4QR7A

Structure and specificity of l-d-transpeptidase from mycobacterium tuberculosis and antibiotic resistance: calcium binding promotes dimer formation
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
349
structure length
349
Chain Sequence
VPKLTASVTDGAVGVTVDAPVSVTAADGVLAAVTMVNDNGRPVAGRLSPDGLRWSTTEQLGYNRRYTLNATALGLGGAATRQLTFQTSSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and specificity of L-D-Transpeptidase from Mycobacterium tuberculosis and antibiotic resistance: Calcium binding promotes dimer formation
rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
molecule keywords L,d-transpeptidase LdtB
total genus 90
structure length 349
sequence length 349
ec nomenclature
pdb deposition date 2014-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
A PF17964 Big_10 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 4qr7A03
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4qr7A02
5LBGA 4A52A 4LPQA 4HU2A 3VYNA 3TURA 5DCCA 5E51A 5DZPA 3ZQDA 5DUJA 4QRAA 4A1JA 5DZJA 5E1IA 5E1GA 2HKLA 4LZHA 3ZG4A 4JMXA 1Y7MA 4QTFA 4QRBA 2MTZA 4A1KA 3VAEA 4QR7A 3U1QA 5DVPA 5DC2A 4GSRA 3VYOA 4JMNA 3VYPA 5K69A 5DU7A 4GSUA 4HUCA 4XVOA 3U1PA 4A1IA 4K73A 4Z7AA 5E5LA 3TX4A 5D7HA 5LB1A 1ZATA 3ZGPA 4GSQA 4ZFQA
chains in the Genus database with same CATH superfamily
2AEIT 2GSGA 3N1QC 4QYOB 2X5PA 5EIVA 3SD5A 2O5XH 3P77B 4KKRA 2D03H 1Q9LA 1PNCA 3GF8A 3GXFA 2CBPA 1L7IH 3BVXA 1A4KB 3W0WB 4R2GB 1QBMH 3CPUA 4FFWC 3QIBD 1LQSR 3WUWA 3FQ2A 1M2VB 2PWDA 3H9ZA 3HNSL 4AOFA 4IIQA 4FHJA 1MQKH 1AR1B 3REVB 1FO0A 1X5AA 3RZCC 5FPIA 2BY2A 2DYPD 1YNLL 4QHKJ 1T66C 1ZLWK 2ZG1A 3KWWB 4DZBA 5LGKA 3WENA 2QVMA 3CSTA 1ZIBA 2R4RH 3BH9A 2ESVD 1OAXL 4TULH 5D6DA 2BP3A 2XHNA 1HFUA 4JRXE 1OM3H 1U8PA 25C8L 3NIFE 4Q6YA 1LE5B 1NDGB 5F7EH 1U8IB 2MCMA 2WJ5A 1HEZB 2Y2WA 3RY4A 2JQAA 3AFLA 3LKPB 3UJIL 1LJMA 1Z66A 2YKLL 3SY0A 4WJG3 3CPLA 4R0LB 1FNEB 1S9WB 3FUKA 4WENB 1VB9A 5IIEA 1EAOA 1TQUA 1JHTB 3GMMB 5J12C 4LCCB 5E5MB 4RISH 4LLMA 3WE6B 4AYGA 1DUZA 1SVBA 2FX9L 5KVMC 4P9HL 4G1EA 1AP2A 4GUQA 4P2CG 1YMMD 3OGOE 4LLWB 3BPNB 4WW2B 1MFUA 1NBYB 2G4EA 5D6CA 5J9PB 2ZIDA 3VFPB 1G5AA 4JGMA 2HRPH 3LEYH 3O2DA 3QI9D 1BIHA 4JO4H 5KVDE 5F7UA 4R5XA 4ZQTA 4GQRA 2NTFA 3NJFA 2DKSA 4PS8A 4MNHB 1TZHA 5HVHB 4HS6B 1A1NA 4JPIB 4ZUSB 2C7UA 1TCRA 3EYUL 1ANUA 3HC4H 1X5MA 4MMXB 1BQHG 3M88A 1CXHA 3S4SA 4E41B 4HMEA 4G80B 1ZVNA 3N1FC 1BW8A 3FUJA 2DZEA 2PWFA 1LGVA 3VTAA 1BZQK 2JKRM 1FJ1A 4FYSA 1S5IH 2DW5A 4PJIA 1A2YB 3GMNA 3P0VL 3QWRD 1BFVL 5AW6B 5G2NA 4H13C 1CU4L 1B88A 1FO0B 2XVGA 5DI8B 3WDIA 3N1PC 1EEQA 5I1HH 3LKQA 3A6CL 5C09E 2E7CA 2X4SA 3UO8B 1I1YB 3DMMB 3BPOB 3HPLA 4ORGB 2Y22A 2XVLA 2MWCA 3SBQA 1M7XA 1MCKA 2CLVA 3EJJX 5BZXA 1LO5A 1XBDA 5LNDA 1HHGB 2EDOA 3EYSL 2C9SA 5BPPA 3CFJB 2FK9A 1S7UA 3HHMA 3NCMA 1PZAA 2Z65C 5JMRA 3HG3A 1IM9A 2DMCA 1HI6A 3AS1A 3TCXA 5GRYA 4W81A 3K8MA 2BVYA 3IDJB 1S7QB 5IFJB 1IE5A 1SMDA 4NZTH 2W80C 3AQYA 2AJYL 3L6FB 2X4NA 5DJ2B 4KTEH 1I9EA 3SKUD 3IGKA 1I3GH 4F57H 3HFMH 2BNRB 3EGXB 2MOQA 1ZCRA 3INOA 3OGCB 4WDIA 4XXDA 2ZE0A 1IGFH 4JUTA 5EOQL 4FXGC 4E42A 3MRFA 3ULVF 3SE8H 4AYEC 2R69L 4FQXA 5LN8A 2RGSA 3NJVA 4WFGE 2BSRB 1AHMA 2HH0L 3O3BB 1T5WA 4JZJA 1F3JA 3K81A 4M5YH 5K59F 1DBML 1FFRA 2XFGB 5CD5D 4ELME 3EYUH 2R7EB 4OLVL 4XP5L 3GKZA 5DC2A 5INDB 4ODWA 3BZ5A 2EILB 1JPSL 1UASA 1NCDL 3D87B 3E6FA 4ODSH 3QEQE 3S88L 3QDAA 4N6RA 1HX0A 1S7SA 1IGFL 4PYHA 5J06A 4OGQC 4FLHA 5I6NA 1CLOH 1J86A 5F3BB 2ITEA 3NJLA 1ADQH 5GRVK 1NEZB 4MD4A 2VGLM 2OW6A 1RSFA 4I0KA 4F1SA 5C0FA 1A21A 4A2HA 4NLAA 1CFTB 4TTDC 3VM7A 2LU4A 3RX5A 5C0GA 1HK6A 1JJUA 2HT3D 4PRNB 3RURA 3L2NA 3V4VL 5GHWL 2Q3AA 3X1GA 5K9QI 1BOYA 2OQJB 4GFTB 3L2MA 5F70A 1OE3A 3BISA 4UOW0 3FB6B 3CXFA 3OPZH 1SJXA 3CC1A 4JN1H 5HYQB 5ICZA 3FSWA 5EU6E 4KX8A 3WLBB 3K2UL 4PJXA 5AOLA 4XO4A 2WB1A 1SOXA 1W9XA 3AY4A 1SLUA 3D12B 4IBWA 1I8MA 1BVKA 3GI9H 2BNQA 1MFAH 1MHEB 3A4AA 3SOBL 1XEDA 2PPAA 1F4YH 3FUNA 3CVHA 4KX9A 5EULV 4YL4A 5I8KL 1DEDA 1T20B 3KYNA 4LNRB 3NIDB 3WCYA 1A6AB 1YEHL 4KUZH 4E68A 1P0SE 1AKJA 1F4HA 2NNRA 3ZKNC 3EOTL 1D5IL 5DJXB 5ISZB 4Q56A 4IRSB 3U1PA 3ZKXB 5EWIH 5HY9B 5K9OB 2VLJA 5AOZA 1B4LA 4PJ7B 4PAZA 3GC3A 4QRTB 2DYRB 5ADOL 1P84J 2Z35A 4I8DA 5TDNA 4MA3A 1RIHL 5L2KE 1KBKA 5DD5H 4DP7X 2R8SL 2A0LC 8FABA 3ARDB 4U6XA 3OMIB 4J4PD 1XMWA 4MA7H 3DURA 4N2BA 1A5FL 3ZN6A 4BSVA 4YJZL 3UTTE 1HHKA 2GT9A 2DJ4A 1QNZH 3ARVA 3QJHB 5HVFB 2KT6A 5SWQB 4Y2NA 1MFEH 3QJTB 4HWZA 3O6LL 1JGEA 2ADJA 4OI8A 2F5AH 1QLEL 3DHUA 5F44A 1LP9B 2VM4A 4FMVA 3S4SB 4E41A 4AE1A 5EEXA 2ICES 2PWHA 1H8LA 3LXCA 4M1CD 4WI3A 3BEWA 1U36A 3US0A 2BSEA 2IJ0C 2YKLH 1NJ9B 1YQVL 4OZFA 4YSCA 4CSPA 1WWAX 2FHBA 2V5RA 1ZT7B 2R29H 3OKDB 1N5AA 1XGYL 1GZPA 4L37A 1V7NL 2F53A 3OR7A 1QI4A 2PXYA 1DO6A 4LHUB 4DKTA 2LW3A 3QIUD 2PXYC 2VZOA 3MJWA 4QRRD 4DQAA 5FX3A 5DA0B 1DFXA 1A7RH 4K94L 4N1EA 4PJ6A 3QDMB 3VTTA 5I1JH 2DIJA 3OKLB 3DC0A 1DBJL 4OSUH 1TT6A 3N43F 4P5TC 4YXHH 2FT7A 4G6JL 3LRKA 5I19L 4UT9A 4WU5A 5IIEB 4APQC 1ASPA 1PLGH 3ZE2B 3LX9A 2X44D 4L8DA 1SLWA 3ATAA 7TAAA 2OFQA 4YDJB 1MCCA 4PB9H 4XBEL 3SPGA 2KKQA 3B2XA 1Z6JT 4MJIE 3UROR 4LLQA 4OZHA 4X80H 3JVGC 3ZE1B 