4QR7A

Structure and specificity of l-d-transpeptidase from mycobacterium tuberculosis and antibiotic resistance: calcium binding promotes dimer formation
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
349
structure length
349
Chain Sequence
b'VPKLTASVTDGAVGVTVDAPVSVTAADGVLAAVTMVNDNGRPVAGRLSPDGLRWSTTEQLGYNRRYTLNATALGLGGAATRQLTFQTSSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L,d-transpeptidase LdtB
publication title Structure and specificity of L-D-Transpeptidase from Mycobacterium tuberculosis and antibiotic resistance: Calcium binding promotes dimer formation
rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 90
structure length 349
sequence length 349
ec nomenclature
pdb deposition date 2014-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
A PF17964 Big_10 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 4qr7A03
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4qr7A02
5DZJA 4GSRA 3VAEA 4LPQA 2MTZA 3VYPA 3VYOA 4JMNA 5DCCA 3ZQDA 5E51A 5DU7A 4QR7A 4JMXA 3TURA 3ZGPA 3U1PA 4A1JA 1ZATA 5E1GA 5DZPA 1Y7MA 4GSUA 4ZFQA 4XVOA 3VYNA 4HU2A 4HUCA 5DC2A 5E1IA 4A52A 4K73A 4A1IA 5K69A 5DUJA 3ZG4A 5DVPA 5D7HA 3TX4A 4GSQA 4LZHA 3U1QA 4A1KA 4QTFA 5LB1A 4Z7AA 4QRAA 5E5LA 2HKLA 5LBGA 4QRBA
chains in the Genus database with same CATH superfamily
3RFZC 1BYOA 5T5FH 3CDYA 4UILL 2YEZB 4NQDE 2EIJB 3V6ZA 2SEBA 4Z77A 5I2IB 3EO0B 4HJUA 4LSSL 3ZTCC 5D7JA 3WFHA 2XETA 3OC5A 3F7KA 1KG0A 1G6RL 5C71A 3QUHA 5MEPA 3IJHB 4PRPB 4U1NA 5IEHB 3F04A 1OTTC 5C0BB 1WCBB 4WK0B 2GI0A 3F12A 4DSYA 4TN9A 5I1AA 2VMJA 4JHAL 4C57C 2X4PB 4UQEA 1D5IH 3HB3D 3CBRA 2YIHA 4ABQA 5KZCD 4S1QL 5IROC 1NFDA 3NIFF 3MCYA 5T3XE 2CO6B 3ATDA 3FTGA 1HOCA 5KVEH 1N59A 1TVBB 5TQ0H 5DVMA 2P4AB 2EDYA 1ZPUA 4LSQL 5E8PA 4BGLA 2OR9H 4LMQE 3VXPB 5D2LA 3RBSA 2G2NA 3MRBB 2OMUA 4PJXE 2E75C 1Y7MA 4F7TA 5EA0H 2M83A 1GXEA 4Z3TA 2X6BA 3OKLB 2VRQA 1KCKA 4M00A 5DEFB 5I73B 3RWEB 2VISA 4X7FC 5E9DD 1MHEB 2WW8A 3C60B 2RFXB 4WDIB 1CFTA 1HWWA 1VFAA 2APFA 3WXWH 3V2AR 2NW3B 2J44A 2CQVA 4I0PC 3OKKA 3T0VA 3IU4L 2EDBA 3K6OA 3QCVL 3LKRA 5GGSB 4OCYH 2A9BA 4ZX6A 2QEJA 3J07A 3VXMA 2PWFA 2AEPH 3H7BA 5GS2H 4JDZB 1ZEAL 3TASA 1THAA 4CA4A 4U1KA 5GQBA 5C7XL 4BFEA 5KBPA 1DVQA 5DHXB 4U7SA 1ULVA 3I6LE 3VG0H 1O6SB 3PPSA 