1UATA

The significance of the flexible loop in the azurin (az-iso2) from the obligate methylotroph methylomonas sp. strain j
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
129
structure length
129
Chain Sequence
b'ASCETTVTSGDTMTYSTRSISVPASCAEFTVNFEHKGHMPKTGMGHNWVLAKSADVGDVAKEGAHAGADNNFVTPGDKRVIAFTPIIGGGEKTSVKFKVSALSKDEAYTYFCSYPGHFSMMRGTLKLEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin iso-2
molecule tags Electron transport
source organism Methylomonas sp. j
publication title The significance of the flexible loop in the azurin (Az-iso2) from the obligate methylotroph Methylomonas sp. strain J
pubmed doi rcsb
total genus 32
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2003-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1uatA00
3FYIB 1PZAA 2PPDA 3C75A 4DP2X 4YSSA 5FC9A 1SJMA 1PNCA 4GP8B 3CDZB 1JXGA 3G5WA 2CUAA 4YVUA 4YSQA 2CALA 2VM3A 3WG7B 4G70B 4GYBA 4ZK8A 2BW4A 2JKWA 2R7EA 4AZUA 1PLBA 1ZV2A 1NICA 4KO6A 2Q9OA 4E9SA 1A4AA 3WKQA 1RKRA 1MDAA 1J5DA 2YAOA 1KBVA 3NJFA 1BXAA 1TEFA 2GIMA 3EH5B 3OMNB 3WNJA 3AG1B 2H5UA 2OJ1A 2GSMB 3PCYA 1CUOA 1X9RA 3V9CA 2VSMB 2ZOOA 1JZHA 2PPAA 1JOIA 1BYOA 2UXVA 1WA0X 2EINB 1V54B 1CURA 4KO7A 1FWXA 2W88A 1NIBA 1RCYA 4Q8BA 4F2EA 2EILB 1NDTA 5B1JC 4DP7X 1IBYA 1JZFA 4L0PB 2PP9A 4N8UA 1GW0A 4HALA 2IDUA 2HZHA 1NIAA 3T6ZA 1HAUA 2DV6A 2IAAC 4M4RB 5I6KA 2UXFA 1CYWA 3AG3B 2PLTA 1SHXA 1ZPUA 1ID2A 1SF5A 1ET7A 2J57A 1ZIAA 1I53A 2VW7A 3X2QB 4DP6X 1V10A 2PP7A 2EIJB 2HX9A 3EF4A 3OMIB 4JHVA 1AOZA 3NJMA 3CVCA 1PZCA 2E86A 1PLCA 2DYSB 1ADWA 1XMEB 2GHZA 3PXLA 5F7BA 5AZUA 2CAKA 1NPJA 4PCYA 2FNWA 4YSTA 1ASOA 2YAQA 4A66A 2ZXWB 5TK4A 1A4BA 2QT6A 1JXDA 2IWKA 4P5RA 5B1AB 5I5JA 4AKPA 1WA2X 3ZX1A 2BP8A 4GY4A 2W8CA 1W6LA 2QDVA 1MG3C 3QJRB 2DYRB 1JXFA 3OM3B 5AKRA 1JVOA 3FYEB 1HFUA 4QKTA 3JT2A 4GXFA 2GB2A 4G72B 3IEAA 4FAAB 4KNTA 3FU7B 2H47C 3QQXA 1E5YA 5B1JA 1KGYE 3BVDB 5D4JA 1NZRA 4Q89A 3CG8A 1J9QA 1B3IA 2UXGA 3NP4A 4M3HA 2FT8A 2YAPA 3L45A 4P5SA 2YXVA 6PCYA 2PPCA 1ILSA 3T6WA 4K9JA 3X1EA 4HCFA 1OE2A 4HCIA 4DP4X 1M9WA 4KNUA 3MX0B 2AZUA 4UF7C 3WKPA 1GY2A 4ENZA 5LDUA 3FSZA 2FQFA 3PLYA 1XB3A 4E9QA 2LLNA 3GYRA 3FSAA 1XB8A 2YAHA 4DPAX 4G71B 2HRHA 2GC4C 3ABGA 1AACA 1AG6A 2RACA 4A2GA 1ILUA 2PPEA 3TBCA 3AZUA 2FTAA 1KCBA 4KNSA 5I6LA 2CJ3A 2XWZA 2ZWNA 3ABMB 3RYMA 3ABKB 2A3TA 2Y1AA 1AANA 1XB6A 1BEXA 2XV0A 3JTBA 4NB7A 3FPYA 3PAUA 1BQ5A 5ANHA 4EF3A 2PCFA 2XX1A 1L9QA 4FA7B 3S3BB 2QDWA 3NJNA 3D12B 3S8FB 4DP9X 1ZDSA 2TSBA 2JFCA 4BK5C 2FQEA 3SBRA 2XXFA 4DPBX 3KW8A 5B7FA 2I85A 3TU6A 1WS8A 4BWWA 2BP0B 1BQRA 1MZZA 3DKHA 1JZJA 2XX0A 2J55A 4GP5B 4YSPA 3T6XA 1FFTB 4YSRA 1OE1A 3AW5A 5I6OA 3N2JA 3WIAA 4YL4A 4E9TA 1AG0A 4RH4A 4E9XA 3N55A 3PPSA 4GP4B 1KDIA 1KV7A 2R7EB 1PLAA 1NTDA 2IDSA 1KDJA 3ASOB 1AZUA 4UAHA 2BZ7A 3NJKA 2WSDA 1OV8A 2TSAA 1J5CA 3WNIA 2J5WA 2XU9A 1TKWA 5I5IA 2VSKB 2GBAA 2OCCB 5IY5B 3NYKA 1AIZA 3NT0A 1SHWA 1MG2C 4AKQA 1NIDA 3CVBA 1M57B 2X88A 4WKXA 4YSAA 1JZGA 1AZRA 5PAZA 2CBPA 2AANA 1A4CA 1E65A 3NSFA 2XLLA 4E9YA 3TASA 4AX3A 2IWEA 2VW4A 5E9NA 5B7MA 1A65A 2UX6A 1SNRA 1L9PA 1BXUA 4BXVA 1WS7A 4W1TA 1RZPA 4BDVB 2OV0A 1DYZA 1NPNA 4YSCA 3NJJA 1UATA 3PAZA 3ZBMA 3U25A 3IN2A 1YLBB 1SDDB 2YAEA 1WA1X 1GR7A 3H56A 4G7SB 1JERA 2P80A 2BP8B 2BWIA 2DY2A 4E9RA 1PF3A 1MZYA 4QLWA 1R1CA 1ASPA 1ET8A 5I5MA 2YAMA 3WI9A 2QPDB 1OCZB 1OE3A 1W6WA 2DWTA 7PAZA 2WO3B 2YARA 3CZUB 1JVLA 2YQBA 4PAZA 1NWPA 2AVFA 1M56B 1AZBA 1AS8A 1DZ0A 1NWOA 2UX7A 3X1FA 4A2DA 1PY0A 5AFAA 1FA4A 1AZNA 5B1BB 1IC0A 4HIPA 4BWUA 3S8GB 1OF0A 1N70A 5PCYA 3X1NA 9PCYA 1E30A 1IUZA 1PAZA 1J9SA 3T9WA 3FPXA 4F2FA 2FT6A 3FQ2A 3FQYA 4G7RB 1E67A 1GYCA 3HEIB 1J9RA 2AFNA 1AS6A 3QPKA 3FT0A 1PNDA 2GI0A 4KO5A 7PCYA 2QPEB 3T6VA 3NJIA 1ETJA 5B7EA 2XXGA 1L9TA 4BWTA 4HCGA 1BQKA 2J56A 1X9UA 5I6NA 4NERA 1AZCA 3EHBB 4DP5X 1KBWA 3CDZA 1J9TA 1ZIBA 2XYBA 4W9ZA 3AG4B 3NSDA 3SQRA 2FQGA 1OCRB 1GS8A 4HAKA 5I6PA 3QJUB 4YVNA 3ABLB 2YAFA 1GY1A 2IDTA 2XV3A 3OQRA 3EH4B 4CSPA 2CCWA 3DIVA 1BAWA 3ASNB 3SBPA 4KOCA 3DTUB 3ERXA 4YSEA 1WAEA 2IDFA 3GDCA 4DP0X 4A2HA 1KCWA 4YSDA 4DP1X 3X1BA 1JZIA 2EIMB 2B08A 1PCSA 5I28A 3FU9A 4NAJA 4JHUA 1ZDQA 2FQDA 3UACA 2VN3A 4AI7A 3H4FA 3NJLA 4BDVA 2H3XC 1SF3A 2EIKB 3NJGA 4AKOA 4CSZA 1OCOB 2XVBA 3S3DB 2BZCA 1BYPA 3FU8A 4A2FA 1NIFA 3FSWA 1CYXA 2MRYA 1W8EA 1ASQA 2IWFA 3TA4D 6PAZA 4A68A 1A3ZA 1A8ZA 3MBWB 3UAAA 4TXVB 2BP0A 3GXUB 1AS7A 1L9RA 2BW5A 2HLEB 3OD3A 3V9EA 3AY2A 3NP3A 3NSCA 2BHFA 2IDQA 4A67A 1BXVA 1KYAA 2HX8A 2WO2B 8PAZA 1AR1B 1RZQA 2Q5BA 2X87A 4JKNA 3H4HA 2FJSA 2UXTA 1EHKB 2I7OA 5A7EA 5F7AA 2HRGA 1NIEA 1EZLA 2BWDA 1QNIA 1OOWA 2HX7A 4E9WA 5B3SB 2IH9A 3TBBA 1GSKA 2JXMA 2PPFA 2PCYA 5D4HA 2Y69B 1IBZA 4X4KA 1ET5A 1N68A 1PZBA 5I6MA 2VMJA 4A2EA 3HB3B 4F7KA 1CC3A 1F56A 1HAWA 1SFHA 3FSVA 1TU2A 3CVDA 3FU7A 3PAVA 1AQ8A 4BXSV 3AG2B 3S3CB 1OCCB 3FQ1A 2GC7C 2MTAA 2ZONA 1GS6X 2VM4A 3ZDWA 5B1KA 3OMAB 2HXAA 3BQVA 1QHQA 4YSUA 2PP8A 1L9SA 2FWLB 1SFDA 4HZ1A 4KOBA 2IH8A 4YSOA 1NINA 3EH3B 3QJTB 4DPCX 3IN0A 4DP8X 2VW6A 1PMYA 2DWSA 1E5ZA 3NJHA 3UAEA 1TEGA 1VLXA 2B3IA 2XUWA 4HHGA 2NRDA 3QJQB 2I7SA 4HHWA 1QLEB 3IBOA 3T71A 1AAJA 3QJSB 1V55B 3UABA 1SDDA 2P80D 1T5KA 4N4YB 3UADA 5EHFA 5D4IA 4WTQA 3KW7A 3X1GA 4UANA 3NSYA 4G7QB 1JZEA 1IKOP 5TK2A 3QJVB 1URIA 2FT7A 3FS9A 1GS7A 2XV2A 4KO9A 4MFHA 1L9OA 2BO0A 5I26A 2AZAA 2YXWA 3SBQA 3ZIYA 4E9VA 3IE9A 2N0MA 3UGEA
