3HA0A

Crystal structure of the ige-fc3-4 domains
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
209
structure length
209
Chain Sequence
b'VSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVQLTWSRASGKPVQHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ig epsilon chain C region
publication title Conformational flexibility in immunoglobulin E-Fc 3-4 revealed in multiple crystal forms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 38
structure length 209
sequence length 209
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ha0A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ha0A02
4LLMB 4RGNB 2A73A 5CGTA 3ZE1F 4PJFE 2MJWA 2SEBB 4GUPA 3RVTC 5FB8A 4JFPA 1MFDH 3IF1B 3SGDH 5EIQA 3UO1H 1V3LA 3T1FA 1ZK9A 2GJ6D 2YUXA 2CLRB 3KLSA 1XF4B 3QO0A 1NC2D 3U1SL 2Q7YB 1QHOA 4RISL 3SKNA 1WAAF 3NPZB 3QSKB 5IG7B 1S9XA 2C4FU 1KLGA 4HHAB 2E27L 3N85H 4DFHA 5DR5H 4Y1AA 3EO1A 3GGWB 4YBQD 3V5HA 2MPAL 5E2JA 4PG9A 4Y5XB 3WE6A 2R0LL 5E4EB 3O8XA 1MH5B 4FZEL 2Z8VC 4MAYA 3ES6B 2EXYC 4HLZH 1MIEH 3KYOB 2J2ZA 5ALBH 4Q9RL 1JK8B 1UADC 4K9EH 5FA3B 4EIZC 1D3CA 4MDIB 2BOCA 3RDTB 4EOWL 5IGXH 4TRPL 1ULVA 1XIWB 4LLDA 3DOSA 3SDYH 1AE6L 1EGJL 4ELKA 3S37X 4FNLL 1CS6A 3IXTA 3SE3A 1N64H 2A1WL 3G08B 4PV8B 1G7MA 3UZQA 3FB6A 1G0YR 1FLRH 5C0BE 1BVKB 1DBML 3RVXC 1KGCE 3NCBB 4NHCL 3O81A 4PBXA 1ZT1B 2QSCL 5FYJD 3OV6A 4MLSA 5DQJB 3DYOA 2I5YH 4XBEL 3VXOB 2R9HD 5MEPB 4QHLB 4RBPH 4XXCA 4XRCA 1WIUA 3MA9H 5AZEH 4TSAL 2K7PA 5MENA 4P5TB 3UBXA 4MA3A 4NFDA 2MWCA 4B53A 3HLAB 3PHQA 1FVCB 3OHXB 5D1QB 3BKML 3I84A 2DQEH 3VFWB 1K3IA 4QRPE 4OJFH 1A7PH 5EFIB 5MEOA 4QT5B 1S7RB 1MFBH 3FN9A 2CDFB 4S1QH 1HQRB 4HC1L 2ZUUA 5HPMB 5JDSB 1P9MC 2OX5A 2BHZA 4JQVA 4PJHF 4ZQKB 4F2MB 3E6FA 1OVZA 2X1XR 1GH7A 3IDYB 1KB9K 4F33B 1RULL 4IRZH 4JZNB 3Q5TA 4UQ3B 4HKJB 3LCYA 2XWBB 3QCTL 5IVZA 1AQDB 1ZT4A 4YXLL 4H88L 2Q87A 1QSED 2CXKA 5DEFA 3IDGA 2C26A 2NXZB 4U1IB 3BPCB 3WNNA 5L7XH 2LU7A 4OF8A 5F44A 1IGJA 5CLWA 1PQZB 1F42A 2X4NA 5ANMB 3PJSA 1JGUL 1UYWL 4MD4A 1A9BA 4NQED 5M95B 3LV3B 3W9DA 4QOKD 2BNQA 1FO0L 5TQ0L 1JHTA 1CR9L 1ORQA 5F9AC 1B3JA 2F19H 4R26H 1R24A 1J1XH 4R4BA 4JRWA 5FUZH 1OAXL 3MJ9L 4WDIA 1FZOB 2YPKB 3EDKA 2BVYA 4PP1D 3CX5J 1MVUB 4I48A 3GMQA 5E6ZA 3ROLB 4XVJH 5A2LH 5CBEA 4Y0GA 1HK6A 1WFOA 2ZZUT 3IKCB 4P2CG 2M8XA 1A5FL 5B38A 1GZPB 2Y7QA 2HH0L 4YDJA 5I75B 1CLYL 4GBXC 2AJSH 2WANA 4TQEH 2A2QT 4KVCL 2KQMA 4PJGF 5D7JA 3SEPA 5D1ZB 4KTEH 4CAGA 1A3LH 2P8PB 1FG2B 1Z5LB 4YQXL 1IAIL 5JPNB 4XNMB 4OCSH 1WAAA 1IKNA 1UB6A 4U6XA 4GKOA 1LEGA 1MRFL 4JFEB 2G2RB 4KY1L 4K23L 1Z6JT 3QXDB 4D3CL 4NJAL 4FG6D 3QNZA 1L0YA 3LEVH 2BXZA 4ONGL 5KBNC 1A7NH 1LO5A 4ODXB 2Y25A 3PNWA 4ODBD 1U8NB 4F80A 2CD0A 3WV0A 2FD6H 1WLHA 4WY7L 2HKFL 1VKXB 4DGIH 4ZOEA 5SWSE 2F74A 1RI8A 5EPMA 1ONQB 4NQDA 3X14B 1MPAL 2Y06L 3I50H 4DWHA 5KS9B 2EDQA 3CFBB 4X9BA 4XMPL 2YKLH 4CMHC 1ADQA 1NSNH 4YGVA 2J7LA 3VFMB 5HTSA 5B3NA 4MD5B 5BXFA 3FB8B 1G7IB 4N0YH 1YEEH 1KIRA 1QQDA 3KPMA 3WDIA 1YPZE 3GFUA 4I3RL 1QRNB 3ROOB 3GK8H 5HGAB 4IJ3B 1D5ZA 3PDDA 3WNOA 4BFGA 5GS3A 4Z7WE 5IW1B 3K8LA 3G6AA 4LOUC 1MI5A 2KBGA 4W81A 4PP2B 2GQHA 2BP3A 1I8IA 1B6DA 1MCOL 5J9PB 5FKAB 3SGEI 3LKOA 5CINH 1MFEH 4LU5H 3VXNB 4UT9H 2ESVE 1DL7H 3ZDXE 3EO0B 3U36B 1K9TA 2CKBB 1DVFB 1F4WH 4LCUB 4GW1B 4FXGB 4QRPD 4YHZH 4BFEA 5BV7C 1GJIA 4HS8L 5FCSH 3GSXB 4PJHA 1G7JB 2KDGA 1LO4L 3O9WD 3B2VL 3F58H 3QUYB 4S1SH 3TGXA 3QXVA 5EZJB 3WJLA 1ES0B 1ZHLA 1UWEL 2XY2A 1UZ6E 3A67H 3DURB 4OQTH 4Z7NF 2ZCLH 1J8HB 3ZSTA 2QR0A 1HKLH 2G60H 3MJ7A 1P7HL 3GIZL 5HI5D 1I3GL 2AQ1A 4AENA 4NP4H 5IR1B 4U6TA 5I17B 2HFGH 4PY8J 1FC1A 5C0NC 2J6EL 3L1OL 1JPSL 3CLEH 4CJ1A 2LAGB 2R0WL 4JJ5A 1CDHA 5IM7B 4G8IA 2GITA 3QEHA 5KTEH 2DYPA 3TYFB 4PLJC 1W8NA 3HMXL 3HAEG 4GW4A 5BO1H 2AJYL 2Q7NA 3VA2C 4QXTB 2ADGA 5GXBB 1QRNE 1U6AL 2DIAA 2UZIL 4J23A 3HNVL 4P59H 5HHNB 4GW5B 3KYMA 2AKRB 2XRAL 1YEIL 2VE6A 4WWID 2FZ3B 3QAZB 5K9OB 3RX7A 2CUHA 5TDNB 5JIPA 5C0CD 1OF2A 1WCBA 3ARBD 5DK2A 5IB1B 3TPUB 1FJ1A 4FQXD 3GBNL 4ZUTA 3FQTB 4HK3N 4IRSC 4F7CB 1XR8A 2BDNL 3EYVB 4C4KT 3VXQA 4JREB 4FFWD 3HE6A 3OQ3B 3IAPA 5E6IA 3Q0HA 4L4JA 4LL9A 1RUQL 4Z7UB 1ZHKA 2AAVA 3ARFA 4JR9L 2V9QA 3L6FB 3OXRB 3S4SA 5DUBB 4K7FB 4ONFH 4PJGA 3CCHB 3JV5A 5IMMA 1WZ1L 4ZAKD 3S96A 1LWRA 1UQSB 2X4QB 1MF2H 3KWWB 4JO1H 4XBGB 2XNAA 2AJVH 3RY6C 1NQBA 4NO2A 4QXWA 1T1WA 4JRXB 1YJDC 2E27H 2EC9T 5DFVC 2VDKL 1CDGA 3ZZ1A 1GOFA 1F58L 1GGIH 4YFLF 1Y6NR 4HV8A 3C5ZC 4NQCB 3QXWA 3OAUH 2R0LH 1ZV5A 4EI6A 4FZEH 5A2KH 5F1KC 2GW5A 3VGAB 4UT6L 1IQWL 3CH8A 4ZUUA 1TZIB 2C9AA 1QBBA 2YZ8A 1CXKA 4TRPH 3G5XA 1BPVA 1KENL 1I4FA 1UM4L 3HC0B 4QF1B 5DQDL 3IFOB 2IALB 4QXGL 1RZJC 1K8DA 4FNLH 4OCLC 3MLWL 4DUVA 5IROC 3WFDL 2AJUL 3KJ4C 2VXTL 4JRYB 4C56E 3FN3A 3QHTC 5CZXC 1LDPL 3RWCA 3KYNA 2DQGL 4OLVL 3ARGB 2Z8SA 5SWSD 4L8CA 5ENWB 3BP6A 4NHCH 3UAJC 4X6DB 1NUNB 2QQQA 2AK4A 3FO9B 5I1CH 4NNXA 2QSCH 4HX1A 5IFAH 4OAWA 2D0GA 1CYGA 5E6YA 4XBEH 5F9OH 3OR6A 5HYIA 2R1XB 2BY1A 4TSAH 1KFAH 1A6TB 3O6KH 5A16A 4XCNA 1N6QL 1QO3B 3SCMB 4TSBH 1MCPL 1D7FA 3E2HC 4LLAA 2P24A 3PL6B 3UPRA 3PG2A 1HHKA 3SDDD 5T5FL 1LO0L 1RK0A 2OQJA 5E4IA 3O3DB 4M5ZL 