3HA0A

Crystal structure of the ige-fc3-4 domains
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
209
structure length
209
Chain Sequence
VSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVQLTWSRASGKPVQHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords Ig epsilon chain C region
publication title Conformational flexibility in immunoglobulin E-Fc 3-4 revealed in multiple crystal forms.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 209
sequence length 209
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ha0A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ha0A02
1XEDA 2C3VB 4P57B 1JI2A 4Z7UE 2N1KA 4JHWH 3JVGA 4GOSA 4PJDA 15C8H 1F00I 1YEKL 4GBXC 4KKBD 4OCRH 1ED3A 4UILL 5E6IA 5KSBB 2F5AL 5SWSA 4ZAKB 3O3BB 2EDHA 2MQCA 5KOVC 5KVFH 5DJCA 1AI1H 3RGVA 1AXTL 1J1XH 1MCJA 3MJ7B 1K8IB 2JIXA 2AV7B 4LSQL 5FUCE 2B4CH 2QQLH 5DK2A 3RAJH 1BZ7B 3WHE0 1N3NA 3UJJH 4P23D 5EU6A 5GHWH 1UVQA 2X41A 3L7FA 1D6VH 5DEGA 1ZHBA 1VERA 3D25A 2CK0H 2ITDB 3MNVA 4P5TC 3CJJA 5J9PA 2E6JA 3WIHH 3SE8H 1H0DB 5FFLA 1NBZA 4NQXB 1PD6A 4I3RL 3C5SA 4G6KH 1YEFH 4ZAKD 5TF1H 4AT6B 3RA7H 5EOQL 2WWKT 2NYYC 2A38A 4N9GB 2A9MH 4U1GC 2FJHB 4WU7B 2JB6B 3U46A 3MOAH 2CXKA 3FO0H 1QSVA 3T2PA 5I1DB 1EO5A 1A2YA 1U8PA 3O3EA 4YR6A 3AMLA 3LN4B 1IEBA 4QCIA 2AXJA 2YPVL 2Q8AL 1RZ8A 3LKOA 1RULH 4X80L 5D1ZB 3CUPA 5MENE 3VG9B 5ESQA 3BGMB 5I1EL 3I6KB 3LEYH 3RY4A 1OARL 1UB6B 3L3JA 3ISWA 2MQ0A 4KJQD 3OKDB 5CCKH 3L95B 4JJ5B 4KKAD 2GYSA 2QR0B 4HV8A 1S7VB 1BBDL 4MX7B 1AY1H 2AJUH 3O6KL 3QUYC 5KN5A 5EOTA 1INEH 2OXGA 3NVQA 4LCWE 2G5RA 3CX5K 5J06A 4G9DA 4PJ9A 3AGVA 1DJSA 2XZQL 1T5WB 4WEUD 3B2VH 2R1WB 5ICZB 1Q8MA 4FFYH 3W5MA 4HIJA 5GGQH 1CICB 4LSTL 5CGMA 4ZFOA 3BH8A 1T1ZA 1WFNA 3BN9C 4GKZB 5C0FB 2ADFH 4XC3L 1MNUL 2BVYA 4Y5XC 4JPIB 5JPMA 1A7OH 5LCVH 3WNKA 4U0RC 2DB8A 5MEPB 1QKZL 2R4RH 3GMQB 4MA7H 1REIA 1OAQL 3GSNH 3DYOA 2DMKA 4S1SL 4A2MA 1A9BB 5IM7A 4R8WH 5C0IB 4XX1G 4P2OC 4JN2A 4ZOCA 5ANMB 2H41A 4QT5B 1LK2A 5GSRB 2V2TB 4CW1A 2DKMA 2CDGA 5KSBE 3K80A 1WWCA 3U7WL 4KV5F 1MVUB 1YQVH 1U92A 1ES0A 5EBLA 3OQ3B 1YN6A 4PGBA 1DBKH 2VUYA 4TPRH 4W68A 4HZLB 3VFNB 5DC4B 3HCVB 2AJXH 2DM4A 4DZBB 3BHBB 1CLYH 1TVBB 5D5MF 2PCPA 4QF1A 2R15A 1CGUA 3OHXB 1IGFL 4NRZA 4PFEA 3BEVA 3VFPA 3QO1A 3OKNA 5IK3B 2HT3C 4GRMA 2AJSL 2CLRA 4HBCH 4UV7L 1S3KL 3HS0B 4PJIF 2BOCB 5EN2B 1ZGLA 1P1ZB 1Q72H 3FKUS 5HYEA 4WCYL 3GUTA 4DN4H 2GSIB 5IG7B 1KT2B 3NCJH 4JRWA 5SWZA 1WAAA 1B2WH 5B8CA 1NCBL 2V5TA 1C7TA 2YPKB 3TJHC 5JNYB 1T0MA 2ICWI 3MROB 4HKBA 1E0OB 4OI8A 3ILPB 3TA3C 3EBAA 2BC4A 2A6KB 3S34H 4MCZA 3SN6N 3T8XA 3N9GL 2H26A 4FFWC 5IB3B 3LQZA 1A4KB 1GZQA 1MCFA 2Z4QB 4YPJA 4XPFL 2P24B 3GMPB 5DFVD 4S1QL 2D7OA 3LVEA 2R0WH 5FCUL 1UT9A 4I0PA 5F7KC 5JXEA 4H5SB 5A2LH 1G7HB 3NN8B 4XTRD 3DX8A 1TPXB 4WY7H 1S9VA 5D7SL 1OQOA 4ODSH 5LGKA 5F1NA 1RJYA 4ETQB 2JCCF 3MLUL 1RZJL 4S1DD 2A74A 3W5NA 1BIIB 3PF2A 4AYFA 4YXHL 5KSAB 2IBZX 4PJBE 4KI5F 3INUH 4K3DL 5DZNA 4DGYH 3ULVH 1MVFA 3BX7C 1T1XA 3QHZH 1LHZA 1BHGA 6FABL 3RDTC 2JK5B 1P7HL 3NH7H 4LASH 5L0QC 1VCAA 3MA7A 5EC1B 3EJYD 3MLTB 2EH8L 5IJKA 4UB0L 3TH2T 5C0JB 4W4OC 2VTFA 3SDCC 1R24B 3UJIL 1DEEA 8CGTA 2DTSA 4QY8A 2XZAL 5FYJD 2P49B 3EYSH 3KPMA 5DURB 3MV8A 4ZDHB 3NGBC 1GIGH 4OGYH 2VLJD 2VQTA 3IYLW 5KS9A 1QQDA 1VADB 2IQ9H 5J6GA 1ZWIB 2GY5A 2B2XH 4YHKL 2BSTB 3W0WA 2DJSA 1DFBH 1WZ1H 4YWGL 5F88B 4LCCA 2AABL 1RUAH 2FJFA 4J8RB 3U48A 1CDCA 3NA9H 5ANME 4ODWB 4MXQD 5D7JA 2IJ0C 1O0VA 1J5OL 4P46C 4HK3N 4RFNC 1GRWA 1OM3L 5JQ6L 4OLEA 5DD3H 3EYQD 5HHXL 3MMEB 4M5ZL 1KJ2H 4HXBH 3K4DA 1UXSA 4TVPL 4KZDL 4DW2H 4NQCD 3HN3A 4FS0A 5DURD 1UM6L 2GJJA 2VDOL 2A6DA 3BQUC 4KTEH 2I60H 4UIKH 1CGVA 1CI5A 1NMAL 4LLDA 4F9PA 2DLIA 1JZ3A 4RMUA 3MJ9A 3PL6A 1IGJA 4OD3L 3IU4H 5DXWA 1GOHA 3G5ZB 5K9OA 4JDTH 5GRUL 5IB5A 1BJMA 5HDQL 4M6OL 1WBXA 4RA0C 4J3TA 1HWHB 2R69H 3LQAC 5EO9B 1CXKA 2VUOA 4LIQL 5HHVL 1EGJL 4LF3B 4XVJH 3T08A 1XCTA 3OAZK 3FTGA 4F7EA 1BJ1J 3B5TA 5EIIB 5FO9A 3ZL4H 3QQ4A 5IMLB 1JPFA 3DUUA 3L3DB 2CPCA 1J0JA 5DUML 2DYPA 2W9LA 1T89A 3WUWA 1SJEB 3OR7A 3CZFA 2VLRA 3WNOA 5LXGL 3TO2B 1D5BB 2ADJB 4MDIB 3REVB 1OLLA 5HGBA 4HXAL 1JNLL 4QO1A 2WQRA 2UY7A 4MAYB 2OSLB 3QWRD 5I9QB 4L8DA 3ARDA 2V2WA 4PGZA 1GOFA 5FYJE 1GC1L 2XY1A 5EULV 1KC5L 2BNQA 2J7LA 4RWYL 4D9QD 5I1KH 1YY9D 5CD3B 2HKHL 3GRWL 2AJYL 1ZLUH 3QI9C 1IQWH 2XNAB 5EBMB 3MYZA 1HHIB 4AEIL 1QTYT 2AEIT 3B9AA 1A3QA 1AGEB 3QP3A 4OLWH 4JPKL 4ESKA 1TJIL 1YYLL 5C0AB 2DTML 3RNKA 2ZUXA 4RNRB 3M8OH 3T2NH 3QDJD 5JHDB 5IWLA 3W11C 2Q3AA 4PY8I 2VABA 2UWEB 1H9VA 3LD8B 4JHAH 4POZC 4MAYD 1J10A 2V17H 3DRTB 4YE4H 3REWA 3ZE2F 2F8XC 1GGIL 3I85A 4NQCE 4AG4H 2ADIA 1ZAGA 3TIDA 1XGPA 2DBLH 2H9GB 1NCNA 1CL7H 3OGCA 1NGPL 3E3QE 1WLHA 1T3FA 4XHJC 2LAGB 1H8SA 4LPUA 4U1JA 5E2WH 4U6YA 5EDXA 1N5AB 4ONHA 7FABL 1A3LH 1K3ZA 1T83C 5HGDB 1N8ZB 1CFVL 3VXPA 1RD6A 1G6VK 4PJEA 4ZOAA 1DP0A 1MCPH 4YNYA 5DZOA 1MIEL 5DMIL 3ARPA 3WD5L 5EA0L 3WXWL 3TVMC 2OR9H 2GSGA 4FP8H 2Q7YA 4P2YA 4NRXB 3LKSB 4LPWA 2ICWJ 1ZLUK 4L3AA 3S4SB 2D7TH 1YY8B 5TQ0H 1IILE 4XAWL 4N8VG 4JY5L 1U8HB 5CZXD 2PR4H 1FN4B 1PLGL 3V6FA 5F89A 1U8KA 3P4OB 3IT8D 1A6TA 3BIKB 