2Y7NA 1HC1A 1A6PA 3LNDA 3AQDA 3MNWA 4DGYL 1W72B 3D2UB 5JXEA 2QQQA 1E9PA 2OL3B 1CFSA 4HJJL 4HCRL 5CD5D 1PZAA 3PWUA 1UUSA 1A6AA 4YSAA 2YGOA 4U3XA 1IGJA 3FMGH 4G6MH 4X8JA 2W07B 3NCJH 2O6PA 1IM3D 4KV5E 4ATWA 2Z0BA 3L1GA 1IL1B 1ADQL 1M4KA 4ADJA 3ZHLA 1ETZA 4GIPD 3NDYE 4Y5YC 3IXAA 4J3BA 5D70L 3UO8B 2OP4H 2P43B 4GI6A 1J5CA 4MSWB 1NBZB 4Q2ZB 1NBYB 5GIRA 4N6RA 1P5UA 1UJ3B 4Y5VC 1F90H 4FKKA 1N5YH 1G6VK 1KXQA 4XBGA 2HFFB 3MI6A 4JJ5B 1BQRA 3EBGA 2YRPA 1MCDA 1G7MA 2ZF8A 1Y0LB 2VITB 2R69L 3PHOB 1PNCA 1F5WA 1H19A 1XBDA 4WKZA 1T22B 4FZEH 4KXBA 2C1OA 4L1BA 5BVPH 2L7EA 4KRMB 2ED8A 3MUGA 4Z7WA 2FT8A 4U1SB 4G8FB 4C55A 3RP1A 4WY7H 1TQWA 4EN3A 3AWFA 2FJGB 2D7MA 1NGYA 1J0KA 3E8UL 4OD3L 4P23B 1KV7A 5LDUA 3CJJA 4OLWH 3EADA 3HS0B 1GPOH 2UX6A 1FORL 3CU1A 3MBWA 5C97A 1R3HA 1JTTA 3HAEB 5F3HB 5I1JH 4L4TB 4HQQL 3H42L 2WUCL 2J2ZA 3FO1A 4JKPH 4JFHD 1U3NA 3MA7B 2FL5B 43C9B 4HUXA 4RFEA 3KZ8A 2UZYA 4PREB 4J5VA 1P7KA 2JCCF 4LLDA 1U2HA 4OFYA 5T3ZD 3Q05A 1IGCL 2LLGA 5F97E 1HEZB 3ARRA 3FO2A 2EEBA 2QBWA 2Q5BA 4LQ1A 5EZLA 5EEUA 4BK5C 3HE6A 4UV7H 4MD4B 2D7OA 4UTAL 1RUAH 2WVVA 3PJSA 2ERJC 3B9EA 2GUYA 4IM8A 3V5HA 3NFNB 1TMCB 1QYGH 3U0WH 1GC1H 4DP0X 5KSUB 2X53A 4ZTEA 2Q9OA 1RZJL 4TUJA 3WSQL 2Y6SD 4B3VA 4QRRA 1QVOA 1PZBA 3QRGH 1IAMA 5EOCH 1IGYB 4CW1B 3QCUH 4IDJH 3FTGA 2DQJL 1SYSA 5DZJA 3TV8A 1K8IA 1J0IA 2EDBA 4OFQA 4R97C 1YJDL 3EFFB 5E8OB 3DX8A 5HGHB 2A4EA 4OV5A 1NMBL 5FYKD 1KENH 2JV6A 1KDIA 4A38A 3TBWA 4W81A 1X5FA 2MFNA 1J87A 4P3CL 4POZD 4JUTA 3C8DA 3EO1B 4AQ1C 1T3FA 2A74A 1NQBA 2JB6A 4CMHC 5L7XL 3VFSA 2VAJA 1TCRB 3U9UB 2FZ3A 3BLKA 3T0EB 1MXGA 1FYTB 1I1AC 4M7LH 2X3CA 1YYMH 3FQXA 5G5DB 4ZO9A 3DDFA 5H8DA 4U1IA 4WUUB 5JHDE 3LEVH 2H2SC 2AQ3A 3VFOA 4RWHA 4MNGE 3VH8G 3SKNA 1FC1A 5DR5L 1YN7A 5DJZA 1PBYA 4PRNB 4LHUD 4JQIL 5C7XH 1I8LA 3LRMA 5E5MB 3ULVH 3QUGA 5KG9A 1AIZA 4K7PY 1QLFA 3V7MA 4IBUA 3KE0A 5TFSH 1M3JA 4NDMA 4GUOA 4W9EC 3ATFA 3BN9D 3UJIH 4Z7WF 3KLDA 3L4ZA 1KMGA 5K1JA 4HYTB 3MLPA 5JPMA 5ABAA 4KRLB 3BH9A 2Z65C 1JZGA 5F7DB 3TO2A 5I0VA 3VFPA 3TIEA 4GRLB 1WHPA 1DVTA 2DI9A 1NCJA 3IBOA 3PQYA 4OLXL 4X0KA 1AO7E 3WL9A 4GINA 4XMTA 2YSSB 4TTGA 1TJIH 4TRPH 4QHLA 4MX7B 4IBVA 1D5MB 1YN6A 5I17A 1CDBA 12E8H 5F7EH 3CFDA 2VDQL 1KYAA 3D85D 3C5ZA 1G9NL 2DJ4A 2ATKA 2ZE0A 4F9PC 3K1DA 4ZW6A 5KVEL 1CICB 4NP9A 1J05A 4KTEL 2E6QA 2VSMB 5C8JB 1WUZA 1UJ3C 3BOVA 2G9HB 3WIHH 4P2AA 2OSLB 1U9KA 4GH7B 2NY6D 4HZLB 3S6CA 4JM2A 4NQDB 4M03A 4PYHA 5EFIB 3BIKA 4ZDHB 5D71H 5DI8A 4Z7QE 2DQGH 1UCBL 1U21A 2AW2A 4JY6A 5D9SA 3WO3B 2H41A 4MZRA 5DUMH 2W9DH 2QPEB 3DTUB 3H2PA 4A6YL 2PWGA 5AB9A 3UIZA 3OGCA 4OGYL 2Q3ZA 3E6FA 5BJTB 1PEZA 1I8MB 3KPSE 2B4CL 1TTCA 2BVQA 3O6LH 1JVKA 4P23C 4X6CB 4YBQD 3BDXA 4LARL 4PRAA 3HS0C 3EGDA 