chains in the Genus database with same CATH superfamily
4BZ2A 2GUOB 4DAGL 5BJTA 2G3MA 2Y5QA 2CO2A 3V0AC 4A37A 1SJMA 5DK3A 3RU8L 1E4XI 3QJFA 2V37A 2ZOKB 4YVUA 4U6VL 2CALA 5AVUB 3I50L 2PR4L 4HPYL 4WAFA 1SYSB 1EO5A 2JELH 4QOKA 5DD5H 3H7BB 1IZJA 2DLFH 2Z6FA 4ELKB 3PIQB 1OP4A 4KRMB 5HHOB 3T65B 2YOCA 3FUHA 4LVEA 1G7MB 2Z0UA 2MQCA 1O9ZA 3LIZL 1U93B 4ORZC 1A4JB 2FBOJ 3MRQA 4ANWA 4M6OL 1RQ5A 2UZPA 2R4RL 3GKZA 1EEYB 4C4UA 1CUOA 4C56B 3SPGA 2DWXA 2AERT 4EQ2A 3TEWA 3U46B 4PY7A 1A9EA 4PJ8C 3S5YA 3SD5A 3DYPA 1JHLL 2LT9A 3LXAA 4HOMA 1UWFA 4F8NA 1NIBA 4PRNA 3QULA 3AM8A 2XN9D 2AEPL 3QFJA 1HSBB 3CSBA 2VDRB 3D09A 3EAKA 1GW0A 4XNMB 3MX0A 3AG3B 4XGZB 2VGLM 4YEFA 1SF5A 1ZA3B 3AABA 1HZHL 1RL1A 2L3BA 2WTPA 4Z78A 2KLRA 3RFRA 2CGRL 3O3BB 4LKXA 2WCPA 4X80L 3MUY1 2G4GA 1I3UA 4TUOA 4GQQA 5JXEC 2E86A 2DLIA 5E23A 5IQNA 5IQ7H 1FORH 3ESMA 1U3ZA 2CAKA 1FP5A 4JRYB 3KYOB 3KYAA 2X2IA 4JY4A 4LLUB 3SKNA 4JO1H 5JPMB 3BH4A 4YX2H 1ODAA 1QSEA 4JRXA 3SPJA 4G8GD 1CXKA 3SCMA 2Q8AH 5KYNA 5KYYB 1KFAL 4U1LB 5BV7B 3MTXA 1MELA 1FFPA 1WA2X 4MJ5B 1NKOA 1KIPB 2BS9A 5B39G 1KYOJ 3H54A 5EZJA 3BISA 1JCVA 5D5MB 3BPLB 3IDXL 4IBUA 5E2JA 1VEPA 4NJAH 1WZ1H 5T3ZE 5IW1A 4LLMA 2D8KA 3WHXB 3ZL2A 4GW5A 3GXFA 4JY5L 3FT3B 1I8AA 2C3HA 4N8PA 5C0AB 3QUZA 3RA7L 2R1WA 1JS4A 2P24B 5F1KC 2FHBA 1EANA 5I16B 3LYRA 4ZNCD 5DI8B 2HT4C 5DS8B 3X1EA 3C5ZA 2CBTA 2H9GB 4N0YH 4YDNA 3S0PA 1YNLH 3E8VA 1H3WM 3ELQA 3HHMA 4ZFOL 2BRRL 3VG0H 3HE7C 5I17B 2B1HH 4ENZA 4HFUH 2NSQA 4IKKA 2CRIA 1NAMB 4NJAL 2FD6H 3FSZA 3PJNA 4ODHH 5F7WC 2XACC 2AXJA 2LLNA 2DKMA 4UT7H 3MOQA 4WWKD 3OB0H 3ZO9A 4M7ZB 5DGRA 3RA7H 3VFNB 4L1DA 5IB5B 5C08D 3K8KA 3TCXA 2IQAA 3ZE2F 5I6LA 2ADFL 5FYJL 2QQKL 5DJZB 2XVGA 3ECVA 5DJDA 5T5NF 2VYRE 1AIFB 1XB6A 5F1NA 1DQVA 2XV0A 1KTDB 2Y36H 3UJJH 1SLVA 3FPYA 2AV1B 3OC5A 4CN4A 3HI1B 1P9MC 2FVNA 2H41A 5CLYA 2OXGB 4H0IA 4BSVB 3LKPA 4JNXA 3ULUC 4MMYA 5L0QB 2X0WA 3T2OA 4F27A 3F7YA 4RISL 1P7KB 4JRYD 1S5HA 2BH0A 3B7YA 3GBMH 5ECGA 1GYUA 5EUOF 3SDCB 3AMKA 4BK5C 5EBWB 2H8PB 1Q0YH 3FKUS 4LCWD 1U8NB 5F9JA 2BVUA 4YNYB 5GRZA 3SN6N 4CVWA 3MUUA 3QSKB 4CNIB 4AGOA 2EECA 3B8YA 3EKCA 1OD9A 1INEH 4FC3E 4TUJB 3RWFA 3N6YA 1IAOB 3PDOA 4D0CA 4PYGA 1L7IH 6CGTA 1MHHB 1KDJA 3CZEA 5F3BA 1TVBB 3ZY7A 2BZ7A 3T2PA 2A5UA 5D1QD 3A22A 4CDHA 4JE4B 1FPTH 3MMEB 4FQ2L 4NQCD 4WO4D 5T1LA 4HZLB 2MOGA 2ZJSH 4CA4A 3SEPA 3GSRA 4M3KB 1D5MA 4GRWH 1RZGB 2VQ4A 3IGAB 3TO4B 1FVEA 2UZXA 1RHFA 1J0YA 4NI3A 5BZDB 1LE5B 2P43B 2EVGA 1M57B 2WB7A 3GTVA 1KPVA 1QWHA 4PJEB 2V5SA 2HT2D 1JI2A 3LNHA 1U8KA 1U92A 4OFDA 4PJGA 3KLDA 3V8OA 4WO4A 4ZW8A 5IVZA 4TVSa 1Q0XH 2YK1L 2FE0A 4O00A 2OMUB 3GSXA 1RMFH 1DYZA 3PAZA 3C5ZC 3SD2A 3VWJD 3IN2A 5C07D 5DT1L 1P5UB 3MOAL 3WO3B 4MMZB 1F6AA 2NDFA 1Z9LA 1R3JA 3LNGA 5DD1H 3HG3A 2AQ3A 3LVEA 4RFEB 4LVOC 4BZ2H 4OAWA 2CLVA 3OAWA 3QYNA 1KC5L 1FFNA 1BHGA 2DBLL 2OCFD 2LFEA 3I02B 4FDWA 3NZ8A 1WITA 1OO2A 3QAZC 5SWSD 4A2DA 5F7LB 4N85A 5DJ0B 1KJMA 4OCWH 3VWKC 3E1F1 3QDJB 3VG9B 2EC9U 5BO1L 4MJID 1E30A 3FQTA 2I07A 4JG0L 5DVNA 2DW5A 4XZ4A 3X13A 4MHHG 1E28A 3K72A 5J0BA 3C5SA 2VKXA 4S1DD 5CCJA 1IAIL 5CXPA 2QGCA 2QPEB 5B4MC 4DUWA 1P7KA 3BSZA 3LCYA 1MJ8H 2GVYA 4XX1G 2KQNA 1FJ1B 3QZBA 4KQ3L 4U1IB 5C0JB 2V9TA 1OARL 5ID1B 1XR9B 3O6LH 4FE9A 3VXUB 3WIIH 5BUAA 2ZUUA 2VMEA 4WO4B 4HLEA 1NMAL 1WAPA 2Y07H 3NZHH 3PGFL 5H94A 4B0MM 5D93C 3MRPA 2EIZB 4M1DL 4NGHH 4PJAF 4H20L 1K2DA 1SHMA 4TQEH 4AC4A 1GGYA 3SDYL 4N8VA 1TEYA 3SDXB 2XZAL 4QGTA 3GTTA 2NLJA 3D3VA 5HHME 2NY6C 2CCWA 2XFGB 1BAWA 2VDPL 5I17A 1PL3A 3DETD 5K93A 3DWTA 2YZ1A 5GGTA 3BFOA 4Z6AT 1FSKC 3GDCA 3QO0A 1JPGB 1VEMA 1P1VA 4RRPA 5KYWA 3POHA 4PG9A 1Q9LA 1ZV5A 4ZO6A 3P2BA 4AY0A 2ICEA 3BSGA 2F58H 3D4GA 3IJ9A 3HRZB 4LEEA 5DJ6A 2OMYB 3SE9H 1ACCA 3KLKA 3BDXA 4FQHB 4LLDA 5IVOA 4FFVC 3ROOA 5F96H 5T1MA 2NUTB 2AS5M 2AQQA 3P4NA 2PR4H 2KZKA 2R59A 5J1AA 2XDHA 3DJRA 1CR9H 4Z7WF 4O2CB 1B0GB 2YXMA 4RETB 2K8QA 4Q0XL 1A0QH 4JDVB 2NY4B 5C7XH 5C1MB 5MEPA 5IBLD 3BWUC 3EDDA 3KWTA 2P8MB 1EXUB 1P84J 5FA4A 5AAMC 1BYPA 1BSIA 3QHTC 1DBMH 4ABWA 1ZEAH 3EOTL 5LAXB 4ZFGL 1ZD6A 2J4WH 4FJZA 5K9JL 1IGMH 4G43A 2YWYA 4Q4IA 3ZE1F 1T5WB 1OL0A 3MBWB 2E4TA 2OMWB 4OZFA 5JNYB 3RL1A 3QR2A 1BEYH 5LGYA 2WNWA 4XR8C 4D8PB 2CDFA 5GGSY 3RZWA 2YBRA 3U9UA 4EIGB 2Q10A 2NCEA 1FYHB 4AYGA 5DK0A 4FTVD 4KJWD 4L3ED 3QYCA 1NBZB 1EO8L 3EADA 4FMFA 4PJXF 2D31B 4JDTL 3IDMA 2ENSA 3CK0H 1Z9MA 4PCSA 3IFLL 2OMXA 3KM2A 1L0XA 1P7BA 2UXTA 3JTSB 4FLHA 3TN0D 4PB0H 1MH5B 5IW6A 5F7AA 4Z0XB 4AQ8C 2P26A 2PXYD 3P4OA 2WBXA 3ZZSA 2N1TE 1A9BB 2ITFA 5J6GB 1JK8B 5AZEH 3W2DH 1LWHA 4OT1L 3P69A 1Z9SA 3ESUF 1B4LA 2NT1A 3EJYD 2XFXA 3D85B 1BJ1J 4Z9KB 5EFIA 4YXKH 1PZ5B 1ZXKA 3HZ3A 5F7YC 3GNMH 3TNNA 5LQBH 4KFZC 5IW1B 3M88A 4IRZA 4D8PA 2DWYA 4N20A 3FQ1A 2GC7C 2MTAA 4G9FB 3CZFA 4NZTH 2KT6A 2ZPKH 3BUYB 4UZGA 3ZGHA 4D0BA 1QI3A 5B1KA 4XNBA 3V0IA 5ICYB 2A77L 3DMMD 2XA8H 3BZFA 2X4UB 2IAMB 2ATAA 3BEVA 5C0BD 2NY1B 4G7VH 4GNKB 5AOZA 