3IS1X 4Z7WF 1AGBB 3KS0H 4JFED 4O9HL 2IWGA 4PV8A 4K9EH 1OAXH 3V0VA 4RWHA 4N5EC 4D9QE 2IALB 4E9LA 2NY6B 4H26B 1OB1B 3MBXL 1DL7L 5E03A 2P5ED 3E2HC 3SDAA 4PD4K 5GISL 1AE6L 2J8OA 5C0CA 2V7HA 3V6ZB 3NOIA 2LTQC 4GUPB 4KQ3H 4GAYB 5INCB 3CNKA 1FVCB 1JWUA 2XKNA 2D0FA 4NZDA 4PJ7A 5D7IB 5K93A 1IM3B 2LU4A 5HYSA 1A7PL 1FL5A 2AXGA 5HYQA 4TSCH 4G80A 4OF8A 3MFFB 5BZWB 4JB9L 3TZVC 4YIQA 1XGUB 4U6HB 4Y4FB 1IE5A 2Q3ZA 1HI6A 4ODTH 2F74B 1E6OH 3T0EC 4KUCF 2J6EL 1P7QB 4XBGA 1Z9MA 3VFTA 1U8IB 4NT6B 4X6BA 1OAZL 3UO1H 3O0RL 4OUUB 1BBJB 4PJFE 3QULA 4JZNB 3OF6D 5AG8A 2EDYA 1C5DB 1JNHA 2FHFA 2A77H 2UWEE 3TYGH 4FQCH 2E7CA 3B5HA 5JOPD 2FGWL 3VCLB 4XCNA 4JO3H 4ZUVB 4ZFGL 4OCLC 4NN5C 1GPOH 5HHQA 2EICA 3QH3B 4KJYB 4V1DA 3VGGA 5KSBF 3VWKB 5HYJD 3FFDB 1ZVYA 1FL6B 5T3XL 4UI2A 1HQ4A 4PRPA 2Z8SA 1IAII 2ZCHH 3P77B 1VSCA 3G9AB 1L9MA 1IAOA 4L5FL 4TVPD 3G5YA 1E27A 3F6LA 3VFUA 1AFVH 5IFHL 4LNRB 4QOKB 4P3CH 4JFEE 5JHLL 4GBXB 4HS8H 1BD2A 3NA4A 3MRDB 1VFUA 5D7KE 2Z31A 4ACPA 1P4LA 1H5BB 4K23H 4OIIL 1QA9B 3QT2A 1ZT1B 3BPCB 5BJTB 4Y5YC 4LLMA 3O8XC 5DD5L 3RUGA 1MWAH 2VDNL 4QRRA 4GW5A 3K81A 5F96L 4Z7VA 5JQHC 1FSKC 5H2BA 1XT5A 3HG1B 5HI3C 5JW5B 1SVCP 4RAHA 4MDJB 4ZO7A 1AHWA 2PN5A 4QYOB 1NFDB 2DL9A 4OB5H 1CFQA 2EEBA 4L8SC 3BO8B 4U1MA 5IMMA 4LMQI 2MQ3A 2PW2B 5FM8A 2OTWB 5I1HL 1F4WH 2P8MB 2FO1A 2DWEB 2GT9A 1MJJA 3UPRB 3KWWB 2CKBL 1RHFA 12E8L 1AO7B 2HVJA 4IS6A 1EJ6A 4NJAH 4OAWA 4U1GB 5IW3A 1S8DB 1I85A 2V2XB 5E5MB 4G6FB 5T3ZD 5K33A 5IHZB 3HG1D 4HSQA 4JDVB 4RZCB 3UTZA 4Q9RH 2QKIA 1KIRB 2R8SL 5IKCB 4H0GA 4PY8J 4ODVL 2UZYB 5JOPE 4JO2H 4YXLL 4ONFH 1SM3H 2L7UA 3JVGC 1TLKA 2Z92A 4F7CB 4RIRB 3P30L 5C08A 5E6IC 1AO7D 2XPGB 1BGXH 3RZCA 3B9KD 3KYAA 1EAJA 1KACB 3LPFA 5ID1A 1EO7A 4G6FD 3RGVC 1BVKB 4XCYA 3SDDB 5T1LA 1WZMA 2L7JA 1FRGH 3AS2A 2BVOB 1G6RL 3ULUC 4TVPE 2C26A 3TBVB 1K4CB 2GHWB 4G8GA 4HJJL 4R6UA 2WAHA 2P1YA 3I02B 3FCTB 4JFFA 1N0XH 3QWQB 5E2VL 3W82A 3VFOA 4MNHA 2J8UA 3CXHJ 3FT3B 4RA3A 3MQIA 4WI7A 4X5WB 4OGXL 1F4XL 3LRHA 4APQC 5E1AA 4Y5XB 2OJZL 1KEGL 1QYGH 2W0LA 3BYYA 3QUXA 1ZS8B 4ONGH 3N85L 2VZ3A 4WV1C 2EE2A 4HX1B 3VD4A 1MCOH 4GS7C 1KJVB 1MAML 4M7JL 1O7VA 4N68A 4KRLB 4YDVA 2ZOLA 1F8TH 4PGJA 4LIQE 3VI3F 3SDDD 5CJQL 1UZ8B 1T20A 1XGYL 3D18B 4P2OB 3ZDXF 3DVNB 3P9LA 3OGOE 2A73B 2CDEB 2EKSB 3WKMH 1FG9C 4NKOA 3LKNA 1JF6A 1P69B 3HE7C 1R0AL 4PRHB 4YAQB 1UYWL 3BN9D 3MRIA 4JN1L 5E0QA 1E28B 5GZOC 3JV6B 4GXUM 1Q0XL 1G9NC 4OLVL 3AUVA 5C0EA 5IW6B 2J88L 5FOBB 3DI2B 1NCUA 1AQKH 1DN0A 1YEHH 2HTLC 3ROOA 2YEZB 1UKQA 1S78C 3HI5H 1IM9D 4JANA 1QR1A 1T66C 2NQCA 5T3ZE 4H88L 1CF8H 3HG1E 4QHMA 1MRFL 2E7LA 1KB9K 1NFDE 3BH9A 5FB8A 4HKJB 3ULSB 4KTDH 2BVQA 2I26N 4PJ9C 5JOFA 2X4RB 3BJLA 4UDTA 1IRAY 3NFPB 5CUSL 4GMSH 5JR1H 3KLHC 3ZYJA 4KHTL 3CPLB 5HVFB 4GMTL 3WO4C 5FYLL 4LHQB 1WCBA 3BISA 2CLZB 4HIEB 2VYRE 3V6OE 2N7BA 1D5MB 3VH8B 1AO7E 1MHPH 3P0YH 3V4PL 3MBEA 2EYTB 2OI9C 1FH5H 4LARH 3TA3B 2DQFB 3MRGA 3IXAB 3PUCA 1AD0A 4F7MB 2BP3A 3I3BA 4LVEA 1B0WA 5DRXA 1WC7A 5MEOA 2O5XL 1ZHLA 3N1PC 5DGRA 3U7YH 4XWGH 5BRZB 4U7SA 4DK6A 4RFEA 3OKKA 4C4KO 4F58H 3WFCH 1YJDH 2EO1A 5EO0A 5EWIH 3ZKMD 4R4FL 3FN0H 2M2DA 1N4XL 4HPOL 4OZGA 5GGVY 4KDWA 5FDWA 4K3EL 2BSSA 5FEBA 4HUUB 1J86A 1VPOL 3Q6GL 3KPPB 4IIQA 1RMFH 3RVUD 1ZLVH 5HJ3B 1FV1A 3VMNA 3HAEH 5I18H 4KKCD 2D0HA 5DJ0B 5EZIL 2NY1C 4X8XA 4NZTL 5E8EB 4UZGA 3KPTA 3WHE1 5KTEL 3FMGL 4DK3A 1CTNA 4L8BB 1F2QA 4ENEC 4IRJA 1JE6A 1JMXA 3SDCB 5AYUH 4R2GC 1HDMB 3ZDZE 3QCTH 5GS3A 5CIPH 3JWNC 3GBLA 3NGBB 4JY6B 1OGAA 2Q7NA 3H9HA 1ETZB 2CUIA 1A7QH 3QQ9C 1A64A 4WWKC 5E5RB 5C7XL 3ARZA 3MJ6A 4LSUL 1J1PL 5F7MC 3H9YA 1IEAB 1MFDH 5IGXL 3VGEA 3P2TA 3UTOA 4NPYB 5D72H 2I9TB 2BOBB 2PO6A 4Y16A 3CVHA 1HH6B 2DIBA 4DZ8A 1S9WB 4P46B 2AKRA 4U6TA 4RFNB 4HC1H 1I75A 3EYOB 2CKBB 2R1XA 2DQGH 4JKMA 1QACA 1NC4A 1S9XA 4CBPA 4ZUSB 3RFZC 3K8LA 5H94A 1KXQE 3KHQA 1N7MH 3QUKA 5L2KA 1I9IH 4NQSA 5EIVA 5T5FH 5DD1L 5HYFA 5JXEC 4NQVA 3JTTA 3BQUB 3H3PL 4LVOC 4HJ0C 1MAJA 3MLYH 1HXYA 1W0WA 4MD0A 5D8JH 2GEEA 2J4WL 3S37X 1RJZB 1VGEH 4X7SH 5E8DL 5I8CB 2WNGA 5FKPB 2VR5A 3MNZB 2ARJB 1KGCD 4KXZI 4LLVA 5DLMH 4WHYG 5EU4B 1AXSB 4G9FD 1T5XB 3F65A 4R4ND 2R23B 4G8FB 3CFIC 2ZG3A 5J1SC 4QXGL 1U8LB 1RU9L 1U6AH 3WLBB 5JZ7D 3DV4B 3IRZA 1MQKH 3PHQA 4XCFL 4UU9B 1YC8A 2P8PB 3GMMB 2X4PB 3HZVA 5BRZE 5CD5C 3FOMA 3IS0X 4NP4H 5E8NB 3MREB 3NCBB 1UG9A 5CMAB 4OD1H 4LCCC 3X17A 4D3CH 4WI6A 4Z77A 4R0LA 5E00B 2X10A 5T3XE 1SHMA 1U3HD 2UWEF 4I9WD 2BRQA 2ICEA 1I1AA 3BRDA 4YDIL 3I75B 1P2CA 3IDXH 3MOQA 2YZ1A 3LRGA 3N0PB 1XR8A 2Q8BH 3GSRB 4CGTA 1M7DB 2AJZB 1ND0A 1CXHA 1DQJA 1LK3L 3QI9B 3MRCA 4X0KA 5IFAH 4N0UE 3O41A 2CIIB 1OP3H 5DR5H 4NC2B 3T4YA 4I2XA 1XGTA 4NZRH 4F9PC 3N1QC 3O9WA 1MRDH 3PL6C 1OAUL 1RZKC 3DETD 4ZYKA 5IT2H 2FHCA 5GGTL 1KLUA 5IHUH 4E42A 1W2KT 2C4FU 4L3EA 4MJ5B 1HIMH 3VG0L 3KYKL 1FIEA 3H7BB 5KW9L 1V3LA 3RIFK 3G6AB 4G7YL 1KG0A 3QDGD 2BHZA 4P4KB 3R0NA 4RX4D 3R06A 4UINH 5CWSB 1CZ8H 4JRXB 1P4BH 2EDXA 3H3BC 1T89C 1IC1A 4O4YL 2G2RA 1R5VA 3LIZH 4TUJA 3S4SG 4KY1H 1A6UL 5IROC 1FPTH 4YFEA 3VFRB 3D0VB 1OHQA 2XTLA 4FNLL 4G9FE 2KDGA 2YRLA 4UDUB 3WYRA 2SEBB 3ULUL 5D1QC 4JR9H 2Z9TA 5TDOA 1YEIH 1YNTB 