3I84A 3RX7A 4CNIB 4JFDA 2FHBA 4GQ9L 1LD9A 2AEIT 3DRTB 3CE1A 3MROB 3VW3H 5TDNB 3UEQA 3T8MA 1D6VH 4GBXD 4LPVA 4IIQB 4NO5B 4XVTL 1MI5E 1MY5A 2W5PA 3LKQB 3BDYL 3RAJH 1I1FB 2CCLA 3MRCA 2OW6A 4R7LA 4LT7A 1MUJB 1FH5H 1M71A 2P42B 1IBYA 3RVXC 5F89B 4UQEA 4LASH 5IQLA 4J23A 4R8WH 1AYRA 4YR6A 3O6KL 3AXLB 1DBAH 1NCWH 5FK9B 1IGTA 1SDDB 1A7NL 4NQCE 5DD1H 4K15A 3DROB 5E03A 4MNGA 2IDFA 4GRWB 5E1GA 4HLEA 3FPYA 2WXMA 1XFPA 5D1QD 2CJSA 1UYWH 3V0EA 2H0FA 5D7HA 3H9ZA 3VXMA 3GO1L 4ZO7A 3VGGA 2O5XH 2K8MA 4PG2A 3QVAA 3IB4A 4ENEC 3MV9D 4RRPG 1F56A 1EEYB 4YDJB 4X5QA 4DAGL 5I66A 5E7FA 4UM8B 2QLVB 4A04A 3GSRA 3ARWA 2CDEA 1JS4A 5SWQA 3F83A 4JFPB 2GSMB 5B1AB 3TCXA 5IROD 2BSTA 1YEDB 3TL5A 4FJYA 2UV3A 5DWUH 1YSOA 1ZTXH 5B7EA 3VXUB 1YEFL 4ANUA 1M7IB 1OE3A 3B1UA 4PV9B 4IOIA 4DZ8A 1UJTA 3MLYL 2NRDA 4FXKA 4O51B 4TLUA 5E2TL 3QH3B 3SBRA 2NUPA 3T0EC 4UMSA 3ZQXA 3LY6A 1UD4A 2RAMA 3GMMB 3D39A 2OSYA 1MFVA 1NKGA 5SV4A 4ZG1A 3U4EB 4XN4A 4YHOH 1LVEA 3ECBB 2P5WD 2RH0A 4JM2F 1PLAA 3QI9B 5DRXA 1TF4A 3ABLB 5EMYA 3U9PH 1LE9B 5T33L 3VFUB 4MAZA 2XLLA 1H15B 5L8KB 3U4AA 1GKEA 3DV4A 1I3RA 4GAAA 4YK4B 1VACB 3RU8L 3OZ9L 4F57L 2WO3B 4QI3A 5I8KL 2FATH 3QK0A 4E9SA 2J1ZA 3FQTA 1G84A 2P24B 4OZHB 3EGXB 4G11A 3S4SG 2W88A 2ZP8A 4PJIB 3OKNB 5EHFA 3ZDYF 5GRVK 4O02H 1H6EA 1ID5I 2GBVA 3CFCH 1UD5A 3JT0A 5L2KB 4PJ6A 5LJYH 4Z23A 2XKNA 3D4GA 4XMVA 1NSNH 3RHWF 5LXGH 3EYUH 5HDQH 1BBDL 3WMPA 3WJLA 1EPFA 4CSZA 5EZJA 1ZGLP 3QULB 1Q90A 5FLVA 4UDTA 4JG1L 5FKAA 3RVTD 5CBAA 1MJJB 3SO3C 5E6YA 5AAMC 1MI5A 4KX7A 4OUOA 1OAUL 4FFVD 4XNMB 2CKBL 4K71B 5FW8A 5FYLH 1CICC 3MRHB 1E30A 1T7WA 4S1DD 4G9FB 2VQ1A 2OCFD 2A73B 3MNZB 2LGNA 2NY1D 5FM5O 1DBJL 1XH1A 1WIOA 2ZXEB 4P57B 3APDA 2QPSA 4QHPA 3CDZB 1CFQA 4LNRA 1X9UA 3KW7A 5IHBA 3WIAA 3IJSB 4FQJL 2HP4A 4CU8A 4S10A 4NQCA 2PKDA 1DYZA 1J9CT 1Z9SA 4HGWA 4MRCA 1SEQH 5B4MD 4OCRH 1ZSHA 1NBQA 1BLNB 3WN5B 4LB8A 4XI5C 3B56A 1CE1L 1T0MB 4HWZB 4KROB 4XCYB 1GH7A 3CZNA 3KYAA 2F53D 3WMSA 2HN7A 4XMLL 1HH9B 1PAMA 4GKLA 3V6ZB 5IQMA 4GQRA 2IWKA 4KJPC 5BOJA 1CZ8H 5DRZA 1Q1PA 4OQTL 1OOWA 4IIQC 1S5HB 2Q3AA 3V0JA 4POYA 2VZSA 3MRFB 2I9TB 1JMXA 4FA8A 4WI2A 1QPKA 5HSFA 3CZUB 5IIEA 1SY6A 4MGXA 1X44A 4NNPH 1YMMD 4ETQA 4D0CB 1WD9A 1PTZA 1A6UH 4KZDL 3X11B 3ULVD 5DK0B 2JLPA 1CGSL 1LK3H 2VM4A 3HCVA 3QZOA 5DJ8A 5AG8A 1EEQA 1IX2A 4XHJC 2Y7QA 3AMLA 2YLHA 3L9BA 3U36A 5F7WC 1GYAA 1ZS8A 3VG0L 4M4PA 4PS3A 1OGAE 4Z7QF 3VYNA 5KBLA 1SQ2N 3IPBA 4I7ZC 1LJMA 1NTDA 1JZEA 3MRBB 4G6KH 2WTRA 4FQCL 3SHSA 4L3AA 2QPDB 1PZUB 3KR3L 3IJEB 1BD2B 4LLMA 1QWHA 1J9RA 3UJJL 4N0UE 2AI0H 4LSTH 2A0LD 4JO4L 3S36X 1BFTA 3QDGB 5ETUB 4U6VL 2IH9A 2E7MA 5DEGA 3K6SB 1K4CB 2R0ZH 3BHBA 3S9DB 5DUPL 1AKJD 4E9LA 2R83A 2VZOA 3OQ3B 4N86A 4EI6A 5E6ID 