2KDYA 2VH5L 4KDTA 1ZHBB 4LEOB 4CW1B 2Z7ZA 1E4WH 3K3QA 1UVQB 1ZHNA 1OTUD 1KF9B 5A6IA 4AL8H 3BEVA 1P7KA 1A6WH 1JOIA 2VDPH 2X44D 3BDXA 5LGHL 5E2TH 1R33A 5A2KH 2NSXA 5CGYC 2VLRA 3QXDB 4A55A 2K7PA 1JV2A 1RHHA 1EPFA 3BUIA 4KPHL 5FUCC 4B9KC 5E0QA 3DPBB 1KDJA 2MPAL 2VXSL 3UBXG 3ZOAA 4J4PC 4M9PA 2YLHA 4IEFB 4X99B 5E08L 3W39B 3RNKB 3PWNA 2YRPA 2DH3A 2LVEA 1E2ZA 3MA7B 3LV3A 5DJAA 1F4YH 1F2QA 1I3UA 1M05A 2VZTA 4R3SB 5LLIC 1S4IA 2E74C 1BEYH 2VZSA 4JO8A 4FJZA 2F7PA 2QL1A 4PJ5B 3WI9A 3RUGF 1HQRB 5ISZE 4HU2A 1QUNB 4KTEL 3NA4A 3QJTB 2RALA 3FN0L 4K71B 4PJCB 2HLAA 3NCXA 2I26N 4LVOB 4PB0H 2NY7L 5JIHA 2CHZA 1F1GA 5IBTL 4P4KD 1HL4A 1Q72H 2I69A 4JL2A 3UABA 2NXZC 4N8CH 5D1ZA 3L4XA 3OV6A 4XRCB 4YFLI 1A7RH 4GAJL 4MQ7A 3TJEL 3HHMA 4P2OC 3VI4B 1K4DB 5CZKA 3JUYA 2EDWA 3EXLA 3NCBB 1RULL 4XNMB 3BWUF 4LCYA 2JIXA 5GJTH 4PTUA 4I3GA 1S7XA 5DZOA 4MZ3A 2X2JA 3T5WA 5AD0B 1G6RB 4QKTA 4GPVA 5FO2A 2GIYA 2Y6SD 3UTQA 1K5NA 3SBWA 2WWOA 32C2A 3HC3L 5KWYC 3KLAA 5HI3C 4AIOA 1ID5I 3CDGA 3QIWA 3V4UL 1QATA 4MBRA 5BNXD 4I0CC 4HH8A 2OZ4L 5AZEL 4LDEB 3QAZC 2WBJC 4GRLC 4PIBA 1RZ8A 3PE9A 1A64A 3MKKA 4JMNA 1CFBA 4H20L 3C09C 4BH8B 3EYOB 3G04B 5SX4H 1CFSA 3AREC 3VQ1C 3US0A 1AXTH 4NN6B 1B2YA 5IW6B 1KENH 1W2KT 2NY0D 5B3JE 1KCSH 2EIBA 3UTTB 4RGMC 4YMPA 3ATBA 4QCIB 1T22B 2C3WA 5C9JA 4HPYL 3HE6D 4EQ3A 4B5ZA 2NYKA 4PLNC 1S2EA 3B7TA 3OXSB 3QPQC 3ROOA 4AMKH 5HHXL 3U4EA 3ZYJA 1NFIA 4OY9A 1S3KL 3US9A 5IB4B 1DFBH 3LIZA 2GK0B 5ESQB 3MLYL 2XWJB 4H25B 4XR8C 4YDVB 5HI5C 4PS4H 1L9RA 3OZLA 4ANVA 2BDNL 5C6WH 5DUBA 3VCLB 4KZEL 4GMTH 4MVBD 3TVMD 4C59B 3S8GB 2O93L 5I6MA 1JCVA 4YIQA 4PP1D 3IDMB 1ZSDA 4V1DE 3ZT5A 4ETQB 4EUPA 2EDJA 4IRJC 3IU3A 43CAB 4UM8A 4K3DH 3BPNC 4MFHA 4F80A 1SXCA 2GI7A 3GDCA 1I7ZB 1IC5L 1SEBB 2VN5A 3C75A 1KB5A 3K1DA 4QRTA 1DVFA 4KQ4L 5GRXG 3MNMA 1ESOA 3CFEA 3OXRB 4W1TA 3BFWA 3DXAB 3MFGB 5FLUA 2AQRA 1NGPL 1E9OB 3D0VB 1ASPA 3L5XL 3CPUA 2DTMH 2OLDA 5F7EL 2VUKA 1DQTA 3RJQB 3MRMB 1BZEA 2VKXA 2ADGA 4KROD 4X7TA 5KVFE 2WQ8A 2ZCLL 4Z7NB 1N6QH 5K9JH 4NNYB 4ZMOA 3EOYG 4Z95L 3O2VH 2FH8A 5D2NC 3VI3F 4AGPA 3Q6GL 2EAEA 5E6SB 3PWUB 3BZ4B 4UZSA 4GRWH 1KSRA 4KGLA 1Z9LA 2BNQB 4G83A 3MKGA 1Q9WA 2F53B 3SPVB 3EXJA 4WO4D 1JZ5A 2C3HA 5C0AA 2F5AH 1LJMA 4P2QD 1CG9B 5CJXA 4ERSL 3CFJB 4UT6A 5DYOA 5AW8B 1NAKL 3OAZK 1ONQA 