4AK1A 4S11A 3VA6A 5JO5B 2GTWA 2QSCL 5IBUB 4P4KD 1ORQB 4BSVB 4DVBB 1OT2A 5TH2B 1HCFX 4OZFB 1VFAB 3GSQB 4RGNC 1S7SB 4XVSH 3T1WA 3DUHA 4LHJB 3GI8L 3SPVA 4LEOA 1FDLL 2NW2A 1TQBC 4PJXE 5FYLD 1WZKA 2F54D 3Q5TA 1JF1B 4BH7B 3LS5H 3KPLB 3CFBA 1BOGA 5CLTA 4I9WE 5D7IF 3ZE1E 1SMAA 1DE4B 1SEBB 1HHKB 5TE4L 2EDRA 3D0LA 3SCMA 5T3ZH 5F44A 4LDOB 1OSPL 1BVLA 2D7MA 4B5EA 3KYMB 2E5EA 1EAPA 4A2LA 3TBYB 2EEAA 3E2HB 4RSVA 4OBSA 1DBJL 3B3IA 1UWXK 1EEYA 1G9NL 1YNLL 1BOYA 1JNNL 4UNVA 2VDRH 3A6CL 1MCQA 1JN6B 2QQKH 4L4TB 3FQWA 3BKYL 1QSEB 4HGWA 2HAZA 3B2UD 5A2JH 5HHMD 4NM4H 2HLFC 5GRZA 3FB6B 4DTGL 3GJFH 5F71A 1DLHB 3KR3L 2HJKA 1IGYB 2HT4D 3ARFA 3P9MA 4NHUB 2WBJD 3T0EB 3VXRB 1XF5B 2ICWB 3QDGE 3OTTA 3QAZC 3BIBX 1CBVL 5EIQA 4J6RL 1C16A 1DN2A 1RVFH 3T2OA 2VXSL 3RKDD 4YX2H 2G5BA 3Q0HA 3V52H 3BDYH 3IFPA 4D0CB 1UM4H 4CDGC 1YQ2A 3C6LA 4Y1AD 4L4TD 3KXFA 5DJXA 3H9SD 4JM2D 5IR1A 3VXNB 2ZKHL 3GMNA 2K7QA 3KPQA 1N6QL 2QSVA 3LSOB 3U9UB 4LSSH 3WFEH 2EDTA 1KCSL 4NN5B 2APFA 2MFNA 5TDPB 2GITA 43CAB 3ARXA 3VFMB 2HLAA 5SX5H 1A47A 2G9HB 3MXWH 3VD3A 1UWGL 3IKCB 3ILQC 5LWYH 4M6MH 5FYLE 2F54E 3NACL 1PBYA 2FH6A 3U30C 3V4VL 4OFPA 5CZVL 2OP4H 3CSYB 4M61B 4FG6D 4PRIB 1CFNB 4QRQB 1KCRL 3NCYP 4U49A 2CRYA 3GJFK 5E99L 2A9NL 3CFKA 1VFMA 2Y5EA 4FQIH 5D70L 3PGCA 4Y5YB 5E6YA 3O8XB 1MCHA 2Q86A 5F9WC 4Q9QL 4POUB 3WIFA 2BVEA 1MUJA 1T0NB 1OF2B 1FSKB 4JZOB 3CIQA 1PW3A 5D1XD 4WUKH 3ZE0E 3O3DB 4TNWF 2ITCB 3TNMB 5KVGH 4L8SB 1NC2B 4HT1H 1K5NA 4Y4HA 5F1IA 4WI3A 1C5BL 2APBA 1NGYB 4U0QB 4XPGH 5HHME 4LAQL 3BJ91 5DMKB 1DQTA 1ZHKB 3EW3B 3ZYOA 5IV2B 4PRBB 4QXWA 2C3XA 2OQJB 3ARED 1T7ZA 5E9DB 4ELMB 1CE6A 2WIIB 4N0RA 5ABDE 4X4XA 1LQSR 5K9KA 4LVHC 1YMMA 5FGBC 1I7TA 4PPTA 3M45A 4N8CL 4S2SB 5H8DA 3O11B 3QHFL 4MB4A 5SX5K 3RX5A 1BWMA 4HS6B 3EZJB 1LEIA 5KZCD 1MJUL 1KIPB 2GK0B 3QEQD 4Y1AE 3WFDL 1MH5A 3IDUA 4L4TE 1JTTA 4YUEH 4X6CA 3ELAT 3HI1B 2WP3T 3H9SE 3T0XA 1QSEE 3NCCB 1DQMH 5MERA 2W07A 2A0LC 1ZHNB 1Q9LA 5C09A 3CXDL 3K3QA 4XP4L 3VFVB 1BQHA 1DEDA 4KRPD 5E9DD 1ADQL 3IJSA 3UCRA 3PWLA 4NGHL 5DEFA 2XRAH 2Z31C 3MCLH 3BD4A 2YD1A 3JZ7A 2CO7B 2DDQH 2NXZD 5GIRB 1MHCB 1VENA 3QNZB 2PYEB 4HZAA 1NMBL 3KPOA 3OJDB 2FR4A 1YUHA 3MV9B 4FQXA 4G3YH 3FQUA 1N3NB 4PIRF 4WO4C 5IBTL 5I8KH 2AI0L 3L7FB 4FQLH 1ZHBB 3RVVC 5E56A 2VSCA 5ICXA 3ORJA 4APQB 2OS7A 5D5MA 1OOAA 3C5SB 1DQLL 3QNYA 2V5SA 4WV1B 2VLLA 4P9MH 4R4BB 4DGIH 4GS7B 3ARVA 4LKXB 4PG9A 4KDTC 3SDYH 4BJLA 5DC9B 4TVSa 3GMLA 2G75A 4JM4L 2X1WL 3OXSA 1I85C 2MHAA 3PV6B 4PJIA 4NKMB 3U46B 5C2BL 4GFTB 3MV9D 1VDGA 3HNSL 1NEZG 1SYSA 1X7QA 2R9HD 3D2UD 1A2YB 3FN9A 3HE7B 3MGTA 2I5YH 1RZ8B 3LKOB 3OKMA 4GLRI 3W39A 1PX3A 1OCWH 5ESQB 5KVEL 2EIEA 3HNVH 5DHVA 3L3JB 3AMKA 3U2SB 3LH2L 3Q3GA 3T65A 3T0DA 1JGEB 2NXYC 3MUHL 4HV8B 4MA3A 4PJHE 4YXKL 3A0OA 3EKCA 3CCHB 3WNNA 2EDLA 3DSNA 2IC2A 3MRKA 4BFEA 3HFMH 3CK0H 1KBGH 1YMHB 3BWAA 5ISZA 4PJ9B 1IKNC 5IP4A 2ZCKL 3PDOA 4NM8H 4WI8A 3X3FL 4AH2A 1I1CA 2X4NA 2JCCA 4JFOB 3WO4B 3DXAD 4RBPH 3NFNB 2W9DL 3BDBA 3HC4L 4NO3A 5E9DE 4ELME 3BH8B 1I1RA 1UH2A 1FCGA 4QNPE 2OI9B 4IOSD 4ZFZB 5DT1H 2AK1L 4CVWA 5BS0A 5F6IB 5GS2H 1JUFA 3V79C 4JQVC 4QXTA 3HZMB 5TE7L 4KK9D 4EXPX 3EFDL 3D39A 2ATPA 4QRUA 5FYKL 3DTXA 3QSKB 1XCQA 3H0TA 3Q6FB 2Q76A 4P2QD 3SDXE 4JKPL 5LGHL 2A6IB 2FDBP 3FQRA 4LP5A 3QUML 1S7UA 1GJIA 3DARA 2ZUTA 2CDGB 5KSUA 4LBEA 1BQLH 4IRSD 4HG4K 4EXKA 5F1KC 2VL5A 4N0FA 4P3DB 3QUZD 1ZVSA 1AC6A 2ZWLT 3ZKQD 4BZ2H 1QLEL 5TGBA 3BZEB 4PGBB 3AS1A 3RPIA 4JG1L 4DVRL 1MEXH 3P9WB 2NY1B 3MV9E 1FAKT 1UFUA 1I1YB 5CP3H 5CBAB 2R0ZH 4NC1C 2W0KA 1RIHH 35C8H 2KZ1B 3KPRD 2E7LC 5EO1A 4IDJL 4R2GB 4GRMB 2CLRB 1LO2H 2Y5TA 4KKNA 4Z7OE 4G6JH 4F80A 5C0BA 3TN0A 1ZGLB 1QD0A 2NW3A 1B0GA 1FBIL 4NO0A 3CFCL 5SWZB 2APVA 3WFZA 4PLJC 4WWKB 2WBKA 4MNQB 1T0MB 3MGOB 1J7VR 2VDQH 4PLKC 1C08B 4I5BA 4FZ8H 5GSVA 1BREA 5TE6H 1CDJA 3QFDA 1BFSA 1R5WB 5FF6B 2DWDA 3TO4A 1BPVA 4XNUH 4H8WC 1E4WH 2BRRL 1GZQB 4OKDA 3HZKB 3G04A 3DXAE 4A6YH 5EBWA 4GO6B 1PY9A 4PGEA 3ZE1F 3U0WL 1P7KB 2VDLL 2M1KA 1EPFA 1MCNA 3RKPA 2HFGH 5IFJB 2A74B 4DCQB 1Q1JL 1MCWM 1WZLA 5LG1A 1OTUC 2WUCH 2DIAA 1BM3H 3GO1L 3EHBD 4XBEH 1EFXA 3DX7B 4KRNA 5EUOF 3KYOB 4P2QE 4Y5VA 3MRHA 5LJYH 3HMWL 1EJOH 5E2TL 5IB2B 4KVCH 4WFFD 3SKOB 3BEWA 3MNWA 4OSUL 5B39B 3FHAA 1TQCC 5AZ2H 4IRJC 4BFIB 5MI0C 4UNTA 1R3HA 4QY8B 4HFWA 2OZ4H 4NUJA 2W60A 1T7XA 3DGGB 1QSFB 3MUJA 1CG9B 4MMZC 4CU6A 4QTIL 2X4SA 1X5JA 3W0WB 4B50A 3O2DA 2BJML 4Z7UA 5ECJE 3TEUA 1ZTXL 2DD8L 3KPRE 4LCCB 1TVHA 4CAGA 3VRJA 2DLTA 4CN1A 4U1KA 3DGCR 1NAKH 1KCUL 2PO6C 4Y16C 4J12A 4ZSOB 2GI7A 2C1OA 2W0FA 5DQ9A 3UDWC 1NAMA 2OL3A 1LNUB 5GJTH 1S7TB 3S96B 3GKWH 3NZHH 4NUGH 4X7TB 4IRZH 1IEHA 4NJ9H 1R6VA 3VXSD 3PDGA 4UUJB 1HKFA 1QSFD 4JO4L 4ZOEA 3TT1L 1SJHA 4HPYH 4NQUA 1QHPA 3PL6B 2AEWA 4JHBA 4HUWA 5J4MA 2DMBA 1JGDA 3BP5B 5IEKB 1PKOA 5IB5B 5C6TH 2Y07L 4LHUB 4QHLA 2XZZA 3D85D 4U1NA 2XA3A 5CHNA 4LCUA 5F3BB 4JGMA 1WBXB 2YBRA 3STBA 2BNUA 2DM3A 1JZ4A 1K6QL 1XCTB 4N8VA 2J12B 3P0GB 5FO9B 1RUPH 1HHGB 1KB5H 1DBAL 4Y2DA 2JJSC 3QQ4B 1JPFB 2XQYG 3QCUL 4EBQH 1P6AB 1Z9SA 4GRWB 2PXYA 4LCYA 4DEPC 5GS0C 4OTXH 1JGLL 1XF4A 3MLZH 2ICES 1HQRA 4JFXB 1DQQA 1NUDA 