4ZYKB 1MCFA 2H1XA 4IRJD 4XMUA 4KY1L 3S37L 1NFIA 3DX1A 4NCC1 4LAQL 5HJDA 5GXBB 5HHME 1HN1A 4P57A 4ANXA 2Y07L 3TBVB 3E9UA 3KPSA 1S46A 2AW2A 3UX9B 4I4WA 3TESA 1PJ9A 3WXWH 4WFHD 1Q72H 2VJXA 4G5ZH 4X9HA 4Y8AA 5LWYL 4QKXB 2F15A 1PKQE 2AXJA 3C2SA 5DVMA 3U82B 4FQXD 1KC5L 2X3CA 3FULA 3K5SA 5FA3B 2VITA 1R9FA 1VJSA 4PWFA 4X7FC 5TQ0L 3WFCL 5FUCC 4FFYL 1MWAH 1NWPA 2W81C 3BP5A 3VQMA 3NSJA 3C75A 5DHEA 1URZA 3O8XD 1Z5HA 3F12B 1SMAA 4IJ3C 1D7BA 3HC0B 3ZQXA 4E41E 4F2MB 2GSGB 5IZ7A 1S2EA 2QHLA 3RUGF 1M42A 1INDH 4DPAX 1VESA 4XHQA 2EVGA 5IJKC 2Y4SA 4PJ8A 3MXVL 3IGAA 3CCHA 4XBGB 5D1QE 5E9NA 4R90L 3L5XL 2OXGB 4CKVX 1BAFH 2MTAA 5F71A 1D6VL 4OW6A 4TOYL 2GJZB 3BH4A 2PCYA 5D1QC 1AZUA 3GMLA 1KLFB 3DI2B 5I16A 4LAQH 4MLSA 4YBLB 3KLKA 4NEHB 3ZZQA 4BSWA 3VA6A 1X4ZA 4JO8A 4K94C 1PJWA 1JZGA 2FNWA 2CUIA 1WYJA 3FQUA 4I77H 2ZUWA 4MBOA 4K3JL 1A6WL 3KL0A 3MX0B 3GUTA 1YNKL 4W9CC 2X4QA 3MRQA 4HIJA 5E00B 2EXWD 1AR1D 1QACA 3FUEA 1VHPA 1OL0A 5LCVL 1N0LB 4ANWA 5GRVL 2Z35B 2JI1A 3RNKB 2Y5QA 3MXVH 2OL3B 2B20A 1OSYA 2WZAA 3HG1A 1QBBA 1R5VB 4PWEA 1UA7A 1VGKB 4AL8L 1KCLA 1UJ3C 4XMWA 3SE3C 3SEPA 1MH5A 5ILTL 1NL0L 3QJXA 1KJVA 4KROD 2V2TA 4Q97A 2IC2A 2ESVB 5CUSL 4ZX3A 1F2XK 5FWQA 4NQXB 3F04A 4FL4C 3QFGA 2DLHA 2H2SC 4NQCB 4NXKA 3JV0A 3TURA 3DOHA 3OKKA 4PWKA 4X6CE 3UP1A 4J4PA 2CO1A 3KPPA 3MJGX 3L3IB 5FDWB 4N8VA 3FQXA 3M7FB 1CCZA 4A2FA 5DTFB 3P0YL 4G8GE 4HWBH 3VW3L 4EAEA 3DTXA 3B9AA 3ET9F 3DK0A 5K69A 3T3PE 5D4IA 1AFVH 1JPSH 3P4LA 1WFJA 5I1GL 3MI6A 4HPOH 4X9YA 2PP9A 2FATL 4QLWA 1TZIA 4KVNL 1WT5A 3ULSA 3CU1A 3GB7A 4LP4A 2RCSL 3G5VB 2ZWLT 3MLTA 3NEOA 2X09A 5E1QA 3V8CA 1P2CA 3LOWA 1J05B 3VB8A 2AFNA 2RAMA 2Q8AL 5DK0A 4LL4A 5FFGA 2OSLB 3BEVA 1AVAA 5FC9A 4A6YL 5BVJA 1IGML 3LQAC 2BSED 1KJ3L 3T6QC 1Y0LA 4NIKB 2IPUG 3G08A 2NY0B 4F7MA 5JW3L 4MX7B 4Z7UA 1I3GL 1YY9D 1LNUA 2MJWA 4JFDB 4NPKA 4F57L 1QTPA 1URLA 3PIQA 4BH7A 5I6MA 4X7EC 2PXYD 4Q14A 1SDDA 4OJFH 2W0LA 5L2JB 4PRIE 5CGYD 3TO2A 4NKOA 5DHXB 4A6YA 1CYGA 3TNNB 4PP2A 3LHAA 1JZ7A 2F5AL 4F7EB 5JPMB 1WCBB 1Y6KR 3RRQA 2F19H 2AS5M 3K46A 1OALA 2VLRE 3KGRA 2GB2A 4E42B 4O02L 4ANVA 4HEME 2V5YA 2Q3XA 4IBZA 3RGVB 4AEHL 1ETZB 4PJ8B 4PTTB 1ZT4B 1CD8A 2EUVA 2DKMA 1IKFH 1UM6L 4Q2ZA 4G1MA 4QRQA 3VFSA 1MLBA 4UNVA 2ARWA 5EZJA 4M6OH 1DVYA 5DEZA 1HYRC 2OX5A 5TFSH 2FYYB 4ZDHA 1LO2H 1EPFA 3MLUL 1HINL 3UACA 5E9DB 1N6QL 2A7BA 4ALAL 4QIRA 2ODIA 4PH8A 2OTPA 1KIUA 4ZFGH 5T1DL 4JAMA 5K9JL 4EIZC 3LN9A 4PVMA 3ZHFA 5FO8B 2XICA 4LSRH 3Q6GL 1OAUL 4Z3TA 4OCWL 5E70A 2VISB 2X53A 5AWNL 4C55A 3S5YA 3MJ7B 2ZKWA 3SE8L 3P3SA 3TNMB 3WY3A 1NOLA 1UZ6E 1IZJA 4NZFA 3V9EA 1DQLH 4Z7VB 1BSIA 1XZ0B 3F7VB 1JHLH 2UWEE 3BRFA 2JLPA 3FZUC 3OVUB 5AZUA 2ZD0A 3OHXC 1YEDB 3K8KA 3QBTB 4MMXA 4X50A 5EFIA 1TENA 2D3NA 3OC5A 2J1ZA 4L5FE 3RIAK 3VD2A 1IC7L 2C7UB 1UWGL 2HJKA 4OZHB 4PY7B 3WS6C 5EIIA 1KEGH 4QMEA 2A74C 4K7PX 4XP4L 5C0IB 2YXFA 5B22A 2ZAGA 4YEEA 4UQ2B 1UH3A 5HGDB 1MF2L 4NCDA 1FPTH 2H32A 3BKYL 1E28B 2BY3A 2P46B 4MD0B 1RIVL 4HCIA 2OMBA 3BP4A 5IKCB 4HOZA 3FUHA 2CPCA 4Y1AA 4X6DA 4LIQL 1TIUA 1QEWA 4UM8B 5AZEH 4ODXA 4D0CA 1K85A 3GKWH 1ZTMA 3IN2A 4Q9QL 2D7PA 4M6NH 3P9LA 2DLGA 4JY6A 1GS6X 1KJ2H 2EDBA 1ULVA 1XL4A 3PS6A 1QW8A 5D1XC 4BK4A 2IIJA 3AXHA 3QNZB 2ZYHA 4MDJB 4B3VA 5KTEH 1IL1A 3IFNL 1F4AA 2D73A 4ZO6A 1VZGA 4FTVA 4N2FA 4Q9BA 5T33H 5HYJE 4MA1C 1A6PA 1FFNB 2WINA 4TQEL 4TUJB 2LFEA 2E56A 5FKPA 5GPRA 3O9WB 2IANE 3U4EA 3VWJD 3O4OB 1E5AA 4LVOC 3MGOA 4ZPTB 2IPTL 1J1XL 2D2OA 2VZ1A 3WXVH 5CJQL 3PUCA 3ARED 1M7DB 2N7SA 4RMBA 3U4AA 3ETBJ 3D51A 1OGAA 1I7RA 2WYZA 5ADPL 5I18L 4ZTPH 4HLZG 3EDDA 4IU3B 3L2LA 1A1OB 1BFOB 3GBLA 3QDGE 3BXNB 2LFGA 4G6AC 2CNYA 3AABA 5B39B 1EFQA 3MV01 3UH8A 4E9WA 2FSEB 2BIIA 1GOFA 3ARPA 1U0QA 1OB1A 4LPQA 2ALAA 1U3YA 5INCB 4PLKD 2EVFA 2A5UA 4QRAA 4JG5A 2VKWA 4J23A 5FM8A 3MMEA 3D4CA 5AW1B 5C9KA 4NQSA 1FVCA 1NANH 3GNML 3QC6X 4OKVB 2OCFD 1KT2A 3LB6C 3JWDL 3RKPA 1KBGL 5LUMA 1T20A 1VFUA 3C5ZA 3MV7B 4ZAKD 4YSEA 3BOVA 3ZSSA 5CCJA 1UYWL 1K2DB 4Z8FH 4GOSA 1BIIB 2J8UB 3G6JA 3N06B 5A6LA 4YK4B 4BFIB 3PQYB 4JKLA 1RZQA 4OFYA 3NCWA 25C8H 3QWRA 4FQLL 4FFZH 4YBQC 4P04A 2B1AH 2N1TE 4FP8H 4NRXA 1AGDA 2P8PA 3QUZD 1I8KA 1NKRA 1Y6NR 2CR6A 2BFVL 2A1WL 1RXLA 1RPUA 1U8NB 1I8UA 3ZDXB 2C26A 2PYEB 2YD1A 3F64A 2XYCA 5TJWK 4DGYL 1JGLL 2DQDL 3H3PH 4XC1L 1WUNT 4YO0A 2CDGB 3V6ZA 5HDBF 1BIIA 4WFGD 4WK0B 3BRDA 3G6AA 1MQKL 3EJSA 4F2EA 1SXBA 5DFAA 1BF8A 1YY8A 1ZJAA 2VLRA 2BOBA 2ZXBA 5JDSA 3S36H 5KUKA 5I1GH 5JOPE 5SWZD 4PJEF 1TUPA 4OCNC 5FF6B 4XE5B 1Q0EA 4L5FH 2BP5M 5IMLB 4M3JA 1CE6B 2R0KL 4MAYB 1TEYA 3VU1A 3DJ9A 3LS5L 1XB3A 2K45A 4G9FD 1J9SA 5EEVA 1XH3A 1Y7MA 5E8OA 3EHBC 2R7EA 4KJPC 3WMPA 3W5NA 1U30A 1WZ1H 1N0XH 4AYFA 2YSSB 3DBSA 1D5ZA 5IHZA 1S9YA 1A1OA 1BFOA 1JFQH 4H8WC 2CMRH 5CBEA 2VWEE 5KYUB 3MCKB 4FRWA 2YEZB 4OLYL 3TVMC 2AEWA 2W9DL 4XVSH 3CVIL 4XCYA 2YD0A 3GHBH 2Q3ZA 4FQPA 4G11A 4TQPA 1TSRA 2Z4QB 1QQDB 4FQXB 5HGAB 4IK7A 5ABDE 2LAGB 4FJ6A 1ROWA 1P6FA 2K78A 2Q7NA 3NZHH 3QWNA 3CVHL 3TYFA 3OZ9H 3Q48A 2Y36H 4XMKH 4O2EA 5AW8B 4PLKC 3GIVB 5FKPB 5GRUL 1A65A 3NH7H 2QEJA 5HVHC 3QFJB 4ZFOA 2G5RA 4AZ8B 4Y1TA 1AQDA 1VF5C 4JFHE 1RPKA 2BP8A 3QIWD 4ODVL 1XB6A 2DQJL 1KNOA 4FD0A 3RL2A 4NO2A 