5KYYA 1KN4L 3UDWC 3PP3H 1PYWA 4M5YL 3SO3B 1XH0A 1VPOH 3PIQA 2BCKA 4IKNA 1VFBA 2EVHA 1TMQA 4LEXL 4CC4C 1BGXH 3GB7A 4GRWF 1X5GA 4JR9L 4TL5A 4BFEA 4NBYB 4UQIM 4KVPA 1VGKA 4UV7H 5E8DH 5E03A 4MNQB 2EEAA 2M1KA 3FUKA 1HI6B 3WHE0 3P4NB 2F8IA 1T1YB 1A25A 1NC4D 5DWPA 1YN6A 2OW7A 3D2UD 3S97C 3QEHA 3UAJA 2ITDA 3NFSL 4PQXA 1R4XA 4JMNA 4AMKL 1YMHA 1F11A 1DVFA 3CVIL 4AVKA 4UDUA 3QO0B 2JVUA 4XGZA 3C2AH 1PKQB 1GGBH 4WTQA 2EH8H 4OLYH 3H2WA 3VD2A 5TK2A 3ZHLA 1U95B 1F3DJ 3GMQB 5ESAB 1LO3H 1H3VA 2FB4H 3TWCL 1GS7A 1ANUA 5KSVB 1RIUH 1OLZA 2BCKB 4GT0A 1CR9L 1ZEAL 2H32H 2EUXA 2E47A 3ARFA 1JHTA 4K7PY 2PPDA 4XXDA 3FB8B 3NFSH 3QWQB 5EDSA 2ATPA 3T4AB 1QZ1A 1NMBL 2JKXA 1TJHL 1QBLH 4JFPA 1TETL 5HHPB 1JYVA 1TVHA 5DXWA 1SXNA 3VGBA 4BH7B 4OM1H 2BXZA 1FL5B 4PJAB 3FTZA 3MXWH 1W72B 5GGRY 2ODHA 3HI6H 1UD6A 1CTMA 3T65A 3WKQA 4R7VA 3HZYB 4OV6F 4OLWL 5IHUH 4G9FD 4N2EA 5IESH 4DKTA 4OFKA 1Z9SB 2J71A 4KKRA 1HK6A 2X1XR 4O02H 3REVA 2OJ1A 1XF2A 1YEWA 4G80A 4LAQL 2ZUVA 4PJGF 1V7NL 4FXGA 4GG6F 4UI2A 5E70A 4OGAD 4K55A 1QUNA 3VNYA 1TYJA 2VXUL 2XWJA 3DGGB 1K8DA 2IPUK 4R7LA 5BJTB 1OWRM 3NH7L 4GRLD 1QSFA 3PAYA 4LOUD 1KJMB 2WANA 2R29L 5BVPL 4OI9A 1ZT7B 2FJFA 1YEJH 2WQWA 4I0PA 4M5SA 4APQC 1BM7A 2R4SL 5LWYH 5JW4Q 1CT8B 4G8IB 3RZCB 4FFYH 1JGIA 4PSPA 5CEXB 3L48A 4GKOA 1JMZA 1I3GH 4L0PB 1P2CB 2GCYB 43C9A 3TGXA 1AR1D 3BQUC 1L3WA 5HTSA 3PHOB 4UZUA 3WHE1 2Z31B 3EOBA 3O6ML 4HIQA 1A6TB 1KGXA 2Y22A 2ICCA 4MD0A 5EEZA 1FIGL 3QO1B 1DQML 4J4PA 1JZ8A 1O5DT 3M45A 1OGAD 5C3LD 5I1KH 4KQ4H 4OZIA 4JM2A 3RIAK 1CICC 2GKIA 1DN2A 5EU6E 1T66D 2AEOA 3V0VB 2EO7A 1KLFA 3M07A 4G8GE 2Y1YA 4P23C 2HTLC 1H3PH 4UNTA 3U1QA 3AB0C 4Y1TA 4JFYA 1U8KB 2IPTL 2HG5A 4ICWA 3UAJC 4CJ1A 5HHQA 1D5RA 4NZUL 2KZBA 1S7TA 4UMSA 4C54A 5E5UB 1U8JB 4HIJA 4X5WA 4PY8I 4LCUA 4PJXB 1MWAA 4KZCA 1HE7A 1ZHNB 3RTQB 5CBEB 5EC1A 3GLDA 1IO4C 2D7QA 1DJSA 4R97B 2QBWA 3FU5A 4FI7A 1W8NA 4P3CH 5BV7L 4XPTH 1P4IH 2CQVA 2MOQA 3U79A 3DX7A 4RZCB 1MCNA 1MIEH 1YEGL 3GO1L 3PXJA 1J0ZA 4PJDA 2HFGH 4FAAB 4LT7A 4LAJH 5HDBB 4PP2A 2YGOA 1TU2B 2FRGP 4JM4H 4WI9A 3P0VL 2X4SA 1MFCH 3QUXC 2DL2A 2Q3XA 2VQ1B 3A6BL 2PCFB 1JFQL 3NP4A 1JHKL 1OTUC 3VTAA 2WMPA 4BZYA 3BJ91 5DEZA 5EG6C 4WSJA 1S9VA 2G2PA 4LNRA 4F3FB 4YNYA 1OGTA 4HHAA 5E9DE 4M62H 1EO7A 4IBYA 3KBFA 4X2UA 2KDGA 1T89C 3AJ7A 3OKEB 4U1NB 3WIHA 1S5HB 5FOJA 2ZWZA 3SDCA 4DCQA 4HGKC 3SYCA 3WKPA 2W92A 4WI6A 5DEFB 4JVWA 5FYKU 3GYRA 5CGTA 4ZUTB 2Q8BL 4EVNB 3TZVC 3P0VH 2J4WL 3ABGA 7TAAA 1OSPL 2PYEA 3ARDB 4LK4A 3KPRB 5GRJH 2Z31D 1FAKT 4KNSA 1SZNA 1IM9D 2IPKB 2XICA 3MCG1 4PVMA 3SO3C 3JWOC 3MA9H 5K69A 4GAYB 4HBCL 5E2WH 1E28B 1DBJH 2H2SC 2IF7A 4ZYKA 1QHPA 3A67H 4NYLA 5JHAA 1F18A 3O2WH 1BMGA 3LIZH 2PCFA 5F7MC 4DN4H 1QI4A 4KJQC 3P73B 4BUHA 1ZT7A 2FJFB 3QK0A 5C0IA 1DLHB 5JLZB 3GS0A 1M9SA 4KGJA 1ZDSA 1QPKA 5ADOH 1ZT4A 1B6DA 3LX9A 2FO8A 4YDZA 1T0NB 4RZCA 3SBRA 1SN2A 1K6QL 3DX7B 2GK2A 2WY3B 2VLLB 3NCBB 2W9DH 2BP0B 5AW5B 4NKMB 3ZRCC 2XX0A 1AHWC 1CICA 1JUFA 1TNMA 5DSCA 3ZDZB 4DSYA 3ZUNC 4N2OA 5HGHA 3U2IA 1AZZC 2MWCA 2Y06H 2ZXGA 4TOYL 1JPTH 5FXCH 3KCPA 4GP4B 1G7IB 5GS1A 1KXTA 2DEXX 4O2EA 1YJDL 5CGYC 5FHAH 4DGIH 5C0FB 4BH7A 3P9MA 3KHQA 2UUDK 4HC1L 4WNJA 3ZUCA 2G75A 4J3TA 2VXVL 3KLAB 2DBLH 1HHGB 4Q9RL 4AQ1A 5KSUA 3B5HA 5AVXB 4JM2B 3CMGA 3HB3D 2OCCB 4U1LA 4KMTL 2JCCE 3VXPA 5DMIH 4K3EL 1NMCC 2WWMC 4JFDA 1RZGA 3IGAA 1I7UA 4AYID 4OB5L 3FOLB 4MNQE 2R2CA 1JZGA 2FGZA 1MJ8L 2R2HB 1MCJA 2JIXB 2VZSA 5KJ4A 1A7BA 1YJDC 4E9YA 4N8CH 1TZHB 1WZKA 4WWID 1RPQA 1U3HA 5F7DA 3RDTD 2VW4A 5FF6A 4I1NB 4U0RC 3UTSA 3DIDA 3QUHA 4S1RH 1F86A 2Q7YB 3TEYA 2X70A 1EBAA 1F02I 1SJHB 5IFHH 1UQSB 5AVSB 3VACA 1INQA 2BWIA 1ZLEA 4OFVA 1UJ3B 2XTSA 4P3DB 4YHOL 5KZCB 2ZAIA 2X6CA 4ZS6D 5AEAA 4FMVA 3QDMB 5AVZB 3KLHD 2DWTA 3VD0A 4ZPTA 3TZVA 1U8NA 2J7LA 3UOAB 4Y16D 2NY5L 5LN8A 1E5AA 4PAZA 1XGRB 2G60L 5CIPH 1M56B 1FA4A 4MZRA 2EXWC 1UOLA 3A6CL 4TKWA 5D2NA 5T1KB 2P5EB 2F7OA 1R9FA 3LN4B 1N70A 2VN5A 5E94B 4U0RB 3D33A 2R29A 5GZNC 2Q8BH 3BUBA 4N2MA 4TQHA 4KK5D 2VL5A 3MRJB 1T0OA 4QRPD 5G2NA 3K6SB 3BHBA 1AIFA 1M3JA 3QUXD 1GYCA 1TZGH 3BUYA 3TL5A 5GGVY 1YPZA 2YJQA 3FUMA 5EORH 4EEEA 1NDGB 1J9CT 3LZQA 1L9NA 1E27A 3BKJL 5B38A 3CCHA 1IL1B 2LTQB 5IT2L 1AR2A 4GMSL 1MLBA 4I5BB 4PW9A 2PWEA 3M7OA 4UQ2A 4WO4C 3CPLA 2PW2A 5ERWA 4OJYA 3B2MA 1N4XL 3NDZE 3QNZA 4MVBD 1MFMA 2DIJA 4P2RE 4XMKH 3S5LA 4YBLC 4KK6C 1YNTF 4NKOA 5GRVL 2DD8H 1LO5B 2GG1A 1BCIA 1LEIB 5DS8A 1MI5D 3SKJL 2AJUL 4Y2DA 2CCVA 3CHPA 3QWRD 1XMWA 3H8NA 3SOTA 1QRND 4PJ9D 4RIRA 3BEWA 4DVRL 4KJQD 3RAJH 1DBJL 1DJGA 5IHZB 3PP4L 3U82B 1I3VA 4UILH 4CGUB 4O58L 1CGWA 4YSEA 3B7SA 5SWQB 1MW0A 1FH5H 2HFFA 5F9AC 4Y16A 3VFGL 1IEHA 3VWKD 1JWSB 4OJDH 1MLCB 3HG2A 1CZ8L 5DC2A 5EZOL 2VO5A 5C09D 1BECA 2G30A 3OR6B 4HUWB 4JHAH 4HT1H 2TRHA 1C1EH 5A16A 5CBAB 3ECQA 5DD6B 3SKJH 2ZNXA 5I28A 2ZOLB 4PJ7E 3RWCB 3MLXL 1HTYA 3EYSH 1CFNA 4HUWA 2CE6A 4LZKA 4P0DA 5KJRH 3IJYA 4PJ7A 4OB5H 5IHWA 5BCAA 2YEQA 3QWRA 4WFEE 4XNAA 1JV5A 4AI7A 4UTAH 1CO1A 3JBG7 4GRLC 4KMTH 3A6OA 2CR3A 4OGYH 4R83A 1F4XL 3U83A 5L2JA 3V79C 4A2FA 3F6LA 5DR5L 2XFXB 3D85A 5IOPB 1ASQA 1I8IA 3SJVD 2VJ0A 3C8DA 4LF3A 5FYLD 1T21B 1TT6A 2A9ML 5LGJA 4OZ4A 