4OD2B 4PLOB 1HHJA 5HGBB 5MENA 4C83B 3QFJB 4JFYB 3BYTA 4WFFE 4XNYL 5IEHA 3QIUA 2IBZY 4XXDB 5I8EA 1JPSL 1ROWA 5D1QB 4Z0XA 1RK1A 3HMXL 5HTSA 3S35H 4R0LC 1J8HB 4KKLC 2V2WB 1QFUL 4AIOA 2QQNL 2VDKH 2IFFH 1I1AC 4PY7B 5HHOB 1EEZA 3GNML 4OZ4A 4PP2B 3VWJC 4RGNB 2NZ9C 2BFVH 5EZOL 1KTDA 4LCWA 1CGSH 4AEHH 5L6YL 2YWYA 3QQ3A 1U8JB 3CDGA 1TQBB 3CC5B 2IQAA 4NNYB 1QO3B 1OGTB 3VRLE 1S9YB 4UV4L 3HRZA 4QGYA 2VABB 4I8DA 4WDIB 2PF6A 5CEZL 2NR6C 5FYKD 3REWB 3PP4L 1D5IH 3VRIA 4NHCL 5GZNC 3VXSE 3C60B 2GUOB 2RR3A 2IPTL 3TIDB 4C54A 1QSFE 2F53B 2JB5L 5J3HD 2C7UB 1QLFA 1F3DJ 1A14H 2NY4D 4ZUUA 2DL2A 1EBPA 5DHXB 4U6YB 2EXYD 1EHNA 3BW9B 1RV6X 4TOYH 4L4VB 4YEEA 4ZSOE 1MI5B 4HH8A 4QEGA 5KSBA 2RQ8A 2JKXA 4ZAKA 5DMGC 3WCYA 2YWZA 3VXPB 3O3BA 4M62L 5EU7E 3I50L 4HGKC 5F3HB 1MPAH 4EI5B 3MUY1 4EKXA 1RK0B 3QAZB 1OAKL 1JYXA 4XNZC 3C60D 3MJ7A 5D7LD 1K8IA 3NABH 1CXEA 3AB0C 3V0WL 1BZ7A 2GSGB 3H8NA 3M07A 4R9HA 4IMLB 4XP5H 4ZXBC 4FQHB 5CJ5A 4L4VD 4M43H 1MI5D 3V6FB 2HLFD 4NQXA 1A6TB 1MLCB 1BEYH 4AT6A 4LGPB 4F33B 4EI5D 1J18A 5F7WC 3V0VB 3B6SB 4N9GA 3MLSH 4LLQB 4K94C 4WU7A 2JB6A 2L0DA 3DX6B 3JXAA 4G5ZL 2BMKA 5IQ7L 1P4IH 3SE9H 5I1DA 3KPSD 1S7WA 1NLDH 3BKMH 3RVXC 4UBDC 3U30B 3BZ4B 5D1ZA 3QFJE 4MJ6B 3I6KA 1UB6A 3VDAA 5HYSB 4JFPB 4LQFL 1A6WH 2H2PD 3OKDA 5TQ2L 1A7NH 3K4ZA 3L1OH 3QPQD 5DJAA 4JJ5A 1S7VA 4YIQB 5FYKE 5I66B 5DUBB 4BQ6A 5HHOE 5F9WB 3RBSA 5CSZB 1ORSB 2BK8A 4RGNE 3NFSH 4ELMF 2IGFH 3EOBB 4PJBA 4KWUA 5JUEH 1UWEL 1KPVB 4X6BB 5EFIA 4BFGA 1T5WA 4Y4KC 2R2EB 2R1WA 5ICZA 2DQCH 1JNHB 4WW1B 2KKQA 4NN7B 3X13A 3ZDYE 4Z7QF 1CICA 2O5ZL 4Z8FH 1GHFL 4L8CA 1XAUA 4GKZA 3RL1A 4XCNB 2VKWA 3WEXB 4NOBA 5FDYA 4H8WL 5SV3A 4JPIA 3SO3C 4UNUA 4X83A 5D6CB 4LVHB 2CRMA 5D7LE 1NCCL 5BVPH 3GMQA 5HHQB 1F11A 2F53E 3TYFB 3RP1A 1Q9KA 4OM1L 1AJ7H 4OF3A 5F9DC 2J3SA 2EDNA 3G9VA 1A9BA 2YA0A 2W1NA 4OI9A 5C0IA 5ANMA 3R0MA 4QT5A 4CU8A 4L4VE 2V2TA 1X5FA 1MI5E 3ULUF 1E27B 4BQCA 1WEJL 4J23A 4PP1D 3VFUB 2X09A 1WTGT 1W0VB 2FWOA 3MACH 5KG9B 1MVUA 2VKXA 3HI6H 3CX5J 3VFNA 3CLEH 4XI5C 5F9OL 1G9MH 3HCVA 3TJEH 3BHBA 1MFEL 2YMXH 43C9B 1RZFH 1U8OB 2O5YL 4LAJH 8FABA 3OHXA 3KPSE 1NLBL 1EZVX 2XA8H 1KJ3L 3N1FC 3G5XB 4MVBD 4WGVB 5IK3A 4BKLA 2YR3A 2Z91B 2K1MA 4WO4B 3RRQA 3IDNA 4XNXL 3U0TA 3IETB 3CD4A 2BOCA 3D9AH 1LDPL 5EN2A 1CFQB 3W9DB 1WF5A 2GSIA 1QVOA 3WE6A 5C0NC 5IG7A 1KT2A 4BK5A 5JW3L 5JNYA 1W72A 3UPAA 4D9RD 2FLBT 1FGNL 2BY3A 3U4BL 4XB8A 1MJJB 2JJTC 2ERJC 4NCDA 2HVJB 3CXHK 3TT3H 1DUYA 3QXVA 4FQ2L 4YDKL 3RJQB 1L0XA 4LLAA 5IB3A 1A4KA 2V9TA 3BE1L 1Y0LB 2VMFA 1X3DA 2Z4QA 4MLSA 4EUPB 4YLQT 1L7TL 2P24A 3GMPA 2VSDA 3CVIL 2LFGA 2QKIB 1E4JA 2QL1A 4H5SA 3UBXB 5EOQH 1OP9A 1G7HA 3NN8A 3GHBH 4WGWB 3TPUB 4KK8C 1OTSD 2KQNA 2Y7QB 4JFQB 4ETQA 3GHEL 2JJVA 4M7KH 1BIIA 5GGVH 2NXYB 5KSAA 2Z92B 1EMTL 3QWOB 4JLRB 5C08B 3ALPA 1C5CL 2YSSB 4KMLB 1GZPA 3F12B 4XMKL 3S36X 1F6FB 1JRHL 3LZFL 5T1KB 5CEZD 5T1LB 5I6XC 1MCRA 5EC1A 3MLTA 1KENL 3NAAL 2AQ1A 1CQKA 4WRLA 2DQIH 1R24A 2QTEA 5GS0L 2V9RA 3MLVL 3WJLA 1NCTA 4NQCA 2RBLA 3RVTC 1IT9L 4TSBL 2UZIL 1C1EL 4KPHH 1VADA 25C8H 1ZWIA 4OQ1A 1A02N 3C8HA 2BSTA 3UYPA 5C8JB 3WJJA 4XVUD 2EDJA 5A1AA 4EZMA 4QLRA 1I3RA 4MQXD 4J8RA 3QO0B 5T1KD 4NSKB 4KDVA 4ODWA 2YK1L 5I2IB 4HUXB 1CS6A 1KSRA 1CL7I 4Q9CA 2BDNL 3MMEA 1YPZE 4UTAL 1LO0L 3LKNB 3MJGX 2VDML 2AGJH 4J7RA 3RI5F 3MRIB 4DKFL 4D9RE 3MRJB 4XMPL 1U58B 3LDBC 3OKEA 3PXHA 5HPMB 1DN0B 2HRPH 3ROOB 3SGKA 3G5ZA 3G6DL 5ILTL 1FZJA 1IVLA 2W91A 3T3MF 1XGQB 3LV3B 2BVUA 4IMKA 4PB9L 5EO9A 2P44B 3D5OF 1H15B 3PWPB 4NBXB 4OCSL 2YXMA 2EZ0D 1WV7T 1T2XA 1MHHB 4Z9KB 5EIIA 5DSCB 3VFSA 1XF3A 3OG6B 4K2UH 3L3DA 4MD5B 2QHRL 1JHKH 3ARBC 3SO5A 1SJEA 5CJXA 4ODXB 1IC7L 5TPWH 1J88A 3DROB 3UAJC 1D5BA 2E27L 4LEXL 2ADJA 4MDIA 4HCRL 1KEML 5T5NF 2EO9A 4PJ8C 5CEZE 2ZJSH 4XH2B 1QFWL 2NNAA 4MAYA 4JRYB 4JPWL 2OSLA 5DRXB 5MEOB 3PWPD 5ADOL 3STZA 1F58H 2BNRB 2XOTA 3O6FC 1D5ZB 1I9RL 4ZTOH 5EO0B 3UZQA 1BMGA 4OZGB 1PG7H 4O02H 5JDSB 2ZSWA 4C56B 2ARJQ 2KZWA 1HHIA 5GGUB 3S35X 2W9EH 2BSSB 4PJFA 4Z5RB 4RNRA 3ZTNL 5JHDA 5FCUH 1FV1B 2UWEA 2EDDA 5I1CL 1A5FH 5KOMC 3S5LB 2CLVA 5KJRH 2ZUSA 5IVXE 1I8KA 3DRTA 1RQ5A 2X9WA 3GSUB 5MI0B 4AEEA 4TSAH 1FGVL 2DJ4A 2H9GA 3E8UL 3UC0H 3C2AH 4P5MA 4C56D 3D48R 3DIFB 4CKVX 6FABH 3H9HB 3LRSB 1N5AA 4M7LL 1LEKB 4I48A 4S1RL 5HGDA 2RCSL 3LMJL 5J0BA 3UJIH 2GCYA 2L4OA 1NFKA 3BOVA 4Y16B 4JFEA 4BZ1H 4RISH 3S88H 3TO4C 5L7XL 3ZKSD 1PSKL 4MD4A 4P49A 1S9XB 4WI5A 1NDMA 4WI2A 1XF2A 3EO1B 3LKSA 4NRXA 1B90A 3S4SA 1IGML 3LEVH 1YY8A 3JTTB 1BZ9B 3MRQB 1J5OH 2Z35B 1U8HA 4OT1L 1OM3H 4ISVB 4WEBL 4AIZB 2B0SL 4YFDB 3P4OA 4ZD3L 2PTTA 3TWCL 4GRWF 3BIKA 1CGXA 1NFIB 3PWPE 1AGBA 4HF5H 5FHBH 4KZDH 1A3RL 5CJOL 1KUMA 4WFED 4RDQF 3I84A 1DR9A 5JXAL 1GGTA 3DMMC 4Y5VC 1NMAH 5EZLA 1DSFL 2IALA 3GB7A 1OSZA 4H26A 1OB1A 3AC0A 3HR5B 5GGRY 4OLXH 1TZGL 5GRUH 1V7MH 4F8QA 1AQDA 4AL8L 2R29L 3OF6A 4KAQL 1PYWA 4DEPB 2IAMD 3V6ZA 4AZ8A 3MA9H 4GAYA 1ITBB 5INCA 5D7IA 1A6AB 1IM3A 3DURB 1INQB 1FE8L 4JRYE 4X4YB 2VWEE 1QRKA 5IQ9B 3FOMB 3MFFA 2BNRE 3E0GA 5BZWA 3H42H 4N8PA 4ZNCD 5DUMH 4U6HA 4PJGB 4R0LB 5GGSY 2F74A 2X9XA 32C2A 2ZG2A 1CR9H 1DQDL 2BY0A 4C56E 1U8IA 4NT6A 3VWJB 