4QR7A

Structure and specificity of l-d-transpeptidase from mycobacterium tuberculosis and antibiotic resistance: calcium binding promotes dimer formation
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
349
structure length
349
Chain Sequence
VPKLTASVTDGAVGVTVDAPVSVTAADGVLAAVTMVNDNGRPVAGRLSPDGLRWSTTEQLGYNRRYTLNATALGLGGAATRQLTFQTSSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords L,d-transpeptidase LdtB
publication title Structure and specificity of L-D-Transpeptidase from Mycobacterium tuberculosis and antibiotic resistance: Calcium binding promotes dimer formation
rcsb
source organism Mycobacterium tuberculosis
total genus 90
structure length 349
sequence length 349
ec nomenclature
pdb deposition date 2014-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
A PF17964 Big_10 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 4qr7A03
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4qr7A02
5DCCA 3U1QA 4A1KA 5D7HA 3ZG4A 3TX4A 2HKLA 5DC2A 5DZJA 4HU2A 1Y7MA 3VYNA 3VYPA 4QR7A 4GSQA 3ZQDA 5E51A 5DZPA 4GSUA 4QRAA 5E1GA 4JMNA 4A52A 5DVPA 4ZFQA 5K69A 4LPQA 5DUJA 3VAEA 4QTFA 5LB1A 3VYOA 1ZATA 3TURA 4Z7AA 4GSRA 4A1JA 5DU7A 5LBGA 3ZGPA 4A1IA 4LZHA 4K73A 5E1IA 4JMXA 5E5LA 4QRBA 4HUCA 4XVOA 3U1PA 2MTZA
chains in the Genus database with same CATH superfamily
2Y6TE 3ZE0E 2SEBA 4GQ9H 2ZWZA 3OG4B 4F37F 1BQHB 1RJYB 2XICA 4L4VA 2CK0L 1I82A 1SEBA 4KK8D 5AW9B 4Q74A 1M6OA 4OZFB 3WE6B 3VXSB 1Q1PA 4YHZH 1YHPA 3K8MA 1NAMA 1FORH 5KVMC 4A2EA 4F58H 2N4IA 2Y1ZA 1NEZA 3NAAL 2F53A 3H2PA 1DQTA 4MA7H 5GIRA 1DANU 5JIPA 1HHKB 3GSVB 3HE6B 4NIKB 1MLBA 2X88A 4R5XA 3M1BA 1XGTB 2WUCH 3PDDA 1WFIA 1WIOA 3ABLB 4JO4H 4JHZA 4EF3A 4BZYA 1ZTXH 5IB1B 4FF9A 2O61B 4FNQA 1FNEB 4P06A 5I1IL 1YEFH 2YAOA 3V52L 1AKJD 3RGVD 2ZCKL 2W0FB 1FFOB 5FYLE 3LPGA 5J7CC 4ODHL 4RAUB 4Y16C 4IRSD 4L9DA 3ZN6A 4QTFA 1MWAB 4ISVA 1QNZL 2HXAA 3BVXA 1NBVH 4ZX6A 1TZ8A 1XF1A 3BT2L 5DFAA 3PUCA 4OV5B 4HH9A 2KL6A 5BRZA 1D5IL 4CC0A 4XMPL 1OT2A 4R7XA 4XN2A 4YSDA 5DUMH 3IB4A 1OZUA 5B4MD 1UD2A 2BS71 4PPTA 4Y1AD 4A63A 4HC1H 2PR4H 4JL1A 2NY3D 3RGBA 3QUXD 4JM2F 5F0MB 4ZYKB 5JDSA 2Z91A 3THML 2A7BA 4K7FB 4UTBA 5GPRA 1UWFA 2AXFA 4F7TA 2IXQB 1DN0B 4MX7A 5GRJH 4KMTH 5IOPA 1JVKA 3DVNA 1JGDA 2VSKB 4NQVB 4DVRL 1PD0A 4DKEH 1HKLH 5DD0L 4ACPA 4D7PA 4EI5A 4XAWH 4X7DC 4WWNA 2GK0A 5H37A 4M3KB 1Y0LA 4J4PD 3VG0L 1WFMA 2EVFA 5A16B 3FQYA 5GIRB 4PJXF 3OKKB 2R56L 3L6FA 3KYOA 4AGPA 1ZS8B 3D69A 3BMVA 2AJXH 4Z3IA 2YA2A 2MTPA 1U30A 4PUBL 3Q6FB 2YD0A 4RNRB 5E8EA 5AZEH 4EIGB 3VI4F 3RX7A 5J12B 5ALBL 5ECGA 2X4RA 4DIXA 2BCMA 2QGEA 1WK0A 5IG7A 4QKXB 4LRNL 1A7RL 1MCOL 1OTTD 2A77L 1FA4A 4FXTA 4PLJD 5C0FB 2DTSA 5L2KA 2PN5A 5E24E 3O45B 4W9FC 3POCA 2NY7L 2WLLA 3WS3A 1I9RL 1XGRB 2ZOOA 5HD8C 2V7HA 1QNIA 1K4CB 1JCVA 2X05A 3VXPA 1G1CA 1G7PA 4UNVA 5EZIH 3ZVVA 1NGWA 4OZHB 4ZD3H 4WUKH 5BRZB 4P9ML 2FX8L 4G7YH 3UC0L 1HILA 3B7SA 4PS7A 1GTNA 1HU8A 4K5NA 1YLBB 4AH2A 1ZVSA 5FB8B 1I9JH 4HPHA 2P8LB 4Z7VF 5CJXA 1EBPA 2WXRA 4IBLT 4JFDB 2XXGA 1FRGL 1MCHA 5I1AA 4KKPA 1TO4A 5JDSB 4OUOA 5EU7E 5AVWB 3IDUA 4HCIA 4PJCB 1GYCA 2VUKA 3UBXG 3HG4A 3S34H 1BEYH 1E28B 5T5NG 4N24A 3AWGA 4Y4HA 2C4FT 1NMCB 3ULUC 4X6DE 3N9GL 2XTJC 2XG4A 3QUMH 1M1XB 3WJLA 2CGRH 3JWOC 3N55A 3GLZA 1NPUA 4OUUA 4G6AC 3QUZA 1EPFA 1AHWB 3D07A 2WTOA 1UXWB 1KLGA 1UKSA 1CXEA 1L4IA 3AQDA 2C9PA 1MIEH 1OT1A 3IFLL 4C55A 5CBAA 1DVZA 1VESA 2YAHA 1DQML 3D69B 4LEXL 1W72L 1BVZA 3IPFA 4XODA 4HJGB 1ES0B 1GGYA 1SEQL 2X4TA 3GLDA 3KPOA 4BKTC 2A73B 4H8WH 5HYFA 3VU2A 2Q86A 3KYAA 2ICCA 4X8CA 4R9HA 4QJ5B 2W65A 3CHRA 1F56A 4R2GB 2YRZA 1F3DJ 2R83A 4EKXA 3MVSA 4HGWA 4D0CA 4G7VL 1ZSDA 2EIMB 1GPOL 4LOUD 3HS0C 4L3ED 4YHYB 5KS9A 1J8KA 5L2KB 1QBBA 1YEDA 3FTGA 4OLUH 4ZOCA 4S1RH 3WS3B 5DD5L 3ULAB 2PWHA 4LVHC 2YPVL 5E4OA 2WN2A 3TBTA 2YPLB 3K6SB 1XZ0A 5L4JA 2X1OA 1DL7L 2KKQA 1E4JA 4ZTOH 2D3JA 4JZJB 1H6UA 2VIRB 4XPGL 4GQRA 1NC2D 2XPYA 1COBA 2VR7A 3GHEL 3L2LA 3MRRB 4I13B 4WUUA 3FH5A 5BPPA 3BVNA 1AH1A 5HJBA 1QFWM 1KMGA 2VE6B 4GOSA 5E4EC 3S8FB 3P0VL 1UENA 3N0AA 4ONOA 4UQCA 4OJFL 1BFSA 4U1NB 4YMPA 2VLJA 1RUPL 3FSVA 2AK1H 3GSWB 1BF8A 2DS4A 3K91A 4M5ZH 2CKBH 3IPBA 1X5KA 3DV6B 4P4KD 1I8LC 5D7JD 3LXAA 1E90A 1KCSL 1XL6A 4PAZA 1IQDB 4OCSH 4Y4HB 4OGYH 2A4ZA 1H8LA 4QXUH 3I50L 1KJVA 1M7IA 2GC4C 4KUZL 4OJCA 1OHZA 5IJCC 1T20B 5C07D 4YLBA 3CVHL 4XP9H 2GBVA 3RU8H 1HH6A 2IPKB 2QGBA 4CSPA 5DQDL 4AIZB 1N67A 1OAKH 2NCEA 2WMPA 2YFNA 3P2DA 2V17H 3F65A 5F7NC 3SOBH 1QZNA 1NIBA 3WOVA 2YK1H 3WY3A 5BVJB 4U7SA 3KPOB 2X4TB 2P5WE 3PAYA 4UQ3A 2W9DL 3FQTB 1F3RB 3OJMB 3RI5F 5DD3H 4BZ2H 3T0WA 1S3KH 5IMKA 4PGDA 3EO9H 3P9MB 2HKLA 4YHLH 4UQ2A 4HGWB 5KS9B 1BPLB 1DUYB 4P9HL 5D71L 3V0FA 1OGPA 2HAZA 3SGDI 2BC4B 3B7YA 3D3VE 2KZKA 2K7QA 5CMAA 4TTGA 3U4KA 2X0VA 3E6FB 3GB7A 2AKRA 3SDXA 2B59A 2VSDA 4TULH 4YIQA 3LAFA 3ASOB 3GHBH 3OGCB 2VN6A 2N59A 3LOWA 5E1QA 1LK3H 4GO9A 2VLJB 2ZWKA 1X5AA 5LN4A 3U0WL 4L8SC 5D1QD 2GUYA 3QIUD 1IM3D 3H9HB 5CP7A 2G4GA 3NJHA 3O3AB 4Z78A 4Z18A 3DBXA 4O4YH 4X99B 4AQ1C 3K4DA 4O02A 2NLJB 4HLZH 4YR6A 3O6FD 2ZWSA 2OL3L 4HJSA 1KJVB 3TS8A 1MUJB 5GGSY 3MLZH 2OR9H 2FRGP 3WXVL 2HT3D 2VCOA 4N5UA 