2QMKA 1G7QA 1VDGA 5DVPA 3SKOA 2Z93A 1K8DA 1SOQA 4XNXL 5I0WA 2HMID 4LESA 5EV7A 5F1SA 2WINB 3LPGA 3NVQA 2F7QA 2ZZUT 3NIFE 3N5AA 5KYWB 4JLRB 1E27B 1X7QA 4HFUL 3EOTH 4NRXA 4IBSA 3RWHA 5B1KA 4XMPH 4LASL 5F1KC 4M6OH 4IIZA 3SGJA 3WENA 3LX9A 3MLVH 3X3FH 4D3CH 2WXLA 2Y36L 5FO9A 4AIEA 1IE5A 3UZQB 1RJYA 2C9QA 1ET5A 5G5DB 5IR1A 4TSCL 5IFHL 3BP6A 2MPVA 3O2DL 2R15A 3T0BA 1AE6H 4IOFD 2I07B 2X05A 5CKAA 2BW4A 3NJVA 3O6LL 1KBWA 3GPSA 3RVWD 1FORH 1G9NH 1I8IB 5I66A 2WWNA 5D7EA 5FIEA 3C8DA 4M1GL 1ET8A 4JDTH 3TA3C 2H0JA 3KL5A 3IFPA 2OK0H 2FT7A 4PG2C 1FZKA 1VIWA 3CNKA 3IJSB 5IB5B 3RL2A 3QDMA 2YOCA 1J88A 3N1GC 3SOTA 1WAEA 1NBCA 2PTVA 1EHKB 1PMYA 3D09A 4APQC 2CJTA 4DGIH 4E41D 2CBPA 4ISVA 4P23B 5E2WH 1ZLVK 2P44B 3ZE2F 2J8UB 3V0VB 4PRIA 5C0EB 1F4XL 2PPDA 4Z7VA 2CA4A 2ZUYA 1G7PA 4RMBA 2GITB 4PJBA 3LVTA 1FSKB 1IJ9A 2YZ8A 1OW0C 4ECNA 4MNQE 4POZD 5C09E 1GL4B 3AUWB 4WUUB 3CJJA 3UBXA 4UTAH 2FK9A 2EVIA 3V5KB 4ENZA 3O3BB 3SQOL 2XCMC 1N67A 5FXCH 1KPVA 3VWJD 4ZMQA 3ZG4A 1GMEA 4FMVA 2GVYA 2MOGA 1YYMH 3FFCB 3WIFB 4Q97A 2XWZA 2NUPA 4NJ9H 3VRLF 3GXTA 1DO6A 4ONFL 4G5AA 2AEOA 4UQ3A 3VXQA 4WF7A 3VRJA 3T2QA 5AFAA 2CU9A 4FGMA 5DT1H 2BVUA 1MFNA 1OT1A 4MJ5A 1UT1A 5EWIL 5T3ZD 4CAGA 1U93B 5E99H 1BQUA 3GLDA 1LO2H 4DKEH 2IPTH 5EU6B 4FFZA 3RUGE 3DROA 1DN0A 4HHAB 4QJ5B 1OB1A 3M46A 4MD0B 3WJLA 4OM1H 1EO8L 4P9ML 4TTDD 3A4DA 4NZTH 3PWVA 2XA8H 3TO4C 3WY3A 4LSPL 4EAEA 1Q9KA 3PUUA 5B38B 3HAEG 1TJIL 4OD3H 3U0TA 1MNUH 3O4OB 3VGAC 5JHLA 5JUEL 3V0GA 3ZLQC 1BXUA 3KPRE 3P0GB 5J3HC 4TNWF 2GAZA 4MB1A 4FMKA 2BSRA 3KE0A 1L7IL 2MIZA 2R4SH 3RGBA 3BD4A 3D39B 1SY6L 1U8IA 4WKZA 3DO7A 2MJWA 3BIKB 4LE8A 3ULUD 2NY1B 4NHUB 3VXRE 2D31B 4XMTA 3WJJC 1Q0XH 5D7LD 2VXVL 4AEIL 2QV4A 3D8MA 1EO5A 1PZBA 2W38A 3OG4B 5ADOH 2FYVA 2OSLA 4DEPC 4AW4A 1EJOL 1YEKL 3ESVF 5L0QB 2R69L 1TQSA 3BE1H 1OAKH 4LDCA 1NUNB 3QQ9C 4QWWD 1CGTA 1TETH 3D2UB 5L4JA 3VGBA 4P2RE 1N0XH 5DU7A 1IMHC 1VCAA 4M62L 2DKUA 4KQ3L 4NKDA 3UTPD 3F5WA 1YPZA 1T6BX 1XFPA 1DQQA 1QYGL 4KKPA 3SJVE 5JHAA 4P0DA 4H0LC 2XTJC 1OP3K 2X12A 1ZK5A 1PX4A 5F1OB 4NN7C 4J3VA 4DO5A 2FGZA 2JVUA 1HH9A 3ES6B 4FJ6A 4M7KH 3SO5A 3QORB 5HYJD 4JHWH 4ZO7A 4OD1H 3II1A 5H2BB 3SD5A 3ZY7A 1HWGB 4HG4K 3RDJA 5DJ0A 3ARQA 4Y8AA 5DGQA 3PCYA 4X8XA 1Y0LA 3NCWA 5DTFA 4KKBC 1GTNA 2D9QB 4TPRH 4M02A 4H8UA 4R26L 