2MKWA 3ARGC 1CT8B 4OUUA 4G43A 3MXVH 1BBJA 1DQJB 4JZNA 3MRCB 1H3WM 4WFGD 2Q20A 4WUUD 1JYVA 2NY5H 4OV5B 5FUCC 4XP6L 4JHWL 3T4YB 4EN3D 1B6DA 1EHLH 1CVRA 4FFVC 5C92A 15C8L 3VCLA 3HKFA 1RIVH 4K7FB 5C3LD 2I27N 1ZV5A 4FXGA 5C2UB 4WI9A 4AEIH 5ACZB 3QH3A 4KJYA 4JPKH 1AI1L 2VQ1B 5K59F 1OWRM 3VWKA 1J1XL 5F9JB 2DTMH 3FFDA 4PYHA 3QXDB 4X9FA 4XWOC 1I7UB 2B4CL 1VFBB 2QQLL 4P2RB 4ZS6D 3RAJL 2Y25A 3P77A 2NZIA 1EGJA 3UJJL 5GHWL 3BI9X 1D6VL 3F7RA 4Y8AA 1MFAH 2BCKA 4LNRA 4X99B 1R5VB 5CGTA 4QOKA 3WIHL 2YD4A 3SE8L 4GBXA 4LLUA 4K7PX 4WFEE 5CEXB 3MRDA 4G6KL 2KQMA 1YEFL 5FCSH 5TF1L 1H5BA 1NGPH 1NGZA 1PQZB 2DI7A 3RA7L 3V2AR 3QIUC 4I3SH 3KLDA 1ZT1A 3BPCA 2GJ6B 3F8UB 5JMOC 4XNZB 5TDOB 2WW8A 3AB0B 1UXWB 3LN9A 3MOAL 1J1OL 2HKFH 4KK5C 5EU5A 1CFVH 3HG1A 5DK3A 1EEUA 5MHSD 4ODHH 4QYOA 5A43C 4S10A 1NFDA 4ZXBB 2E8YA 3SPVB 3MJ8A 3GRWA 1MIEH 2OTWA 3PQYB 3LEYL 3T3PF 2P8MA 2E7MA 2DM7A 4U7MA 2H3NB 1BJ8A 1TETH 2ZUVA 1V7NH 1AY1L 2AJUL 1AO7A 1LO5B 3V7MA 3D0LB 5J89A 4BQBA 2VH5H 1S8DA 3B9KA 2YD8A 4JJHA 2V2XA 5E5MA 2BZDA 1PLGH 1EAPB 3L3GA 4WUUE 5FUOH 3UZEA 3F58H 3EO9H 4JDVA 1KLGB 5FV2A 4K55A 3B2VL 2F19L 1KIRA 5IKCA 4FFYL 1TZIB 2ZSVB 4M7ZC 1LDSA 3CSGA 4P23C 2VLKB 2I25N 3PQYD 2EC8A 4RFOL 5FAAA 4WHTB 4I18B 2I07B 2ADFL 2XWJB 4HGWB 4F7CA 2UYLB 3K2UH 4PS4H 5LCVL 3UTSD 1WFOA 5GISH 2XPGA 4ZAKC 3P9MB 4YK4C 2R4RL 5JW4R 3GSNL 4V2BA 1BVKA 2HP4A 3SDDA 3CFJB 3SKJH 1TTUA 1C16B 4K9EC 4Y4KB 4R8WL 1U8QB 4AQ1B 2G5BB 3TBVA 1K4CA 1EBAA 3NMEA 1LP9B 3I3EA 1NL0H 4NZUH 3QDMD 3I02A 2VLKD 3FCTA 1FZKB 1NEUA 3KXFB 1KN2H 3FT3A 4X5WA 1YQVL 2KH2B 2G60H 2APWA 4Y5XA 5AUMB 4TPRL 1ZS8A 4KJQC 3HPLA 1U41A 4IM8A 4HX1A 3WDIA 5FA3A 1KJVA 1CLYL 5FO8B 4E41D 5FA4B 3PHOB 4KU1A 3OB0K 5F6HJ 1WJ3A 4Y4KD 5MHSE 2XFXB 2X2YA 3D18A 3B8YA 5TFSL 4HAFA 2A73A 2CDEA 4XGZA 3WFBL 2EKSA 3CMGA 1HSBB 4HBCL 3TH3T 4CN6A 4PRHA 4YAQA 1Q72L 5BQ7B 3R8BB 2VRAA 3JV6A 4DN4L 3LPGA 5M94B 3NCJL 1B2WL 1CVSC 1IBGH 5IW6A 5FOBA 1IC5H 2BY2A 3JV4B 3WFHB 5INDA 3PGCB 3S34L 2Y72A 5D4QA 5IFHH 3VD7A 4BM7A 3MCKB 3WIFB 4FFZH 4S0TD 3PHSA 5JHLH 4HKJA 3SEPA 1R3IH 2HFEB 1WT5A 4OFKA 3ZKXC 1PEWA 1FFNB 3C8KA 2J6EA 2R0WL 3NFPA 3PQYE 3JWOC 1FNEB 3CPLA 4EUPG 4WY7L 4C58B 3STLB 2CLZA 4HIEA 4G8IB 1QBLH 1QRNB 3SGDH 2VZUA 4ODSL 2P5WB 5F7HA 1D5MA 3UBXG 3UTSE 3VH8A 1NCDH 1WICA 3CZJA 2EYTA 3TA3A 5FKAB 1CE6B 5EU6D 3INUL 3L9RA 1ZEAH 4OCYH 3IXAA 1X44A 4DGYL 5FGRA 4F7MA 5B3JE 1I7TB 4MQSB 3ULVL 4CADA 2YHGA 3KNBB 3QHZL 2AQ2A 5GS1A 4L1HA 2CK2A 1X4ZA 5FM5O 4LASL 5BRZA 2VZOA 4EIGB 3QDME 5EB9A 2VLKE 5D2LB 1RSFA 4X6CB 5F8RC 1FZOB 4NO2B 3HR6A 3EYSL 4GXUN 3OAYH 3T4AB 1Z9LA 1Q9LB 5CILH 1GIGL 4OGYL 5D6DC 1NSNH 3NZ8B 4HUUA 3UYOD 2OMNA 1F90H 3KPPA 1KB9J 2IQ9L 1I9JH 4E41E 2B2XL 3BVNB 3IJSB 1RI8A 4N0UA 4UIMB 5HJ3A 4I77H 4KK6D 4TNVK 1DFBL 1WZ1L 4P4RB 5DA0B 3S98A 5DJ0A 2W59A 5GRXG 1RUAL 1M1SA 3NA9L 2BVTA 5E8EA 4TUKH 1A1OB 4XPBH 1LP9E 5DD3L 4W4OA 3FQUB 5C6PB 3LQAH 1NGXA 1HDMA 2FD6H 1KJ2L 3EOAB 4HXBL 1G7QB 4WWID 5DFVC 4DW2L 4C55A 2P8LB 4U7KA 4JY6A 4XTRC 5BV7C 4KTEL 1ETZA 4MZ3A 2FBOJ 2VOTA 2VLLB 5SV4A 2AXFB 1J8KA 5T1DL 4S1DC 3IU4L 4HMCA 4QRPB 1IEAA 4JDTL 2CXGA 5JW4N 4NPYA 1WSST 2BOBA 4XAKD 1FLTX 2OTUA 1HH6A 5E2VH 1UCTA 1S9WA 4MS8D 3MV7B 4EEEA 1NJ9B 2R69L 2CKBA 3EYOA 3GIVB 1F4XH 4ZUSA 2OJZH 3KLAB 1CWVA 1X7QB 4QRSB 3UTTB 4XVJL 5GRJL 3VXMB 5EORH 5J6HB 4HMDA 2DLEA 3ZL4L 1SY6L 3RVTD 3CU7A 3FFCB 3LDBB 1VEMA 1TPXC 4U05A 3BXNB 3WS6C 5CJQH 2XN9B 5EU6E 1XGYH 4WEMB 1Z6JT 1PGRB 2EECA 1F3JA 5TDNB 5FKPA 2YA2A 4OQTH 4PJXA 1FP5A 2ARJA 3B5GA 1KTLB 1U3HA 4KVNH 4MXQC 1T5XA 4NWTH 3VXMD 2J88H 1LGVA 2R23A 3GSNB 4G8FA 2EIDA 3RGHA 1BJ1H 1GYAA 4NYLB 4J3VA 4PJAE 1S5IH 3UJTH 2P5WE 3PJSA 3EYQC 1NMCC 3BUYB 3FFCD 5I1KL 2OCFD 5MEQB 4H1LG 3QEGL 3ARBB 1G6RA 1MRCH 3WLBA 1IQWL 3DV4A 1OT1A 1QP1A 1FAIH 4OLWL 4BUGA 3TLRA 4OZGF 4HEPG 5BS0B 1JBJA 2P8PA 3M8OL 3LAFA 3E3QC 4HULB 1MJ7L 4GQPH 4PJ8B 5I71B 1TJGH 1ZVHA 2X4PA 3GMMA 5I30L 3MREA 4JHAL 4QRUB 4U6XB 5CMAA 5D2LE 3DTXB 1WFTA 1XCQB 5E00A 2V17L 3EIFA 4YE4L 3O6FB 5DJDB 2YS4A 1QFPA 3I75A 2X44D 4HWBA 1NCAH 3S5LG 3L3KB 4AG4L 3QA3B 4KTYA 1CL7L 2AJZA 3X14B 1GH7A 3EO0B 5KSUB 1FCCA 1K8DB 4OCXH 3NIDE 1UENA 2CIIA 5E2WL 3HC0A 3DVIA 1H8NA 3HE6B 2X4OB 3LOWA 4OZFH 1A3LL 3ZTJH 4XAKE 4I0PD 1MCCA 2YRPA 5HHPB 3GM0A 4R4FH 3SGKC 3GMOA 4EQ2A 3QJHA 1QLRB 4XNMB 1ZANH 3NIGE 4IMKC 4ZFFA 1MCPL 3H7BA 4GH7B 1VPOH 5ADPL 4OLUH 4KQ4H 3DRQB 3G6AA 3RWIB 3TC9A 1RIUH 2OR9L 5L2JB 4P4KA 3LHPH 3V0AC 5CWSA 2XI9A 3SQOL 2PUQT 4JRXA 5EZIH 3ZSTA 4X9GA 2EDBA 3ZLQC 1YY9C 2NW3B 4NO0B 3D3VB 4N1CA 1QPPA 4QRPE 3HE6D 2PR4L 2X40A 5L8JB 1G7MB 1T83A 2XWTA 1UM5H 5GSVB 3OG4B 4M1GH 2D7PA 3VFRA 3D0VA 3QFDB 2GKIA 5JIKA 3VXME 3MV8D 4K9EL 2SEBA 1OAXL 4MAYC 5GRVK 1IGIH 5I9QC 1QBBA 1YNKH 3A67H 3FFCE 4TN9A 1ZA6A 5EBWB 1SEQH 1YECH 2VISB 2XN9E 1ORQA 4BSVA 4DVBA 2P47B 1VFAA 3GSQA 3QG7H 3D3VD 2X70A 5D7JD 1N6VA 3IU3B 3LY6A 3BZFB 4PBWD 4BH7A 2F8VA 2DKUA 4TSCL 3MYJB 2XZCH 1EXUB 5DD1H 1A0QH 2CJUL 4JDZA 1NANI 5AYQA 2E7HA 3OKOB 1DE4A 1SEBA 1EFXB 3DMMB 4Y5VB 1HHKA 3MRHB 5FYKU 4ODTL 3ULVD 1E6OL 3BEWB 3OX8B 4B0MM 4N5UA 3IJYA 3MFGB 4PJGF 1T03H 3TBYA 5E8DH 3UO1L 2YKLH 3NIFE 