1KGCE 5ADPH 3RKDC 4L5FH 2DMCA 2WC7A 2YPKA 1W72H 4Q58C 4P2OC 4ODSH 1BPLB 2EADA 3MA7B 2DQJL 4F7CB 1MWAH 3TCLA 5IFAH 1QW8A 5D2NE 3DO4A 2X6BA 4NKIH 1DSFH 1FZJA 5SWZD 5D1QC 3TCTA 5JA9A 2F7IA 1A9EB 2W60A 4W9IC 1EERB 3H4HA 5F89B 4AGMA 1ZHKA 3MODH 3I6SA 1BD2E 4HC1A 1INDH 1NIEA 3C60B 4M3JA 2UWEF 3CIAA 2ZCKH 3VD3A 5KSBF 1S3KL 3QT2A 4YHPA 3U30C 2YS4A 4H13C 1N5YL 1T5WA 3MBWA 2YD2A 4HKZA 4PJHE 4F5CA 1SVCP 4NC1E 3GT6A 4U3CA 1VKXB 1CLZH 1OTTC 1PZBA 1SGKA 3AWGA 3HS0C 5A2LH 3SB3A 2AVGA 2MCAA 2C5DC 3QEQA 4XBGB 1AQ8A 3Q1SL 1MUJA 3OLIA 4GO6B 3H42H 3SYPA 5I8CA 4L4VE 1RIUL 3O45A 3CSPA 3VFOA 3K2UH 4WGVB 4IRSA 3U7WL 2BSCA 4N0RA 4BV1A 2QV2A 3K2IA 1FRGL 3LOWA 2GTWB 5E2WL 5JXED 3S36H 4YSUA 5ISZE 3HZMA 3F3HA 5DCCA 1B0WA 4NJ9H 1INQB 3G6JB 5F88A 1SOKA 5IMOB 4K3JH 3L1GA 1SEQL 3MLTA 4MA3B 4YFDB 4K07A 1YEKH 4JFDD 3Q01A 1IC4L 2ZSVA 2KUTA 4O02A 1ETZB 1DZBA 1RZJL 4R4ND 5FA3B 2DQFA 1J11A 3A6BH 3L54A 4JKMA 3APMA 4CVXA 3I50H 1TEGA 5ACMA 4PV8A 1KB5B 3GSOA 4ERSH 2PW1B 5D7KE 4ZO7A 3FH7A 4N8VB 4NO3A 5CEYA 5DTFB 4AT6A 1NGPH 4HS8H 3KPPB 4AQ8A 1NBCA 4RFNC 2NY2B 4C4BA 3G9AB 3A23A 4AW7A 2K45A 3PWUB 4Y7OC 1IZKA 3BLBA 1K4DA 4GSUA 4LE8A 4P8QA 5MENA 4NQEA 1X5LA 1DVZA 1QLRB 3II3A 4LDEB 1KXVC 2OX5A 5J12C 3WS6A 4D94A 1KTJA 3UTPE 2WBJB 3A47A 4L1LA 1EMTH 3CNKA 1AGDB 3OPZH 4RAHA 2NSXA 3S6CA 4HUVB 3CX5J 2NYYD 1FJ1A 2PXYC 1A7RH 3DXAA 1WP6A 2EICA 5HYJD 2GY7B 3KZ8A 1PZAA 1IGML 4IIQB 5DO2D 2Y72A 4XNQB 3MTRA 4LQ1A 4F7TB 4MAYC 5IBUB 2A9AA 1AVAA 1DBML 5I6XB 2YSTA 4DIXA 1WV7T 4G3YL 4IOSD 5IB3A 1XGUA 2I07B 3KPSB 4LGSB 5LBSH 4JVUA 5F88B 4MZ3A 5I74C 1G7LB 4JFEE 1JL8A 4KJPD 3QDME 5F0PB 2DQHL 4MHHI 3DTXB 4JDTH 3S3PA 1YC8A 3QP3A 1QVOB 5SX5K 3UJIH 2ZXAA 4FA8A 3O6MH 3NK4A 3HVNA 1N64H 3V9CA 2GJPA 2J88L 3K3QA 4X6FB 2EDKA 1V7ML 3UG4A 5I18H 1OAUH 1E90A 3WUZA 1RP8A 4TTGA 1A7QL 1H6EA 2JJTA 4OZGA 1EA9C 4F80A 5AAWC 2RFXA 4U6YA 4DKFL 2VLMD 4NQVA 2QVTA 1N5AA 5B1JC 3TBVB 1NBYB 4LSRL 4R5TA 3B9KA 4HALA 3ASWA 4KTEH 4DEPB 1M7UA 3HPJB 5DZ9A 4QF1A 1Z0MA 2CMRH 3MLRL 2VC2L 3F7PC 4WI0A 4DP6X 1HEZB 1S7QA 4LGPB 4UIKL 2FHCA 1SJEA 1AOZA 1PEWA 3SDDC 3WMPA 5J57B 1YECL 4FQ1H 2HJLB 4Z3EA 1HJBC 2DQTL 4TNWK 2XTJE 2K3TA 2GJZA 3S34H 2WKOA 1FG9C 1ZJAA 2RAMA 1FRGH 4XPAH 1F0LA 1A1MB 3BGFC 4LASH 3MLWL 4GKSA 3QW9A 3UO1L 4G8EA 1F45A 4AL8L 2IADB 1Q38A 4NQDE 3H42L 2ZXWB 4AV0A 5T5FA 3O2VL 2APFA 2HFEB 2GJ6A 1PCXA 3DJTA 4KUZH 5C0ND 1KWKA 2XWRA 2VABB 3SDXF 4GUPB 4JFZL 3QB7C 3OAZK 5CBEA 1JF6A 1Y0LA 1TKWB 5D7JB 3L1FA 3MLZL 3NEEA 1YECH 4GY4A 2W8CA 1S4IA 2XWTB 4Z3FA 3IXTA 5CWSB 1HFUA 2AXGB 2GB2A 3CVHL 1IQDB 5EZJB 2MHAB 3IJYB 2FAUA 4PJ7B 2OSLA 1A14H 1KLFB 4XHJC 1RIHL 4XBGA 2FSDA 2XWCA 2X1OA 3HPLB 2JLPA 1HKFA 1NZRA 4OKDA 2UXGA 3RVUD 5CJQL 3ZT6A 4M43H 5EU6A 3HI5L 3HZKB 4C57C 2DMGA 3GTNA 5HPOA 3W39B 2ENYA 3B43A 2COVD 2HVBA 2ZWKA 1ACYH 1UH4A 3EOBB 4M6NH 1A0QL 2HA1A 3OKNB 2CIKA 2X53A 3O3DB 1XFPA 1YUKB 2VLJD 3I74A 3PV6B 4KZDH 5JOFB 1KJ3L 3QDGD 3V6OA 1P69B 3HKZA 4JL2A 4LSUL 4XPHL 4LPYA 1NAMA 3TCLB 1AG6A 2B1OA 3FCGA 4XPBH 3S5LG 3AZUA 4H0GA 1CQKA 3ROLB 3DGGA 1XGTB 2YR3A 1YAIA 4PJ8A 2JKRM 2XWJB 3BCFA 1BQHG 1I3RB 3DX4A 4RAVA 5D7IE 1S8DA 4MAYD 4F8QA 1DFBL 2F54B 1RULL 1HSBA 3FHAA 2UWEE 2DLGA 1IRAY 3H85A 4PRBB 3H9ZA 4S1SL 2X09A 3ZTNL 5CN3A 4O9HL 5FGCE 3CFTA 2JFCA 4YPGA 2VDKH 4YXKL 3IFPA 2J25A 3MLUL 1IBGL 3PABA 4RX4D 3WDJA 1JRHI 4DPBX 3TONA 2PN5A 3ZTDC 2CRYA 2PO6D 4UNIA 1JZJA 1X7QB 3BGAA 4FMKA 2XC8A 5HVHB 3K74B 4J3OC 3BSZH 1NLDL 1RJLA 5I73C 3EH2A 3O6FA 5LO7A 4O4YL 3BVUA 3U2SA 5C6PB 1JHTB 1KWGA 4E9XA 2VDMH 2X12A 4YHZH 2VUOA 4BK8A 4OBRA 4IU3B 3AWEA 1DVFD 3I3EA 4UTCA 2AJYL 1EK3A 2R7EB 2YN5A 4YLCA 3KPTA 1T89A 4UV7L 2YQ2A 2DN7A 4PUBL 1YPZF 1IFRA 2WIMA 4AM0A 5FUZH 2MKWA 3K7UA 5E1AB 1NEUA 4R4NC 4PJCB 3OB0K 4MXVF 2VDOL 4R26L 4KDVA 2A6KA 4BQCA 4EZJA 1I8MA 3JWNG 4ZUSB 4M5TA 5EC2A 2N4IA 2NX5A 1TNNA 3EGDA 4MCZA 1NIDA 1YN6B 2F5AH 1P1ZB 4RGNE 3LS5L 4XNUH 2F5BH 4MQTB 4P23B 2VKWA 3DGCR 1HI6A 4IMLA 2BOLA 2QQNH 2VR3A 4K8RH 5DURB 3R7QA 3UZEA 3T3MB 3CFCH 1TZHA 1TQCC 2OA9A 5HYSG 4XXWC 2CRZA 2X4PA 3OJDA 3MACH 4NP4H 3BT2L 4W1TA 5BRZA 4DKEL 2BY2A 1JZDC 2P4AB 3QULB 4AYEC 4CL7A 4NZJA 3NFNA 1NCIA 3TN0B 1YLBB 1SDDB 4AG4L 2N56A 2B59B 5E6IB 2H2PC 1AHWA 1UXSB 3D0LA 4LVOB 3I6KB 2QPDB 1E4WH 2VDQB 2WXOA 1Z2KA 3QRGL 3FB7B 1LXMA 1R3HB 1W6WA 2CBQA 2JKIS 4KXDA 4QDGA 2NQ3A 4K73A 3RTQC 1CLOH 1JMXA 1DBKH 5HI4C 1G7QB 3BZ4B 4Y9BA 1KXTB 5BMFH 3GLEA 1UACH 3N0PB 2BNQE 4Y5XC 3KYNA 3DX2A 4JAMB 1GAFH 5IJVA 2GSIA 1OF0A 3W11D 4GXVL 3GJFH 3N04A 1EHAA 4V1DE 1NOAA 4UOJA 3EGXB 4XMKL 3SQOH 4AUJA 4IGBB 3MR9B 4JCLA 4HCRA 5L6YH 3VXSE 4YXHH 3FQ2A 2IAMD 2N1KA 3C08H 3NN8B 3W11C 1A3RL 2DIAA 3FQXA 4LHUD 4W6YB 4M8RA 4I18A 2O61B 1MN4A 3VFGH 5IW6B 5AW1B 1Y6MR 4H44C 3HR6A 4DEUA 4KXZH 5E2VL 2X6VA 3UYRL 1S3RA 5KS9B 2YRPA 4LO9A 3T0WA 1DQQB 1L9TA 3GXDA 4HXBL 1BQKA 3I3BA 4TYUA 3DVNA 3C8HA 5I6NA 4LRNL 3KPMB 5F1IB 3EDFA 4UT9L 5HVFB 1A4KA 3LRMA 2WJ7A 2J8OA 4Z76B 3PWJA 1YMMA 5GGRA 5JR1L 5KANG 5F1OB 5GHWL 3Q1EA 2EYSA 3NCEB 2NZIA 4BZ2L 1WC7B 2HVKA 5I1IH 4HJJH 3EH4B 2DJ4A 4HJ1A 5CCHE 3T2NL 3IDXH 5GS1B 4WCYH 1JNHA 1OP5H 1RZKC 2F54E 1LD9A 3WY2A 2WSPA 3KJ6H 4FZEL 5FYJE 2Y06L 