5C09E 1F97A 3ZDYE 4HC1H 3SKUD 3PP4H 3QDJA 2YD1A 2GTZB 4CVWA 4ZSOB 5D8JL 5D9SA 3TJEH 5HHXH 5H94A 3RVWC 5KVEH 2F58L 1R5IA 2YRZA 4KHXH 3IRZA 4YBLB 4HXAL 4O00A 3QIBD 3CFEB 4FXLA 4XBPA 3I3DA 2A6IB 4G42A 2NQCA 1CGXA 1RULH 3QDMA 4YE4L 3RNQA 2VYRE 3W82A 1BP3B 4YXLH 4FFZH 4HPYH 1RMFL 2H41A 3LD8B 3O6FD 5C0FB 3QQ3A 1QTYT 4U1KB 3C09C 4NO5A 4Y2DC 1HYRC 4JRYE 5E08H 4YDLB 5GQBA 3RTQB 4J1UA 4Z78B 2Z92B 1RK1B 3TNMB 5I1KH 4HKBA 4OTXL 5BVJA 1UYWH 5IF0A 3PWLA 5FYJH 1X5LA 1XR9B 5DDHB 2GYSA 5TQ0H 4YK4C 4KDWA 2HT4D 4AK1A 4P4KC 1Y18B 5ALCL 2IADA 2V2TB 2VDQL 2P5EB 2BY2A 4WJ5B 3NA4A 1K4DA 4FQIH 4F3FA 1OTSD 5CEZL 1HOCB 3ZDZE 5GS1A 3MJ9H 2H1PL 3VDAA 3FT3A 2DJSA 3NGBC 5GGQL 2C1OB 2BVQB 4PY8I 5BJTA 2JB6A 2V9TA 1U8PA 2CJUH 4K94C 5D1XA 3SHSA 4GO6B 2CMRL 5IFJA 4JN1L 3QPQD 2FJHA 4X99A 2RIKA 1KJ3H 1T0MB 1CLYH 1UC6A 4R90L 3NABL 4OIBA 4TNVF 5BRZA 4HDIB 1S7TA 5EO9B 3BQUC 3PQYB 4BK4A 4KVCH 1OP5H 4XI5D 4RFOL 2WLYA 4GOSA 3DPBA 3BKJH 4C83A 5ICZB 3SDCA 3HPJA 4YQXH 1KCSH 4XMLH 4O5LL 4JHWL 3MLUL 3PGDB 5DJ6B 1CL7L 3U0TA 2FSEA 3DGCR 4I9WE 2E7MA 3T0EE 1MOEA 4K23H 3FFCE 2H9GA 1CICD 4NJAH 2HLAB 1MCKA 4ONGH 1OP3H 5EB9A 4H8WH 1U8IA 4OQTA 1KC5L 2LU3A 4POYA 1LP9E 3UDWA 4PRIB 1ZLSL 2V6HA 4JHAL 1PYWB 3UZEA 4OGZA 3FB7A 2HKFH 5IEKB 4FQ2H 3OJVC 3BP5B 3LKRB 3L95A 3NFSL 1RY7B 3QHZH 4QRSA 5EOTB 3KPRE 3O6LL 2O61B 1NDGA 3VFUB 2Y06H 3DXAE 1AXTL 1IVLA 4EIGB 5FA4A 4PPTA 1A6ZA 3BPOC 3LHPL 4FQLH 2JK5B 2VABB 3HUJE 4UQ2B 3SBWA 1A0QH 1R0AL 4XP4L 2G5RA 4NKDA 2P8MB 4GKSB 4QKXB 3MR9B 1IGFH 3WEXB 3O4OB 1F4AA 1JV5A 4C56D 2Q20A 1KCRH 1R5WA 3GMMB 1PZ5B 4Z7VE 1GIGL 5C1MB 1T2JA 2W0KA 3AREB 2ARJB 4JY4A 3Q6FB 5DMIL 3OZ9L 4WU5A 2CH8A 1RJLA 2XI9A 2FEDD 5D2NE 1LHZA 4IIQA 3RVTD 2CKBL 1BQUA 3PQYE 4MNQA 1HEZA 4G43B 3MRHA 5ESAA 4L9LA 3JVGA 3BUTA 3ZO0A 2CPCA 4RBPK 4Q9BA 3TZVD 4WFGE 1MCOH 4Y5XC 4JGUA 2OK0L 3C6LB 1BBDH 1I1AB 4QRQA 5FKPA 3QXTA 4LLYB 3GSQA 1J5OL 4ORGA 1EBPA 5DYOB 3RDTC 3QFDB 1XIWC 4AM0A 4O2CA 1F4XL 1KNOA 2XTLA 4HS8H 4M8VA 2FIKA 2Y1VA 1OY3B 3V0WH 4NKMB 4L8BB 4PJEF 4Y4FC 5CBAA 5DJ8A 3QDGB 5DRWA 5C09D 4BH8A 1LMKA 3RWDB 2QSQA 4PRIE 2EXYD 2PN5A 3NIGE 3L3JB 4OGYL 3EDFA 3GIZH 5DURD 5AAMA 3TVMB 5D71L 4FP8L 1IL1B 5HPOA 1QEWA 1J0ZA 1E28B 4HF5L 2FX9L 2CIIA 3ECBB 4OM0L 2R8SH 1R3LA 3OJDA 3C5SB 5EU6A 3O4LB 3HPLA 1JPSH 2GI7A 1FYTB 3H3BC 3CPLB 4LGPB 3TNNA 3C08L 3T4AA 4LP5A 4Z76B 2H45A 5I1LA 1FFRA 4P5TC 5CKAA 1CLZL 3PWPA 3MRFB 1S8DA 1XH3A 1CG9A 2VDNH 3RVXD 4MHHG 4Z9KB 3PWVB 2R2EB 4UBDC 3MOBL 1ORSA 4U6VH 3T4YB 2W59A 5HYFA 4EI5D 3HNVH 3RY5A 5BZDA 4IMKC 5IQ9B 4D0CA 4H0GA 3LMJH 4F9LA 3O0RL 2VR9A 5TF1L 4KDTC 3VA6A 4CBPA 2JIXD 3T77A 2W38A 1DQJA 4HBCH 3FTGA 3BZEA 2PO6D 2DI9A 1DQML 2APBA 3MRIA 1NJ9A 1V7NL 5FYKU 1I8KA 4UIKL 4TUOA 2VZ3A 1A6UL 2Z93A 2C3XA 5ID1A 2Y6SC 4X6FB 3F5WB 3ZTNL 3FQUB 2GJ6A 1M7XA 1NC2A 3RY4A 3RZCB 1SM3L 4LQFH 2D03H 4PJFF 3ZHLA 5C8JB 2FO4A 4NPYA 1XGRA 4D0DA 1MCCA 4EJ1C 2VLRE 1WZ1H 1FNGA 4UI2A 3KG5A 4HC1A 3MOAL 4N0RA 1Q72L 4CW1A 3SPVB 2FBJH 1SJEB 1BAFL 1F58H 1UFUA 1JNJA 1FG9C 1QLEL 2YUZA 1MCSA 3E3QC 1JGEB 4UT6H 1XF3B 1BFOA 4RFEA 4E41B 3P0YL 1Q0YH 4I9WD 3T0ED 2W0FA 1T22B 3FFCD 5DJXA 1YZZA 3ARRA 4XC3L 5GSVB 3S98A 4KZDL 2NY0B 1JNLL 4QXGH 4LVOB 4XGZB 2E9JA 2BNRB 2VERN 4HUWA 3WFDH 3C9NA 1TPXB 5F96H 3NZHL 2AJUH 3BKCL 4OFPA 5I66B 1BREA 3EGSA 5IW6A 1UG9A 2B8OT 1IKFL 2XOTA 4KK6C 2GFBB 2DQGH 1T7VA 4JKMA 2E5EA 4LHJB 3KPRD 4NFBA 1RZ7L 4I18A 4U6HB 5D7KD 4JFZH 4M1DL 5LJYH 2FJGB 3DXAD 5EBLA 4M7ZC 3V6OA 1H5BA 5D1ZC 5L2JA 4OD2B 4AIZB 5KVGH 3DUUB 5DI8B 3KPPB 4M8QA 1HHJB 3GJEA 1N0LA 3F6LA 5IBTH 1OPGL 5DHVH 1HHIA 1MWAL 4GBXD 3D39B 4NO3A 1N6QH 3KPQA 2KH2B 1U58A 2VC2H 3LRGA 5HGBA 3K2MC 5JNYA 5IOPB 2EDXA 4XTRC 3MBXL 1G1YA 5T1LD 3N1MC 4RZCA 1HSAA 5CS7A 1F11B 4M5ZH 4Y4KB 1DUZB 3WFCL 4LGRB 1OAQL 4AT6A 2OP4L 5E5UB 2AXFA 4UDUB 1TETH 4KGLA 5D8JH 2Z4QB 3SDAA 4NSKB 2PW1A 3CH1B 1JPGB 4PJ7B 2F58H 2VZUA 3GMRB 3TN0B 3DUSA 5EO1B 4HXAH 1G9NC 1SBSL 4PJEA 4E41E 4Y4HC 3VFPB 2RBLA 3IJSB 4NO0B 3RU8H 5JR1L 3BH9B 1NCAL 4YE4H 1MHHB 1QSEA 2FB4L 3PUCA 5EU7E 3RWHA 1S9YB 4LAJH 2BNRE 1GGUA 4UUJB 2ZUQB 4RSVA 4ZTOL 5D72H 1B4RA 3V5DB 4X80H 4OGXH 1P5UA 3CVHB 3QNXA 1C5CH 2DL9A 3QUXC 1A8JH 1KPVB 3BGAA 3QJHA 4NQEA 4Y16B 4JGJA 4KTDL 4QOKA 2EC8A 5F21B 5T1KD 1GL4B 4CN4A 3GBLA 4AL8L 4KKLC 4OTXH 3S9DB 2VDLH 1OM3L 2V2WA 2V5SA 1NLDH 3DNKA 4DKFL 3DROA 2DQHL 1DBBL 3AROA 1U2HA 3MLTB 4X7TA 3G6JB 4YDKL 1HZHH 1XF5B 4LCYB 3ISWA 2B5IB 1GSMA 4HWZA 2H1PH 3HNTH 1PY4A 2CK0H 4U31A 2PTUA 5GGQH 2QEJA 3FN0H 1DUYA 1ETZB 2VO5A 3HI1B 1MCEA 3JWDC 5CGMA 5SWZB 5AYQA 5FOBB 2HFEA 1SEBB 2CMRH 3KPSD 4S10A 1EJOH 3NN8B 2EDDA 2NY1B 1A14L 4PJ7E 3VWJB 3BP7B 4Q0XL 3VXSD 1D5XB 1KYOJ 1KG0B 4PJBB 4O51B 4PJFA 3C8KB 4DGYH 2DOCA 1M6OB 1T83C 1TZHA 4Q97A 3BEVA 3SJVD 4RFOH 3Q2CA 4XCEA 3D85B 2APXA 5DUML 5EC1A 1CTNA 1UENA 3OL2A 3UTTD 4GKZB 4MB5A 5DVLA 1FORL 3U48A 5TGBB 2XWJA 1WBYB 4XWGL 4MVBC 4HIJA 5EWIL 4WVRA 3O3BA 3FQXA 2VLRD 5GZOC 5F6IC 4OKVA 4WUUB 32C2A 4NZUL 5C0ND 4XP6H 5BZWB 1MJUL 4PUBL 1UM6H 3RX8A 4RQQA 2AXGB 3MROB 5FCUL 3WFEH 1ZEAL 1ZLSH 2WINA 2FWOA 3P0VL 3PE9A 3V8CA 3TIEB 1NFIA 2XZAH 2GSIA 2YS4A 3TBTA 1I7TB 4UNVA 3NFSH 