2H8PB 4O5LH 4HFUH 4GAJL 1JN6A 1KJ2B 1VFOA 4HHAB 1ZLSH 4Y1AA 5CGYD 4L4TA 3TYGL 4FQCL 5IOPB 2LE9A 2DQEH 3B9VA 2X4SB 3H9SA 5CZXC 5CINH 1QSEA 4UQ3A 3RHWF 3WSQH 3FB6A 4JO3L 2DYPD 5CEYB 1DLHA 1IGYA 1MCKA 2E6QA 4NHUA 2VLRD 3DECA 3T0EA 1BF2A 1GPOL 3VXRA 1XF5A 2ICWA 1M05B 1LO4L 1JJUA 3ARGB 3JWOL 1OLZA 5J12B 4P9HC 3JWDH 1S7RB 3FT4B 2XIDA 1AIFB 2ZCHL 1MIML 5KVDH 3BT2L 4KFZC 3ARDD 1AFVL 1V05A 2H45A 4LSDA 4N1HB 4P3CL 1A6VH 1K85A 1OP5K 3BKJH 4HS8L 3S3PA 1KELL 3CDYA 3MV8E 3LSOA 3U9UA 5GGRB 4MXWH 3OJMB 2NMSA 1RZJC 4J3SA 4K23L 5EPMA 5TDPA 43CAA 5F7EL 1GVIA 1MWAL 5KANG 3OL2A 3SOBH 3WMSA 1JVKA 3VFMA 5DWUH 3D3VE 2G9HA 1OAUH 5LGJB 4NFDA 3IKCA 2F5BL 2KBGA 3IFNH 2WUBL 1G7JB 4OB5L 5GGSB 2H1PH 3KYKH 3CSYA 4RRPG 2FJGB 4PRIA 5KW9H 1CFNA 1F4WL 2HG5A 4QRQA 3F7QA 5I17A 1EERB 2YD3A 4R90H 5MENB 1ZK9A 4TRPH 3ULVE 1FNFA 3QIUB 1QG3A 2VL4A 4FQJH 4Z0XB 4NJAL 3IAGC 1X5AA 2CSPA 3Q2CA 3E6HB 4DQOH 3W9EB 4PJHA 1T0NA 1NUFA 4JZOA 2D31B 4JY4B 2LVCA 3O3DA 5BV7L 1SVZA 2ITCA 2YXFA 4Q9RL 4FNLH 4OZIE 2DQJH 4L8SA 3ARQA 4HGMA 1NC2A 3SJVB 1W72L 3QQ3B 3TP4A 4JO2L 1NGYA 3EDDA 4ONFL 4Q6IC 5DMKA 1SM3L 4YHPA 1ZHKA 3LKQB 3VW3H 2R2HA 1KIUA 4CDHA 4PRBA 5IV2A 4X98B 5EBGA 2OQJA 4EI6A 2UY6A 2VLRE 4K3JL 5E9DA 3UX9B 4ELMA 1AD9B 2WIIA 5LVEA 2ADGB 1MLBB 4KHXH 1BGXL 2IMMA 1F97A 4S2SA 5IHBA 1FDLH 5GGTA 1MCWW 3SKNB 5HVHC 3O11A 3VI4E 5C0GB 1FRGL 2BVPA 1KIPA 2GK0A 1J11A 3R8QA 5FYJL 4FQQB 3SJVD 3HI1A 4ZUUB 4P23B 5EOCH 4KMTH 3SDXA 1ZHNA 1OSPH 1RUQH 3VFVA 1LP9F 2WINA 1D9KB 5FHAL 3SDAD 4TULH 2D4FA 1YNLH 1JP5A 1MCOL 4YK4B 4OBRA 4OM0H 1H5BC 4MAUL 4JPVH 3EUUA 5EZJB 1F8TL 3RTQD 4B53A 4G42B 2VXVH 5GIRA 1MHCA 4CRPA 3LKPB 3QNZA 2PYEA 4J3WA 3OJDA 3BKYH 1AP2B 5DJZB 3MV9A 4PJCB 4ZTPH 1II4E 3WKML 1UZ6E 4YHYC 1I7ZA 1PKQB 3KR3H 1GC1C 2HWZH 1EVUA 4APQA 1BVZA 1D9KD 5DC0A 4WV1A 5E4EC 1AQKL 1YEHL 4R4BA 3U83A 4LKXA 3ABZA 4NDMA 2GK2A 4MXVF 5SX4I 3V6OC 3AS3A 3MUZ1 1CF8L 3GJEB 1CD1B 3B9KC 3PV6A 3MRRA 2BMKB 4NKMA 2ZKHH 4HWEH 1KYOK 3V95A 4KTDL 1S7WB 2VAAA 1CCZA 4OGAD 3HE7A 3BAEL 2X05A 4FMFA 1AR2A 2ZUQC 3GIZH 1P5VA 4GMSL 1EO8H 1CU4H 4GG6B 3BPLC 4DJMA 2CMRL 4ZO6A 1X4XA 1F4YH 2XV6B 4PRPD 3D69B 1MHPL 3P0YL 3U2SA 3C5JB 5DJAB 4LARL 4LPYA 1JGEA 4L9LA 1FYHB 3TH4T 3U82B 3NACH 2JE8A 4P5KB 2WMPA 5I1JH 1NGWB 3CCHA 4LOUD 5CZVH 4PJBB 1G7IB 1BD2D 1YMHA 3SJVE 3U7YL 4XWGL 3ZKXB 5EFIB 3SDDC 2Y6SD 4F58L 3WFCL 1YJDL 1CGWA 5E99H 3UTQB 4YHOH 3FN0L 4JFOA 5D70H 3X13B 3NFNA 5D2LF 4QRRD 4LFHD 1MCSA 4L8CB 4ZPTB 4X6CF 4MQ7B 4PTUB 3QUZA 3RL1B 4ZFZA 1RMFL 4TQEH 4XRCB 5FIEA 3HZMA 4LDEB 4MA8H 1T7YA 5I18L 3HA0A 1F11B 1HEZB 1Q9KB 4HQQH 1ZT7B 5BZDB 1M71B 3Q6FA 3KYNA 4XCCH 3KPRA 1VKXB 4O51A 1MWAB 3PGFH 5AYUL 3JTSB 2A6IA 5L8LB 1U95B 3QCTL 5FOJA 1SJVA 4ELKB 4BK4A 2FWOB 4P3DA 3NIGF 1A7QL 1T2JA 1FNSH 3BZEA 2YPLB 4G7VH 4AENB 1MFDL 5FGCE 1IAIH 8FABB 1TNMA 4PJCE 1I1YA 1VA9A 5CBAA 4BSWB 1T4KB 1PKQE 4KROB 1INDH 4HC1L 2DQGL 4EDWH 4BKLB 4MCYA 2FBJH 5LBSH 2FX9H 2FH8A 4XP9L 4HBQA 1WT5C 3IDNB 4AM0B 1N7ML 3U0TB 3RZCD 2EYSA 1I9IL 5T5FL 4PRPE 3ZKMC 4DWHA 5BV7B 5DQJB 1QVOB 3WE6B 3MLYL 4WWKA 4H0HB 1XFPA 2Y06H 5D8JL 1NMBH 3U9PH 1W72B 4MNQA 3MGOA 2YPLD 1C08A 1FZMB 2EDFA 4G8GD 2HTKD 1VGEL 1Z3GH 4X7SL 1QFWM 5CSGA 4LSRH 3RVUC 4DFHA 1BD2E 1QEWB 1R5WA 3FRUB 4JFFD 4OLYH 5FF6A 4P9HL 1DUYB 3CGTA 1SBSH 1HNFA 4HD9A 4KROD 4KKCC 5GS1C 3VDCA 3LKRB 4HG4J 3HZKA 4GG6E 3QUXD 2WSKA 2X1QA 4PR5A 3RUGE 1ZOXA 3C87A 4F57H 3WDJA 5FM5M 3UYRH 5ID0A 3FQNB 1GGCH 3QEUA 1P7KA 1U6AL 2ENYA 3LN5B 5IFJA 4QGTA 1MQKL 2VLJB 3HNSH 3RWCA 4DCQA 3RL2B 2DAVA 5HD8C 2C1PB 3QZWG 4NP4L 1GZPB 2HT2D 1ADQA 1UKTA 3DX7A 3KYOA 4OD1L 1BP3B 3MJ9H 5C86A 4MZ2A 5IB2A 1RZKH 4HKXA 3SKOA 3EFFB 5B39A 1YDPA 3IDXL 4BFIA 1NMCB 1WIPA 4CVUA 5D93C 3MO1B 3KJ6H 2E9BA 3S6CA 3HB3D 4NQCB 2FX7H 5HDBE 4C57C 4NBZB 3DGGA 1QSFA 2CQVA 5DR5L 1CG9A 4EQ3A 5K9QG 2E9IA 4NZRL 1B4RA 1MRDL 5ESAA 4JFDB 1A1NB 1QPXA 1IFHH 2JJUA 4PTTB 1I3RB 5IT2L 5IMOA 1G7PA 4P59H 2OK0H 2FX8H 5BW7C 5IHUL 4ZSOA 4DOHB 3WV0A 4WJ5B 5ACMA 1HIML 1JGUL 4GKNA 1NBQA 1LNUA 1S7TA 2I9LB 1ZGLP 3S96A 1XH3A 4R4NC 2A6JB 4X7TA 3EFDH 4G6MH 4UINL 1UACH 5AWNH 1CZ8L 4UUJA 2YPLE 1BFVH 4G8GE 3OKEB 4M7LT 3LIZL 5JZ7C 3B9DA 3FB7B 4JFFE 1TIUA 4KY1L 3BKCH 4LKCB 4JFDD 2J8UE 3BP5A 5IEKA 1FPTL 4LHUA 4M93C 5CP7B 1FZJB 4LSVH 1BLNB 4M5YL 1CD0A 5F3BA 3QB7C 4YQXH 3V5HB 1B4JL 1YEIL 3U4AA 1U3HC 5I0DA 4LVNC 1IZKA 3DSFH 1P6FA 3VFSB 1XF3B 1HHGA 5B38G 5J1AA 4HDIB 2IFGA 1SBBA 1P53A 4OZHB 5IROA 4JFXA 4OD2A 4RMSA 1SYVB 4FRWA 3QDJB 4C83A 3QFJA 4JFYA 3K1KC 2PTVA 4XXDA 2NNAB 1F4AA 1CDIA 5D1QA 3DETC 2CRZA 2RAMA 3STZB 2X4UB 5T3ZL 4CJ1A 3HAEB 1J8HA 2VAJA 4JVPA 1K3IA 3DBXB 4DGVH 4PY7A 5HHOA 5DVMA 4PP2A 3TBTB 1UH3A 1XZ0B 5CFHA 1CDBA 4KJWD 2VLJE 2ZSWB 5GJSH 3L3OB 2VDRL 1RUKH 1U8JA 2BRRH 3QUMA 1NC4D 2AEQH 3CC5A 2QQKL 4NNYA 3JUZA 4PJFB 1QO3A 1OGTA 2MKLC 1S9YA 3VI4F 1ZA3B 1WBYA 4POYA 3MLWH 5AD0B 2KPNA 3N1MC 3WBDA 4M8QB 4NM4L 4H0IA 4WDIA 2ZNWA 3U0WH 2CLVB 5F8QC 3WKNA 3BP7B 5C6WH 1I8KB 4JFZL 1X6LA 4Z7UF 3O4LB 4X6FB 1HINH 4O58H 3C60A 2GUOA 3O6LH 2X4TA 2C3HA 2JELH 2F53A 2VR9A 4P5MB 2C7UA 5E8PB 3K7UA 4P4KC 3VFGH 3V52L 3X11B 2OX5A 3N50A 2CDFB 2HVKB 4J2XA 4JFDE 