2PW1B 5IHHA 3HG5A 4PW9A 1HXMA 4ZUWB 1CZ8L 5LN4A 2OR7A 4GB9A 1XR9A 4JANB 3CCHB 5IJBC 3WFZA 1INQB 1L7TL 4JPWH 2WYZA 2G0KA 3PL6B 3KXFE 2R1XA 3LQAL 1OAQH 1VACA 4PJEF 5T1LA 1N4XL 4PVMA 4XHQA 3RZCB 2H41A 1JZGA 3CPLA 4IYKA 3CN2A 4KK8C 3TEYA 1QQDB 1X6NA 4X6FA 4C4UA 4CMHC 1VADA 2AEWA 4KMTH 4AYGA 1R3LB 1E8WA 1J8RA 1SLWA 2R0ZL 4Y4FC 1QWNA 1EH9A 1QLEH 5KBMA 3VVVA 1XD1A 3QHZH 4G43B 4N1HB 4NM8L 5KJRL 4PJIA 4YQXH 1BAFH 2V17L 1J11A 2EDXA 3C2AL 3HC4L 3X3GH 5BRZA 1BBJB 3HFML 5B8CB 1PAMA 5DQDH 1AXIB 4A7QA 4DF9A 4UYQA 4YDKL 2CE6A 1E30A 2PCYA 4LRIC 3QCTH 3B8SA 5FYLD 1BGXH 4HWUA 1LTXA 2VDOL 2RGSA 4BSVA 2DI8A 5FUCE 4WCYH 4PJHF 3MNVB 4GYBA 2GBAA 2VL5A 1XGPB 4N0UA 3VI3E 3K2UL 2V2WB 1CF1A 1EAJA 4LSRL 4Z3HA 3AXIA 4AENA 3NFPA 5B21A 2X4TA 5HY9B 2C1PB 4PR5B 2WOYA 2IALA 5FUOL 3IPFA 3R4DA 5FDWB 4U6VH 1BLIA 3GM0A 1FFNA 4I9WD 4JFDE 4E42B 4PMFA 3IVKA 4I85A 1NKOA 1MAMH 2BIMA 4NN5B 4NQVA 2IDQA 4NERA 1KPUB 2DIJA 3NQKA 3TBSB 6FABH 2FEEL 2B9AA 3L4UA 2GSMB 4Q4EA 4WHYH 1T89C 2IDSA 4UINL 2OMZA 2B20A 1HDMA 1CT8B 2ZKMX 3BKCH 5EO0B 15C8L 1OIOA 4R2GC 1KEMH 1XWVA 4FNSA 5CU9A 1BVZA 3EFFA 3FO9A 2QQQA 1TR7A 1FL6A 1XGQA 5FCUH 1SXZA 5GHWL 5IY5B 1FZMA 1HSBB 2H45A 1YG9A 3NZ8B 2WBKA 1P1ZB 4UV7H 1NGZA 5F7WC 2AJYH 4YSDA 5DUPH 3E8UH 1ZT4B 3GEWB 3QEGH 2P5WA 2XDHA 4RWYH 5ID1B 1BFVH 1FJ1B 4X7DC 1YEIL 5D7KD 3CMGA 5MEOA 2RQ8A 4I18A 1GGCH 4UB0L 1EGJA 1YA5A 4FTVA 2ZTBA 4NQEE 3UTSD 3T6ZA 1HXYA 5FO8A 4Z8FL 4GQPH 5J56B 1WCBA 3IDXH 4QIRA 4UOZA 1MUJB 3B2UC 3PHOB 3RZWA 2E9BA 3NDZE 4KRNA 1GW0A 4ZW5A 1R0AL 4NCC2 1M53A 1NBQA 4HUCA 1CDGA 1WA2X 5E6ID 5GGQH 3NGBC 5D1QC 1QSFE 3MV7D 1LP9A 1XF4B 4I1NB 3VD4A 3JV4B 5HHMB 4XTRD 2CDGA 2HKFL 3F84A 2FVNA 4KKCC 4GBXA 3VMOA 4W9EC 3CLFL 3ZE2E 3MBXH 1TTUA 1KGWA 5HVHB 1YNKL 2HZHA 4ETYA 2ZYSA 5IWLC 2F74B 4KY1H 3MN8A 4CC4A 3GHPA 1XIWC 3OHXA 4J3WA 2V7NA 4CN1A 2DQUL 3UADA 1WZMA 3NCCB 4UDTA 1K4CA 4HIHA 2VR6A 4MD4A 5DEFA 4P46A 1GGTA 3IFNH 4XP1H 1E5AA 1NPNA 2Z3FA 3UGUA 3OF6A 5KYUA 2F8IA 1N2RA 1Z3GH 1JFHA 2IFFL 4F8NA 2R7EB 3BPOB 4PJ5D 3CG8A 4OLUL 2NW3A 4BRJA 1S9XA 4X4XB 3QCUH 1L0QA 3H9SB 3VRLE 4FEMA 2X10A 1C5BH 2XWEA 3BUYB 5GRVK 3KCPB 3LIZH 3IJEA 3BVWA 5DJXA 2XWRA 2Z64C 1QZ1A 5CSGA 2NR6D 4OT1L 5HHNB 1H3GA 3X12B 3RGVA 4AQAA 4HULB 3O2WH 4MMXB 5DC2A 3HAEA 1RZGA 5BVJA 1EAQA 1NKGA 5I1GL 4P99A 