2FGWL 1JD9A 3OHXB 5IW6A 2IBZY 3P1VA 1KGXA 2DBLH 5EU5A 5HVWA 3IU4L 2QBWA 2RBLA 5I0WA 5FYJD 3QIWA 4G9DA 4N8VB 2WWOA 1BX2A 1JVLA 1KB3A 4CSZA 2G2RA 2HVKB 4Q2ZA 4P57B 2V7NB 4X6CF 2XHNA 4Y88A 2EDLA 1NSNL 4BFIA 5TPWL 2VUYA 4UT7L 4PU2A 3TIEA 4LSTH 1OARH 2OYKA 4XVTH 5C0AB 5LVEA 1ZY9A 5E5UB 3RILA 3RKPA 4Z5RB 4IKLA 5IFHH 4QYOA 1QFWL 2ATKA 1R19A 3QT2A 4UT6H 3RDTB 1CU4L 3LDBC 3PQYE 3NZHL 1G9EA 1TZIA 1FH5H 4CJ0A 2VITB 2R0KH 2ZYIA 5CMAB 2E86A 1TQCC 3D85D 3NFNB 5JPNC 3E6HA 3GB7B 4PJFB 5ICUA 3AQZA 4O2EB 2WTRA 2XV6B 1MHEB 1ZT1B 1KNOB 3T0AA 5DO2C 5SWZA 3BFOA 3OKLA 4BE5A 2UX7A 4UINL 3CXHJ 2LABA 2KLSA 4I2XA 4GO6B 1CLOH 2CNYA 1T1WB 3QC6X 1YMMA 1IAIH 4U1IA 1A4AA 4AM0A 4WK0B 4R96A 3M45A 4JE0A 4QRRE 4U4BA 2A6JB 1MH5A 2JKIS 1DQLH 1S78C 3WUWA 5FA4B 5AEAA 5E2UL 1ZD6A 2CRIA 4W9HC 3MNVA 4HC1A 4EN3D 4AT6A 1SDAB 3DBXB 3BKJL 3FN3A 1MAML 2VXQH 3EOAB 1P5VB 4GG6F 4JAMA 5IVXF 2PLTA 2PWGA 4JFVA 1ICTA 1IVTA 1QUNB 1JK8A 5GHWH 2CD0A 4JDZB 4NHUA 4XH2B 1I7UA 2ATPB 4HS6A 5IVZB 1ZIAA 5J13B 3RUGA 1VKXB 1BYPA 3LQMA 4DGWC 3HUJA 3SDDB 3QIWB 4Y2DB 1G0DA 1PEWA 1BX2B 4KV5F 4HWBA 1OGAA 1P69B 3NCEB 4TUKH 1OP5H 4X4ZA 4N85A 4Q2ZB 1VSCA 1FIGH 3EBGA 4AVKA 3GK8H 3RX8A 3WIHH 2QSTA 5I18L 5ICZB 1XF3A 3WEXB 1CTOA 4RMBA 1A6ZA 4S2SB 1LDPL 5KAQF 1VRSA 2VLKE 1KV3A 4YLCA 4QYOB 4YFLI 2AQNA 1IRAY 2A0LD 4IBSA 5HY9A 4N2BA 3SKJL 4TSBL 3E6HB 4JGJA 1PSKH 4PJ5E 4P5MB 2WTRB 1KGWA 3KGUA 3RGVB 3ZQXA 5SWZB 5FK9A 4LU5H 3QWNA 1R3IL 1DBJL 3LMJH 2WOYA 5FKPB 2WVSA 1CTNA 1IGTB 3BD3A 4TPRH 1WTGT 4RRPA 1YMMB 4U1IB 4AM0B 4F33A 2AP2A 2NNAB 5EORL 4H5SA 1FIEA 3BLBA 2FSEB 4I1RA 1X5LA 1AD0B 2CUIA 5I75C 1TQVA 3VFNB 1KCRL 3Q8EA 3FB6B 3L16A 4LPWA 4DK3A 4Y2DD 1S7WB 5DS8A 2X2JA 2F15A 2HKFH 3QHFH 2V6HA 3NPSB 4Y1AB 3PWNA 4G80A 4JY5L 1M9WA 2B2XL 2NY3B 3H7LA 4HS6B 3QUXB 3QUMA 5C0DB 3PDGA 2JKNA 1SY6L 5A2IH 3EYQC 3QZBA 3HUJB 3MZTA 2EKSB 4TM9A 3KR3H 3SGJC 2F54A 4WDIB 3U1SL 5KJ7E 3TLRA 4KK9C 1G7LA 1X5ZA 5IBUB 1U41A 4NRXB 3CHOA 4NO5B 4PTUB 5IK3A 3LZOA 4PJ8C 4GMTH 1KYOK 3HNTL 4HH8A 4L5FH 4YHOL 5I71B 4FYQA 1ZSHA 4U7KA 4JGMA 3ZDZF 2HH0L 4AL8L 1A9EB 3KJ6L 3L95B 4JDTH 3OKDB 3ATFA 1KXVA 3FXIC 3V9EA 3NIDE 4N26A 2EO1A 1KXTA 1Y1DA 4LLQA 1UCBL 1B4JH 2H4EA 3L4UA 4NBYB 3BYYA 4X9IA 3AG4B 3Q1SH 1AI1L 4RGND 3ELAT 1P5UB 3V4PH 3VFOA 2R2EA 3OMNB 3LRMA 4LQFH 3DHJA 5CJBA 2VISB 2EAEA 4OKDA 2HWZL 4MAYA 1GGBH 4LE8A 3CBRA 1J0IA 1GA2A 2XN0A 3MROA 2OMWB 3QNZB 2WOBA 3GXFA 4JG1L 4WUUE 3OSKA 3F6JA 3WJJC 3RVWC 1NBCA 1T89C 1VFAB 2WQUA 3MBEA 3RTQC 3WCYA 3ZT7A 2FX7L 1TVBB 4MYPA 2BSTB 2NY2D 2BWQA 2A74B 1H19A 4XP5L 2WGNB 5KN5A 1ZV5A 4HKZA 2EVHA 5C0IA 3QUMB 4K15A 2ZOLB 3I3DA 1KTLB 1VFUA 3QSKB 4RGOH 3HPLB 5HGDA 2K1MA 2OMBA 3HRZA 4OD2A 3LKNB 1DVUA 1ZK5A 5EC1B 5HYSA 1R3HB 3U46B 1LYQA 4ELMB 2GJZA 3EJPA 1SF3A 2F2HA 1U3HA 3SZ6A 4U1GB 2BMKA 3MPCA 1DCEA 3TM6A 3AM8A 2X6VA 3GMPB 4P46C 4TNVK 2J56A 4PR5A 4TQ8A 3W9EA 4BZ2A 5I76A 1WZLA 3QJTB 1DQJB 5E9DA 3V6FB 2CJUL 1YYLL 4NFBA 4UQ9A 1BMZA 2ITFA 1Z9NA 2XWBA 4G2AA 2GT9B 2IJ0C 1XIWD 1UQSA 2X1XR 4LCVA 3B7RL 4UYQA 4V2CB 4LLQB 4OLYL 3W37A 2FTAA 3TFKC 3TYFA 3HI1B 4NQSB 1KN2L 2AQTA 4FQ2H 5AAWC 3GI8L 2AQRA 3POHA 4ZI8A 4P04A 1T22A 4PBDA 4L3EB 5GSVB 4M6MH 1ZLVK 4QO1B 3QNXB 2D7MA 3QQ9C 2AEPH 4OCLC 5ANMB 1MFDH 3D08A 1Q0YH 3B2XA 1YO4A 1JHLL 1ACYH 1HN1A 1A4BA 3SDXE 3ZRFC 4XP4L 4OGZA 3QPXH 3GSNA 1NC2B 4Y9GA 5T1LA 1KUMA 2CKBB 1I1RA 4FN0A 5CGYC 3QFJA 2CKNA 4PLKC 3O4LE 4RFEB 5I30L 4GJTB 4YSSA 5AL8A 1JN6A 1X5XA 4CADB 1CK0H 2F08A 4ZSOE 1E6JL 1GZQA 1TQBB 1J0YA 5FYLD 2QKIB 4KZEH 4FQPA 1LWHA 1HKFA 3FB7B 3H3PL 4XMUA 1LEKA 4F91B 3G5ZB 3FT2A 4KDWA 1FNGB 4P4KB 4WFHE 4BQCA 4HIHB 1RURL 5D7JB 1FPTH 4I5BA 3R7QA 3D0AA 1SXSA 1JWMB 4HBCH 1Q9WB 3VMNA 4WU5B 4OD2B 1S6NA 1QRNA 4MD5B 4WTZG 3I74A 2X6UA 1U93A 3M86A 3T3MB 1NKGA 3BKMH 3MOAH 3O3DB 4I88A 3BCFA 4Q6IC 5EUOE 1UVQA 3EH4B 3T6ZA 1M71B 3WLWC 4KRPC 5C07B 1INEL 4GBXC 3MREA 2YXMA 3RDJA 1DDHA 3CK0H 3WV0A 4L4TE 4IGBD 4QMEA 4K23L 2EUZA 3EYUL 2C3GA 3TBCA 2Y69B 1HH9B 2ZWLT 4PR5B 5I76B 1J8RA 3K46A 2EDWA 3ZGHA 3HC0A 1SXAA 4Y1SA 4FLRA 4ZUSA 1OXYA 4PW4A 1D9KA 5I8CA 2OYMA 1IGCL 4AEIL 1IAII 4W93A 2D7OA 1BLNB 4GAJH 5MENE 5DMJB 3HBPA 4XN5A 4CMHB 1XSJA 2XTSA 1VEOA 3T0EE 3ZHDA 1HZHL 4NGHH 3BXNA 1T22B 3K81A 3H7BA 4XCYB 4AZUA 3RFZA 4HWZB 5B38G 5CLTA 3NIGB 1DBKH 4Z7OB 3ZQDA 2X9ZA 4NN6B 1C5BL 2VZOA 1W15A 2H26A 3D2TA 5C3IA 4RVBA 4LCYA 3OAYK 4M9OA 2ZT9C 4I2XE 3Q9QA 8CGTA 2W38A 1GZQB 2OMUA 5SV4A 3CDCA 5B3SB 2BS8A 2VXQA 4PGBA 4MDIB 5D1QB 3PFUA 4ANWA 1UATA 2EYSA 3FT2B 2R8SL 1YUHB 3IEAA 4WW2C 4AITA 1PIFA 4ZMXA 4R26L 3GWJA 4EXPX 2YLHA 5CU5A 2HTLC 3O6FB 1DJSA 1NFAA 4EVNB 3BZ5A 3NIFE 2E7LA 4XMXA 1CICD 4AKOA 4XMKL 2V5TA 3E1F1 3QXAA 1G6RH 5JPMC 2LR4A 2NZ9C 3KNBB 4M61A 4RAVB 4UDUA 3WIHA 3WTTA 1JZDC 5SX5H 3ZKNC 3DETD 3WFHA 2B15A 2FIKA 4KJYB 3VI3E 3L7EA 4GS7C 5HI3C 4TVPL 5JXAH 1YC7A 4D0DB 2EDNA 1UACH 2YC1B 1CLYL 4Z7WB 3N1GC 3TZVA 3OKEB 3BN3B 1QQDA 4JO3H 3PGFL 2EXSA 5I1GH 1G9NL 1MJ8H 1BZOA 4PJDF 2XRAH 4ODTL 1IBGL 3RFZB 1P4LA 2J4WL 5E08H 4GXUM 4DN3H 1O5PA 2XIDA 2A4EA 2FATL 2QSQA 3SE4A 3T3PF 5IQOA 5IMMB 2BFVL 4RSVA 1XB3A 1JZ8A 3D85B 1UJ3B 2LLNA 1I9IH 1A0QH 3MLUH 1A5FH 2FHBA 2FHCA 1FL3A 5TQ0L 4PRDA 1NFDE 