3PYCA 1DDHA 2KDYA 3RWCB 3TZVC 1SXCA 3JZYA 4P2OD 5T1LA 4ODTH 3GBMH 3BVVA 1HE7A 4WO4C 3S3CB 4MNQE 3VCLB 4EZKA 2C1PA 1Y1DA 5I24A 4ISVA 3DRTA 3DOSB 4G59C 4U6VH 4V1DA 3MOQA 1P5VA 4NN7C 4NOFA 4UDUB 1NCAL 1BZ8A 3HN5A 5TE6L 4BA8A 2QGCA 2EDMA 3VXMA 5I6PA 4GMSL 4LVHB 2AQNA 1CFSB 4NPJA 4IOSD 43C9B 2B5IC 2J5LC 4L0PB 1GMIA 2ZOKA 5I5JA 5JXAH 2QELA 4Z0BH 4W9FC 4O4YL 4X9GA 2RHEA 2WN2A 1TQWA 3BLPX 3SDAB 4D8OA 1E8ZA 1Y7VA 1NWOA 2BXYA 5IEKA 3P4NA 4CVXA 1NH6A 5E7FA 2AI0H 5C0JA 1E90A 2BJMH 4GG6E 3HE7B 5AVVB 1LK3L 2VQ1B 4JREB 3VWJA 4AKPA 1MFDH 2IANA 2IAND 3LSOB 4U1IB 4PP1C 3VXPB 4NSKB 2HKFL 1SN5A 3DX8B 4HS3A 3AMLA 3QUYC 2YPLD 1TYJA 2DQEH 2ZUUA 2DWYA 2FD6L 2BNUA 3MODL 4JDEA 4WI8A 2P4AB 1DJHA 4N90E 1SYSA 1SM3H 2J73A 2AABH 1C08A 2VOTA 1L6PA 4YDKL 3KVDD 3RIFF 3K6SB 3WTUA 3ZRCC 1HCVA 5IW1A 4YDLB 1QHOA 2HUEA 4IRZA 1U41A 3IAQA 1JUFB 4XNQA 2Q10A 5E2TL 1FFTB 3SYPA 4U31A 1ZA3A 4NT6B 1TO5A 4G8GA 1S9WA 2G4GA 2OX5B 4R26H 2H0PA 1U3NA 43C9A 5JOEA 4G1MB 3OWEA 3ABKB 1R5IA 2LABA 4JANA 3TBSB 1G7HA 2H2PD 1WSST 2D7OA 2ZJSL 3FF8A 1EO7A 1AE6L 3P4MB 4FA6A 5F97E 3FB7A 4GAJH 1KYOJ 2CBQA 3BH9B 4AVIA 3ZVVA 4HKJB 4MASA 3MO1B 5GS0H 1S7WA 1Q1JH 3M8OH 3PPSA 4ZO7A 4YFEA 5K33A 4JN2A 5I8KH 1A3ZA 3VCLA 3ZDZE 2CJ3A 5AVRB 1ZSDA 4MNGE 1TQVA 1RUQH 4LSPH 3MLWH 3BZ4A 5HXMA 2X1QA 4N2MA 4J7RA 1ZEAL 4ONFH 5DVOA 1RUAL 1N18A 2H9GA 3QP3A 4U33A 4DEUA 3DNKA 1KCVH 1FNSL 3MHZA 4O2FA 4OZIB 4DIXA 1AHKA 2ARJA 4XMVA 3L1OH 1J11A 1HHJA 4JRWA 4LLDA 5CEXB 3KHOA 1UCBH 5B38B 2PW2A 2YLKA 3K2IA 5D5MA 4A63A 2DM2A 1EVTC 4ELMA 1NFDE 1OTSD 1YJDL 2BP0B 1E6JH 3MLTB 3U83A 3KXFB 4LCWE 3O4LE 4X6BA 3GLDA 3OBAA 4NKIL 3VSUA 4L1LA 1NUDA 1SEBA 3L8QA 3LD8B 2Y1YA 1S9VB 3V0WL 4UAOC 2O5ZH 5GIRB 1JI1A 1K5WA 2VDQH 1CF1A 2WXHA 2FJSA 3V0DA 1FZOA 3AU1A 1S78D 2DV6A 3SJVA 4RRPM 1FHNA 3ZW3A 3CZFA 5IMLA 2VDNL 5E9DD 1R3HA 1RY7B 4BJLA 3HZMA 4NAQA 3JWNH 3PL6B 4U2ZA 5DZ9A 3GSQA 5FYLD 3ZK0A 1YN7A 3HHSA 3JWOL 4UQIM 4ICXA 3H4HA 4ZMXA 1P9MC 2QLYA 3PXHA 3KBFA 1LQBC 1FF5A 3KYKH 4LSVH 1X4YA 2YQ3A 2L7UA 4KKPA 4YO0B 2XA3A 4WGVB 4TSAH 3VXRB 2QGBA 1DVSA 1ZXKA 3OSVA 1KUMA 2YEQA 5I82A 1ZD6A 1BD2E 4DKAA 2ZWKA 3U2IA 3ARGB 3T3MF 4OAWB 3MRCA 1U8LB 4QRUA 1DO5A 3IWVA 2OL3A 5KVEE 4EQ2A 1MJUL 2PTVA 4JFSA 2V7NA 1XT5A 5J57B 3MBXL 2Y06L 4Q7DA 1BCIA 3PQYA 3C5JA 1QLRB 1BXXA 1XF5B 4HOXA 5LKNA 1B4JL 3QEHA 3H3KA 3QR1A 3CN4A 3CDFA 2NY5H 2VLJE 4O9HL 3RVTD 1TG8A 1E43A 1QI3A 2GJ6D 4J3WA 3VRLF 4N87A 4NQSB 5EC2A 4FG6C 3D69B 3SQBB 3RIKA 1RZKC 3MMEB 1RCYA 3FONA 2WC7A 5IVOA 1RZIA 3QUYA 2P9RA 4LOUC 3P0VH 2B0SL 3IPBA 1R4XA 1ZWIB 4Y1AE 1DEEA 2OYPA 1QSFD 4WF7A 3O9WA 3F58H 2FEDC 2ZJSH 1KEMH 3G6JF 4OLVH 4GKOA 2DYPB 3KPRA 3OR6B 4M6ML 1XFPA 1N26A 2DPKA 2JKLA 1Q1JL 3M8OL 5C0CB 4F2MA 1NCWL 3WKQA 3ZYJA 2PTTA 1BBJA 3WE1A 2VLJD 3IRPX 4G7SB 3S3JA 4NFDA 1TJHL 1WCQA 2YA0A 3U0PB 1XX9C 2HH0H 4V1DE 5KSUB 3DO4A 3HR5B 2Y72A 1AQHA 2BSCA 2P49B 1I3RA 3PDDA 4G7YH 3W38A 2CKBB 3H0TB 1RVFL 3ME0B 2VKXA 5FA3A 2G60H 3PDOB 5JQ6H 4JRXA 5T3ZH 1M2OA 5KBNC 1LVEA 2B4CC 2UX6A 1GS8A 3GMRA 4I0PA 2J1YA 4ORZC 5HP5A 1TNMA 2NX5E 3IXTB 3DSFL 4RFNC 5JYMA 5LHDA 4M6AA 3VRIA 2FJGA 4F9LA 3TN0B 1HHHA 3VWKD 2I5YH 1IAKB 4MFHA 3TZVA 4P3WA 4WU7A 5KVFE 2D31B 4LVHC 1UKTA 1H6UA 3OMNB 3OV6A 3T1FA 4O4YH 4QRPE 4R3SA 5CILH 3I6KB 4MAUH 2DQHH 3EGSA 2VRAA 2XPZA 3ZHDA 5C0NC 2DWEA 1J5DA 2Z7UA 2HX9A 4KXCA 2VISA 1RZJH 3Q2CA 4U6HA 5ISZD 3MRLA 4F33A 1GY2A 1YEWA 4BIKA 1EBPA 3KPTA 2CLRB 5IBLC 3V0VA 5DLMH 2WGXA 3VFRB 4DKFL 2R0WL 1PD0A 1YNKH 2G0LA 1BZ7A 2XKSA 4I2XE 4PJ9A 5E8DL 2ZCHH 1GOGA 3GGWA 3L3GB 2D3LA 2WLNA 4PJHE 1IBGH 4LHUA 1OANA 2CK0H 3TEXA 2OTUA 4JKNA 2OV0A 2NY6D 4FNTA 5BOZG 3P2DA 5ABZA 2YC1A 3UABA 3EYVA 3DYMA 1CICA 2V17H 3EFFA 4R90H 4ZFZB 2R0LL 4M61A 2R1WA 4XMKL 3TA3C 4XPTL 3K6OA 4FLSA 3VFNA 1MWOA 1S4IA 2DLTA 2NY1D 4ZOEA 5SWSD 4HKZB 1FNFA 1SNRA 3GS0A 1OGPA 4LPUA 3EFOB 3ESVF 4QPEA 1OVZA 2KZKA 4Y9CA 4NFCA 2GTWA 1UXWA 2F54E 2BY1A 5D7KE 1E40A 4XN9A 4HDIB 3L95B 1DJWA 35C8H 1JS4A 4Z7WB 2HRGA 2CRYA 1FAIL 1UCBL 2PN5A 2J2ZA 1OP4A 2YR3A 3BPLC 2WLIA 2XQ0A 5FYJE 3DX3A 1OAXH 4TULL 2FX7L 4BXVA 1FNSH 2AJUL 2AI0L 5T1LB 5K9OA 3U0TB 2JMRA 4FFVC 2R27A 4BWTA 1XGRA 1Z5YD 1JGDA 3GRBA 5AEAA 3SGEI 3HE7C 4S1SH 5H94A 1CN4A 4Z0BL 5D93C 2APXA 1TU2B 4QAMB 4R7NB 2ORBH 4HQQH 1MFBL 3NSCA 1L0QA 2EDJA 1UKSA 3KDMA 3BZFB 2E0PA 1HIMH 4O2CB 5CFHA 5J1SC 2HMID 3B9EA 2GUOA 3OMAB 5HYQA 4MHHG 3UO1H 1N19A 2W9LA 5B3JE 1WIUA 3GJFA 3PP4L 3QZOA 4NJ9H 2D03L 4KH9A 5JA8B 1TFPA 2NX5D 5ID1A 2Y36L 3LN5A 3OZ9L 4KO6A 5KVGL 1RK1B 5D7LD 5I74C 2FUQA 4I13B 3AG2B 1Y18B 2A1WH 4NOBA 1QFWI 1LO3L 3SKOA 3UZVB 4U1JA 1SFHA 3O81A 3HI1B 2WXKA 1U91B 1FAKT 2AXFB 3B3IB 1HH6A 5IEHA 5FF6A 2QR0B 4PJAA 2RQEA 4KRLB 3QT2A 4N9OB 4Z7WF 3NRPA 1FUNA 2X70B 4Y16C 4N5ED 1SVCP 3HAEH 2Y3AA 4TNFA 1HCZA 2WSKA 2VQTA 2XNAB 1QSEA 2DWSA 5IWLC 5FOJA 5FO9A 4B5EA 4UOJA 3D3VB 2DYSB 5B1KA 2FYVA 4PJBE 5JOFB 3E6HA 5LDSA 2VMFA 3DARA 4OUUB 4G72B 1W0VA 1QASA 1CD1B 4I1RA 2CBTA 2Z64C 4MS8C 3CBJB 4WJKB 2E7MA 3MTRA 3PWVB 1RIHH 3KYAA 2GVYA 3WN5B 1DE4A 2NZ9D 4ZI8A 3PHOA 2CLZA 3I6GA 4P0DA 3OZLA 1EFXB 2OSXA 4FQHB 4LSUH 2F7QA 3CSPA 1A9EA 1MRDH 4LGSB 3WJJC 4HXAL 4I5BB 1FFQA 3HG4A 4YDZA 2R0WH 2AQQA 