4URTB 4GH7B 1QKZL 3F01A 1KBPA 1RJZA 1OP9A 2EIMB 2NUTA 1SRDA 4ZXBB 1PCSA 1XAKA 4LLWA 4QUOA 4DGVH 4KROB 3DI2B 1YYLH 5CSZB 1ZDQA 1FYTB 4NNYB 1NJ9A 4N0YL 4G1EB 1NOLA 1WUZA 2I69A 4GB9A 4DPRA 1FL3B 5TF0A 3U9PH 2BFVH 1OARH 4XP4L 4K3EH 4OF0A 4JQVC 4Y9EA 3UROR 5D1ZA 1BA9A 1AJ7H 1L3NA 1WCQA 4PR5B 1A22B 2X9YA 4AGQA 3RJQB 3HKFA 2JI3A 3OAYK 4M8UA 5IJKA 4PHXA 3LD8B 5D9SB 1IEBA 3ESPA 1X6NA 3A21A 2KQMA 1NFDF 1M1XB 3IGFA 4X0KB 2YLHA 3OJVC 2NNXA 5HI4D 4UOQA 4HKJB 4X7SH 2V2XB 4N90D 4QRTB 3BFQG 5DS2A 2HFGL 2GJJA 2WZ0A 4JJ5A 3FT2B 4XN1A 1M7IB 3FQUA 1ZK9A 4G8FA 5FX3A 4OUUA 3BP5B 4XVTH 5T8IA 2NR6C 5IMKB 2OYKA 3H55A 3IS1X 2I5YH 3MNWA 1AR1B 3HG1B 3RWIB 2NY0C 1EHKB 2NY0B 3OKEA 2I7OA 2HSIA 4U1NA 2CKBL 1D7FA 3EBAA 4Y16C 4XO3A 4DCQB 2BWDA 5BXFA 3Q05A 1LLAA 1NA8A 1QNIA 2OXHB 1I1AA 2HX7A 3O4OB 5DC9B 5HJ3B 1LE9B 3ULUF 1QVOA 5DUPH 1GSKA 2MMXA 3CFIC 3M7FB 4MZ2A 4GO8A 3B56A 4L4VD 4X4KA 1OT2A 5IQ9B 1M2OA 1E4WL 4KAQH 5IUSA 2PCPB 1OW0A 3D39A 1TYRA 4WGWB 1TU2A 1ZHLA 2Z3FA 3CVDA 4FKHA 1QSFB 1UZ6E 4X99A 2YPLB 4X9BA 2VXTL 4ZUUA 4ZUVB 5EBGA 2F8VA 4BE5A 1FCCA 1E40A 1OCCB 3STLB 1BF8A 5GSVB 3MLYH 2WLLA 3L3HA 2L7QA 3LQZB 4CW1A 3ZW3A 1QFOA 4IHOA 2DM2A 4JGNA 1OSZA 4JM0A 3IXAB 4YHLL 1F6AB 4KROD 4ODUA 4IMKC 5K9QI 1Q9OA 4Y1AA 4YOKA 1HYSC 1FFQA 4RBPH 3BP7B 2E46A 2YGQA 2XV6B 2P47B 1B4TA 2JNZA 2X4NB 4DP8X 3ULVF 4KJYA 3HTLX 3D51A 3R19A 1R47A 2DF3A 4QRAA 3T8VA 5JPNA 1VFAB 3P3UA 5C0NC 4EUPH 3B6SB 1A02N 1VLXA 3ZDZF 3KLQA 4HEPG 4ENEC 2DI9A 5HYQA 3MJ8A 4OY9A 5AKTA 3DA0A 1I8UA 4RFOL 2WWNA 5BZDA 5JYLA 5JXAH 1LE5A 1N26A 4X4XA 4AQEB 4Z3JA 3RY4A 1JV2B 3AU1B 1QHOA 3JWNC 5MEOA 4EIZC 2OMZA 3UYOD 3UL4A 4LLYB 1QRNB 3NCYP 1TQSA 3IB4A 1U95A 4X6DE 3FFCD 5LJYH 4JHZA 4Z7IA 3QCVH 1V7NH 4RNRB 1TUPA 2X2UA 4F8LA 4CADA 4PJIE 2DWDA 3HAEA 2EDRA 5K39B 5FV2A 4HJJL 1KYUA 4HUNB 4PRIE 1V8HA 4L29A 3FU3A 1NFKA 3CQPA 4FTDA 4Z7UF 3HMXH 4G1MB 4H25A 4L3FA 3PDOB 5EUOB 2CG9X 4UBDC 2GQHA 3NIGF 4PRDB 1EFQA 4U05A 4LPWA 2ZWYA 2H2SD 1AH1A 1JXGA 4MCYB 4PRPB 3ZHNA 2Z8WC 4KVCL 4ZW6A 2XA3A 4GQZA 3TTSA 4QLRA 3OR7A 5FUOH 4DH2A 2HN7B 4HIHB 3NCYS 4JKPH 4X6CA 2FX8H 4Y5VB 4IBVA 1M7DA 4WWNA 1A4AA 5ALCL 4P9HL 4GKNB 1W72A 2P45B 4MMYB 5C08A 2YAOA 3QIWC 2E7BA 3KBHE 4MNHB 2Z8SA 3CFBB 3GMPB 3L4CA 4P59H 2I32A 1FZOA 5JHLL 4JO4H 1HZLA 5CP3A 3S35X 5KBDA 2PKDA 4OLYL 4URKA 1CVSC 1CDHA 1P4LA 1A7OL 2R0KH 2GAZB 1O5PA 2RALA 4JFXA 3SDDB 1ACZA 5KBMA 1NANH 1C12A 1D6EB 4U6VH 1FHGA 1KSRA 3U4BL 5JQ6L 2Y6TE 2QFPA 1BQLH 3BAXA 2EXYD 3UC2A 4A6YA 1G5GA 2Z65C 4Z3HA 2YSSB 5FPIA 4KMLB 3PGCB 2EILB 3RIFF 3KL3A 3VXNB 3EYUH 5CMAA 4OD3L 3EYOA 5SWZB 3DUUA 2LQRA 1MIMH 1SOXA 1TJHH 5CHNB 1WD8A 3MV8A 3PP3K 4E41B 2X2YA 2NYYC 1T0MB 3C5ZB 2J57A 1KB9J 1CU4L 1I53A 1BIIB 4FXLA 3Q7JA 2AXHA 3IJ7A 2EVFA 2EUVA 5C6TL 3HG1E 2EC9T 1W9XA 4IOFC 3II1A 4CJ0A 4L3CB 1RUAH 1A3QA 3MACL 2W65A 1OTTD 1PZCA 4JKKA 4NP4L 5I0XA 3QZLA 4XN4A 3BE1L 2E74C 4PI0A 4HK3J 1NPJA 1SBSH 4K7PX 4FXTA 4JFVA 2OI9B 3HG0A 2DYPD 3PREA 5AOMA 1KTRL 2FHFA 1CIDA 1NL0L 4GEJA 1DN0A 3GWJA 5L4JA 2XBZA 2LAAA 3H3KA 3HFFA 4XNZC 3MRCB 3AT8A 2F53B 2JKJA 4TN9A 1ACXA 3LNDA 4ODVH 2A7BA 4KI5D 2B14A 4Y2LA 4XN7A 5A16B 3UBXB 4DJMA 3OG6B 1XSKA 2X42A 5ESVA 2ADIA 2WZPA 4Y16B 2UY7B 3KYKH 4XAKE 3LV3A 4PJ5B 3FYEB 3ZLQC 4O9HH 2AEPH 3PRZA 25C8L 1PQZA 4N2IA 2BVYA 4DQOH 3TNNB 3L9BA 3A4DA 3AXLB 3PYCA 1RERA 3QQXA 4NX0A 5FCSH 5AB9A 5AYUL 2A4EA 3OPZL 3RKPA 4LKXB 1FDLL 4M3HA 5E6SB 1B3IA 5EN2B 1UXWA 3QFJD 2YAPA 3QIBD 4AE1A 4PBDA 3MO1A 2FEEL 5E4AA 4KDTA 5EUKB 5FM8A 5BVJA 3KL5A 1NANI 3LH8A 4Y5VC 1O9WA 3MX0B 5CM1A 2BSDA 3Q6FB 2HRLA 1NLDH 3IDMB 3ZTNH 4AK1A 4X8XA 1A6ZB 3MV7B 4HWZA 3IK2A 1XZ0B 4M8QA 3VGGA 1YNTB 4S0TD 4OZHF 1AACA 3ZYOA 5AYUH 3U9UB 1R5IB 4V1DA 1CFSA 5KVEH 5HHMB 5AVWB 1XIWA 4OQ1A 5DGQA 1AFVH 4DN3L 2LLLA 3QHFH 5KSAA 3GXTA 3ZE0B 4ETQB 4HP5A 4G6ML 4PJFA 3KEHA 3MRJA 4MKTA 3OF6D 4PRIB 5F9DC 4EF3A 2J6EA 5I1LA 4MAYA 3DROB 2XX1A 3CFBA 3KPRE 3OBAA 3CUPA 2F7QA 4X4ZA 2WZ5A 4M00A 1Z3RA 4QRRE 1WWAX 5M94B 1HN1A 2TSBA 5FA4B 3OR7B 1M71A 3FQRA 3O9WD 1I1YB 1HXMB 3FONA 3OKDA 4I9WD 4Y19E 3TYGL 4P5TC 1A1NA 1V7MH 2XPGA 2L04A 1MZZA 4M1DH 4XP5L 2V0AA 4MCYA 4PRPA 4QT5A 2ZXEB 5GSRA 3QDGA 1JNLH 3WEXB 1H9DA 2XNAB 5I6OA 1R17A 3FQTB 1N0XL 2QPSA 2OMYA 2YD5A 2CGYA 2WGXA 3ES6B 5FDYA 5FLUA 2EKJA 4HUXA 5SV4A 4Z7VA 1G9MC 2VQTA 1BVKB 3F65A 1Y1DA 1RZJC 2NX5E 3LXBA 1F1GA 4WHDA 1YRKA 2CLVB 1JN6B 1I7RA 2PWHA 3K2UL 3Q44A 5CR8A 3TYGH 1OV8A 2TSAA 3NSJA 4RGND 2QVKA 4EKXA 3U0TB 1W91A 1COBA 3CN3A 4OD3H 4PLKD 5AL8A 5IY5B 2X05A 1UUSA 3GSUA 5TGBA 1JNLL 5KN5A 5DMKA 1PZ3A 2OJEB 2G3NA 4U33A 2R2BB 4RDBA 4L8SB 1IGFH 4NQXB 2AXFA 1IC5H 4N0UB 4HSAC 1CF1A 3IMUA 4P2QB 5EH1A 5TE6H 3SJVB 4CDGC 2E59A 4AX3A 4DZ8A 1IT9L 3TT1H 3AUVA 4P2QA 3X3FH 2OZ4A 3RPKA 1G7PB 1RJYA 2ZYRA 1BZ7A 3TFKC 1NPNA 3M46A 3LMJL 3O8XA 3T04D 4PY8J 3N06B 3GM0A 3GK8L 2P80A 3QUYD 4GAFB 4PD4K 3KNBA 5G4MA 4DETA 4PJIB 1GOGA 3K81A 3U48A 4FLRA 1AGBB 2QQLH 2I26N 3B2VL 3BKCL 1OCZB 4R97C 5I30H 1I1RA 4N2DA 3RVTD 1UFGA 1CDBA 4Z77A 4UM9A 2VLJA 1QEWA 5AFAA 5D7IA 5B1BB 1T1WB 1KIQA 4DTGL 5ETUB 3O9WB 2I60H 2PCPA 3DO7A 1IVLA 4GW4A 4GG6E 1XH3A 4KJWC 3PNWA 5SV3A 1EEZB 5DJYA 2P8PB 4PJ5E 3DNKA 