2Y25A 3SB3A 3E7JA 3WMPA 1EZLA 1IM9D 1MY7A 3EHBD 4LMQE 4WGVB 4WI0B 4GSUA 4KXDA 2OMTA 4HSQA 4NO3B 3T71A 3LKQA 2O5YL 4MQ7B 4EN3B 4QTHB 2VDRH 5KSBF 3KPNA 3LV3A 4MZ2A 1G6VK 4NRYA 3QBTB 4AIXA 1GC1L 3DUUA 1I7RB 3EDJA 2BWIA 3OLEA 1JDAA 4LGRB 2DLFH 3MJ8B 3KPSA 2LHAA 1E4XL 3GMMA 4NYLA 5AKTA 1JXJA 1ZT7A 2NY0C 3CC1A 3LZFL 3SJVE 5C6TL 3B9VA 2X89A 4X8GA 1VF5C 4KKNA 2BHYA 4K94H 5ETUA 4DNLA 3KPTA 4D94A 4QHLA 2XTLA 5DLLA 3MV01 3ETBF 3FUHA 2HFTA 4KPHH 1CGTA 2EDOA 2WNXA 4JFZH 2CRMA 2VDLL 1F58H 2EIZB 1QI5A 4K3DH 4XPBH 3ZL1A 4URKA 1RZ7L 4O58H 4HULB 3U82B 3VSQA 3WBDA 5G4MA 1AXSB 2XOTA 3IJ9A 2X1WL 4KXAA 5BRPA 3TCLB 4ZUTA 1S9XA 3I6LE 3V4PA 3ZDYE 2P8MA 2XVKA 4ZW5A 4N8PA 2P5WD 4B5EA 3BD4A 3GMQA 4AGOA 2JQMA 3A6CL 1FL3B 2J88H 5I1CL 1XF4B 2PW2A 5AYUL 2GTQA 3ILPB 4H8QA 4PJHB 1JMXA 3ARDA 5AVUB 5G4NA 2OW6A 4GIPD 2E6JA 1F41A 1KGJA 2UZIH 3BEVA 1HXYB 4TQEH 3UP1A 2H1PL 3EGSB 1IE4A 2VR4A 3EJZC 5E8PA 3W11C 4Z0BH 3ZE1E 1E2WA 1RZIB 1NGPH 3D3VD 5DR5L 5JLZB 5F7FA 5ISZE 3UPRA 1QG3A 2GI0A 5FM5M 4A38A 5EPMB 1BZ9A 3Q0HA 4E9SA 2V2XA 3DUUB 3T4AB 5A2KH 1CQYA 1KJ2L 3QXTA 4FXKC 4HKXA 4N1EA 4XPAH 1CVSC 3B9KA 3T2LA 5IFAH 5LCVL 4YSTA 3OGOE 5BW7A 3VDBA 1BMWA 3JWDL 4EXKA 4R90H 4XBPA 1YNTA 3E8UL 3R4RA 3VFGL 1ZHNB 4XB8A 4YL4A 4NQEA 5C08E 5F8RC 3WFCH 2Q87A 5IHZA 3SBPA 3S3DB 5BOZG 3C6LC 4LCIH 4P9HC 3VFSA 4PFEA 4JKLA 1L9TA 1FH2A 3DPDA 4Y5YC 4IOSD 2D7TH 1TLMA 4NN5B 4X50A 5J8OA 2JTDA 3LVEA 4O00A 5HHPA 2R2HA 2DJSA 2ZF9A 3F7RA 4RGMC 5KYNA 3BIKB 1TXKA 4W9KC 3LN5A 1PTZA 4KNTA 4AVJA 1QSEA 1LMKA 1N8ZA 4KXCA 3HIZA 4AEHL 1EGJL 1EVUA 1GL4B 5BRQA 1FVEA 2RACA 3DECA 1AGEB 1JFQL 2J1YA 1S9XB 2BSRA 2UWEA 3FN0H 5F72S 3V4PB 1Z5HA 2P8MB 4AMKL 3GMQB 4LLUB 1UXMA 1TYJA 4B9FA 2CHZA 2EDTA 3SPHA 3AS1A 1DO5A 4HEPG 5E00B 5GZNC 3LRLA 5GGVY 3RWEA 3ZTJH 1VPOH 2BVQA 3VD7A 5CEXA 3BEVB 5GS2D 2ZXQA 2DQGL 4FGMA 4GAFB 4TVUA 3V4VL 1YAIA 4L8DB 1I3VA 5E8PB 2R4RL 3A6BH 3PQYD 4PJCF 1H3UA 2ALAA 3V0AC 5T3XE 2VQ1A 2DH2A 1HINH 2Y2YA 3G5WA 4K7PX 4CC4A 3KYMA 4X0KB 3B6SB 2XUWA 1HE7A 1M56B 1F4YH 1V3LA 1MFBL 3H9YA 2V2XB 1MREH 2HRPH 4POZC 2DLTA 4YK4C 2NY2B 4HKXB 5EH1A 1WZ1H 3B9KB 5E8DL 4ZMOA 3BDXA 5IB5B 3MRDB 4G8IA 3B8SA 1X5YA 2FQGA 3V7AG 1JL8A 4H7VA 4JFYA 4HGMA 4QRRD 5DWPA 3GJFK 3DWTA 2AXHA 4K5PA 1A4KA 1XR9B 4Q97A 3US9A 1B4RA 2AABH 4NDMB 5AZUA 4EI6B 2EDRA 1BAFH 1MJUH 4GG8A 1SUJA 1A22B 4W4OC 5LBSL 4FXGA 2J7LA 5JA9A 2JCWA 1XF2A 2R2HB 3RG1C 4JEGB 1EDHA 3N5AA 1RVFL 5AVSB 1FV1B 4PYGA 1PD6A 3VUAA 4OD1L 5I1KL 1U3JA 3WAJA 4QXGH 4KI1A 1FVCB 3WFEL 2LQRA 1Q9LA 3VAEA 2WXKA 1DANT 3ZE0B 3ZZSA 2HFFB 1F18A 1XIWB 4Q6YA 3MJGX 2VC2H 3C6EA 3NRFA 5C92A 1VIWA 2P80A 1UOVA 2HRLA 1RI8A 4G7SB 3AT9A 5DT1L 5KYUA 1G7QA 1AMYA 1MCPL 2IANE 3L1OL 1DEDA 3U48A 1C8QA 2VLKD 1ZA3B 3TBSA 4UM8A 5KW9L 3ARVA 5FC9A 3BGAA 4EN2A 1XF5B 4H88L 1F2XK 5E2TL 2E27L 1TEGA 3SO3C 4DP5X 3KPPA 2VQ1B 3WO4B 4E9TA 4BK4A 3KYMB 5B7MA 3AT0A 5D6CB 4PJ5D 4XOAA 3MLXH 1ZLEA 3ZW3A 4WENB 5HTSA 1P4IL 5HD8D 3KEDA 5JR1L 1F3JA 1KLUA 2FQEA 1IC5L 3T2OA 3VQMA 3P9WB 2MWCA 2WCPA 3MRCB 1F4AA 2IWKA 1HEZB 1H3PL 4OIAA 3WNOA 1UWEL 4MNQA 3TV3H 4XVSL 2BH0A 4HU8A 3QEHA 3VD9A 1G6RA 3KL0A 4NSKA 4OZGA 2XX1A 3ZDXE 1FGNH 3N41B 4YHPA 3MV7E 4FXGB 1II4E 2R7EB 1EDQA 4XMWA 2Z64C 4YEFA 1KPRA 5F96L 1MFEL 2CDFA 4IGBB 3E80A 3D39A 2DZEA 3IKKA 1I3UA 5ABAA 3ZKXC 4NQQA 1EAOA 4HKJB 5C0BA 1XHHA 1Q9LB 2NTFA 2NYYC 1G7MB 1IEAA 3L5WB 2JI3A 1GYUA 5FOJA 1PNDA 3LZLA 4KK5D 1BIHA 4N6RA 3U0TA 3MRHA 3CCHB 4FQIL 4KTYA 2CIKA 3ULUH 5D7SL 1BSIA 1O75A 2VDQH 3JWOH 4FKHA 1P7KA 1G7QB 2Q5BA 1FGVH 2QR0B 3IK2A 1DJGA 2MNWA 4CVZB 1N68A 2O72A 3GLEA 4UZGA 1I1YB 3GLAA 5KAQG 2IADA 5GRXG 2X09A 3MCLH 4AYEC 2J8OA 3KPPB 4YZFE 4K55A 1BVLA 3BZFA 5B3JF 3BJLA 2LTQC 3NJNA 4FDWA 3EFOA 3IDGA 5KTEL 1O7DE 4HX1A 3HVNA 4L37B 1W6LA 2VL4A 15C8L 3H4HA 5DJXB 4Y2LA 5F9OH 1DVFA 4PRPA 6FABL 3P2TA 3EOTH 4KTDL 1ACZA 2GHZA 4HLEA 2V5RA 4OV6F 4OGAD 4JM2C 5AW4B 4WUUD 4G6MH 4NSKB 1OAQL 5DEJA 4AL8C 2XN9A 4JRYA 1I4FA 2OMXA 5D4HA 5MI0C 4YHPB 4RISH 4JN2B 5JO5A 3WTXA 4M00A 3BAKA 2DQUL 2LU4A 2GSMB 5HDBB 3BKCL 3DI3B 2CDFB 4OSUH 4NCDA 3U6XA 3D52A 5AKSA 4FI6A 5JHLA 4JKPL 2PP9A 2NUPB 3X3FL 3ET9F 2QQLL 2WP3T 1KBBA 3WHXA 2E7DA 4BV1A 1VLXA 4OIBA 1MRFL 4Z0XB 1RKRA 4X6DB 2UYLA 6PAZA 1F90L 4WI8A 4XC1L 4B9ZA 5JW4Q 3TVMD 2Y3NA 5ADOL 3X1NA 3MJ6A 2P24A 1NGXA 5AWNL 5DC9B 4DPAX 3AREC 4WKXA 6PCYA 4O5LL 3UYPA 2JVUA 3GMRB 1GKOA 4YHML 2DQTH 1JD7A 2KDYA 3LEVH 3K2UL 1KGCE 3T4YA 3V6OC 1CBVL 4H25A 3VXMA 2WQRA 4OKVB 1BVLB 2Z9TA 3Q8FA 4XPFH 4M43L 5ENWA 2A1WH 4FQJL 1F6AA 1GZHC 3GBML 3ULVF 3W5NA 1IM9B 4P2YA 1E5BA 4JFEA 4QAMB 2WZ6A 1NAKL 5L6YH 4UTCA 3BI9X 2Y7QA 2VJXA 2EUXA 3HC2A 1X7QA 3DLQR 2VMEA 3RZCD 2AK4A 3FH8A 2VZUA 4NZRL 1YPZF 5A2JH 4LAQL 5DHVH 1AD9A 2JWYA 4DGYH 3RRQA 5FLVA 1FJ1A 1HCVA 2X40A 1VFBA 1N19A 3O4LD 2B1HH 1CDIA 4HIEA 4IEFA 5EWIL 1LP9E 5IBTH 3LY6A 5KVFE 2ESVA 3HOGA 2VXTH 2AHIA 2WIIB 4NQEE 2XG5B 3S4SA 4F3FA 4QOKE 2EDHA 3WXWH 4R83A 4WFHD 3WN6A 3BP5B 4TNVF 3HFMH 3S35L 4UQBA 2C3XA 5FM8A 3TA3A 2K6ZA 3A21A 1R46A 4X8JA 3QNFA 5INDA 4KFMA 4D8PB 5IB3B 1YN6A 5E0FA 2PW1B 3NEEA 4H0GA 3O0RL 3U6RB 2H9GB 1HQ4B 5GS3A 1USQA 4LCUB 1OOWA 2ZD0A 3V6ZB 3F2LA 5J6GA 2DWEA 4L4TD 3TTYA 