1QI5A 1YYMH 3QZNA 3N55A 4JCWA 4Z7VE 3RGHA 1EEZB 2WUCL 3FTXA 2M83A 4QUOA 1MWAA 1UVQB 4PS4H 1T0PB 2X05A 3FUIA 3GMLB 2K4WA 3IFPA 3MA7A 4NI3A 4EDWH 3HMWH 3SQOH 1CLCA 3BAWA 2ZSVB 3GI8L 4HHGA 3BP6A 4U1LB 2VXQA 4YC2C 2B7DT 4XX1E 2L8AA 2R29L 3CVHH 1CGUA 3GTTA 1N67A 4LNVA 1NDMB 4X42A 1TYRA 1NAKH 2VN7A 3QNXB 2IH9A 2ROYA 4XMPL 2Q5BA 5DSCA 3GZKA 1BDYA 3PWUB 4JLRB 3RTQB 3Q6FB 4RFOL 3FHQA 1B0GA 4PJ9B 1SBSH 2ZZUT 3MXWH 4XNYL 4JKPL 5DO2D 3VH8G 4GUPA 3L3OA 1LILA 3DGGA 3UBXG 1KGXA 2GC7C 1WAAE 1QWUA 3EJRA 4OCSH 1ORQB 3BWAB 1KOAA 5AL0A 2XIIA 3VFWB 3BW9B 1G1KA 2I25N 1GYWA 3KXFD 1OCWL 3FUDA 2D8KA 3VXPA 3QEUB 1AD9A 3N9GH 1A7OH 3P4OA 3EGDA 3IKCB 3I6KA 3N85H 4DOHB 5AYUL 1AP2B 1EJ6A 2IDTA 5E23A 3AJ7A 4XNUH 4P57B 2FBJL 3LNGA 1RQ5A 2A83B 3MUGA 3Q0HA 1S7VA 2IPTH 3OJVC 3SKJH 4JFDD 4LHUG 4MWFA 3FDWA 1V3KA 4APXA 2X2IA 1KEML 4V11A 3SDAA 3TIEA 2HG0A 1JTTA 5ITBL 4P2OC 4R4FH 1UM5H 3PL6D 3FFDA 2D0HA 5DHVB 2AKRB 2CO4A 1WBXB 4E0RA 1T7WA 3ROLB 1HEZA 1ZHBA 1NJ9A 1UUNA 3WNJA 1WFIA 2EKJA 5T1MB 2ISDA 2P24B 4ZUUB 3LEVH 2P48B 4UDUA 1NUFA 3QRFM 4H0LC 2CKBA 3O8XB 3TOPA 3VDAA 3GSNH 4AG4L 1X44A 4HHWA 1U9KA 3CFEA 4PJ8D 4UTBL 3QGVA 3KWWA 3GMOA 4WFED 2IH1B 3DXAD 5GGRB 5F6IB 1UWGH 5C0DA 4P2QD 4MB3A 5FUOL 4LCUB 3IETB 3X11B 1NMAH 1N8OE 3C8KA 4I7ZC 3EJPA 5DFVC 4EKJA 3ML9A 1MIMH 3KBHE 5HD8D 1X6LA 3HG1D 3WDJA 4WEMB 1DCEA 2K9FB 4QRTA 5T3XE 2OMUA 3QCUH 4FXGA 5LO7A 5T5NF 1ZTXL 5KSVB 4R2GC 4HBCH 4WWKB 1NGQL 2VO8A 4NQCE 5IUSA 3VI4A 3I85A 3AS3A 3O3EA 2YD4A 2A74B 2MRYA 1AS6A 2GT9B 1T21A 3IDXH 1RAMA 2B3IA 1ZT4A 3STZB 2BSDA 2W94A 3WD5L 4J39A 4XNUL 12E8H 3WIAA 2YAHA 3FT1A 1Q9WA 4NHUB 3QZLA 5FHBL 4L3AA 2Q8AH 3RYMA 3F58L 1Z1WA 2QQKH 2CH8A 5FGBC 4TQEH 5DQDH 1BFSA 1WCBA 2W92A 3ROOB 2EH8L 3CWGA 1D5MB 2C3GA 1ZHNA 2JJSC 3BPLB 4GRWE 4DW2L 3B1TA 4XMTA 2BNQE 5DWPA 5C0BA 3HZ3A 1DL7H 3K4AA 4NQCD 5HBBA 5E2WH 3QPXH 3UTQA 3NG5A 3ZTEA 1H3XA 3H55A 4DP0X 5C7XH 1YMHA 3F7RA 4Q58C 2CLZB 3I6GB 1ECYA 1S7TB 3U7YL 3QYMA 1LD9A 1UM6H 3A23A 2HCZX 2P3YA 1FFOB 1CDBA 1P4UA 2ZWYA 1JNLL 1KGUA 1NL0H 2WKLA 1FI8C 3WLBA 1MLCA 4GRLB 4F7TA 4KAQL 3V0HA 2CGYA 3VGHA 4GLRI 2R29A 3CG8A 1CWVA 3V5HB 1PLAA 3WLWD 5E8NB 1NC4B 3MV9A 2F53D 3H2WA 4FLOA 3ULSB 4RGOH 2ITCA 2F18A 4FQQB 5DD3H 4G9FA 3ALWA 3WN6A 1EXGA 2E9IA 3CK0L 3EBAA 3Q8BA 1CFTA 4H5SA 4NQQA 3MREA 3GO1L 1XF4A 1CT8A 3KH4A 3KL5A 4MXWH 2XWBA 4X5WB 3VRJB 3D48R 1ID5I 1K5NA 3CUPA 3D4GA 4WEEA 5GJSH 1RFDH 2AV1B 3E8UL 2G3MA 4GI6A 4AC2A 1CVSC 3QUML 1II4E 2NY2D 3SO3B 4UOQA 2OS7A 2XY2A 3DX0A 3L4XA 5F7LB 4N3UA 1JVLA 4FQCH 1RZ8A 5IVXA 4JDTL 3IMBA 3GM8A 3IF1B 1NGWA 1TVHB 2JSFA 4WFFE 4FZEL 4KZCA 4WNSA 1PZBA 2WP3T 5B39A 2V2TB 1GHFH 4ODVH 2J20A 5D1XA 2LHAA 2YPVH 2MFNA 1IB5A 2ALWA 3KPSD 1KTBA 2KHAA 2VN6A 5I1KH 3EOYG 3GJFB 3QXDA 2VSMB 1LE9A 1B9ZA 2HP4A 2NRDA 1H6FA 3UBXI 3RGVD 5D7SH 4OLWH 5F3FA 4YIQB 3EJZD 5CSBA 4RX4A 5I17B 4RX4D 2H2PC 1NPJA 4UZGA 4YHNA 3KCPA 4XP1L 1RZPA 4IIQC 3ARYA 2NY0C 2QTVA 3QZWG 4FTVB 5I8CB 1C5BH 3L5JA 1EK3A 3VMPA 1XGRB 4BSWB 3PABB 1NUNB 3LNIA 2D0FA 2P8MB 3RHWF 5JW4Q 3JYBA 4GQ9H 1M3JA 2GJZA 1N64L 5CINL 4TSCH 4Y2LA 5FXCH 2DM7A 3WTXA 3H42L 1VZIA 4MQXC 2MCG1 5AVQB 5GSVA 3T0VA 2PYED 3VH8A 4AMWA 4Z7UE 5AOIA 2ENYA 3C60D 3H6JA 2EADA 4MCYA 2XQBL 3MNWA 4CVZB 3HRPA 5GGUB 1F18A 4OD3H 4E9RA 3ZE0F 3IGUA 2H8PA 4XO3A 3U9PH 1NBVH 3HC0A 3CDGA 3Q5YA 1G7PB 3K6IA 3UGEA 1AQ8A 5HJBA 5D7EA 4HWNA 4BZ2H 4HH9B 4LLWA 4Y16A 2BVQB 3ZE1F 3EXJA 4U7KA 1AKJD 2UV3A 4M48H 1AY1H 3VD4A 4XOAA 1DZ0A 3RAJH 4L29B 5JW5A 2WY3B 2X2HA 5EMYA 4H1LG 4LL9A 1TOXA 3CLFH 4X0NA 1CL7H 3FO9A 5BUPA 2CXKA 1NPNA 1ZSHA 4AUJA 3KPQB 3WSQL 1AH1A 4NN6B 5AW7B 1CLVA 4PRPD 3FU7A 4JE4B 2Y7MA 3V6OA 4PCTA 1XR9B 2AZUA 3D8MA 1D3CA 4RGNB 3TNMA 5AW3B 5FYKL 4MWFB 3WIFB 5DRZB 3UJJL 4XVTH 5IHBA 1TETH 3IJYA 4YSAA 2HN7A 1SUJA 4ZYKA 1DFBL 2H2SD 4M1CC 4NFBA 4U7MA 5I30H 3JV5A 1L9OA 5EG6C 1CDYA 2HT4D 3CMOL 3P2BA 1MVUB 3WYRA 2WO2B 4U6HB 3QFJD 4BFKA 3DO7A 3TTSA 3BGAA 1KTJA 3BW9A 2JTYA 5ILTH 3LS4L 1AGFB 3FH7A 1FNEA 5C09D 1SXZA 2BP8B 3LKPA 3OC8A 2X6VA 4UB0H 2E7LA 3QUXD 3EJZC 4R3SB 2EDLA 3H7BA 1F4XL 4MNQB 3CN2A 1VRSA 3I3DA 1KGCE 1QNZL 2P5WA 2YGNA 4JLRA 5IJBC 3FSOA 3S3PA 1QKZH 4JL1A 1IKNC 5HDBB 5C6TH 1VFMA 3TZVD 3MFFB 2J7LA 1L9NA 4YZWA 4MRCA 3RWDA 5KSVA 3TNNA 2EXSA 4I0PB 3GO1H 3TJHC 3K2KA 4H7VA 5KYUA 4U1LA 2G9HA 2I26N 3ZKND 1XTMA 3TO4B 3ZE1E 5FGCE 1H8SA 1JPGB 3QUMH 5GS2H 1TO4A 5DD6B 4D8PB 5EOCH 1YEKH 2PP8A 3IDXL 5BV7C 2P52A 3M17A 2BOCB 3QJVB 2OBGA 4JVPA 1NEUA 5IQOA 3LDBB 4XRCA 4UQ9A 4CU7A 1BBJB 2V8MA 1OE1A 1RUMH 4J8QA 5CILL 4J4PC 1IAIM 2PPEA 3BMVA 4FNLL 3NJGA 3VFVB 4KK8C 1T1ZA 4E9LA 5IMKA 5IW6B 1KG0A 4PG2C 2F1BA 1Z9SB 1TEFA 5IF0A 1TKWA 4QRBA 1PZ5A 1F1DA 3CZSA 1RZIB 2WIIB 3PNWA 4S1QL 1UFGA 2C4FU 2ZNWA 4X6EB 4V33A 2EUXA 3BAEH 1A6AA 4UTBH 4YDNA 2DQ6A 3G5ZB 3FU9A 1MCHA 1V5JA 3LV3A 1ERNA 4JFEA 3LQAH 3RTQD 2Z9TA 5FCUL 3WTTA 1M57B 4APQB 2M1KA 2MQGA 2E86A 5KYWB 3D3VA 1OPGL 1KXVC 5FO9B 5FYLE 2XNAA 2ZUQC 4L05A 4DW2H 3A6BH 3T2LA 3W3BA 1P4LA 1LO4H 3DV6B 4P5MA 2ZXGA 2ADGB 3SDAC 4AK2A 1E5ZA 1JGUL 1LLAA 3T4AC 1ZOXA 1QWHA 4PJ7F 5B1JC 3MOAH 3OWRA 4HUNB 5G5DB 3BD5A 1Q90A 2VDKB 3AG4B 4FG4A 5AVZB 5MHSE 3UZVA 4FFYA 3B7TA 4D0DB 2XETA 3HZKB 