4DN4H 4EN3C 4WI4A 4EUPH 5F1SA 1WWAX 1OARL 3VXMB 1NL0L 3EYQD 1D9KC 3K1DA 4HZLB 4NM4L 3KR3L 3MRRB 2P5WB 1AXTH 4XH2A 4MJ5A 5JHLL 3THMH 1JNNL 4WI5A 3D25A 4W70A 2R2CA 1R0AH 5ICYA 4QXUH 5C0RH 3J7HA 5J1SC 3QG7L 1QA9B 3ARTA 4JGMA 3BO8A 3EJJX 1GIGH 2APFA 3MV8E 4IRSD 4BZ1L 5DMIH 1RUAL 3L7EA 1YPZF 3QHFH 5C0DB 3HFML 4MQXC 2AABL 1AHWB 2R4SL 4LKXA 4XVSH 3N50A 3K0WA 1JTPA 3GMLB 4K3JL 2ZKHH 3MA7B 4Z7WF 1QSZA 2FDBP 3QULB 5FYKE 4K71B 3AS1A 3G9AB 3UPCA 2FCBA 1NUDA 1DANT 2OK0H 4LSQL 5I16A 1M4KA 1J11A 4PLOB 1X44A 1BBJA 3QR2A 4DVBB 3BRFA 3M8OL 2O5XH 5E2UH 3ZKSD 3MUJA 4HUXB 4XPBL 3O9WA 1G9ML 3CAFA 4JFYA 3M17B 4WUUE 4ACPA 1RFDL 3ZDXF 1BQHB 1K2DB 1II4E 1KJ2A 3UEZA 1F3DJ 3C5ZD 4FABL 1R5VB 1WF5A 4Z6AT 3VWKA 4HWBL 3DRQA 5HDQH 1CLOL 5HYJD 1JWSB 4RFNB 2P49B 1Y0LB 5C2BL 2AEQH 1IAKA 1UZ6F 2JJSA 1OB1A 4WTXA 1LEIB 3ARGC 5D71H 3D2UB 4FP8H 1ED3A 5I73B 4L8SA 3VXME 3M1BA 3TWCL 4OM0H 1BLNA 1BGXH 2VDRL 5C7XL 2QBWA 1VGEH 4HCRH 4WHCA 5B39B 4XZUB 5CZXD 3STLB 5IEHB 2EH8L 2Z8RA 3B8YA 2QV2A 1MHEA 1PEWA 4JAMB 1IAII 1M71A 2CLVA 2CSPA 3I6KB 1U3HC 4BK5A 3SCMC 3RP1A 5L6YL 4E42B 5E8OB 3ALWA 2HJFB 3MLRH 4AIOA 3MLPA 3PL6C 4LPUA 3VCLB 5I8EA 1XGUA 3QQNA 5HHOE 5I76B 4MQSB 3MRNB 3O0RH 5TF1H 5C0CA 3ARBA 2H26B 1Q9OB 2IWGA 3OPZL 4FFYH 4JVWA 5KN5A 4FQXA 2C3WA 1M05A 2YD9A 1S7QA 5MP6L 1T21B 2BMKA 2DD8H 4YBLC 3TIDB 3FKUS 1IEAA 4A6YB 3U7YL 1V7NH 1HN1A 4Y89A 3O3EB 4BKLB 3I2CH 2F53B 5BQ7A 1A6UH 1J0KA 4DK3A 5GS0L 2ICWA 5DEGB 4QHKJ 2ATKB 3MUZ1 1P7KA 3CZJA 1EA9C 1SM3H 1UWXH 3TA3A 1MJJB 4P57B 4PRPB 4X0KB 4ZAKA 3RVWD 1EEZB 3F6IA 1R3KA 2DKSA 2WUBL 1RZ8B 2OL3B 4NC1E 3VFSB 3WYRA 2YWYA 5F71A 3H9SE 4DCQA 3BZ4A 3GJFH 1A2YB 3T65B 3OKMB 1HCFX 3MOAH 1CVRA 2OZ4H 2AVGA 4UOW0 3F7RA 3OAYH 1HI6A 1QHPA 5C3LD 4IHOA 1IFHL 1JZ3A 5DGQA 4Y2DD 1N2RB 1QLEH 3UTOA 3I6GA 1MREL 2FRGP 4LVEA 3HNSH 2IAMC 2YBRA 3F7QA 1NGWA 1KTDA 1D6EB 5KAQG 1K8IB 1FDLL 2VLLB 1K5NB 4XC3H 5F88B 4KROB 1KBGL 1QPXA 5EA0L 1OP3K 2XQYG 5HYSA 1HKFA 1JNLH 5SWQB 4RRPG 4X8JA 1VPOL 4HH9A 3P4OA 3SOBH 3LRSA 1XFPA 1D5IL 2JJWA 5FK9A 1IKFH 4O2EA 3QDHA 3AY4A 5JW4M 4NNPL 5GRJH 3BJLA 3RGVB 3OGCA 1A6AA 3DI3B 4AEIH 4MQ7B 3CFKB 3D0LB 4TN9A 3RWFB 3NZ8A 1K6QL 3WHE0 3UJJL 1ZWIA 5I2IB 2GHWB 2YD3A 3WHXA 1MRCH 4XXDB 4PV9A 2R29H 4KXZI 1MWAH 4M7JL 3PWJB 3SDDA 1LNUA 4F8TA 4BA8A 2X9WA 3OB0H 4Z7WA 3MV8D 3I6LE 1FGVL 4OV5B 1HSBB 1F6LL 4Y8AA 3U4EA 4I13B 1NEZA 3SKMB 1AGEB 2XWTA 5L8JB 4U49A 3WL9B 3BIBX 4NOFA 3P0GB 3E3QE 4YLQT 5EORL 3SKOA 5J6GA 5JUEL 2Q1EA 5FYKD 2DMCA 3QIBA 3FQRB 4M6ML 3ZDYF 1WFNA 5DC0A 1VEMA 5CCKL 4LFHG 5TDOB 1XGQB 1I7RA 3DLQR 3VJ6B 2HFTA 1U42A 3B2UC 3IYLW 1D6VH 4MCYB 4YHML 3O6FA 3RX5A 3T3ME 4F37F 1SYVA 2G9HB 3MZTA 1CT8B 2APVA 1NUGA 5FUCC 1KXVC 1KPRA 2OXHA 4M93B 4UV7H 1HH6B 4BYHA 4IOIA 1X5IA 5IV2A 4N0UE 4G5ZL 1IBGL 4ZTOH 4I4WB 2Z0BA 2BJML 1INDL 3S3PA 3HZKB 4JCLA 5IVXB 2WBJA 4OCWL 3JBG7 1DR9A 1EV2E 5ETUA 3QO1A 3MCKA 2ZNWA 3AREC 2VLJB 3VRIA 4KTDH 5I8OH 1CF8H 2IFFL 4JM4H 1N5AA 1TQBC 4AL8H 25C8L 4I5BA 3U46B 2VLKB 12E8L 2ADJB 3QEGH 1F3RB 3C2AL 2DQHH 4EUPA 5ADPL 1MAJA 2H6PA 1EERB 4L8DB 4YDKH 3LEXA 3C6LC 4R2GB 1RJYA 3KHOA 1NCCL 3CUPA 5L88H 1I1YB 1IM9B 2UV3A 4H5SA 1YYLL 3IXAA 4S2SB 2NXYC 3ZDZF 4L5FL 4GRLC 1KEGL 5L9DH 2PYFA 2IEPA 3FB5B 4ZPTB 1X5ZA 5HHOD 3NCYS 5KSAA 4NUGL 2VISB 1UM5L 5FDYA 3HCVA 5FYKL 1I8MA 4L3CA 3BVNB 1N7MH 4TULH 4HFWA 1JPTL 5I9QC 2VXSL 2HT3D 2BSTA 1A14H 1ZHBB 2X4UA 4Q0XH 4NKIL 2MTPA 3TVMC 4RMRA 1O0VA 2D0FA 2ITCA 2FH8A 3QI9C 4MA7H 1RZGB 4Y4FD 4GG6B 2OR9L 3DVGA 5MERA 4AH2B 2EC9U 3MREA 4OFDA 1CZ8H 5DUMH 3HE7B 1KLUB 4NGHL 1OSPL 1FORH 3WJJC 2JCCB 1CICA 3MRLA 1HXYA 3S5LB 4LBEB 5EWIH 3IDMB 2EYRB 4OLYH 4I2XE 5EBWA 2GT9A 4LPYA 15C8L 4W68A 1UXSB 2BSRB 3H9SD 4WHYH 2OJZH 3RJDA 1V8HA 1EVUA 4HUUA 1YQVL 3IFLH 1MCNA 3OAZH 2LVCA 4HEME 1ZTXL 1RHHA 3GM0A 1MJUH 2BXYA 4PREA 2FH6A 3C5JA 5CGYC 4QHKI 1WTGT 2VLKE 2MCG1 3S36L 5LKNA 5L8LB 1LP9F 2KZ1B 1OD9A 3QEQB 1JPST 4NKOA 3U7WL 5D2LB 1ITCA 4M9PA 5C0AE 2E7LC 1OAUH 1EEYB 1QG3A 4UBDD 1H3VA 1A1NB 3T0AA 2X4OA 1RU9L 4HCRA 3GMPB 1NL0H 1RZKL 4NM4H 1J0YA 5F8QC 3KR3H 2I60L 2IGFL 3LB6C 3TH4T 5ESQA 2X2YA 1FH5H 1JNNH 4XC1H 2J88H 3U0WL 3I3BA 3GRWH 1B0WA 4G8EB 4AYFA 3HUJF 3IDXH 4J3XA 4PJ5E 4PB9H 4Q74A 4PGEA 5E00B 1EPFA 5C07B 3BPNB 2NY7H 5IW3A 2C7UA 5HBBA 5BV7H 2Y6SD 4AG4L 4Z7VF 1R3HA 3TZVA 2R4SH 1P4LB 2ADIB 4Y19B 4NN5B 5E2TL 4U3HA 1IGIL 1LVEA 5D5ME 4NZTH 2DQIL 1FPTL 5C9JA 4LSQH 2X9XA 3DVIA 3QH3B 1WFUA 4KI5C 8FABA 1IGTB 4LPVA 4X98B 4GAYA 2YSSA 4QRUB 3LRHA 4FQJL 5GGSY 3RJQB 3IFNL 4M03A 3WIIL 2EDHA 5EO0B 4V2BA 5TE7L 5C09A 2YUWA 4HBQA 3BX7C 2NY0C 4APQD 2XXMB 4FABH 4WIQA 4LVOC 4Y5YC 5HDLA 1U8LB 3WS6C 2JB5L 4HWBH 3L3OA 3RIAF 3V6FA 1FFPA 1CLOH 1S5IH 5C0GB 3GJFA 4D9QE 5D2LE 2OZ4A 5KW9L 3NIGF 4HS3A 5ICXB 1AP2B 3VRJB 1G7HA 1TCRB 4QTIL 1HHHB 2XXCB 1YUHA 4UU9B 4ZXBB 3X3GL 4NRXA 1A21A 2BVPA 2NW2A 1J1PL 5F7NC 3S3SA 3CXHJ 1NGPH 2NNAA 1VEOA 1IAOA 2B0SL 3FRPG 5GRXG 5IWLC 4E5XA 4K7PY 1V3KA 5HSFA 1RQ5A 4GG8A 4LMQE 1GRWA 2EDOA 4KRPB 2NW3A 2I07B 1MCDA 5EU3B 1F90H 4G8GB 4EI5A 1CL7I 1QBLL 2BVOB 1FBIL 3HZVB 3GSOA 4CN1A 3L3HA 3VMNA 1ZA3B 5L6YH 4U0QB 3ULUC 3GSVB 1CGSH 3U2SA 5EZLA 1N3NA 