4BK5C 3N42B 1AIFA 1ZHBA 1PCSA 4LEOA 2LTQB 3RI5F 1TCMA 4MS8C 4AYFA 4H2AA 1A3RL 2O61B 2VDOB 2QGEA 2TAAA 4UMSA 5F8QC 1F45A 3RG1C 3WKMH 4LP4A 1J5DA 3I50L 5I8EA 5AW4B 3MHZA 2AQ3A 3R1GL 4NCDA 4WU7A 4JB9L 4Y16C 5IVZB 5C0DA 1X9LA 1IAII 4X98A 3L6FA 3GSRA 1KB5H 2ZXEB 2HN7A 4ACPA 2A9AA 4QXGL 4YDIH 4TSBL 2X7LB 4CVUA 3P77A 5D2NE 2I60H 3EYUL 5MEQB 2RA1A 4PJGB 2Q1EA 2EXYC 5A6MA 1BP3B 1ZHKA 1SMDA 5E6RB 3GM8A 1BMWA 4M3JA 3LD8C 3W39A 5PCYA 3A4EA 4IGBA 1TZHA 3RURA 2BJML 4EEEA 4HIIB 1MCIA 5CS7A 4FA7B 3MA7A 1R19A 3VTTA 3UMTA 5GS1A 1F18A 4P5TA 5I75C 4HMCA 1FNHA 3IJ9A 1CD0A 4LVNB 4NQUA 1CVRA 3HNSH 4KO7A 1EAPA 4MHHI 2OXHB 2VSMB 4JE0A 1USQA 2BOLA 2VC2L 3ILEA 3OR7B 25C8L 5DZPA 3W82A 2O5YH 1N68A 1CDIA 3CX5K 4UT6H 5JPNB 4UNVA 3BD3A 5EU5B 1QI5A 1LO5B 1S7UA 2RBLA 2UZIH 3U36B 2YMXL 3VXOA 4DK5A 3V0WL 2EYRB 2HRLA 1G7HB 2QDWA 5C0ND 2WGXA 3REVB 4AE1A 4BE5A 2R0WL 1UCBH 4XAKD 4QRPB 1IC4L 5J12B 5FYJE 2KZWA 3HLAB 1OHQA 2DLTA 3KH3A 3DUUB 3KJ6H 1NJ9B 1NOFA 2G5RA 4FXGB 4WI0B 3HS9A 3KJ4C 1ZTXL 5ACLA 1J5IA 3H4HA 2P8LB 2VSCA 3GKWL 3NTCL 2BWIA 3SO3C 4QXWA 4G8FB 5JIDA 3PXLA 3TNMA 1CB4A 2Z31D 3EAKA 4POYA 3MX0B 1VFUA 1NCUA 3EADA 3RNQB 4PJEE 4OCRH 4N2KA 4CSSA 3DK2A 4HZLA 2YD1A 4R9HA 3CC5B 3ZQ9A 4NQDB 4MMYB 4OKDA 2YKLH 4OIAA 5IW6A 4MCNA 1MHHA 1AY1H 2Z7UA 4RDQF 1XCTB 5DQ9A 2JI3A 4QCIA 5BMFL 2XWBB 2H2SC 3LRKA 4A66A 1QLRB 2VM3A 4MZIA 2E47A 3ARUA 5G4NA 3T2LA 5J0BA 4L8BA 3U46A 1UWGH 4EF3A 1RU9H 4K07A 4ORGA 2X4QA 2XN9E 3DBXA 3DO3A 3LB6D 3HZMB 3AT9A 2V8LA 3GWJA 3FH5A 1GR7A 1INDH 3RJDA 4PJHE 4ZUSA 4YVUA 5GISL 2AGJL 4P9HC 2KC0A 5IZ7A 4EO5A 4HT1L 3V4VL 4PJXB 1A1NA 1OAZH 1I7TA 2NCEA 2QR0A 4RESB 3RTQC 1PJ9A 3IDMA 4GSUA 1JXKA 1A5FH 5EOTA 2HVJA 5E8OB 5ICXA 3CFCL 2EQDA 3MOBL 2NTFB 3TTYA 4D9RE 1JVOA 2YPKA 5IM7A 3K6DA 3L95B 2QPFA 4G8GE 2YPLE 1JDAA 2WP3O 4PGDA 4WI9A 2V0AA 3WTTA 2PLTA 3QA3B 1K2DA 2VDQB 1X5MA 3RVXC 3F58L 3DXAA 5F21B 4W68A 2P45B 4PTTA 3JV6A 1KOAA 1BZ9B 3OLIA 3H85A 4U0QB 2NQ3A 3EKCA 1E3FA 1NUFA 1QRNA 2EEAA 1T21B 4HWBA 4ICWA 3CZJA 3H1ZA 3UAEA 4PRDA 5F6IC 1ZA6A 4OJYA 5GGUA 2FGWL 3UAAA 4RA0C 1YYLL 3ZKMD 4DH2A 4P4RA 2XU9A 4JAMB 2OMWA 5I1HH 4JRYE 2ZJSH 5EHFA 2IQ9L 4A2FA 1SHWA 2AXHA 4BWWA 1JPGA 1A1OA 3WKQA 4K2UL 4LZKA 5A43C 5JOFA 2DWEB 3L17A 3CFJA 1DBBL 5SV3A 5BOJA 1OQOA 1YEGH 3WSQH 4FYTA 3WFEH 3O8XD 