1QBAA 1KV3A 4N0YH 3L7EB 3BW9A 4I48B 4HWUA 3QXAB 4L4VA 1Z9OA 3RPKA 4DOHE 1MI5A 4LSSL 2GCYB 4YGVB 4JFEB 4K71C 3MLPA 3IAPA 1UCBH 5F3HA 4EI5A 1HWGB 4CU7A 4MD4B 1RK0A 3O4LD 3FB5B 3FOLB 3S37H 3UMTA 1DUZB 2FATH 4O2EB 1NDMB 3EJJX 2FNBA 1Q94B 2BJMH 3MXWL 1XF2B 3S3SA 3KPSA 1ZTXH 2P5EB 1IKFH 5LWYL 4M6ML 1S5HB 1FFPB 4IMLA 1N6UA 4FQHA 1KIQA 3IDYC 2OP4L 2H2SD 2QADD 4G6AD 2R56H 2PTTB 1MLCA 1E4XI 1E4KC 3QPXL 3B2UC 1FJ1B 4F33A 4FQIL 3QDAA 1J05B 3B6SA 4ZUTB 3TT1H 4XMLH 4LLQA 5CZKA 2C3GA 2HT4C 5EZLB 4H20H 5BVJB 3DX6A 2WBJC 3GB7B 1F6LL 3IDJB 1K4DA 4D9LH 1OSZB 3O9WD 3QIWB 1QOKA 5IMKA 4GSDH 3V4UH 2ESVD 4WUKL 4OZHE 1AQDB 4U6VL 4Z95L 5KVGL 3H7LA 3RKDC 3BZ4A 1PYWB 2V7NB 3QDJE 1SJXA 3ZYZA 1V3KA 4MJ6A 1FO0A 1U42A 4XPGL 4JHZA 3EYFB 4KXZH 1T21B 3PIQB 4JFPA 5C9JB 1KCVL 3HUJB 4JM2C 5D96C 1VEOA 4XZUB 5H37H 3CH8A 5I66A 5DUBA 4ZQKB 5CSZA 4XPAH 1ORSA 32C2B 3EOBA 3DHJA 3QIWD 1M7XA 5B4MD 1RURL 4X5XB 5HYJB 1KPVA 2XYCA 4G43B 2R2EA 4ZS7H 4WW1A 4YUEL 1JPSH 1S7QB 4IOIB 2P7TA 5DRWB 1DQML 1IGCL 1KJMB 4Q6IB 2V5RA 1BAFH 3PABB 1HE7A 2FEDD 1T7VA 2XG4A 3GNMH 1JTOA 4FG6C 3WEXA 5F7NC 1KF9B 3IFOB 4K07A 5D6CA 2XRAL 3FO9B 3O4LE 4TTDD 5FGBA 3MCLL 4FXGB 4YBLC 3RWDB 1X5IA 1QFHA 3TYFA 2R0LH 1B6UA 5HVHB 2DDQL 2GTZB 1NUGA 2M8XA 2OR8A 4UV4H 2UVEA 4G3YL 4J1UB 3A6BH 5DMJB 2DI9A 5D1XC 1LD9B 5I8KL 1TTGA 4FQLL 3LS4H 4JZJC 1N59B 2BCKB 4L29B 4PJCF 4Q6YA 1W0VA 4XPTH 5KG9A 3KGRA 2HYMA 5TF0A 3EOTH 4LLUB 4IHOB 5E1HB 3OSKA 1Z5LB 2JB5H 5HYIA 1BFOA 5GXBB 2MPAH 1NGZB 3AREC 1YEDB 43C9A 2ZCLL 1R3JB 2IBGA 1U8OA 3SDYL 2APXA 2ESVE 2P5EE 5F7DB 2E7BA 3G5XA 3HMXA 2Z91A 1N26A 5DGQA 5EU5B 4FABH 4YHYB 5JTWA 4WO4A 1MSPA 1LMKA 5H37G 2A1WH 3IETA 4HK0B 3ARFD 1FNLA 1DLFL 3VFWB 3CSPA 3W9DA 2FL5B 3MJ8B 2EC9T 1OCWL 5J56B 3HNVL 4N90D 4X9HA 1ACYH 1LILA 5E4EB 4GG6F 2MSPA 5BXFA 2VDPH 3OPZH 5EG6C 4KDTA 3B83A 4KRPC 4LFHG 2IG2H 3C6LD 4UT9H 3B9KB 5I16B 1BX2B 4OFIA 3GJFB 4ZMAT 1H8OA 3HFML 3G5VB 1Y0LA 1KBGL 2HJLB 1U8NB 2NXZC 3L3GB 4EUPA 1AKJD 2DLFH 1GAFH 4NM8L 2ZUQB 4PJBF 4U1LB 2CGRH 3UBXA 2DN7A 3BPLB 3TPUA 3HUJE 4Q7DA 4YPGA 3VD9A 2Y7QA 4RMQA 4JFQA 5C0RL 5DT1L 2DLHA 5C71A 3QWOA 4JLRA 4LU5H 3GKZA 4J4PD 2FEEL 2IMNA 2DQDH 4EVNB 2YSSA 5HYJE 3F12A 3ZO0A 4HS3B 3FAXA 1NBVH 4GXVH 3TCLB 5T1KA 1GGBH 1IKNA 2EYRB 1Q38A 1OAYH 1NKRA 2R9HC 3G6JE 3KPNA 1R5IB 3LQMA 4ORGB 1FHGA 1BQLL 3QRFM 4R97C 3K46A 4WW2A 4BZ2L 3RY6A 5FUZL 5A3ID 1KPUB 4JQVA 5HI5D 1MEXL 5E4IA 3HPLB 5C8JA 2AP2A 1HOCA 1TXKA 4MYWB 4F37K 4K7PY 5FA3B 4Y4HD 1IM9B 5IF0B 2Q6WA 1PFCA 3QO0A 4HWBL 5ELIA 4NSKA 4CNIB 2R0ZL 5I2IA 1S7XB 3IGAB 1RIHL 35C8L 4HUXA 5EH1A 2NY3B 2VXQH 5C3TA 1EUUA 4X6EB 4XGZB 3ME0A 5HGAB 1LO2L 4YBQD 1JHTA 4G6JL 3NCEB 1JHLH 5D2NB 4N90E 5HBBA 1MCBA 4FZEL 3MRJA 1U58A 2DIJA 4L9DA 4OM1H 5H35A 3MOBL 5CKGA 2EE3A 1PEZA 5HPMA 1WK0A 2VDQL 1CK0H 5T33H 3MRFB 4L9LC 5INDB 5L88H 5TE6L 1NEZB 3FQTB 4KK9C 1JPTH 1XGQA 3LV3A 4U1SB 1E4WL 1NBYA 2NY3D 4HUNB 1H15A 1RZGB 3PWPA 5F7LB 4PBXA 3W2DH 1GSMA 4A6YL 3C8KB 1MHHA 5DSCA 3TV3L 4P3WA 4M48H 2FLRT 2B1HH 2NY0B 4MD5A 2O5YH 1NLBH 4WU5A 1JYNA 4NNPH 1KJ3H 4ODXA 4NFCA 5I74B 4DFIA 2HFGL 4IRSC 4F7PB 4FQXD 3DROA 4NOFA 3QUZC 5ESVB 4XT1C 5DUPL 3THML 5F6IC 1N64H 3L9RB 1BM3L 5I8OH 4M1CD 1HH9B 4XH2A 4OV6F 4XBEL 4CADB 4JRYA 4RGMB 5GS1B 3ZMRA 2PW1B 1EJOL 1G9MC 3HZYA 5JW3H 4H1LA 4EOWH 2BNRA 2ORBH 2N56A 2AEPH 3ZKND 4OFYD 1TNNA 1D5ZA 3MLXH 5AZ2L 4NCC2 3CVHH 3R1GH 2NY0D 2ZUUA 4NZJA 5JDSA 3ZHDA 4I13B 4C56A 4G8EB 4FQ2H 3V5KB 2OZ4L 1OPGH 1CLOH 5GGUA 3SGEH 2CR3A 3SE3C 1TTFA 3C6SA 3O6MH 4Z5RA 3CVIH 3IAQA 1KPRB 4N0UB 2VLMD 3L3HA 4LGRB 3IFLH 3S5LA 4PB0H 1NAKL 1CD8A 4YZFE 1XGRB 4HIXL 1I4FA 3GSUA 4Q0XH 5IVNA 5GJTL 3FB8A 1FYTB 5D93B 1NGXB 3GKWL 3NZHL 4NUGL 1PX4A 3HNTH 5DS8B 3WS3B 1UADC 4IRZL 4JGJA 4NJ9L 3DIFA 1EFQA 1JCKA 3LRSA 2AV1A 4XB7A 5DF0A 4U1HB 3T77A 2DKSA 3V5DB 5HD8D 3F7VB 3WIIH 1IAMA 2EC9U 5F7FA 1LEKA 2YA1A 1YN7B 4Y0GA 5C6TL 1CLCA 2OTUB 2Y9RT 4KI5D 4HAGA 2B5IC 3WDHA 1WWBX 3EHBC 3UDWA 5D2NE 2VIRB 4PLNC 5HDOA 4G9FB 1FYTD 4FOMA 4YFLI 2IAND 4MWFB 1RUPL 1KB5L 2DRUA 2MJWA 3EO1A 3IB4A 4D2NA 1BZ9A 1KTKE 4EBQL 2YK1H 2LQRA 2WWMD 3MRQA 1KTRL 2Z35A 4Y2OA 3OR6A 1YYMH 1FIGH 1Q0YH 4OTXL 4ISVA 2WM0A 2NLJA 3MLZL 3KLSA 1ZLVK 4AIZA 4OKVB 5HY9B 2CUMA 4UTAH 1LO0H 1F3JB 4M93B 4N0CD 1NFIA 5JMRA 5D5ME 4PJXB 2FIKB 4TUOA 4HLJA 4NO5A 2UV3A 4GKSA 3I3DA 1U3HB 2HN7A 4GLRH 4LVNB 2VDKL 2IFFL 3IDMA 1O5DT 3HR5A 2JJSA 3G6DH 3PJSB 3HAEG 1PY4A 2BFVL 1G6RB 1CGSL 4R96B 4F2MA 1UA6H 1EDQA 5E94B 5BO1H 2VLME 1A6AA 3DURA 1INQA 3VGFA 4X4YA 1NH6A 4R7NB 3BN3B 5IQ9A 1PG7W 3TN0D 1KN4L 1BF8A 1T6WA 1M4KA 2BX5A 3CFDB 4GJTB 4PJFF 3MRBB 5GS2D 4Y88A 4NQDD 1I3GH 4PJGA 1JZ6A 5E2JA 3HC3H 1AGCB 3CDFA 1IC7H 3NPSB 1FLRH 2GY7B 3VWJA 1CT8A 4M3KB 4GRLD 5EU7C 1DDHB 3QDGB 1A14L 1JGVH 4OV5A 2Q1EA 1MF2H 4W6XB 3HC0B 4CVXB 2YD7A 5I76B 2JCCE 3UZVB 1CFSA 4ERSH 4MJID 2KUTA 4TOYL 3P4LA 2Z8VC 4KI5E 4K7FA 3L5JA 5E7BA 3GMOB 3QJHB 1T6VN 1FYTE 3RIAK 2IADB 5I19H 3UBXI 5KAQG 5ACZA 1MPAL 1CIUA 2IANE 1HZHL 2BXZA 2VQ1A 3C09C 4ZFFB 5IB1B 4MA1C 5F9JA 3QXDA 3NABL 4LPCA 1I7UA 4P2RA 1VFBA 4D0BB 4K94H 1QUNA 5MP6H 5DD0H 1A9EA 3GSOB 4XP5L 4X99A 1GXEA 2XTJC 4HWZB 