3DV4B 2Y7QA 4DT2A 1UOLA 2X6BA 3FZUD 2VLKA 1O6VA 4YE0A 1GZHC 2OR8A 3FK3A 3MZTA 1TMCB 4G3YH 2DLEA 1ZVSA 5C6WH 5ABAA 5ID1B 3GUTB 5KBDA 4HSQA 1JDCA 2R9HC 4F24A 4IBUA 5KANI 5J1TC 1S7SB 1UOWA 3NMEA 4JFXB 3A67H 4PG9B 1QMUA 3LPWA 4GI9A 3SCMB 4GSRA 5HHOA 2NY6C 5ETUB 4PJGA 1VFOA 1SZNA 2JCCE 2W0KA 5E5LA 1FBIH 1H9VA 3G6DL 2DF3A 3BKJL 4NUGL 4AGPA 1EWHA 3MA7B 3IFPB 1CLOL 4OIIH 5IVNA 2AC0A 4E9YA 4RVBA 4XP4H 4MB5A 1KEGL 4YGVB 1KB5H 5LQBL 2XG4B 3IU4L 4FLRA 1OWWA 3C9NA 4P2QB 4NO0A 2O5YL 4QOKD 4TSAL 2AVFA 2VABB 4EI0A 1YMMA 3ARTA 4QXGL 4UYPA 1GIGH 4XNZB 1I1FB 2PW2B 4C4BA 1U58B 3ZIMA 4U3HA 3VQ1C 4ACTA 3ZPDA 3BP5B 5C08E 5D9SB 2XPGA 3QUYD 1AOZA 1BAWA 1YA5A 2J88L 4MCZA 5DJ2A 1KXTB 3FSZA 1OAQH 4MRBA 2J21A 3N9GL 4TVPE 3RNQB 1M9WA 1ITCA 5E4AA 1XCQA 4N8CH 1IGTB 3ZTJH 2DI8A 4XH2B 2ZCLL 1XCXA 1EO5A 1OLZA 2XV3A 2XX0A 4JFFE 3MRGA 5BJTB 3BT0A 4XX5A 4NN7B 3N42F 2IPUK 2WXRA 2YLHA 2AJYH 4PV1C 1BBDL 3X3GH 3FQRA 3HE7D 1NUGA 1M05B 4EI5D 2VUOA 1NAML 1KPRA 5EOQH 2UXVA 3WNLA 4GW5A 2E27H 5JYLA 4K73A 3RPBA 9CGTA 5MEPB 1KPVB 1PX3A 1TTFA 2H26A 3CX5J 3EHBB 5TGBA 1FJ1B 4DK5A 4FKKA 3T4YA 1RP9A 4NDMA 1GS7A 5F6HJ 1F90H 5CLXA 3DUHA 5KW9L 5AVXB 3I84A 5IW1B 3O41B 2EXYC 4OIIL 4BQBA 3V0VB 5C92A 5JR1H 3ZKMC 3ZLQC 3HLAB 1N7ML 3GPEA 3WS6A 3WJLC 1GJUA 3BUPA 3LRLA 1SJMA 2BIHA 4QWWC 1I9RH 5EO1A 1F11B 5JNYA 5DRNA 1DL7L 2VAAB 1TLKA 3FL7A 2CM6A 3OF6D 4HIHB 4NSKA 4QTIL 4WTXA 3HC2A 5LAPA 2XQYG 3HC4L 1KJ3H 1PZCA 2M2DA 3OKEA 4DNLA 5EIQA 3CLFL 2BZCA 3BCDA 3U46A 4YWGL 5E08H 5KG9B 5KSAC 2X1OA 3AS2A 1EGJL 3QCTH 2OXHB 2KL6A 1L3NA 4IGBA 3PFUA 4X5PA 4YAQB 2VAJA 4LCWB 3DROA 2AJ3B 4B5ZA 2X87A 4PS7A 3N42B 4FYTA 5TDPA 1U8KA 4MSWB 2YD2A 5CBAA 1CICD 3U9PL 4RDQG 4NKOB 3GMRB 2F68X 5G55A 1FVEB 1RUKL 4A6YB 2HPTA 4DJMA 1YMME 4LVOB 3TN0D 3VWKB 4P49A 5EF1A 4GAYB 1JF5A 1XGUB 1OT2A 3TIDA 2WAHA 3HR5A 4NKMA 1QAWA 1FBIL 5JLZB 3BT2L 3G08B 4PRHE 3U0PA 4A68A 3AAZA 3WKML 5EV7A 3VJ6B 2XV0A 5SV3A 4KHXL 4C56B 2NY4C 1GGYA 5TF1L 3WFCH 4LPTA 2HT4C 4LF3A 3TCLB 4JFDE 3V4PL 3GSNB 2DYPA 2UVFA 3C09B 4HZAA 4K7PH 4AZ8A 3US9A 5D5ME 2AHIA 1BM3H 1GCFA 1IEAB 1E4XL 2NY3C 4M4RB 4YNYB 3BJLA 5GGSA 2AGJH 4UTAA 3V6OE 5E99L 3HPJB 5GZNC 4NJAL 3BYTA 3QNYB 4PRAB 4AW4A 1NCIA 2Z91B 5DJ6A 3UIZA 4UQDA 3ARRA 5CS7A 2EECA 1XF5A 2FL5B 3BFWA 3C60B 4Y4HC 2IADA 4XGZB 4M7JH 1LO4L 1MCQA 4JM0A 1IJNA 5H4YA 3T77B 3ULVE 1FE8H 2LQRA 2VDOH 2VRQA 1E9QB 4P4KC 4OLXL 3DVGA 1AO7A 4NO0D 5CF3A 5L8JB 2LAAA 3WL9B 2DQJH 5FECA 4H8HA 3B5TA 3G04A 1A3RL 4RBPK 3PWNB 2YPKA 1MRCH 5LAXB 4FA7B 2Y7SA 4G6KL 2IH3B 2ADGA 1KMGA 4AQEA 3DV6A 4P5MB 3X1FA 5AYTA 2HFEB 3LHPL 1JGVL 4G6FB 4WU7B 1LEKB 4ODWB 3I2CH 3HBPA 1UJ3B 3L5WA 4I9WD 2WYHA 3KNBB 1XGYH 3MX0A 2Z31C 3BSZH 1HCFX 3SBRA 1U8CB 2ZP0T 2AJXL 4IS6B 1IC0A 5DZPA 1DLFL 3KS0H 3O2DL 3T71A 4B9YA 5CFAA 2RIKA 5GSRB 1P53A 3QSKB 3P3RA 1N12A 4QJ5B 5IESH 5FW7A 4WWOA 5GIRA 4JBSA 1OM3L 2J44A 4QHMB 3WXWL 1FORH 2P7TA 2HFFA 3M1BB 4M5SA 1SJEA 4ZUVA 1PG7H 4EI5A 4HS8L 3SDCB 5HPMB 2VN3A 4AYSA 3KH3A 1KYAA 1QFOA 1AXIB 3HVNA 4X80L 3L4VA 3V10A 1U6AH 3WIHL 1MCLA 5KS9A 1E27A 2B08A 3T9WA 2ZOLA 2AF2A 5E8EA 1SJEB 5F7AA 2W38A 1OP3H 4I88A 2GYSA 3E2HB 1DEEB 1N9PA 1ZWIA 1OE2A 3HNSH 3EZJB 4NWUL 4UT7L 4ES9A 1JPGA 1I1YA 4TRPH 3U7WH 2NPLX 2W88A 3FONB 4XB7A 1QLFB 3QARA 3CZLA 4IKNA 4IU3A 5KSBF 1L7IL 2R1YA 4NZUH 2DI7A 1KIRB 3MR9B 4EI6B 2IEPA 3RWDB 4BE5A 1EEYB 1MCNA 4PG9A 4TPRH 4YSRA 1MCJA 1ND0A 2YD9A 4D3CH 3UPCA 5JDJA 3OAYH 4CU6A 2G2PA 1A25A 4OCXH 5DDHB 3QEHB 1LDPL 4P23B 1DN2A 2CQVA 3FB8A 1Z9OA 3TL5A 2O6EA 4G82A 3EJUA 1UYWH 1RHHB 1J8SA 1L9TA 3M46A 2XDHA 3DUUB 2XQYA 2Y7QB 4RFNB 1BM3L 1J1PH 2IH3A 3BN3B 5GRWA 3R8QA 4MNQA 3T3MB 3H7BB 4KU1A 4MJHA 4FCHA 2ENPA 1U33A 2H5UA 4G43A 2IDCA 3U2SB 3V4PH 1IL1B 32C2A 3D08A 5JIPA 1USQA 1OT1A 2QADC 1M71B 4X4YA 4N5EC 1H5BC 5GGSY 2QFRA 3WEAA 4GINA 2YUXA 2OJZL 2X40A 1GW6A 5I1IH 3AVEA 4BE6A 3D85D 3FFCD 3OKLA 4ZNEA 1C8PA 1T22B 3E3QC 3QG7H 1Z9NA 4Z3FA 1XIWA 4EN3A 4M48L 2G3NA 5IKCA 2QDVA 3FNKA 2EE2A 4LRNL 3T2OA 1ETJA 4AQ1B 3G5ZA 4JFEB 1SJHA 3VAEA 4L1DA 3OR7B 4R97B 1BQSA 5EO9B 4U3SB 5E2VL 4M6MH 3KG5A 4U1HB 1REIA 4KVCH 5GGSB 5AG9A 3R18A 3ZU8A 3ZTNL 3THML 3VXOA 3QK0A 1OP5H 2XG5A 4N26A 1SPDA 3RFRA 2B0SH 3S35H 3DX2A 4PB0L 5CJ8A 5HVWA 3K1DA 4J2QA 2AXGA 3KVQA 5IB3A 2BVQA 3MV7E 2D9CA 4ZNCD 5E4IA 3ILPA 4TLTA 5IVXF 1BAGA 4AEIL 2JJWA 2Z7YA 4RZCB 5CZXD 4BUGA 3CDCA 5IWLA 1AYRA 3JUZA 1FYTA 1T1YA 1PFOA 4G71B 4HIEA 5DK2B 4CADB 1P5VB 3SYAA 1A3LL 5C08B 2XTJB 3BQVA 4U1SA 3SY6A 5F7NC 2IXQA 2YPLE 2HVJA 1AO7D 4W70A 5T1LD 4XI5D 3MLSL 4LSQL 2WKGA 5E6YA 3UTTB 1ZPUA 2ZOWA 2CDFA 1A6TB 4JO3H 4J3TA 3GSNL 1TZAA 2FYYA 3SGKC 2VJ8A 4EIUA 1CURA 4QOKA 2DD8H 5MERB 5L2KB 1NFAA 2NUPB 3WELA 4FE9A 1UD2A 4DAGH 1FZKA 2B59B 5J5EA 4LARH 2FWOA 2CIIB 1J8HE 3TH2T 4Z7QE 2ENSA 3ZJAA 1YSOA 2FEDD 5MHSD 4LKCA 3ATDA 4BFEA 5C8JB 4FHBD 4QOKB 2VSKB 4WKZB 2VH5L 3ALPA 2RA1A 5ANHA 3UTSA 5ICZB 2BPBA 2HT2D 5LGJA 1BM7A 1PQZB 2VAAA 3D09A 4XVJL 5F88A 1D5IH 5TE7H 3D30A 2VZ3A 4JJHA 3RDTC 2ED9A 2K8MA 2ATPB 1S7RB 2FB4L 2FR4A 1H8NA 1XH3B 1FWXA 3OG6B 3VDBA 5IG7B 2NR6C 4MJ6B 3F84A 1HQRB 3G5YA 5HYJD 1WITA 1T0OA 3PL6C 5LB1A 3QUXA 4M6OL 2GFBA 5JPNB 4NYLA 3TBWA 3UEZA 1GZHA 