3HA0A

Crystal structure of the ige-fc3-4 domains
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
209
structure length
209
Chain Sequence
VSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVQLTWSRASGKPVQHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conformational flexibility in immunoglobulin E-Fc 3-4 revealed in multiple crystal forms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Ig epsilon chain C region
total genus 38
structure length 209
sequence length 209
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ha0A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ha0A02
1TCRA 4JFQB 1HKLL 3ZKQD 3K7UA 1AGCA 3HI5L 3CPLB 3AREB 1EK3A 3TYGL 5CJ5A 3QYCA 3QJFB 2HTLC 3RZCA 1G84A 1XF4A 5FCSH 5ENWB 3FO0H 1U8JB 1CGVA 2IJ0C 2XTJD 3X3FH 4GRMA 1JGUL 3LMJL 4KMQA 2R9HC 2BHYA 2NY1B 1A14H 3LEVL 4P2RE 1IGIL 5GRZA 1INEH 4RAVB 4XZUA 5J6HA 1UFUA 3E6HB 3O3UN 5EORL 3K2UL 4PJAE 3VGBA 2P5EA 5HHOD 4J4PA 1HQ4A 1INEL 4XTRD 4PB9H 3D39A 1BIIA 5IW3A 5FA4B 2WAHA 3RWIB 2E7BA 2A6KA 3WFEL 4YHKL 3CNKA 5K9JL 1U8QA 2I9LB 1KPUA 5I19H 3GHEL 3BKJL 1JNLL 1NCAL 1TPXC 4KY1H 5LQBH 3UBXA 3HAEA 4JHZA 1CBVH 2JJTA 2CD0A 4YFLI 5EC2A 3U9PH 1JNLH 5DYOA 3QULA 3T0EB 4ZNEE 1BD2A 3VXUA 3BUYB 2A6IA 1M05A 2FB4H 5JXED 2R4SL 2CK0L 1A1MB 4R7NA 4D9RD 3OXRB 5D7KE 2PW1B 3UTTA 4HJGB 1RVFL 1D5IH 1MWAB 5DHXB 5TGBB 2XRAH 3EDFA 4O4YH 4M8VA 1T22B 3H6JA 3MJ8B 1YNKH 3C6LA 4RMRA 4G8GD 4NM4L 2R1XA 2C3HA 4LPVA 1NUDA 2BNRB 1NJ9A 4PRIB 4QHNB 1AI1L 3L5XH 4DN4L 1MRFL 3FRUA 3O6FB 4HUUA 3B9DA 1CFTA 2EDHA 2W07A 1NC4B 5CEYA 2OJEA 1DBKH 4ESKA 5IW6A 5SWQA 4NO0A 3WS3B 3FAXA 3IRPX 1T0MA 4POZC 4Z7NF 3PWPE 1JHTA 35C8L 3I6LD 2L7UA 1AJ7H 2N56A 3FN9A 2YMXH 2Z8WC 3H7BB 4OD2A 4Z7OE 2BNQA 1Q1JL 2NY4D 2A0LD 4X5XA 1G6VK 1PLGH 2YK1H 5B38G 3PIQB 1BF8A 4YAQA 3OHXB 5BV7H 2ICWA 1MELA 4O2FA 5I0DA 3Q3GA 2FATL 3UTPE 1XF3B 2AXGA 2D0GA 5GISH 4JFEA 2EE2A 4NO0D 4CNIB 1OSPL 9CGTA 5BV7L 5C07B 1ZGLA 1C5BH 1G9NL 1R3KB 5JO5B 3IFPB 3BEWA 4AIZB 4J3UA 3M45A 1T80A 4P99A 1RHHB 4JQIH 4P3CH 5HVHC 4QOKE 3TT3H 4OCYH 2YXMA 3SDCD 5JOFA 1KCSL 4YWGH 1TJGL 5CWSB 4N68A 3A6BL 4DUWA 5D1QB 1FNSL 4HC1A 4ZO6A 4OSUH 1MJUL 4F3FB 2V9QA 2IG2L 5DEGA 5GGTA 3A6BH 3HS0B 1MIMH 4NNXA 4CW1B 3ZT5A 1JK8A 1GCFA 3HCVB 1IT9L 1DVFD 4JCMA 3KXFA 2I27N 1NMCB 4M5YH 5ID1A 4LSTH 1NEZG 4L4VD 1OQXA 1WFUA 2WINB 3PABA 5L0QC 3VE0B 2CIIA 2GT9A 3BE1H 3CSBA 4P2OB 5IUSA 4KV5E 3VD9A 1DVFC 3MR9B 4DZBB 2Z8SA 1Z6JT 1ZTXL 3BT2L 1BD2D 4EUPH 5JIIA 3G6JA 4HGWB 2VWEE 4F7TA 2ERJB 5L6YL 1Z2KA 2EE9A 2O26U 2GK0A 4I5BB 1J0JA 5EZJA 4HGWA 1MF2L 4Y89A 5E56A 3TCLB 5IF0A 2PN5A 5D70L 4R2GB 4OKVA 1RURH 3S35X 1RULH 3KPRB 3MV8A 4IRJC 3TCLA 4FQXA 1CICA 3NPSB 2QSTA 1E27A 4LLUB 1V7MH 1FIGL 2FBOJ 3ZE2F 1I1FA 4M7LL 3RPKA 2PO6B 5KSBB 1FGNH 4PJ7E 3V6ZA 4MGXA 5MEPB 3MFGB 4I0PD 4LLAA 5GGRY 1FPTL 4OUOA 5F88B 2PXYA 4R4BA 1R5VB 4LAJH 4LRNL 2R69L 5E9DB 2JK5B 1IEBA 3T0EE 4BQ8A 5JDJA 2G75B 2YEZA 1EH9A 3O4OB 1S7XB 4WV1B 5DO2C 3C09B 3D18A 5EUKA 3MV9E 4L9DA 5DMJB 4PGEA 3WE6A 1IE5A 1JNNH 4K3JH 1RZ7L 5DUBA 4PJBE 4BSWB 5IFHH 3SDDB 2HT2D 4FNLH 1FG9C 4JZOA 1EV2E 3MOBH 3VD5A 1HK6A 1K8DB 4G80A 4OZHA 3CAFA 2R2EB 2P45B 1KBGL 5CS7A 1JRHL 2DJUA 4R3SA 5IKCA 4NN5C 4Y4FB 4FQCL 5DI8B 2PYFB 1B4RA 3QXVA 1HNGA 2HTLD 2A38A 4O9HL 3SCMA 2HJLB 4JJ5A 2IPTL 4HX1B 4ZMAT 2HJKB 1MI5D 6FABL 4TULL 3MRNA 5CZXD 1R3LA 3V52L 2YD9A 3TNNA 4Q9RH 2DBLH 3EJZC 4JO3H 5E00A 1UEMA 3V7AG 5I17B 3FOMA 3NCYP 3ETBF 2WBJC 4QCIB 4XVUD 4Y1AE 2AV7A 3S34H 1X5JA 4Y5XA 4YDKL 3OKLA 2AJ3B 2CLRB 3O8XC 2H32A 4OLVH 1GOGA 1BWWA 3RHWF 1DCLA 3VXRB 3HZMB 4KFZC 3MCKB 3GKZA 4RIRA 1QSFE 43C9B 3W2DH 1RK0A 1H15B 4TVPH 5DRXA 5FYKU 5DK0A 3PV6B 1YYML 2QQKH 3WFHA 3V5DA 3WHXB 5E08H 2MQCA 4ZYKB 4M1GH 5L2KD 2Q87A 1MLCB 1JI2A 3QUMH 1J0ZA 1HWGB 4UDUB 1S9XB 3INUL 3V79C 3U1SH 3WUWA 4TN9A 4AEFA 4OZFB 1PQZA 4PJ5E 3FL7A 1MCRA 3QUML 5BZDB 3PL6D 4JO1L 2QR0B 2HKFH 3LEYH 3RU8H 4PJEB 2VDKL 4OLYL 4D9QE 1W72B 2BNQD 4I4WB 4U0RB 4A6YB 3ARBD 2FO4B 3VFNB 2E27H 3RKDD 3AM8C 2W38A 4LCCC 5EN2A 1J87A 3ZYIA 4EUPG 5FF6A 4OLYH 1CDCA 3L5WA 3TBYB 4M6AA 1BFOA 3O8XD 3FT3B 3HLAB 4OGZA 5DJDB 1N26A 2AEPH 4R6UA 4DVRH 4OZGF 4RFEA 1LK2B 2Q86A 3TO4C 3WNNA 3IAGC 1QFWM 4NN6C 3PHQA 3GSUB 3RDTD 1KN4H 4OFDA 3C60A 4POZD 3K80A 2YA0A 3KNBA 1E4XI 3ZE0E 4AH2B 2ADIA 5JIPA 3EGSB 4BZYA 2D03H 5ID0A 2BVEA 2EE6A 1ORQB 4MNHB 4IRSB 8FABB 4NKOA 4MLIA 4NUJB 2I25N 1GZPA 5I71C 4J7RA 5C07D 2BNRA 4QHNA 3I2CH 1QR1B 2JJSA 4G8EB 4G6JL 1HH6A 3MA7A 1X4XA 3QQ9C 3KYOB 1T1WB 3QQ3B 3WSQL 4I77H 3VXSA 1G0XA 1WZKA 4Y5XC 4YPJA 3DXAE 3C87A 3G5ZB 2NNAB 4LCYA 4U6HB 4F9PC 4U1IA 5T5NF 2AVGA 4AM0B 3ZKND 4H20L 1RUPL 1SYSA 3VRLF 3NZ8A 2L0DA 4PJ9D 3P9MB 3FRPA 2X89A 2JB6B 3T65B 4QRTA 2ZJSL 2JCCB 2DOCA 2R15A 1QTYT 3MUGB 4EI5B 3NCEB 3WFDH 1IC5H 4GRWF 2YBRB 1IGML 2GK2A 2NW2B 3QIWC 1FJ1A 3SCMC 2FX8H 5JOPE 5MHSE 4BUHA 1CVRA 1LO3L 3QJHB 4MLSA 4FQ2H 1S9WA 4IRJB 3PQYD 1OAXL 5JO5A 4OZGA 3IDXH 5C08A 2VITA 3WFDL 3F7YB 3U7AA 2LU4A 3FFCD 3GM8A 4ISVB 4G6FB 1JGEA 2F54E 2DDQH 1BVLA 2JIXA 4JG0L 4NBXB 2Z35B 5D1QA 5JW4N 5I8OL 5D6DC 3TA3D 1BD2E 3QWRD 2GSGB 3QZWA 4NUGL 3VFSB 4PP1D 2N7AA 