5JYLA 1A47A 3DX3A 3CZEA 5FO7B 1KCLA 1KUMA 1WHPA 3QBTB 4M7LH 4F33A 5KVFL 4B9YA 2VC2B 2QQKL 2WINA 4PRHD 5CN1A 4MJ2A 4A52A 1CBVH 4L0PB 1U3HB 3ZTNL 3EBGA 2NXYD 1HCFX 2O72A 3ARGD 1C1EL 2N1KA 3V0AC 3WHXA 4OUOA 1MAJA 3T2OA 1ZMYA 2C3VA 2J5LC 4HCRA 2BC4A 2WMPB 4I1RA 4PJDB 3BSGA 3G9VA 4KRPD 2XTJE 4JZJC 3TNNA 3VQMA 4IRZL 1A14H 2CPUA 3D69B 4NKOB 3CHSA 3GSWA 1HT6A 2VLJE 2MH4A 3UZQA 4FZ8L 5ISZB 3D0LA 4JQXA 5DHDA 5CFAA 4UAHA 1HS6A 1QVOA 4AYDC 3LKNA 3E7JA 2MOVA 5AB1A 1AYRA 1B6DA 1Y1DA 4JE4B 4LLYA 3AGWA 1SLXA 2IOMA 5E95B 5G55A 3ZXAC 5KVDE 4FFZL 1SBSL 3L08A 3ZKXC 3E6HB 2ZSVA 4O2EA 5IJVA 5BS0E 3V9FA 2EXWD 5EU6D 4CVXA 2FT6A 2O6DA 5SWZE 1NFAA 4PW3A 5GGSY 1PZAA 3I85A 2NY5H 4HU8A 2PTTB 3MRQA 4M29A 2CO7A 3OGCB 3QUZD 4ZOAA 1RFDH 5JHLL 3F6IA 3ZO9A 2YGPA 2YSSB 4YC2C 5JXEC 3QT2A 3QI9B 5GPRA 5J9PB 2AVGA 2J8UA 2EDRA 3QUXB 4NRZA 3TBCA 3TEWA 3AQYA 3W1ZA 5C0EA 5JW4M 3PABA 2E7CA 1AGBA 4ILDA 4HIJB 3VFTB 2GITA 5FB8B 5C97A 1MCRA 1RZ7L 4S0TD 1W0YT 3BJLA 1QOKA 3N06B 3SDCD 3LPOA 1TU2B 4FE9A 5F7MC 5JDSA 3IS1X 3QJQB 5GGTA 3U25A 4WZ9A 5FFGA 4EXKA 3CFQA 3GD1C 3MJ6A 5C86A 1LO3L 2NY2B 2WJ7A 4U3SA 1WDAA 5JO5B 3WO4C 2AZAA 4N9GB 3MSPA 5AQ0A 4MJ6A 1BVKA 4FQXC 5BV7L 2D3LA 2HJFB 4U1GC 1FNSH 2HVKA 3KPNA 1ZHLB 2E5EA 3D2UD 4DIXA 4OVUA 3EH3B 3LH8A 5LUMA 3NJJA 2AAVA 5F3FA 5EB9A 1ADWA 3QEUB 1ADQA 4WWID 4C83B 1BWWA 2OCJA 3EHBD 3ECVA 1O9ZA 2XX1A 2BWQA 1M4KA 3UPRB 2O4EA 3LNHA 2CKBL 4JRWA 2BHYA 4MD0A 5IVXB 2AJSL 1LMKA 3DMMD 3QDHA 2PW2A 4XHJC 4B6ZA 4KVCL 4OF7A 4DKFL 3SCMB 3BRDA 1SJVA 1VAHA 4Y9FA 1MG2C 5EN2A 5JPMA 1EVTC 4FJYA 4QRRE 3LXUX 4V1DB 1Y6NR 3JTSA 1S8DB 4P5SA 4ZTOH 3I75A 5K9KA 2XV6B 3ULVC 1MFMA 1FH5H 4ZMPA 3SGKC 5LGJA 1NCOA 4GAAA 4XT1C 1J1OL 1SM3H 4WAFA 5F1IB 1F00I 4JZNB 1JGEB 1SOKA 3D39A 3SE3C 1M71A 1HZKA 4OLEA 2C5DC 3DX6B 3DVGA 5F9JB 1FNEB 1XMWA 3WUWG 2E86A 5KSBA 4Y2DA 3RJOA 4ZAKC 1QFWL 3LHAA 3N50A 4HXAH 1IBGH 1S9YA 1Z5LA 4P06A 4XNYL 4HV8B 5IQLA 3NJMA 2V5TA 5I9QC 1O6VA 2EZ0C 2JMRA 1UOWA 2ZKHL 4H13C 3S9DB 1IGJB 2W1NA 4YK4B 5D1QE 5JQ6L 3QULA 2JCWA 4NAMA 3R7RA 3U0PA 3T4AC 4FQ2L 1EGJH 5I16B 3FB6B 4F7CB 1UH4A 2XZAH 3MR9B 1PEWA 4Q2ZB 5HDBF 5TPWH 2MEJB 5C2BH 5CZVL 4H1LB 5J6HB 2UYLA 3T0AA 2Z92A 4KXZI 4BRVA 3L16A 2NZ9C 1TEYA 3C5SB 3CVIL 3DX2A 1Y7VA 4OZIA 1HNFA 1NOLA 3ES6A 2A83B 2GSIB 1E5ZA 2EO7A 1QBML 