5DJCA 3V9FA 8FABB 3CFJB 5FW6A 5F96L 1ZHNB 5LWYL 1A21A 4QXGH 1XF5B 5EBLA 5J56B 3EFDH 2FGWL 5FECA 3E9TA 2NZ1A 4X80H 1E9OA 1HOCB 4PJ7B 4WNJA 4GG6E 3CFKB 5H2BB 3KWXA 4DCQA 3DETD 1JPST 3SDAD 3WMQA 3UYPA 2QSQA 4HKJA 1J88A 4QRTA 3QI9C 3KNBB 5LG6A 3RX9A 1VFUA 3GMRA 2OMYB 2DYSB 1C5BL 2X4UB 3K72B 1BFVH 1URIA 3QIWD 4YJZL 4YK4C 4O00A 3RDJA 2DB8A 4IU3A 2J1XA 4GSRA 2OZ4A 2VLKD 3FQ1A 1IGMH 3PL6A 4QRPB 4F8PA 1U8OB 1HESA 4JRXE 1FCCA 4OIBA 3P9MA 5C3TA 3D0LA 1WT5A 2WWOA 4M43L 5EC1B 1P4UA 4KJQD 1MPAH 2I07B 2EEFA 2F18A 2XTJB 4ZUUB 5JIQA 4FLOA 3ILDA 5CMAB 3WYRA 1FFTB 5HGAA 2K7QA 4F1SA 2WBJB 3WD5H 4BSWA 3REWA 5HYJB 1M53A 2WSPA 4IDLA 4K71C 1AC6A 4X7FC 1NBCA 1QLEB 3QQDB 3R7RA 3V6FB 3WHE1 4M48H 1HKFA 4FJZA 4IEFA 5D6DA 3RQ3A 2CSPA 3KG5A 4EAEA 4PG9B 4M3HA 4W9LC 3UTTD 4NO3B 1ZLWK 3MFGB 2NNFA 2VJ8A 1IQDB 1SUJA 2KH2B 3BZFA 3N6YA 3PAUA 4Q4EA 4AKOA 4NNYA 1LEIA 4CMMB 4GW1A 2X44D 4IRJA 4P9MH 3WN5C 4NB7A 1ZJBA 4CSSA 5ESQB 1X5GA 4KROC 1UM5L 1OGAA 3DBXB 4ODUA 4K3HA 1VFAA 3GJFA 3A3YB 1CJYA 1LO2H 4UTBH 4MVBD 4OLVL 2QSCL 4W9HC 2A6JA 3FSWA 2GUOA 1DBMH 4MWFB 1EA9C 1E4KC 5F9OL 4RX4A 3WTWA 1GOFA 3GI8L 5CILH 4OI9A 4MLSA 2EXWC 3QUMB 1WBYB 4N0UA 4PWJA 3VGEA 4LLQB 2TSAA 3KBEA 2ZOKB 1TITA 2NZIA 2RJMA 4ODHH 4DKFH 1E8YA 4ZYKB 1OP3H 4ZQKA 5MHSE 4L23A 4R7DA 4FFYA 1O7DE 3PV6A 3AITA 1A2YA 1MCLA 1RJZA 3O6ML 4HKZA 1P7QD 2XWDA 4ORGA 1FCGA 1MELA 1T1XB 2I7SA 1X5JA 1FLRH 2BX5A 2J8HA 4TVUA 3OJ2C 2RALA 4GG6A 4AYFA 2YXFA 3MXVH 3QPXL 3VH8A 2P80D 1F4XH 5I1AA 4PWIA 2I7OA 2BNRB 4ELME 3KPNA 4MRBA 2F1AA 4EIZC 3GGWA 3RJOA 3EG9A 2AJYL 2E8YA 4G6JH 4HUUB 1CXKA 4E9XA 1UWGH 2Y2TA 3NESA 4K5PA 4A2GA 4AJ0A 2A83B 2X4OB 3CQPA 3QR1A 3NZHL 1WIPA 4JRXA 2ITDB 5HY9B 4I2XA 3RHWK 4KTDL 5GS1A 3C9NB 4JKNA 2DPKA 2VLRD 4NOFA 5EC2A 2GJ6B 5F7YC 1CVRA 1KIQB 4Z77A 4FQPA 3VYOA 1P2CA 1ZXQA 5I74B 5IMMA 2ICWI 3F8UB 1CK0H 2J88H 5C70A 1Z5LA 3GTNA 2H0JA 4NYLB 3GPSA 5TH2A 1E9QB 3HZYB 1E5CA 4AEHL 2IAMB 3OLIA 4ZSOB 3U1SH 4GKZB 4MB3A 3J27A 3U82B 3WS3A 1OEZW 4ICXA 4PS7A 35C8L 3IMVA 2FD6L 4PJ8A 1RJCA 5C0FB 1IFHH 1NEZG 5LGYA 2Y5TA 1EZUA 1W9XA 4Z76B 1YEEH 4XCEB 5A6MA 2XZAH 3GMNA 4YHKL 2DWDA 2HRLA 4L3EE 4XX1G 3FB6A 1DQMH 4U0RB 1F8TH 1BMGA 2Y36L 1JHTB 3DIFB 2R2BA 4L3CA 4XMPH 4GUQA 1FWXA 3BESR 1FRGL 1SM3L 3DMMB 4F8NA 2VAAA 1MCSA 1MHEA 3DURA 4JDTH 4MQ7A 5ALBL 3ZHKA 3CH1A 3DVFA 4RESB 1WFTA 1A9BA 1DDTA 2DQIL 1J1XL 4K73A 2DJSA 2IH1B 1HWWA 5F1NA 2OMXB 2XSKA 2XTJC 3O8XA 4B7IA 1RUPL 2X1OA 4YDKH 1T21A 2LQRA 1UWYA 3ZZLA 4AV0A 3KPRE 2R1XB 5E99L 4Z3EA 1A4AA 2F61A 3APFA 3H7BA 2WBJC 2OTPA 2EO1A 5BV7L 3MRKB 3FOLB 5JXED 2X7LB 3R06B 4HV8B 4DO4A 2X87A 4KY1L 4RAHA 1UZGA 2VDPL 3CC5B 2XPGA 1KTBA 2B0SH 5I24A 3E80A 5DZVA 3B2UD 1DCLA 3FCTA 5EO0B 4GG6F 1RUMH 3ARBB 