2UVEA 2YRPA 1SEBB 3O8XA 1G7JA 2X4NA 1TZHA 5INDB 1JHKH 1OM3H 1KJMB 1MNUH 5FYLE 3FQXB 4MHHI 3PGFH 3LKNB 1HXMB 5BW7A 1ND0A 2R56H 5TPWL 1AC6A 1VPOL 1ND0B 1QBBA 3GJFH 5B3NA 2GJJA 4XCYA 1Y6KR 3BP6A 5DUPH 2EC9T 3WO4C 2ZCLL 2K1MA 4JFQA 3ZDYE 4DJMA 1LMKA 1X5ZA 2DRUA 3QPQC 4K94L 5FM5M 3JV4A 3IJHB 4JY5L 4ZPTA 1W0WB 3O41B 1MFNA 3C8DA 5IV2A 2DYPD 5ESQB 4JHWL 5ABDE 1INQB 3EDEA 5F9JA 4QHUA 3QI9D 3U4AA 2FH8A 4JFHD 1P2CB 3GSNA 5KSAB 3MRGB 4EIZC 3GO1H 2OYPA 3U9UA 5AUMB 4R0LC 3IKCB 2EDFA 4UAOB 2XFXB 3WUWG 1FLRH 1FFRA 5EBMA 2F53A 1T5XB 2J8UF 5J3HD 2HLAA 3FO9B 4Z7VF 4LNRB 3S3JA 5EZIH 3BRDA 1LGVA 2VLJE 4B53A 3F5WA 3TN0D 1RZKH 1MJ7L 3C6LD 4YHKH 3MRRA 3CSPA 4P2QD 2YRZA 1QRKA 2ICES 2Q8AL 5BJTA 1DFBH 4MDJB 5FHBL 1NAMH 1I7ZB 2W0FB 1UT9A 5KN5A 4R4BB 3X11B 5DC0A 5TDOA 1JNJA 1NGQL 2LTQC 3GSXA 2VC2H 4LNVA 4Y4FC 3PDGA 4QRPE 1J8HA 1DQQB 3DO3A 1G6RL 1LD9A 3HRPA 1MVUB 1NEZB 5GGVH 2IAND 4G9FD 1IBGH 4AMKL 2LTQB 3U2SB 4XCFL 1D5IL 2YPVH 1G9EA 2ZG2A 5HSFA 1JHLH 3QP3A 3REWA 2LFGA 4XP5L 5EZJB 4GW4A 5DRZA 3W39A 2LAGB 4OKVB 1ETZB 2XKNB 3BZDA 4DGYL 1CXHA 1N5AA 5IJVA 3ULVF 4GFTB 4P59H 4JVUA 2AS5M 1RUKL 1R3LB 5ISZE 5IJVB 1D9KD 3ZKMD 3U82B 1H3XA 2ADJA 4HX1A 2IBBA 1JGLL 5BZWA 2QQLH 4KROC 1FL3A 1J11A 4POYA 3BQUD 2CUMA 3OKLB 5D1QC 3Q1SH 2GAZA 3A6CL 4L4TB 1IL1A 1FL3B 3SN6N 2X4TB 1JGLH 1XCTB 3LKRA 5CIPA 3UJIL 1VFOA 2Z31D 5IW1A 4PJCE 4O51B 3ILQC 5DURB 4N8CL 1KJ2L 2BNQB 4P3DB 5A2LH 3UBXG 4LIQL 2DWDA 5EUOB 1D5XB 4AG4H 5ISZB 4BSWA 2O93L 2CLVB 4KKNA 3TT3L 2DIBA 2O5YL 5C2BH 2ADFH 1A6VH 3WFHB 2W60B 2VDMH 3BWAB 4U1NA 3NTCL 4NKDA 4QHKI 3UAJC 5HGAB 3SDAC 1RMFL 5DK0B 4N8VG 3TO2B 1XR9B 4XBGA 4HLJA 1G9NH 1IM3B 4X6EA 4RAHA 5EU4A 2PNDA 1CGTA 2IADA 2PCPA 3MLSL 5EOCH 3CXDL 3VFOA 1D6EA 2I60L 4HWZB 4BELD 1QBMH 2QR0A 2Q6WB 1KLUA 4O00A 2VDLL 3C5ZD 2A9ML 4UOJA 3X3GL 2CJUH 4NWUH 3N0PB 3O9WD 4MD0B 1HHKB 3CLEH 3OR7B 5I1KH 1II4E 3IYLW 4ZUVB 1S7VA 2OZ4H 5A2IH 5JLZB 3QDGA 3QUZB 4HDIB 1MFBH 1KCLA 1XIWA 3HMXH 3QHZH 4PGDB 4NWTL 3BUTA 1AIFA 1KPRB 4NNXB 4EJ1C 5SWSB 4PJHF 1ZTXH 4IOFD 4G3YL 3UTTB 1T6WA 4FQLL 3U4BL 3CFDA 3C60C 1BJ8A 1XGRB 3BDYH 2XIDA 5TE7H 4JKKA 2HTKC 3D25A 3VXRA 1F13A 1LO4L 4CADB 4XGZA 4X99A 5F9OL 4HCRL 4G6AD 1S7WA 4OFVA 5JW4Q 4X9BA 2NY2B 5D2NB 4BFEA 1MFEH 3VE0A 4YHLH 3LD8C 4NQEE 3I9GH 4NUJA 2YUXA 4N0UE 5IB3A 4F7CB 4Q2ZA 4AEEA 5F7KC 5AWNL 4M7LH 3MRHB 4K71C 3FB8B 1GAFH 3TJHD 2WANA 3EGSA 2CLZA 3EJYD 3FFCB 2E7LA 3LIZH 5D6CB 3O2WL 3R06A 5DSCB 2M2DA 3DI2B 1BBDL 3MV9D 4BFIA 3DRTB 1T66D 3HFMH 3LH2L 4LDOB 1BIIB 2ZP0T 2F8XC 1LP9B 3L3JB 8CGTA 4X7TB 5E6ZA 2HAZA 3RZWA 1ZAGA 3O9WC 3QA3B 2ZOLA 1DLFH 1EERB 5M95B 3JV6B 2EXYD 1CIDA 1I1FB 2XNAB 2ED9A 4Q97A 3ARDA 2QSQA 4K3HA 5E8PA 5M7QA 4A2MA 5JDSA 5MEPA 4YUEL 4NQVA 1NFDA 3VFNA 2YUVA 5HDBF 3HAEB 3UTZA 1NC2B 3AS2A 3JWOC 4QXUH 5IB1B 4FQJL 4Y88A 4OAWB 3MOBL 3BX7C 1I3RA 5GGVY 4YGVB 3LKPB 1WIPA 1D6VL 4U1GB 4XMLL 1ZGLB 5IMKB 2MNUA 2DM2A 1LVEA 3VWKC 1CG9A 1XGPB 2PKDA 1FJ1B 3E8UH 1HYRC 4KRPD 3T2QA 3FT2A 3TVMA 3UTQB 1KB9K 4JR9H 4XWOD 4NQEA 5JW5A 5JA8B 3RKDC 3BZ4A 3KPSB 4F2MA 4M62L 5EOQL 5GGTL 1JGEB 4ONOA 2COQA 2DQJH 5D2LF 4LCWB 1MLBB 5DHVH 3TH3T 5EIVA 1ITBB 5DD3L 3WIHA 4GMSL 4F33A 5GZND 1EAPA 1QSVA 2PYFA 1QPXA 2EEAA 4N8VA 3O8XB 2XZAL 2WV3A 3MJ6A 4M1DL 3T3ME 4O58H 4BQCA 3OAZK 1JPSL 4YHIB 3FTGA 1CR9H 5F6HI 2J8OA 4NCDA 3WO3B 4J1UA 1KTDA 2DQFA 2HT3D 4FFVC 2C7UA 3L7EB 3EYSH 3QBTB 1UG9A 1OD9A 3M8OL 2C1PA 1GGIH 4G9DB 4DCQA 5L2KE 2E6PA 4E41E 1RZJC 3QEQE 1H3TA 2WLYA 4GBXA 3EYSL 1F2XK 5D1XA 4WI2A 1ED3B 4NKIL 5E08L 2LU7A 3RY5A 3SJVA 2ESVD 3NCCB 4M1GL 4UNUA 4ODWB 1ZLUH 3ZKNC 4GXVH 1HSBA 3IJSA 1HHGA 4XNYL 2WZPD 1QLRA 5F97E 4C83A 2PETA 4JRYB 3ARTA 2RCSH 1I1AC 1MCPL 2FSEA 2OR8A 4HZLB 4LU5L 3UYPA 1RIVH 4QXGL 1RZFH 5EIIB 5HPMB 3W9EB 3QIWD 1N0XH 4PYGA 4P2QA 5FV2A 2RBLA 4NSKA 2OMNA 1RIUH 2IPKB 3L1OH 3BH8B 4XVUC 2ADGA 1CLZL 3L5HA 4P48A 5FDYA 5HTSA 4X80L 2VXTL 5ACLA 5GJTH 4JB9H 4YE4H 4OIIH 4OJFH 3C8HA 3LQMA 4OCXL 1E4KA 1A4JA 4OF5A 1CXFA 3GMNA 4HWUA 1H3PL 2AGJL 4UILL 4MNQA 1QLFB 5D1ZB 5BJTB 2AJUL 1S7XA 5KS9E 2Y5EA 2OP4L 1HQRA 4L8SA 3MYJA 5DJ6A 3TO4D 1KB9J 1XMWA 3WIFA 5IESH 3HCVA 5F88A 3HR5B 4MVBD 2FEDC 3S3SA 3OAUL 3IDGA 4YPGB 4A6YL 2KH2B 2QTEA 2VABB 3TNMA 2V17L 2IH3B 2GQHA 3HE7D 2H1PH 5H94B 3PQYB 1VHPA 1Y0LA 5GPRA 5IBUB 1OVZA 2G2RB 2JELH 4WO4D 2XY1A 2H2PC 2X70A 5FYKE 1F97A 5JNYB 3DX9B 2I07A 2V7NA 2D3VA 4PIRF 1QHOA 1SVCP 1WBXA 4KROB 4MX7A 4TVSa 3G6JF 4WO4C 4R9HA 1J86A 1U8KB 4PJ9C 5DJYA 4GKOA 3TV3H 4C59B 4TOYH 5BV7C 4XAWH 4XNQA 1K4CA 3RQ3A 3ULVE 1L0QA 2IEPA 2NXZB 2GAZB 4ZFZB 3S5LB 5LAXB 2BY3A 3OKYA 3WLBB 1X6NA 3ORJA 3MRRB 5KANI 5HI4C 4ZQKB 5L88H 4WDIB 2EH8L 3DROB 5C0CA 1QR4A 1YN6B 1CGSL 4ODXA 1TVBA 3EYVA 3VGDA 2BSED 4MA1B 1P4IL 1J1PH 3LEXA 5HDQL 2FECL 4PJCF 3O6LL 5I71B 4ZAKC 4GKNB 2A6DB 4PRIE 1JYVA 1KSRA 3E6HA 1DVFB 2AI0H 1NGYA 3E3QE 5T1DH 1KCKA 5DHYB 1B9ZA 1MVUA 2XOTA 4PJGE 5DRWB 3LZFL 1K8DA 4G80B 3ZT7A 2UWEE 3TN0B 1IGYB 3GSOB 5GSVB 1CXIA 1EA9C 1CL7H 4PJ8B 5TQ2L 1BPVA 2C4FU 2VTFA 5EZLB 1EGJA 3VXOB 1MEXL 1C1EH 1NCTA 3VFRA 4KK9D 1S9XA 5I1JL 3QQNA 4TQEH 4WHDA 1BGXL 5IHBA 5MI0C 5GGSY 3MLUL 4WNQA 5E6ID 3VXUB 1YEIH 