3HA0A

Crystal structure of the ige-fc3-4 domains
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
209
structure length
209
Chain Sequence
VSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVQLTWSRASGKPVQHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ig epsilon chain C region
publication title Conformational flexibility in immunoglobulin E-Fc 3-4 revealed in multiple crystal forms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 38
structure length 209
sequence length 209
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ha0A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ha0A02
3OJ2C 3NZHL 1NUFA 3FQNB 2ZOLA 1S5IH 2YEZB 3J7HA 3MOQA 4F57H 4OV5B 4U3CA 4JRYA 2Q6WA 1JF1A 4BH7A 5KSAC 3RUGF 5J1SC 1JF5A 3VH8A 2BY1A 3MRGA 1ZT4A 4MJIA 3UPAA 5LQBH 2O5ZH 4ZOEA 1KLGB 4UDUB 4P48A 1UEMA 3U1SL 4IJ3B 2BZDA 4HKJB 3OPZH 4WTXA 2O61B 4Z7VF 3K7UA 5B38G 2WLYA 4POUB 4TUJB 5C9JB 3QWOB 3R1GL 1TPXB 1BF2A 4FS0A 1AIFA 3STLA 4OLWH 3V2AR 1S7XB 4QHNB 3GMPB 3BH9A 2BSRB 3BUYB 3HE6A 3DTXB 3R8QA 1I7ZA 4PLJD 4G80B 1HK6A 1JK8A 5DF0A 5ERWA 3CSPA 3QNYB 1BEYL 5T1MA 5BOPA 4HLJA 3T2NH 2FHFA 4UDTA 3LD8C 3L6FA 2FEDD 1OAYH 4M6OH 3U0TA 1PY9A 3WHE0 2BVQB 4MD5A 3MOAH 4YHML 4YGVB 2PYEB 3F7YA 4NFDA 2LVCA 2X4NA 5C6WH 2A6KA 4BK4A 4N5UA 2DQEH 5K59F 3FO0L 4IHOB 5E2VL 2VLKB 3Q6GL 1C08A 1FIGL 5DR5L 2VQ1A 4MWFB 3V6FB 2YPKB 1QACA 1FFOB 2WW8A 4N8CH 5FYKL 4W6XB 4KRLB 1D9KA 5A3ID 1KXTB 3TC9A 1JFQH 5IEHB 1B4JL 1T22B 4OD3H 3BESR 4OGXL 5T5FH 1PZUB 2HMIC 4F33B 4MNHB 1ZT1A 4QRQB 1FVDA 2WWMD 4QLRA 1SJHA 3D39D 1T66D 1JHTA 4GMTL 4L9LB 2NYYC 2NY3B 3IXTA 3QI9B 4E41D 3RVXC 4WFFE 3ZTNH 1MF2L 2WWKT 4PRPE 1IAIL 4G6AD 5CCKH 4JVUA 3ULVF 2Z35B 2QKIB 5DFVD 3MJGX 2DQDL 1CFBA 1NBVL 1LP9F 3U30C 3MMEB 4DCQB 4ZTOL 2P8PA 5EPMB 3W9DA 2VISA 4QWWC 5EUKA 4MQXD 4XVSL 4OLYL 5BO1L 3O6ML 4FG6D 1KB9J 3HC0A 4Y1AB 3UTTE 1FRGH 5FYKU 3SDDB 4AQOA 2YA1A 4TSAL 2DQFB 5I1JH 1A1MB 2HJFB 3DSFH 3G6JA 4JB9L 3MV01 4LLYB 4P4KC 4LSDA 5CP7B 3PXJA 3NIGE 3UX9B 3BSZH 4POYA 4XNUL 5LWYH 5IB1B 3BGFB 3LH2L 2PO6A 3BP4A 2ZCKL 5GSVB 1AJ7H 1RY7B 3NIDF 3I02A 1FH5L 1GAFL 1T83A 1M7IB 4X6EA 4AL8L 1MFCL 3BMWA 4JY6B 4JPVL 1KJ3L 4WO4C 4XNZC 3JWDC 2NY4B 1SJEA 3WO4C 2RCSL 1YA5A 2VSCA 3MUZ1 4WHTB 3WLBA 3PWUA 1GL4B 1ONQB 1ZA6A 5JZ7C 4NNXB 3V4VL 4LPVA 3NA9L 4JPWL 4OIIL 5EBWB 2OK0L 5T1LA 2ARJB 4RDQG 2ZUUA 3NACL 4ZXBB 1JI1A 4NQCD 2J5LB 5D7JA 4YHLH 1YDPA 2FJGA 4E9LA 3FL7A 1RD6A 3VXTA 5DMJB 3ARZA 4I5BA 1RZ8B 3PQYA 3GI9H 1C7SA 4PRPB 1C5CL 2KZ1B 5DD1L 1OGAE 1BD2E 4HIIA 2UVEA 2AEPL 1T7YA 4UAOC 5DJ0A 5GGQL 4Q9QL 4APQC 3OZ9L 1U41A 4GAFB 1A1OB 3UTTB 3IRPX 3ROLB 1G6VK 3D25A 2N7BA 1I1RA 2EIEA 4P4RA 3LKNA 3NCBB 4JY4A 4OB5H 3JV5A 2D7QA 4XAWL 1FNSL 4YFLI 3EYOB 3OJDA 1WLHA 2F19H 4LSRL 3LDBB 2C1PA 1JWUB 2AV7A 5BS0B 3HRPA 4HCRA 3GMLB 4G3YH 2G5BA 3MUGB 4HAFA 4LLAA 4LLUA 1Q9KA 1INDL 4WFHE 1CLCA 2HFGH 3DX7A 3O8XA 1XGRA 3B5HA 3RVTC 4PJ7F 1KCLA 2FECI 5EC1A 5J1TC 1CXFA 3ZE0F 3U7WH 3MRJA 1TVDA 5DZOA 4KROC 3MBEB 1WFOA 1NMAL 2BHYA 4QRSA 3OR7A 2Z4QA 1H9VA 4FQXB 1PKOA 4XC1L 1U3HC 4L8CB 2HVKA 3KHOA 4XNYH 4DN3L 1DUZA 1I3GH 2MSPA 3UJIL 1XR9B 5L2JB 1LO0H 2DJSA 5D5ME 3H3BC 4GBXC 5J1AB 4NWUH 3MLRH 1KJ2H 2LAGB 1Y0LB 3UBXA 3LKQA 5CEZH 4PJ8D 3OF6D 5D7KD 3IYLW 3LQAL 4TRPH 3ARBC 4HIHA 1R5IA 4ZAKA 3U46A 4Y5YA 2YBRA 4DOHE 2Y07L 4HV8A 1HSBB 3BP6A 1ADQA 5M94B 3SHSA 3H3KA 2AXFA 4FRWA 2VQTA 3IFNH 2D4FA 2W0KA 5E4EC 2YPLA 4M6MH 1N3NA 5EUOE 1ZKAA 1L0XA 1MFAL 4LDEB 4UT6H 2X9WA 3G04A 3U82B 1YUHA 4XZUA 3ARFB 4Y5VA 3SOBH 4H88H 5DUBA 2YA2A 9CGTA 1IM9A 3OTTA 5EIIA 2IPTH 4JRWA 3HPJB 3LKOB 1IAKB 1I1YB 2NXYC 3WYRA 2HLAB 3PIQB 3O41B 1FPTH 1JGEB 5IMLB 5EWIL 5J6GB 5I8KH 2AV1B 1NCBH 1PLGH 1X5ZA 4YZFE 5GS2D 3FQNA 1OAUH 4NKMB 3BO8A 4I3GA 5C0EB 1RJYA 5FEBA 3BKJH 1U91A 2A83B 3HFML 4KMQA 2EYRB 3FQUB 3V0VA 5GISL 1I1AC 3TBSA 3MGAA 3VFPB 4OUUB 4NQTA 2HLFC 4IRZH 3DX6B 5F89B 1MNUL 1CU4L 3GSNL 3H7BA 3QWOA 4HLZG 4P46B 3WUWA 2VDLH 4MD0B 3GSRB 3HKFA 1RSFA 2JCCF 4L8SB 3SDYH 1S7XA 5CUSH 3CUPB 4Z7UF 3MC0A 4QHNA 4OZIE 5DURB 1EIBA 3GMPA 1GPOH 3BDXA 4P5TC 1YNTA 1HSAB 3MV8A 2DQUL 1NFDE 3MA7A 1YECL 4R4FL 1YMME 5GGVL 3E8UL 2P1YA 4U1GC 1NCNA 4DOHB 3AGVA 2CQVA 5F7HA 3O4LA 1EMTL 5LAXA 3CVHH 4LIQH 1D5IH 2EDQA 2KZWA 5DA0B 4BKLA 3S36X 4D9QE 3QAZB 1EJ6A 2JJVA 4PLNC 1FO0A 4NRXA 5IGXL 2EXWD 2PYEA 1OM3H 1XGQA 4XNXL 4M4RA 1N6QL 5ADPL 3OKMB 4I18C 2DMBA 4JHWH 3HI6H 1B90A 5IBUG 1CGSL 1BZ7A 1CFTB 4MWFA 2DQIL 3V6FA 2YRLA 4GH7B 1FVCB 1LK3H 5BW7C 4KKLC 5I19H 1C12B 4KHTH 1T22A 2YA0A 4U1JB 5JHDA 3PV6B 4Z9KB 2NXZC 4RGNE 3VXUB 1NC2B 1FE8H 3ARVA 3K46A 4Y16D 4O02H 5I1DB 2R9HC 5BV7L 3IJHB 1W72H 4LHUG 2M26A 3B9AA 1SM3L 2P5ED 5L2KE 4NCC1 4JN1L 1CQKA 1AGDA 1E0OB 1LO4L 4HGWA 1RUPL 3V52L 1X44A 3W81A 5T33H 3I85A 2MWCA 4GG6F 1T2XA 1VACB 3SDXE 1ETZB 4UU9B 3BGAA 2IQ9H 5B22A 1UZ6E 5D6CB 4UV7L 5IJVB 4YUEL 1IGTB 3B2UC 3RWJA 1CF8H 4MDIB 3L3HB 1OW0A 4YBLB 3ULUL 5EA0L 4PY7B 4TVPH 1HH9B 3NZ8A 4P2RA 5F9JB 3SKNA 4WI5A 5C7XL 4OZIB 4Y1AA 1T1ZA 3W9EB 1P5VA 3O6LH 5TDOB 1JRHH 5DK2A 3EJZC 4Y2DC 2OTWA 2R0LH 1ZLSH 1YMMB 2HJFA 32C2B 5CEYB 1S9KC 2J12B 3ZL4H 4PJBB 1IGCL 3MBXL 