5D6CB 1EHKB 1GZHA 3TA3A 1UB6B 4OI7A 5KW9L 3F7YA 4AVIA 2A4CA 1V3MA 3RBGA 3DRQA 2D0GA 4KXZI 1RD6A 2ESVA 4UOJA 1G94A 1WQVT 1M9SA 3JWNE 2VXQH 5J6GA 3ULSB 3BO8B 3V4VL 3AU1A 1ZT7B 4HOZA 4M6NH 4WI8A 4RRPA 4DUWA 3V95A 4WHYH 3O9WB 5CIPH 2VO8A 1KEMH 4J4PD 4JVUA 1AGCB 2OYMA 1HL4A 3T77B 3F62A 3QXUA 4FQQB 3WFEL 2X4PA 1V3KA 3UJTL 4P5TA 4XVJL 2O5NA 4FTVE 3AW5A 4GQPH 2FJFB 2DQEL 3BUYB 4N5EC 1JNLL 1EGJH 2NY0D 3UROR 2C3VB 4QRBA 1M7UA 3IGUA 4KY2A 5FCUH 1T7VA 2NW3A 1HI6A 2E86A 3SOBH 3RPBA 4EN3D 3KCWA 3VXSE 3U25A 4U1MA 4H8WL 1S7WB 3BWUF 4WJ5A 1YVLA 1E90A 1H0DB 4PGBB 1HHHB 1EO8L 2YPVH 4GP8B 1N64H 1H8LA 1CPUA 5F21B 3QWNA 4YPJA 1IC0A 2A5UA 3L7FB 5DD5L 1T7ZA 1JL8A 1AS7A 1DBBL 5A3IC 3L5XH 4NJ9L 3DTXA 3V52L 4OFYD 1PD0A 1U8QA 1M9WA 4EEEA 1ZGLM 4L3EA 3ZW3A 3ZL2A 5E5RB 4Z1PA 1IMHC 1U92B 4MQSB 3CHPA 3S4SA 4CC0A 4B60A 3C08L 4O58H 1L0PA 2ZUWA 1Q9KB 4PGDA 1LO3L 2ZCKL 3WY4A 2A6KA 3ARVA 3WFHA 3RDTA 5FAAA 2WC7A 1HCVA 2H2PD 5I74C 3RGVC 4KDVA 2FQGA 1PNDA 1JPFB 1QG3A 3GDCA 3TCTA 1C12B 5D2LE 4QYOA 1UA7A 5ITBH 5IVXB 5IY5B 4HWBA 1BF5A 4TQEH 1HCYA 3NCFB 2HVBA 3QUZB 4H7VA 1JZ4A 1A7RH 5KYUB 4YXKL 5KYYB 3QORB 4QWWD 1XCXA 5G4OA 5JORA 2R2EB 2XYCA 5HDBE 4NPYA 3Q8FA 1J1OL 2MCG1 2L7QA 1HNYA 3R0NA 4NUJA 1OP9A 4R90H 1J7VR 1IT9H 4K5MA 1W0VA 1UWEH 5IR1A 2Q8AL 1DQTA 4L2LA 2RIKA 5HJGA 4TVPH 3WGUB 1K72A 4U0RC 2AS5M 5DRNA 2VISB 4NS0A 3V4PH 4KZEL 3IXAB 4QEGA 1DEEB 1BCIA 3X14B 5GIRB 2LAAA 2WQ8A 3HPLA 4XWGL 1NGPL 3DSFH 5LBGA 1MCNA 2V2XB 1JWMB 3BPNB 1A7QL 4FYQA 3NFPB 4JFEA 1XF3A 4RIRA 4WSKA 1DUZA 4KGJA 4F7KA 1USQA 1N4XL 1YCSA 5A43C 4XPGH 2X4QA 5I0YA 4X8GA 2AJXL 1XX9C 3FH5A 1TO5A 4WO0A 3W56A 3LH2H 2MCMA 1OXYA 3F7VB 3QPQD 5IVOA 3SZ6A 4DP2X 4Z7VE 1XQ4A 3IJHA 6PAZA 3RGHA 1XGRA 3VXSA 4WF7A 3HG1E 5F3BA 5H94A 1W16A 1WWWX 5DA0B 1TEYA 2E47A 4HG4J 5JHAA 5D7EA 3SDXE 4MHHG 4KZ0A 3PQYD 1HJCA 2M83A 3ARBC 3LKOB 2VH5L 3MJ9H 2R9HD 1W72H 2XIIA 5AAWA 1AE6L 4L37B 4BE5A 4Z6AT 2OL3H 5ISZB 1FL6B 4RFEB 1Z0MA 2GVYA 3EF4A 1PKOA 2H47C 1KTRL 3LHAA 5T1MB 4UTCA 2VXUL 1Q9LA 1L6PA 3BUTA 1C9SA 4MASA 3GJEA 4HWBL 3WE6B 1Q9OB 1RZKH 1RZFL 3O9WC 4Q0XL 3LEXA 4Q58C 4HC1A 4X7SH 1WICA 3MNVA 2KLSA 4PJ5E 2FX7H 2NW2B 3GF8A 1ACXA 1KB5L 2WVVB 5F1OB 5L4FA 1N6QL 4XBPA 3KYKL 3GNML 4LEXL 3T9WA 3C60A 3QEGL 1QATA 2G2RB 1R3LA 1HTYA 2SODB 2EQDA 4K7PH 4EJ1C 3TS8A 4TUJB 5HTSA 4QRRB 5EULV 3B6SA 3HUJE 4KHXH 1UWFA 2KS0A 1MIEH 5IKCA 2Z92A 1F6AA 3ELAT 4YSCA 4JFDD 3H85A 1V3LA 1AG6A 1FNAA 3FS9A 3NK3A 3RPIA 4A7VA 1CXFA 4KNSA 2ZJSH 2F5BH 2DQUH 4N2BA 2EEDA 2X4RA 5GGUA 3VDAA 5IB2A 5L9DH 3PY9A 4XH2A 3MLVH 3SZKC 2A1WH 3EO9L 4UT9H 1V7MH 3O11A 3HI5L 3MLTB 3TBWB 4HPOL 5ICZA 4N22A 3QFJA 4A6YB 4MNQB 3B37A 2GK0A 4L8BA 5J12B 3HAEH 7TAAA 4HIHB 1C8QA 1USZA 1JWSA 3HW7A 