2O5ZL 4N2HA 1J05A 4K8RH 1YAIA 4M7LH 4HPYL 4Y0GA 1OHQA 5MENB 3HE7A 4RFOH 3D0VA 2JNZA 5E4OA 5HI5C 8PAZA 3WS3B 2DWXA 5IHWA 1RJYB 5IQ7H 2E47A 4ENZA 3C5ZD 3FQRB 4K0OA 3U1SH 3VFGH 5KYYB 4JKMA 1A1MA 3T4AA 1XSKA 3BFQG 3MV8B 3CH8A 3HR6A 3H2PA 4J5VA 4N2LA 5I1HL 4CN4A 5T1KA 2XWCA 3W0WD 3SPVB 3GEWB 2BHZA 1KCKA 4NRXB 1WG3A 4LDEB 5CNHA 3RPKA 5GZND 1L9MA 5F6IC 3UTOA 1BQ5A 3MQIA 1OCRB 2Y3NA 3MNVA 3ECUA 1LD9B 2R2BB 5EZLB 4J3VA 5KS9F 1MFVA 4R4BA 2W8CA 3LZQA 2ZWSA 3QDJE 4OZGE 4AV5A 1MCSA 2XWEA 3K6FA 4DP1X 1C5DA 4GBXA 2A9DA 3IDGB 4PGBA 4UAOB 4XOCA 1QNIA 1CGSH 4AJYV 2F61A 1BYPA 5FYKE 3TEUA 3NA4A 1QBML 4ZFOB 4IKJA 3BPCA 1IC4H 2F8IA 4YZFF 5M7QA 4R83A 1OB1B 3I50H 1AIZA 4JQIA 4POZC 4MLIA 5I17A 5FO2A 5CJXA 2OMNA 4QT5A 3T0ED 1S8DB 1VFBA 2X4SB 4FQXC 4Z1PA 3T8XA 1SM3L 4WEBL 4R7DA 3WIHH 4F7PB 4WAFA 4LEOA 5HHOB 1NCBH 4HCRL 2P8LB 3D9AH 4H0GA 1TVDA 2Z8VC 4GW4B 3OX8B 3BO8B 1MCOH 3L48A 4N2NA 4RESB 2JIXA 4ZW7A 3OKYA 1M7DA 3PUUA 1QFHA 4Q89A 4N0YL 3NPZB 4GEJA 4YC2B 3II3A 2VRKA 4F7CB 4IRJC 3D0AA 2VLKB 3GBNL 1NGWB 3BWUF 4N8PA 4JGUA 2PMZA 3E0GA 4U4BA 1RJZA 3BMWA 4BM7A 4LCIH 4GAGH 3VSTA 2K7QA 1NLBL 4UMGA 5D1QA 2A4CA 2BLFA 5D1QD 2BDNH 3RU8H 1TTBA 5A7EA 4PGBB 2AJVH 5I8EA 3CFBA 5CU9A 3V2AR 1HDMA 4NP9A 1TTGA 5AALA 3CUPB 2QKIA 5F8RC 1H15B 2XVBA 5EU4B 1FN4B 3AY2A 3B2UC 5DS1A 5GS0D 4I87A 4CA4A 4HIXH 1T2JA 4QHMA 3H6AA 4PREB 3WE6A 3WTVA 1D6EA 1I9IH 1MREH 4HIIA 5TH2B 4FQQA 4N20A 3VXUA 2X0UA 1NC4A 3WNKA 1QBAA 2ZG3A 5T1KB 3W39B 1JXFA 2P28B 5F2FA 5HHQA 1G0YR 3T2PA 1Z9LA 3AT9A 3O6KL 4XCCL 1ZGLP 5LNGA 1UACL 1VACB 1MFBH 3AM8C 1E7VA 5BS0A 1UJ3A 2GQHA 3NQKA 3RBSA 3SE3A 5EO0B 3BX7C 1V7ML 1OOWA 3B2VL 3IJEB 1PTZA 4Y5XA 5EF2A 2A83A 2JI3A 3LNHA 3PP3H 4L2LA 5F72S 4Y2DB 2E7HA 2A6KA 3NPSB 4XTRC 2B1OA 3WEOA 1HOEA 1E4JA 1IGJB 4ODHH 4Z5RB 5I15H 5F1OB 2J8HA 4RAVA 1HTYA 3NIFB 3S98A 5C07B 1HQRA 2H3XC 3G5YB 1HL9A 3WL9A 4AEFA 4FTVD 2VLLA 3QW9A 3T1WA 1XCWA 4WGKA 3T6ZA 1G6RA 2Q7YA 1GVIA 2H3NA 2XXMB 4X98B 5K1NA 4UQAA 1OSEA 1U93A 1F41A 4WNJA 3GBNH 4GUPB 4YXLL 2C3VB 4ZFFB 4XAKE 4F8OA 5ELIA 2X6MA 5BMFH 4J6RH 4KXAA 4U0RC 3CZNA 1GR7A 2GY5A 2PO6B 2YWZA 4BDVA 1WZ1L 3ABZA 3SGJA 3ZR5A 1KLGB 1I7ZB 2EZ0C 3P73A 1TTCA 3HS8A 3A5VA 3NRQA 5E56A 5G4MA 1IEAA 3U4BL 2HG5A 5LDUA 2IFFL 2LLGA 3X1EA 1FZKB 3I50L 4PRHB 3V7MA 4A2EA 4CDHA 4ZTPL 4P9ML 3NDYE 5D4HA 3CFKB 2BMKB 4MDJA 1E9PA 5E03A 4PW4A 3QJHA 5CGYC 1FE8L 2VDOL 1BYNA 3A22A 4GO8A 2IPKB 4CKQA 2XWTA 4H26A 4MMYA 2J1KA 4PRID 2X28A 4DZ8B 5M94B 4YXKH 3HTLX 4IRSD 4OJEH 4OQTA 4RGMC 1T7XA 4NAJA 4U1SB 4ETQB 1IIKA 3FTGB 3NIGE 2OZ4A 3VXSD 4JCMA 4HS8H 3NCJL 5EU6A 5EU6D 3FO2A 4ZZFA 1NMBL 2BVOA 1I9IL 1MREL 3N50A 5BS0B 4J27A 2B1AL 2HVBA 4OIFA 4QHPA 4WHYH 5DT1H 3RPIA 5HI4D 3UJTH 2FEJA 1NLDH 3U36A 5IB3B 1G7IB 3FT4B 4A7GF 4E36A 3CDZB 1WFNA 3L7EB 4HUWB 3UERA 3V4UL 5L4JA 4OV5B 3VFGL 1E6OH 4WI7A 3D05A 3MFGB 1PZ2A 1R0AH 4ONOA 3MBXH 2KLRA 4ABWA 2ETWA 4MNQD 2EDYA 4QRSA 3VFMB 2F8VA 1NCOA 1P7QD 3CHQA 3EGDB 4RH4A 3QS3A 5KSAB 5DS8B 1KWGA 2I07A 3F5WA 5C71A 3TF4A 3FTYA 5K1VA 4QEGA 2FZ3B 2QBWA 4HFUH 1IFGA 1T7VA 2D7MA 4XWOD 1T1WB 4MJ2A 2AEPH 3GK8L 4N8VB 3L3IA 1NA8A 3BPOC 5FDWA 4FOMA 3RG1C 3HEIB 3ZUCA 5IW3A 2LU3A 1OEZW 1PZUB 2QQNL 1HNYA 4FZEH 3M6DA 3L4TA 2WXJA 3U6XA 1V7MH 3TO4D 4D7BA 3WMQA 5E2JA 5IM7B 2NXYD 4FQCL 2P8MA 5IBLD 3TA3B 4V1DD 4OM1H 4W4OC 4ZAKC 4HJGA 3U6RB 1NGZB 1MLBB 3IJSA 1VGKA 3KPNB 3LPPA 2E5EA 3HAEG 1RULL 4JFFB 4TQHA 1QHQA 3NGBB 1RURL 2YSTA 4X99B 3HRZB 1BVLA 2A6IA 1GYVA 2PLTA 2DBLL 5GS2D 1L7TH 1L5GA 2WTRB 5DLML 4KZEH 1ODUA 2DQGH 1LO2L 4QXWA 1H19A 2VN4A 4RMQA 5HYFA 1EEYA 3QCVH 4EI6A 5I0VA 1HXYB 4QRRB 2ZX9A 2XA8H 5D1XB 4WV1B 4AJVA 4BH7B 1MCOL 5L88H 2DMBA 1ZLSH 2R56L 1VSCA 4AKQA 1DQIA 5IJCC 1A4JA 4KKCC 3GXPA 1LWRA 1BQRA 1V3LA 1NPUA 3T6VA 3BAXA 4KRPB 1CGXA 4LSPL 4HJGB 2OJ1A 3AWEA 3UAFA 3MOBH 3SPVA 2A6DA 1SDYA 3X3FH 3KPSE 3P2TA 4F93B 3FUMA 1UA3A 1UTDA 1RPQA 3J7HA 4U1NB 4HWEL 1OTUC 2OP4L 2Y25A 2P7TB 3ASWA 3V55A 3PGFL 5D93B 5ESQA 1HOCB 2A6IB 2HJFB 2QHRH 4Z7QB 3VYPA 4XC3H 5FW6A 4HJEA 2WKOF 4BFBD 3GINA 1NOAA 4NWTH 1QSED 2J1XA 3SODB 5HYJA 4Y9GA 4N85A 2CHDA 3M7OA 4JY5H 1F8TL 3VGDA 3NCFB 1AR1C 5K9JH 2QR0A 2DQIH 4PJAB 4MCMA 4PGDB 4XX1G 2HLAA 5CLWA 2ICWB 4XVJH 1R6VA 3HI1A 3KPPB 1KB9J 3HFML 3SCMD 2X4TA 5I1EL 4YSOA 1U8MB 1XGPA 5IMOB 1KJ2L 1HWGB 3NZUA 1HSAB 2Q7AA 3C08L 1KENH 1BGXL 1NCCH 1RK1A 4BWWA 5I66A 1X5ZA 2R56H 4LMQI 1KB5L 1YC8A 5EHFA 3RIFK 2Z6FA 3QUGA 3VX1A 3DUSB 4QD2E 3DHPA 3AQXA 3MRIA 3NVQA 3QJZA 3GNMH 5F0LB 4B0MM 4N0CC 4FAAB 3DLQR 2V8LA 3GBEA 2BVOB 1DUYB 3VFPA 3ULUF 2D3JA 3DYPA 3RUGE 1ITBB 1EANA 5F0PB 2X6UA 1KLUA 4KROB 5HSFA 4YDMA 1LO0H 3RI5F 4AJ0A 4IJTA 2HT2C 5CUSH 2FEEL 3MLYH 4AEIH 4ZS6C 1JPTL 4KQ4H 1KV3A 4O00A 4ES8A 3QQ4B 4QF1B 3CPLB 4R0LA 4U0QB 2HJLB 1A6TA 2CDFB 5A3IC 1GA2A 3OZKA 3VVWA 2RALA 5BRZA 4LB8A 1B3IA 1J1OH 3CAFA 4NWUH 1UWXH 2B16A 1ZK9A 2IOIA 2OCCB 1HQ4B 1T5KA 4IGBD 5ESVA 2WXQA 3P73B 2WTPA 5LGJB 2QL1A 3SBPA 5GZOC 4WLCA 5DVNA 4QGTA 2J88H 1FYTB 5T33L 1PDKA 2WHVA 2VZSA 5JZ7D 3VGEA 1FNHA 3MRNB 1UXWB 1RD6A 5HI5D 5I71B 3VJ6A 4B9FA 3HN8A 4UUJA 4L8BB 1ET5A 1TJGL 2IQAB 3MJ6A 4FDWA 5C0CA 5JW4R 2EKSA 1T1XA 3CFEB 2WXGA 1GGTA 1HINH 4OBSA 4XAWH 2AXGB 