1EO8L 4KMTL 2RFXA 4OFYA 2ITDA 3BQUB 2WUBL 4WUUB 4WEMB 2XIDA 1HIML 2AXGA 2VLRD 3TT3L 4YE4H 2EDXA 1FGVL 3VRJA 3IVKA 1K85A 3VXPA 1G9ML 4HWBA 4R8WL 2J6EA 3RNQA 5DFTA 5EN2A 5ESVA 4RMUA 4JO2L 5IROA 1EFXA 1NEZA 1WIUA 2DTSA 4WHTA 4ZUVA 3MNVA 1U6AH 4YXKL 4Q6IA 3JV6B 2KQMA 4LVHC 5DWUH 4X6BB 4I3SH 3VMPA 3LN5A 4ZQKA 4RGNB 5JW4Q 1KPVB 4P3DB 1GC1L 4CDGC 3FOLB 2IBBA 2EC9U 4N0YH 4X98A 3MFFB 4IOFC 1VFBA 3C60B 8FABA 1WZKA 1G7LA 1A7QL 2ARJQ 2H32H 5BZDB 4JRYD 2PR4H 3W0WD 1RZ8A 4WGWB 5D6DA 3UTOA 5FK9A 2I9LB 5I74B 4ODUB 4X6CF 5T3ZD 4LPWA 5F44A 1QEWA 4KTEL 4MJID 1NCWL 4NFBA 4FN0A 3A6BH 2IBZX 3P9LB 2AGJL 1CG9A 2QSTA 3NCYS 5I15L 4RAHA 2VDPH 1P1ZA 5JXAL 1AY1L 3WE6A 3ETBF 4N9GB 5D93C 3T0WA 5CBEB 3QZWG 4P23C 3VXSE 3V5DA 3H9HA 2UZXB 1B3JA 3MXWH 2DRUA 1HNGA 2VUYA 5F93C 3SPVA 1VPOL 4GRLC 4O58L 1KG0A 1HYSC 3HE6D 2FJFA 4X7CC 1XAUA 4G8IB 3QIBA 1JUFB 1YEGL 1UYWH 1GZPB 2JB6B 3EFFB 2PN5A 2NTFA 1UJ3B 4EZMA 5B39B 4U2ZA 4UV4L 3AAZA 1MCBA 3N0PB 1QSEA 2XXCB 3U4AA 5HDBF 4N5EC 5HI4C 3P4OB 4KJQC 2GSIA 4JDVA 1G7MA 3BPLC 1I9JL 4XBGA 4GAJL 3HR6A 2BCKB 3BRDA 3C5SB 1EGJA 3E6FA 4PGEA 1WBXA 1T1YB 3ULVL 4G9FE 4L8CA 2H9GB 5DC4B 1BQLH 4ETQB 1WUNT 5IVZB 15C8H 1FL6A 1XR9A 3VXMA 1JMXA 3KLSA 4KZEL 3QDJD 3QHZH 1KPRA 4QRPA 5FUZH 5J1AA 4ZFOL 4NOBA 3TH4T 1RUKL 3MJ8B 5F9WB 1PY4A 2YWYA 1T1XB 4HJGB 4R2GD 2HA1A 4NZTL 1CD1A 1MCJA 1HSBA 1MJ8L 3ES6A 4I3RL 3DV6A 5DZLA 4HUMB 4DGVL 1F90H 2GAZA 4O5LH 4LCCC 1J1PL 3HNVL 4E0RB 4P5KA 4XPBL 4FFVD 3VXSB 2QHRH 4AG4L 4P5MB 4JGJA 5E6YA 5DO2D 5I1IL 4GAGH 3LEVH 1DEDA 1E4JA 3KYMB 5DRZA 3KHQA 4MA1C 2OS7A 3O4OC 4LLDA 2D7PA 4TSCH 1F42A 3Q5YA 4B41A 4M62H 1MHPH 3AY4A 1F6AA 3TT1L 2WIMA 4DUXA 2RHEA 1B0GB 1MAMH 4RFOL 2R29L 4AH2A 2DBLL 5C0CA 3KNBB 1NCTA 3I2CL 2FEEI 3GMNB 4KVNH 2FJHB 5DK0B 4OUOA 1TZGH 2EH7L 3T1WA 3WIFA 4CN6A 2A83A 1FLTX 4JGMA 2C3XA 3RTQB 1MHHA 1I8LC 3FQUA 4G8GA 2FIRT 3DECA 3O3UN 2AQ3A 3ZDZE 1QA9A 1QQDA 4ZPVB 2IH1A 4HBCL 3VFPA 3QIWB 1UWXK 5F89A 2EDWA 2X4TA 2ZKHL 4UOJA 4YPGB 1F4XL 4P46A 1IC4H 1UH3A 1CXHA 3BP7A 3CSYB 3ROOB 3GSRA 1KGCD 4ZSOA 5JMOC 3GFUA 5KW9H 2IEPA 5D7JD 3CUPA 2IF7A 1DTUA 4KQ3L 3JWOL 5CSBA 2CJUH 1U8JB 1WTGT 2HWZL 3N1MC 4Y5XB 5HHQB 1N8ZA 1FLRL 1RZGB 1A6WH 2DDQL 5I30L 3PQYD 1QYGL 5HHOA 3W5NA 4P9MH 2NY6B 3T08A 4ENED 4RZCA 1NLDH 1GOFA 1ZMYA 1RJCA 2BFVH 3FJTA 5DYOB 2QADB 1H3GA 5EOCH 2B5IB 1QP1A 4GW5B 4UQ3B 1J1XL 3OKMA 1BFTA 2FZ3A 1K2DA 2GTWA 1I3VA 1DDHA 1Q0YL 5JUEL 3T0VA 4YHIA 5C3LD 2QSQA 4UB0H 3DUSB 1JYNA 3KPRE 1TCMA 2Q3ZA 3RY5A 1PG7W 1ZHNA 4PD4J 4PJGF 4DZBB 3X11B 2AW2A 1KBGL 3B2VH 3PV6A 3RWDA 4GKSA 4IMLB 7CGTA 5INDA 3QQ9C 1NC2A 4L8BA 5T3XD 4Z95L 5I1DA 4DKFL 1KXVC 4UNVA 1N0XH 3O8XD 1BFOB 4IJ3C 4X4ME 4Z7QF 1CT8A 1F4WH 4N68A 4Y4FA 5FYLE 4EDWL 1P9MC 1OD7A 2WAHA 2IG2L 2VC2H 4XMKL 5JHLL 4LKCB 1TPXC 2BNUB 2IFFH 4HKZA 1VACA 2BHUA 4Z77B 1QPPA 4F3FA 2OCFD 5D6CA 1OSPL 1TTGA 3LN9A 4G6KH 1C8PA 1YEKL 1JV5B 2ICWA 4PP2B 4C83B 4OCLC 3BT2L 1KIRA 1EH9A 1T3FB 3Q5TA 4M8QA 1U9KA 2DLIA 5IKCB 1EEZB 1X9QA 1CTNA 4HKBB 5TDOA 2VXSH 1QR4A 4HF5L 2E9WA 32C2A 4RA0C 4TPRL 4EI6A 4PJBA 1CCZA 4XXCA 5DHVB 3ULSB 1JHLH 4HWEH 3QFJB 1DVFB 1W0VB 4ZAKD 3VFTB 1JE6A 1IAMA 3H2WA 5HD8C 2YD7A 2Z93A 4OGAC 4O2FA 4V1DB 3O3BA 2YPLD 2FD6L 1UM4L 2W60B 5HY9B 5FECB 3ARXA 3H9ZA 3LS4H 5D8JH 3QUML 5C0ND 1Q72H 1ZK9A 5D70L 2WBWB 3JV6A 3KPRB 2EDBA 3O11B 4X6BA 2HTKC 1XGPB 3C08L 4L9LC 1KPVA 2P45B 2NY3C 5H94A 2IC2A 3QI9C 3DXAE 1HEZB 1KEML 1JZ3A 1YEFL 2GITA 3MFFA 4P2OB 1JNHB 4MZ3A 2YRPA 4CJ0A 1IKFH 3C60A 4U05A 3CH8A 1WT5A 2OM5A 1XCTA 5MP6H 2H2SC 3QIUC 3ULUE 3QFDA 1UWXH 4HXAH 3TCLB 1V8HA 2R69H 7FABL 2EDEA 3CMOH 3TZVA 1WZLA 4CRPA 1HN1A 1UXSA 5BXFB 3X3GL 1S7RA 5I1CL 3KYNB 4RRPG 3GJFB 1DQDL 2YN3A 3RAJL 1JZ6A 2AK4B 3SDDC 4KQ4H 2DMCA 3T3PF 1BJ1J 1V7NL 1MCQA 3EYSL 2FATH 4XT1C 1N6VA 1IQDB 4JQIH 1NDMB 25C8H 3H9SA 1E6OH 1DBBH 1FNGA 2J88H 3DX8A 1MFEH 1HHGA 5EO1A 1S8DB 1VSCA 4M1CD 3DBXB 3BGFC 4NHCL 5E03A 4U6YA 3DMMA 2VXQL 2HT4D 1ED3A 1WBYA 1WAAE 3LZFL 4GUPB 1QLEL 3RGVB 1GZPA 5ESQB 5TE4L 2BJMH 3HTLX 1RZIB 3O4LD 5F1OB 3RUGE 3RWGA 5C6PB 4G5ZH 4UI2A 4XNQA 4L3EE 1H15B 4J3VA 5D2LA 3RWFB 4B53A 4NO0B 5C0JA 1AC0A 2R4RL 4AMKL 2H1PL 2AJVL 1HKLL 3BPCB 3C5JA 4J1UA 3RVWD 3F58H 3HLAB 4Z7VE 2B2XL 2DS4A 3O0RH 1P4BL 2ZUSA 5C09E 5KZCB 3FQRB 4ZXBC 3TN0D 3SCMC 5DD3H 1A6TB 2J5LC 3MRFB 3NTCL 4XHQA 1IQWL 3RHWK 3C5SA 5BVPH 5ADOH 1TJIL 5F7EH 1P2CA 3WDIA 3DXAB 5D1ZA 4KJPD 3VD7A 3BN9C 5IVZA 5JHDD 4LEXH 1RVFH 3TFKD 3HI5H 3TLRA 1KIPA 4NZUH 2NW3A 3LKPA 1S7VB 1AGFA 4JKKA 1UA6H 4QNPF 1U93B 1LNUA 1ZE3C 3U4EA 1A6UL 2AEQH 1S9YB 2WINB 2DWEA 2FSEB 3F8UB 1WF5A 1KXQE 3X12A 1J5OL 1Y18B 5IM7A 5KS9F 3AREB 2E8ZA 3DRTB 3EYQC 4HUXA 4K71B 4F37K 4LLQA 5DGRA 4LCYB 3O9WB 4MS8D 2VLJA 3ME0A 5DMKB 4N8VG 4M48L 4OZHF 1U8PB 4P2RD 1QHPA 2Y36H 2Y1VA 3VXRE 3R06A 2AKRB 2J4WL 5J12B 1IFHL 3QEQD 5CZKA 1RHHA 3IAGC 3MLUH 4IMKC 2R1XB 4UUJA 1I8KA 4RAUB 1R3JA 3ZDXF 1QVOA 4IS6B 4XX1G 2H6PA 2P44B 3QH3B 3RUGB 3ZKND 1KC5L 1KN2L 4JFFB 4OFYD 1SBBA 4FQ2L 4L3EB 3FQTB 5SX5K 4M43H 1YEEL 3GMNA 1MJUH 3ULVE 3MBEC 3P4MB 1YY9D 2F8VA 1PFCA 1XIWA 3IJYA 3KPNA 4LSSL 4Z7VB 4XI5D 2QQLH 4HG4K 5DJ8B 4X8JB 4FQXC 5C09B 1J0ZA 