1B6UA 2RJMA 5B7FA 3HHRB 3S0PA 4R0LC 4EDWH 2UWEE 4IBTA 4X7FC 4QRPE 5JXED 2Z31C 4PB0L 1W80A 4P4RA 3C09B 1V54B 3FF8A 3QQDA 5GXBB 2Q7YB 3BAEL 4P3WA 4G5AA 5ENWB 4B41A 4YPGB 1JXGA 5MEND 3BPLC 5DZNA 1NC4D 1UH2A 1JYWA 1GIGL 2GITA 3OV6A 3T0ED 1ZRUA 5K39A 3VSTA 2RCSH 1RZGB 1X4XA 3WIFA 3GD1C 2KHAA 3FU3A 4DK6A 1MWAL 4GKLA 3D3VB 2X4PA 1XZWA 3F7QA 5IMOA 2XV3A 3JTSA 4NO2A 2I5YL 3QWRD 3FFOA 2P5ED 1PDKA 2DQEH 4OLZH 1N4XL 5SX5K 1F1DA 3GXIA 2NY5L 2JJTC 4Y16A 2PPCA 5BVPL 4XPHH 2MMXA 1IC4L 4KMLB 1CGWA 5GS1C 3ECVA 4Z7QE 3PWPA 4PRHE 1NANH 1KTDB 5KJRH 3LPFA 5FYKE 2ESVB 2ARJA 3U4AA 4O2CB 4S1QL 3DJZA 3O3BB 2DQDH 2EKJA 1DJHA 3LKRA 3MLRH 3UP6A 3KPLB 5AVYB 5KG9A 3E2HC 4U49A 4XWOC 2NY6D 3ZQ9A 3II1A 2QSVA 1JNLL 5C09E 3LB6C 4H26B 3VXNB 4H1LG 3FTUA 4YL9A 1NEPA 3ECUA 4ZOEA 3HNVL 3Q48A 3ALWA 1HIML 5F6IB 1F00I 3IGAA 4NZFA 3O6KL 1A6VH 1S2EA 2PPDA 3ARBC 3O2VL 4YWGL 3LZNA 4CN4A 1U33A 2BVUA 3DK0A 3ETSA 2D7PA 4KXZI 2C7UB 3ABZA 2YGQA 4BKSC 3HZKB 1KCUH 2DWEB 3UJTL 4YFLF 2CSPA 2OXHB 3HEIB 3JUZA 1XGZA 4Y19A 4LLVB 4P4RB 4NM4L 3V2AR 3CDGA 3VCLA 1MCQA 4CDGC 3QQDB 5DJ8A 4YDJB 4Y5VC 1VAHA 4ODWA 2YQ3A 2Q20A 2GITB 3RPBA 5K39B 4RZKA 2AXWA 3UIZA 3QFGA 3UIYA 3WIFB 1QVOB 5I19L 1QBMH 3ZYZA 2ZSWA 1ADQL 1PS3A 2X4PB 4OQTL 4LGSB 3BWAA 4FNPA 2FX9L 2DJUA 1T2QH 4KMQA 1XCTB 3RWJA 1Q9OB 2I24N 1X5GA 4JX0A 2XY1A 3AGVA 1CFVL 2FNBA 5BO0D 1U95B 3P73A 1JNJA 1PZ3A 1J1OL 4IOFD 2FL5A 1REIA 1WS7A 2C9VA 3EFFA 3HVDA 4JZNB 1GGIL 2Y5EA 3R18A 1G9NC 1AXIB 1W91A 4PV8A 5CUSH 4IMLA 5D7KE 3T2QA 2J2ZB 1ZGLB 1BMGA 3HE7C 1S7VA 3GTTA 1HT6A 2COVD 4WO4C 2AXGB 3K2KA 3Q5TA 2NXYD 4NHCH 1CZ8H 4P3CL 5I1EH 5D7HA 3A47A 2DTML 3D51A 1M7DB 2VC2B 3C5SA 3IE9A 3LPPA 3NFPA 4PMFA 3CQFA 1TT6A 3DVFA 1I85A 3SJVD 2HVJB 1L5GA 1PL3A 1UC6A 2P49B 3O6ML 1KF9B 4KK9D 1YEWA 4JCWA 4KKLC 2P8PA 4G7QB 2Z0BA 4GAYB 4PY7A 3VMPA 5ID1B 3O8XC 3CDGB 4KQ3H 3VCLB 3AT8A 1GGCH 4ZNEE 1GW6A 1KPVB 2F58L 3JTTA 4NZUH 4G9FE 4RMQA 3CUPB 3MCG1 3QRGH 5C6WH 3SSGA 3C08L 3QEUA 3TJPA 2HN7A 3AMKA 3VGEA 3BDYL 1AZRA 3MYZA 3O41B 3CN4A 4ORGB 4UOW1 1OQOA 3VWJC 5JW3H 1U91A 3TWCL 4XCEA 4ZXBD 2Q8BL 1MCEA 3I6LD 3RVVC 3HS0A 3QH3A 4GG6A 5I6XC 3D4ZA 3R1GL 4XZUA 4LOEA 1DDTA 1JGIA 3CSBA 3VJ6A 3LCYA 4R8WH 2XWDA 1LO4H 3O81A 3FQRA 1N5AA 5C9JB 1J11A 4HJJL 3SDCD 1KB5H 2H6PB 2YXFA 1IAOA 4PJEA 4PV8B 4FABL 3F8UB 1BCIA 5ISZD 5EBLB 1S3RA 2EEFA 2H0PA 5KBPA 5T33L 1EMTH 3VXTA 1GZPA 3ME0B 3TBWA 5I17B 1I8LA 2Q8AL 4UV7L 4QRFA 1TZOA 3KL5A 4Y4FD 2NXZD 1M3JA 4FTVA 2XSKA 3FBQA 2IVFC 4NUGL 4I18C 1VGKB 4KVCH 1OWWA 1XCQA 5C08D 5F88B 1MHPH 1NUFA 4Z7OF 2IMNA 2P8PB 3K8LA 1JHKL 3DROB 4NX0A 3K6NA 4LP4A 1KIPA 2OP4H 3GJEA 4FQXC 3IFOA 5ICYB 1OIOA 4HCRA 4QHPA 5EIQA 1A9VA 1V3MA 1NWOA 2GBAA 1XH0A 4ETYA 1P7QA 4B97A 4UIKH 5D1ZC 5JHDA 3TJHC 4ZDHB 4MKTA 4GKSA 4ODUA 3VXME 2ARWA 3JWDC 4L3AA 4LCCC 4MZRA 3S36X 3QZOA 5K69A 3FO2B 3FPYA 3GRWA 2E7BA 2OTUA 3NIDB 1S5HA 3J27A 3QDMD 3S96B 3UTZA 2ICWI 3IDYC 3MI6A 4XVUC 2HG5B 2RQ8A 1JHTB 3S5LA 4G72B 5BNXD 3MV8A 4BDVA 5DHVA 3ZX1A 2ENYA 4ZFQA 1U2YA 4OI7A 1MSPA 4M4RB 5IT2L 3MOQA 3ARUA 5CGYD 3T04D 1MJ7H 5DVOA 1NCDL 5DQJB 4G1EA 2R15A 3BC9A 3VGAB 4TSCH 5GS0D 3SD2A 3QGVA 3MBXL 5DMIL 2WB1A 4GQQA 4JREB 4PCSA 3ZT6A 4L8SA 3VXTB 1HS6A 1DVXA 4M3HA 1FNFA 1JV5A 4WNJA 2DV6A 5EUKA 2X0WA 3SBRA 1M42A 5C0RL 2NSQA 1WSST 5EIIA 1UWGH 1IBDA 3ZSSA 1WBYB 2ZZUT 3LQZA 4AQ1A 4UBDC 4XTRC 5C0NC 3HN8A 1XO8A 1MLCA 4UILL 2PP7A 2IDSA 4ZFOA 3FT3A 1XCQB 2DWDB 3BPNC 4XN8A 1PZ5A 3BQUD 4L8CB 2AANA 1FZMA 3QZMA 2X6BA 4K71B 3WHE1 3ZE2E 5IQLA 1HCZA 3IFOB 2CJSA 1FG2A 4PM1A 3X1BA 1YEGL 1H9VA 2NYKA 3ECQA 2CMRL 3VD3A 3LQAL 5IESL 2MNUA 1CXHA 2VXUL 4I4WA 3RFRA 4XX1G 1K8IA 4NZTL 1SZNA 4N90E 3DUHA 1J1XL 1GYWA 4TYUA 1ECZA 1A1MB 3KXFA 1OW0C 4WWKC 5EA0L 5DDHA 2ZCKH 1AQMA 4ODUB 3E1ZA 1NANI 4Z3TA 1T5XA 2XXMB 1ITBB 3L3KA 3IRZA 3QZLA 5I0XA 1EXUB 1S5HB 5K9QI 4IU2B 1TZHA 1HYSD 2CO6A 1FBIH 1HHGB 4S0TD 1HL8A 4U6YA 4LGPB 2EXYC 4BCXA 3D2UD 4BDVB 5JPNA 1SVBA 2IAND 2VQ4A 2DI8A 3M8OL 4CGTA 3SQBB 4A7GF 1UM4L 4YXHH 3F62A 1AQHA 1J5OH 5DJAA 4XMPH 3RZCB 3VWKD 1KELH 1K85A 1JG9A 5J6HA 2AQ3A 1HHJB 4HJIA 4P05A 4AG4H 5AOZA 4RRPM 4GT0A 4QIRA 2DYRB 3U0PA 3PWPE 3MA9L 3ULVL 1DBBH 3THMH 1ZATA 2ICWB 3O4LB 3ARFC 4D2NA 1TMQA 4HIPA 4P5TD 1OD9A 2CR3A 4ZSOB 4XNYL 5BZZA 4WI2A 3CSPA 4MCZB 1UM6H 4DVRH 3NJFA 1Z9SB 3C8KA 4EQ3A 5DD0H 1A66A 2IV8A 3EO0B 4X4MA 3RWHB 3WO3B 3F5WA 4MA7L 4NQCD 4N2GA 4U1HA 4NKIH 1TJGL 3F05A 3GMNB 1HI6A 1FZMB 3M88A 3VG0H 3CZUB 3VFRA 3SCMD 2KQMA 4BK5C 4E9QA 4ZMLA 1DP0A 1H5BC 3FW6A 3G5YB 3MRQB 2WUCL 4I7ZC 4JPQA 4JFQB 1DE4A 3KLAA 3MV7D 1YQVL 1O6TA 1AGCA 2H3NB 3ARRA 1TETL 3OKNA 4JO4L 2R29L 4HALA 3I6GA 4I4WB 4MNGE 3WN5B 5J5EA 2J5WA 3DMMD 4PUBH 4XB3A 2BSDA 1L9PA 2KC0A 1YEFL 2FLRT 1RPQA 2OJ1A 4U6XB 5HI3D 4GRWE 3W3BA 4HQQL 3ARSA 2I7OA 3CZLA 5ALBH 5GGRB 4I87A 5FFLA 2JB6A 3CZSA 3MRKA 4KDTC 1ZS2A 5ILTH 4OFVA 3TL5A 4OJDH 4F5CA 2A77H 4PMEA 3V7AE 1AZVA 5A1AA 3L3KB 5FUOH 4MD0A 5C7ZA 2NY7H 3FRPB 2E59A 1I9RH 2B5IC 3QORC 1NC4B 3G6JA 2QQNH 3IM1A 5T8IA 2K9FB 1ZCRA 2HUEA 3ZL4H 1BFOB 1FE8L 4U6YB 1HTYA 4HZ1A 5EOCJ 2GK2A 1TTFA 1LVEA 4W9EC 1HSAB 3SPJA 2PO6C 3HN3A 3QQ4B 3UC0H 1WPCA 1T83C 1T7ZA 2P5EB 4A7TA 2MHAA 3UEQA 3VXOA 1MCCA 