3JV6A 4NT6B 5E7BA 3MPCA 4ODTL 2JELH 2JIXA 3LQZA 3JTTB 5I1HL 4Y19E 3T2PA 1K4CB 2PO6A 4UNUA 3OPZH 1RIUL 2QHRL 4JHBA 2EE2A 1LK3H 5FF6A 1BQHG 3P9MB 4JKWA 2BHYA 1BD2D 4XTRD 3RNKA 4OGAC 3EOBA 2EZ0C 3C60B 1V3JA 4K7PH 1DQLL 1YJDH 2APTA 1P9MA 4WO4B 1NGXB 1N26A 3ILQC 1EZVY 2A73B 5IHUL 3PGCA 3CK0L 1EO5A 4GUPB 5FB8B 3UJIL 4JFPB 2ZG2A 4F7MB 2ZUQC 4MHHI 4PJ9C 4OUOA 2YK1H 2WUBH 3UTSE 4JVUA 4Y4HD 2V5YA 4LSRL 2W60A 1S7SA 3I85A 3MSPA 2XKNA 3DJ9A 4QY8A 1KCLA 5B22A 5B39G 4F58L 3SKNB 4Y16C 1S9XB 1KEML 1VHPA 3C8DA 5I1JL 1FNHA 4XVTL 4G6AD 4Y1AB 5I71B 1IFHH 4XNYH 3V5HB 3GSRA 5KZCB 4WHTA 4PG9B 1MREH 3WE6B 4FFVC 4GSDL 3O8XB 3AM8C 4X5XB 4MAYB 3QUXD 3WSQL 1T7XA 3CSPA 3QISA 1JP5A 4LIQE 4X6BA 3ARDD 4OD3L 4KKLD 1LP9A 1MRDL 2BOCB 1QFWH 3BGMB 4I0PD 2DI8A 4LKCA 5KOVC 4MNGA 3S35L 4LLDB 1KT2A 4XP1L 1AC6A 1JHLL 5D93B 1VPOH 3IXTB 5CWSA 3FQNA 4POZC 2ZG1A 5GIRA 1G7MB 3KPRA 4RDQG 2P44B 1U8HA 1NKRA 3A6OA 5C0AD 3FB6B 1NGZA 3DXAA 3S34L 1Z2KA 2NY1C 2ZSWB 3GO1L 1KN2L 3VWJC 1JPFA 3WIHL 4NBXB 5CZVH 4J4PC 3ZL4L 3W81A 3P2TA 3HRZA 1XF1A 4R3SA 3ORJA 3HUJA 2DMBA 3VU2A 1H9VA 4U1NA 1MQ8A 2VDOL 1JWMB 1RVFL 5EUOE 4DK6A 1K6QH 4GBXA 3DX6A 5CJ8A 5GJSH 4ZFOA 4LEXH 5DMJB 4XRCB 5DT1L 3UBXB 5DMYA 4PJ5D 1EMTL 3FO2A 1PSKH 3PHQB 4U1SA 5T1LA 1YY8A 2E6PA 1GCFA 2IMMA 4RMUA 1FGVH 4PTUA 5DS8A 3CXDH 3ZTJH 1NMBL 2HKHL 1U41A 3X13A 2UUDK 1J7VR 4UINL 5MEOB 3T0BA 4PG2C 1NBZA 3VFOA 1Q9KA 4LPWA 4D9LH 3UXFA 5JUEH 4Y1AE 4MVBD 4RMWA 5DD1L 4JN2A 3LIZL 4OLWL 2XKSA 2OCFD 5CCKH 5GZOD 5A1AA 2DTSA 2VKWA 4WW1A 4L9DA 3I75B 1GAFH 2VR4A 3M07A 3ZYJA 3D3VE 4P2OB 4YC2B 2EICA 1WT5C 1ZT4B 5GSRA 3KDMA 4LF3A 4YHLL 4EN3D 5DEFB 4R7NA 1IBGH 2X1OA 3IDGB 3RVVC 2OTUB 5A2IH 5IHZA 1NLBL 2BJMH 3QUML 1SEQL 4D9QD 3OGOE 4OCWH 4XNZB 1NPUA 4HUMB 1D9KD 1EH9A 1SJHA 2WP3T 4TTDC 1IGJB 3DHJA 1S7WA 1I8LA 5FYLE 3PJSB 2PUQT 1AHWC 3PWUA 4MD4B 1A9BB 5IKCA 12E8H 4LRNL 3W9DB 2HT2D 6CGTA 1JHTB 4P9HL 4K71C 1AGBA 2ERJB 1ORQB 2OTPA 4ONHA 5MENE 3MCLL 1VESA 1NCCH 1R24B 4B50A 1JCKA 4R4BB 4ODWA 4O9HL 2V5TA 4WDIB 4YHIB 3GRWA 1OLZA 3HS0A 3H3KA 4MQXD 3SDXE 1G7PB 1MCWM 2AK1H 3OWEA 1S7UB 4I48B 3KPSA 4PY7A 3GMQB 5ADOH 4MJ4A 4BQ9A 5DK3A 3STZA 4YEEA 2J4WL 2YPVL 1AGFA 1UM5H 2WWKO 1IT9L 5FYKH 3VXSA 5B38B 3JXAA 1JPTH 2DAVA 2VXSH 1P6AB 2Y7QB 4RFNC 1A3RL 4YDJB 3SJVA 3EAKA 5F7DA 4NKIH 4OCYL 4PJ7F 3QDAA 1OSZA 1UACL 4U0RB 3UTTA 3RAJH 3UX9B 1VB9A 1JN6A 4NN7C 1HYSC 5D7JB 5IJVA 4NGHH 5JMOC 4NC0B 5CAYB 3L5XH 2VLRA 3RL1A 2XZZA 4H26A 1IARB 3OBAA 1UB6B 2PXYC 3UTSD 2IBZY 4HFUL 4LHUD 4U6XB 1LEGB 5C08E 5I8KL 1INQA 4CMMB 1UT9A 15C8H 4Y88A 5JO5A 2M2DA 1OAZH 4KAQL 4NWUH 2DQUL 4HWBA 3IFPA 3QNZB 1X5JA 4NM8L 1H3UA 1ZT7B 2IJ0C 1LO5B 3LQAC 1NFDF 1NCBL 4R97C 1LE5A 1NAKL 1E4XH 2BNQE 2VXVL 3U7WH 1U3HD 5HYQA 4CRPA 4PRHE 5EZIH 2F74B 4BSVA 4XP5L 3QWOB 5EPMB 4JQXA 4NQDB 5FGRA 1AD9B 1UWGL 4BFBD 1ERNA 3BE1H 4R96B 3NTCH 1M1SA 5EN2B 4F15B 2IPKA 3U0WH 2IG2H 4YGVB 1T5XA 3O2WH 5BXFB 1NAMH 2YEZA 4IRSA 3KLHD 1V05A 3NFNA 5FECA 4ISVA 2NZ9C 1NGYA 3B4NA 43CAA 1QQDB 3KPMB 4WENB 5LBSL 4AG4H 3GMNA 5DQ9A 3RKDC 1D5ZB 1JMXA 4KKCC 3K46A 2MSPA 3S5LG 5ELIA 3G6AB 3WUWA 4LNRA 5E2TH 5I1EL 6FABH 4X7SH 1MI5B 2A9MH 5T1DL 2R0KL 5E8EA 4HIXH 2DQIH 2OSLA 4NBZB 1I8IB 4DZ8A 2EKSB 4XHQA 5SX5H 3RY6A 5GJTL 2C3VA 5DJAA 3WXWL 4HKZA 3C5ZA 4FQJH 2R56L 3OB0K 3BHBA 1I1FA 5TE7H 5JHDD 4XPHL 5J06A 4KROC 5HYJA 2A6KB 3DMMC 5MHSE 2NTFA 4PJHB 5I74B 1M7IA 2JB5H 4N1HB 2IAMD 1HWGB 2N7AA 4UILL 1ZHLB 5DRNB 2WZPD 5C0JB 4C58B 1J86A 1FZMA 1U91A 1YNTA 2QR0B 1DN0A 2EIEA 3LS4L 5IROA 3RGVC 4AENB 4U1JA 4LIQL 3OG6B 3DHMA 1A7OH 4YH6A 1G7QA 1T20A 3UTQA 1TQCB 3KPTA 3D3VD 3CFCH 3TYGL 4JJ5B 1XEDA 1C16A 2A6JB 1A4JA 1IM3A 4G8IB 2GITB 3QEHB 4J12A 5DA4A 3EO9L 1QNZH 2DYPB 2HVKA 5JW3L 4GW4B 3ULSB 1QPPA 1CU4H 1LEKA 3PIQB 5F9DC 5EBMA 4RIRA 5FYLD 1U92A 2AV1B 3T2QA 3LPGA 5JOFA 4MDJA 3KYMB 1MI5E 4DGVL 2AJ3B 5DMKA 1RIUH 2IPUK 2QHRH 2VE6B 3NVQA 3VFRA 5MEND 5DLMH 1OF2B 1WCBB 5DK2B 4WUKH 3MLZL 5ESVA 2UVFA 5HDOA 1FJ1B 4R4FL 1S7XB 4XAWL 4P2YA 4ZUTB 1DQLH 1XR8B 2X4RA 3UC0H 1U95A 3VXQB 3N1GC 4P2QA 1AH1A 4QCIB 3CK0H 5E6IB 1T89C 3IDJA 4M93C 3BH8A 1E27A 4OI7A 4FQCL 2CO6B 1ZHKB 3ARFB 3S4SB 5E94A 3MRMB 4PJGB 5J7CC 4UDTA 1MCFA 3FT2A 3B2UD 1QSFE 4YWGH 3S96B 3RWIA 3DO7A 4F58H 2DM3A 3LY6A 2MHAA 4Y2DA 1KEMH 2XNAB 4J6RH 1NMAL 5DWUL 1A1MB 4NO2B 1T1WB 2NY2D 3G5VA 1YDPA 3WD5L 1LQSR 3RIAK 5IMKA 4HV8B 4D2NA 5EOQH 1QKZH 4GSDH 2PW2A 4NQVA 1WZLA 3TBVA 4EI6B 3OX8A 4GXUN 3OF6D 5C08D 1NFDA 5J0BA 4OD3H 4ZUUB 5I1AB 4P4KA 5IP4A 5E70A 5E5MB 3G5XB 1I4FB 5FYLL 5HGHA 4W6YB 2UWEA 2X4TA 2ZPKL 1UH3A 1K8DB 1JHLH 3P77A 1JNHA 5K9QG 1GGBL 4MD0A 1ZA6A 5FUOH 3C6LD 2BNQD 5L8KB 3WLWD 4KQ3L 1KIUA 2DWDA 5E5RB 4PJ8C 1MY5A 2R0ZL 2L0DA 3RWCB 2AJXL 3KYNB 4PRHD 1KN2H 1RZIA 2NXYD 1O5DT 4GRLD 4N0CC 3WIHH 4D9RE 4L8CB 4YX2L 5HD8C 1YECL 3BP6B 2D7MA 5TE6L 1MJ7H 2AK4B 1KTLB 4NNXB 4HX1B 4OAWB 2VTFA 3S3JA 5K33A 4RDQF 3OR6B 5DJYA 1FC2D 2J3SA 2NCMA 1DANU 4LAQH 1UVQA 2HYMA 1G9NH 2BRQA 1FFQA 3PDGA 5A16B 4XCNB 3VGBA 3ULVE 1JJUA 4G6FD 3QI9D 2P24B 3X17A 2HKHH 3O4LD 1X5KA 2VUOA 1F2QA 3Q3GA 1RK0B 4KHTH 2OQJB 3M45A 1YMME 3W0WD 2FECI 3LSOA 3S97C 1NBQA 3QWQB 3QDJB 