4EVNA 2CK2A 4U6HB 4EN3A 4KGLA 5GS0D 2R4SL 1FZKB 1EFXD 3WIIH 5C86A 5KVDL 1EEYA 4FZ8H 3RY4A 5IR1A 1SMOA 3MLSH 5SWZD 4NNPH 2XPGA 4ZPVA 2FB4H 1MIML 3QIWA 1ZLUH 4NQXA 5GIRB 4C56D 3KPSE 2GT9A 2X4UB 4NQDD 1FVEA 3TO2B 4NO3A 3MACL 1F2QA 3UTSD 3WO3B 1RZFH 5JIIA 2JJSC 1KN4L 3EO9H 1JWSB 3UTZB 3SDAD 4Y5XA 5HHQA 3P77B 2AJYH 5IW6A 3QDGE 4XBEH 3UC0L 1FFQA 4RBPK 5HGHB 3NIDE 5CD3A 1RZJH 5GGTL 1SEQL 3ARFC 3RWHA 4D3CH 1FZOA 1KCUH 2VDNL 3P9WB 5GGRA 3MLPA 5DYOA 3TJEH 2AERT 1CDIA 2UYLA 4KI5D 4ERSL 5FB8B 4ISVA 3S98A 3TO4B 4DVRL 5C07A 1HKFA 2EC8A 4GLRI 4RWYH 2YKLH 2BP3A 4KFZC 1A6VH 4NKIH 3BZFB 2VITA 1F4HA 2YD6A 5ISZA 3QIBD 1S9VB 1A4JB 3F7RA 2YUZA 4X99A 4PJCF 3OMZA 4IMLA 1P5UA 3L3IB 4OZGF 3LKSB 4HH8A 4QXTB 5HI5C 1AD9A 1AC6A 5FOBB 4BSVB 5BQ7B 1W0WB 4WVRA 1QSED 1LP9B 3GB7B 5DMGC 4B7IA 4NKDB 2FX9L 1AP2A 3MXVH 1F13A 3U9UB 2BNUA 3LSOB 3EDJA 1DL7H 4FQ1L 4KV5E 4ZFOB 2DBJA 2WBKA 3CXHJ 3LRSA 4JG0H 1RUAL 4L8SC 4GKNB 2OJEB 1MJ7L 3V5KA 1NMBL 1GXEA 1CE1H 1T3FA 3R0NA 1WISA 5C0DB 1D6VL 4MAUH 4U1NA 2AS5M 2FHCA 1ZVSB 4J3TA 1U8OA 3HZKB 3VXMD 4WFED 5JPNA 4HKBA 4XH2A 2CKBA 4MVBD 4WW2A 3VFGL 43C9B 1DFBH 5EOQH 2F74A 1QLRB 1ZEAL 3QDGB 1EERB 5DRNA 5F96L 4LQFL 1NGXB 3MRMA 3QAZC 5CMAB 1P84J 4IOSD 1J1OH 2AJ3A 2NLJA 2XTLA 3MO1B 4L4TE 4PJ7E 4O2EA 2IALA 1MCKA 4NC1E 1DZBA 2BOBB 3ZE0E 3AS3A 3IDMB 3THML 1JNNH 4K3DL 5EZLB 1EAPA 4Z0XB 1OAZH 3WCYA 1CGUA 1U3YA 4V1DA 2J7LA 5HJ3B 3O3DB 1OAXL 1RUML 1FFPB 2GJJA 4H1LB 4WENB 2DYPB 5E2UL 3L5XH 5SX5H 2ZNWA 2ZUYA 1T0NB 3INUH 5C6TH 2IANA 1HHIA 2YSSB 3KGRA 1K5NA 3O6FB 5MEND 1XGPA 1KLUB 1WITA 3ARDA 4NBYB 3CFKB 3T8XA 4C4KO 4CU7A 5C71A 1NCCL 4I2XB 1FL3B 4XPFL 3TA3A 1Z9OA 3CZFB 2A9MH 4FXKB 3RZCB 1GGBL 1JNHA 4GXVL 1KLFA 1SY6H 1B6UA 5C0CD 3I3DA 3HC3L 1O7SA 1WEJH 2WBJB 3QEGH 2R2EB 5CIPB 5D7SL 2Y9RT 1F4YH 3V6BR 3P73A 5ANME 2EKJA 3OKYA 1XF4B 4YBLC 3MLZH 1GH7A 4ETYA 1FYTE 4G8GD 3DO7B 3KYNA 3G6DH 3GJFA 3M17A 1R3HB 1EDQA 1ORQA 2AK4A 2F58H 4PRID 3QWRA 1UCBL 3U7YH 4HEME 1QBLH 2EXYC 1MH5A 3LIZL 4RBPH 5KSBE 4CU6A 3BOVA 1X6NA 2FIKA 1NDMA 2NX5A 3KYOA 1IEBB 2E9JA 2W59A 1VKXA 2BNQB 3BQUC 5IEKA 4HJJH 4XVUC 1Y6KR 2XFXA 5DTFB 4ELMA 1GJIA 5IK3B 3L3GB 1S7WA 4L4TB 4PJ7B 4O4YL 1UM5L 5ITFB 4DEPB 2HJKB 1CR9H 1NGZB 1A9EA 3FRPA 5IVXF 5HHOD 1JMZA 4UZGA 4YDJB 5GS1A 2XZQL 4K2UL 4CN1A 5L6YH 4NUGH 4EDXB 4D94A 4YK4C 4ODHL 5LBSL 3JSSA 2YMXH 2EC9T 3RWFA 4ODTH 4GQ9L 1J18A 3MJ9A 2Z92B 3SE4C 4OLXH 4AJ0A 3CK0L 3FQRA 3IFLH 4RGNC 1CBVL 5J3HC 4HZLA 1EVTC 3NN8A 3JTSA 1HWGB 4PRNA 1L7IL 4NNYA 4Z7UE 3O2DA 1CD0A 1TITA 2HFFB 4KVCL 4WDIB 3RIAF 4WI7A 1AKJA 3HCVB 1OP9A 2I5YH 5I74C 4A6YA 2HMID 1MRFH 2YC1B 3BAEL 3D3VE 4RNRB 3E2HB 3OAZK 4Y2OA 5ANMB 1WFTA 1UB5B 4GG8B 3MLYH 4Y4FD 1SVCP 2D31A 3RFZC 4N90D 1FYTB 5IFAH 3H0TA 3ZE2F 1S9YA 2XZZA 5MEOA 5T1KA 2Q8AH 3T0AA 3T2QA 1T6WA 5B3JE 2IGFH 1Y18A 3OKEB 3MNWA 2A9NH 4F9PA 4IOIB 1D7FA 3HNTH 5FKPA 4HH9A 4LGRB 4XP5L 3IDXH 3TIEA 4HJ0C 3TNNB 3OXRB 4TSBH 3IF1B 3TGXA 4UMGA 5HYEA 2YPVH 5DLMH 4WWID 3QUKB 2ATKA 4PGDB 5KVMC 1KCVH 4S2SB 4KRMB 2BXYA 3LPGA 5EBLA 4YHNA 5C0BB 1BIIB 2FH8A 1UJ3C 2AK1H 3C5ZC 1K6QL 2IMMA 5DD6A 4PP1C 4PTTA 4KY1L 3NCCB 3NZHH 3QH3A 4XCNB 4GRWF 3TPKA 4W6WB 4AIZB 5L9DL 4PJFA 3U6RB 1QO3A 2C4FU 5F6HI 2Q76A 2FLRT 4M3JA 3GI8L 1MSPA 3ELAT 3P4MA 5GRUL 5GZOC 3TBWB 3EZJB 2MQ0A 3REWB 3WD5H 4EUPA 4YNYB 3L7FA 5AZ2L 1T04A 3U0WL 3U1SH 1CDBA 2JCCB 5CAYB 2P48B 4RA3A 5I73B 4U6TA 2KDGA 3R1GH 4Z7UB 5L8LB 2QQKL 2CXGA 5DFWH 3GGWA 2X7LA 4K3EL 5D7LA 1VFAA 4KKCC 2E27L 5C08A 2X4UA 3DGGB 4PBWD 5E8NA 2B20A 5F9WC 5GGVY 2NNAA 4U7MA 2K7PA 3D3VB 1R24A 2CRIA 1JWSA 5E0QA 1GSMA 5J9PB 1BEYH 4ZS6C 3FT3B 1G0YR 3CCHB 2NY0D 3P77A 1OP5K 5C0AA 1DQLL 5HGHA 1OAQL 3U9PH 3TZVD 4EI5C 2VDKH 5DQDL 1S9XB 4YHMH 5MI0B 5DUPH 4AY0A 2XN9E 3A67L 3I6KB 2P5WE 4JFHD 4H25B 3RWEB 2VH5H 1OCWH 1RZ7L 1YEJL 4IDJL 3Q6GH 3NCJL 2Y6SC 5F6IB 3QEUB 2D0GA 3SDCB 1DE4B 3GRWL 1IGYA 2PW1A 5FYKH 2EEAA 4WEBL 4F7MA 3H9SD 3P9MA 4NCDA 1NFKA 1B4JH 5E70A 3G08A 5KJRL 4H20H 5DVMA 3BZFA 3FT4B 2JK5A 3S4SB 3DMMD 1F6FB 4PV8B 1C16A 3MR9A 4U31A 1T0MA 4GMTH 3L3IA 5FO8A 4XNMA 3RTQC 5HYIA 4Y4KB 4GG6B 2F54E 5FOBA 1MF2H 4BSVA 4FQHB 3G5ZB 5CSZA 3KVQA 1F58H 1Q0XH 4NKDA 4ALAH 2DQDH 4U0QB 1NBVH 2X4QB 3BPNB 3LSOA 4ZTOH 3CFJB 4F7EB 4XVSH 4JVPA 4QHLB 4NO5B 4OLYH 3NABL 4HX1A 3RL1A 3CX5K 2PTTB 3KPOB 5EOTB 4TSAH 5D1ZD 4JPIA 3VMOA 2Q7YB 3ORJA 4JB9H 4JFEE 3MZTA 2JJWA 3GSQB 1M7DB 5HHMD 5C3TA 5DZNA 2EKSA 4QRRB 4XNUH 1QLRA 2NY6C 4FP8L 5FM5O 4ODXB 4L9DA 3PWLA 3LH2H 2XACC 3GSWB 2QADC 2CO7B 1A6PA 1H5BB 4BSJA 2ZCKH 1AO7B 4RFEB 1FH5H 2O93L 2JJTA 3IDMA 4FFYL 2P5WB 2QR0B 3NFNA 4AL8H 1MFCH 3DJ9A 1QSFE 1KJ3H 5EZLA 4RX4D 2RCSH 5DVNA 3MOAL 1V3MA 2VLJD 3V95A 5E24E 3V4VH 3NA9H 3V5HB 5GRWA 4JPWH 3VDBA 2CDGA 2HT3C 4OIIH 1WCQA 4JQVA 2DTML 2OK0H 3OKNA 4N0CD 2CUMA 1NBQA 4NZRL 4N8CL 2M2DA 1KLUA 3CFKA 5AUMB 4I2XA 4CVXA 1P53A 4PG2C 5CJ5A 1QPXA 4I13B 3RZCA 4FXKA 2F54B 2NXYD 4X6CB 2VIRB 5HGGS 5E1AB 1C5CH 3X13B 4HS6B 5DD1H 3ARTA 4JR9L 1XIWD 4NWTH 5KVFL 3LQAC 5GSRA 1HCFX 1RJZB 3ZTNL 2BRQA 1HQ4A 3VFNA 1YC7A 3C09C 4EN3D 1X5AA 1U8IA 3GJFK 2X4PA 2YD1A 5FAAA 1NDGB 5JO5B 1R3HA 2AAVA 2WMPA 2KL6A 1UXWB 3C8HA 