3OGOE 3NCFB 2DLEA 3PY9A 2XN0A 2VLRD 4KO5A 1UXLA 1MCPL 5HPMA 1X4YA 4MMZA 1S9YB 1NM9A 3O4LB 3GDBA 3V10A 3T6VA 2WLYA 2J88H 5BQ7A 4OFQA 1JDAA 4E68A 3PWNB 2K9UA 1FFOB 3QAQA 5FHBL 3K6OA 2UVEA 1KBWA 1DJYA 4BM7A 1VACB 2H6PA 3CDZA 5AVRB 2C9RA 3SZKC 1J9TA 5I1GL 1DVQA 1KCRL 4XBPA 5GXBB 3OXRB 3T3ME 3GMNA 4WZ9A 3UG3A 1FNSL 4HAKA 2L7UA 2CR6A 2QSVA 1FSKB 2YMTA 5IMMA 1BQLL 2EH7H 2YD1A 5HGDA 4BK4A 2AV7A 1P6FA 5DRNB 3K71A 2CXKA 4A04A 3OQRA 4DO4A 4E41E 4B9PA 3C6LD 3CSYB 3U0WL 4KQ3H 3SBPA 3FBKA 2MPVA 5EULV 2DZEA 1P53A 2WTRA 3QCUL 5L2KD 3MRKA 1CBVL 5EU7E 5I2IA 5HYJB 1JTTA 2V6HA 1BLNA 3H6AA 4WQOA 1MCQA 3F6JA 5DQ9B 5A2AA 5INDA 1RUKL 3MCKA 1K4CA 2PO6B 4XVTL 2ZCKL 4D0CB 5EU7C 1WIOA 2WBKA 3BXNA 2DM4A 4LLWB 4BRJA 3QUZB 4XN2A 1NEZG 1PDKA 1F4YH 4RAUB 1FN4A 4JB9L 4JHUA 4JLRA 3MBEA 4RDQG 3TBYA 5E4EC 1JZ4A 2WAHA 4AIZA 3OHXB 5I1EL 4FQXB 4OQTL 3T0AA 4H2AA 5DD0L 4BDVA 1TSRA 1SF3A 3Q1SH 1YEFL 1G1YA 2EP6A 2E7MA 1JYXA 4XPFL 3FU8A 1GSMA 1LNUA 3KJ4C 3V5HA 2EYTB 3QCTL 4FXKA 1SYVB 2EYSB 1K72A 4FQLH 4JPWL 2FJGA 2DQMA 1KPUA 3OQ3B 4OLEA 5SWSB 2BVPB 4KHTH 4TXVB 3IJEA 4X7EC 1GZHC 5EIIA 1EJ8A 1IM3A 3FN0H 1O75A 3G6DH 3D9AL 3HNTL 5CIPB 2XVLA 3O4LD 5DWUH 3MREB 2P28B 3SCMC 4HWBH 4ACPA 3SBWC 1LQSR 4P46D 3T8MA 4W6WB 3HLAB 5IIEA 1RAMA 2R8SL 1JF5A 1QFWM 1FO0H 1K3IA 2VWEE 1KYAA 3GQFA 4P5KA 3BVNB 2F19L 2WO2B 2WP3O 4MJ6B 5IV2A 2BC4B 5JHDB 1T20A 2ILLA 1SXBA 3DHUA 5HHVL 1NGXA 2A2QT 2BSED 1PAMA 2Z9TA 4MNGE 5EA0L 4I18B 3TFKD 1KUMA 1OOWA 1MY5A 2H32A 4XC1L 1Y18A 2FO1A 2VDRL 3MV8B 4E41A 1CBJA 4NM4L 1XF2B 4BZ1A 2CKBA 3ISWA 2HTLD 3NRPA 4P9ML 3VFUB 1DTUA 1I9IL 1ZLSH 5C07E 5HYFA 1XSJA 3APNA 3GM8A 1SOQA 1L7IL 3U46A 4LLQA 4BXSV 1Z9NA 2W9DL 1K5WA 1BXXA 2UZYA 2WNGA 3S3CB 4CVUA 2X4RA 1TVHB 3DETC 2VOTA 5LNDA 2GEEA 3T4AA 1UXSA 4FQCH 3R0MA 1O0VA 1U3HC 4NENA 4ZFZA 3UJTH 2JV6A 2UY6A 4H8WC 3OXSB 3REWA 1RZ8B 3TS8A 5F3HB 4NQEE 2H1PL 4LU5H 1KULA 4P46A 1TDQA 2IH8A 4BKTC 5CD5D 1IILE 3BH8A 4BCYA 1E4XL 4K71C 2NW3B 2V7HB 1QNZL 1SJXA 1JDCA 1D5ZB 2NY7H 3VXQA 1PZSA 2YEVB 4RRPM 4WI7A 1IBFA 1YJDH 4M1CC 4WSKA 4NNPL 3BSHA 3ARZA 1LHZA 2NY1C 1LDPH 3FCTA 4I4WA 4UYQA 5ENWA 3UAEA 5JXEA 1WBXA 2VDKB 3PNRB 4P5MA 3T0EE 3WL9B 5C9JA 4P5TD 1P1ZA 2MOVA 3QJSB 2Q87A 4YAQA 1BJMA 1RUKH 2ITDB 1SVZA 4HUCA 1X5FA 5CZXD 4KXCA 4XN8A 4HGMA 5DHVB 1B9ZA 5D4IA 1RU9H 1KTBA 3DJZA 3QUKB 2MQ3A 4I77H 4RNRA 1M42A 5C09A 3VNZA 4CC1A 4PJCF 5C92A 2R1XB 1FZKA 4AH2A 4B97A 1J0HA 3LH2H 4QGYA 2ITCB 2QV4A 2J20A 1AKJB 2N0MA 3SJVE 2CUHA 2FH8A 3GSNL 2EZ0C 3WD5L 4HJIA 5F97E 5IFHL 3P0YH 2PUQT 4OFPA 5D1QB 4N2NA 2CUAA 2VT0A 3C6LA 1NC2B 3QPXH 1WBZB 4Y2DD 3UP6A 3CXDL 2J6EH 3IFOA 3L95A 3L9YA 4G2AA 3DHJA 1U93A 3BMWA 4R96A 4WUKH 3VRLF 4FFWD 3GSWA 1ZLWK 5GRJL 4NLAA 4RMQA 5IB2A 3R18A 1WTGT 3OMNB 3WIFA 1AGEB 1KLUA 1X5ZA 2ICWA 2Z7YA 3GI8L 1JK8A 4IRJD 3D85D 3GBML 4HZAA 1I3RA 3GMLB 3MRIB 1HZHH 1X9RA 4JCMA 2VSMB 4PD4J 1FNHA 4HKXB 3WJLA 2OMNA 1VFMA 3QDJE 2YRBA 1J8HA 2H6OA 3KH4A 2EINB 4JPIB 2F19H 3LKNB 4N9GB 3T6QC 2YPLA 1R5VB 1GKEA 1XCQA 4X99B 2Z8VC 4ZUUB 3L81A 5IQ7L 2OQJA 3DMMB 3BQUB 4LSSH 2DOCA 1KIUA 4F2EA 5DC4B 2IANB 2W0FA 4EI6A 2NY1D 4Y19A 1WSST 2GFBB 2DV6A 3LSOA 4LMQE 2IV8A 1F6LL 2CIKB 1IX2A 4L3AA 4RGOL 2O6PA 5KOMC 3SKMA 2X3CA 4ZJ9A 4TTDD 5H8DA 3VWKA 3T0DA 4OZFB 2R0WH 3Q8CA 3HJ0A 1RVFL 1IKFL 5FO9A 3TURA 5FKAA 3CZLA 1E7UA 1OHQA 2EIJB 3K0WA 2ALAA 2KL6A 3QFDA 4P23D 2KI6A 2KYIA 4WKZA 2B39A 2AI0H 1QZNA 4LBEB 1FNLA 4HC1H 5E6ZA 2VR6A 4HF5H 4RMUA 1NCCH 2VZ3A 3QQNA 2Q86A 4OCSH 4X6EA 2FR4A 5FOBB 4K5LA 5B39A 2V2XA 5HBBA 2Q7NA 1XWVA 4H26A 3QZWA 3RGVC 4NNPH 5EU5B 1G5AA 2QT6A 2HKFL 4MAZA 2IGLA 5D5ME 4NUPA 5JR1H 3KXFD 3L3KB 3KL0A 4ZPVB 1E4XH 5D2LF 4UAOC 1LO4L 4AKPA 4OCYL 3HRZA 5DJ6B 4JFFE 3LEXA 4X80H 3TO2A 3H7LA 3EJJX 1XIWD 5KYWB 4QRPE 1K3ZA 2RGSA 5GJSH 4DTGH 1UT1A 2WBWB 2R4SH 4KZEL 3QG6B 4YC2B 1FF5A 2H47C 2X9ZA 3NCWA 3TJHD 1NCHA 4YX2L 3BKML 3LKSA 3NGBC 1AGCA 3QUMH 3D1MC 4M7KL 1LEGB 3QORA 2B7DT 4WW2B 4QRSA 2YGNA 1CD1A 2E7CA 3GIZH 1TYEB 2EO1A 4Y4FC 4ZTOH 3IKKA 4I3GA 1X4ZA 1NGYA 2B4CC 3SYAA 4BQBA 4YQXL 1JZ2A 1URLA 1WWBX 4ELMF 2EUZA 4QHNA 3ZT5A 5IZ7A 1T6VN 3I2CL 4OD1L 1S7SB 3IETB 2RTTA 2OL3H 4Z7AA 1PS3A 4A7GA 1G9EA 5TDOB 2JKNA 3W9EA 4DKDC 3UO1H 1H5BB 2AEQL 3ZR5A 3MLZH 1UJ3C 1YMMB 5DC0A 3ALXA 3ARBB 4XPGH 4CSSA 2WZPD 1S9WB 4TNGA 2Y7QA 2CNZA 3VXRA 2A3TA 2W95A 3X13B 1D9KC 2XN2A 3UYPA 1KIRB 3OTTA 1L9QA 1HOCA 2X3AA 3VB9A 3OF6A 3I9GL 4JG5A 3RG1C 3QNYA 4PGEB 5KSAD 4G9DA 4M43L 3DSNA 5INCB 2VLME 1XGUB 5DZOA 3OG4B 5T3ZL 3D5OF 1W2KT 2O5XH 2J8UA 4YHYB 1BIHA 3QIWA 5D2LE 5L0QC 2AW2A 4QXWA 1TCRA 1FZMA 4HOZA 1G43A 1HDMB 3N2JA 3O11B 3EJZD 2BVOA 4LSQH 5IFJB 3B2UD 4G9FE 1B3JA 1CL7L 3SGDI 2K78A 2VJXA 3CVIH 4AEFA 2WQSA 3BIKA 3SDAB 2B15A 3B2UC 2R29H 2FBJH 3S88L 5J6HA 1OTSC 3OZ9L 1J5CA 4MDIA 4N2CA 1II4E 3F7VA 3GSQA 4FTVA 3U1PA 1TZIA 3NIDE 1Q4NX 4J3VA 4GKZB 5L7XL 1TQUA 1KB9K 2R2EB 3NT0A 5HVGB 1S7RB 1E6OL 2YPVH 4JZNB 4P2OA 4XNXL 1YN7A 2E0PA 4CVZA 4YFLI 3L2MA 1DFBH 3BVWA 3GSOB 3T0EB 2C4FT 4WHTA 3ZQXA 3ZRSA 4CU8A 4JGUA 5I82A 2P8LB 5DJ8A 2HAZA 2A6JA 1VZGA 2NNAA 1L9PA 3J8F7 2VRKA 4PJHF 4IMLB 3PL6B 3CFKB 5DHVA 4CMHB 1W0WA 4M7LL 3WTXA 3CV5A 4AXWA 1NPUA 2QHRH 