2MCPL 2CIKA 3LIZH 4OLWH 4E0RA 3OXSB 3MV9D 1QFUH 1R5IB 5D70L 2XZCL 3S8WA 4X6CE 3SE4C 5C6TL 5I19L 1P4IL 4F7PA 5ECJE 4G42B 3QDMB 5CGYD 1JRHL 4MXQC 3RNQB 3P30L 4RAHA 3BWAB 3T3MF 5MHSD 4P3DA 2DM2A 4YHLH 4OLZL 5FGCE 3AU1A 3QQ3B 8CGTA 4NO5B 1VENA 3QUMH 1SEQH 2N4IA 1CGWA 3LB6D 2X41A 1AC0A 4J1UB 5LGKA 1QRKA 2QQLL 4HKBB 1WCQA 5BVJB 4OLUL 4N9OB 2AK4E 3PWLB 3UBXG 1AFVL 4NN5C 3KXFE 2XY1A 4PGCB 4D94A 2Q7YA 5DD0H 1Y6KR 4WFEE 1EFQA 2IADB 3MCLH 3DETD 2IMNA 5CJBA 1K4DB 4M6AA 4PJAA 4F3FB 4O9HH 5GS1B 5KSVA 3MGTA 4BQBA 1FRGL 5HHOA 5CD3A 3FT3B 4XHJD 1NAMA 3ZKXC 3K80A 4ZTPL 3JWOL 4NOBA 1MH5A 1GGCL 3ES6A 1CFVL 5BJTB 2JB6B 1RZFH 2HTKD 3SGJC 1U8PB 2K9UA 2YPVH 1FL5A 3HMWH 5D1XB 1FSKC 3SGKA 1JK8A 1RUPH 3ZHDA 1IT9H 5IB2A 3RDTA 4I1NB 4KI5D 5IFJB 3T08A 2NY6B 2FJHB 2BSSA 4X99B 1A3RH 4Y4FA 3KAAA 2W9DL 3OKEA 5CILL 5EU4B 4XAKE 2QADB 3G08A 4OCYH 5BRZB 2GK0A 1S7TB 3ZSSA 1UACH 2O26U 4G7VH 2CR6A 1A22B 3MBEC 4XCCH 4C83B 2C3HA 3SDCB 1BFVH 3HPJB 3X3FH 1MIML 4G3YL 3LEYL 5ILTL 3PABA 1ZVHA 3H9SA 4HEPG 4WV1A 2CRIA 1WWBX 1WK0A 4G9FE 1ZT1A 4HFUH 4KRPC 5HHVH 5I8KH 2LE9A 4H20L 4Z0BL 1C1EH 5C71A 2H9GB 1QSFD 4QYOA 2DQUH 1WBXA 4NM8H 3EYSH 1U8IB 2ZSVA 1NCBH 1SYSA 4G6ML 5JXAH 2DQFA 3ARWA 1F6FB 1B0RA 4LSVL 3WNPA 3D39D 1IC5L 3FB7B 4OCRL 3WXVL 5EC2A 4IMKA 3ULUD 3L95B 4QRSB 2ID5A 5DD5L 1OL0A 4KDTA 1NDGB 1HQRA 4D0BA 1P84J 1CIUA 5JDSA 5HPMA 3FOMB 4ZOCA 2BRRH 3D9AL 5B38G 5FA4B 5JORA 4ZQKA 4ALAL 4WWKC 4JB9L 3T0VA 4ZMAT 3T2NL 4LLWA 4DKEH 5H35A 3O11A 4KC3B 1JV5B 4X7CC 3BFOA 3FAWA 4OZFH 1R5WB 4P23C 2Q8AL 4OGAD 2EZ0D 4CU8A 5LBSH 5K9JL 4MNHA 3RIFK 5FM8A 1TFHA 4JY4B 4D9RD 2JLLA 3VFNA 1YYMH 1U8MA 1RJLB 3B9EA 3ILQD 3AS2A 4KK8C 4YFDB 4MNQB 1HEZB 4OD1H 5I1EH 3MRHB 1MFDL 5ESAB 4L9LB 2R0KH 2YPLE 4PJ9D 5I71C 3QFJE 3HE6D 4WI8A 2X42A 5D5MF 5GJTH 43C9B 3RKPA 1JYXA 4QRQB 2XN9D 5FKPB 4HSQA 4YFEA 3GSQB 2JJVA 3WXWH 4ORGB 3ULVD 2BOBA 1KCVH 4S1DD 4ZOBA 1CFQA 2YD8A 4AM0B 4O2CB 5MEQA 1KNOB 5DR5L 2XPGA 2FIKB 3HC4H 4YHOL 1MVFA 3NIDE 5CBAB 5D93C 1YMMD 5DJ8B 4D8PA 5DRWB 4BH8B 3SQOH 4UILH 1EAPB 1MIEL 4GAGH 2FLBT 5ALBL 3QIUC 2H3NA 4K9EL 3LS4H 2HJKA 5IGXL 5KVFH 1CN4A 2X7LA 2APWA 2ED7A 4LIQH 3IKCA 3SDYL 1QEWB 4KJWC 2ORBL 1JMZA 1R3LB 4H1LH 3AB0B 3EW3B 3OJDB 5EU6B 3PWNB 3WKML 5CEYA 3HPLB 5SWZD 3PV7A 2PYED 4N0UA 2ZUWA 4P46C 1AIFB 1EX0A 3TNNB 3PHOA 4QEGA 3T4AB 4FXKA 3WLBA 1NEUA 4PLKD 5FXCH 5I1LB 2NY1D 1YEHL 4JANA 1FLRL 3VWJD 1MFNA 3EO9H 1BWWA 1S8DB 1XH3B 2Y5EA 1CG9B 4J4PD 5JW3H 5KSBE 5CEXB 4YR6B 3LKSA 1FG2A 1ORSB 5I18L 4OUUA 1X7QA 2OBGA 3GB7A 1H3XA 4N1EA 5BZDB 4D0CB 1MNUL 2FO1A 1MJ8L 5AZEL 3MA9L 4MNQE 3KXFD 1TJGL 4NYLA 4HGKC 3WIHA 3L3GA 4Y8DC 4TNWK 1ACYH 1BD2A 5SX4H 3T77B 3QBTB 4WFED 2EXWD 1DQJB 2AW2A 3FTGB 3BZEB 4JQVC 1FL3A 2DF3A 2HG5B 3MRIB 1NJ9B 1BZ9A 3ULVL 4X7FC 1I8KB 1FE8H 1OAKL 4N5UA 1A7PL 2Z93B 2ZCKL 4XB8A 4GLRH 1VKXA 3MACL 1DBJL 1MFBL 4O58H 1BM3H 4S1QL 1V7ML 4P2OC 4YC2C 1KJMA 2GJ6B 4Y4HA 2Q86B 3TH3T 1NC2B 2IBGA 4ZO9A 2Y5TA 4XB7A 1ZOXA 2FO4B 4NPYB 5KS9A 1FV1A 1XGRB 4D0DB 2A77L 4XVUD 4CU6A 4JDTL 3WFHA 4XNZC 3VFMA 3TO2A 2P47B 3DX7A 1PG7W 1F13A 4HLZG 1FNGB 4XAKD 4FRWA 4U1LA 5DWUH 5SV3A 4CW1B 1B88A 5JW4N 3WD5H 3QUXA 3WNLA 1W0WA 5JOPE 5L0QB 3DTXB 2ERJC 3AFLA 1BFOB 4FS0A 3PWPE 4G9FD 4RFEB 3EFFB 4UTAH 3H42L 3TFKD 3IETA 2W0FB 4JG1L 2NLJA 4HULB 1I9EA 5FYLH 4AMKL 1VACB 3MNWA 4HAGA 3NCCB 3QUMA 3H2WA 1KCUH 4HUWB 3R8QA 2F5BL 2VLME 1A9EA 1BX2A 3C9NB 3MJGX 5JLZA 1OTUC 3RZWA 3UZVB 1C5DA 3EGSB 4KQ3H 4IS6A 1J1XL 5IW6B 1PKQE 4JDZA 1WIOA 1GPOL 3RWGB 1YECH 2LTQC 3PV6A 2B4CC 1BQSA 3HRPA 4I18B 1ES0A 4PJDE 4XVJL 2B2XH 1ROWA 5ISZE 3HG1D 4U0RC 1GC1C 3DGGA 4V2CB 3S4SG 4KK9C 5EBLB 4PJ5A 3VXRB 2VN4A 1H5BB 5L2JB 4ZUWA 4LCWB 5EUOF 2NX5E 1T83A 3KNBA 2W9LA 3GJEB 1H3TA 2X10A 4EVNA 2V9RA 1IKNC 4NO3B 3KPQB 1KIQA 2AJSL 2ZCHH 1KB9J 1U58B 2CXGA 2FLRT 1NC4D 5HGBB 1BF8A 3U79A 5JNYB 4N8CH 5DD6A 2MOVA 5D5MA 3Q6GL 3GNML 4RZCB 1A3LL 4ZO7A 1HIML 5JQHC 3BPLB 4MJ2A 4OCSL 4AT6B 1AGDA 2YPLD 1ZS8B 3QFJD 5F8RC 2MCPH 2PXYD 4OF0A 3MRJA 1IMHC 2MNUA 2PW1B 5HHNA 2XZCH 5GRZA 5C6TH 5I30H 4PJEB 3TBSA 4QWWC 1P4IH 3TO4C 1OCWH 1TTFA 4KUZH 2QSVA 4Z5RA 2E6JA 4M02A 1QSEB 2FZ3A 4I0CC 4YZFE 4EN3A 5K9OA 1BZQK 3KLAA 5TDNA 3BMWA 5J11B 4HKXA 5IB1A 3IGAA 4JO4H 1D9KA 3BUYA 3MLXH 4IMLA 3EYVA 1I3RB 3V4VL 5DVOA 5E2WH 1KPUA 2DQTH 4QNPE 3QNXB 2B39A 3QJHB 4NQEB 2EIZA 4X9FA 4QOKB 2QQLH 1A6VH 2YKLL 4H0HB 5INCA 1AO7E 1AFVH 3TM6A 2V2WB 3CCHA 4EDXA 4PRPD 4N0YL 1YEEL 1BJ1H 2NZ9D 3DROB 4JZOA 4BJLA 2WUCH 1S9KC 4OSUL 4LEOA 4XBGA 4X7TB 3PP3K 4GQ9H 1XCTA 5CHNB 4XNUL 4HWZB 4NCDA 3MRQA 2AXHA 4LSSL 4KKCD 5CUSL 3JWOH 2ZUVA 1CDIA 5EDXA 3SDXF 1MCWW 4U1HA 4E9LA 3V5KA 3DX8A 2Y36H 5DZLA 4OZFA 1PFCA 3QUZD 3WFBL 5A2FA 2HA1A 2L4OA 5DGRA 2H2PC 3OKYA 3WJLC 3MFFA 3P73A 1U8KA 4LU5L 1AI1L 3IFOA 5AZ2L 4IOSD 1F4WL 5CJOL 4PJEE 4YHZL 4YDIH 4PJFB 1CBVH 3SO3C 1TZHB 3DMMD 1E4JA 3BEVB 1JI1A 2M26A 3F58L 3I02A 2ENSA 4S1SL 4XCEB 3IAGC 4ZNCD 3ARGA 1QSVA 1OQXA 2HJLA 2G5BA 2QLVB 3GSNH 4LHUA 5EC1B 5ENWA 3A67L 4MS8C 4OQTL 3UTSA 3OSKA 1MIMH 5ILTH 5JDJA 1F45A 4U3XA 5DXWA 4J3TA 2XWJB 2NY3C 4R0LC 1HKLL 2G60L 3RGVD 4FQHA 1FP5A 4G7YL 3O3BB 3GI8L 4H20H 