1IAII 2EZ0D 1OP5H 4PRDA 3BP5A 2LTQB 4XAWH 1FNSH 3OKLA 3QO0A 4M5ZL 1NAML 2DM4A 3RX7A 1DVFC 4FQPA 5I66B 3V6ZB 4LCWD 4RMRA 3VE0B 1IC5L 4G6JL 3WFBL 3TBVB 1ZS8B 3B3IA 3QJFA 3V7AE 3WS6A 3BPOB 3GBMH 3DSFL 5F9DC 1INDH 5ITFA 3K2UL 3UJTL 4YC2C 3GK8L 4DUVA 1C5BH 5LWYL 1ZT7A 3G6JF 4CUCA 1QSFB 5J11B 4MA8L 5I8OL 3AMLA 4L4VE 5FGCE 4RMVA 2AJUL 5FGBA 4PREA 1H3PH 4ZUTA 1N59A 2I26N 1TCRB 3DUHA 5CD5C 5IVNA 1MFDL 2HN7A 4XC1H 5C07D 2EDFA 1ITCA 3FFDA 3P0YL 4PB0H 4PJIA 2WM0A 3EUUA 3DV4B 4P59H 3W39B 3PWVB 4C4KT 4DN3H 4P2OC 5GHWL 3UJIH 3TVMC 2HFFA 3EYVB 1MLCA 5ISZD 1ACYL 4S1DC 3ZTJH 4KKLD 4AENB 1BHGA 3HG1E 1FORL 2G5RA 2YC1A 5EU6B 3KJ6L 1GVIA 5A2FA 5E5MB 2R9HD 2Y07H 1UB5A 4CGTA 4I0PB 4JFDA 4L5FL 4J8RA 5TGBB 2B7DT 5TF1L 5DC9B 3WNLA 4MJ5B 4PIRF 3T2PA 1U8KB 4JZOA 1ZHLA 3M1BB 3PABB 3GBNL 3KJ4B 3RY6C 4HIXL 4QRTB 3IF1A 5DHVH 3IFOB 1PGRB 1JPSL 1OPGL 3C8DA 5TDNB 4PJGE 3RGVC 1ZVHA 2VKWA 3TBYA 3MUHL 1NFIB 2VZOA 1O0VA 4XXDB 2C3VB 5EWIH 5EG6C 1NBZB 4Y2DD 5I8EB 3TBTA 3FT2A 2W91A 3H42H 2NR6C 3MZGB 2HH0L 4Z7QE 2ADIB 1ES0A 3DX9B 5FGCB 5BV7C 4JHZA 4CVWA 1MVUB 1P4LA 3HFMH 4X7FC 3MV7E 2HFGL 4X0KB 1PW3A 4Y19E 1XF5B 2XNAA 1TVBB 1XZ0A 3PWNA 5GISH 3Q48A 5GJTL 5J56B 2DLGA 1MNUH 1CU4H 3V4PL 1J0IA 1T1WA 3OAUL 4OQTA 3S36L 4LHQB 5IIEB 5EDXA 2IAND 3ULUC 4PRBB 3ARDD 3SJVA 3HG1B 4LAQL 2DQUH 4G43A 3T3MF 3FCTA 1I3GL 1YECH 3GSUA 4R97B 1SJVA 3TA3D 4R4FH 3GJFH 1LO0L 5GGVH 3KLAB 3E8UH 1JGVH 2XKNB 3BIKA 5ACZB 5J9PA 4PBXA 1NC4B 4X4YA 1EMTH 5TPWL 2ESVE 4OF5A 2SEBB 3AREC 3BEVB 3QCTL 4K71C 3PJSB 4R7NB 3ZO0A 5HYFA 3O9WC 1BMGA 4IRJA 5IGXH 2GJ6E 4Y88A 2X10A 4QHKJ 4NKOA 3I6KA 4TN9A 1N6QH 1G9MC 2GKIA 4RFNB 4PTUB 4DVBA 3IFNL 3SO5A 5SWSE 1BX2A 2NW2A 3FFCE 1CGSH 3QWRD 2BSTB 4ONFH 3QEUA 1D5MB 4LMQI 4YHPA 5GQBA 4GAYB 2R23A 4PJDA 2NX5D 1AR1C 5EH1A 4PRHE 4F8QA 4R0LB 5ILTL 3MJ9H 4KK5C 3PWJA 1MCHA 2DIBA 4O51A 1UFUA 4PV8A 2V2XB 1GC1C 3DIFB 1NAKL 3SGJA 2OQJB 5EO9A 3E3QE 3MV7B 5JIPA 2R56L 4Y19B 4KJWD 2Y23A 5IF0A 5CKAA 3WN5C 4HMCA 1JZ8A 3NIFE 4UV7H 4YUEH 4NQVB 1IC7L 4GMSL 5MERB 4FQCH 4YX2L 4D0DA 4F7EA 3T3PE 2X4OA 5EA0H 3JVGA 4NO5A 3C6LA 1DJSA 5F1NA 1ZXQA 5C7XH 3VMNA 5D5MA 3BD5A 4G7YL 5IB3A 2GJZB 3C8KA 3RI5K 1Q9LB 3L3OA 4DTGL 4WFGD 2CUHA 4JREB 1AKJD 3HHRB 3KPLB 4HKXB 3H6JA 1A1NA 4ZPTA 1EO8H 4AT6B 1GPOL 4KMTH 3FRUB 2ESVB 1CXLA 2WUBH 4ODXA 4FTVB 4XWGH 1HIMH 3TT3H 2NY1D 3R0MA 1FGVH 1AO7A 4QHUB 2GJ6B 1BZ9B 3MRHB 3D87B 1IAIM 4LPTA 1Q9OA 4R8WH 2ZCHL 3QULA 3TO4C 5FGRA 2QR0A 3OKOA 1S5HB 5T1KD 3CVHL 1IAOA 4X83A 1KTDA 4WTZA 5DQJB 4BQ6A 5SWSB 4TOYL 5CWSB 3FFCB 2PNDA 4E5XA 1E6JL 3MROA 5BJTB 1OM3L 5KOVC 4YXKH 4TTGA 3BWAB 4PRHB 5FYJD 4M02A 3L5IA 3GUTA 2AQ1A 3HAEB 5EZJB 5FO7B 3ULVC 2CUIA 2NCMA 4DQOL 1IZKA 2NMSA 1T7ZA 1A7QH 4F8TA 1TETL 5H35B 3RIFF 3GJEB 4X6CA 5IWLC 2VIRA 1XF2B 3TP4A 5GS3A 4LCUA 4NHUA 5JXEA 1W72L 2IQAA 1AQDA 1RHFA 4F7PA 3I50L 4QF1B 1NCWH 5KS9E 1RJZA 2AGJH 1I75A 2ADGA 5I15H 3D85B 2OX5A 2X1PA 4NO2A 5ALCL 5JXAH 1AY1H 4K7PY 4OZHE 2IPKB 1H0DA 1MCSA 1KJMB 1NDGA 2VERN 4XP6L 3AM8A 4TNWK 2VL5B 5GGTA 1MCRA 5D7LD 2O5YL 4I1NB 1KCSH 4YDVA 5C08D 3MLTB 3A0OA 1BQHB 2VNCA 4TVPL 1ZOXA 4O58H 3ZDXE 4GT7A 5H37H 1TZIA 4JFPA 5F71A 4EEEA 5D7IE 1YEGH 4JFXA 2PXYA 4DW2L 1JRHL 3TBVA 4X5XB 5LKNA 1ZLSL 3EOAB 5D96B 2I9TB 5C0AD 1UT9A 2GCYB 5ICXB 4F7CA 3Q1SL 3D39E 4HW6A 2XICA 4NQEE 2DLFL 5E9DE 3RDTB 4BFGA 3PL6D 4E41E 4NDMA 3U0PA 5B4MC 1I9JH 4XP9L 4GRMA 4M6NL 5E5UB 3FN0L 3O6FC 3OX8A 1RMFL 5F72S 3ULVH 1G1CA 1JNJA 3FO2B 3LPWA 4CAGA 3MRDB 5B39G 3QEHA 1KB5A 5IJKC 3PWPA 3RZCC 4X6DE 3B6SB 1LK2B 1ZTXL 4X4XB 1FYHB 3PGDB 2CDFB 5DWUL 4KZEH 1F8TL 4I3SL 1IEAA 2CIKB 2WBJC 1X5LA 5GRXG 5L2KA 3UAJC 5T3ZL 4ZS7L 1LVEA 4NPYB 1J05B 4AENA 3DVGB 2H3NA 3JWOC 1WWWX 3KPMA 4PUBH 3CC5B 5IESH 5CJQL 5KS9B 2ZZUT 4NZTH 3I75A 2V5RA 2Y7QA 3ARPA 2ATPA 1MJ8H 3K8KA 4I3RH 2YD5A 2ZUQC 1XH3A 4OZHB 3D69A 3N85L 1J1PH 4OLZH 1D5BB 4AG4H 1M4KA 5BRZE 4YHZL 3PABA 2VDPL 5I1IH 4KK6D 3IFOA 5D9SA 2FX7L 1RFDL 1I7UB 1IILE 4NC1C 4DEPC 4KI5F 4ZTPL 4AK1A 4PJCE 1HI6A 4OZGE 4AEHH 5AEAA 1PKQE 3B8YA 4RFOH 3N1GC 3VXQB 2DBLH 4H1LH 4UNUA 3I2CH 3SN6N 1QKZL 3D39B 2AJZA 4NUJB 5I1KL 2EH7H 3DX9A 3KWWA 3RL2B 1LE5A 1MVUA 4NBZB 3HA0A 4E41B 2KPNA 4UBDD 5IG7A 4JJ5B 2EE2A 4BFEA 3WFZA 5INCA 5KN5B 3V6OE 3IDGB 3WJJA 2ICEB 1DEEB 4CVZA 1F11A 2ZKHH 4MAYC 4YIQB 1F4XH 2Y5TA 1BOGA 2Q20A 3GMQB 3FZUD 3ZDYE 3EFDL 4UT9L 5CIPH 2NY2D 4P2YA 1KFAH 2IADB 2JKXA 3PHSA 1HHJA 2CRMA 4MZ2A 1IBGL 2XWTB 2XXMB 1OTSC 1JCKA 4KQ3H 2FO1A 1BQLL 2VE6A 4XAKD 2HWZH 2ITCB 3A6CL 3VU2A 4IIQB 1EXUB 2I25N 2DDQH 5I30H 4F9LA 3QI9D 4KGJA 1PG7X 1QYGH 4M61B 5ACZA 5I16B 1NC4A 3HZMA 1NH6A 2SEBA 1NAMB 3BEVA 4QXGL 2H2SD 3LB6C 3QIUD 4K55A 1QR1B 3FB8B 4HWUA 3QRGL 3E1F1 2N4IA 5LGJB 5I1AB 5DJDA 1J1XH 5DJCB 4P57A 3ZT6A 3AXLB 5IBLC 1VESA 2OL3A 3MRNA 2C4FT 1YN7B 2X09A 3WEXB 4ZFGH 1Q0YH 4IM8A 5JUEH 5DJ6A 4J4PA 2QHRL 4HIJA 5J13B 4MMXC 3OAYK 4OZGB 3WNPA 1KULA 4BA8A 2F9BT 1PKQB 2DQCL 4CMMA 4G8FA 4LRIA 4R0LA 4NQCB 4FFWC 4TSCL 2HTLC 4MGXA 4MLSA 4Z95H 43CAB 4LAJH 2VDRL 2D03H 5DSCB 1GYAA 5EZOL 3C2SA 5DEZA 5HPOA 3L9RA 3OR6A 4XMKH 5JHLH 4KVNL 5E08L 2LAAA 5I73C 4FXLA 3B9EA 1A4KA 2GIYA 2BSSB 3UTQA 