5FXCH 3GUTB 2BHZA 1IEHA 3N1FC 4S1DD 1R5WB 2FO4A 1F3DH 5KW9L 1IGIH 1HIMH 2P5WD 1AE6L 5HGDA 5C9JB 4JHWH 4PJHE 4M02A 5GRUL 2XWTA 3B9VA 4APQB 1FVCB 3HNVL 3T0BA 3WS6A 4GT7A 3TVMC 4CADA 1J0HA 4XCNA 2D7TL 3GSRA 1RUQH 1NAKL 1CFTB 3WCYA 3JV4B 2DQUH 2IANB 2P46B 5H35B 5JMRA 3DRTA 1JGDB 5CLWA 1DN0B 4YHML 5K9OA 3EZJB 3FN3A 3R06B 2K9UA 3EO9H 3FOLB 5EORH 2LE9A 1IAMA 2APTA 5K59F 4ZOCA 1GZPB 1H3GA 4PJDA 5J9PA 2B1HH 4PJXE 4G43A 5DJ8B 3GGWA 1A6AB 5CGTA 5JDSB 3BKMH 4UIKL 1F02I 2YD1A 2DAVA 5LGJB 4YDLC 1CTNA 3BW9B 1DBBH 3ME0A 3QA3A 5JUEH 1VESA 2OK0L 3RX8A 1VCAA 3IDIB 4K55A 5JW3H 5D93C 2GITB 5C0CE 4CL7A 3MRCA 5IMMB 3PGCA 3PJSA 4XP9L 5JQHC 3N1PC 4ACPA 5HYEA 3B2VL 5HVWA 3HC3L 4RGOH 5HDBE 3D3VE 4NRZB 4JPVH 4DN4H 4F2MB 1DBJH 5A40E 3OKDB 1EFXB 1EO5A 2WIIB 4UINH 5DTFB 1MRCL 1ERNA 3REVB 4RGOL 3SOBH 1QFWL 4ZNCD 3H7LA 1DBJL 4NO2A 2CXKA 2NXZD 5GGVL 4MCYB 3TT1L 1EAPB 1FP5A 3ALXA 5E94A 4OF6A 3DYPA 3NZHH 4JN2A 1T83A 4UIMA 5IEKB 4KJQD 1YN7B 4K7PY 1NSNL 3L3GB 2P5WA 4XCEA 5TDNA 3RGVC 2AXFA 2BOCB 3OKMB 2CDFA 4RFOL 4I0PC 4PD4J 4M03A 4JRXA 3DIFA 1IM9B 3T8XB 3F58H 5T3ZH 3PWLB 5L2KB 4DKAA 1WT5C 1AFVL 5E2WL 3NIFF 1NGXA 3ROOA 3H9ZA 2NY6C 3FONB 4GG8B 5LBSL 1OSPH 3RWJB 4CU8A 3FB6B 4I9WD 2V7HA 3KYKL 4JPIB 2C7UB 3L7EA 2ADFL 5ILTL 3RY6C 4RX4A 4PJ8D 2PW2A 4HUMB 1J88A 4JRYE 1NQBA 2WLZA 4NOBA 4JRWA 3CD4A 4R2GC 5D7IF 4JQXA 3MRQB 3F7YA 4FFYL 1A9BA 1CQKA 3G5YA 4Y19B 5IB4A 1Z9MA 1BBJA 4KXZH 2KZWA 4M6ML 3P73B 1RQ5A 4LSSL 4P23C 3L3DB 2DD8L 4ZFFA 4JFZL 4XT1C 4ZOAA 5FDWB 1CDIA 1G9MC 1YMMA 4C56E 4JQIL 3KPOB 4YJZL 4P9MH 2Y6SD 1A4JB 2GSGA 5FKAB 1KEGH 2BC4B 4PJDE 3VXRD 5GRVK 3JSSA 5DEZA 3HA0A 1AD0B 3HNSL 5FYKL 1WC7A 3VFVA 4V1DB 4Y16A 3NIGF 4HIEA 4G6JH 1LEIB 5TE7L 4P2OA 1LNUA 3BT2H 1MHHA 4HIEB 1WIUA 5DEFA 5HD8D 3SDCC 3FQRB 4X9IA 1LEIA 1BZ9B 1MJ8H 3CZFB 5E8OA 3H42L 2C1PB 1I7ZA 4DUXA 3UEZA 3DGGA 5DMIH 1LP9E 1T3FB 4Y5YB 5ERWA 2X1WL 1GIGL 4ZOEA 3UZEA 1DJSA 4CRPA 1F3DJ 1U2HA 4O02L 4JGJA 1CXLA 4L4VA 4EN3D 4NBYB 2WBKA 1FZJA 2X89D 4HW6A 1RZKC 5IMLA 1R0AH 2IPUG 3LPFA 3RIAK 5J56B 2NTFB 5B21A 3U0WL 4ZFZA 5FGSA 3AY4A 1KJVB 3MFFB 4EUPB 3O2WH 3DV4B 3MRMA 1AQDB 2Q8BL 4ZUTA 1NL0H 2VOTA 3G6JE 4PRDB 3TWCL 3F12A 3VFWB 4C4KT 3IFOA 5MP6H 1YJDC 5FA3A 4YDJA 2HTKD 4ODXB 2Y25A 1YY9C 3WLWC 3KLHD 4WDIA 2VL4A 4YDJB 3LD8B 5IR1A 2X44D 2D2OA 3PGFL 4U1KB 2CRYA 3CH1B 4G42B 3BPLB 3AC0A 3AB0B 2FLRT 1NUNB 3R1GH 2AABH 5DD5H 3C5ZB 5ACMA 2VLRA 1T4KB 2W0KA 1X5GA 2EH7L 2GY5A 3TYGH 3VCLB 1MRDL 3P30L 3RY4A 3QXUA 2C3VA 1I9RL 2AV1B 5DD5L 1EBAA 3VCLA 3SEPA 3C5ZC 2Z92B 3A6OA 3V5HB 1GGUA 4NQCE 4FXKB 3BZEA 1PGRB 3A0OA 5GGTH 1PKQA 4G9FA 1FFNB 3SKJL 5B3JF 4Z7QF 4XAKD 2HT3C 3T0EC 1JNHA 1HWHB 5BW7C 3PXHA 3SKJH 1N6UA 3D69B 6FABH 5FF6B 1V8HA 4JQVC 4ZSOA 4GJTB 4FZ8H 4QOKD 3T0EA 4TVPE 3EYOB 5I1CH 4K3DH 1FE8H 4Y19D 5FYJU 1OLLA 4WI4A 1EX0A 2VISB 5B8CC 2ARWA 2PTTA 1UVQB 3HPJA 1JBJA 5J1SC 3Q0HA 2R1WA 4K2UH 3L95B 5SWZB 3QEUA 4UZGA 4JY4B 3LEXB 5GJSL 4Y4HD 4I5BA 4X7SL 2YN5A 1EZVX 3BP4B 25C8L 3LOWA 4FP8L 2IQ9H 4M7JH 4MB5A 4PJFB 3FOLA 1HDMB 3CMGA 1X5AA 3BP4A 1DQLL 4QXTA 4P5TB 1UM5H 4WGVB 5SWQB 1RFDH 4F7CA 1PFCA 3BKCL 2PR4H 2Z8RA 4KGLA 5IQ9A 7FABL 1NLDH 3VD7A 3FZUD 2FHFA 5DJAB 1MI5A 3NVQA 3WHE1 3QDJD 3PXJA 5IVOA 4LOUC 4YFDB 1URLA 4XP5H 3NFPA 2G9HA 3X14B 1HH9A 3MC0A 4R26H 3B9KC 1YEJH 3ESUF 4A6YH 4P46C 3AY4C 2UWEA 4OF7A 3QUXB 2E27L 5F8QC 5C9KA 3G04B 4OZFH 3NMEA 4NRZA 1KPRA 3QH3B 3TESA 5CFHA 4MDIA 2OL3B 2D03L 5IG7A 3O6FC 4ZFGH 3MUZ1 1SEQL 1F3RB 1Q94B 4R4FH 5C0AA 3U79A 3N1GC 1OAKL 4Y5VC 4APQA 5JOEA 3O6FA 3KPSD 3CXHK 4NQCD 2H1PL 5JIHA 2YC1A 2VKWA 3N1QC 2X40A 4Y2OA 5C0BE 4JO4L 1DE4B 4MXQD 3DXAB 4F58L 1Z9LA 4TOYL 1LO2H 3O3BB 2I24N 4HUUB 4YGAB 4Z0BH 4P46A 2HJKA 5D7IA 1R6VA 3DVNA 3D2UD 2NY6B 2NX5B 4GUPA 4IJ3C 4HXAH 4ZUWB 1I1YA 4PJEE 4K8RH 1IGJB 2MTPA 3NZ8B 2OQJB 3ZT6A 4NHUB 2P5WB 4XCEB 2ZUUA 5I1EL 2EYRB 4PGCA 5HGBB 3CC5B 4IRSD 1OAXH 4X5LA 3HKFA 1J1PL 4WWID 5HDQH 4JN1H 3VXUD 5ADPL 1FZKB 4JHAL 5HJ3A 4OZGB 5DMGD 3GMOB 1G6RA 5TF0A 4HULB 1CF8L 1AO7B 4DKFH 4Z7UA 5FEBA 3U6RA 1MFAL 1A8JH 4JPIA 2Y06H 4I0KA 1AXTH 2QSVA 5AD0A 4JZJB 1IGFH 2IFFL 4S1RL 1CL7L 3ARED 3GMMB 4V2CB 5BMFH 1CZ8L 1ACYH 1WCBA 3PWNB 4K7PX 5D7LD 3SGJC 1MCOL 1AXTL 2XV6B 4HUVB 1BLNA 1QYGH 5ALBH 1DVFA 1GPOH 3PWNA 3QIUC 1B6UA 5ADOH 3TH2T 1XT5A 4DKEL 1KIRB 3RHWK 2Y07L 4IEFB 2WBJA 2XT1B 5C0GA 3P4LA 4E0RB 5I1LA 3B8YA 4A6YA 2FR4A 2G60H 3P4MB 4N90E 3HE6A 4U6VL 1OL0A 1KN2L 4XXDB 3SDXF 2HYMA 5I30L 2RAMA 1X9QA 1EEQA 3SQOL 3WE6B 1A14L 3D85B 2OI9B 1H3UA 4DZBA 1HCVA 4RFEB 1KN2H 5J12C 4I13B 4KTEH 4X7CC 1RUQL 2VXQH 1NAKH 4ZD3H 3MACL 2ZCLH 1F42A 4XBEL 1IGCH 1I8IA 3CVIH 5IHZB 5HHOB 2VDQL 1AXSB 4M4RA 1D5ZA 3L3IB 2P8MA 1DN2A 4LGSB 2EDNA 4ODHL 2AJSL 1JNNL 4K3JL 5IKCB 1JPTL 2ZUYA 2Z91B 2ATPB 2ESVA 4WUUE 5TQ0H 5HHXH 4Z8FH 5T33H 4C83B 1MCWM 5C0NC 4RAUB 43CAB 4BZ2L 5ACZA 4FQXB 2HLFD 5E6YA 5HHPB 2C9AA 2X1QA 5EU3A 5T33L 2HVJA 1RHFA 4M1CC 1W0VB 2DI7A 2P7TB 4LL9A 1ZVSA 3QQ9D 1D5MA 2H26A 3EKCA 4MCZB 2IPTH 2P7TA 4O51A 4JFOA 4E9LA 1J7VR 1AHWC 3FB7A 1ROWA 5HXMA 3WDIA 3P2TA 3HMWL 5DZLA 4XPBH 4JFHE 3UC0L 5F7UA 1JN6A 1X5XA 5E8NB 2CSPA 3V9FA 1G7QB 2VITB 3CFEB 