3TFBA 3WYRA 4OIAA 2NY0D 3QJXA 2YRZA 4S2SA 4DEPC 2DYPA 4HWNA 4H1LH 4B0MB 4G11A 5CEZL 4S11A 1ET8A 3MJ9L 5E0FA 2A0LC 4G3YH 4ZS6C 5BRQA 1RPKA 2CO4A 3L17A 4C83B 5GGSB 2MH4A 2CHZA 1NEZB 4J4PD 7PAZA 3QWNA 5G4NA 3MGOB 1CFMA 4XNZB 4BFJA 4F7EB 3RWDB 1X7TA 4PJ5D 3RIFK 3W3BA 1IEAA 4DFIA 2O5NA 5D1XC 3PHQB 2ORBL 2VTFA 1WFOA 4MRCA 3FFOA 4OD2B 4BUGA 4LL9A 4EN3A 3T9WA 2UVFA 3LEYH 4I2XA 2Y7SA 5E2TH 4NO0B 4M03A 3JVFC 5DFVC 1R24B 4F2FA 4AEIH 3FFCA 1UM5H 4JZJA 5CEZH 3KPQB 3VG9C 1PNDA 2GI0A 4UWQB 3ZT7A 3JTTB 4MA1B 1TJIL 4GSRA 1H8NA 1VRSA 2YRLA 3U4EA 2A73B 1PBYA 5CILL 5I0VA 3V7AE 3WFZA 3GIZL 2BIHA 4X5QA 3BPLC 3ESVF 3G6AB 1R46A 4HCGA 3QWOB 1VDGA 3UFIA 5MERA 1M6OA 1AZCA 1R0AL 4GLRI 3KBEA 5E9DD 1J87A 4PW4A 2XYBA 4WTWA 3UTZB 3AG4B 3ILQC 4B5EA 2H9GA 1A7OH 2R0KL 3PWPE 2LTQC 5CGYD 4QTIL 2BVTA 3SIKA 3CXHK 1OCRB 3OLGA 1R3KA 1XR8A 5I5RA 4KUZL 5KVMC 2R69H 3W0WB 3TV3H 2ZP8A 4LHJB 3ABLB 1A2YA 3T3PF 1GGIL 1CTOA 1GY1A 3MNZB 4H2CA 5HYJE 4BINA 3I85A 1ZANL 2CLRB 1NGPL 1VIWA 3ARFD 5EO0A 2BJML 1WO2A 4BFBD 3ULSB 3V5KA 4XMTA 3MLWH 3OKYA 1Y7VA 2F8XC 3RX7A 3FTYA 2DM7A 2O26U 4EN3B 4F58L 2W38A 4UT6A 4XXWA 1GGBL 1I1AD 4JRXB 1LK2A 1CJYA 4MMZC 3DRQB 4YK4C 1OALA 4OF7A 4APQB 4YDJB 5FKPA 3KYOA 4LLUA 5B4MD 2BVEA 4PJXE 3LQAL 4NZ8A 2FWOB 2BSTA 4GS7C 2K70A 4MASA 3QQ4A 3TT3L 3GRWA 4R4FH 4PRPD 2X3BA 3BP6A 1T3FA 4UDTB 1PFCA 3EGSB 5DUBB 4RMWA 2FGWL 3EXLA 3LZFL 5D7IF 1JPFB 2G4EA 5A3IC 4WHCA 2ICWJ 4GUOA 1KELH 2W59A 1AS7A 1FDLH 4G8AC 4XN5A 3VSUA 1UB6B 4DOHE 4NAQA 3C6SB 5KJRL 2OP4H 4LL4A 5JHDE 2YC1A 2YD3A 4ADGA 3QIBC 4PP1D 4XH2A 5LBSL 3L3JB 5LVEA 3CC5A 2RQ8A 4NSKB 4HU8A 1C1EL 3OKMB 4NQCA 3E7JA 4WFHD 2G5BA 5IJCC 2PTTB 4I18C 1KPRB 2R2EA 3MGTB 3SYQA 3ECBA 2ZOUA 5BO1H 3GJEB 4W9KC 3SDAC 3QEGH 1WTLA 4DZBA 4MQSB 5HDLA 1J48A 2CM6A 5B3SB 4L4TB 1MQ8A 5D4HA 4YGVA 1IBZA 4IJ3B 3AS2A 4BUQA 4NQDB 3D69A 4J7RA 2HMID 1YEEH 2R56L 3LN4A 3QDAA 4A2EA 3D50A 3INUL 1CC3A 3E2HC 3G04A 4OZGB 1WD9A 2HT4D 4EIUA 1I85C 3AG2B 2XZQL 3A0OA 3IFLH 3O41A 1U2HA 3QH3A 3GSNB 4JN1L 4U7MA 4PJ7F 1TJGL 1BMZA 3VI4A 4HEPA 3M17B 3ZZLA 2XXCB 3VVWA 4OV5A 3EO0B 2FJHB 2AEWA 2QGEA 3PGFH 2J8UB 4JFQA 3T08A 3W56A 2WXNA 3NZUA 2ZOWA 4GS7B 4KOBA 3C09B 2BIMA 3VQ1C 5IQLA 1DE4A 4PV9A 3VXTB 4Z7QE 4UQEA 4ANUA 3ZKMD 2EE6A 4GSDH 1D6VL 4O2FA 3KR3L 3QZMA 4DVBB 5CP7B 2WP3T 2F74B 3QUZC 1UB5A 4FFZA 4P59L 4EXPX 5GQBA 3G5XB 4HHGA 3VFSA 4ANXA 1U3JA 4LKCB 2ADYA 4XNQA 4X7FC 1FE8L 1R5WB 5ESQA 1BM3H 4KDWA 3ZDXB 1A64A 3QIBB 3PJSA 1YN7B 4WUKL 2VZ1A 3P9WB 4ODWB 4ZFOB 1A7NL 1T2QL 4LOUC 4X6BA 3QRBA 3VXPB 3EUUA 4XWOD 2ZWLT 3B9EA 5FS5A 1RJYB 4JQVA 4QD2E 1A3LL 1NKRA 2CO1A 3BX7C 4GINA 4FQQA 3D25A 2IEPA 3QQ3A 4JY6A 3TA3C 3VMOA 1X5JA 4OZHE 4KHXL 2VH5H 2XY2A 1N2RA 4FQQB 1V3JA 3US0A 3BAWA 3RNQA 2MNUA 5CJOL 3SBQA 5CEZE 1FGNH 3HHSB 4JJOA 5F0JB 4Z7VF 5D6CA 3HBZA 1BQHB 2RA1A 4Z8FH 3GIVA 4W4OC 3C60D 4MQXD 2KPWA 4NN7B 5KVGL 1MOEA 3WXWL 4KY2A 4FKEA 2DWEA 2CJUH 4HS3B 4LL1A 3FL7A 1KB5A 1TSHA 4AITA 5TH2B 3G5WA 3G5XA 4L3EA 3CH1A 3HUJB 4WFFE 4ZUWB 3IMRA 3L1OH 2W0KA 3WG7B 15C8L 4ZK8A 1CLVA 4WNQB 4UBDD 3MRGA 1ETA1 1PLBA 3H9SB 3LVTA 2Q6WB 4P57A 1BBJA 4PV9B 1KN2L 4BA8A 3MFFA 3O2WL 2VXQA 3Q2VA 4JO1L 2BIPA 3ARTA 3WNJA 4JO2L 5HI3D 1HHJA 2BDNH 3MA9L 5F0LB 4F93B 4O51B 2VITA 1AYRA 2NW2B 3PPEA 3Q48A 4GAYA 3MYJA 4KPHL 1WICA 1CL7I 4X6CF 2BSBA 4XRCA 3LPPA 5F70A 3CFEB 1UWGH 1S9WA 2VMFA 1WFIA 4NM4H 2Q86B 3UEQA 3KLLA 1JPSH 2BOBB 1KEMH 2HVJB 3EDKA 4J1UA 3ZZ1A 1IIKA 1KXQA 5MHSE 1WZ1L 2WLNA 4HF5L 4B9IA 4EZMA 2HPOA 5C0RH 1NCAL 5CZKA 1JZFA 5I1LB 1GMEA 3BW9B 4DOHB 4F15C 1MJUL 1T1XB 5JYMA 4ELDA 1UWXH 3T6ZA 1U58B 2IAAC 1U3YA 1JPST 1PKQE 2K9FB 2JJUA 2UXFA 2VR7A 4HHAB 5CKAA 4KRNA 4HISA 5DFTA 2P3YA 4HFWA 3NRFA 1BJ1H 5IKCA 3C09C 2XJKA 3L5WA 2Z7ZA 2X4OA 4N3TA 1J0IA 2PP7A 4PSRA 4N8CL 4QHUB 4Q7DA 4ZDHB 3N50A 5FV1L 4TSCH 5SWZE 5HYSA 1HYSD 1AGCB 1XZ0A 4NQCB 1UZ6F 1WYJA 3IJ8A 4U1SB 2DIBA 3WXVH 3X12A 4AMWA 1PLCA 4XCFH 3Q8FA 5F1SA 4KTYA 4LPTA 3LKNA 4N9GA 2OW6A 3TO4D 4ORGB 1QFHA 2FLRT 5AZUA 3TOPA 4JCWA 1ITBB 3O3EB 5C2BL 1NFDA 1QFUH 2QSTA 4PLNC 3VRIA 3WN6A 4HGWA 2ED9A 1KLGB 3GMRB 3MBXL 3QCUH 1YY8B 2W07A 4I1RA 3QEUB 2QQKH 4WY7H 3MQIA 3WIFB 4NHCH 1BWMA 4OQTH 2A9MH 4ZPVA 4AQ1C 2XBDA 1MRCH 3BP6B 5DUBA 5CZVL 2EE9A 3D3VE 4FNTA 2VIRA 1J5OL 3ARGC 2QDVA 4PJ8D 1PQZB 1UZ8B 2OMBA 3ULUL 1GZPA 3VXSB 4WJ5B 4YHOH 4GXFA 1MAKA 3RJDA 4G72B 4I2XE 1JV5B 2EDTA 4KNTA 3WN5C 3ETBF 3KGRA 4FQLL 1R33A 3L3OB 4TVPE 5F9OH 1QFUL 5HI5C 4C8XA 2NR6D 2ZXDA 5KVGE 4CKVX 3AXHA 1ZLVH 4HIIA 3CG8A 1J9QA 5EORL 4OF6A 5DZLA 3K4AA 1X5YA 2HKHL 1OAZL 3MN8A 1OGAE 1VJSA 2VZTA 1U33A 4OCRH 1WISA 3GJFK 3PHOA 5ES4B 3S2CA 4TNFA 1N0LA 1ZVNA 2NTFB 5DK2B 4XBMA 3LSOB 2E8ZA 1EX0A 1IGYB 2CLRA 3O6FD 4DAGH 4EI5C 1O7DC 1KEGL 4ENED 1FLTX 1FUNA 4HXAL 4LPCA 5ACZA 1WAAF 5EZLB 2RACA 4G6FD 1EAPA 2I5YL 1UCTA 2CWRA 4J3OG 4WV1A 2XKSA 4JPIA 4O02L 3MV7E 3ABKB 4YDIL 1ZWIB 1EV2E 4TUUA 1FC2D 3P4MB 5FYKD 1EZVY 3QUMB 4OLWH 5ANHA 2Y24A 1NCJA 2O6EA 2VERN 3C6LC 1W15A 4HVBA 2GBUA 1MJJA 3L4UA 1QLFA 1E8ZA 2DRUA 3S3BB 4NCC2 4FA7B 5C3TA 1F58H 5KBPA 3S2AA 4N5ED 4WTZA 3PE9A 3EBIA 3MC0A 2ZQKA 1KJ2B 3HUJE 2D2OA 2ICEC 2X4QA 1RZ8A 2UY6B 3REWB 4MDJB 4D7PA 