1Q9WA 1OSPH 4G9FA 5F7MC 4LEOA 4DZ8A 1YEKH 3RKDD 1SYSA 2BNRE 5FA4B 3AFLA 3BT2H 1UACL 4M7KL 1J8HA 1MCFA 1U92A 2GYSA 4E42A 1LEKB 3CLFL 5E2TL 3SCMD 2OR9H 3TYFB 1KPUB 4QOKE 1IKNA 5JW4R 1IC4L 1RURL 3GSOB 4DN4L 3IGAA 3CVIL 4PJHE 4XRCB 1OF2B 2A0LC 4HKXA 4HS3B 5KW9L 4I9WD 1MJJB 4WFFD 4ODBD 3REVB 1FJ1B 3BN9D 3ZTJG 4MA7L 4PRPD 3FRUA 5FHBL 5MI0C 4OT1L 2CJUL 1BVLA 4FTVA 5I2IB 3VFUA 2FWOB 2XRAL 3Q3GB 5F3HB 4B5EA 5FIEA 4WU5B 4JFDD 2BERA 4QHUA 4ZFZB 1BZ9A 2XZCL 5TE7H 1S7TB 4XPTL 3OJMB 3SDCC 1FP5A 4XCCL 5E6ZA 5AWNL 5JDJA 1EZVX 2FD6H 5DQJA 5DJYB 4JQXA 1AHWA 2OI9B 5E7FA 2VXVL 5BJTA 3QA3B 5BCAA 3EYQD 2ED7A 5D70H 2C3WA 4N0UE 4HCRL 3T09A 5T3XL 4PS4L 1S7SB 3D48R 4DJMA 4NBXB 5L8JB 3C08H 3GMMA 3BXNA 1OB1A 1TTUA 4Y4KC 1VFOA 4UB0L 1KEMH 4NRYB 1YEFH 4LLMA 3QT2A 1CZ8L 1JPFA 3WHXA 5A40E 1RU9L 4XMPL 2DMKA 2ICCA 4PJ8B 7FABH 3N1PC 3BPNC 3ZE2E 5IMOB 4LSVL 3X3GH 3B9VA 1KF9B 1N0XL 4QF1A 1JP5A 5I1CH 1DQDH 2E7CA 3D85A 1GGYA 3CFBA 2DICA 3ILQD 2IPKA 2YD8A 1KJMA 5B8CB 1FZMB 1V7NH 2VAJA 4LOUD 3ZKMC 3EYSH 4YJZL 5JQ6L 5IFJA 1VA9A 4AEEA 4M1GL 4OD2A 2VL5A 3HC4L 2FO4B 4YO0B 3ZYJA 1K8IB 5FA3B 5TQ2L 2CLRB 1BQHA 3SJVD 2VDQH 1NGWA 1H5BC 3MYZA 5IVXB 2VXQH 3D0VB 3MRPA 4GRWE 5HPMB 2EIDA 3PGFL 1ADQL 1T2QH 3DYPA 5TE4H 5A16B 1OGAD 1BD2D 4NM4L 3KR3L 2DB8A 4Z78B 3AS2A 4X5XA 2A77L 3CJJA 3MRCB 2I9TA 3DVFA 2NY7L 2DJUA 4ONHA 2P5EE 2R4RH 1HWHB 4P49A 2H1PH 2AJVH 4AMKH 4IRJD 4OZFB 2E7LA 4LK4A 1P4BH 3ISWA 2X44D 3GSXB 2VAAB 5IOPA 4K9EH 3LEYL 4N0UB 2OTUA 3NTCH 1R5WB 4LBEB 2YUVA 3GSVB 3SQBA 1A6AB 1TJIH 3FO2A 3MRDA 3GNMH 3P4LA 3P4NA 3QUXB 5DS8B 5DRXB 4JCLA 3PNWA 2V7HA 5IT2L 3WNMA 2CIKA 1BBJA 4WFHD 1CICA 4S1QL 3F12B 2V7NA 4EIZC 3MRIA 1Q1JH 3IJSA 5DQ9A 3SY0A 1CL7L 5FCUH 3SGDH 1A6UH 4F7TA 5HI5D 4CNIA 4QCIB 4TVPE 4ZUSB 1AD0A 1DQQA 5DJAA 1DQML 4Z18A 3S96B 1J5OH 3SKOA 3BW9A 4G6ML 4MXQD 4HHAB 1AI1H 3QXDA 3NFPB 1TZHB 4NT6A 2G75A 2LTQC 1D5BA 4H0IA 2A6DA 2ILLA 4U1LA 4Y4HC 4XWOD 3QUYB 3C6LD 1U36A 5I8CA 5BVJA 1I7RB 4WTWA 2MCPL 1IFHH 4EBQL 1K4DA 3IXAB 5ICYB 3CVHB 1A02N 3BPOC 4GRWB 5DXWA 4PR5B 4N0FA 4JZJB 5E8EB 1BLNA 4XTRC 5J11C 4MNQA 1KC5H 1FO0L 1KN2H 4PB9H 4JPKH 1B0RB 2GK2A 4FQ2H 3DHMA 4Y16B 1PYWB 1YEEH 5GJSL 5D1QA 2P5EB 2CLZA 1BREA 1FG2A 4LSSH 4MB4A 4J7RA 2HAZA 4G5ZL 5JTWA 4JRYE 3FB6B 3QNXB 5E2WL 5I71B 4RIRA 5KVDH 4XCEA 5T3ZE 5HGAB 3OGCA 4S1SL 5D2LF 4MJIE 1MIMH 4UTBL 1UADC 4WW1A 1F6LL 2W07A 3MRKB 2X42A 2ORBL 2ZPKL 3MACH 5D2NA 5ADOL 2XWTA 3S3SA 1KN4H 3F5WA 4PYGA 5HDOA 2QL1A 4K07A 5CZXC 1TXKA 1GHFL 3L5WB 4I0PC 1L6ZA 1RVFL 3UC0H 4M61A 4NZUL 5JXED 5GGTH 3VRIB 2Z31A 1NGQL 2RB8A 1P7QD 1SEQH 2MTPA 4NKQB 2BMKA 2VLRB 3HB3C 4Q2ZA 2DKSA 2R8SH 4U1IA 5IB2B 3KJ4C 2VDNH 1QFWM 2AEQL 3FO1A 2G9HA 4DKDC 5I76A 1HDMA 3CDCA 1I85C 3MRQA 3SKJL 2CLVA 4RMTA 3SGDI 1U8LA 3X14A 3VJ6B 1YN7A 1INQA 3G9AB 3S5LB 2FYYA 1FNEB 3ZMRA 1XCQB 3VGDA 1ORSB 2WANA 4BQBA 4PFEA 3IKCB 2MMXA 1AE6H 5SWQB 1UEYA 3NPZB 4MCYB 5EIQA 3MLUL 5TDPB 1L9NA 4HWBL 5F1IA 2J6EL 4D9QD 5DSCA 1PZ5A 5GS0L 1KUMA 2ZOLB 4JRYB 1JPST 1N26A 3W0WB 2Q6WB 4Q9BA 1G7QA 2FX9H 4PLOB 1MJUL 3MRGB 1KCRL 2FX8L 1ZT4B 1NUGA 4GW1A 4MJIB 3DNKA 4FQ1H 3T0BA 2QQLL 1RUAH 1JZ5A 3IRZA 1MJ7H 3TPUA 5FA4A 1LEGA 3WIIL 3DHJA 4FZ8L 3FN3A 3MLSL 2R0ZL 4HS8L 4MX7A 4NNPL 1D6VH 4R97C 5TF0A 1LEKA 3PWPD 5DVKA 5MEQB 5KVEL 1U3JA 1AIFB 3STLB 2OJZH 1VADA 3HMWH 2OZ4A 1D5XB 3GSOA 1T80A 3VFGH 5L2KD 3BH9B 1UJTA 3C9NA 3HE6B 4JFYA 3REVA 4LQFH 4YHYB 4JDZA 1I7ZB 3MJ6A 1H3WM 1GGCH 1JK8B 5ERWB 1JN6A 3JV4A 5T1MB 3THMH 4WU5A 4UDTB 4Z76A 3L6FB 2JTDA 4K3DH 4BUHA 1RZJL 3EHBC 2EO1A 3U0TB 4MD5B 3F7YB 3HN3A 2X4NB 1OAXH 1RUMH 2A6KB 4Z7NF 5KTEH 1I3RB 2BXZA 3TJEL 3VG9B 3WJLA 2B0SL 4D9RD 1Q8MA 5E2UH 2WZPD 1C08B 5E8OA 3BYTA 5D1XC 2VQ1B 4HJ0D 4QYOA 4W4OC 5JW5A 4FXGB 3I9GH 3O6KL 4XPFH 4NKIL 3LRHA 5HVFB 5EZIL 1KGCE 1ZT1B 3QDJB 2J8HA 4QTIL 1FVDB 1JL8A 2XOTA 4FNLL 4HFUL 4GXVH 4U7KA 3S3PA 3C5ZD 3OXSA 4KAQL 4GW4A 3HC3H 4H1LG 5D7SH 1KTRL 2MOVA 4U1MA 2QJDA 3MLWL 3OF6A 4O2CB 3IXTB 3DROA 3S35X 2W65B 4XCYB 5CGYD 4I8DA 1EGJL 1OSZA 3PQYE 4R2GB 4PRAA 3EYUL 2YZ1A 3SBWA 4LVOB 3NAAH 2R2CA 1J0JA 3KPSA 3MNZA 5SV3A 5F8QC 2ERJB 2P8PB 1FZJA 1UCBH 5EUKB 1DL7L 1FZMA 3LIZH 2YK1L 1Z5LA 3TF7C 3FB7A 2RJMA 3U7AA 4KWUA 4HUUB 2DQHH 1YN6A 3K0WA 2YXMA 1CE1L 4AQ1B 2VUOA 2CLRA 3QPQC 5EFIA 1B6DA 1EUTA 3D0VA 4R26L 5HPMA 3BN3B 3G6JB 4O4YH 3KAAA 1UM5H 1KTLA 4O9HL 2F15A 3VWKA 4Z78A 1CGVA 1F45A 5F7WC 2XZQH 2B1HH 4K2UH 4WW2F 1I8MA 4ZS6D 3BP4B 5T3XE 1OGTA 4ODHH 5LBSH 5HI3C 1J1OL 3HNSL 3PP3K 4OM1L 1ZGLA 4GQ9H 3I02B 1MI5A 3W11D 4OZFA 3OKKB 4EI5D 4X6EB 3MA9L 1NSNL 3KLHD 2XT1B 2VAAA 3CK0H 1UG9A 3EW3B 4CMHB 1SJEB 1XGYL 1CBVH 2IPUK 5F9AC 2XWBA 1U3ZA 3WLBB 4J4PD 4M7LL 4KDTC 3PWUB 1L7IH 1ZA6B 3ECBA 4KVCH 3E3QC 3L5XL 3T3ME 3INUL 2DAVA 3V0AC 5C6TL 3ARGA 5D7JB 3S9DB 2N7AA 4H0HB 5DVLA 3BAEH 1YDPB 2XA8L 2JJUA 3VXTB 4HWZB 3PQYB 5FHAL 4LHJB 1PD6A 3S37X 3Q2CA 1EHNA 1YJDH 5DJZA 4G9FD 3SKMA 4XP5H 5TFSH 2Z8SA 5DJ0B 2XG5A 2C7UA 1TTFA 3WSQL 2X1QA 1J8HD 1I7RA 4RMQA 2F58L 5L8KB 2V2WA 1EBPA 4P4RB 3LKNB 4JY4B 2XZAL 1JIBA 3HMXA 4HGMA 5GGUA 1KT2A 1OWWA 2K7QA 4JZJA 3OJDB 5E8EA 3IFPA 4KY1H 5EU4B 3MLXL 2DLTA 5EOCJ 3RDTC 5L9DH 