1YSOA 5D96B 2O5XL 1HZHH 3TN0B 3Q5OA 3NIFB 5F9WB 2MNJB 4FYRA 1TUPA 3IDUA 2KLSA 3JVFC 4O2FA 3HC0A 3RAJH 2I9LA 3FL7A 1INQA 3HG1A 3JV0A 4GKNB 4Z0XA 2J1KA 4DTGL 4BHUI 1I75A 4F20A 2DWDB 1M2VA 2C1OB 4XMKL 5AKSA 1RURL 3F05A 3RZCA 3QISA 4XB3A 2AJ3A 3HZ3A 4K55A 3FSAA 3T3PF 2X4SA 4N8VG 3QP3A 4DCQA 4Y5YC 2X3AA 1YQVH 3G6AA 3IKCA 1GW6A 2R29A 1OP5H 3W0WE 2DWYA 1ZLWH 3T2NH 3P3SA 4JJ5A 3ARDA 2BNRA 5MERA 1XAKA 5I1KL 1IKNA 4DP6X 3WS3A 4DP7X 4DAGL 5INCA 1KLGB 4I0KA 3RI5K 1ZVSB 2FEEI 1XCQA 2B14A 1CL7H 4X0KA 2FEDC 1G94A 5GRVL 3TZVB 3OD3A 4GIAA 3HAEH 3CIAA 5DEGB 2JELH 3X2QB 3KPOB 3T65B 5GRUH 2ZWLT 2OJEB 3MRHB 4FYQA 3VRIA 3QZPA 1CDJA 3ALWA 1XH2A 3MNVA 5GJSH 4JPVL 5GIRA 1U8CA 3DV4A 4WWPA 5GRZA 4RX4D 1ODUA 4WWKB 3QZNA 4XO9A 1BF2A 2PPAA 4MRBA 4PR5A 1S9KC 3M45A 4R96A 3PV6A 4JG1H 5FDWA 4KUCF 4MNQB 5C09B 4EN2A 1RUQH 3H3KA 3KPSD 5HHOB 3I3DA 3FT2B 5LWYH 4U31A 2ZXGA 4GP4B 2CKBB 3VSUA 2UXTA 1K8IB 4HS3B 4YSAA 2CLRB 2PR4H 3TBYA 3DHJA 1IIIA 1IC1A 2UZXB 3ARBD 4PYHA 1JVLA 1IGCH 3MPCA 4CADB 3UJIL 1NIAA 1FGVL 3DGGA 4MA8H 3TWCL 3BP5A 5EO0A 1UD2A 3B34A 2Y5TA 4X8CA 1R3JB 2A77L 3GK8H 3LS5H 5E2VH 3UZEC 3DOSA 4AXWB 1CXKA 4NWTL 5HGAB 4L37A 3ULVF 4QHMA 2K0RA 3PP4L 1LXMA 1SHXA 3NZ8A 3G6JA 4PLJD 1OARL 1AFVH 4Z18A 1PX8A 1DJHA 3L1FA 5HPMA 3RUGB 4BEIA 4EMZA 4DK6A 4L4VA 2XJKA 3DETD 1JGDB 1MHPH 5D7IB 2X4RB 1CFMA 2FX9L 4XPGH 4G7YL 4LARL 4WW1B 3ZZ1A 3SZKC 3KPRB 2QKSA 3LRHA 1JGIA 1PU0A 2XXCB 5JR1H 4XAWL 2DMBA 3C08L 1RSFA 3M86A 3JWNC 4PJFA 4GW4A 1V54B 1KYOJ 2H6PB 3LKSA 5AVUB 3VD7A 5D7JD 4ZFOA 4HVBA 5CJOH 2NSQA 1BXVA 3VFMA 1ED3A 3KYMA 3RFZB 3B6SA 2CIKA 3VXRB 4L8CA 4LMQI 3FO1B 3HZYB 4GNKB 3P4MA 2EIDA 4AH2B 5GZNA 3HZKB 1G43A 1GMIA 3UG5A 1OPGL 5LXGH 3EYSL 4X7SH 2W91A 4U6YA 3VE0B 5KN5B 3MNWB 1Y18A 3OKDA 4PV9A 3BXNB 5I30H 4P2RB 4E0RB 2QPEB 4NXKA 1WUZA 1H15A 1X5GA 2HFEA 2XT1B 1YNLL 4QHLB 3ZL4L 5FOBB 1CGXA 3SJVB 1YC7A 4QRSB 1T04B 3GZKA 3HE7C 5T5NG 4X6BB 3SE8H 5F3BA 1VENA 1AD0B 1T0NA 3WFBH 4X4XA 3EJQA 4AYMC 3ZBMA 3V7MA 2YD6A 1MY7A 2O5ZL 2R2HB 1ANUA 4WHTA 4EN3C 2OAAA 3D06A 4YR6A 5TDOA 2JWYA 4CSPA 1D5RA 3DIDA 3RWCB 2ROYA 3BSZL 4APXA 3DV6B 3WY2A 2NUTA 3V5HB 5JHBA 2DM2A 4XCNA 4PRBA 3UCQA 2VTFA 2DQGL 4XZ4A 1JZ3A 3VFOB 3EYVB 5KW9L 4QXTB 1X7SA 2QZ5A 2OCFD 3CN1A 4TRPH 2ZUWA 3VXMD 3KXFB 1B9KA 4I0PB 1TZ8A 1MIEL 2GT9B 