4EIZC 2E3VA 2RB8A 3MJ7B 3IXAA 2IDQA 1WAAF 1F1AA 1J8HE 2F19L 4KMTL 5GRJL 1ZLWK 3FCTB 3NG5A 5TH2A 3TPUB 1L9NA 4KH2A 4UT9L 4DKEL 1HKLL 3JWNE 3IFPA 3ZZLA 2YBRA 4X7SL 2NY6B 4RFOL 2E9JA 3F5WB 4U1HB 1YN7A 3T0DA 1U3YA 3FQ4A 5AOMA 2X70B 4B6ZA 5K9OA 5ERWB 5IWLC 5DS2A 1ZAGA 3IFLH 2B39A 3CG8A 3RWIB 1BPVA 4KX7A 3NIFB 1DE4B 2X6MA 3KLAB 1G7IA 1DQMH 4KJPC 2PXYC 2GCYA 1MQKH 1MFMA 1SEQH 1T4WA 2X4QA 3SGJA 3PREA 4NQUA 3L9RA 5TDPB 3FQNB 3KWVA 43CAA 2GTZB 2JQAA 2I9LA 2ZCHL 3P4MA 3C2AL 4LBEA 4GW5A 1IKFH 4N87A 5JUEL 1ZWIA 3EZJB 3CE1A 3MRKB 1ZEAL 2WQVA 4NS0A 3ZO9A 4P23C 3VI3B 3RWGB 4PJ8A 1EIBA 4G7VH 1NCUA 3QXDB 4X6FB 4JFFA 5LO7A 4AM0Q 4MD0B 5EF2A 1ZXQA 1PPIA 4XVOA 4Z3JA 1BJ1H 3IVKB 4WNQA 4PJBF 1AGBB 4B50A 3BHBA 2HT4D 2JH2A 4NKMA 5EZIL 1DL7H 3CGTA 3QI9D 4PN6A 1A3LH 4ZD3L 2ADJB 2BVEA 3GHEH 3WEOA 3WKNA 1OV8A 4ZMQA 2N7SA 4BA0A 2UV3A 1AZUA 4FC3E 4F80A 1I9JL 4W6XB 3ZYOA 4M5TA 3UG5A 2JKJA 4FG4A 1RUPH 1QFPA 3FONB 2IH3B 5IW3A 1KGCD 2X7LB 1NIDA 1T21A 3LTVA 2I07A 1OCOB 2JFCA 5D5ME 4J3WA 4UU9B 1NFDB 3ARDD 3VVWA 2X3AA 2EZ0D 1IEBA 1BEYL 4OZ4A 4RZCB 3UBXA 4NP9A 1CDHA 3EJZD 5IROC 1NM4A 3W11D 4EI0A 2NNFA 3BAXA 3G3LA 1YEEL 1KCSH 4HIIB 5DZVA 3WJJA 4G8EB 1T89A 1FF5A 2KZ1B 3I50H 3N85H 4KUZH 5DYOB 4LPYA 3RTQA 3GMOA 3W0WA 2CHXA 1E4HA 4OT1L 3CVHH 4IK7A 1MIEL 1T1XB 4NAQA 3ZE0F 2EACA 3KPRE 5DHXB 2HG0A 4V1DE 4NO0A 1TNMA 4U3SA 5DK2A 5DQDH 2FZ3B 4HT1H 2JTYA 3V9FA 1FL5A 1GY1A 4FTVE 2J5LB 4N8VG 1XGUA 2NXYB 3RWCB 1OP4A 1WBZA 2BM3A 1GY2A 1ZT4B 1MRDL 1A2YA 2HT2C 1W0WA 2IOOA 3ASWA 3MN8A 1VERA 3C6LD 4XBEH 5DUPL 1AZNA 2YAEA 4U1KB 3SJVB 3LZQA 2FBJH 2W9DH 3VNYA 3JV0A 4QOKD 3T08A 4GW5B 1KY7A 4XOCA 4PJIA 2WTPA 3QYMA 3LIZA 1IL1A 2G3XA 3ZY7A 5KVFH 2PETA 3LNGA 4P46A 4OLUL 2KDGA 4RIRA 5LXGH 4L1HA 3PHOA 4ELKB 2BP5M 4XO3A 1FSKC 5BUGA 1XH1A 1WV7T 4J8RA 5JHDE 4AGQA 3CC5B 4XP1H 5I8OH 2Y6SC 2N1KA 1PX3A 1ZMYA 2CLZB 3LHPH 3QQXA 5IQ9B 2LAAA 1YEHL 2JNZA 4IDLA 1CE1H 2BY1A 4AUUA 3U2IA 3LRSA 1IFGA 3BKYL 5HHQB 4NB7A 2KPWA 2EEXA 4QRPD 4ZXBB 3LSOA 1QUPA 2AK1L 5AAWA 3ZDYB 1AKPA 2CKBL 4J28A 5JIDA 3GKWH 3PV6A 3U0WH 4PP2A 1QKZH 3MFGB 4M7JH 5C3LD 1IBYA 5BZWA 1KB5B 4YSUA 4S1SH 5DQ9B 1KXQA 4I1PA 3UBXB 5I73B 2FE0A 3H55A 1WG3A 1ECYA 1KG0B 1IAIM 1XXFC 1L6ZA 5LHDA 5M7QA 4DGIH 5HGAB 3SDCB 1JV2B 4N1HB 1YJDL 2OL3H 2EIBA 1E3XA 3JV4B 4KJWC 5DHYA 4XP9L 3Q3GB 2WKOF 2CRYA 2J8UE 3WXVH 3ARGD 2G75A 2IGLA 5ISZB 5I6PA 2FGWH 5FHBL 3AS2A 1OANA 5L2JA 1OAKL 2OKMA 1TTBA 3MRFA 3SOBL 4BBWA 3SYAA 3IU4H 9CGTA 1N6VA 2YK1L 4P5KA 4Y4FB 2NXZB 4PRHD 3K6FA 4FLHA 5CN2A 2JB5L 3GZOA 4N5EC 5DD3L 4GKZA 3QAZB 4RQQB 1NBQA 1NSNH 5C08B 5TPWH 2VN4A 4UT7H 3MLPA 4GBXA 4BFKA 1TFHA 1U58A 3TEXA 3BAIA 3SE3C 2DB8A 2YHGA 4GKNB 2BS9A 1IL1B 5C09D 1C7TA 2CBMA 4WSJA 3MRLA 1E8YA 4X6EA 4GRLD 3DTXB 1CU4H 1U8PB 5J1AA 3OMZA 1DUZA 4NQXA 3TGXA 4KVNL 2Y36L 2FEDC 2NY5C 4I1NB 3SDYL 1IC7L 2PYEA 3UYRH 3LRSB 2BOCB 1R3KA 5CS7A 5DEFA 5C8JA 1FZOB 2NW3A 5JOFA 3IJSA 3NCCB 5JOEA 4V2BA 2NRDA 4Y9FA 4PP2B 2F6AA 2QGCA 3QDMB 2V5SA 5BZWB 1B4TA 3NMEA 4AX3A 2B3IA 4HK0A 3CD4A 4LRIC 3P3TA 3V5KA 2ZSVB 2WZPA 2YBGA 2YEVB 4NI3A 5HHME 3IKCA 5L8KB 4EDXB 4HDIB 1ERNA 4QY8B 4N0UE 2YD8A 1F97A 2QV2A 4MHHI 2A38A 3QDGE 4X6DF 5DHDA 5AOKA 1C12A 4YE0A 3HRPA 4HOWA 4WW2A 3M1CA 4AMWA 2A2QT 3PWLA 5AYQA 5D2LA 3R06A 5J12C 3AWFA 1MFAL 3FZUD 1I75A 4MQXC 1JF1A 3EGXA 2VL5A 4IHOB 5FYJL 1P84J 4Q6IB 4LSTL 4RBPK 2DYSB 1RAMA 3GNMH 2AJUH 5D7IB 5I18H 4N2LA 4KRPB 4QHNA 1FL6A 3KBPA 3IS0X 5J6SA 1LDPH 1MF2H 5D7KD 5IFHL 2MPAH 4UT6L 4ZUUA 3VM7A 5JPMA 3OLDA 3HBGA 3N0PB 1CXKA 4M5YL 5EEYA 1M4KA 1U8OB 3IGFA 3MRLB 1OGTB 1ZDQA 4XBGB 2R0KL 4ZO8A 4OF3A 3Q43A 5BQ7A 1C7SA 2WBJD 4XHJC 5MEOB 2RR3A 2PCYA 2WZ5A 4TSBH 3WY1A 3OWRA 4M6AA 2PYEB 2HX7A 3FRUB 5AZ2L 5JW5A 3KDMB 4XNDA 1JTOA 3EG9B 2VKXA 1CLOL 1DBJH 1R3IH 5DEFB 3CX5J 3OXSA 3W39A 1NEUA 1IAIL 1TCRA 2NW3B 5JOFB 2ADIA 4LEOA 3PGCA 3QNYB 1OTUD 3L3GA 1DQLL 3BMWA 5EORH 1OF2B 3GSUB 4ZMPA 5A40E 4G9FD 2DJMA 3FT1A 2MTAA 1HHIB 1NMCC 2DQCH 2PCFB 5CWSB 4QRTA 3O2WH 4HK0B 3AITA 2Q0ZX 4TVSa 1KCRH 5FDYA 5IUCA 2CZNA 4MTMA 3VWKB 1AHWC 3Q13A 4ZQKA 4YQXH 5EDXA 1T3FB 2K3TA 3VH8G 1B0GB 1ED3B 4B9JA 1OAJA 1SJXA 3S97C 1L0PA 3KJ4B 4JDVB 5DZPA 1JRHI 1OCWL 3NP4A 2BHZA 1C08A 1OQXA 2G30A 3D8MA 4P5TB 4N0RA 1V10A 2AF2A 4TUKL 5AD0B 1ANUA 4QJ3B 3GC3A 4RETB 8FABB 1FP5A 5D2LB 2F5BL 3R06B 3VM5A 4YC2C 3WL9A 2VAJA 4R2GC 4D9QE 2VL5B 1W8OA 1MW2A 3MLTA 2VR3A 1W72A 5F1SA 4YHYC 4JRXE 4NQCB 4QHNB 1FL6B 3HNTH 4YHOH 3SCMB 3HG1E 4ES8A 4J2QA 3ZDXB 3N43B 2W80C 3QCTH 2YGOA 3B2VL 2HH0H 4Y4KC 3G08A 4AL8H 3KJ6H 1LGVA 1AQDA 2VR9A 4DP6X 1O9WA 3FL7A 32C2A 3EOBA 4JZJC 4PJAE 4UZUA 4XGZB 3DMMB 5F7YC 4GS7B 1PSKL 1U8JB 1ID2A 3QISA 5MERA 3FQUA 3EYVB 4BCYA 3ESOA 3SE9L 4MXVE 5EC2A 1UT9A 2IH1A 2YPVA 5DFWH 4YHNA 3S8WA 5EU3A 4X5LA 4TPRL 3OXSB 1K3ZA 2BP0A 2HKAA 2FWOA 3G5VA 1TCRB 3DO3A 3IJEA 4XXDA 2WLIA 2K8QA 1KCKA 3PGCB 2BINA 1VADA 4JVPA 1ACCA 4KKQA 4BH7B 1AS7A 1LQSR 4LCWA 4PWHA 4NQDE 4I9XA 5K9KA 4PWKA 4PYHA 2FVNA 1HHHA 2ICEA 4F2EA 4JG1H 4ADGA 1LWJA 1T04A 4ZW8A 2H2PC 5FR3A 2HKFL 3QHFL 4FULA 4UUJA 4ZQKB 2FJFA 1UG9A 3MRMA 4XNXL 3B1TA 3PPEA 3STBA 3MGOA 4XP5H 2JKXA 2I26N 2YJQA 5J89A 2K4WA 2ZUSA 3DOSA 4NNXB 4L2YA 3CVHA 