4N8VA 4IRJC 4NP4L 2XTJC 3BIAX 3FQXB 2R1WA 4Z0BH 4OIIL 4OKVB 2HFGL 5C92A 4XNQA 32C2B 2W07A 2VAJA 3MRPA 3G5YA 1U3HA 4RQQB 3TF7C 1G6RH 3NCMA 4DN3L 2WINB 2FWOB 4WW2F 3PL6A 1S9VB 5JOPD 1IC5H 4OCRH 3TBTB 3ARYA 5BO1L 1SBBA 4H1LA 1GXEA 1P1ZA 3PWPD 5DD5H 3WKNA 3DARA 1BFSA 4P59L 4ZSOA 2NTSP 4XH2B 4MJ5B 1QD0A 4BUHA 4LCCB 3RWJB 1FNFA 1X5AA 4ALAH 4JB9H 2OXGA 3T2NH 2VLMD 5D7IE 2A6IA 3CFDA 5ICYB 4LSTH 1VFBB 3BYYA 4XX1E 2ZJSH 1FZKA 4HMEA 3V4UL 5E56A 3SN6N 3BT2H 2MQ0A 3L7EB 5EUOA 5BVPH 5AG8A 2B1AL 4U1KA 2HMID 4LKXB 5ISZD 1YEDA 3B83A 3HI5H 1QR1A 3S37H 4RGMC 4Z78A 2ATPA 2NX5D 4ONFL 3WMSA 3V79C 1BBJB 5BS0E 5JHDA 4J8RA 5AEAA 1T03H 4QRPB 4JO3L 1MF2L 5IT2H 1QBML 4JO1L 2AJVL 1Y18A 1F6AA 3O9WB 4JFYB 4PBVC 2IAMA 5EZOL 4BSWA 3CDYA 1FNSL 5FIEA 5F7HA 1GGIL 4YHOH 2D7TL 1P53A 2H8PB 1HOCA 1E4KA 1MHPL 4J3WA 3OAUL 4ELME 4CL7A 3T09A 3C2SA 3DRQB 5FDWA 5GHWH 2R39A 1IM9D 2GJZA 3JV4A 2DL2A 4PTTB 3ULUH 1IAKB 4WEBL 5CSZB 1CQYA 5GGRY 4WU7A 1ED3B 3D3VA 4NQUA 2ORBH 4Q2ZA 3L9RB 1WEJL 4L8SB 3M1BB 1BLNB 2P43B 3WKMH 5HJ3A 3L3KA 3BYTA 1T0MA 5EUKA 1T7WA 1OQOA 4PJ8D 3VGHA 3KPOA 5D96B 5EO9A 4Y2OA 1YEHH 1MHEB 4BQ8A 5L2KE 4N0CD 1M71B 1O7SA 4LPCA 1W0YT 2CLVB 5HD8D 4MJIE 1UB5A 3MRCA 5F9JA 1XT5A 4RWYH 5I1CL 4P4RA 5I18H 5AYUL 5IFAL 4L3EE 4M5YH 5F9OL 1MNUH 1MJ8H 1AO7D 3EHBC 1Z0MA 1KFAL 1TJGH 4JDVA 1PLGL 2WNGA 3ARBB 1X4ZA 3O6KL 1T1ZA 1NBYA 2RCSH 5KN5B 4FQXB 3CVHH 4TSBL 4BZ2L 1M05B 3SDXA 1S7QB 2BMKB 3V52H 1OOAA 3ULVH 1PYWA 1OAKH 5BQ7B 2NY5C 2ZCKH 5IEKA 3MACH 2ICWB 2D9QB 1DBJH 3BP5A 1V7MH 3PP4L 3IU4H 2NY4C 1P7KB 3HR5B 4UT7L 5DHVB 4ESKA 3QEQD 2FHBA 3TJEL 1X6NA 5HHXL 3VFUA 4X5LA 4KV5E 4ZAKB 3EDDA 1OGAE 5KVEL 4LLQB 4KHXL 4TUKL 1R3KB 2A77H 3EYOA 4JDTH 3SDAD 5HVGB 4DCQB 3BZ4B 5F7FA 5JIIA 5F7WC 4MXQD 4JG0L 4UAOB 1U8OA 4LRIC 2D3VA 4R4ND 4HIIA 2VRAA 4DW2L 4FFZL 3RPIB 1PZ5A 4HPYL 4C4KO 2OMNA 1HI6B 1CXEA 3AREA 4IHOB 3Q6FA 3OF6A 4JQIH 5C08A 4JM2D 5GRWA 3I6GB 5E08L 4MX7A 3QJFA 3ARQA 1NGWB 1KTDB 3MV7E 4QRTA 5JMRA 2VMFA 1RJZA 3H42H 5I1KL 4JG1H 5E99H 3CSGA 1N0XH 2W9EL 1DFBL 4WW2A 5FYJL 4NZRH 3C6LA 1BWMA 2X44D 5HYSB 4AMKH 4J7RA 4FA8A 4Z0XA 4YHKH 2F5BH 1NCDH 1DZBA 4CN6A 4HH9B 4HG4K 4PRHA 1FCGA 1L7TH 2PTVA 5SWSB 4GRLA 3UROR 2XG5A 1BJ1J 3QFDA 4FQIL 5C0CE 4JFDE 2NY6C 5FK9B 2EO1A 4JY5L 4TPRH 3SE9L 4GRWE 3ZYZA 2I24N 1F3JB 1GPOH 1J87A 3AC0A 1A1OA 1A6AB 5JQ6H 3CLFH 3V6BR 3Q48A 3T8XA 3DV6A 1IZKA 1T2QL 2CJUL 1FAIH 2GTWA 4LHQB 2D4DA 5C9KA 3SDCC 1KB5L 2BVEA 1ZWIB 3WHXB 3QI9A 1RSFA 1YPZB 4PV9B 1KJ3L 2EE6A 3O4LA 1OGTA 4AQ1B 2EDNA 3SDDB 1LNUB 4EQ3A 3B9KC 4N0FA 4Z7WB 2HWZH 2W92A 3MBED 4U33A 3ULVF 3W0WA 2A6DB 5KVDH 4NBYB 1NEZB 2XWTB 3BKJL 5C0EA 3Q6GH 3GNMH 4ZUSA 5K9QI 4JE4B 1HIMH 4XWOC 4RA0C 1IZJA 4G6JH 1KCSL 4XMLL 3MV9A 3SKOB 5J6GB 1FZJA 4WI3A 2ESVB 4KRPD 3QIBB 3WO4B 3MRBA 1MEXL 5CJXC 2VQ1B 1ZKAA 1WBZA 3MRDB 4TVPE 2ITDA 5BS0D 4Q6YA 1HHGA 1YNLH 1I7RB 4XCYB 4H8WL 3ZKMC 1L7IH 3CXHK 4X6CF 3GSNA 4IEFB 2Z31C 1FN4A 4K07A 1RAMA 3O6FB 3IDNA 4DAGL 1ZLUK 1SYVB 2V5RA 2XQBL 3TBYB 5TFSH 1KPRB 3EJYC 2XACC 3QCVL 1IEHA 1IGYA 1JUFA 5IV2B 4FQ2L 1F5WA 2DICA 5BOZG 2OI9C 2YD6A 3QHZL 4HGWA 5KVMC 3V4VH 3L3IB 3S36X 1N5YH 4OFVA 5ETUB 3VDBA 3QO1B 2GEEA 3MCKB 3VRIB 4OB5H 1G6RA 4OZIE 2B1HL 4BFIA 4FQLL 4HJ0C 1OW0C 4I5BB 4WWKD 1BHGA 1A0QL 3CDFA 1XGTA 5FAAA 1IGFL 4L9LC 2VITA 2Z91B 4EUPB 2H6PB 1KCRL 4P23D 4OSUH 4FTVD 1ZVSA 3BGFC 4PFEA 3ALXA 3SPVA 1RJYB 5L2KD 4CUCA 3CUPB 4XNUH 2JF1A 1CVSC 4MJID 1LO2H 1FFNA 5IBLC 4LSSH 1WC7A 3IXAB 4NZJA 4KMTL 2EO9A 5CUSH 1LE9A 3HA0A 1HILA 1PAMA 4L3ED 2X6MA 3WFBH 1T22A 1XGPA 1BBDL 4L3CB 1AI1H 4HFWB 5AZ2H 1MLBB 3GSUA 3CFJB 2J8OA 4Y5YA 4XGZA 2XA3A 2PNDA 3BDYH 2X4UB 3WS6A 5CJOH 1PVHA 3AXLA 3UBXI 2ITCB 3OKKA 3MODH 3V0WL 1W72L 3LQAH 1AJ7H 3DVGB 5MERB 3MREB 1CXIA 3DO3A 3VWKD 3IKKA 3BDXA 1QSFA 3QIUD 4U2YA 1CICB 1OGAD 4ZPVA 1XF2B 3MRLB 1HXYB 2PCPA 4G7YH 3CMGA 3GI8H 4LQ1A 3QCUL 4HLJA 5EBWB 2GT9B 5D7SH 2AP2A 4KJWD 4OIIH 5IWLA 4OD2A 3ZKND 2R8SL 1HHJA 3REWA 4HUUB 5FHBL 1J0IA 4P46D 1RHHB 3OTTA 1OTTD 5F72S 2PKDA 3D39A 4KVNL 2RQ8A 4DN3H 2DKMA 3K2UL 1NANH 4F9LC 1S5HA 1JTOA 4NKOB 5J12B 2VDNL 3QIWC 4X6EA 1DLHA 3QNYB 1HNFA 3FO1B 4AEHL 3TJHC 2HP4A 4U6VL 3MV7D 3VG9B 2EE9A 1FFOB 3ARXA 4XX1G 5MI0C 4Q6IA 3MGAA 4U1MA 3LMJL 1T7YA 1DSFL 1JRHI 4C56B 5HI4C 4JFOA 3QRFM 4NHUA 1ZLVK 3IJSA 3UTPE 4HBCL 1UXWA 1FL6A 4JFDD 4M1GH 2ICEA 1SJXA 3V4UH 3D69B 5ITBH 3U0PA 2EDRA 4XPAL 4KDVA 2VAAA 3BD4A 4PJ9A 4HIEA 3ZE0E 2B1AH 5GRVK 5GGRA 4P2OD 3TZVB 5DO2D 1YNKH 1EDQA 3CVHA 4LQFL 2D03L 5JXEC 4WEMB 2XN9A 5DRXA 1KJ2L 1YEFL 3H3PH 2C4XA 4MJ6A 4Y16A 5L0QC 2XTJE 3TA3D 4XMKH 2R15A 5DVKA 3F7YA 4X8XA 2BC4A 4JO3H 4YPJA 1QBMH 4GAYB 2R2BA 2YSSB 5FOJA 4BH7A 1YMMA 5C09B 3AM8A 2XFXA 5EZOH 2FBJL 1FNSH 5GRUL 1F4HA 5JPMA 1L0XA 2D7TH 5KJRL 1MHPH 4X4YB 1AY1L 5ACZA 3L3OB 3TCXA 4X6CA 3NIDF 5DURB 3GJFB 4XCFH 1Q0YL 5FM5M 4YHYC 4KRLB 3HI1A 4LARL 4HS3B 4TVPD 4WEBH 1FAKT 1I85C 3P9LB 5SWZA 2PYEA 1G7HB 4HK3J 1DE4A 1JF5A 1WEJH 1YUHB 1FQ9C 3H7LA 4NRXB 4WFHD 5IVOA 3LN9A 4TVSa 2BVPB 2E9WA 3B5HA 2NW2B 2RB8A 4CVZB 3VWJA 5F96L 1OTUD 3V6OC 4J4PA 2NNAB 1IAOB 4E5XB 3S35X 1RURL 1M6OA 3WNKA 5JA8B 2NW3B 4W4OC 4ENED 2MMXA 