5BO1H 5AD0B 4TKWA 1CE6B 4YPGB 2CJ3A 1R0AL 1OCRB 2YOAA 3GJFK 3O0LA 3P4NA 5GGQH 1U93B 2XFGB 3MJ6A 5BZWB 1SHMA 4FNUA 4GG8A 1U6AH 2C9AA 2CHXA 3MRQB 4R4NC 4J12A 2ZKXA 4I3SL 4NQUA 3WG7B 2GITA 1J10A 2IV9A 2X3AA 1FFNB 3IJ8A 4YDZA 2OI9B 1H3PH 1HNGA 2CLVB 1S9KC 4NZFA 3OMAB 4ZX3A 2Y1ZA 1JGDA 5KG9B 2D4DA 2V7HB 5C6PB 1JYWA 2VLME 3R18A 2F08A 4M93B 2R1WA 2JKTM 2OYKA 1KJ2L 3VXMD 4I0CC 3PWNA 1EJFA 4FAAB 1IIKA 1VLXA 3A6CL 3MA9H 4TULH 4BZ2H 2ICWJ 3QUZC 1OZUA 3LHPH 3ARUA 3UYRL 5K9KB 2EH8H 3FRPA 4ODWA 3QORC 1VAHA 3FSAA 1GSKA 2JKWA 5FLUA 4WHCA 5F88A 5AALA 3HG1A 5ACMA 1PG7H 3LQMA 5TQ0H 5DJXA 1XCTB 3SDXA 1L9TA 2YMXH 3G5VA 4ZMOA 3EOBB 4NM8H 4K3DH 2Q86A 1Q0YH 4R3SA 3MLZL 1TDQA 1RZJC 4OLZL 1OGSA 4LLVB 5JHBA 4QHLB 3WN6A 1Z2KA 3F7KA 3MC0A 1AHKA 4J8RA 5MEPA 1SFDA 5CF3A 4JFOB 5EUOA 4H20L 3X1GA 2C7FA 2HT3D 1WIUA 1VDGA 1MJUH 1YJDC 2R0LL 4HSCX 3EOTL 1FL5A 3D39D 1J05B 2PCXA 4G43A 2HRPH 1OK0A 3DI3B 5B21A 4DO6A 4LSSH 4QLWA 3BPNC 1MQKL 4QY8A 4XE0A 4Q6YA 3FNKA 2E0PA 4X98B 1YEKH 3B83A 4ORZC 2Z4TA 3OXSA 1NEPA 2CBOA 4PJ5A 1HAWA 2K4WA 2IQ9H 2ILLA 1HQRB 4JW3A 5MERB 3MUUA 2O6EA 3WLWD 1SDAB 4PQXA 2PYED 4FG0A 1SN0A 3F12B 1WCBA 4HS8H 3P3SA 3TVMA 2PPEA 3OB8A 5KYXA 3NCEB 4I89A 3PCYA 4JO2L 4AIOA 4LSRH 1EXUA 4GAYA 1LO5B 3O6FB 4R96B 2IO5A 5BOPA 3CN2A 5ITFA 5C07E 5JW3H 4RAUB 3P4OA 1HYRC 1I7TB 1LD9B 4PIRF 4YZWA 1CGUA 4KDTA 1MCWM 1DVXA 4KKAC 4L8SB 4Z7NE 4HKXA 3NSDA 1E2VA 3TA4D 2GAZB 1IVTA 3AWGA 3HR5B 1P4BL 1FI8C 3RTQA 3UAAA 3MRCB 1NIEA 3L4CA 2Q1EA 2WHVA 4YO0A 2I27N 3U6RB 4NFDA 2W60B 1A1OA 1M71B 3LRLA 3QUKA 4QKXB 1A65A 3ESNA 1GMEA 4XP1H 1A6VH 3WXWL 4PJXE 4ZS6C 3TEWA 1ECZA 3A5VA 3HE6C 4S2SA 4PRIE 4KQ4H 3DOHA 1UM4L 4NQCD 1GW6A 2P8MB 3C8HA 4O2CB 5ICYA 4G80A 4BCXA 3KDPB 3Q5TA 3CBKB 3TV3L 2BFVH 3T1FB 2VDNL 2MIZA 1G9NC 2RQEA 5CJXA 2CKBB 4OM1L 5C09E 1SF5A 4FQXA 2Z8WC 1J48A 4EDXA 3T0DA 2K7PA 4I5BB 2CIIB 1TOXA 4HMCA 1FG2B 1MH5A 4TPRH 5I66B 4JY4A 3ZHDA 3II2A 4TUOA 2EDNA 4M7JH 4PFEA 2G5RA 4TVPD 2AAVA 1I9RH 1NEZA 3SDXF 4JZJA 5CLTA 2BSTB 5LUMA 1W8OA 2BRRL 2G0LA 3KXFE 2HXAA 2XN0A 3TJEH 2OTWB 1AO7B 1ZY9A 1MQ8A 2DLEA 1DE4A 4GMSH 1DJGA 2A74C 4P4KA 2B4CC 3Q43A 5F7AA 2IDQA 1J12A 5EUOF 5BS0E 4CSPA 1ND0A 5CZRA 1N10A 3KS0J 4ZMLA 1XO8A 4ZS7L 1SYVA 1ET5A 2PO6B 4JO1L 4PI2A 1D6EA 5B1JC 2ED7A 3VQ2C 5EBMB 1H8OA 4NC0B 2OI9C 3VNZA 4P3WA 5DRXB 2XV2A 3P4LA 3SQBB 3NSCA 4XMKH 1CDYA 4OUUA 4M93C 3DV4B 2QV2A 2WXQA 2ZKYA 3KYOA 1YEGL 5DT1L 2D7NA 3BUBA 3NCXA 5FGBC 2R2HA 4GRWH 2Q7YB 1KC5H 1K3IA 2GJZB 2YAPA 3D2UD 3KPSB 1P1ZA 4X6DE 4UINL 3BKCL 2VOTA 4XB3A 1AGFB 4ODBD 3TH4T 5C07A 4NQVA 1AGDB 4ERSL 3KWWB 4YVNA 3UC2A 5M94B 2ADFL 1SVCP 4G8AC 5C3LD 3IKKA 1C08A 1XZ0A 4H1LG 5HI5D 1PX4A 2RGSA 1QWUA 3GXDA 3NACH 5DO2D 4K23L 1BAFH 3C5ZC 3GKWH 