3MGAA 2VXSL 3UBXB 3TO4A 1KULA 4RQQB 4GSQA 1VDGA 2EEBA 4XNYH 4I48B 4TNWK 1FVEA 2VR9A 4AEHH 1UZGA 1QO3B 4C59B 4MSWA 3O6FD 1YLBB 1LK3H 1WUZA 3N0PB 4APQD 1E6OL 3LRSA 3CMOH 4PJBB 1HEHC 3GIZL 4KTGA 2J72A 1E4KC 2KQNA 2YD8A 5EEWA 4P5KA 3D3VE 2J6EA 2XX1A 5DT1L 3EDFA 2C3VA 2LTQB 1EJOH 3L3DB 3TX4A 3B9KB 1QRND 1IC5L 1ZS8A 4CAGA 4AYMC 1OSZA 1OWRM 4PQXA 4NN5C 2BFGA 5ESAB 3S35X 5IROD 1M71A 4YXKL 4X4YB 5JUEH 1I3VA 3MRHA 1SHSA 4MXQC 2O61B 4M1GL 5ICYA 3TFKC 4TOYH 2AQ1A 3HB3B 3HNVH 3JVGA 1MI5E 3WEBA 4PREA 3SKNB 3WY1A 3ESMA 3QDMA 1IC1A 3VXUD 4QAWA 3IAGC 4JGJA 3IJYB 4Y5XB 1U8MA 4A7GA 2XIDA 4NDMB 3DVFA 4UIMA 1PZ3A 2DOCA 1DTUA 3SYCA 1JPEA 5CZRA 1AR2A 5MEPA 2R59A 2WGNB 3D39B 4KKCD 1OTTC 3KAAA 2XRAH 2LE9A 5TFSL 2UUDH 3VNZA 4XPGL 2W65B 4P2YA 3BEWB 4JPQA 3CFIC 2ILLA 4JPKL 5CGBA 5I73C 1S9XA 4JRXB 4NUMA 5JW5B 4W4OA 5DYOA 4LEEA 4M1DH 1WWBX 3V6FA 1P6AB 2ZG2A 1I3RB 2EQDA 1FL6A 3F7LA 1TTRA 1XR8A 4P59H 4AT6A 5I28A 1MWAB 2L7QA 4NS0A 3MRKB 4CN1A 3PY9A 1HHKB 2A6DB 2GK2A 4TNGA 3SPIA 2MQCA 4KO5A 3KHQA 3MCG1 4GAFB 2Z8RA 1DBBL 1ED3A 3UJJH 4DP5X 3HBZA 4R5TA 1BEYL 1S7XA 2OYKA 2E8ZA 3FKUS 4XZUB 3Q2WA 1ZHKB 3ML8A 2XWJB 1D7CA 1G84A 5D4QA 5IFAL 5B7EA 3S97C 4I3GA 2PO6D 4OLUL 3HI6L 4UIKH 1K3IA 5FEBA 3P40A 1L6ZA 2K1MA 4NO0B 5CJQH 5JIKA 1L9QA 2FECI 1WBYB 1NM9A 4GW4A 4TVUA 1X5HA 2R1XB 4P46B 4PJCA 1ZSDB 2IMNA 3GSXB 5HGGS 3DVNA 2G2RA 3A6OA 1MHEA 4KTDL 5MEQA 4QKTA 3QDJA 4OZGA 4AMXA 3H3BC 4N0CD 3L5WB 1A4BA 3LEXB 4OJCA 2WBJD 2VMJA 4HKBB 5H35B 4RWYH 4AXWB 1G0DA 1UT9A 1AQMA 3PJSA 4G6FD 1D6VH 3B6SA 1TDQA 1VKXA 1PG7X 2X70A 3BPCB 4GY4A 4N0RA 4OAWA 1CZ8H 4L8SB 5IBTH 3MODH 3WFBL 5L6YH 3UPRA 1NGZA 3H9HA 3IJSB 4ONGH 4W9GC 3MSPA 5D7IA 2X3BA 5D2NC 3GSVB 3CX2A 2HFGH 3BUYB 3TA3A 5I1AA 4PRNA 4NO3B 4PJHB 5KYYA 1KJ2B 4XPAL 2EJ1A 3LPGA 1PYWB 3NA9H 4D9LH 1R3IL 3SD2A 3IMSA 4JFTA 1RZ8B 2BJML 1AXSB 3BLKA 1ZAGA 1F3DJ 4P4RB 3LB6D 3LN5B 15C8L 1CYXA 3G3LA 4FI8A 3MCLL 1GW0A 4BFFA 2B2XL 1PZSA 4YSPA 3SKMA 3QORC 4XCNB 3RE0A 4PJ9C 1FZJA 3SE9L 1FH2A 1EHAA 4JHAL 2VDLL 2GUOB 2FQEA 3VRJA 5CLTA 4AIZA 3VWJB 4A2LA 1N2RA 4N2AA 2DIAA 2VDKH 5EEZA 4I1NB 1Z3GL 2DICA 1P7QB 2PCPA 1A9VA 3HUJB 5I1DB 2FHCA 5LG6A 3OKMB 1QSZA 3MYJB 1TXKA 4E5XB 2V17L 4Y4KC 3S37H 4L1HA 3V5HA 2ZOKB 1F13A 3KJ4C 4WO4A 1XSJA 2N0MA 4YDLC 4HT1H 2CCLA 2A9NL 4A55A 2BSTA 5CMAB 3QUZB 3J07A 2WZPD 1FZMA 3QIBA 1NC2A 4CVUA 2YAPA 1G7LB 1KGYE 3L9EA 5AKRA 5IQ9A 4WUKH 2JELH 4DVBA 3S8GB 4H25A 5DEJA 5JUEL 3ZL2A 1G9HA 5EN2A 1YMHB 4UOZA 4JX0A 4BKLB 1PCXA 4O2FB 3VGFA 5HI4C 2O5NA 3C8HA 4MMZA 5H2BB 3ARFC 4O58H 5D1ZD 3NFNB 3QYNA 3FFCE 3TJEL 2GTWB 5F88B 3DPBB 4JFFD 2COVD 2EC9T 1E9PB 3CFJA 5CJXC 1J0IA 2Z31B 3REVA 2A3TA 3JWDH 5HHMD 2FBOJ 3DSNA 4BKLA 3MKKA 2EYSB 2GIXA 5AD0A 3S9DB 1IBFA 1EAJA 1ZK5A 1A6UL 2XZCL 3GZQA 3U9UA 5JIDA 1CTNA 4H25B 4LDOB 4M61B 4J3OF 5FO7A 1RZKL 1UWFA 3BKYH 2YMXL 2JCCA 1XCTA 3CMGA 3LXUX 2C9XA 3WIIL 2YJLA 3BUDA 1NOFA 3O3EB 2GPZA 3N44B 4G5AA 3QJQB 4WO0A 4M62H 4YHZL 2APTA 3NCEB 4WW1A 5E1IA 5AKSA 3SDDD 2P5WB 3O4OC 3UTTA 1JWMB 1TCRB 3Q5TA 4K9JA 3LZNA 5E5UB 2QVKA 5ECGA 3VXOB 3ZIYA 4ZNEE 3IETA 4QTHB 2R23A 3MA9L 1LEGB 1WIOA 1AGFA 1IBYA 2YN3A 2PWEA 1NICA 1VEOA 2EEFA 1U8QB 1XF3A 2C9RA 1I4FA 1UJTA 1NBYA 5D6CB 2MH4A 1XIWB 4RMTA 5BRPA 4N6QA 2G3XA 4Y2DA 1J1XH 5KTEL 1I8LC 4P2OB 1JK8A 1IM3A 3OLDA 3CBRA 3ULUL 3BAJA 3T6XA 2H47C 3W9EA 3BWSA 1L0YA 4FFVD 2JI2A 1JD7A 2XTJD 3IDUA 1IAKA 3D34A 2Z93A 2I32A 3APNA 2VDPB 3TWCH 4ZMNA 1NFDA 3QCUL 1G6VK 1P1ZB 3FRPB 1MHHB 4HZ1A 4JM2F 5DUBB 3WIIH 4BZ2A 4DF9A 5C97A 2CKNA 1EUUA 2FIKB 4JN1L 1ZT1A 1TLMA 2CJTA 5IMMB 1HU8A 2JK5A 4TNEA 4Y5VC 5L2KD 1BMGA 4BK5A 5CU5A 4EN3B 4AXWA 2XUWA 3LQZB 1HZLA 4P5RA 5DZJA 5GHWH 3CU7A 4DUWA 3FB8B 1V10A 1J5IA 2GC4C 3IMVA 3GSOA 4F80A 3FO0H 2XWXA 4Z3IA 3CDGB 4LQ1A 3QDJD 4I2XA 5DJZA 4M93C 4HGKC 4NO2B 1BEXA 2NNXA 5D6DC 1QLFA 1YCSA 3OR6A 1L7TL 4FNPA 3OLEA 5C0AE 3OF6A 2O6FA 3KJ4B 3JWDC 1IGMH 3Q6FA 1ZA6A 1YQ2A 1A6WH 2WLKA 1XGTA 1S7XB 5IK3B 5DJCB 1NANI 1YYML 1ED3B 3ZHLA 5DDHA 3I6LD 5KS9E 4PVBA 1CBVH 3B3BA 4ZMTA 1Z3RA 1XL6A 4AGNA 4R96A 4P5SA 1G7QB 4RGMB 4TXVB 4G83A 5L8LB 1QEXA 2VC2L 5EDXA 3DIFB 5D1ZA 4DN3H 5ITFA 3VTMA 2EDHA 5FKAA 1YNTA 2X2UA 1IX2A 1QLRA 2B14A 5B8CC 1DCLA 1OAQL 4X5LA 3OXRA 3U2JA 1C12B 4Q9QH 1TJMA 2NR6D 4LPYA 2NR6A 2OMWB 4KY2A 5D2NE 1JAEA 2RJMA 4XNBA 1CF8L 1KCRL 3LCYA 4D0DA 2ZX8A 3QEGL 4GW1A 1EO8H 1KCUL 1M56B 2MTPA 4A2DA 1N6QH 2APBA 4W6WB 2WZ5A 4XN2A 2DD8L 1NMAL 5FYJD 3W37A 2P5ED 3FH5A 2OJZH 2GY7B 3VACA 2Z93B 4UIMB 4HEPA 2BOBB 5H8DA 2OMYB 4FG2A 4YHIB 4JFOA 4GP8B 2IDFA 1Z2KA 1OF2B 2YFNA 5DFWH 1YEJH 3QQ3B 3R0NA 4WGWB 4KKQA 1B9KA 4XPHL 2DWDB 5AW5B 1XF1A 4K2UL 3RB5A 1R3HB 1YVLA 2XY1A 3V4VA 3MUHL 3LIUA 4XNAA 4PGEA 4JFPA 2NLJB 4IKLA 5DMKB 2EACA 5IUCA 3DX7A 1BMZA 4OJFL 3E80A 4FNQA 4MKMA 1DQTA 4GRWH 3V9FA 1PZ5B 3POHA 2VLME 3F01A 1J8RA 1AZRA 4K5NA 5CKGA 4BFIA 3AREC 1I1AC 2C9AA 4S11A 2HFEA 4X6BB 3U79A 3FJTA 2BK8A 3A6BL 3F7VA 1VADA 5MENA 3NJNA 4QO1A 1U2YA 3ZTNH 1X9QA 2WXNA 1DP0A 3B34A 5HHOD 4AQ8A 4OFPA 1QA9B 3GSRA 3BQUD 1D2PA 1U6AL 2VM9A 3AY4C 3FAXA 3LXAA 5GS1C 3VXMD 1O7DE 3MUZ1 3RWIA 1O75A 2OSWA 3U9UB 3UFIA 4G8AC 1NGPL 3KCWA 2ARJB 3HAEA 4GQZA 1IJ9A 4W93A 4FX5A 