1I7RB 4R90L 4YPGA 5J06A 2R2EA 5EG6C 2VABA 4LARH 2WMPA 4XHJD 3IFNL 3TT1H 2NY4B 3AROA 4PV9B 3DYMA 4Y0GA 1UEYA 3C5JB 3P3YA 4X6CA 3BP7A 4ODBD 4MJ6A 1J0IA 4IOIB 4KRMB 4U0RC 3IFNH 4WUKL 1KCVH 1NCUA 1OF2B 4NT6A 4PRHB 1I9IH 2FO1A 5INCB 3LRSB 1TJHH 2X7LB 5H8DA 5E00B 2YKLH 4YQXL 2OSLB 1PKQB 1BQUA 4OGAC 4QHLA 3S96B 3CJJA 2YUZA 1MCJA 4MWFB 3MFFA 4WWKC 1OAQH 4EUPA 1LK3L 3V8CA 4M1CD 1XCTA 3LKRB 1U8OA 4LEOA 4MQXC 1A3LH 2FL5B 5ILTH 1A3RH 1Z9SA 5K33A 3CFBA 1CDHA 1QACA 1DLHB 5ALCL 4P23A 4KKBD 2H41A 3I84A 2AJ3A 1AFVH 2ED8A 2GTZA 2X4RB 4YK4B 5HYQA 4KHXH 4LVHC 2NY3D 5LBSH 4AT6A 4G42A 4QRPA 4YK4C 3EYVB 1QNZH 2EZ0C 2ARJA 5FKPA 1VEPA 4DUVA 4FMFA 3PGDB 1ZLWH 4PREB 2BMKB 3ARWA 1CYGA 4PBVC 1T5WA 4P9ML 1LO5A 1TZGH 4Z7WF 3MV8D 4U7MA 3UYRL 1MJUH 1RJYA 1KEGL 4LHQB 3SE9H 4MAUL 1P53A 4PJHB 3W9DB 4AIZA 3MRQA 3ZO0A 5EC1B 2E7CA 5K9QG 3BGFB 4YHZH 4GRWH 4U4BA 4PJHA 3HE7B 3W9DA 1HI6A 4AQOA 5I8KH 4EN3C 1EHXA 1GRWA 2ITDA 1PJ9A 2ZCKH 5F9AC 1CICD 1J0YA 4PLJC 3TZVC 5IBLD 3DXAD 5I74C 3EFFA 5H37H 4KAQL 1DBML 4QGYA 1JNHB 4H1LA 5IFAH 4K9EH 4NIKB 3BE1L 4PTTA 2Z31B 3CLEL 4G8GE 2JCCA 2XACC 4NM8H 4HS6B 4X6CF 3HNSH 5FK9B 5IMOA 5KZCB 4NFCA 4PGBA 5D72L 6CGTA 3TV3L 2N7BA 2BNRE 1Z0MA 4HS6A 4HK3J 3DOSA 3VDAA 3ARGC 5DYOB 4JZJC 3QULB 4HKXB 4XP6H 3FT2B 1GGYA 1TQCB 1RURL 3P4OA 2VAAA 3MX0A 1XFPA 3KYAA 4FQLH 1BZ9A 3QG7H 3WDJA 1FNGA 2HKHL 3H42H 5T3ZE 4W4NA 4WV1C 3LIZL 3ZHLA 3GKWH 3SDDA 2O5ZL 4LLDB 4EDXA 2APBA 4N5UA 4I2XB 5DS8B 1RZGA 2Q8BH 5CSGA 1QBLL 3SCMD 4G8GB 3MRPB 1FPTH 1A1NA 3QO1B 4PJIB 5T1MA 2CMRL 1YEFL 1WIOA 4GAJH 4HHAB 4ORGB 1CGYA 5TE6H 4MQ7A 5D2LA 4Y2DC 3T3MF 1JMZA 4L8SC 4PG9A 4Q6YA 1SBSH 3QFJD 3DHMA 3H9SD 1V3LA 5I8OH 1YPZF 3PP3K 4GAJL 1RZ7H 2F5BL 2XQBH 3DV4A 3MRMB 2KQNA 2Y9RT 4PJEF 1F8TH 3X14A 5IW1B 4FXLA 3T3PE 1FO0L 4LVOB 1FNAA 4GAGL 4OGXH 4HUXB 2VZOA 5JHLH 5FGCB 1M6OB 4QTIH 3WKML 2NR6C 5CGMA 1EEYA 3GK8L 3T0VA 1A9EA 2R56L 2Y6SC 1U3JA 1I9RH 4OGXL 2KL6A 4M3JA 1RK1B 3P4NB 1CL7I 4MDIB 3T09A 2W60A 3ALPA 4L3AA 4NKQB 4GSDH 4JFDE 4MJ4A 2Z35A 3VXQA 1U58B 5E95B 4OLXL 1QQDB 5IWLC 2IPKA 2OTPA 2FGWH 5HI3D 3EOAA 3G5YB 5IB4B 4GBXC 2WBJB 4E42A 3L9RB 4N8VB 2B7DT 3TFKD 4OLXH 1CDJA 4NGHL 5GQBA 3O2DA 4WRLA 5DJXA 5ANMB 4P2YA 2R29L 4UIMB 3MRLB 5D5ME 4X4MA 3QDGE 4V1DA 1JPGA 1YDPB 2DQUL 1S5HA 1FYTD 2BNUA 1W72H 1LE9B 2B1AL 1R5IB 4F3FA 3OBAA 3U30C 2ZSWB 2OQJA 3LVEA 3WJJC 4OV6F 5DQDL 5FOJA 4P2RB 4K3GA 3DI3B 5DLMH 2B1AH 4Y8DC 1QVOB 3ZMRA 2O5XH 3UAJD 3SDXE 2ARJQ 5JR1H 2YD4A 4M5ZH 1CBVL 2H8PA 1F4YH 4OFIA 3ZHKA 1JZ4A 1PG7L 1RZFL 3BEVA 1OP3K 2X10A 3SJVD 1CTOA 3ELAT 3QUKB 4LIQE 4PUBL 43C9A 4DZ8A 5C7XH 2AW2A 4PJAA 1WZLA 3REWB 3BPOB 4NZTL 4XVSH 3MRGA 2OR9L 5I8CB 2CIKB 3QIBC 5E2TL 1S7RA 3KLAB 3UJTH 5I6XC 2HKFL 3LEYL 1RVFH 4PJCA 3ARZA 25C8H 1Q9LA 1EGJL 3U7YL 4C56D 4UINL 1YEHH 5H2BB 4N0YL 3WN5A 4ZFFB 4P9HL 2DICA 5FOBB 4RA0C 1OGAD 1T6VN 4WU5A 4X80H 5GJTL 5GHWL 1G0DA 5CKGA 3GIZL 3WLBA 1YMMD 1HILA 3MMEB 3GMLA 4X9GA 3C60D 2DMKA 4KQ4H 4NC1C 1ZHBA 4V2BA 2VDOL 1G7QA 1D7FA 4CU6A 4F7PA 3VXUE 4DVBA 1ZHBB 4A2LA 4BH7A 4OF8A 1I85A 2XWJB 2C5DC 5EC2B 5BVPH 3SGKA 1XR8B 5CJXA 2A77H 1Q9OA 3CUPA 3P77A 4E41D 4LCWE 1RUML 5EU6B 1X3DA 1CDUA 2CLVA 3ZE1F 2A73A 3B9EA 2C3VB 3OKOA 1EHLH 5CILH 1A5FH 3GFUA 1BFTA 1MWAH 1UWXK 4PJGF 4XPAL 1UWEL 2VLRB 2CRZA 4WI5A 1KXTB 2DIJA 4HPYH 1KJ3L 5HI3C 4HXAL 1TPXB 5ITBL 5DD6B 1WBYA 5L7XH 3BP7B 1NUGA 2JJVA 3DECA 2HRPL 3L5IA 1G7PB 2H9GA 3WXVL 2NY5C 3BP5A 4WFEE 4RISL 5C6PB 4KZDL 3WNLA 1FV1B 2CR3A 5CP7B 1S3KL 1HH6B 3DNKA 3MA7B 3ZDZE 4G6AC 5E03A 3WNOA 3ULVC 1T20B 4HCRA 1N8ZA 2OSLA 1GC1C 1R3JB 3FQXA 3R8BB 1P7QB 2W1NA 5BZWB 4FABH 5SX5K 4GS7B 3BXNB 5BVJB 1QO3B 2BRRL 3KPQB 4LMQI 4WCYL 1BFVL 3WFBH 1XGRA 2OL3H 5ISZA 3CC5A 4NNYB 3K1KC 4LPTA 5BMFL 3D9AH 5ADPH 4L1HA 3ET9F 4N5EC 3S35L 2HT4D 5IQ7H 2H6PA 1BFVH 2VXUH 1I8MA 5E4EB 3OZ9H 4RIRB 4KH2A 4J3VA 3O6KH 1L7IH 5C09D 1NGPH 3VXMA 4MAYC 1QLRB 3ARFD 1HXYA 5C0IA 3BN9D 3P11H 3FB8A 4U05A 4HZLA 2GHWB 4HLZH 5D2NE 3BPLC 2GUOA 4QXWA 3QG6A 4FTVD 5T1DL 5IQ9B 1RJZA 5E2VH 1E4JA 2DM3A 2IC2A 4HCRH 1ZEAH 1PBYA 1QFPA 3GBMH 3MOAH 3QO0B 4P4KB 3D39D 1L7TH 4Z7WE 4QNPE 3ARFC 3RI5K 1G7IA 3TIEA 4QT5A 4I3SL 1XF5B 3L6FA 3U30B 1L0YA 4F15B 3GMPA 2J12B 4OZFA 4N0RA 4NP4H 4Y2DA 2BVYA 2X4QB 3IDIA 4JG1H 1MQKL 3FN0H 5E2JA 3QPQD 4OGYH 3UTZB 5B39A 4JFFE 4PTTB 4RGMB 5EN2B 1MQKH 3FN0L 5BCAA 2V2TB 3HE6D 4H8WH 2DMBA 4MXVE 3TWCH 4M61B 4BM7A 3QWRA 3SQOH 1YYLH 4K71B 4OCMC 4W6XB 2GCYA 3X11A 1KB5B 5F1KC 1DDHB 2DQIL 1NJ9B 4PRIA 4KTEL 1EVUA 5CJQL 4NO2B 3VWKA 4PJ5D 2F15A 3GSUA 1U3YA 4RGND 4QF1A 2BMKA 3HNVH 3CVIL 3FFCA 4G8GA 4BFBD 1F6FB 1A1NB 1CE1H 1ODAA 4LLQB 1L6ZA 3CFKA 1MUJA 4O2CA 1ZLUK 4MAYB 3VD3A 4KJPC 5CHNB 1JPTH 1C12B 4KK5C 3OKMA 3VW3H 1NCDH 2VIRB 4LLMB 5HHOE 1DBBL 1XIWC 3U9PL 5HVFB 2DQGL 4MNQD 2VR9A 1J10A 4NQVB 1QSFD 1DEEB 4JDVB 1TENA 4CAGA 3G6DH 5MENE 4PR5A 3RI5F 3LQAC 3BKML 1U6AH 3MBEA 3QDMD 4L9LB 5E8EB 3QJFA 3B83A 4QRRD 4JDVA 1XH3A 3JVGA 4ZS6C 1SYSB 3G6DL 4MDJA 1S7QA 5MEQA 1UWXH 2HFGL 3T3PF 5JW5B 4WUUB 1EUTA 4J6RH 2HN7A 4J4PD 1BECA 1XGPA 3NZHL 5ITFB 1FNGB 4KC3B 2RHEA 3U6RB 4IM8A 1YPZA 5FUCE 5MENB 3C8KB 1DANT 1IC1A 3LCYA 