4EI5B 4B7IA 3GSOB 2IANE 4JFZL 3L3HB 5AYUH 1T6VN 3U9UA 5B3JE 5KSBF 5EZLB 5K93A 3KXFA 35C8H 1WBYA 1ZLWK 1N3NB 3JV6B 4GMTL 1Q9WB 4JZJC 5KVGL 2JIXB 3LQZB 4ODHL 1KIPA 5JIKA 1PLGH 2PO6B 4AY0A 1J18A 5IBTL 3GSWA 5F1IA 5T3ZE 3ZE2E 4BZ2H 2VC2L 4PG2A 4YHNA 5TDPA 3MNVA 4FMKA 1MFCH 1U93A 3RNKB 3EOBB 4GMSH 4ZOAA 1VGKA 4O2FA 4O02L 3PGCB 4UT7H 1MWAB 1TETL 3FOLB 3V8OA 3FCTA 3OB8A 4S0SD 4B7LA 3MRRA 4AEEA 4NIKB 2CGRH 4TUKH 2O93L 4QWWD 3TO4D 3BP4A 2W60B 4TVPL 2E8YA 1S7SB 3RU8L 2QQNH 2XKNB 2E9BA 4MA1B 4QY8B 4C55A 5HI3C 4JG0H 4P2RE 1R6VA 4PRBA 3RWEA 4DW2H 5JZ7D 1RV6X 4CGTA 4G9FA 2DQDH 2AEPH 3GSRB 1DBAL 1NDMA 5D72L 3SGDI 2XQYK 3T0EB 1IC7L 4X80L 4OGXL 3FFCB 4V1DE 5C0DA 5AAWA 1C5CL 3DBXA 4ZS7H 4PP1C 2V7HA 3EZ8A 3GMLA 5DHYA 4X6BB 4GRMA 4OT1L 2WBJD 1LP9B 2VDLL 1UH2A 2W9EH 1DFBH 4M6OH 4LKCB 5INDA 4MNGB 4OKDA 1NLDL 4ZFZA 1OAYH 3TEUA 3WN5C 5CWSB 3Q5OA 3REVB 5LVEA 4JFXA 1HZHL 5GIRB 3M17A 3KPRB 4JY5H 5TPWL 3LKNB 5E9DE 4WNQA 3SE9H 2BK8A 2HTLD 3V0AC 3HNTL 1NGZB 3MCG1 3DXAB 2CK0L 3HG1A 1A7RH 3HKFA 3QG6A 4BSJA 1JPFB 4MMZC 3FN0L 1CFSA 3HRZB 4R3SB 1ZGLP 3HUJB 2LV4A 1T2QH 4W6XB 4HH8A 3IDIA 4U1NB 2BHUA 3BD5A 3E1F1 4P49A 4PJDF 4N9GA 4KQ4H 4PYHA 1LEIA 3LH2H 5HHME 3V9FA 1KB5H 1NBVL 2GK2A 3DX6B 4GBXB 4NQTA 1EJOL 3RQ3A 1QACA 2B7DT 3OKNB 5KSAD 3UTPD 4Z7VB 1NC4A 2P46B 2FGWL 5LWYL 1J9CT 4M6NH 3RBSA 3FO2B 5D2NB 4U1SB 5T1LB 4DGYL 4ODSH 5DS8B 4PTUB 2Q8BH 3STLA 2YPLA 3X13B 3QFJA 2PXYA 2O5ZL 1BJMA 3OG4B 3I6KA 4NWTH 3LKQA 4RMTA 3MJ8A 1NBZB 3VFOB 4F7TA 1Q9KB 4Q9CA 2NY3D 3LN5B 2OR7A 3BIKB 1MEXH 4JN2B 4IRJD 2XTJD 2YA0A 2GCYB 5HYSG 4YPGA 3TPKA 3B5TA 3RI5K 3LS5H 4XP6L 3MRNA 4WW1B 4HJGB 1UM6L 1DBKH 4DAGH 4MNGE 2Y4SA 3Q1SL 3WFEL 2XQBH 4LCCC 3QCVH 4YZFF 5DMGD 5GSRB 4BKLA 1I75A 3VXTA 2XZAL 5C0IA 4CDHA 4LF3B 5TH2B 4ZFFA 4DN4L 4R7NB 5IHZB 3V0VA 3RVUC 5T1KB 4CMHB 5D7KE 2OTWA 1SJHB 3HHRB 3TBWB 4L4VE 1L9NA 4QNPF 4PRPA 5D4QA 2EDLA 4BZYA 1S7WB 2B1HH 4RGNC 3THML 3MRKA 2YMXH 2OL3A 3PWUB 4X5WB 4QXUL 5C0RL 3K7UA 1AGBB 5KSBA 1HQ4A 4JFFD 4FQQA 4ONHB 4P5KA 1T1XA 5LGJA 1T7ZA 1DEEA 1NEZG 1P2CA 1JVKA 4ODWB 2IBBA 4ZO6A 1ZSDA 1D5BB 3QHFL 2IAND 4PIRF 3HS0B 5F7MC 1N2RA 3QUZA 4KMTH 4M7KH 4XVSL 3O9WC 2CK2A 3IJYA 3KPSB 4PY7B 2ZKHL 1BECA 2V2XA 1T4KB 5IB5B 3VMOA 3STZB 4OZHE 5E4EC 1AGFB 2X5PA 3VXSB 2FEEL 5LQBH 5F88A 5HI5C 5T3ZD 2O5XL 5E2UL 4MSWA 2DLHA 2NPLX 5FGBA 1JWUA 1JF1A 2Y23A 3DMMA 3SJVB 4OFYA 5F7DB 3FAXA 4WTWA 2D2OA 1YMHA 4LLVB 3BN9C 1OSZB 1W72H 1RUML 3O2DA 4L8SC 3UTTB 4ZFGH 1JN6B 5DSCB 1E0OB 2OR8A 3RGVA 5IJVB 1QFWM 5HDQL 3C8HA 3DSFL 1AKJD 2VLRB 1P4BH 1S3KL 3RL1B 2AEQL 4LPXA 4H26B 4JM2F 1DTUA 1IGML 4QGYA 4MQ7A 3QCUH 1INQB 1HDMA 5JO5B 4PD4K 2VXQH 5I2IA 5JA9A 1BGXL 3IFPB 1IQDA 4XXDA 3DECA 4P2RD 3SO5A 4EUPG 5FHBH 5T1MA 1VGEL 4HCRL 4QRRE 3DX9A 1IGCL 4M00A 4KVNH 5FM4A 3WS3A 4EDWH 2QJDA 1LE5B 1P7QD 3K2UH 5C6PB 2Z35A 3B3IA 1NKOA 3I9GH 3IU3B 2LABA 2QKIA 4KFZC 3BISA 4V1DD 2O5YH 5D1QC 4AEHH 3MLRL 1WSST 1KJVA 4BSVB 1EFXD 1TENA 1Q1JL 2I25N 2DLFH 1KUMA 1RIHH 3EHBD 2QL1A 3F65A 5GGSB 1F4YL 2D7NA 4K3DH 5E8PA 1DSFH 3KPSE 1IE5A 1T5XB 4FFYL 4ZYKA 1PKQA 2ED9A 4PRDA 3BI9X 2E6QA 2YEZB 4IRSB 3NFNB 5FECB 1VFMA 4MCYA 4ISVB 3VXSE 5D7IF 2DD8L 5T33L 4UNTA 1NGYB 5E9DD 4PJDA 43CAB 3I2CL 3IDYC 5ISZA 4XPAH 1T89A 3SJVE 2EEAA 1ZGLA 2F54E 9CGTA 3GMNB 3WIFA 1WFTA 1F02I 2AGJH 3EOTL 4G9DA 1JGLH 2NY4D 4I4WA 2NX5A 3B9VA 3RPKA 3UTTE 4RNRA 5IVXA 3WUWB 4LNRB 1CIDA 4YAQB 1KJ2H 1TVHA 1YEFH 5HHMD 5E8EB 3AGVA 2OSLB 2E9IA 3VI3E 3VXUD 2NXZC 4DZ8B 5LGHH 2GY7B 2DBLH 1F8TL 2X70B 1GZQA 3GZKA 3AAZA 3QA3A 4HKZB 3C5ZB 4NDMA 2OZ4L 5J4MA 1KSRA 3BHBB 1I1FB 4N5EC 5GRUH 5HYJB 5KJRH 1P6FA 1JZ7A 1IM9A 1BVLA 4DUWA 2NTFB 4G8FA 3LPWA 1AY1H 5C70A 4YDVA 3U30B 3HNSL 4S2SA 4PGZA 4ELMF 1T04A 1H8OA 5HYEA 1FZMB 2OJEA 4LARH 1U91B 2FIRT 1RJCA 3NOIA 2FBOJ 1DN0B 4WTZA 2EIDA 2FHFA 2WK2A 1TMCB 4MQTB 2E7CA 2VISA 2EH7H 5AUMA 1AXSB 1YY9C 3BVNA 4PJIE 1G7QB 1T20B 4PJ8A 4HIHB 2K7QA 3RBGA 3UTQB 2DLEA 4U7KA 3V4PH 3LVEA 4YFLI 3SOBL 3TP4A 3PXJA 5IFHH 2NY6D 1WQVT 1H3WM 1EHLL 1MUJB 1Z0NA 3D0VA 1C16B 1RURH 1MY7A 1A4JB 1IM3B 1P5VA 3H7BA 5GRJL 1YC7A 4GAJH 3FT4A 2HVKB 5I75C 2XG4A 2VXUL 4GRWH 1AO7A 1LEKB 3N9GL 3ZT7A 4AEIL 4AZ8A 4L4VD 4K2UL 3LKPA 4M62H 1DEDA 4RIRB 4EQ2A 3DIFB 4GXUM 4NRZA 4DZBA 2JE8A 2WIIA 5IESL 1U92B 4GMTH 3BSZH 2EYRA 1BEYH 3UYRH 1MQKH 4ODHH 1MSPA 2EDKA 5JOFB 1MRCL 3E2HB 4MDJB 1UXSA 5D6CA 1KF9B 1AGCA 2R29L 4ERSH 3WO4C 3B9KD 4DKAA 1NANI 3VFRB 5K9KA 1BZ7A 2D31A 3B6SA 4PB0H 3NCFB 3BWUC 4KJYA 5ESVB 3K3QA 1KB5A 3QEQA 3W2DL 4XWOD 3UJTL 1XCQB 2EDTA 2X4RB 1U95B 3O6FC 1JE6A 4O02H 5CSGA 5HYJE 5AD0A 3IDJB 3GMPA 3MX0A 2FL5B 4JVPA 1E27B 1SQ2N 3N1QC 3F7VA 4NJ9L 5IB4B 2F15A 4KV5F 1QYGL 5E1AA 4TVPH 3ZKMD 4UDTB 2EEBA 4ORZC 1SY6H 2Z31D 3FT2B 1C8PA 3H9YA 5FO9A 2I9TA 3RWIB 1D6VL 4WI6A 3DO7B 4WGVB 4Y2DB 1A6WH 4FQPA 4JM2A 3EJYD 5E00A 2I26N 4UV7L 4QTHA 1EUUA 3G5VB 4LASL 5TQ2H 1MCLA 2JJUA 1DBAH 1IC7H 2PW2B 4NQVB 3TBVB 1KN4L 2ADIA 3OX8B 2HRLA 5EOCL 2B4CH 1NFDB 3P4MA 5I8OL 1CF8L 4OT1H 4JM4L 4NN6B 4IJ3C 4HJ0D 4NRYA 1GC1H 1EXUA 2CR3A 3A6CH 3QH3A 5HGHB 1WISA 2X4TB 3QPQC 3QEGL 4QRRD 1X9QA 3RUGE 3FZUC 4HWUA 3P77B 1JNHB 4CKVX 4MD0B 