1PYWA 4LLUB 4QY8A 1Q9KB 5I0ZA 4AZ8A 1X7QA 3R4DA 3GI8H 3MGTA 5GRUH 4WU7A 3DX7B 3O8XB 1XGRB 4ELMF 3PV7A 2EYTA 3HAEH 3U0WH 4CL7A 1FG9C 5L6YL 2AXHA 5JORA 2I07A 2GFBA 3MRJB 5IW3A 3NOIA 3IAPA 2QQKH 2VR5A 4PGJA 4K3EH 2BSED 4KDVA 4X5LA 1UGNA 2FL5A 3TH3T 4PLJC 2HT3D 4DK3A 1DUZB 5ENWA 2NQCA 4YHKH 3SO3B 3VD4A 1G84A 2FEDC 3BUTA 2I5YL 3UBXB 3LKQB 3VD3A 3MV8E 1P6AB 2E9IA 2VRAA 1OAQH 3VRIA 5A2KH 4HIHB 1R5IB 5DQDH 4ZAKB 3U46B 4Y5YB 2YBRB 2VLRA 4HV8B 3FO9A 1BQUA 2BVEA 4LPUA 1T5WB 3M8OL 1RZ7H 2AXFB 4NFCA 1UQSA 3RKPA 1DUYA 3NCJH 2YPLB 1MCIA 4MD4B 4WV1A 2IGFL 4BH8A 1JTPA 2GK0A 2PYEE 3GRWH 4Z7WA 4ELKB 2E5EA 1YUHB 4XZUB 5A3IC 4Y5VB 3HNTL 3VG0L 5DUBB 4IRSC 1G7PA 4KUCD 5KJRH 1KACB 5CJXA 2YPVL 2WWMC 5EIIB 2VLME 3PP3H 1UWGL 3N1FC 2V17H 5E56A 3BZ4A 5TDPA 5ACMA 2D0FA 3MCKB 5CLTA 5JHDE 4Z5RB 4KKBD 1WTLA 3HR5B 2KKQA 4G6AC 1F00I 4HSQA 5DFVC 1P7HL 4ZFFA 4KC3B 1T4KB 3ARWA 3BO8B 3W0WA 1RJYB 3UYOD 3LKRA 1U91B 4FZEL 4PJFF 1EBAA 2W9EL 4MQXC 4YWGH 4LSQL 3S4SG 3WD5L 1BVZA 4YAQA 4FG6C 3V0VB 1IGJB 3NABH 5HGDA 3OB8A 3TBSB 1XF3A 2P8LA 5DDHA 3RVUC 1OL0A 3UP1A 4JY5L 2BRRL 1JJUA 3WUWB 3H7BB 4QTHB 4IIQC 5MEQA 5A43C 3MGOB 4P2RE 3CDGB 1D5XA 1I3UA 1IT9L 2XY1A 4TNVF 1CICD 2G60L 4Y1AE 3MUY1 3TVMD 1YNTB 2DL2A 3MV8B 4FP8H 1IL1A 5FYLD 3MA7B 4BSWB 2DKUA 4S1DD 3L7EA 1WC7A 1J0HA 2LV4A 3FQXA 3VFWB 3O4LB 4C55A 1BP3B 4FFYH 3S97C 5LAXB 4Y89A 1M7XA 2EECA 3P11L 2OXGA 4NJAH 5DMYA 2X9XA 3U9PL 4BKLB 1FV1B 2VDKL 1FO0B 4NRXB 5J13C 5DUML 5DUPL 1XGQB 2EYSA 3A6OA 5FDWA 3QUZA 1MQKL 1WFNA 1I3RA 2VH5L 5GZND 1OAKL 1OCWL 1G7JA 2DTMH 4ZMAT 1BZ7B 3SGKA 1TNNA 3VA6A 4NZRH 1BVKA 1FSKB 4FXGA 4JLRA 5JOPE 4H20L 1CDYA 5JHDB 3VGEA 4MNQD 5B38A 3V6OC 3QDJA 2IH3B 1I1FA 4W81A 1MFNA 3ARUA 5D1QD 5EBGA 3UDWA 4CU8A 2CPCA 4ONOA 4C59B 4GFTB 4KTDL 4U0RB 4NO0D 3F7VA 4JR9H 3RPIB 3GM8A 5FF6A 4O2CA 5KVFH 4R4ND 3CXHK 1AGDB 2W65A 4TVSa 2HVJA 4XCYA 4HGWB 4OFKA 2ZUVA 1I9RL 2H2PD 5KOMC 1F58L 3KPPA 2AP2A 1BFSA 5IQ9A 1Q0XL 4ALAL 3EO1A 4HQQL 2X1WL 2CR6A 3RWJB 3IETA 1ND0A 3ZYOA 3NZ8B 4P2RB 4KI5E 3SKNB 2WSKA 4HUUA 4M5ZH 1NAMH 5CP3A 3O3EA 5EU7E 1T1ZB 3QEQB 4FABL 3ULUD 4AEIL 1IC5H 2DL9A 1DLHA 4G6JH 5DK2B 3WFBH 4JHBA 2OTWB 4N1CA 5TQ0L 2VWEE 5DJ2A 1MAKA 2X5PA 3K2UH 3RI5F 3VD9A 4XMLH 4NN7B 3UJTH 3MYJA 3GK8H 5I6XB 2RFXB 2Z31D 5BS0E 2ITDB 4JN2A 4MA8H 2AXGB 5I8OH 1CK0L 4L4JA 1J0KA 2AJUH 3MFGB 3VRJB 3IVKB 4LPXA 3VXPB 4ODWA 4OD1L 2YR3A 4TUOA 1RUQL 2DQTL 1QSEE 3MX0A 3OKKA 3RNQB 1AXTL 4OCRL 5F70A 4UQ2A 5EN2B 5ESVB 1MFDH 1EFXB 3RIAK 1NEZB 3P0YH 1HXMA 4PJAA 5SWZB 4ZUVB 5DI8A 3MNVB 2D7TL 4Q6IB 1U8NA 5GHWH 2ADFL 3BH8A 4C56B 1A14H 4MJ2A 3P0VL 3LN5B 1MWAA 4NQDB 4ZQKB 1L6XA 1ACYH 3QXWA 4PJ8C 4XB8A 4JG1L 1FORH 4X98B 5TH2B 3KJ6H 3VI3F 1VFBB 3SDAB 1A22B 8FABB 4QRPE 1G7LB 3IAQA 5DD0L 4HWZA 3CFEA 2EE3A 3TH2T 1GZQB 4L5FH 1WWCA 3JBG7 4D0CB 1J9CT 4L8DA 5FK9B 4Q74A 5C8JA 5TF1H 5B8CC 1NGYA 2VABA 3DUUA 3QBTB 1QEWB 4TYUA 1HHKA 2PW2B 2BVPA 4NWTL 3D6GA 1H3UA 4HWNA 4PGZA 3LN4A 1CG9B 1YC8A 4ACPA 4WWKA 3GBNH 1P1ZB 4TTDD 4HIXH 3WE6B 4C58B 2HKFL 1JTTA 1JPSH 3MRRA 1OPGH 2Z8VC 3CGTA 3V5DB 3H9HB 1Z2KA 4Y0GA 4P2QA 4KRNA 3WHE1 3SPVB 1KG0B 1RPQA 4TNWF 4X4ZA 4JVWA 2FJFB 1U2HA 1R5VA 5EU4A 3QIBB 1HE7A 3EYFB 2HH0H 1U8MA 1BAFL 1CDHA 3NCMA 2NTFB 3GBML 2VZUA 1JZ4A 3AAZB 4LDOB 1J88A 1C5BL 1QSEB 1A7NL 4M5YL 1MFBL 1YYLL 3EJYD 1G6RA 5GJTH 2R0WH 5I1LA 5H2BA 2GSIB 1FCCA 3V7AG 1QSZA 3VXRD 4N9OB 4ZOBA 4JDVB 3V4PH 5E6IA 3QUXC 2B8OT 3H9YA 1H3PL 1G7MB 1UB6A 1NBYB 5E99H 3OAUH 3S36H 4G8GE 4XBGB 2V2TB 1WJ3A 4HK3J 3QCUL 3E6FB 4PGEB 1WBXB 3LQZA 4PB0L 2D7NA 4P59L 4LAQH 4PJ9A 4RMSA 1FL6B 2A2QT 3VXMB 2EE9A 3MLVL 4ZSOE 4PJIF 1KPRB 4QRPB 1MHCA 4KK8D 5CJ8A 5TPWH 5J57B 1FN4A 2BY2A 5L0QB 3QCTH 1T0PB 2HT2C 2JE8A 4EQ2A 2EXWC 5GXBB 2V9TA 2IFGA 3DI3B 3QUYC 5HHOE 1CD1B 3UZEA 1DR9A 1T5WA 3ES6B 3DV6B 3KPSD 35C8H 4GOSA 5DHYA 3PF2A 2GAZB 1P69B 2CKBL 4P5KB 4MD4A 4HZAA 4ELKA 4JZJC 4YBQD 1MUJA 3EDFA 3DURA 3CXDH 5IFHL 2GHWB 5GS2H 3O3AA 5DRZB 4L29A 3QQNA 4XGZA 1K8DA 4Y16C 4NRZA 5ILTH 4LLDB 2IMNA 5I1GL 3PDOA 4OZFH 3FAWA 4X5WA 1DBJL 2A6IA 4HK0A 1F6AB 4ZYKA 1NAKH 4OI9A 3VWKD 4NIKB 3NIGF 3MCKA 4Z5RA 3HRZA 5I71C 1T21A 3VXUE 4FMFA 3HR5A 4AH2B 5C0CB 2R56H 3H42L 2K9UA 1T4KA 1X5GA 4Q7DA 5HGBA 3VFMA 4OCMC 1MI5D 3WIFB 1IC7H 4GMSH 4YX2H 4N90E 1VDGA 4U6XB 1MHHB 4G8GB 1HILA 3G5XA 4LNRB 4HG4J 1C1EH 1IGJA 2FGWL 3EOYG 1QA9B 1QQDB 2IH1B 5B4MD 2APWA 1XF1A 2BOCB 2ZSVA 4PRIB 4X7TA 4G7YH 2X4TB 2GTZA 4DTGH 4QTHA 2VZSA 4MA3A 3BP7B 5F8RC 4LSTL 4LRNL 4ZSOB 4G6FD 3MGOA 3VRLF 3ARGD 4U1KA 3CDGA 3SE3A 2JB5L 3T1FB 3P30H 1OTTC 4LGSB 4BSWA 3UAJD 1N8ZB 1NJ9A 1JGVL 3TNMA 5TE6H 5HHOB 4PJBE 3VFWA 4HC1A 1NCAL 4TQEL 2ZCHH 2GEEA 1KIQA 4WUUE 4MXWL 4GRWH 4RZCB 1T89A 3OG6B 4TOYH 1FV1A 4DGIL 2BY3A 1E6JH 4LKXA 1CXKA 5F6HJ 4NJ9L 5IV2B 5D72L 3V0WH 3RNKA 1LEIA 5ICZA 4LARL 3K80A 3KDMA 2FZ3B 3SQOH 1K2DB 2GTWB 3TN0A 4OCSL 1DDHB 2C3GA 4ONFL 4X6FA 4YHIB 3VXNA 2GW5A 3BRFA 2Y06L 3BIAX 4DQOH 4LVEA 2M8XA 3QDHA 1ZHNB 1TJGL 3GHBL 5FKAA 2PYFA 3PHOA 3S7GA 1TETH 3RWDB 4LFHG 4GKSB 4PJDF 5INDB 2IH3A 4L8BB 4NZDA 3MJ9L 1DN2A 1Y6MR 2YS4A 2XG4A 3I50H 3IDIB 3EJJX 3RPIA 2O26U 1CT8B 4Y4FB 4OAWA 1WIPA 