1SM3H 1QRNA 3LQAL 4M4PA 5E5MA 5F89B 3NGBC 1AJ7L 1N2RA 2W9LA 4YDIH 1E4XL 1IFHH 1K8IB 3F65A 5I0ZA 3DV6B 1MREH 3KPNB 3GJFK 5KJRL 1AY1L 1HKFA 2X4NB 3MLRH 1RIVL 1KACB 4HJ0D 3PDOB 5C70A 4OT1L 3QDAA 1ZVYA 5C6WH 2YZ1A 4KI5E 2WIMA 1LE5B 3IF1B 1FNHA 2FATH 3O45B 3RGVD 2Y72A 4ZUUB 3ULUL 2FJGB 4OCWL 5JLZA 5JORB 3CVHA 5GS1B 3BPOC 3QUZA 4HDIA 4WIQA 4ODVH 3CVHL 2FL5A 3EOBA 3NTCH 4NQSA 5GS2H 3ILQD 3QIUA 2X09A 5K9KA 1LP9F 5D6DA 2YR3A 5EO1A 2IPUK 4L3EE 5FAAA 5K9KB 1ORSA 5GS0H 4OBSA 4AIXA 3MCKA 2CKBB 4XHJC 1QP1A 3ECBA 4UOW0 1NBVH 3NIDF 4LHUD 3MRBA 15C8H 5D2NA 2V5RA 2CJUL 1F4XL 4HIIA 5KVGL 3MLPA 5HGAA 2ZKHL 3KR3L 3O4LB 1QQDA 5I74B 1G1CA 2C4XA 5C92A 3B2UC 1FNFA 3G6AA 4U7KA 3N85L 1VACA 2BVOB 1IEAA 3RP1A 2P24A 3BFOA 3MNZB 4IDLA 4EQ3A 2A9NL 3V95A 4UT6L 1MJ8L 3MCLH 3O3DB 5DJ0B 4L8CB 5A16B 5FYKH 4JFPA 1OD7A 1KENL 2A9NH 2JCCF 3CX5J 4BZ1H 3RNKB 2MKLC 4K9EL 3QG7L 3ARDB 1DEDA 1YMHA 1U42A 1OP5K 4NPYB 1M7DA 4JZOB 2R39A 1DQJB 1RUPH 1FO0B 2RGSA 1IAIL 3LB6C 2L4OA 3OAYK 4RWYH 1VEOA 2WIIA 3BD3A 5L8LB 4X6DF 4YGVA 5TJWK 3EOYG 2HFEB 5LCVH 1IQDB 5DI8A 3MA9L 2P8PA 4S1QL 4LP4A 3VWJD 2HFEA 5B38B 2WSKA 3V5HA 1WAAF 4O02H 4Z95L 1I3GL 1NKRA 3U2SA 1JFQL 1TFHA 4U7SA 4U0QB 1IGTB 2CIKA 2HJFA 3VXOA 4KRPB 3C6SB 2AI0L 4MWFA 5GS0D 1JPST 1IGFL 5EUOF 1I3GH 3NCMA 4LCWA 5DD0H 1A2YB 2ZNWA 3ARPA 3I02B 3S5LA 5J0BA 1T2QL 3OF6D 2AV7B 4KXZI 3U0WH 1MFCH 4WNQB 1U93A 2X7LA 1H8SA 4EQ2A 4WU5B 3EHBC 5TE6L 1P4LA 4XMLH 4OZ4B 1SHMA 4H26A 3ZDZF 2AABL 3F7VA 4ZFOA 1QZ1A 1ZVSB 3NA4A 4H0GA 2RQ8A 2J1KA 3H9SA 1BAFL 4WEBH 3W0WD 2NY5L 1ONQB 3D39E 4HIHA 4LQFH 2EYTA 3BMVA 4BKLB 4JO2H 3VXMB 5D1QD 3O3AB 4J2XA 5JHDD 4P3DA 1M6OA 4PLJD 5FO7A 5KG9A 3KYMB 1Q9OB 3CUPB 3O2DL 2NX5D 2GUOB 1ZHKA 1A9BB 5CD3B 3IDUA 5I16A 3L3KB 4Q58C 4NJAH 5FO7B 4U2ZA 5KG9B 3ISWA 5KSAD 3QR2A 3KPRA 3MV8B 1AE6H 3U46A 4RBPH 5DJCA 3BWAA 4TULH 5ESVA 4UU9A 2VXQL 2J6EL 5CZVL 3QIWA 2VZ1A 2XZAH 4ZD3L 5F7HA 5F1NB 5FUZL 5TDPB 1T5WB 4X4YA 4ZPVB 3M17A 3MREB 3D69A 3PWPD 5I1CL 4K3DL 3CX5K 3VI4E 2ADGB 4O2EA 1A7RL 3VFRB 3BAEL 2E6JA 2JK5A 5D1XD 1VSCA 1U8LB 3X13A 2E7HA 4Y19E 3WFEH 3QUXA 12E8L 4RDQG 4ZXBD 3W2DL 3RBSA 1UGNA 2VXVL 3HPJB 3QXWA 3ZYJA 2MHAA 5EPMB 2GCYB 3ZKXC 1X5YA 4P9HC 3T4AB 4D9QD 4DQOL 2MHAB 1Q94A 1NKOA 5AZEH 4F7TB 4NNYA 2V2TA 1TQBB 4GBXB 4F37F 3MLTA 1DSFH 5IF0B 4DQOH 3IDMB 3MJ9H 3L1OL 2R8SH 2P49B 3PWVB 1RZGB 5DQJA 4LKCA 3CFKB 4PRID 5E70A 1KELL 1W0WA 3O6FD 2X42A 2DTMH 2VH5L 4AL8L 2ZOKA 1QOKA 4KMLB 3I3DA 4UV4L 4LLDA 4I18A 4OZIE 3RWHB 3OAZH 1P6FA 1S8DB 1VB9A 4AK1A 4PRDA 1MRFH 2R2BA 3SHSA 2XTJB 3U9UB 1OP5H 3VRJB 3AMLA 1N5YH 4WHTA 1A6UH 4HKZB 4H25B 1G7HA 3JWDL 4LLUA 3BSZH 4I48A 4X5XB 4IIQC 2BJMH 1PLGL 2YK1L 5FO8A 1N5YL 2IFGA 4GG8A 1UJ3C 4PGEB 1CFNA 1KIQA 4Q74A 1NGZB 3V0VA 3BDBA 1FAKT 1FH5L 1NAMB 1EHNA 4CVXA 1WBZB 3MV01 4DGIL 4F7MA 5BV7B 2O61A 4RX4D 5FB8A 2JKXA 4KDTC 2QQLL 3D3VB 2DKSA 4N8PA 1I1RA 4JRXD 3S3PA 5I76B 1S7QB 32C2A 4HPYL 4DGIH 3RAJH 1P4BL 4DFHA 5JXAL 5E5MB 2IH3A 1DANU 2PYEE 2VAJA 2AAVA 1KV3A 4HC1L 4MJIB 4P5TD 4R4FL 1KNOB 1A5FL 4L3CB 1P4BH 3FMGL 5I66A 3CZJA 1NGWA 3RVXC 3IAQA 3ZTJG 1BIHA 3SQBA 1KJ3H 5JNYA 5DDHA 4HS8H 3HS0A 1WBXB 1R3HA 1EEUA 1C12A 2WBWB 2ZJSH 2QHRL 5GGUB 4PV8B 4M6MH 2FJHB 1TZGL 1ES0A 4JFDA 2BRRH 5CMAA 4OM1L 1FFOB 2F53E 2IANE 2R0LH 4LPXA 3HI1A 4PPTA 3GMRB 4N5ED 3BPCB 3X3GH 5E8OB 1R3JA 4LSUL 5KAQF 3RVTD 3OJMB 4PY7A 1P7KB 3CLFH 4FS0A 1MIEL 4LF3B 5HYJE 5HHOA 3O2VL 2VYRE 4YC2C 5HDOA 2I5YH 4Y16D 4QRQB 1MHPL 3RVTC 3TFKC 2Q7NA 4X7EC 2A6DA 4N0UA 5DK2A 4PJFF 2ZUQB 4QHMA 1YECH 1MCLA 3RY6A 1VGKA 4FQIL 4LSQL 4XI5D 2FWOA 4G7YH 5EBMB 3QRGH 3QUZC 4KI1A 4OKDA 5DJ2B 2NLJA 5EIIA 4FQIH 2VDRL 2AQ2A 4P4RB 5BS0D 1GGBL 5IJKA 4YX2L 4EBQL 4LASL 4MA8L 2VLLB 3FO1B 3STLA 1ZK9A 1EIBA 1NPUA 2VDRH 4MB3A 1OWRM 1QBLH 3AVEA 2HWZL 1T66C 5C0EA 5GRUH 3MACH 4WI7A 4Y2DB 4JFFB 3MJ7B 4JKLA 3SDAB 4LDLB 4U6VH 3VMOA 2A0LC 1K5NA 1XF1A 4YZFE 1P5VA 4YXLL 1FO0A 1U8IB 1KIPA 1T1XA 1MHCA 2HWZH 5FUCC 1MWAA 2AJSH 3GMQB 5SWSA 5C86A 4Y4KB 2QLVB 2GITA 4KV5F 1A6WL 5DJDA 4R7NB 3NOIA 1KXVC 4LCWD 4IOIA 2ATPA 1UCBL 4OLWH 1D6VH 1JWUA 1NEUA 3DX8A 4ZG1A 3QQ4A 3OKKA 4XC1H 4FQPA 3OGCA 4NOFA 3WEXB 2EO1A 3RWFB 2ADJB 1WAAE 3DX9A 2Q8AH 2BVUA 1H0DA 5KSUA 2B4CC 4GLRI 3T0XA 3RWDB 1H8OA 1G7PA 3LDBC 4HJJH 4G8EA 1NCDL 5T1KD 1FAIH 3UC0H 3ZTNL 4H26B 4L5FH 1YY8B 3EFDH 4P23B 3VXSB 3LS4H 2YD8A 3KWWB 1G6RH 4KKLC 1RZJH 4YHYC 2Y36H 1FAIL 2BVPA 3RGVB 3OJDA 4Y1AB 4XWGL 3QDJB 1MAJA 4IRJA 5L2KA 3FKUS 4OM0L 3BH9A 1FZOA 3UTPD 4PJIE 1CGWA 4NQXA 4P57B 5ICYA 1IM9D 3GM0A 3WHE0 3BH9B 4F8TA 2NYYC 2FJFB 5DR5H 2ICWB 1HXYB 5C0IB 2B4CL 4R4NC 3VXTB 1ZHNB 2DQCH 2J8HA 3OB8A 1FE8L 5IT2H 3UTTD 1I9IL 3SY0A 1CDYA 3EIFA 3KPLB 3QUMA 3QEQB 5I9QB 5IGXH 1E4XH 1I8LA 5JXEA 4H0HB 5FGCE 1YEGH 5I2IA 1VKXB 4TVPL 3P0GB 4JM2C 3F7QA 2YUWA 4KI5D 2XXMB 3M17B 5CD5C 1BBJB 4X7SH 2ILLA 4L8BA 2QQKL 5DHVB 2VQ1B 2GJZB 1TETL 2J6EA 3VFGH 3MBXL 3RU8L 1L9NA 1A3LL 2VLJA 4LVOC 3JBG7 4HS3A 3QI9C 1TTGA 1IC7H 2IWGA 2ZUVA 4PJ8A 1K2DB 2V5MA 3O11A 1VFAB 5DVKA 1F4WH 4FHBD 1JYXA 4R0LB 3IJYA 1KJ2H 4OBRA 2M1KA 3GBNH 1AY1H 5IVXF 2UYLB 7FABH 1F4WL 5DF0A 4KMTH 2QQNH 4M8QB 5DWUH 1CD0A 2AEPL 