2NXYC 4W9DC 4IU2B 1JRHH 3T1WA 2BMKB 2Z35A 3Q8EA 1FFTB 4WCYL 1YA5A 4OZGE 4MDJA 5D1QA 3WTYA 2LLGA 4XXDB 3WLWC 4XB3A 4AGLA 2ZTBA 4RH4A 3BKCH 3F7LA 4N1HB 4HSQA 2GABA 5E99L 2Z91B 2P5EA 1KNOA 2IXQA 1M7DB 3R4DA 1KTKE 3TT3H 3ILEA 1EQWA 5AYQA 5IVXA 3ARDC 1FVCA 5D2LA 5F7KC 5KUMA 3WY1A 3GMOA 2OSWA 4ELME 3DX8A 3QXAA 2A83A 4MD5A 3L9RB 4N90E 3LH9A 3ZKMC 2G9HA 2Z4QB 5GGTL 1F11B 1A6AB 4PWFA 4GG8B 1OCWL 2BCMA 1N19A 1RD6A 4WHYG 4JPVL 1PIGA 2DM3A 3LRGA 1A6AA 3DVFA 4IHBA 1JPTL 4B9JA 1RSYA 3IDJB 1NGQL 5LG1A 5TQ2L 1ADQA 2A6JB 2NNAB 3UTSB 3IU3A 3L6FA 5E9NA 4P99A 3CDGB 2PYFA 3AAZA 3HVDA 1SNRA 4IJ3C 1O7VA 3TNMA 1KFAH 2X40A 4MCMA 4P4KD 1RZPA 1SVBA 5CKGA 2CDGB 4AYFB 5IB1A 3L7EB 4JM4L 5A6MA 2GUYA 1LK3H 4LB8A 3RU8H 4CU7A 4UM8B 4HIIB 4P46B 5I76A 3GHEL 5B8CA 3L7FB 3RUGE 2E27H 3BZFB 3F7VB 5DVOA 4A7GF 1F2QA 5D7JC 3ZZQA 2J44A 1M4KA 2HWZL 2F5BL 3BRGC 2Z35B 3HMXA 3AT0A 5L2KA 3EHBD 1F1DA 1T4KA 3UXFA 5E24E 5EEVA 4OCRL 5ANME 4U1HB 1DBBH 2GHWB 3MXVH 5CCKH 2RIKA 3EG9A 1A7QH 1OAZH 2ARJQ 2KDYA 3SY6A 1PD0A 1BJ8A 5BPPA 2A6IA 4QXUH 2V5TA 2V2WB 3QS3A 2GIXA 1IUZA 1FN4B 2ZKYA 3S37L 5IFJA 1CFBA 4YZFF 3D0VA 1M05A 2NYZA 2DQDL 3FHEA 2LVEA 5F9OL 5LCVL 1UA6H 2BVQB 5DJCA 3IF1B 3WV0A 4G7RB 1JTPA 1KGIA 1KLGA 3GMRA 1RURH 4IMKA 4HGWB 1AS6A 2HT2C 4V2BA 4AIEA 1GGIH 3U0PA 4GRLB 5FEBA 3ZQWA 1WT5C 4OGXL 1QABA 4YXLH 1F4YL 2XXGA 2K6YA 4AVJA 3S34L 3TX4A 4QTHB 2DQGH 4HSCX 3UBGA 3FUFA 3FO2B 4X6DB 4F7MB 3VXRB 3D6GA 1F90H 4HUKB 5BS0D 3RL1B 2FQGA 4M93C 4QOKD 1JJUA 1RZFH 1YQVL 3BPCA 4JN2B 2YD0A 3ARDA 3VXUE 3P30L 1DFXA 2MQ0A 2Y3NA 8CGTA 4AENA 4IOSA 3MJGX 1KT2B 2H26A 5IM7B 3TIDA 5ITFA 2XV3A 3BD5A 2V5RA 4NUJA 4PS8A 3DECA 5EUOE 5IMKA 1SYVA 2FL5B 4P5TB 3WNOA 3DIVA 4J2XA 1DANU 3BUDA 3HC2A 5FCUH 1BMWA 3W82A 3PG2A 3ERXA 4KGLA 2Y6SD 2C7FA 3E2HB 1KBBA 2DJUA 5DEGA 5EO9A 4FEMA 5DVMA 3FMGL 5AB0A 4NNXB 1IEBB 1E9OA 1ZKAA 4HLZH 5E6ID 2KLTA 4MBRA 1RZFL 3MBEB 4ATWA 4NM8H 5LCVA 1PG7X 2AKRB 2V7NB 5AL0A 3BKYL 2NUPA 4HDIA 3Q2CA 2IJ0C 4B53A 4R9HA 3OZ9H 2R23A 3LJ3A 1GKOA 2H3XC 3O3EA 5JW4N 3ZO0A 1C5CL 4MTMA 4Q6YA 4C56E 4XBEH 5D8JH 3MCLL 4N24A 2E75C 4AEEA 2Z64C 3FQ4A 2EACA 1VSCA 1P7HL 2XRAH 1AD0A 3ATFA 3GF8A 2AJXL 2ENJA 2DEWX 3GXUB 3B2PA 5H94B 2B4CH 2XBTA 3AY2A 1D5BA 4XO8A 1U91A 4A67A 2GIYA 3IJHA 4PRAB 3FUEA 4NQXA 3T3PE 1DBBL 5FB8B 4NUJB 3MOBH 2DEYX 4LHUB 5ITFB 1BZOA 1RZQA 3CN0A 5JORB 2HWZH 4ODWA 2FJSA 4ZFOA 3IAGC 3NVQA 1SDYA 1T7XA 4LCVA 3V4PL 2HRGA 1S9YA 2C9SA 4JANB 1F3JB 2JXMA 2VITB 2APXA 4WFED 2Z92B 2DQIL 1EEZA 1JF1A 1DQQA 2OL3L 3L3DA 4NO2B 2PWDA 1UURA 3VGHA 4D7BA 4Y1AE 1QEWB 3C2AL 4H1LA 4LHQB 4P2YA 2JKTM 3FN9A 4MWFB 4LOFA 1E8XA 3QDGB 3QORD 4G82A 5D7SH 5FYLE 3QVAA 5ID0B 5EOCJ 1KGCD 2CJTA 4L3EB 1CG9B 4NHUB 2C3XA 4ZUWA 1F90L 3IDYC 4ZAKA 1HXMA 3FONB 1SFDA 3FQNA 1T7YA 1UA6L 1X3DA 3I6GA 3NMEA 4WHYH 1QR1A 3A3YB 1UKTA 4HMDA 4NBZB 5GZOC 4DPCX 5I71B 1G7QA 1CFQA 2ADJB 1V27A 4LVHB 1T0PB 4IRJA 3MI6A 2GEQA 2G5RA 4X8GA 1AC6A 4BCXA 4HS6B 2XPYA 2XUWA 3MLSH 2BS8A 2NRDA 4EI5B 2RHEA 4N0UA 4TULL 5FM5O 3TP4A 1XIWB 5BOJA 1AQHA 4GIPD 3GJEA 3ECBB 5F7UA 4PJBA 2VDPH 4GBXC 1GW6A 1SDDA 2ZJSL 4WRLA 3F2LA 3GSRB 3P3YA 2PCXA 2WSKA 3FFDB 3SDCC 1EGJA 5CEZD 4JMXA 4WEUD 5JMRA 3MMEA 5FO7A 2ZX7A 5LNEA 1FLRH 3X1GA 4UANA 3FAWA 3QZPA 3RPIA 3U7YH 3WNPA 1IKOP 2E7HA 5DRZB 2P5WD 3RAJL 1MHEA 1KTCA 2F7PA 4Y5XB 2CXGA 3WIHL 5I26A 1SXZA 4UT6L 3P9LB 1LTXA 2AZAA 4X98A 4R7NA 3CH8A 3E6HB 5KEZA 1E6OH 1WIPA 4J4PC 5ISZD 1HIML 1FNEB 1PIFA 3MOAH 1E9OB 4L2YA 2WM0A 4YDLC 5KVEL 1JFHA 1N3NB 1DO5A 2FWOA 4B9CA 5LBGA 5TFSH 4TLSA 3LIZA 3QH3B 4JFDE 4PJ9A 2YK1H 3F8UB 5EBWA 4LSDA 4HWBA 5JXAL 2BINA 3HBPA 2WUCH 1VF5C 2YGVA 1SBBA 2B20A 2FL5A 3EJPA 4P5TA 3QZOA 4YDVA 4ZQKB 3UZEC 4YO0B 4PBWD 4ADJA 2R83A 3KAAA 1RJLB 3MRCA 1I9RL 4GFXA 5HGAB 1P5VB 1W16A 5FGBA 2BNQB 1SY6H 5I74B 3ULSA 2AQ1A 2IQAB 4QYOB 3QI9A 1QQDA 4Z3TA 4PRHA 3W5MA 4LCYB 1FWXA 1QPXA 2FX8L 2NPLX 2PF6A 2V8MA 4L18A 3Q43A 1P6WA 4M61B 5BZZA 3MNZA 2CIIB 1TF4A 1UM4L 5T3ZD 2A6DB 3QUXA 1IBYA 1AHKA 2LU4A 2ZAHA 1QFPA 2ZCLH 4GIAA 4IIQC 1CIUA 4KH2A 5E5RB 4BHUI 3MBEC 3UC0H 5FR3A 3NEXA 4M6MH 3RVXD 4KZEH 4L37B 3MLPA 4OZHB 5EUKA 3V0EA 3AFLA 4XN9A 1BAFL 1RK0B 4X7DC 1BOYA 1Z5LA 3KWWB 1T6WA 1KYFA 3TA3D 5MEND 1JPFA 5AYTA 3QPXL 1CICD 1I1CA 1HINL 2BNUA 3X11B 4NQUA 4X5XB 1ZVSB 5DMYA 1ROWA 4B96A 3EG9B 2QADD 3PQYD 4MX7B 4PCYA 4ZSOA 2IGTA 2GAZA 1RFDL 4TNWF 2FH6A 3NIGE 4CGTA 1ZLWH 4B9GA 5KW9H 4OLUH 3EJSA 4P5RA 3MRMA 1FZOB 4LCCA 4MSWA 4XAWH 1IC4H 1VCBC 3OB8A 4YO0A 3FT1A 1DVTA 3O4OC 4XVUD 2V5YA 3ARRA 1GOHA 2WXRA 4ZTPH 3V0WH 2VXQL 4UQ3B 1BYNA 1IM9A 1MIML 1EXGA 3WUWA 4NJ9L 1IQDA 2F1BA 3LQAC 2PYED 3NJVA 4KTDH 5F8QC 3IEAA 2F61A 3GKWL 4J8QA 1XGYH 1HXYA 3KVDD 3FU7B 4AIZB 3GRWH 4L8CB 1AZVA 4UTBH 5HD8D 3VVVA 2LU3A 1THAA 5D4JA 4OFYA 4W70A 3D4ZA 3V6ZB 2ZSWB 2FT8A 1A2YB 1X9QA 1MNUH 3W0WA 1OOAA 2P44B 4L8SC 4FF9A 2BHUA 4K9JA 2QSCH 3LS4L 4OKVA 3BVTA 5E2VH 3VI3F 2X6MA 2XTLA 4EJ1C 3RPBA 4KNUA 2XTJD 4MXWH 1OP3K 1GIGL 4XOAA 5TE4L 1EFXD 3CSYA 5KVGH 3QG7H 3X12B 2Q8AL 1NGZA 3ZK0A 3TA3A 5FIEA 2HJLA 1XB8A 2B5IC 4QJ5B 1KENL 4WWKB 3C9NA 4I48B 1FPTL 4FQ2H 4ZDHA 5FYKE 5HYSB 4HX1A 4PJBB 2JB6A 4UNUA 4NQCE 5I71C 4PU2A 4PRHB