4OBRA 4GNKB 3D18B 3FN9A 2CH8A 4NC1C 5E94A 2W92A 3ZO0A 2XC8A 2WWMC 3UX9B 2WXQA 5FV1L 5G5DB 3E8VA 1TQWA 3SGEH 4FXKA 4OZIB 1ODUA 1NCBL 3FKUS 5F9JB 4JB9L 3FQXB 4HCGA 4X80L 5KSVB 2NY0B 4ACTA 2GJ6E 2WXJA 3B9AA 1BM7A 3MRGB 3R0NA 3KH3A 3PWVA 2DM7A 4F9PA 3RL2B 5INCA 2BZDA 2CJUH 1IBHA 1YYLH 4P2RA 4HUMB 4HK3J 2R23A 4X9BA 4PJGA 1JK9A 3QIBA 1B4JL 5I8EA 5E5MA 3SYCA 5KYYA 3MR9B 3DNKA 4Y5YA 3T3PE 3RNQA 3WI9A 3ZGIA 2JIXA 4OLYH 3SOTA 1KN2H 4JBSA 3V0DA 3D48R 3GI8H 1XV8A 4HCFA 1RK0B 3FUDA 3UTTA 3G5VB 1OWRM 1MOEA 3BH4A 4N0CD 2HCZX 3U7AA 1O6SA 2EO9A 5JA8B 4XXDB 1GGBL 1V7NH 4PRAA 3F7YA 4WFEE 1E3ZA 2CAKA 3B37A 2DYPA 4PREA 3QI9B 3KBFA 3LKOB 1HHHB 1NLDL 3AQXA 4N90D 4PSRA 3QFDA 5DFTA 4DFHA 1QTSA 4GUPA 4OU3A 3K80A 5I30H 3QJRB 4XR8C 3W2DL 3OHXC 3ZT5A 2FJFB 2ZOUA 1VZIA 5GZNA 3PNRB 3H3PH 3RVUD 1SF5A 1TJIL 1YYMH 4XRCA 5DRNA 2BVYA 4RESB 1PY4A 5F44A 3WSQH 4DUWA 1FCCA 2AJ3A 3CVHB 2DIAA 3RKDC 4PIRF 1AOHA 4G6JH 3BN9C 3LNDA 3UTOA 4UYPA 4ZFGL 2ZYRA 4WV1B 4JNXA 2DQFB 3LQAC 1INEH 3QPQC 4FXKB 3UZVA 4GXVH 3GBLA 4PLNC 4B27A 1ZLUK 4RX4D 4AYBA 1OP3H 4LVNB 4M3JA 1OTSD 4MVBC 4X2UA 1YA5A 4K23H 4ECNA 4ONHA 4Z3GA 3DIFB 1PJ9A 4UQAA 3PWVB 4HXBH 3WNPA 3H3BC 5JW4R 1LP9B 2X9WA 3C6LB 4ZOAA 5KSAC 5J0BA 1PMYA 4AEIH 3FFCA 2XZQL 3NYKA 3NJVA 2R1WA 4QOKB 5KYYB 4FQ2L 5T5FH 4Z7UA 3FUMA 5J3HD 1RHHB 1OK0A 2BP8A 5JQ6L 3AAZA 1TIUA 1ZVHA 2WLHA 1CFQA 4PREB 3QPXL 1C5BH 2OX5B 3FFDB 1J0JA 3DX3A 4Q56A 2VR5A 3ULVC 5HDQL 1A6WL 1MCSA 2K70A 4IOIB 2MKLC 2ZX5A 1CK0L 2WBKA 4QRPB 1M53A 1R6VA 2E9BA 3GMLB 4TTDC 4KZEL 4YXKH 3OG6B 4W9CC 2X9XA 4Z23A 4MCNA 3H42L 1FPTL 3IMTA 5F7MC 3SDDC 3BZEB 2R8SH 2OL3B 4Y2DC 4X5WA 1M05A 4GRWH 4YDLB 4G11A 5JYMA 5KVEE 3IDIA 2OW7A 5FYLL 2CIIA 2R0ZL 3LN9A 3I6SA 1XEUA 4KK8C 1I7ZA 4WTZA 4PRBA 3BRFA 1EEUA 2WYZA 1JMZA 3HS8A 3MOAL 4XZ4A 2Z4QA 5DA0B 1WC7A 5TDOB 1JDCA 3CK0L 2B0SH 4XX1E 3UZVB 5BZDA 4K5LA 4JCLA 1SYSB 2FWSA 2VJ8A 1OCCB 5IJDC 3ZIYA 3QJHB 5EZLA 2XV2A 3QAQA 1QTYT 3QRBA 4DSYA 1LILA 1J8HD 3SPCA 1G5AA 1J05B 3RGVC 4GAJL 5TFSL 5FF6A 2Q6WB 5BXFA 1K4DB 3AVEA 4Y7MA 1UASA 1CLYH 3II2A 3IGUA 4G8AC 1RK1B 4NGHL 1YDPA 4ZAKD 4JR9H 4IRSC 3RJOA 3I85A 4IDJL 3SBWC 1VZHA 3KS0H 4AK2A 4BCZA 1SJEA 1CO1A 5BO1H 4D9RE 3L9BA 3AG1B 5B38A 4GPVA 2Q76A 2BP8B 3Q01A 3NIDF 3L7FB 2J4WH 3N50A 2FO1A 2QGDA 2R2BA 2I9TB 1PGRB 2F5AL 3TA4D 2QELA 5TJWK 4XMLL 2KBGA 3S2AA 2QPEB 3NPSC 5B4MC 4OF8A 3FOMB 3HHSB 1C5DB 4JANB 1J18A 3QUXC 4R3SA 5CSGA 4DKTA 3CFEA 1V05A 4ZTEA 4W6YB 2I7SA 5CGTA 2Z8VC 3O4OC 4C56E 2GSGA 3VWJD 3FTXA 3CFBA 1BXVA 2BSEA 5G4OA 2O5ZL 3OKOA 1U8KB 1T0MA 3L3JB 4BSWA 1YMHA 3ZTNL 1SY6A 1WWCA 2C4FU 1NGQL 2Z4QB 4J4PC 1WC7B 1CD0A 4BM7A 5CEZD 3V4LA 2CGYA 4S10A 1E4XH 2QKSA 5I71C 5BZDB 2IAMD 3NFSH 3L9EA 2WBWB 4QHKJ 4I89A 1CLVA 5C6TH 1UUSA 1YG9A 5IKCB 4OTXL 2XNAA 5F7WC 3RZWA 5EZOL 5C6PB 5EZLB 4TF4A 2FJSA 3TEZA 5CEZH 3BFQG 3MCKA 3A23A 1FUNA 4A67A 5H94B 4DO6A 5AFAA 1QLFA 3KLQA 5JXAL 1AYRA 4HK3N 4HLJA 4JM2A 2LVCA 5E9AA 4FFWD 5KZCD 1EO8H 3K7UA 5LGYA 5DXWA 4XVJH 2UY7A 1OTTC 4JO3L 1L6XA 2KLTA 5I15L 4PLJC 2BX5A 2VDLH 1YDPB 2ZYHA 5JNYB 5DJ0B 1IGJA 1QBLL 3PABA 1DQDH 1K6QL 1BD2A 2ZUVA 3KPRD 5B1AB 1AS6A 4V1DD 5TE7L 5ESVA 1LEGB 1RZ7H 4FLOA 1Q9KB 4YSQA 2CLVA 4DHLA 3G6AA 3KD4A 2D0GA 2WBJB 2QVKA 4UOW0 4PJXA 1I9IL 2X1PA 3MLUL 3HZVB 4HUXB 3QDJD 4YN3A 4LEEA 5I0DA 1XGQB 3DYOA 3GM0A 1HXMB 4OFDA 5AYUH 2D9CA 2XWTA 2NX5D 4ABQA 2IH9A 5K1NA 4KNQA 5L0QB 3SDXF 4HU2A 2QVIA 3VI4A 2W88A 3JSSA 3DHUA 2LFGA 2H1PH 3VVVA 1SM3H 3H9SE 1KCWA 5DR5H 4H8UA 3V6OA 2JLPA 3B3IA 3B7TA 4IYKA 4YSCA 5MEPA 3UADA 3PNWB 2YD1A 3IYLW 3G9VA 3PHQA 2OMVB 4G8FA 3U4EB 1GZHA 1KJ2H 4WQOA 2LTQB 4TUUA 4P5RA 1BVKB 3NQKA 3RB5A 1N59A 5LCVH 3GGWB 2FYYA 4KKCC 3CU7A 3CHXA 3JT0A 1CD1B 1FCGA 3JWDH 1PLGL 4G3YH 4BE6A 1LO0L 5KVGH 3MRNB 3BEWA 1K8DA 3E8UH 1K3IA 5EUOF 1JGEA 3HR5A 4IIQC 4Z7VA 1MNNA 2YWZA 4YZWA 5H35A 5DO8A 3QCVL 5LDUA 4OGXL 2Y7LA 5D6DC 3OBAA 3WKML 3BUYA 2FJGB 3FQ2A 4JFZL 2UY7B 2VDNB 3BVUA 4LOUC 1F58L 3VO0A 3TEUA 4R7VA 5KSUB 3A67H 5FUCE 3A22A 2R27A 4K3DL 3QZWG 5C0CE 3PABB 4MJIA 4ZUVA 3GXDA 4LSUL 4R7NA 4OJAA 1UD6A 1BD2B 3VU1A 2PMZA 3NDZE 4HIJB 1GJIA 2GPZA 4AEHH 2ZONA 5MHSE 3BUDA 1FWXA 2ZX7A 3VFTA 3IDMB 1JPFA 3GSXA 1JFQH 1PQZB 4QCIA 3SKMB 4AMKH 2NPLX 3UJIH 2J88L 3D34A 3MGTB 1E9OB 2ZX9A 5HDOA 4GUQA 1EUUA 2OBGA 2P52A 4GEIA 3JV6A 4FZ8H 3VGBA 1I7TA 4TQEL 4P4KC 5E70A 3VI4B 4ZMYA 3ZOAA 5D7JC 4WHYG 4MJ6A 1YJDC 3FHAA 3CFTA 1I1CA 3AREB 2DQGH 4PVLA 2CK2A 3VXUA 3SY0A 2OV0A 4GSDL 2R4RH 2Z31A 4N2MA 4K7PL 3QHTC 5DRWA 4E9YA 1AY1H 3GZPA 4MCYA 1HC1A 3B3IB 1W0VA 4LHUD 3H2QA 4WU7A 1P2CA 1MFBH 3L1FA 4NKDB 5CR8A 3TIDA 1AE6L 2E9GA 4B9YA 5E8DH 3RVTD 3KYNB 2ZXWB 4R90L 4YNYA 1WFJA 3M7FB 2X4SA 3ES6A 3QVAA 4PD4J 2NR6D 1K8DB 1XGPA 3DUSB 3QO0A 4KRNA 5AOJA 4OCYH 4DZBB 2WVVA 3NIFF 3O6LL 2VLLA 3E9TA 4N0FA 1NDMA 3B56A 4PVBA 2MCMA 4MJ2A 1XDTT 4P2OA 3UBGA 1SBSL 3P3RA 2D7TL 2JJTA 5T1KA 5EBMB 4CMHC 3V4UL 2CM6A 2WJ7A 5HHMD 3ARFD 3HAEG 5DMKB 3VI3F 1J1PL 1NCCL 2V2WA 3CZNA 4HD5A 2Y4SA 1RVFH 2C9XA 2D8KA 4PG9B 4D8OA 3BPCB 5I1KH 3QDGD 4IRJD 4NN6C 3T8XA 3WFEH 4F7CB 5D2NA 1ONQA 1KGUA 2BNQA 3EGDB 2WANA 4K2UL 3X11B 4YX2H 5EFIA 4JN1H 1DTUA 5TGBA 1Q90A 4X9FA 5CJQH 3ARBA 2AC0A 