1ZA6B 1FNEA 3HZYA 3NGBB 1E4WL 3VE0A 5L88L 3MNZA 4ZFOL 2DWDB 5TPWH 5BOPA 1CGYA 2YOCA 5IBLD 3SGJA 1RZIB 5D6DC 4I3GA 1DVFC 4GRWF 4XI5C 4LOUD 5L9DL 3SKJL 3U4AA 1ZANH 5C0GA 4NUJB 4MAUH 5D7IA 3QUYC 5F70A 1JZ5A 2ARWA 4JFQB 4P2QE 5ICXA 4DOHE 2AEWA 1NBVH 5DJYB 3VRJA 1N7ML 4TULL 1A4KA 3U6RA 3MV8B 1UVQB 2M1KA 3MBEA 2FGWH 1Z3GH 5LWYH 3QZWA 4HWEH 1RUKL 2K3TA 4MA7L 1URLA 2F54D 1SMAA 1CZ8L 1DDHA 2RFXA 2O5ZH 2I07A 3DRTB 4FQ1L 1J12A 2C1PA 4AIXA 3ZYOA 3LSOB 5BS0A 2A0LC 3MRGB 2CIKB 4OLYL 4PRAA 3I3EA 1W72A 5H37H 4NC2B 2OJZL 4WFFE 3CZFA 4RAVA 1NFDE 3IFLL 4F7PB 2VDPL 4TOYL 3K81A 4ELMA 4M48H 1UGNA 3GEWB 3Q1SH 3P9MA 1AD0B 4ZD3L 3CSYB 3OKDA 2UWEE 5GGUA 3AMLA 4P48A 3QIWD 2A38A 4PLJD 4P3DB 3VI4E 3MYZA 3QAZC 1OAUL 2D9CA 4RA3A 2E7HA 3AU1B 3TJHD 2Q6WA 2IPUG 2X4SB 1J0HA 2FEDC 1FIGH 3BPOB 3PDOA 4WWKA 3U83A 4XNXH 3W5NA 1RIVH 1TXKA 4F7MA 3GHBH 4FMFA 4JREC 1FH5L 4XC1L 2J88L 3BEWA 5HI4D 3GRWL 4P23A 3TZVC 4FTVA 4OZIF 3VD5A 2YA2A 5D7LE 5L2KA 1G6VK 3IDXL 2EYTA 5DFTA 2RJMA 1GHFH 4MJIA 4PRNA 3QUKA 4BM7A 4PB9L 1EJ6A 1GOHA 3UMTA 5F93C 4MWFA 3ZLQC 2NY7L 3DVNA 1UJ3A 2IH3B 1KELH 4PJAB 5BV7L 3IVKB 3O3AB 5KSVB 4L3EA 3MGTB 5IUSA 2UUDH 5CD3B 5HHOB 4MZ2A 1DN2A 4F57H 1NAMB 5KSUA 5JXED 4P9ML 3VW3L 4X5XA 2CDGB 5F1OB 1HXMA 4NZTL 1VFAA 2MKWA 1FL5B 2X9YA 4JPKH 4JO2H 5CJQL 5IB2B 3BGMA 4KGJA 3VGAC 4YO0A 2BSSB 3MLYH 4QHUB 2DJUA 4Y4FB 5DJ2B 3OKEB 1T2XA 5DFVD 3UYPA 2DBJA 4GKNA 5GGTH 2GK0B 1RUMH 4WHYG 4I3SH 3CDCA 3O6MH 3QIUA 4NNYA 1OGAA 1J10A 3C6SA 3NPSB 2WIMA 2ZSWA 3FRUB 2BCKA 4CVXA 1S5IL 3BESR 3DSFH 1S3KH 2IH1A 3L5HA 3MYJA 3PABB 3X12A 3H9SB 5E8DH 4WV1B 1IGMH 1XGYH 3DV4A 4HS6A 1JWMA 5B8CB 4EI5C 4P46A 4RGNE 3KPLB 2ZUYA 3RHWK 4QYOB 1WBXB 2CO7B 5I1IH 4ODUA 3BKYH 3VXRD 5IK3A 1NGPL 4LCWD 2CQVA 1TITA 1IGCH 2ZSVB 4PJXF 4FZ8H 1SYSB 1JGVH 2QSTA 4L4TD 2PO6C 3MV7A 1F90L 2DQFB 1B0RB 2P8LA 3UAJD 1A3QA 5EC2B 3MJ6A 5DJ0A 4C59B 1T5WB 2VL5A 1CGSL 3QB7C 2DRUA 4PJAE 1Q1JH 4WI2A 4DTGH 4D0BB 2JELL 1JL8A 1F4YH 2YRPA 3FONA 5JORB 4JFDA 4CDGC 1ITBB 4IOFC 3K4ZA 1N59A 1LK3L 3TLRA 2ICWJ 4LLWB 1MCHA 3L5WA 1ZMYA 2VIRA 5H35B 4Z77A 3O11B 3I75A 5T33H 5T3ZH 3NFPA 4PR5A 4P2OA 4OCNC 5J6HA 4AJ0A 4MNHB 4K7PL 1DQQA 1YJDL 1NMCB 4MA1C 3GDBA 3VFNB 1QVOA 1U8MB 1FVEB 3EOTH 5SV4A 1FVDA 2OTUA 4A2LA 1XZ0A 3ZE0F 4YNYB 2FJFB 1BF2A 3JUZA 3LD8C 4P2QD 2VNCA 2YK1L 2GAZB 3T0EC 4YDLC 4F9PA 3RTQC 3R8BB 1F8TH 4UMGA 5HI3D 1U3JA 4APQB 1RZJL 2BOBB 1CFQB 1QLFA 3K8KA 3GUTB 1G7LA 3GI9L 5MEQB 4KJPC 2XPGB 4XNYL 3VH8A 4U05A 1CLCA 2Y9RT 3UYOD 4D8PB 1MAKA 4YHIA 1SY6A 1G7PA 3MMEB 4LSUH 1S7UA 5HY9B 5HHPA 2F9BT 1JTTA 1NCNA 2H3NB 2HJKB 1QFWL 4WFFD 2X7LB 3N1PC 2UYLA 1LO3H 1NCTA 2P7TA 4P4KD 3TESA 4I77H 3DYPA 5CEYB 1T1YA 4N0UB 3QQ4A 1S7VB 4JHZA 4X4XA 3PHOB 5A40E 4FXKB 3WLBB 1CXLA 1EHLH 3LQMA 1C7SA 1UKQA 4K3EH 4JANB 2JJTC 4X83A 2AI0H 4OZIA 1KOAA 5CZVL 1M7DA 2VXUH 4M7ZB 5B21A 1Y6MR 5D2NC 2W65A 3WUWG 2NY5H 1UKSA 3N9GH 3LKSB 2YWZA 1U3YA 4K2UH 4UIMA 3R0NA 4OUUB 1EBAA 1JFQH 1X7QB 5FHAH 3GB7B 5B3JF 5IESH 1B4JH 5GJSL 4LEXL 3DVFA 4CMMA 3K74B 4U1GB 3TCLA 5D7LD 1TJHH 4NYLB 4Z95L 3L3GB 3BAEL 1BD2B 3TT3H 1PSKL 5ANME 1ZT7A 1EEQA 4NZDA 2KQNA 1MAMH 3BQUD 3ZE2F 3CXDL 1FL3B 1BZ9B 2WWMC 5F3BB 3W2DH 3UJTH 3VRLE 5I0ZA 3IAQA 5FO8A 4D9LL 3MO1A 3TO4A 1KJMB 4Y4HB 3QWOA 1UZ8A 4IDJH 1AD9A 3W9EA 5BW7A 3EKCA 4R96A 5EIIA 2Y5TB 4NJ9H 5EN2A 5CFHA 1FV1B 1QYGH 3U82B 3EYFA 4M3JA 3WFHB 5DVNA 2XV6B 3ESVF 3TO2B 3DX7B 3T2OA 4L29A 1GAFL 1CGTA 5JW5A 2PETA 4U1LB 1I8LC 1CE1L 5CEZE 3CDGB 4LASH 3QUXB 5C0BD 5J1AA 2DQJH 1W0WB 2J12B 3O4OC 1AXIB 4I2XB 4OF3A 1KGCD 3RVUD 3ARDB 4PLNC 5FFLA 5E1HB 1KN4H 2K1MA 4I0PB 4HD9A 1E6JH 5EOCH 3O41A 4PJXA 1WZMA 4RGND 5H8DA 3IETB 1INEH 4K94L 2NLJB 2EKSA 2R1YA 4LNVA 3MNWB 4P3CL 3QUMB 5C0AB 2FX7H 4P5MA 1A9EB 1BX2B 2J8UF 4JFEE 2W0LA 5JLZB 1E4WH 1I1AC 1C5DB 1MELA 2ADFH 4IS6B 3MUGA 4PYGA 1BD2E 2AQ2A 5ERWA 2A6KA 4JDZB 1I1RA 4MZ3A 2H32H 1BIIA 2AK1L 5I6XB 1A7BA 3SKJH 3PV6B 3IJHA 4JY6A 3D48R 4HPOL 5ADOL 5DRNA 5DUPL 5C0JA 4G80A 3N1FC 3DGGB 3ZTJG 1HCVA 4Y5VA 3U9PH 5I1DA 1YN7A 4KK5C 4PJ5B 5LAXB 4ZUWB 3BW9A 4ETYA 3KNBB 3P4LA 3BZFA 2VSCA 4EVNB 3RDTD 4KZEL 1G9MC 1N8ZA 1PX4A 1XIWD 5KS9E 4U3CA 5C86A 1KIQB 1RUKH 3BN9D 5CP7B 5AWNH 3RAJL 5F97E 4WI9A 4TUJA 2A6JA 2BNUA 4R0LA 4XPTL 2A9NH 5DD6B 4M7LL 5D5MB 4FQ1H 3GMOA 4IRJA 3L5XL 1W0VA 2AJZB 3ULSA 5F6IB 3PIQA 1AGDB 1TZGH 2ICWI 3MRJB 4TYUA 3EYQC 5GGTA 2AV1A 3ELAT 1OAZL 3LPFA 4NWUL 3TBSB 2VDPH 4JQXC 2AJ3A 4TOYH 4Z5RB 3UCRA 1A7QH 1KXQE 4EN3B 4ZD3H 1E4XL 5ACMA 4P5TD 3KLAB 5J13B 4HKXB 3IGAB 2X4PB 1D9KB 1GGTA 3BUYB 1QZ1A 3DSNA 1I9RL 1S7XA 2G75A 5D1QD 4GJTB 5EZIL 4IMLB 1KPUB 2BVTA 3BE1L 4QCIA 3NTCL 2XICA 3KYAA 5CZKA 3HZMA 4KKBC 2EIZB 4MA8L 5J56B 2IG2L 5INCB 3O2WL 4JFFA 5F7LB 3MRMA 1NAML 5C3TA 3RZCC 1J8HE 1VFUA 4EDXB 4BQ6A 3U1SH 1CFTA 3NCEB 4JZOB 4RISH 2IANA 4LEOB 2MKLC 2RHEA 1A1MA 1CDUA 1TIUA 1XCTB 5GS0C 4ZUVB 2MPAH 3FL7A 3MRQB 4OF6A 1MHCA 2WP3O 4IBLT 3TV3L 2VQTA 3ABZA 4P9MH 4X7SL 6FABL 2A9ML 3VW3H 4U1HB 3V5KB 3QXUA 3IDUA 3DX8B 4HIXL 5DTFA 5F7YC 3D6GA 4OZFB 2NXZD 3GM8A 5I1AA 4Q9RH 2D4FA 5CJQH 3EFDL 3U30C 4EOWH 3MFFB 5E5MA 4OZHF 1C12A 3P73B 1U8KB 1L9MA 3OJMB 1AE6H 1EGJH