1IC4H 2YC1B 1FH2A 1BA9A 1I9IH 4K3EL 5BXFB 1CLOH 4N6QA 2EXSA 2JTDA 3MU3A 1QA9B 2ZAIA 2GEEA 2HFEB 2DLFH 2GC7C 3JWDL 1C5DA 3Q1SH 2OJZH 2WW8A 2B1HH 2WXPA 3IS1X 4JM2C 4QTIL 1D7DA 3PFUA 3E3QE 4PJXA 3OKLA 2H1PL 2E75C 3H2QA 1BG1A 1BZ9A 4HSAC 1B4LA 3CMOL 4JG0L 4PRIA 1OTTD 1QX1A 4HGWB 4KGLA 2WLZA 4NBXB 5LXVA 4RDBA 1GVIA 1U36A 5FYJE 3VRJB 4NQXB 5A1AA 1RHHA 3L3HB 4XXWA 1ZANH 4GMTL 1G0YR 1V55B 2ZCLL 4UM9A 4Q97A 4MCNA 5C09A 1FZKB 2YGNA 3IDNB 3O6FC 4DN3L 5DC9B 5HPMB 4MZIA 3HG3A 3I6KB 5HVWA 1X9QA 2HT2C 3JXAA 3NSYA 4OGXH 4A2HA 5FO2A 1AS8A 4L05A 4HMDA 3ATAA 4L8SC 1ZLUK 1BQLL 1R34A 4JHUA 3WUWB 2GY5A 1QPPA 2XBTA 4MQXD 3MXWH 3UTPE 3KXFA 3ZTDC 3G04A 2DLHA 2EDFA 4BFFA 2NY5L 3TM6A 4KJWC 2RFXA 4C56E 2D9CA 3WNJA 5IJKC 2WBWB 2ZT9C 1F3JA 2ZD0A 1A1MA 2BRQA 1BZ8A 1KLFA 3KPPA 3QBTB 2IOIA 2VTFA 5DD3L 3C5XA 4M61B 2XFXB 3FTYA 4N2HA 1QEXA 4IRJD 1J8HA 2PCPB 3U36B 1ZS8B 2ZKHL 3RA7H 5BW7A 2ORBH 1OAYL 2B14A 2Z31B 1TU2A 1WITA 1M7XA 3IRCA 4R84A 2XYBA 3QZWB 4JHVA 4Y2LA 4Q9QH 2F7IA 4R9HA 1W6WA 2WNWA 1OAJA 4J3XA 4M5ZH 1OPOA 1SXCA 5J1AA 2HT4D 4NZDA 3LKSB 4L0ZA 1OLLA 4LLMB 5AAPA 4LAJH 2ARWA 4X4XB 4XP4L 3VD5A 5G4MA 4PRDB 4FKHA 4HH9B 3SJVB 4ZBJA 3MJWA 1AR1D 1KLGB 1KBWA 1FZOA 3T6QC 2OMVA 5LGJA 5JIHA 1IB5A 1OWRM 1TTRA 1BVOA 3R0MA 5EO1B 1PU0A 3O2DA 3O4LE 5AL8A 4Z7NF 2EXYC 1QWNA 1A7BA 4Q9RL 4RSVA 1HJBC 2XG4B 2A6IA 4L48A 1HSBB 2OQJA 4JPIB 1MRCH 4NAQA 3BP5A 1NMAL 3FU7B 1ICTA 2J20A 2X5PA 2XBZA 4TSCL 5AKRA 3V8OA 4HISA 4IOFD 1T5XB 1S2EA 2HSIA 2PO6C 4FG6C 5K93A 1MWOA 3SGKC 1N0XH 2O61B 1A4KA 1W0WA 1KFAH 4NRYB 4NQEE 4HKJB 3IAGC 1BX2B 1G7JB 3JT2A 1R17A 3HZMB 3GMRB 4JM4L 4PJXF 1AANA 3SPVA 3GMPB 2XWJA 1G7HA 3GIZH 3ES6B 2ADJA 5GRXG 1UT1A 4LGPB 4LSVH 4IU3B 2OTUA 5HHNB 4D7PA 1IRAY 4NWTL 2FJSA 4S1SH 4Y1AD 5IB1A 5A2IH 4QYAA 2XPYA 4JKLA 1U41A 3W2DH 3ARTA 4J1UB 1JJUA 3UZVA 3PL6B 3PDGA 1FL3B 3LIZA 1UTDA 1MJ8L 1S3KH 2ARJB 2IPTH 4WKXA 3H3KA 3K7UA 4LLWA 1G9HA 4J2QA 2CLZB 4LL1A 4LOVA 4GRLD 1JAEA 3PWPE 3SKOA 3WJLC 5C1MB 2YMTA 3EJCA 3O4OC 2CGRH 1FGNH 1P4IL 4N28A 3WHXA 4CVUA 4FFZL 2HWZH 3GM8A 4HXBL 1JUFA 3U7YH 5LHDA 3KPOB 3ME0A 3REWB 3PXLA 4YHIA 3RVVC 3B7YA 3A6BH 2I60L 1DJWA 3ETBJ 1XR9A 4CN6A 2NUTB 4PS4H 4PJ8D 2FT7A 1XH3B 1GZQA 2IALA 4NENA 3NJKA 1XF4A 3NMEA 1IAKA 2VT0A 3T5WA 1JPTH 1SDYA 4F33B 3NZSA 2CK0H 1NCOA 5C9JA 3QJRB 2NNXA 1RJLB 1BEXA 2K8QA 4EXKA 4MNHA 1DJIA 4WZ9A 2RBLA 5EU5A 3A67H 3UPCA 3G9AB 5T5FH 4HG4K 5I0ZA 1HXYB 4M6AA 4NQSA 4B95C 5TE7H 2P8PB 4R7XA 4AYBA 1YHPA 4XNXH 3K0WA 4KI5F 3FDWA 3N43F 5CJQH 4JMXA 5SX4I 2WIIA 4N0UB 1KULA 5F0JB 3K2MC 3RWHA 1KTDA 5IW6B 3CDGA 4KMLB 2AJZA 4LPCA 1RK0B 4JQVA 4YC2B 1F18A 3U79A 3BH8B 3QXDB 3Q2WA 1Z5HA 5DFTA 1G9EA 2FAUA 2R56L 2VIRB 3FTXA 3NP3A 2FBJH 1QFWM 2XA8L 5FYJL 