5BOZG 2IAMB 3LS5L 5GS0L 1LK2A 4LQ1A 2MJWA 4IMKC 3ZYZA 4ZUUA 2QQNL 3MNVA 2OP4H 1I8IB 5IHZA 4JGUA 1NDGA 15C8L 4G8IA 4LDEB 4ELMB 1NC2D 2R23B 3MR9A 4QHKJ 4XPFH 1ORQA 3GJEB 3NBNA 3IVKB 3WFZA 2IG2H 4NWUL 3O3BA 3UPAA 2A77L 1MCCA 5I1KL 4I18B 3E1F1 1FFPB 1KF9B 4NNPL 5FHAH 5DJAA 4W4OC 1NCBL 4KI5C 5LWYL 3NFNA 1F5WA 4TNWK 1MCBA 3QAZB 3GDBA 2OM5A 3SO5A 3S7GA 1ZHLB 1JE6A 5E8PB 1OB1A 2EYRA 1MH5B 4KJYA 5LWYH 4NBZB 2D7NA 3KDMA 2W92A 4MQXD 4PGBB 4CUCA 3GI8H 4ELKB 2PF6A 1ZWIB 1G7HB 2EDDA 2XG4A 2D0HA 4U6XA 2YD3A 3BQUB 1IEBB 3Q5OA 2X1OA 1ZWIA 4GRWB 4WWKA 3WNMA 3I9GL 5D7SL 3BVNA 1HSAB 5E8EA 1I7RA 1JCKA 1WK0A 1XGYH 4WUUD 4FFWD 4P2OD 3SDYL 1JGVL 1OAZH 3H9HA 3IDGB 5GGQH 2C3GA 5MENA 5DFWH 4MJIA 2A2QT 1JFQH 5D4QA 5C0AB 1CGSH 5EO0A 4RWYL 3GRWH 4ZFOL 3M07A 3D0LB 1PEZA 1JTPA 3ZE0F 5IOPB 4U1GC 4Z78B 1OTTC 1S7SA 4QRPD 2HFFB 1TZHB 5INDA 4HV8A 5A3ID 5GGUA 3IU4L 4PG9B 4FXGA 5HGGS 1R3HB 4JVPA 2DLFL 2BSRB 5L8JB 2OI9C 5A2JH 2I26N 3PHOA 4YHIA 2VZSA 5FECB 4FMKA 2GTWB 1IAII 3N1MC 3IF1A 2NX5A 1NFKA 4ZUWA 4KQ3L 3QDHA 3TC9A 4D0CB 3BYTA 4WENB 4UDTA 4IJ3B 4H25A 5IFHL 5ADOL 4PRHE 1FDLH 1GH7A 4U49A 4KVNH 4I3RL 2GJ6A 1WFNA 2XQBL 3X3FL 4ZSOB 2KQMA 1TCRB 3W81A 1ED3A 2MCPH 5E1HB 5KVEL 5GGSA 2H8PB 1NCCH 4L4TA 1N6QH 2EDRA 1EO8L 5H37G 3LEVH 4EI6A 3D3VA 4M6OL 3SGDH 3HI5H 1F45A 2IH1B 3MV7D 5EU6D 2MCG1 4OGYL 3IB4A 4TUJA 4UI2A 3LN4A 3W0WE 4EI6B 2J6EH 5CZVH 3OR6A 4TRPH 3IETA 4U6YA 4HEME 4ZOBA 2CLZB 2XKUA 4H5SA 3ARVA 2NY0D 3D1MC 3KHOA 3MGAA 5JPMA 1FLRL 1TJIH 1SJVA 1JPGB 3EO0B 1A6TA 4GS7C 3S34L 1IM3A 4X6EB 3MLVH 5F7EH 3C2SA 3QIBD 4MJ5B 4H8WC 1CE1L 3JV6A 4I4WA 2F19L 4IRJD 3ZLQC 1GGIL 5F7WC 4WFED 3F62A 2D4DA 4YXKL 3ULUE 2H3NA 4NO5A 3MQIA 2FJHA 4KROD 3P40A 1YA5A 1QVOA 1WFOA 4HZAA 1KIPB 1T1XB 3KPMA 3OR7A 1K5NB 1A21A 1QRND 5AG9A 1KFAL 1YUHA 5F96L 3VG0L 4XXDA 1AR1D 2AK4B 3QIBA 5C0EB 4LPCA 4X7FC 4DTGL 4GG6E 3PQYA 1A7BA 2PW1A 2CXGA 4M43L 1P9MA 1BFOB 4XX1G 1HHIA 1NAML 1KIUA 2VDNL 4WU7A 4LF3A 1S9VA 4JFYA 5HGDB 1S7RB 1BQLL 3C5JA 3KPSE 1P9MC 5CLTA 3U7WL 3QUXD 4MX7B 3FHQA 1QRNE 5MI0B 1PYWA 1M7IB 3I3BA 5FOBA 2WUBH 2P8PB 3V4UH 4ONFL 2EDKA 4J3SA 1T1WA 1QSFA 3QQ3A 4ORGA 1QFWH 3SGEI 5HYJA 3RWIA 1ZT7B 5EZOL 5LAXA 4F57L 4P46B 3MLZH 2EZ0D 1PZ5A 1WCQA 4PBWD 3BXNA 4YEFA 3NAAH 3FQTA 3ARGD 1KJ2B 1AGDA 1NBZB 2B20A 1OOAA 3GSVA 4RFNC 1RUMH 2YKLL 4N8CH 4DGVH 1CXKA 4R8WH 5HYJD 5CILL 2EDOA 2YMXL 2EIDA 2BFVH 2FECI 4CDHA 4WY7H 2EXWC 2E9IA 1WLHA 2YPLB 5FKPB 3SJVB 4EI5A 3L3KA 5T5NG 5DC4B 4YAQB 3HG1D 4DGVL 2X6MA 5F3BA 4MXQC 4NKDB 3SO3C 3FMGH 3QEQA 3QH3A 3MRKA 4OZFG 2VZUA 1UZ6E 4R2GD 3V5KA 5CCKH 2DI9A 5D1XC 1NDMA 1UACL 3CU7A 2EXWD 1VGEL 3PUCA 3V5KB 3DBXA 5JXAH 3UTQA 1NFDE 5TH2B 4HUWA 4K8RL 4P2QB 3VFSA 4PD4K 3K4ZA 4HD9A 2ICCA 5JIKA 3RL2B 3WNPA 2AEIT 2YC1B 4HAGA 2JE8A 3PL6A 3QFDA 4GKSB 1B90A 5DRNB 5L9DH 5IM7A 1DQML 3CXHJ 3UO1L 3MLYH 1B0GB 1A22B 2EC9U 3NH7H 1TXKA 2P5WE 5SWSE 3WXVH 1P7QA 3LRGA 4RDQF 3O4LE 5DVLA 1UJ3B 1CD1A 2VE6A 3SE9L 2AKRB 3FB5A 4JPKL 2BNQE 3H0TB 3WJLA 5M94B 4QHLB 3S96A 1TMCB 2UVFA 1HXMA 1FNSH 3DRQB 4M6NL 4TYUA 1IAOA 4L29B 3CLFL 3O6LH 1KLFA 1YY8A 2YD6A 3CFDB 4PRAB 4JPKH 3LKOA 5HGBA 2R0LL 4HKXA 1XZ0B 3MGTB 2I5YL 5K93A 3TBTA 1NGPL 1DBMH 2VLKA 4D8PA 5LGHH 4PS4H 4CGTA 4D2NA 1BOYA 3MLWH 2N1KA 4WFGE 1Q8MA 1B88A 1SQ2N 1S7TB 1UVQA 1HYSC 4HKBA 2WINA 2DQDH 4Q2ZB 1MIEH 4PJAF 3DMMB 2RFXA 2IF7A 1RJZB 1FBIL 5D7JA 3HPLA 4HFUH 3NA9H 2PW2B 1C1EL 2VDPL 4DKEH 4JZJA 3T4YB 3C08H 1P2CA 4OCSH 2BHUA 1FFPA 2YXFA 2Y07H 5SWZE 1I7TA 2NMSA 4QHUB 3B6SA 3IU3A 4HT1H 3NACL 2VQUA 3JTTB 2AK1H 3GIVA 4KKAC 4PJ7A 1WEJH 3AU1B 4JG1L 1LO0L 2E9JA 2B5IC 1CICB 3RVWD 4PJ5A 3MA9H 3MZGB 4XNUL 5D1ZA 3GIVB 3LN9A 3KDMB 3KVQA 4HG4J 1KXQE 1S7UB 1U3ZA 1ZS8A 1HZHL 2PXYB 1J5OH 1T5XA 2WWMD 4LASH 1K3ZA 3MO1B 4MA8H 2DYPA 4YHNB 1WZMA 5IWLA 1EEYB 1J5OL 3GJFA 3D5OF 1FSKB 1XR8A 3I85A 1I8LC 4P2CG 1X6LA 5CINL 3K0WA 2XN9A 4UT7L 3KS0J 1MHEA 1T04A 4OLWL 1NEZA 1WJ3A 3GBLA 1FVDA 1MCEA 3U0TB 1YPZB 1EJOH 1YC8A 4H1LG 4MNGB 4HV8B 2XA3A 1N0LA 4JPWH 3L5JA 3OQ3B 2F74B 1ZSDB 2B1HL 4LHUB 3E8UL 4XC3L 1WUNT 1UH4A 2ZPKL 1JWMA 4AJ0A 4ZTOL 3HZVB 1UCBH 3FFDB 2BX5A 4L3CA 5T1LB 3GSNH 1IM9A 5ELIA 3RWGB 4ZUSA 2J8UA 3SDDD 1N64L 3EBAA 3TZVA 5AZ2H 5A3IC 1CD9B 2BY2A 2FDBP 5KSBA 4KI5F 2R2BB 4G8FB 2Y23A 3VA2C 2B5IB 4OM0H 1XIWD 4OLVL 4I1NB 3HNTH 5CIPB 5FCUL 2ICEB 4KPHH 2E7LC 1YNTB 4TUKH 2AXHA 3GI9H 1JTOA 4MCZA 4P2QE 1U0QA 4AMKH 3EYQC 1JPSH 3SO3B 4WV1A 4WTXA 1JJUA 4YR6A 3BAEH 5BRZA 4PY8I 3RDTB 2YZ8A 4UUJA 3IFLH 5I15H 4NN5B 1UH2A 4TUJB 4X6DB 1ADQL 2A83A 5J13C 3CH1A 3MGOB 3ECBB 3DROA 4OIAA 5C0CB 5A1AA 1U58A 4AEHL 5HY9A 5B8CB 4O5LH 2VN7A 4ZXBB 3WXWL 3TN0A 1IFHL 1VFBB 4JRYD 4AEHH 4UTAL 5C0BB 2VSDA 1UXWA 4ZS6D 3WUWB 1XGUA 1XR9A 4J3TA 4V1DD 1IZKA 4XBGB 4R3SB 1I1CA 5DRWA 4MNGE 1U92B 4PUBH 2I9LA 4GRLB 3MJ9L 2R8SL 5ECJE 1V3JA 4E42B 2FIKB 4YHYB 5DJ8A 1A6AA 5HI4D 4K7PL 2LU3A 1BFSA 4I8DA 1E28B 1PSKL 5SX4I 1EFQA 3SDCA 2IAMC 4EOWH 4DK3A 5DHVA 1N4XH 4BJLA 2FYYB 4UNTA 1AIFB 3SDCB 3OGOE 2VXTH 5DEFB 5GRJL 2Q20A 1YEHL 1L6XA 2R0WH 4OCXH 3AGVA 4DVRL 2GSIB 2XWJA 4JDTH 3PV7A 4OCWH 1A7PH 1A7NH 2CLRA 5BRZE 2BY0A 4R26L 1BD2B 3QUKA 1HCFX 4UV7H 