4TQHA 1G5GA 5DT1H 1TU2A 3ZTCC 4FADA 4YSEA 5D1QC 3QIUC 5IM7A 2MIZA 3L1OH 3RWFA 2PWEA 1J9RA 4IMKC 4KBPA 4FRWA 4L8BA 2G9HB 5FA3A 4E0RA 1TVHA 1UA7A 1NFDF 35C8H 3QQ3A 4LP8A 4R0LB 4IU3B 3SY0B 3FUEA 4GXUN 5I6NA 2QQQA 2J55A 3MODH 3OB8A 3CHQA 4LESA 4LSQL 3O6FC 5C0EA 3HJ0A 4MCYB 1W0VB 1HJBC 5CP3H 2HRPL 2HT3C 3T6XA 1WZ1L 1ZKAA 3SPVB 4Q8BA 5CEYB 4Y5VA 3IMUA 3AXIA 3MV11 4YNYB 3HCVB 3D0LA 1IC5H 1N64L 3KLDA 3MRIB 3BP6A 5GGSA 2G5RA 2PO6D 5C0GB 3S7GA 4F24A 2A6IB 1H3PH 3OXRA 4TQPA 1UWEH 4GQZA 2BFGA 5DYFA 4XVSH 3CTTA 3PHAA 4N0FB 1A4JA 1D7CA 1I31A 1RY7B 4NUMA 1EAPB 1EZSA 2JJVA 4TUJA 1TKWA 5DJDB 4KKRA 3O2DL 5E2JA 43C9B 4HUCA 3KHQA 2Y72A 5GS1B 4KROD 3EYFA 1EV2E 5F1NB 3ZZQA 5C2BL 2V2WB 3ARYA 3C9NB 4OI9A 1MFEH 2CO3A 3P3YA 2UZYA 4H1LH 3MFFB 4MDJA 1EEYB 1NA8A 1NBZB 1R3LB 3BE1H 3PJLA 3E2HB 4JJHA 3T8XB 1UJ3C 2DWSA 3EO1B 2VC2L 4DVBA 3OR6A 1DFBL 1X3DA 3HE7A 4OLXL 4B3EA 4FQIH 1A6PA 1R4XA 3ECWA 3CPUA 4ODSL 4WO4A 4UM9A 3TO4D 3VXQA 4D9QD 3ARBB 4KJPD 4JRXD 1RJCA 4MS6A 3EF4A 3ZDYF 2N7BA 4BZ1H 3T09A 3FQWA 4RA0C 3HG1D 4NQTA 4Z76A 1NFIA 3KVQA 3EFDL 4L1DA 4U1LB 1UM5L 4HHAA 4P2QA 5FA3B 4DPBX 5J11C 3PP4H 2CPCA 1P4UA 3VRIB 1WICA 3O8XA 5C0EB 1XSIA 1S4IA 4I77L 2QLYA 4M6OL 1M7UA 1LNUA 1FHGA 4GRWB 1BZ7A 1VZGA 2CU9A 1MCFA 4NKOB 1CGSH 1I8AA 2J6WA 4OD3L 3ZE1F 2ZJSH 3T1FA 3F12B 4RFNC 5AKVA 3D0LB 15C8H 5LGJA 1R47A 2D03L 4I0CC 5DGRA 2BY3A 4MASA 4KTDH 3CFNA 3NACL 1U8CA 4NQDD 4GW1A 2PCXA 1FGNL 2VXVL 3DX4A 1RIHH 2WXIA 1KIUA 1BVOA 1OAQH 2Z93A 2EDQA 1TDQA 2B14A 1O5DT 2KT6A 3BWZA 1A6UL 2DQUH 5D7LA 3VQ1C 5IROD 1JTPA 1ORSB 1AHKA 1INQA 2PR9A 2P26A 4JY6B 4K5MA 2UZYB 1E0OB 2LLLA 2VT0A 1T1ZB 1IGMH 1KJ3H 1WZMA 2A0LC 5IVXA 3MRBA 4CNIA 3SODB 2C9QA 3C6SB 1G1OA 3R19A 4Z77A 1J8HB 2J1XA 4R4ND 3QWOB 1X9RA 4XNZC 4DVBB 1RIUH 4RSYA 1D3CA 3ISRA 4WJ5B 3T77A 4XBMA 3GUTA 1ETA1 1MRFH 1X44A 2JELL 1BBDL 1R5VA 2GABA 3ARQA 3JWOL 5EEWA 1F86A 4C59B 4KZ0A 3VXQB 2MCAA 5IQ7L 2GSIB 4FFVC 4ZAKB 4BUHA 5T1DH 1LD9B 2LU3A 3MRJA 1D6VH 4H8VA 3BO8B 4X6CB 4QHMA 2FNWA 2EC8A 2HT2D 2GJ6D 3D05A 4I18A 1CTMA 3IDJB 3IS1X 5FGCB 3SQRA 4GSRA 1A6TA 2NDGA 5HHNA 4NUJA 3IN0A 4X8XA 4P2QB 4BFOA 1JVOA 4YHMH 3NCMA 1H15B 5T1JA 5J56B 3HLAB 4XCNB 3PUUA 4IHBA 4FQXA 2EIJB 3CSYA 2ADFL 4BFEA 3K3QA 4JPWH 3MA7B 3Q8CA 4AENB 4JLRA 1E4KC 1SN0A 3CDZB 4EQ2A 4JY4B 4PRIE 2CDEA 2E5EA 5F9OL 4FNRA 5D1ZA 2R1YB 1H6FA 5AVVB 4KI5E 4ATTA 4KO5A 2KLRA 1KJ2A 3WGUB 2O6CA 5EEXA 1ZGLP 1IFHH 4WFED 5LCVA 1G1KA 4QTIH 3VWJB 1OP3K 4PY8J 1U8CB 3FYEB 4G6ML 2OZ4L 2Y1VA 4LNVA 3O0LA 1CG9A 5T1MA 5CNHA 2FWLB 1Z2KA 4NN5C 3TP4A 1TZGH 1KIUB 4RISL 4CW1A 5E1AA 2C1OB 3MV9E 5EWIH 1BFTA 3MUGB 2IAMB 1NMAL 1UD8A 4OSUL 1NIAA 2YWYA 2P9RA 3GO1L 1KIRB 3KWWB 1IBFA 4AQAB 1JZJA 2DQHL 4XB7A 2AQPA 2PP8A 5TK2A 1EAJA 2VLRE 2DKMA 3MRBB 4CNIB 4PCKA 5DJZA 2E8YA 3FBKA 4L9LB 4BSVA 4APXB 4JJOA 5KZCB 1UURA 3QULB 4TSAH 1EGJA 1R5VB 2BNRA 3AZUA 4RGNC 5HBBA 3O0RH 5BV7H 3DTUB 4DEUA 2DICA 3BH8B 3R4DA 3QE5A 1MRCL 1I8KB 2GUOA 3KPRB 4QHMB 2ZPKL 2EE2A 1MWOA 1S8DB 3KPQB 2X42A 4OFYD 1JF6A 4V1DB 4AGLA 1BWMA 3N06B 5ADPH 2YRBA 3UG3A 4AGNA 1H6EA 5K5YA 2B4CL 1PZAA 2UUDK 4NUJB 4UNIA 4CL7A 3KCPB 1AJ7L 4JO8A 5F1IA 2VAAB 2ZE0A 5EN2B 3QDJB 2BOBA 1TFPA 3U36A 1J0HA 3X3GH 2QFRA 5JIMA 2IFGA 4FQXB 2NY2C 3V4VA 2OAAA 2X2UA 3FO9A 4QNPE 2NX5B 2XXCB 3CH8A 5DEGA 1BQ5A 1NEZG 3DXAE 4HA1A 2ADGA 4JLRB 4X6BB 1Z5LB 2PCPA 4LLDA 2IG2H 1H3GA 4QJ4B 5IEHA 3HKZA 3AY4C 4BK8A 2Y07L 1KJ2B 2BIMA 1OW0A 3QUYA 4WWKA 3V0JA 4GRMA 3E38A 4ZZKA 1F4XH 5F70A 2XACC 2I5YH 1IZKA 4LCCB 1N4XH 7PCYA 3D9AH 2NY5H 2F7OA 1IC1A 4YH6A 3CFKB 2N7AA 1IC4H 3DO7A 2JCCE 5IBTL 1R5IB 4Q58C 4J2XA 2WYTA 5A7EA 3NJLA 5F7HA 5KYXA 4ZFZA 5CFAA 4TLSA 2Y7MA 3QK0A 2N01B 1I1FA 4S1QH 3N43F 3ZDXF 1CXFA 1AFVH 1LK2A 5LBSA 3MMEA 3HFML 3TYGH 3UOAB 2GY7B 2E8ZA 4MRCA 3STZB 1XIWC 5EU6A 4W9ZA 5DJZB 2ZOKA 4A68A 1JNLH 4LK4A 1CFTB 1Y6MR 2E75C 1ZA6B 5E95B 2BNRB 3O6KH 2JK5B 1IV8A 5E8NA 2J8UB 2ENPA 1CJYA 2VZTA 3A4AA 2L7EA 3LNHA 1SUHA 2GUOB 4N22A 1D5MB 5D2NE 4EDWL 2BIOA 2AEIT 4AYID 4YBHA 4UIMB 5AUMB 5FOBA 3WO4C 3EXLA 4NM4H 2IALA 1ETB1 2FIRT 3OZ9H 3DGGA 3U36B 4GMSL 5H37G 5C0JB 1H5BA 2UX6A 3HFFA 2FDBP 3FO9B 3WKYA 2YUVA 3SDAA 4BH8B 2VH5H 3ZUNC 2ADGB 3TO2A 1UB5A 1DJYA 4NLHA 1ET7A 2LOEA 1OSPH 4PBVC 4YZFF 3LS5L 4IJTA 1G7JA 2C9UA 2EXTA 3GBDA 2CO2A 4YAQB 5JHMA 1Y18A 2EE6A 1MPAL 5DWUH 4ZODA 5H4YA 4KDTA 4OLZL 5CIPB 2NY1D 3OVUB 4OQTH 3L3IA 3GQFA 4KKBD 5I5IA 4XPHL 4HS3B 3T0VA 3D1MC 4HUKB 1BECA 2BSBA 5I28A 3QORA 3SGKC 5KJRL 4IGBC 1ZANH 4F7EB 5ITBH 4R84A 2D3LA 2DQDL 5HGBB 3MLRL 1E2VA 2AFNA 4ODXA 4J7RA 4UMGA 2Z35A 5EO0A 1LK2B 3DA0A 1A6AB 1ADWA 1ZHBA 3MMEB 3ZMNA 1QWUA 5CCKL 1GGIH 5HYJE 5DUBA 2DAVA 2M1KA 3CZFA 4C56D 1A1NB 1T83A 2YQBA 2XKNB 2NW2B 1MHCB 3U6XS 5IW1B 3OKMA 2ZXAA 4U6HB 4RMTA 3F3HA 4N4YB 5HHMB 2Y5TA 3ARFB 4TVPE 1XAKA 5E8NB 4N0UB 3QEQA 1QTPA 2AQSA 2LGNA 1O7SA 4Y0GA 3QDGB 3RPIB 4MYWB 3O6MH 3VFVB 1URZA 3LX9A 1QI3A 4FFZH 5I26A 1FN4A 1T5WB 1MJJA 4PP1D 3ESNA 5LAXB 1A21A 1CE6A 3RJDA 3QA3B 5I5JA 1PEZA 1CFNA 2MKWA 3MNMA 5IWLA 4LPUA 5IB4B 1TUPA 3MBWA 2NYZA 3D4YA 4Y4KD 1CFSB 2PXYA 3VRLE 4M02A 1UB5B 2VABA 1LE9A 2A6KA 3C08H 3WTVA 2GFBA 3T65B 1PZDA 1UZ6E 2ZKHL 2VRQA 1ET5A 3SO5A 1OAUL 