1F11B 2D0HA 1FN4A 3MYJB 5J6HA 1IAOB 2FK9A 2QHLA 2O5YL 3QCTL 2B16A 2V9QA 4ZW7A 3TA3D 4C8XA 3WLBB 1QLEH 2XG5B 4MKTA 3L3JA 4N8PA 3WFDH 4QPEA 1HZHH 4ZMAT 4KH2A 5J6SA 3KPNB 5IESH 2ESVD 1TTFA 2DTML 3ILPA 3GGWB 5HD8C 4UQIM 5FUOH 3U7WH 4RLDA 1N8OE 4FOMA 4JDVB 4XCFL 1OSPL 4YDLB 2Z4QA 1BM3L 4BH8B 4J3OG 1LO4L 1XBRA 4NFCA 5I30H 5F8RC 4P2OB 2VDPB 2EIKB 4KITB 3DGCR 3FSOA 4MJIB 2AV7B 1CD1A 4WU5A 5BUGA 3MV7A 1I8UA 1RUKH 4Z7UE 4AENA 1MCKA 3BXNB 3CZSA 1L3WA 4JRXB 3IMUA 1AC0A 3OR7B 2Q87A 1DJSA 4FLQA 4HX1B 1N9PA 1S7TB 2WNGA 4GLRH 3FU5A 4XNYL 1ED3A 5TGBB 2DMHA 4QCIB 3L08A 3BJ91 1CLYL 2WAHA 2Y5EA 3PWPA 4PGCB 1TCMA 3M45A 4Z77B 1P2CB 5GGTL 4EUPG 25C8L 4X9IA 5IMMB 1AQHA 1ET8A 5CP3A 3TF4A 5GS0D 3QUMH 4YIQA 2HKHH 3V4VB 1ZA3A 1Z5LB 3TBTA 4WGKA 5TH2B 2JI2A 5CLXA 2GY7B 3WHE0 4FNSA 5IEKB 3EYVB 3VRIB 4FQ2L 4B53A 5IFJB 3GSQA 4MS8D 1PY0A 3DTDA 3EH5B 3LEYH 3MFFA 4EBQH 4V11A 1LK2A 2PPFA 3GSOB 2E59A 1EHNA 3S5LA 3RI5F 3G9VA 4YHZL 3IETA 5TQ2L 2OK0H 3FU8A 5CZVH 4L3ED 2R23B 2VL5A 5HVHB 4JG5A 2G3NA 1T5WA 2Y69B 3PL6C 4IS6B 3GBDA 1HQ4B 3OR6A 4XPHL 4RFOH 1P5VB 3NSJA 4TV3A 5JO5A 3G5XB 2WWKT 1MHEB 3LV3A 2W0FA 2DKUA 3QARA 3DUSA 2XNAB 4UMGA 5CUSL 3BWAA 4N20A 9CGTA 4TM9A 3RDTD 4CVXA 3O8XB 3HHMA 3NTCH 4XAWL 1VHPA 2BNQE 3PDOA 5CJ8A 1MW2A 1YNTB 2WNKA 2JJSA 1B4JH 3QDJA 3AQXA 5AENA 1OAZH 5IMKA 1R24A 2W59A 3FAXA 3ZR6A 4UI2A 4XRCA 1GGBL 1YNKH 2VN4A 5ID0A 4ZPVB 3GXTA 3UMNA 4GO6B 4PUBH 3FCTB 1T20A 3G5YB 3N9GH 2A9CA 2O30A 3MCG1 3HC4H 1HE8A 3K6NA 5TDPB 3MRJA 3ULUE 3VXPA 3K2KA 1T89C 2P26A 3MRGB 3S8WA 1FHGA 4XP6L 5IK3A 4ELMB 4WVRA 1UXSB 1OY3B 1BIHA 4R0LA 1XF2B 4KBPA 1T4KA 4DP4X 5DXWA 5J6GB 5TJWK 1FNGB 2MKWA 1MLBA 2V9UA 3QHTC 1KPUA 1ASQA 3V55A 3BT2L 1VPOL 2AEWA 4JFED 3ZIMA 4PWKA 1M57B 5TPWL 1UH4A 2J73A 2JJTA 4M1DL 2X4PB 2Y07H 4PLNC 1XGUB 1R75A 4MLIA 1MVFA 1PVHA 4P5TB 2NY2B 2DQTH 5CEZE 4YC2C 3OKKB 3TEYA 4N2AA 4RNRA 1N2RA 2X70B 2ZYHA 2ZUSA 3RY6A 1EDQA 1S5IL 4Z0BH 2JXMB 3O41A 1EXGA 1YY9D 2CRIA 2RCSH 3IJ9A 5CGYC 4EDWL 3Q5YA 4OF5A 3EXLA 2WTPA 2Z64C 3ETBF 2TAAA 5F6IB 4FF9A 4DGVH 5C0DB 1IAII 2WSDA 3MV01 3SQRA 1CG9A 1CBVL 2R51A 3SCMA 1FZMB 2DL2A 1SN5A 4Y1SA 5BV7C 3KL3A 4YDLC 3FT1A 2JELH 5C08E 1BQUA 1DSFH 1A6TA 5KVFH 1KYOK 4P2OC 1JGVH 4XB7A 1RSFA 1QTSA 3OLGA 4I0PA 1XAKA 5C0CB 1YEHL 3WFBL 1DTUA 4ZMZA 3H6AA 1YMHB 2AEQH 2EDOA 1MFCH 5EO9A 5CR1A 4MD0A 3D25B 4DGYH 2KQNA 1ZLSH 3QRFM 1FIGL 3QW9A 3C60D 2EDMA 4ENZA 4YQXL 1ZVSA 4HJJH 5H37H 2A6KB 3EIFA 4QHUA 4HCRH 5KVDE 2VYRE 4JDEB 4PGEB 5AVSB 2BNQA 2CJUL 4H1LA 1RZQA 1MFBL 1HH6A 1HXMA 1JNHB 3S35X 3KPRB 1T6WA 3QJXA 4QYOB 5I5RA 3LXAA 4KOCA 3H56A 3AS2A 2C34A 4XMXA 1ILUA 1ADQH 2CO4A 2XV6B 4FA7B 2JKSA 3IDIA 2GT9A 5L4IA 5EEZA 5KOVC 4C4BA 1KB5B 1EIBA 3QZBA 2BXYA 2Y3NA 