4BYHA 1I1AD 3B8SA 4KQ4L 4J12A 5IESL 4FFZL 1WF5A 3KR3H 3DETD 3LPWA 1DBAH 5IFJA 3V0WL 3NFSL 5KZCD 4ODTH 5DFVC 2I07B 4H0IA 3WIIH 2M26A 2ZCKL 4ZFGL 4U6YB 5H2BA 3MODL 5CHNA 1ZA3A 2IGFL 4ODTL 4QHMB 1G7LA 3DVIA 3CK0H 2F54D 3KYOA 4UT6H 2PO6D 1JIBA 4TSBH 3L3JA 1KG0B 4U1SB 1M7IA 1NLBL 4MD4B 1PVHA 4TNVK 4N1EA 4LCYB 2HP4A 2VUOA 3F6IA 3OGCB 3E2HB 4RNRB 2BCKA 1HI6B 3DSFL 3N85H 1P1ZA 3U4BH 3ULSB 3JVGC 3W82A 3WS3A 4ZQKA 2HRPH 1CGXA 3GSVB 2DL9A 3SKUD 1WTLA 2H32H 5F9OH 1G7MA 3ULSA 5IB1A 3DX6B 5C09A 4YHLL 5IK3B 3T2OA 1KJ2A 4XCCL 4XPTL 4R4ND 2XN9E 5EU6E 4OFPA 3R8QA 3T65A 3DMMC 4QRTB 5JW4R 3VFTA 1OTSD 5KVDH 2Z0BA 1IQDA 1M05B 4Z9KB 1MHCB 4NQUA 4JHBA 3MRCB 1RZIB 4WI3A 2FX8L 3OXRA 2JIXB 3OB0H 1Q9KB 5DZOA 4UU9B 2DLFH 2ZUSA 1O5DT 4Z6AT 4NQED 1C08B 3O2VH 4D9RE 1JWUB 2DQTH 3QFJB 5EO0B 2J88H 4K23H 1UJ3A 4ENEC 2WP3T 4MXWH 5TFSL 4YBQD 2F5BH 3DXAA 1JF1A 1JWSA 3P11L 1RJLB 1SJEA 2EE3A 1RIHL 1E4WH 5E94B 4OZ4A 5CEZD 1HKLH 5FGRA 4XNMB 4OLUL 3ES6A 2GJZA 4PRAA 3H9YA 4HHAA 5ANME 5TQ2H 3DTXA 5J8OA 4MAYD 5GIRB 3FONA 5ICZB 3BKYH 3LKOB 3HMXA 4XNZB 2G5BB 2X1PA 2EDXA 3EYUL 4HPOL 3TPKA 2ZNXA 3DRQA 3O2DH 2PXYD 4XVJH 2NR6D 4NJ9L 4NZDA 1EXUA 1QO3A 3OPZH 4M8QA 4MMZC 3KXFB 5I16B 1MOEA 1WSST 5HJ3B 1EXUB 2CDGA 4ZXBC 5ESQA 4JRXE 5D7JB 3T2PA 2CDGB 1TCMA 3DO7A 1I8MB 4Y4KC 2JF1A 4HIJB 1VEMA 5CIPH 2BP3A 4CNIA 1MCDA 2WQ8A 5D7JC 3TA3A 4OI9A 4K94H 4MAYA 1LDPH 4HSQA 3QCVH 4I9WE 1BZ7B 5I1AA 4OV5B 2F19H 2KBGA 3ARYA 5J9PB 4HK0A 1Z0NA 5I1AB 4OV5A 4O2EB 4OCNC 3K81A 4H1LH 1IJ9A 1AQDA 5E6IA 3GMNB 1NMBL 4W6YB 3MNWA 2MSPA 4JQVA 1YEKH 3HB3D 4IIQB 3VFWA 5I6XB 1IVLA 1KIQB 1QUNA 4XC1L 4JFPB 3ILPB 2QBWA 1UKSA 1ZVHA 3P4MA 4WFGD 1FGVH 4W81A 5SV4A 3RWCA 4XNYH 4XRCA 5ISZD 3NGBB 2ZUQC 2XRAL 3C5ZA 5DTFA 5J6GB 4KK8D 1Y0LB 2JB5H 4LKXB 3VJ6A 5DQJB 2VH5H 4L4VB 2AQ1A 4RMUA 5F93C 2PR4L 2F74A 4KDTA 2EEDA 1NGWB 4GW1B 4H88L 1BX2A 4KJQC 4LSPL 2W9DH 4ONGL 4Z7UF 3BIKA 5J1AB 5I9QC 5FYJE 2AJUH 2NTSP 4IOFC 3B9KA 5L2JA 4LSPH 2MFNA 2YPVL 4TTDD 2ESVB 3QDJE 4NYLB 2EO9A 4JFED 1Q0XH 5K59E 5FYLL 5T1LA 4G8FA 5BQ7B 4JM2B 3AS0A 2PO6A 3EDKA 4F7EA 1OT2A 4I18C 2P48B 2V17H 1NAMA 5F6HJ 4F7EB 1GOFA 1D9KC 1MREL 1XF4B 2AXJA 1YC7A 4PLNC 3TA3C 2DL2A 3I3EA 4Z7WA 1RZ8B 1KYOK 4LLWB 5FA3B 3QEHB 4KRLB 1MWAL 4CKVX 5CCKL 1JPFB 1H15A 5FV1L 1JMXA 2FZ3B 1IKFH 2HFTA 2VDML 4B5EA 4NFBA 4RBPK 4DWHA 4N9GB 5J3HC 3NN8B 3H9HB 4JREC 4NZJA 5DJCB 5ESVB 1HDMA 5I1HL 3TO4B 2AEQL 5B8CA 5EU4B 4NN6B 4KJWD 3UO1H 2QKIB 4RRPG 4WTZG 4QOKB 4AEIL 3VFOB 5DJ2A 4HC1H 3QEGL 2P8LA 1JZ7A 4LSRH 2Q3AA 3V5DB 3WHXA 1QSZA 1OARL 4JFDB 1JUFB 1N5AB 4Q7DA 2Z92A 2I60H 3DV6A 3KPNA 4LSSH 4WHCA 1G9MH 1Y6NR 3S9DB 2OTUB 5EULV 3EJZD 4P5MA 1W0YT 4YHZL 3DETC 2QHRH 4BK5A 1QA9A 3AREC 4M93B 4W70A 1MHHB 3D9AL 1OP3H 2A1WH 2PTTB 3FB5B 3QDGB 4PRPD 4YZFF 3V6OE 1GHFL 1T1ZA 2CRMA 1W2KT 2NQCA 3NIFE 3HZKB 3O6KL 2F8OA 3HAEH 4Y5XB 1SJXA 4ZAKB 2VB5A 1MCOH 2EECA 3QSKB 2I9TB 3NA9L 1GHFH 2VDPH 2AK4A 4ELMF 3MLTB 5IHUH 1GZQB 4OD3H 2VLKB 2UUDH 3T0AA 4D8PB 2A83B 3EDDA 2PYEA 1S78C 3GBML 3WO4B 1PYWB 2FWOB 3P0YL 3OKKB 5I1JH 1B6DA 4OD3L 4XCNB 1FVEA 4KHTL 3T0DA 2J7LA 3VWKB 1IQWL 2NXZC 1OSZA 1H0DB 4YIQB 5J6HB 5I8CA 1FIEA 5BS0E 3MV7E 3DURA 2XA8L 5AYUL 3KJ6H 2EIBA 2O5ZH 4DEPB 3HZYA 4LPUA 5MHSD 4HT1L 3GSWA 3ZKSD 1RU9H 3S5LG 4EEEA 3ULVD 3JWNC 1PQZB 5T5FL 1BBDH 1UCTA 2W0PA 1QFHA 3LH2H 3RGVA 4G6ML 5KSAC 2ZOLB 3O3DA 1PZ5B 2EDTA 3NIGE 1T03L 1XIWB 5GZNC 3GMQA 4PJIF 5IG7B 1SY6L 1L4IA 1K4DB 4NRXB 5FK9A 1CG9B 4EDWH 4XP1H 4ISVA 1CLYL 4JFEE 4I2XE 4W4OA 4OAWA 5GGRA 1HEZB 3AFLA 1BAFH 4WEBL 4EDWL 5CGYD 1YJDL 2VAAB 4RMWA 5KVEH 1QFUH 1OWWA 5F1IB 3QFJA 3SDDC 1FL6B 4NDMA 3RL1A 4LOUD 3MRDB 4N90D 2D4FA 5B38A 3BZ4B 4GBXD 2NY0C 3C8KA 5E99H 1DL7H 1HHJB 1J1OH 4URTB 3TM6A 3ZTNH 2PYED 3FRUB 4GXUM 3RIFK 3K8MA 1IAOB 4XPBL 2OX5A 5T1MB 1A2YA 4PY8J 3T77A 4HMDA 3RVVC 5IVXE 2BOBB 4GUPB 3QDMA 1WVZA 2GKIA 3MBED 3QNYB 2EDYA 3BP6B 3PIQA 3VGHA 2P43B 1EJ6A 2JJUA 3CH8A 1G6RB 1E6OH 1MRCH 3FTGB 2FHBA 2X5PA 4G7VL 4NQTA 1P7KA 3MBEB 4L9LA 2JB6A 5DZNA 1XGQA 4TUKL 1LHZA 3KPPA 5IEHA 4ELMA 1ZHKB 3FO2A 3D0VB 5FM5O 5EH1A 3K2MC 2VL5A 5CJOH 3SGEH 4NZRL 5IEHB 2OMBA 3VG9C 4HXBL 3O6MH 4TNWF 1AHWB 2Y5TA 5EB9A 1ADQH 3P73A 3T1FA 2QSCH 3DX7B 1UM5L 1VGKB 3MXVH 5CJOL 3UTSB 5AD0B 2JLLA 1CLZH 4PRBA 4X4YB 2CUIA 4HK0B 2CUHA 4MYWB 4JJHA 3RZCC 1YEGL 2EICA 4PJXA 2Q76B 5E2WH 4UILH 3OXSB 2OS7A 4ZPVA 4U33A 1I7TB 3CSYA 4K94C 4LU5H 5DRNA 4KMTL 1JV5A 4HWBL 1TTFA 3BH8A 2R0WL 5D9SA 5DWUL 4ZAKD 2XTJE 2YWZA 3IKCA 3F8UB 1HQRB 1WWAX 4MA7H 3RWCB 4Y1AD 3CDGA 1VADB 4N0YH 2CK2A 4FQHB 1QLFA 1RAMA 4NZUL 4QY8B 1UH3A 3THML 1NDGB 4MA7L 1A6UL 3GB7A 1MFDL 2FBJL 4NHCL 2DYPB 4OCRH 4WFFD 4DN3H 4DW2L 1XZ0A 3MGTA 5T1LD 1AXSA 2RR3A 3QCUL 1U36A 1TLKA 4PV9A 4XI5C 1N6VA 4PG2C 2G2RA 2PUQT 1RD6A 2CIIB 1EPFA 2GT9B 3O4LD 3V7MA 5IIEA 4UV7L 3HC4H 5SWSD 5L2JB 1FL5A 1KN4L 1OGAA 3MUHL 1HHGB 3HPLB 4ZUSB 3RWGA 4KAQH 1X7QA 4XPHH 3LRSA 3VGAB 5J89A 1Y18B 1BX2B 3BO8B 4X0KA 2ITCB 2NY2D 3RX7A 1KC5L 4Z7UE 1C5CH 3TNNB 4KUCF 1CDGA 5F44A 4CVUA 1NCBH 3CX2A 1UENA 3OX8A 3QXTA 2V5SA 1E27B 3LN5A 3L3OB 4Z0BL 3RWEB 4WW1B 3BPNB 1ZS8B 4KK5D 5E2UH 1U95B 2IQAA 4K8RC 