2IDUA 2IOIA 4G43A 3TWCH 4P23A 1NGZA 2PTTB 3DRQB 3DIDA 2Q8BH 3UACA 1XT5A 3BGFC 1CICC 2DMGA 1P4BH 4AJYV 3R1GH 2MCG1 2XY2A 5E1IA 2B5IB 4YJZL 4H0HB 2BSSB 4F7MA 5DCCA 1KENH 1MELA 4UB0H 2AEWA 3RL1A 2X4NA 5EU7C 4WIQA 3DETC 1QD0A 3HMXL 2PO6B 2IQAB 4HJJH 1EANA 1ZHBB 2Z3FA 5CUSL 1Z66A 1RZ8B 1OAYL 1CVRA 2IMMA 4N8CH 5ICXA 2P43B 1LP9F 3H9SD 3BP4A 2CBTA 1D5BA 4H1LB 3V55A 3DX6B 3FNKA 3T8MA 2ZUXA 3P0YL 5T33H 4WLCA 3SYPA 4S11A 2A83B 4ABVA 4NHCL 4APQD 5A2FA 5IEKA 3MLYL 1ZHKA 3CFDB 4KROB 1UOWA 3UTSA 1QO3B 4LPXA 2EILB 4F2MB 1QW9A 4NWTH 2YPKA 4NUGH 2C3VB 4MD4B 3ILEA 1E9PA 3V0VA 1NCOA 5GJSL 2IGTA 2WWMD 4LLMA 4FKKA 4AOFA 3BUTA 1GMIA 3OMAB 3IFNL 3V6BR 1AACA 3KW8A 1GGCL 1JHKH 3TBYB 2J12B 1B0RB 4PGEA 2YS4A 5AG8A 2X41A 4NZUL 3TO4B 1EFXA 3EHBC 4HHGA 4AY0A 2ED6A 1OGSA 4X0NA 2UWEF 2WLYA 5B8CB 3QRGL 2FR4A 3DGCR 4F1ZA 1PKQE 4JRXB 4UI2A 1K5NA 1AHMA 4ZPTB 1OD7A 5E99L 3HG1B 5C0CD 4B0MB 5F7DB 2A6KB 2VWEE 4LSPL 3QYNA 1I8MB 1T6BX 1KTKE 5JW3L 4NUQA 3OR7A 3HC4L 4ALAL 1Q1JL 4G43B 4PJDA 3S36L 5MHSD 2XPGB 1TYRA 4PJAB 2DI9A 3ROOB 5HJ3B 1U3ZA 5HHOE 4X98A 4B7IA 2EEDA 4G71B 3ECBB 4LKCA 4WHDA 1DR9A 5E1GA 4J3OF 1OAXH 3HG3A 2V2TA 3NUKA 3DPBA 4J27A 4R8WL 4RDQG 1LO4L 4F7MB 5I16A 4PJHF 5GRUH 3GSRA 3HZMA 1S7XB 1Z9MA 3MNWB 1EZVX 1LJMA 1S7TB 4YSRA 1H8SA 1KB5L 1Z9LA 4FZEH 5FXCH 5DJYA 3BZDA 1E42A 4QF1B 4Z7QF 4WTWA 4NQDB 2HLAB 3VXRD 1NCDH 1GR7A 4OIIH 4WKZA 4LLWB 3BP4B 4G8GA 4LB8A 1EMTL 5DMIH 3MBXH 4FP8L 4JUSA 3WNKA 1A47A 1AIFA 1JNHA 2DD8H 1OP9A 4UOZA 4F7PA 5C0RH 5KSBA 1CYXA 3PCYA 5LWYL 3BGMB 2XBTA 1BQHA 3KGRA 3X12B 4V11A 3D5OF 4FFYL 4KVCL 4OZFA 3BN9D 3KW7A 1I8IB 3VXSA 2HJFA 2R0LL 2APXA 4UILH 4ZK8A 5FPIA 1TJMA 3QPQD 2BNUB 4YBLC 3CSGA 3WJMA 3GSVA 3HE6A 2B3RA 3FB8B 1IMHC 4UMSA 2QPDB 4NEHB 4MVBD 5HPMB 1YEGH 5HDWA 2CMRH 3LQAH 2FR4B 1NTDA 4LT7A 5IB1A 2P44B 2O61A 2X2IA 5ESAB 2GJ6B 2H6UA 3B1UA 5KSAD 5B1JC 2X4UB 2W0FA 2AS5M 1HOCB 1FFOA 5EA0H 5HPOA 4MGXA 2ENJA 3SKNB 2Z7UA 4RAUA 4F92B 5EEVA 3SE3A 1WF5A 4LKCB 1MWAA 4XNMB 4B9GA 3T3PB 1MVYA 3D25B 2G3NA 1EDYA 1E8XA 2V2TB 1JZGA 3G9AB 5E6RB 5HYIA 3DPBB 1U8LA 4OV5A 4TRPH 1SQMA 4JHWH 3GSRB 3U7YH 3VRJB 5BS0A 4QHUB 4GAGH 2VN3A 3M8OH 3CN3A 4DQOH 5I0ZA 1MJ7L 1KFAL 1UM4H 5F7KC 1CDUA 4GB9A 2WQSA 4TSCL 4WSGA 4WWOA 3CIQA 5ESQB 4GUCA 5IP4A 4K7FA 1WBXB 1L0QA 3HZYB 3MA9H 1AIFB 4MZIA 5ACMA 3ULVH 2AMGA 1A02N 3NN8B 2Q2EB 2E4FA 5KSBB 5GS0L 3B5TA 4NQVA 1NCNA 1SXBA 4XNYH 3MNZA 1WIUA 1USZA 4MAUL 4PVNA 2WZ0A 3WUWG 4E41A 3BH9A 1BVNP 1B88A 2HJFB 2Q10A 5BV7B 5A16A 4A52A 2XKSA 1A3RH 1W8EA 3BUIA 3OKKA 1TJGH 4LO9A 1EZUA 4PI0A 3WJMB 4P0DA 1SHMA 1ZS8A 2RHEA 3REVA 2WWNA 4MB4A 1YQVH 2F18A 4ZFFA 4RNRA 1TETH 3Q6FA 2R29H 3ROLB 1EXHA 2C26A 2J6EH 2WXHA 1RUKL 5IQMA 4GLRI 4U4IA 3T6QC 4HQQH 3VTTA 1SJHB 2E7MA 4X7TB 4Y8AA 1UD4A 3FU8A 2ALWA 5C0FA 1CGVA 2E46A 3EDDA 4QXWA 2KI6A 3ARTA 3O45A 5BMFL 2RMNA 5D4JA 2Z1PA 4EIUA 4FA7B 1XGRA 1Z0NA 3U79A 4B95C 1K4CA 4NNYB 1YCSA 1FBIL 1ADQA 4ZPVB 4OQTA 5HVFB 1FE8H 2K7PA 4OZHA 1WDAA 1U8LB 2XT1B 5F97E 5BS0B 4LFHD 4YXHL 1J5OL 5J4MA 1KTCA 1UYWH 1ZLVH 5DURD 1E27B 5F3BA 2OMZB 2F1BA 5KVDE 5FB8A 1KELL 1E40A 2V3EA 2P8LA 1JYNA 2J25A 2L04A 4JFDA 1V5JA 4AG4L 2XV0A 4CMMB 3S3SA 1DBBL 3WS6A 1Z6JT 4IJ3C 3IXTB 3CZKA 4PJCA 1QACA 1E28A 2F19H 2XYBA 1Z9OA 2GJJA 5DZOA 3M07A 1UM6L 4PJ7E 3EJTA 3MNZB 1AGDB 4UT9H 1M1XA 3UGUA 4E41B 1RPKA 5FHAL 2Y0SA 3BH9B 4QRQB 1TTGA 4TNGA 4X7SH 1U21A 3ERXA 5K9JH 3FTYA 1AHWA 4RFOH 1L3WA 1UXWA 3QUKA 4NKIL 4WF7A 5K59E 4PWJA 1TTAA 4QEGA 4R6UA 3RE0A 2D3VA 3K6IA 3RWDA 3ZUCA 3NCYP 2C3WA 4FI7A 1F1GA 3A4DA 5I5RA 2PF6A 3REVB 4HJGA 4NM8H 1ES0A 5TE4L 4LDLB 1WA1X 3O3EB 4ZFFB 4FE9A 2A73A 2MOVA 5L8LB 2VRAA 2BRRL 2TRHA 2OTWB 3GUFA 3QXUA 4Z7AA 4Z9KB 1FZJB 5T3ZE 3FTVA 2D2CC 4MA8L 2ZCHH 5ILTL 3C2AH 5IHUL 5JUEH 4ZT1A 1MCRA 1ZEAH 4PGJA 3N40P 5FUOL 1DVQA 1KGIA 3F85A 3EH5B 1OK8A 4HHWA 2PPEA 5JMRA 2QQNL 2YPLA 3K6SA 2OJZH 1T03H 3ZL4L 1YSOA 1AZCA 5CJ5A 1OVZA 2DOCA 4JZJA 4EUPG 2VIRA 3MRRA 1Q72L 2VE6A 1GGTA 2E6PA 2FB4H 3J8F7 1QSFE 5F3BB 4U1NA 3TURA 4M7ZC 2NY1B 4F15B 1F6LL 1N18A 3GSWA 2BIQA 3DV6A 2J3SA 2FT8A 1T1YA 4AV0A 4FNSA 4P3DB 1UD3A 3OAYH 1EHKB 5CZKA 3DV4B 2EYRA 5DFVD 2EVJA 3U25A 3OF6D 1IQDA 1YEEH 4P5SA 1J48A 4EBQH 2ZP8A 4PRID 1KIQB 3HHMA 4KI5D 1T20A 3Q2VA 4LKXB 3I9IA 4C56B 3HBZA 4KK5C 1XX9C 3QUKB 3DVIA 2IPKA 3OTTA 4OT1H 2WWKO 4AIZA 3RWDB 1H3WM 4KKCD 3QUZC 5A2LH 4CVXB 4ZJ9A 4G6FB 1S7QB 2CBQA 1IBBA 1QEWB 3U1PA 4G42B 1V7MH 1MQKL 3MV9D 1F2QA 2QADC 1N2RB 3QHZH 1MRDH 1JRHL 4U7MA 2YRLA 3Q7JA 3FQTA 5FO2A 5PCYA 1FYTE 1HWHB 3ZE2F 2E56A 5DUPH 4NPYB 4YC2B 4YDMA 1IKFL 4XXCC 1JZ5A 2VLRD 5HYSG 4C4BA 3P9MA 3CFJA 3QDAA 4OLEA 4K8RD 2AJSL 1CT8B 1DUYA 1NDTA 1MY5A 3QJUB 2BC4A 1SFHA 3VE0B 1IB5A 5IIEB 3UAAA 2R51A 4Y4KB 2L7QA 1W6WA 2AVGA 4K8RH 4AC4A 4ANXA 3E6FA 1A3LL 3I02B 3U2SB 2GEQA 1NCAL 4YHIB 1ZOXA 5DLML 1UZ8B 3PGDA 1KPUA 1YEHH 3OGCA 5CJOH 1MXDA 4DTGH 2F1EA 1FAIL 4OGAC 3BKYH 3BSZH 3B2MA 3VGAC 2O6DA 3K72B 1IT9H 4JREC 5ELIA 4MJJA 5FW6A 3H8NA 3WDHA 4HJEA 2X5PA 1NJ9A 4M8QB 1T1YB 3H9HA 2ROXA 4JM0A 5D1XE 3O3AA 2W0KA 5C86A 5GGQH 2CCWA 4YFDB 2EYRB 4X99A 3DXAD 5H2BB 5I2IA 2NLJA 2HX9A 5GJTL 2EP6A 1C1EH 5EMYA 2JE8A 4LDEB 2RH0A 1N0XL 1MUJA 3N85L 4JFSA