3T4YA 1S9XA 4LPWA 3H3PH 3UC0L 5E0FA 4EI5D 1B0GA 3QFJD 8CGTA 3CSFA 1K4DA 3QDMB 4XPFL 3RVWD 2N0KA 4GW5A 4KKRA 4N9GA 3CPLA 4C54A 1FZJB 1FNSH 4AE1A 1GJWA 4JEGB 4A55A 5HVHC 3HPJB 4ZD3L 1G9MC 1X5XA 4FXTA 1U8IB 2AXHA 1NCBH 4QHNB 2K0RA 2J72A 5EH1A 3APNA 4LU5L 5KANI 5FDYA 3P3UA 4OCYL 5KANG 3OJDA 3TWYA 3HNSL 5DJDA 4ZAKA 4PAZA 4JFZL 4OD3H 3O8XC 4RMBA 3THML 2FYYB 4NZUL 3EJZC 3LZPA 1CDGA 5ENWA 1SJMA 3EW3B 2CMRH 4FTVB 4JZOB 4IQHA 4RAVA 3TONA 4HQQH 2WUCH 3P4MA 2C5DC 2EINB 5F8QC 4BFEA 1O7DC 4DUVA 3VWKB 5I16B 4UILL 3AS3A 3N3EA 1ZSDB 1AMYA 3BP7A 5H94B 1XVSA 4OF7A 1OGTB 1PIFA 1VGEL 1QFPA 1AQ8A 1WEJH 2KZKA 1O6VA 3LN9A 1BQHG 4OD2B 3CVBA 3AQZA 3PGCA 1NAML 1BAWA 3SBWA 1KJ2B 3ZHNA 1D5XA 2O5ZL 4UTAH 1F1GA 2BSEA 1ZHKB 3MCLH 4N3TA 5C08A 5FO7B 5JYMA 4J7RA 1NUFA 3RWIB 2R8SH 1MCPL 1RZJH 2YXWA 4U33A 1OV8A 1HXKA 3ISWA 1EVTC 4GO9A 2GG1A 2QKIA 4ETYA 1YQ2A 5E9DA 5DZ9A 1BXAA 1G7QA 3WU1A 1YJDH 2WZ6A 4P5TC 5D7JB 2NY2C 1FQ9C 5B8CB 1G6RA 3OLEA 3E38A 3OF6A 3PRZA 1NMBH 2WINA 1XEDA 2WY3B 1L7TH 3S34L 3ZQ9A 2OMZB 4DOHE 3ULUL 2EVFA 3TVMD 1NCUA 5KUMA 2XRAH 3MR9B 5D2LB 3PE9A 4BH7B 1X5IA 3RVUC 1SHWA 4J6RH 2NTFB 5IB5A 5F6IC 5L7XH 2J7LA 1MFDL 5DEFA 1HL5A 1H3WM 3BYTA 4HUKB 5HDBB 5IB2B 1MCWW 4XH2B 3IDYB 2MTAA 3GSNB 4WTZG 3RTQD 3RI5K 1MFEH 3JUYA 1KBVA 2COVD 3P73A 5HJ3B 1PX3A 1AY1H 4OT1L 3ZKXB 3ULUF 2GK0B 4JQIH 3GHEL 1EHLH 2VMDA 4JDZA 5CEZL 2F58H 4XNAA 3QNYA 3HI1B 1B3IA 3MJ7A 4Z95L 1VFOA 1Y7VA 3ESPA 3JV6B 1YUHA 4X5WB 4G9DA 2BVOB 3NIGE 3RWDB 5AVVB 1PZSA 3BAKA 2EDQA 1A6WL 4CC4C 3CLFL 4DHLA 1F6LL 4FCHA 3U1QA 1T1YA 3BIBX 1X5LA 2YUWA 3BKYH 5ID1A 3BE1L 3QIBA 1Q4NX 4OLXH 2JWYA 1E28A 2ARJQ 1U8JA 5DSCB 1HX0A 4OIIL 1NIDA 3A21A 4OCNC 3RB5A 1XEUA 3FB7B 3OM3B 4Z7VB 2Z1KA 2FIRT 5JZ7C 3BVTA 2WB1A 1I1YB 2IAMD 4O4YH 4HHAA 2ADGA 4OZ4A 3FAWA 4XN8A 2CCWA 1JF1B 3MGOB 1LE5B 5IUCA 3NG5A 4WNSA 4PJ9A 4AQEB 1EFXB 2FRGP 2VDNB 4AC2A 1FVDA 4P05A 1E2WA 2VMEA 1BQ5A 5KSAA 2R0KL 3T4AB 1KCKA 2HTKC 3K4ZA 4P4KD 5DD6B 4UANA 4K94L 1QUNB 3QEHA 1RUQL 3QUYA 4FHBD 4N2DA 5F7LB 3TO4B 1JZ7A 2MRYA 1YPZF 4X7TB 4D3CL 2C3GA 4XVOA 4OM0H 2IOMA 2BOBA 3QUXA 3T65A 3JWNC 1FL5B 4KK6D 5DJ2B 4A6YH 2EJ1A 3DMMD 3LPPA 4J27A 4LPUA 4OGYH 5E8NB 1E8ZA 2EYSA 2B4CH 1KYUA 2XY2A 3LS4L 1FGVL 3OC8A 4LARH 1QFHA 5E1IA 3FSVA 4AWJC 3LKNA 3PWJA 1OB0A 3CFTA 4GQ9H 1I7UB 1MW0A 2WNXA 4K8RL 5HYSG 5DZNA 1AAJA 2Y24A 2AXGA 3N04A 5GZND 4LHJB 1X4YA 3TYGL 4UOZA 2PXYA 4PY7B 3VWKC 2ZONA 5EN2A 5L0QB 1DLFH 3MUHL 5JHMA 4FLSA 3HUJB 3UZEA 1MJ7H 2O4EA 3PAVA 3DX9A 5ELIA 4EZJA 3D18B 4UQ2B 3WJJA 1GR7A 1CGXA 2F5AL 2P4AB 2ZOLA 3LRSA 4BZ1A 4ES9A 4Y4HA 3UIYA 4G42A 1L9SA 3PGDA 1TVHA 3ASWA 4OB5L 4PP1D 1AVAA 2GTZA 4XXDB 4X2UA 3CCHB 1A7NH 3K8LA 4ISVB 3S88L 5CEXA 3NPSB 3CLEL 2E9GA 3IRPX