3AREA 1EEZA 4PR5B 4J4PC 2GTZB 3GI8L 5KVFH 2M8XA 4H20H 4P57A 3GKWL 5ICYB 1PDKA 3MV8E 4OM1H 4U2YA 3DX6A 5C09B 3I75B 4XCCH 4XPTH 2DDQL 5HI5D 3MOQA 1I8KB 3IS0X 3UJJL 5TDOB 2C1OA 1YNLL 5C0JB 5FM4A 3ARXA 4MZ2A 1MJJA 1KEML 3PWUA 3VXME 2UZIH 3EOAB 4LK4A 1UXSA 1VFMA 2QL1A 4PRNB 1AD9A 3E6FA 3BWUC 5LGHL 2CO6B 3ARGB 4G9FB 5TF1L 4PRNA 5E8DH 1NBYA 1MCKA 1OQOA 4PV8A 1ACYL 3OKEA 1IRAY 4ZUVA 4HFUL 5GSVA 4I3GA 5TPWH 1QYGL 5DMYA 4I3RH 4X6BA 4F8QA 1DR9A 1JI1A 2X4SA 2H32B 3R1GL 1NCWH 3ARSA 2Y1VA 1WICA 4ORZC 1HHKA 2VR4A 5C0DA 4JM4L 2Z93A 1AGCB 4F15C 4NJAL 2FJGA 1UKQA 2ERJC 4XGZB 5J4MA 5JORA 3BHBB 1J1XH 3KNBB 3PHSA 4OB5H 1NFIB 1CI5A 2NY6D 2ORBH 1N3NB 4MA3B 3IXTB 5D71H 2UY7A 4KU1A 2IANA 4AT6B 3FFCE 4NKOB 1U8HA 4YC2B 4D0BB 2GI7A 43CAA 5CINH 3UDWA 4XBEH 5B22A 4FRWA 5JQ6H 5FFLA 1U8HB 4D0BA 1HOCA 1QFWI 2D7TH 3GSWB 4YNYB 2BSSB 2X4PA 3AAZB 5JOPD 3HZYB 2DIAA 2WUCL 5JQ6L 4Z7VB 5DA0B 2ZZUT 1KB5H 5KS9F 4ALAH 4C58B 1AO7D 2UY6A 5TQ0L 5DSCA 1CT8A 3D6GA 4QT5B 1YUHB 1J8HE 3ZE2E 4JFFA 4LVEA 4G43B 3SBWA 3HMWH 2FHCA 1MY7A 5AZEL 1UM6L 1K4DA 4GRLC 4KK8C 2F53D 4U1JB 1I7UA 4UIKH 1FYTA 1DSFL 4CN4A 1DQTA 2H2SD 2EDQA 5C08B 3SJVE 4YH6A 4CMHB 5GRVL 4LARL 3UPRB 3TLRA 4G9FE 2ZUTA 5C9JA 4KPHL 3FJTA 2J4WL 4HIXH 3X12B 5DA4A 5C3TA 4YHPA 2DB8A 1S7WB 5D8JL 1KTLB 3HC3H 1UQSA 4TTDC 3MROA 4NQDA 1CFQB 2P1YA 5K9QI 2IBZX 3QIUD 2PTUA 4GW1A 1KJMA 1MCFA 5TDNB 1T2XA 3T77B 3WXWH 1SM3L 3F58L 5T3ZL 4WVRA 1QR1A 3Q1SL 1AH1A 3BIAX 3QO1A 4HJ0C 1UB6B 4B50A 1WTGT 1DLHA 1RJLA 1SJEB 2BCKB 5EDXA 3Q2CA 4WHTB 2DM4A 1G9NC 3MJGX 2BDNL 35C8H 1TETH 5ID1B 4L4TE 4K7PH 1PSKH 3VMNA 2ENYA 3IDYB 5AG8A 1NC2A 5AAMA 3PGDA 2G5BA 2O61B 1JTTA 3OHXA 3PGCB 3VXQB 2R1YA 1RMFH 5L7XL 2UWEF 2A6JB 2BVQA 5F9JB 3S88L 3RVVD 5GS1C 1K85A 1T89C 1WISA 2X1XR 4LSRL 3C2AH 1RK1A 3P4NA 4NQCB 4IDJL 1B2WH 3J7HA 4D9LL 1EUUA 5GZOC 5J12B 4P2RD 4QRQA 4OGAD 1HSBB 2VJXA 1BVLB 1RHHA 2AEQH 3QT2A 3ARBB 4FG6D 4FFYH 1PZUB 1K6QL 3MRLA 1OAYL 1B2WL 4MCYA 1AC0A 1JV5B 4OQTH 5J11B 1MCNA 1N2RB 3ARBA 3H0TA 1MLBA 2VQTA 4C56B 3BZFB 1AKJD 2R4RH 4IOSD 2W9EL 1KCSH 4YWGL 2HG5B 1NMCC 3KS0H 3OF6A 1OARH 1WC7B 3V0AC 3VFVB 4D0DB 3MODH 4LSTL 4DKFL 2FX9L 4GKZA 5D72H 1FFOA 1FC1A 3MNVB 3KLDA 4Z5RA 1LE5A 3PWJB 1VADA 3L7FB 2H2SC 3QHZL 5KTEL 4OLZL 3G6JB 2J5LB 1OCWH 3SDAA 3GB7B 3KPPB 4GRLD 5C0CD 3SE3A 3SGDI 2Z4QB 3H3BC 1HHHB 3I6GB 4GMTL 5IB5B 5IVXA 1CWVA 5D7SH 1TQCC 3NCJL 5AYUH 3BEVB 2B39A 4JANA 2AEWA 5IV2B 4GAFB 5KVDL 1SBBA 5HHNA 4OQTA 2E9WA 5HHVH 4PJXF 5EO9A 1AQKH 5D2LB 4Q0XH 2VUYA 1LEKA 3RWEA 5I30H 2V7NB 3ARRA 4YLQT 2ATKA 3GHBL 4HG4K 2CR6A 3TVMD 1FIGH 5JA9A 3HR6A 5GSRA 3U83A 1T21A 2NZIA 4HUXA 1NBQA 4LEXL 4HWEL 4EN3B 2C26A 3K8LA 1KCUL 1EDQA 5C07E 3ILPA 2GW5A 4M7ZC 4U3CA 4LEXH 5EU6A 2C1OB 1LD9B 1ZT4A 3FCTA 2WWMC 3SPVB 4WWKB 2H6PB 3NN8A 4FQQA 5F3HA 5IR1B 1QFUL 1GOHA 4JLRA 1NGYB 3QDJA 1U8IA 4FTVA 1FO0H 3WV0A 2VLMD 1KBGH 3OR6B 4GRWE 5EOQH 1OTTD 5F7DA 1QRNB 2CKNA 1V5JA 3ARGA 2NPLX 5DURD 4XMKH 2MCPL 2FGWL 3E6FB 2G5RA 1OW0A 2NY1C 2DJSA 4U1HA 4E5XA 3FO0L 1M71B 4MHHG 1FHGA 4PRHA 3DVGA 2NW3B 3VG9B 2VZTA 2VZ3A 5T1KB 4R96A 4PP2A 3Q6FB 5DQ9A 5BS0A 4X6BB 3QXDB 1IGTA 4P5MB 2DQJL 1QSEE 4PJEA 4UDTB 3QXDA 3HUJA 2H9GB 1C5DA 1WQVT 3CVHB 1JUFA 1TJIL 2XQYK 5DLML 3BMWA 2HRLA 3HUJB 1ES0B 3CPLA 5C8JB 5HGHA 3RZCB 1U8OB 4LEOB 1EVTC 4O58L 3RA7L 5JR1L 4QWWC 1U9KA 5K9JH 4UTBH 3EOTH 5EWIH 2LV4A 3GHEH 2Q86B 3ULUD 4FZ8L 5D7IE 3RKPA 1M4KA 2X4RA 4UTAH 5HYQB 3TJEH 3BHBA 3I75A 2IALB 3EOTL 5EWIL 1F6AB 2VR5A 4FQXC 2IH1A 1C7TA 4NC1E 3QG6B 3FO2B 4QXGH 3WFCL 2IADB 1FLTX 1OW0C 3V4PL 3PWPA 1HOCB 3MBXH 2FB4L 2F8VA 1AGFB 2Q6WA 3BKCH 3U7YH 4JQXC 3RIAF 1A6TB 3DSNA 3KGRA 4JB9L 3QPXL 3VFUB 5CBAB 4GLRH 4HH8A 2P24B 3U4EB 4HGMA 1A1OB 1H8NA 4HUNB 3G5VA 2BY1A 3VXSE 3Q48A 4FP8H 2XI9A 4X7TA 5IBTL 4XVSL 1KPUB 3IDJA 3QPXH 2XWBB 3G5VB 3E3QC 2DTML 3UJTL 4H88H 1CXEA 1YEJL 4AM0A 4CJ1A 5GS2D 5KSBE 4ETQB 4U1JA 5F70A 2YA1A 3V4UL 2VDOH 4B7LA 3QB7C 3BN3B 5IK3A 2H3NB 4NO5B 4EKXA 4DVBB 1O7SA 1QNZL 3IJYB 5JPNA 1GYAA 3MTRA 3UP1A 4LFHD 1WAAA 2NY4C 3KPMB 5D5MB 5DC9B 5GHWH 4DFIA 4FFZH 1Q0XL 1ZLSH 3AXLA 3QJHA 5FYLH 1SEQH 5J1TC 2XYCA 5D5MA 1GXEA 5FYJD 3BD4A 5EBWA 1XEDA 2D7MA 1GGTA 1XF2B 3S36L 1T22A 2VXSH 5BXFB 4OFKA 2B8OT 2QADB 2FBJH 2GIYA 2APVA 1FH5H 2OL3A 5CBEA 2FNBA 4YEEA 4UOW1 3KAAA 3CK0L 4JY4A 1C08A 4HUWB 4X99B 3SDXB 2GJ6E 4GQ9H 3S4SA 5HI5C 3MJ8A 1BMGA 3PNWB 3MXWH 1DBAL 2QADC 3N50A 3QUYD 1ZXQA 3QHFH 3WIIL 1SEBA 3F7RA 5IFAL 4BSVB 4N1CA 3VWJC 1DN0A 5K9OB 4LCCB 4NM8L 1S7SB 1YEDB 2XY2A 2HFFA 3VFPB 5A2FA 2XQYG 1IGJA 2X4PB 2NY1D 3QHFL 1Z3GH 4NFDA 1X7QB 3RRQA 3V7AE 2XZQL 5CEYB 3DVNB 4LSDA 3VXRE 4QRRE 3C5SB 1Z3GL 1OGTB 4JHAH 4HS8L 4XAWL 5MEND 4WEUD 3WFBL 1UB6A 3V6OC 3VGGA 5D1ZC 4MS8D 2ESVE 4WUUA 1UZ8B 4Y5VB 1Q38A 4Z0XB 2CH8A 3LKQB 1RZIA 1NGXB 3VDBA 4J3WA 1ZLVK 2R1YB 1EEZB 4Y5VA 1NDMB 2IFFH 2LAAA 2KZ1B 3FT4A 4S1RH 1A9EB 4LRIA 3C9NA 3U46B 3ULVL 3TN0C 4M9OA 3NCYS 1I9JL 1GC1L 1QFOA 4TSAL 3MRBB 3I6KB 3OTTA 1YEFH 3LQZB 4NUGH 5I75B 5HDLA 1YNLH 2Q1EA 1UXWB 4PS4L 3H8NA 3B6SB 1XGUB 1RIHH 4L4VE 3IFPA 1GC1H 3BEWB 3BZFA 4Y5YC 5IHUL 3HE6C 3S97C 3KJ4C 2B0SL 4FZEL 4K8RD 4PTUA 5CKAA 2DQTL