2F54B 4M43L 4D8PB 1FGVH 3V7AG 2XWTB 1KGCE 5CEXA 3E8UH 3RIFF 4XCEB 4K71B 3FHQA 1PQZA 3VXUB 5DQDH 3U36A 4HCRA 4DUWA 2H32A 2GJ6A 2XG5A 5ICYB 3MLSL 3QHTC 2EE9A 5E8OB 3RX7A 1UXWA 1FFOA 4S1RH 1ZA6B 2RCSH 4M9PA 4GQ9H 3BKML 3P0VH 4RRPA 1JFQH 5BCAA 5IB4B 2X70B 1OP3K 5J3HC 4ZXBA 4XHQA 3OB8A 4QHUB 2BY1A 4NQTA 3IDYB 2NY4C 3PQYA 2B1AH 3F6IA 2EXYC 2JLLA 3GBMH 4NQDE 1A6WL 1A7NL 3L1OL 4FMKA 5DYOB 3VXUD 4JDZB 2H3NA 5HHMB 4MB5A 3UTSA 1LO5A 3CMOH 3GSVB 1UGNA 3X3GH 3HUJF 2WBJB 3NFSL 4OT1H 2IGFL 5JUEL 1JWMA 4WEBH 3IJYB 5D71H 3C60C 1KLGA 2VXTH 4HIHA 3BP6B 2DQCL 1TZIA 2ZSVA 4MJIE 1F13A 4HUMB 4Y1AB 2VLKA 5K9JH 4Z8FL 4WHTA 4Y19B 4I18A 2I07A 3H9SB 2F8OA 2VITB 3DYPA 4JM2B 5D96B 3GBNH 5DI8B 2XWJA 4DKEH 1N5YH 4UQ3B 2UYLA 5E2UH 2C9AA 1T2QH 1MFBH 2PXYD 5A16B 1JL8A 4NKIL 2VZTA 5BVPL 4E41A 2DI8A 2P43B 1SMOA 4URTB 4EI5C 1RY7B 3TIEB 5C0DB 3CFJA 4Y4KA 4HK3J 3MUGA 1U8QA 3OJVC 2E3VA 3T0WA 4BELD 1OD7A 1LP9A 1UH4A 1FZKA 2A2QT 1KB5B 1U2CA 3WUZA 4Y19D 3BDXA 4GW4A 4LLYB 1A8JH 1H3UA 3OMZA 4I3GA 3WN5B 3WL9A 3MRLB 5AUMA 3CLEL 5SWQA 3SKMB 2H2PC 1G9ML 4L3CB 2BSRB 3TJEL 5DDHB 3QPQC 4YBLB 5EPMB 5FO8A 2YMXL 5KBNC 1RZFL 5FA4A 3OAUH 3OZ9L 4XP6H 1E4XL 3PHOA 3ZE2E 2XA8L 2XFXA 3UROR 1DVFC 4Y7MA 5DRZB 3O45A 2F58H 4FQ1L 1HSBA 1MREL 4KUCD 5D1XB 1TZHB 4JZJB 3D9AL 2EIBA 4YHLH 5BQ7A 2BERA 1NPUA 1WVZA 2IPKB 3VXUE 4GAGH 4KZEH 2HG5B 3MC0A 1NFDF 5IW1B 5I17B 1MELA 2NY5C 1T7WA 3JV4A 3AREB 3WFHA 5M7QA 3C08H 4GW1B 4KI1A 3TT3L 4Q58C 3MCKA 4K8RH 3RZWA 3QG6B 3CDCA 4PJHB 5KSVB 2X9YA 1IGTB 1U8MB 1OTTD 2HFEA 1E6JH 1PDKA 2PETA 4ALAH 4LRIA 5KZCB 1FFNA 3QEQB 4OF0A 4LRNL 3GHBL 1G0XA 1FNEA 4NN7C 1NQBA 2YD6A 3STLA 1URLA 4G8IA 1QRNA 4PJAA 4YHPB 4PP1C 2P5WA 2R2HB 4F15C 1J1OH 4M7KL 5JDJA 4EI6B 1FQ9C 5GGVL 4Z7WE 2JJTA 4KRPB 5FKAA 5BMFL 4MSWB 3F62A 1RZ7H 2HMID 1X5ZA 2FGZA 1JZ5A 1TCRB 2ZOKB 3KNBA 4AMKH 3GK8H 2NXZB 4YHZH 3ARSA 4XNQB 2NY2B 3TESA 3X12A 2BVPB 2VR4A 2UUDH 5D2LA 3CAFA 4MVBC 3K1DA 2XY2A 2DQIL 4Y19E 5AEAA 1FZOA 1WWWX 4NO2A 3SDXB 3T4AA 4HWNA 2EXWD 4YZFF 1JIBA 3NZ8A 2WINB 4BFBD 4KPHL 2YC1B 25C8L 5DO2D 3BVNA 3WIHA 4UIMA 2F19H 3EDEA 3RQ3A 5DHVH 1JRHI 4KGLA 3ZDZF 5D1ZD 4P4RA 3EGSB 3GMRB 5HI4D 2LV4A 1A1OA 1YEEH 2NY2D 4RFOH 1LVEA 4PV9B 4U2ZA 3KVQA 5JA8B 3O2WH 1J0KA 3D2UB 3QNXB 2QSQA 3MODH 3S9DB 1I7ZB 3EOAA 1G7QA 2AGJL 3VD5A 3QJFB 4OUOA 1BQHG 4MGXA 5F70A 4KJPD 4Q2ZB 2P8LA 2FO4B 4JFHD 1KNOB 4R97B 1HHHB 2AXHA 1OTSC 4P2CG 4Y89A 3SQBA 1PAMA 1UC6A 2AXFA 4QHNA 2HRPL 4NDMB 1J87A 3U1SH 4QRPA 3V8CA 3HPJB 1CICD 3L6FB 4WTXA 3RVWD 3MV7A 1NJ9A 3GIVA 3MRRB 4YDJB 2FZ3B 2UUDK 3RY5A 4QRSA 3KLAA 4HKZA 3UTTA 1IC4H 2VAAB 3VXMA 5J6HA 1BQUA 3P73A 4I0KA 4QXUL 1PZ5B 2I24N 4K2UL 3FFCA 2X89A 2Y4SA 3GI9H 2VC2L 2DQTL 1JHKL 4LLWB 1VHPA 3BXNA 3DXAB 2XN9A 1CYGA 1L7IH 5TPWL 5TFSH 3ZT7A 3WFBH 2DQUH 3MGAA 1HYSD 5F21B 5HDLA 4PRAA 4L9LB 5TDNA 3EAKA 1J0YA 2VN4A 1XR9B 4PRDB 2ZJSL 1EVTC 4XVUC 5ITFA 2P42B 3QEQE 4DN3H 3QIBB 4MQXC 4EIZC 1F58L 4KUZH 3VGBA 1KTLA 2DICA 1FFRA 2BHUA 3GSNA 4P2QB 3S3JA 4ZTOL 4NYLA 1LO3H 2OLDA 4AQOA 4MNGB 1X5KA 3BUYA 4UOJA 5MEQA 5FYJU 3ARBA 5KANI 1PG7L 4O02L 1RHHA 4JAMB 3QZWA 4IRSB 4M6NH 2W9EL 3LPWA 3QUZB 3RX8A 1O7SA 4WW2C 4KC3B 3RY6C 1QFWI 4PJ8A 2ED8A 4PUBH 4U2YA 1JPGB 5EU3B 2DM2A 1A5FL 3MRPB 4U6XA 2QEJA 3FO1A 3QIBD 2YN5A 5KJRL 3O6FA 5DJDA 3KYNB 3KPRB 3L3KA 4O51B 2NY7H 4TSAL 3QA3A 4JFHE 3VGAC 3UC0L 2EZ0C 3C2AL 3X14A 3EO0A 1K8DA 1RUMH 3Q1SH 4ZUWB 5AG9A 2VQUA 3HE6A 2X4OA 1WITA 2CKNA 3OAZH 5HHPA 1CTOA 5LKNA 4ZPVA 4M03A 3EYUH 2XKUA 4BZ1L 4YHMH 4RISL 2V6HA 1QLRA 4XNMA 3S88L 2ZG1A 1U91A 1I7RB 3BSZH 4MCYB 5KSAD 3ROLA 3DRQA 3C5ZB 3RWIA 3VU2A 1FNGB 2EYSB 5L2JA 4PGCA 4NWUH 3CX2A 4RBPK 3BP4B 3LEVL 1JZ2A 4NIKB 4HH9B 2IH1B 3MLRL 5CBEB 3D3VA 5DTFB 2CIKB 5FXCH 1RJLB 3WXVH 2B20A 1UQSB 3EYVB 1G7MA 5J8OA 1IARB 2CUHA 3VMOA 4HF5L 4W6YB 5FHBL 1QNZH 2B5IB 3VI3E 5J11B 3FO2B 2DQHH 3O2DH 3FRPG 2VWEC 3CU1A 5B38A 3ZDXE 4PJXF 4WNQB 1FVDB 3P11H 3C5ZD 4PR5B 5IUSA 5T1DH 2BSED 2VISA 3S7GA 4OIAA 3RWFB 4OLXL 4BUHA 1V7ML 4KMQA 1TJHH 3S36H 5ID0B 1NAMH 4F7TA 2AERT 3QEUB 2OL3H 3L5XH 3IU3A 2D7NA 5I15H 3BZFA 3MA9L 4JQXC 3RWCB 4D94A 4OZIA 5GRJH 4DAGH 3AU1A 3MYJA 1DZBA 4PREB 1EXUA 1SY6H 3H42L 4CMMB 3OKOA 3DMMA 4LDLB 3CFEB 4RAUB 1BZQK 4MNGE 3GZKA 4HKXB 1L6XA 1CR9L 3OX8A 1NGQH 1YDPB 4QHKI 5I1GL 2AJ3B 1TFHA 4R3SB 5LAXB 1FO0L 3MXVL 2H8PA 4XPHH 4LK4A 1LE5B 2NY5L 3VXSB 2ZUYA 4NRYA 4C4KT 1KJ2A 4HHAA 1EHLL 3QEHB 1CE1H 5IOPA 3OKLB 2RB8A 5ETUA 5LQBH 1RIVL 5ESAB 1MJ8H 3QEGH 3CLFH 1JYWA 1ZE3C 3D85B 5CEYA 3SBWA 5IMOB 1G7PB 1F4HA 3K4AA 5E08H 3DO7A 3RU8H 1M05A 3UPCA 3DX9B 1AR1D 1AGFB 4GKNB 1SQ2N 3ARGA 1MJ7H 4YHIB 1S7RA 3FT4A 5I30H 1XH3B 2J8HA 1AIFA 1A6PA 3PNWB 3K0WA 4XP1H 3H3KA 3QRGH 1MFAL 2EH7H 1SY6A 2GAZB 3AXLA 5IHLB 2QHLA 2IAMC 1RFDL 2ATKB 4H25B 4MJ4A 5GGRA 1MFCL 4V2CB 2YUVA 4LCIH 4JVUA 5CKAA 4PG2A 4I3SL 1CXFA 3C09B 4MA1B 4W70A 5C0AD 5ENWB 3TF7C 1F5WA 1I1FB 5JHDD 3I6GB 2XICA 1EEQA 1YEGH 2HKFL 2OJEB 5LGJA 1IQDB 3AS0A 5L9DH 2VO5A 4O2CB 5J1AB 4ODHL 1G7JA 4JCMA 5GGSA 2XTJB 5JORB 2FJGA 5DJ6B 4CJ0A 5ADPH 4EN3C 2ZPKL 3ES6B 3FZUD 3ZE0F 3SQOH 1KLFA 1TETL 1V7NL 3RJDA 3E6HA 2VH5L 1Q9OB 3W9EA 4R26H 4JE4B