2VB5A 3P0GB 1V5JA 3HAEG 3O2DL 5ALCH 4OCXL 4HKZB 3CFIC 5I18L 2YRZA 2N56A 4F3FB 4XP6H 4RQQA 4UIKL 3HE7A 3MV9A 4FQCL 4WNQA 4A6YL 2ICWB 2O5YH 1KIRB 1E4KA 3HE6C 4M8QB 4MAYD 1DLFL 4YHYC 2RR3A 3B9KA 1N7MH 4BZ2H 4JJHA 3DARA 1UVQB 3QEQA 1G7IA 4DW2H 3IU3A 5D5MF 3VFVA 4BM7A 5HYSG 4JFZH 2EDLA 4EI6B 3OKDA 3V4UH 3Q1SH 3BD4A 3AU1A 2DLFH 4PY8I 4XWGL 3VG9C 5FYKE 5GRVL 2Z93B 3LB6D 4O2FB 4NOFA 2OYPA 4XP9H 4M6NH 3O3BB 4LHUA 3FN0H 5EUOF 4F80A 1D9KC 1RMFH 3OB0K 3QQ3A 4DWHA 2RIKA 2Q1EA 5SWZA 3WO4B 4YHOL 2UWEA 1ZTXH 4C56A 1F8TH 3KLDA 2L0DA 2AJSH 4NQDA 5T3ZH 4ZS7H 2GSGA 3UTSA 5H94B 5C2BH 3STZB 4OIAA 3D9AL 2MPAH 1VERA 5TH2A 1X5JA 1V3JA 5GRYA 2GITB 4R2GC 4PJ5A 5KSUA 3SDAA 2B39A 4LVOC 5HHME 4F2MA 5HYJA 1XCTB 5CJQH 2NY0B 3QFDB 3LY6A 1GZQA 1G9NH 4D0CA 3LEXA 3TZVB 4FFVC 1UXSB 2F8XC 3N85H 2PW2A 1S7RB 5LGHL 5DO2C 5FYJU 1PX4A 2CIIA 1VHPA 4YHZH 5F3BA 4YH6A 1K4CA 1NCDL 3DPBA 1D6EA 3DI2B 2OXHA 2P7TA 2FX7H 1RFDH 3FOMA 5E8PB 3RRQA 4ZTPH 3H9SB 3QG7L 4P3CH 1FNGB 2NZ9D 3DX8B 5JNYA 1HHGB 5EO1B 4MSWA 1OHQA 1KCSL 5FGSA 2EIBA 1TENA 4K94H 1RZKL 2PO6C 4U6YB 4I4WB 3ZE1E 1A5FL 3DMMB 3LVEA 1ED3B 1WBYB 2BVUA 3U36A 3EYFA 1QKZH 2IWGA 3E6HB 1A9BA 5K33A 1T83C 5I1KH 3RWGB 4OJFL 5K9OB 5CJBA 3T4YA 2UV3A 5F21B 3ALWA 1JRHI 4XNQB 1NKRA 5D2LB 5F7FA 5C0JB 3T0EA 1PG7L 3C5JB 4J1UB 3VW3H 4GQPH 2E6QA 1TJHL 3QUZD 4JM2A 1WCBA 1YQ2A 1ITBB 4HUWA 1MCLA 1NBYA 3EFDH 4UT9H 5D7JC 5LJYH 4WRLA 2V2TA 5GGSA 1ZANL 2CD0A 4U33A 1IBGH 1CLYH 1T5XA 4X80L 5CFHA 1P2CB 3G6AA 4XHJD 5D1ZB 4EKXA 3A6CH 3UCRA 1IVLA 5HHMB 2AEIT 1EEUA 3QZWA 1KIPB 2NW3B 2OR7A 1FBIL 3LKPB 1AGFB 4UIMB 4ENEC 4M7LT 1F3JA 4K7FA 4QXGH 1EAJA 5KAQF 2JIXA 1LNUB 2DJ4A 3U4EB 4ZDHA 4WI3A 4PUBL 4PG9B 5IESL 3QRGH 4JKMA 1BFVL 2DWEB 1LDSA 3I6GA 4Z7NE 3LV3A 1MEXL 4I48A 2FBJL 3SDXF 3X12B 4GXUM 3VWJA 5IM7B 1OY3B 1UZ6F 4HUXB 1FNHA 2BVOA 4LLQB 4OLZL 1MY7A 5IMKA 2VLJB 1MRDH 1ZV5A 5D7IA 1LO5B 4AM0B 1X5XA 3SEPA 2FR4B 2PTVA 3R06B 5C07E 2DLHA 2DQCH 3JXAA 2IAMA 3QNZA 3TYGL 1RHHB 4L3AA 1MOEA 4FMKA 3DRQA 4MNGA 4UUJB 2JLLA 5MENA 2VDRH 1I8KB 1R3JB 1QVOB 4OF7A 3O8XC 5KVGL 2H6PB 3TV3H 5E9DA 4JZNB 5ISZE 3QJHA 4AEHL 5EZOH 1YPZA 5GRJL 2NXYB 2XN9D 3QPXH 1KYOK 1NANH 1FAIL 5HHNA 5E08H 4OKVA 3HZYA 4K7PX 3IJYB 1XIWB 3KPNB 1YMHA 5EC2A 2F8OA 3K8MA 2A38A 1P7KB 4EVNB 5KSAA 5EO0A 4EN3B 1HINL 4U6XA 1UACH 4QGYA 1MCCA 4LNRA 1HXYA 1N2RA 4M7KH 5IR1B 1EEYB 4RAVA 5F7KC 2W9DH 1JWMA 2XPGB 3CLFH 3TESA 5E2TH 2BOCA 1KOAA 1YYMH 4PRIA 4NGHL 3SO3C 4NQXB 3L3DB 1MREH 3QQ4B 1HQRB 1RURH 4DN4H 2GT9B 1U2CA 1FVEB 1P4IL 1X4XA 3CVIH 4NO3B 1NLBL 2H26A 1KFAL 4MCZA 4QXUH 4MA7H 4LMQE 4PYHA 5IB4A 4ZAKC 5FHBH 4Y5YC 3T1FA 4LCWB 4OT1H 4H5SB 3QISA 2AXJA 1OVZA 1N5YL 2XRAH 4LPCA 5ESAA 4U2YA 5IW6B 2OP4L 5CD3B 2XZCH 4XPTH 5BRZA 4XCCH 5AWNH 5K9JH 5MHSE 3QFJE 4Y5VC 3RWHB 1FZOB 3T2OA 5GGRB 2VXVH 1REIA 2QTEA 3VFRB 4WWKD 1IARB 3KPTA 4CJ1A 5JW3L 5IV2A 4V1DE 3QDMA 2UYLB 4HCRH 1UWEL 4M6AA 4ISVB 1YY8B 5T3XH 4HAGA 4PS4H 4Y4HD 4JFED 5C07B 4A2LA 1U8QA 4N1HB 5C2UB 4P2QD 4ZFGL 1B88A 4I18B 2VKXA 3RIFK 5FV1L 4Q0XL 2FHBA 2VITB 5L7XL 1HHHA 1FCGA 1CZ8H 5ISZB 1ZA3A 2IANE 3U2SA 1RU9H 2ENSA 4M00A 4XMPH 5HHPA 1BOYA 4X99B 4YDKL 4BK5A 5JOFA 3K8LA 2XTJD 5ID1A 2BY0A 4OBRA 2D03L 4EOWH 4LSVH 5JR1L 1AD9B 2PCPA 2A1WL 2HFEA 3ZKQD 2HG5A 1RIVL 3IDIA 1XMWA 1AP2B 2YUXA 5ECJE 4XPHH 3PGCB 1QBML 5E6ID 5JQ6H 3LRSB 2CDEA 4RISH 5T5NF 4M1GH 1FNFA 3WXVL 5CHNB 4M1CC 3HC4H 3K4ZA 4GXUN 3V5KB 2IJ0C 2H41A 2AK4E 5TQ2H 1WBZA 1OTUD 3VFSA 2HT4C 4QHMA 4Z7OF 4U1NB 1BWWA 1R3IL 3QR2A 3GZKA 4PJ9D 5AG9A 2OR9L 1U8OB 4JHAH 1UVQA 3PGFH 5JPNB 1ADQH 4R90L 4XH2B 2NX5E 5CILH 2CKBB 2Y25A 4WW2B 3BGMB 4NM4H 3KR3H 2F74B 3GKZA 1I7TA 2I60L 3HI1A 2A77H 3PG2A 5DRNB 1S9WA 5CZXD 1CFQA 4Y2DB 1AXSA 3WKML 4EXKA 3MRMB 1IGFH 2NY7H 1QLFA 4P4KA 2AJ3B 3RPKA 2NLJB 3RVWC 3UTPE 2QSVA 3QHFL 4O2EB 2IALB 5IHZA 4KDWA 1IGML 4TULL 5A2LH 1A0QH 2G2RA 5TE7L 1EAPB 3LEYH 1IGIL 4KHXH 4MHHI 3B5TA 2ZSWA 2X4SA 4H8WL 2CXKA 1YNKH 1F4AA 4KJPC 1S7UA 5F9OL 4J6RH 4WO4A 4JO3H 2R1WB 3HPLB 3ZHDA 3TFKC 3KXFA 5IT2H 1E28B 2IANB 2CGRH 1HHIB 2UVFA 1OOAA 4POZD 1K5NB 3LS5L 3ARDB 4LVHB 3T8XB 5C92A 4S1QH 2W0FA 3STZA 1QFOA 1I4FB 3TA3B 1JGDA 4L4VD 2X4RB 4NM8L 2DQJL 2W92A 1CL7H 3QO1A 3HS0A 4WI2A 1O7VA 3WL9B 2VQUA 5FV2A 3P73B 1DQMH 4OQTL 1CFNB 4G6MH 4MS8C 3BZEB 1OW0C 4LLWA 5AD0A 4ZD3L 1KJ2A 1QFUL 2GUOA 2LE9A 3QYCA 1DBKH 3M17B 4QOKA 1A47A 1ORQB 1CDGA 3TJHC 2MCPH 4Y8DC 5DJXA 4PJHA 4EBQH 5IB5A 1MH5B 1FGNL 4ODVL 5E8PA 4Z8FL 1R3LB 2FIKB 2NX5B 4G42A 3KYOB 4NN7C 3ZKNC 5DT1H 4HUVA 5I6XC 1VKXB 4HUKB 1FO0H 3UBXI 5IEKB 2VDQL 4I4WA 3JTTB 4KUCF 5I1HL 2XFXB 4ELMB 5GJSH 1S7WB 1YY9C 5C1MB 1T2QL 3E6HA 4XI5C 1A9EB 2R0KL 4HDIA 1U0QA 4S0TD 1CN4A 4JFFE 5GS0C 3VCLB 5GS1B 5K9OA 5IROC 2NY4C 4W70A 5E2WH 3RJQB 5KSVB 1FNAA 4Q6IC 4S1SH 4RMWA 4I0KA 2P46B 4P3WA 5DMIL 3AC0A 1VENA 4UTBH 2D9QB 4C57C 1MHEA 4Q9CA 4K9EL 2ORBH 3L3JA 5FO9A 5EBMB 2ZPKH 5IW1A 4HZLB 3NN8B 3H8NA 3P3YA 1ZWIA 3JTSB 4PRNB 1L0YA 5IQ7L 4JO1L 4NNYB 5D1XD 4RRPA 3GNML 1MCNA 1AKJB 1U3HA 5D7LE 1KEGL 1GHFH 5C08E 5D6DC 4KUZL 3BVNA 3VFOA 2CMRL 4K8RD 4A6YB 3MRLA 4WHDA 1HH6B 1NGQH 4UIMA 2VXTH 4GBXA 5T1DL 3WNKA 1Q1JL 4R4BA 2NY1B 