1DQJA 5HGHA 3PXLA 2CNZA 1OPGH 1GYCA 5CN2A 1U92A 1PAMA 3HI6H 4UIKL 4JM4L 1CIDA 3TT3H 5DRWB 4N5UA 3ROOA 1FFPB 3IAPA 3MLPA 4CDGC 1CVRA 3ZL1A 3QFJE 1MJJA 1JF6A 1WIPA 4H4NA 4E2OA 5DR5H 1IE4A 3O3AA 2JV6A 4DPCX 1ES0B 5CN3A 1NGYA 4Y88A 1IGYB 5H37G 5MP6H 1RK7A 2O93L 1QSFE 4R7NA 3S2CA 2VXUL 2XN9D 2EICA 2H6UA 4OI9A 2XRAL 3UG5A 3I9GH 4LRIA 1CFQA 1A9BA 2BX5A 4OB5H 2WLMA 4RNRB 2R39A 3P02A 1J87A 1MVYA 4LCWA 1A5FH 2EIMB 2GJ6B 3X14B 3QHFH 1QLEB 3OB0H 2XWDA 1RSYA 4TN9A 4R97C 5BQDA 4IBTA 4NN5B 2D3VA 2DLFL 1U2CA 4Z7UB 3OKEB 1SYVB 3LRGA 3PGCB 5EWIL 3UO1L 4OBRA 3CFUA 2Y0SA 3RLSA 2YJQA 3ZE2F 3N2JA 1H9DA 1OZTG 1H6TA 2HKHL 3WHE0 1RMFH 4P46D 5L0QC 4LEBA 3AT0A 3VB9A 2YD7A 2MPAL 1WWCA 4MS8D 4ZMLA 2VQ1A 2WXLA 3W5MA 2PTUA 5C0IA 1JMZA 2H1PL 3P54A 5C0JB 2OXHA 4OLUH 3OLGA 4R9HA 3B8YA 3S2AA 1XZ0A 3KR3L 4KZDL 4NP4H 4C54A 2CM5A 1KPUB 3QXAA 4HAFA 2DQMA 3SPCA 1AXTH 3FFDB 1MIEL 1T0MA 5EA0H 4JZOB 4PRBB 1HAWA 4B53A 5ACZA 2QKSA 4TVPD 2BRRL 3ULVC 1K8IA 4Y4HA 2H3KA 5DJDA 3T65B 4JQXC 4L3EB 2AK1L 3VI3E 1F2QA 2D0GA 5AVWB 4DCQA 1CTMA 4ZPVB 5KSBE 3ARBC 1E5BA 3GSXA 5HDBE 5T8IA 2ZICA 2COQA 3LN4B 3QIWA 4W1TA 4MA7L 3QPQC 4JPKH 1XO8A 2E9WA 4L4VB 2XT1B 3DDGA 2JKWA 2YOCA 4ZXBB 4AYDC 1DVXA 4HSAC 1A4JB 3GLAA 1C1EL 5AOKA 2XWJA 1PLGL 4WTZG 4O2EB 2YPVL 1MNNA 3K91A 1I1FA 2AEOA 4ALAC 2WN3A 4M5YL 4TYUA 5DEGB 4F92B 4NGHH 1HH9B 1PX4A 3L08A 4JGNA 4OSUL 2CKBH 1UM4L 4KMQA 2YA1A 4HQQL 4NKQB 4X7TA 5BS0D 2XTSA 1PKOA 2GHZA 2X9XA 2YEZA 3B7YA 1LDSA 5CBEB 5EPMA 5D96C 3UPAA 4AYFB 3LKOB 3HHRB 1UB5A 4WHCA 2Y7LA 4W9EC 3U1QA 5D2NA 1COBA 1YNTB 1A64A 2WAQA 3BN9D 3K8LA 4I89A 5D1ZB 5HD8C 4JPWH 1NBQA 1BEYH 1EEZA 2GI7A 4JFFA 4Z7OF 2RFXA 5DURB 1OTTD 2VZTA 5AG8A 2ZQKA 4IGBC 3OJMB 4GQ9L 1IGCL 3B9DA 5PCYA 1JNLH 3L54A 2YZ8A 5FYLL 5GZOD 1MQ8A 2HPOA 1F90L 1T2XA 2HXAA 3C9NB 4P2QA 3H9SE 4KJPD 1CXEA 1K8DB 4ZUVB 3ZHKA 5JIHA 2J8UF 1XF4B 4X5WA 2MNWA 4JQIH 3AZUA 1GZQA 5FUZH 2VITB 1D9KD 4GIPD 5HYSA 4HUUA 2G30A 4NUPA 1U42A 1VGEL 4JO2L 4S1DC 5DLLA 2IWKA 3EO1B 3UCQA 2MIZA 3RFZC 4AQZA 3CXHK 2NXYB 4PB9L 5DJZB 4ELKA 2P5WD 3HVDA 4H8QA 5BCAA 1TJGH 2TSBA 1MAML 2QT6A 1FGVL 4J1UB 5I75C 3TWYA 1MCWM 1QTSA 4ICWA 2D7NA 4Y2DD 4ZAKA 5H4ZA 3ELQA 2CK0L 2W0PA 5F7KC 3FAWA 4TNVF 4GXFA 3RKDD 2Z1PA 5KYWA 3KLLA 3BSGA 4PD4J 2UY7B 2K6YA 1QX1A 1U8LA 2YO3A 3CDZA 1JK9A 2TSAA 3FT4A 4WWNA 3MA9H 5EZOL 2A6JB 1DLHA 3ILEA 1FVCB 4YDVB 1KYFA 5E94B 3AT8A 1URIA 3IDIB 1PD6A 5D7JA 3GHPA 3S8WA 5CCHE 4N4YB 3K72A 3BP7B 5LBVA 1CDJA 3REWB 3NFSL 4UILH 2H0JA 3D7PA 2BC4B 2Y6SC 2DQHL 1JYXA 2DMKA 1UG9A 2QZQA 5DRXB 4QGYA 5D7LB 3MRQB 2DLIA 3F6LA 1JRHL 1TITA 4DEPB 2W9EH 1TJXA 1HNFA 4FLQA 1NIBA 1QLEH 3QB7C 4UUJB 4XXCC 2EIBA 4KH2A 4Z78B 2ZYRA 4MCNA 2AK4D 3QJSB 2G75A 1BYOA 3BGMA 4PRIA 4XRCB 4A7QA 3AXLB 5A2JH 4L3CB 3CFCH 3S48A 4FNRA 4UMSA 3D50A 1ASOA 2IALB 3PGDA 2APFA 3C6LC 3GZOA 3TEWA 3FU0A 1BFVH 3NJXA 2WLLB 1LP9A 3L4YA 4CC1A 2XLLA 3SDXE 5E2UL 1OGSA 5I6LA 3TV3L 1NSNH 3X11A 3BE1H 4OU3A 3HMXH 3GPSA 3EDEA 2DAVA 1AHWA 4ZFOL 3ZYIA 4BDVB 4FCAA 5F7MC 4G2AA 3BGMB 4PRIB 5CLZA 4OZIE 4U3XA 1RZFL 4BSVB 2WWKT 1IGYA 3FQ4A 5DGQA 3RVVD 1HKFA 3BVNB 3VG9C 4NQTA 3FOLB 5FHBH 5DD6A 1NGQH 4D8PA 2GABA 2J5WA 3KVPA 3O2VH 3PAYA 4RMWA 2GHWB 2YQ2A 2P24A 5ANMA 3EYQD 2WUBH 3Q2LA 1J1OL 4LK4A 4DFHA 4ZFGL 5HY9A 2NY7H 4JQVC 3EFOA 2V9TA 1MOEA 7FABH 2YBRA 1N6UA 4K3DL 2UXFA 4HZLB 4KJWC 4NKIH 4D9RD 4JFVA 2PR4H 4ETYA 5E24E 4HEPG 4X6CA 1R19A 2HTKD 2NYZA 4AYID 5EZIL 2V2XA 1WAPA 3CFDA 5B1JA 1KJMA 3MV11 2L3BA 4FEMA 3R7RA 4PGDA 1BX2B 4Y7MA 1AD9B 4YLBA 1B2WL 5KZCB 4UM9B 3QUMB 4ZX5A 3QAZC 5AB0A 2VXTL 4E5XA 4JPWL 1BZ9A 4X4MA 3Q1SL 4WU5B 4I1PA 1JUFA 3MRPB 1KIQA 3S88H 2HJFA 1NAKL 3RQ3A 1G7JA 4UV7H 4WJ5B 1SEQL 4F7KA 1UQSA 3PWLB 4PJAE 3FHAA 3K6DA 4HALA 1ZPLA 4QXTA 1NBZA 1A6VH 1A47A 3HI5L 2ESVE 4KNSA 4Y16B 5I1EH 2Q6WA 4TTGA 2ZPKH 1MRDL 1JPFA 4LKXB 1NIDA 3WEXA 2WWMC 5D70L 1FYTD 3EZ8A 1N5AB 4WI0B 1V3JA 1QZNA 4N6RB 4KI5F 2YIHA 2VXVH 5IBUB 4NM4H 3X2QB 1HS6A 2PF6A 2XJKA 1U8HB 3WFEH 4QY8B 3U4BH 3O45A 1PSKH 4OGXH 5B7MA 5EU5B 4N3TA 5LJYH 2IGLA 2OI9B 4TL5A 3C09C 4L23A 4ACPA 2IWGA 3IGLA 4AW7A 2BVTA 1MI5B 1D7FA 4XMLL 2APSA 4X8GA 3VXMB 2LU5A 3NP3A 2HKLA 4K55A 1QPXA 4PSRA 2J25A 1I1AB 4MQTB 3DURB 4AM0Q 1C5CH 1TSHA 4HKBA 2FD6H 2GCYB 3AROA 4KHTH 4ANUA 1GTNA 1OY3B 2FHFA 4X99A 1RZKH 4XP9H 1Z32X 3JT0A 3HJ0A 5GSVB 3SDCC 5GZOA 3EXLA 1M4KA 2CUHA 3AUVA 4XMPH 5GRJH 4KXZH 3P30L 3RWCA 4Q9RH 1BQHA 1LO3H 4YQXL 1P7BA 2I9LA 1BXUA 2WCSA 3QQ9C 3BDYL 3WNPA 4M29A 2YGQA 5B4MD 2CR0A 2VDML 3KPRB 5A2BA 3T0DA 4IHBA 1XGTB 2EZ0D 1OW0C 5IJKA 4DOHE 1E8XA 2NYYC 4N2DA 4GO9A 2AQPA 3UMTA 5CCGE 1BJ1H 3KBEA 3L5IA 4K8RC 2NY4B 3MJ9H 4YN3A 1FSKB 4ZMZA 4XCCH 1XWVA 5EZPA 2V7HA 2Y2TA 2ZUQB 3FQWB 4PS4L 5FYKU 4E9SA 3VUAA 1U95B 2A9NH 1F3DH 1HIML 3D39D 4YH6A 1ZVSB 3ABGA 2WW8A 1WAEA 1MCEA 4KNTA 2FRGP 3LIZL 4NUQA 1FYTE 1S9XB 2QQNH 4AMKH 2Y69B 3NJMA 4N1CA 1WD9A 4MNGA 4P9MH 4OVUA 2HA1A 3DX6A 4MDIB 1ZXQA 3ETSA 4OB5L 1J7VR 4DGUA 3HG1E 3L7FB 3NH7L 3CN1A 2ZPKL 3RJOA 3WBDA 2F5BL 3TJHD 3DMMC 2DQEL 4PBVC 2CGRL 4MJ6A 1VLXA 1X5KA 2EIZA 4OFDA 3RNKA 2FQGA 2OMTA 4XPFH 3MREB 1N0LA 4YUEH 2VDMH 1KXHA 1S6NA 2NT1A 4J6RL 1F00I 2ZYSA 1MFDL 1TYEB 3CLWA 4WWKD 4C58B