2D31B 5FCUL 5BZWB 5C0AE 1ODAA 3H0TB 4KI5C 1CFVH 4PG9A 5DVOA 4D8PA 5MEOB 3ARBA 4JAMB 5T1KB 5EU7C 3W82A 1CL7I 3SE9L 5K59E 3SKJH 1RZJC 3D18A 3K3QA 3MNWB 3IDUA 4DFIA 4PGCA 1AI1L 4RX4A 3HE7D 3MV9D 4HH9B 5FKPB 2W0PA 3TIEB 2ZNXA 2VWEC 2OR8A 2H8PA 2NZIA 3QIBC 1LO5A 3B9KD 3LDBC 4AM0A 2FR4A 2ATKB 3W5MA 2EDNA 3EO0A 1UKQA 5EBLB 4JO4H 4YHNB 1VFMA 3B43A 4HWBH 1ZLVK 1F97A 4J2XA 2J6EH 5DD6B 2V6HA 4PTTB 5GS0H 4K3JL 1H3XA 4JZNA 1SMAA 2EE6A 2GJ6D 5H8DA 4PB9L 4PJFB 1CXEA 3NMEA 4JPKL 1QO3B 5HXMA 4F15B 3GMOA 3S5LG 2Q76B 5CZVL 1WFUA 1KCRH 3OWEA 2FX8H 4PJXA 4EUPB 4IEFB 5TJWK 5DEGB 3L7FB 4LHUD 1T04B 1LP9E 1P7KA 4NN6B 2J8UA 4HS8H 2R0ZH 4U6VL 1T20A 4GKZA 5KVEH 1N5AA 4MVBC 3O2VL 1I1AA 3L3DA 3GGWB 2X7LB 4YEEA 5D7LB 1VFAB 3QQ4A 1HQRA 5C08B 3VH8G 2F5AH 3QP3A 5E8NB 1G7HB 5L0QC 2NNAB 4BUGA 1I9IH 5A2IH 1R24B 3ARSA 4N8VA 4PJ5D 4LCWA 4H5SA 5HYJD 1CFSB 1Q94A 4P5TA 1AGBB 1ZHKB 5C0AB 1J87A 3D2UA 4XCFL 1YEDA 5AYQA 3LRGA 2R8SL 1L7TH 2VOTA 5E8DL 3PL6B 1D5ZB 3BJLA 3VFRA 4FQIH 2B0SH 3S35L 3LHPL 3VGBA 1YY8A 2FGZA 1IGYB 1TFHA 2PW1B 2Z91A 3AY4C 1QRKA 4F7MB 3O6KH 2Y4SA 3P9MB 4I18A 4YQXL 3G08B 4MXVF 2OTPA 5EZIH 2JK5B 4QTIH 3VI3E 4FNLH 4HFUH 3FB5A 3X3FL 4KAQH 4Q9RL 1C16B 2RGSA 1WAAF 5BW7A 3MR9B 1AE6L 4XPAL 1JZ7A 1ACZA 1T0MB 4LLVA 4LNVA 5FO8B 4XNMB 4XAKE 3MLWH 4I2XE 3RDTD 4PGBA 3AB0B 1T2JA 3RVVD 1EGJH 1A6ZA 4NYLA 3EYUH 5CSZB 2V5TA 1KB5L 3BHBA 3T0ED 2ADJB 4FQQA 3UZVB 1CGXA 4WI6A 4KU1A 4P46C 4LF3A 4JM2D 4FA8A 2H32A 1MCWM 3CH1A 4KRPD 1LQSR 4JANA 3PGCA 3BYYA 3PHQB 2YK1H 4OF8A 3GDBA 4HX1B 3RL1B 5CHNA 3O45A 1CGYA 4M7JH 4X9GA 5HSFA 5CGTA 5F1SA 2HRPH 2DKMA 4U49A 1IM3B 2DQGL 5EU5A 4JPIB 4KKAD 3GMRA 2OJZL 4XBPA 3HMWL 4R26H 4D2NA 1RK1A 5J4MA 3BGMA 4O9HH 2EKSB 3EIFA 2P42B 2BNQE 3LMJL 3PWLB 3B4NA 4Y2DA 1EHAA 4CW1B 1GGCL 3HNSH 2JIXD 4OM1H 3IDJA 3NGBB 3NFNB 2PTUA 1NSNH 3MA9H 4OCWL 2LVEA 4M1DL 1LD9A 1JYWA 3VWJD 4HMDA 1U8HA 1ZLVH 1XGYH 4R7DA 1S3KL 3FQWB 3V8OA 4M7LH 1VB9A 2DM7A 1JZ2A 3S37L 4ZUUA 5KTEL 1JPGA 2XQBL 1IEHA 2CDGB 4EQ3A 3OKNB 2R1WA 2NY2B 3HPLA 4YR6A 3G5YA 2IAMD 4OGYL 4IRSD 4PJIE 1E28A 4QEGA 3I9GL 5KG9B 2XA8H 4OI8A 5E9DD 4NQED 4Y4FC 4CVXB 4K23L 3G5VB 1I4FA 3F7PC 2X4RA 3HUJA 1WZ1L 5FM8A 4I9WE 5FHAH 4X9BA 3WL9A 1QRNA 1F3DH 2DOCA 4OSUL 1H3TA 2Y5EA 3QIUB 5GSRB 3RJDA 2WUCL 1CFNA 3BZEA 1HQ4B 3VFNB 5KSAD 4S1RH 4JFDE 1QD0A 1U8IB 1TIUA 3WSQH 2X4PB 1B9ZA 3NAAL 1RIUL 4KKNA 2VLLA 1CVSC 3RVUD 4PRDB 2XZAH 3BP5B 2CH8A 3D0LA 3P2TA 3ARYA 5GGRY 1R3LA 1C5DB 3OKLB 2DQHL 3QO0B 4P23A 3VDCA 4XXCC 3I6LD 3GHEH 2OSLB 3MLXH 3JTTA 3MRBA 1A2YA 2P24A 3B3IB 3QJFB 5C0BE 2LFGA 1DN0B 4GRLA 2MQ3A 3DVNA 3K4AA 4MHHG 3ILPA 2OL3L 5DRWA 1ZT7B 1MY5A 5BRZD 2ZUXA 3VCLA 2B1HL 4WJ5A 2VDML 4PREB 4BZ1L 2ZOKA 4KZDH 4HXBL 5KSVA 3DVIA 4ZUTB 1N59B 1NL0L 3QXTA 3QDMD 5I17A 2HN7B 4JDTL 3FFDB 5EBMA 3OBAA 3WMSA 2JCCE 4OCYL 4PJIB 4UINL 3VRLE 1ZSDA 3EBAA 4LU5L 3SCMB 1A7OH 1CLZL 3C60C 1WT5C 2EDOA 1MLCB 2NY0C 5C70A 4EJ1C 5DEFB 2CK0L 4H0GA 3SJVE 3WDJA 3TZVC 2Q87A 1AGCA 3MJ7B 5FXCH 1HH6A 3MUJA 1K3ZA 2EH8L 3NVQA 4DUWA 4JFDB 2NYYD 3M8OH 5BZWA 4J8RB 4LSUL 3RVXD 3BX7C 4JAMA 5F7DA 4J12A 3RWCA 1YJDL 4KV5F 4JZOB 1ZHLB 3VG0H 5TFSL 3T77A 3UBXG 2JELH 1LE9A 1F3RB 3WFDH 3FAXA 4LCCA 3DMMC 4QWWD 5C0IA 3CIQA 3TBYB 1QFPA 1UWGH 3DWTA 1VEMA 3VGGA 4PJDE 4XVJL 4JRXA 3FTGA 2Q7NA 1K3IA 2I27N 3GM0A 3T4AA 3ZKSD 1BWMA 3RZWA 3TBTB 3FT2B 3TIDA 4P4KD 1WIOA 5C0RL 4U3HA 1ES0B 3KS0H 3JWDH 3CFDB 4XC3L 4FZEH 1P4LB 6CGTA 1V7ML 2W9EH 4GG6E 4LSQH 3RWIA 2XNAB 2WV3A 2WLZA 1SEBA 1XZ0B 3PWNB 5DEGA 5C0GA 4YEFA 2EEBA 1PBYA 4OFPA 1R6VA 4JY5H 2BRRH 5D1ZC 1Y6NR 4YXLH 5CINL 2EDKA 4WO4D 1I8LA 5MEPB 1T1WB 4PJEA 1U95A 1S78C 3KXFD 4WCYL 3S88L 5JZ7D 4OFIA 3CD4A 1IT9H 2G60H 3SJVB 2X9YA 2F53A 1G7HA 1NKOA 4G43B 2GY5A 3FCTB 3GSUB 4YHKL 3OHXA 4P99A 1OGAB 3CFCL 1BD2B 3BIKB 1CFSA 1HZHL 4HPOH 3QG6B 4X4YB 1YEIH 4NC2B 4PPTA 4QRRE 5F97E 1CIUA 5JW4M 1AGBA 1ZHKA 3WUWG 3P11H 1RK0B 2BNRD 1AR2A 4RGMB 5E94A 3VA2C 1EO7A 1AO7E 1MLBA 4IRJB 1BBDL 5DUMH 4NKOB 5CEZD 1MQKH 3PL6A 4KJYA 1D5ZA 1NMCB 2ICWI 4QOKD 1OAKH 2EDTA 1QBAA 4N0CC 4DVBB 1BX2B 2NW2B 2V9RA 3UYRH 4YHPB 4APQD 5KSBF 4KPHL 2R23B 3FMGH 4PJDB 1KJVA 4Z7WF 2FCBA 2A74B 4DKEL 1LO2H 4L3CA 3PWJB 4O51B 1XT5A 5D71L 5DD5L 5CBAB 1XIWC 2YEZA 1NUNB 4OV5A 1PJ9A 2V17L 4KTDH 4WI8A 5EO9B 4EN3C 4X6CE 1I9RH 4YDLB 5IF0B 1KLGA 4UOW1 3V7MA 4UDUA 3QIWC 2ADJA 3RVTD 3UYPA 3U48A 4HKJA 4HQQH 2EZ0C 2O61A 1P9MA 4YWGL 5J0BA 4D0DB 2X4OB 4TUJA 5C9JA 3PHQA 1G0DA 5FYLL 4KROD 3C6LB 3QUXD 5F1NB 5F7UA 3OAZH 5D5MB 3SGEH 5IB3B 3C8KB 3L3OB 4Y5XC 1IM3A 3GO1H 2BSRA 1MELA 4AEIH 3BUYA 1U3HD 4FABH 2UUDK 1LGVA 3DTXA 4HUNB 5TQ0H 2CR3A 1A1NB 4ZPTB 1N4XL 4G80A 2DI7A 3QNYA 5FUOL 4GBXD 2P43B 2QHLA 3W2DL 3DOSA 1CK0H 2B5IC 4CW1A 5EUOB 5HDBE 2HT2D 2BVQA 3OGOE 4OD1H 4YGVA 1Q9OB 5J8OA 3QULB 3UPRB 1RUQH 2DQTH 5CKGA 3OKOB 3ARBD 3K81A 1IAOB 1AXTH 4OCRH 1KTDB 4NJAL 5B3JF 3BFOA 3QUYD 4IHOA 2VLKA 4J3OC 4E5XB 3MROB 3FQWA 2JF1A 2YPKA 2D7TH 1FFOA 2ADFH 5IEHA 5I0DA 3P0VH 4LVNB 3RBGA 4CDHA 3GUTB 2AABL 1PVHA 4F33A 4MNHA 3H3PL 1OARH 3PWPE 4JG1H 4QRQA 1INEL 5KG9A 3PXHA 3WV0A 3G5VA 4L9LA 5DD0H 3UMTA 1NEZG 3QI9A 4W4NA 3N9GH 4ZOCA 4K3HA 4LCUB