1PAZA 1BQSA 2O61A 4HK3J 1G5AA 3ECBA 5CLZA 2DD8L 1NCDL 4I89A 1BQHB 3Q44A 3MNZA 4ELMA 4X8JB 5FM5M 3B1TA 1BJ1H 2GJ6E 2FBJL 1VCBC 3WUWA 1PLGH 4PGCA 1E6JH 5AW3B 5CMAA 4AG4L 1GH7A 1OSPL 4O02B 3RIFF 5KG9A 4D9LH 3GKZA 4TQIA 2R8SL 4XN8A 5HP5A 3CFTA 1PY0A 2VLRD 3IJYB 5MI0C 2V7HA 2GTZB 4HWBH 4J3OC 5AYTA 2VXSH 3WTXA 3DJTA 5FS5A 2VXTH 1MJ8H 4Y19A 3U6XS 1CD8A 3CZNA 4XGZA 3BT0A 4DN3H 3QIBA 1PD0A 2Q86A 1U3NA 3VI3B 2MCPL 1AP2A 1DE4B 3F8UB 1B4JL 5LB1A 1XD0A 3JVGC 4N2EA 3G9AB 4LEXL 2FJFA 2EDEA 5FW6A 1TQCC 5CZRA 5HDBE 2X3BA 1QBLL 4AZ8B 2ZUQC 3S34H 1AZZC 5K59F 5AAPA 4JFDB 1IAIH 4WTXA 3AROA 4JFEB 3F7LA 5CO1A 1NBYB 2I5YH 4HIXL 4LHJB 1F3JB 4TOYL 5EUOA 1CFVL 1RXLA 1A9EB 1J0JA 1A6VH 4R4FH 4AM0A 1AI1L 3K46A 4HZAA 3EG9B 2DTSA 5D1XA 3U2SA 2ICWB 2EIKB 1ZWIA 3B2MA 3VXSE 2CGRL 3S37X 4YSOA 2VUOA 2ZE0A 3EOAB 4K9JA 3W11C 3EDEA 3DRTB 3PGDB 4L0YA 2NXZB 3QNYB 2EC9T 1FFOA 4G8FA 4N8VA 1MEXH 1WBYB 4DZBB 4R7LA 1B9ZA 1JZJA 2A73B 4OLVL 4OF0A 3GXMA 4P2OB 3RNQA 3PWJA 3SPCA 1EERB 3FUMA 3NA9H 3L3IA 4XNQA 4Y4HA 2JJTA 1CXIA 3RL1B 4XODA 1T7YA 3T3PE 2Z4QB 4XWGH 3BMVA 1JXJA 3CC5A 1UD6A 4D0CB 4FADA 5DFWH 2YWZA 3QIWD 4AKQA 5FYJL 3M17B 1KGUA 2DMKA 4C56D 3F00A 4TTGA 4NQEB 4LLWA 3CSYA 2EIZB 1NLBH 3MGOB 2RCSL 4L3CB 5J6GB 5E4AA 3POCA 2VRKA 1ZLEA 1NC2A 1JHTA 2BX5A 5FM5O 3QAZB 2WBJB 4GRLB 4PY7B 2F5BH 1QSFB 3T8MA 3NYKA 3OX8B 1AYOA 4B9PA 3B9EA 3C09B 3BUPA 4KKRA 4K73A 2HFTA 5I6LA 1BG1A 3AREB 3BCFA 4F7PB 4X5RA 1H3TA 1S9VB 4KO9A 2LU7A 4RGMB 2BPBA 3QWRA 4JPIB 4W70A 1J5OH 1D2OA 3OTTA 1UB6A 4UQ2B 2EDMA 3RU8H 3CMOH 2P46B 3EGDB 3QARA 4HCRL 1F4AA 3UJJH 2Y1AA 3LKQA 3DX4A 3NOIA 2A1WL 4LCIL 5F7UA 1OGAE 4HOZA 1QLFB 2YAHA 4EIGB 3FSWA 4WUKL 1P4IL 1P2CA 4MYWB 3RE0A 3CHOA 1XSKA 2DQIH 3POHA 4JPKL 4OGZA 4P59L 5F3HA 3MGTA 4G80A 2WK2A 1AKJA 2FJGB 1DVUA 2WOBA 1ADQH 5T1DL 5HYQA 1BZ9A 3BT2L 4M6ML 1D5MA 2I9TA 3PNRB 3QO0B 3P9LB 3JWDC 1N64L 2W9LA 4X42A 5K9OA 4JGNA 2G9HB 3LZPA 2A2QT 3UL4A 4IRJB 5EH1A 1T21A 1BQ5A 5EZJB 1JZEA 3D52A 1HINL 2E27L 3L2MA 3ULVE 2VXUL 3BPNB 4HHGA 1JVKA 1RKRA 2R27A 1QFWM 4G8IA 4XXWA 5HGDA 3WKNA 4HEMA 4WSKA 4OV5A 1J0IA 3RY5A 5JTWA 2CSPA 1T1XB 4TQEH 2DW5A 2NY6D 3FZUD 2V5MA 1I1AA 3QC6X 3PXHA 4HGKC 4J3OF 3WELA 3SQBB 3QS2A 1LD9A 1EEYB 2JK5B 3LEVH 1E8ZA 4HOWA 4LIQE 3GO1H 3BDYL 5FO7A 1U6AL 4GI9A 5E7BA 4D94A 5BZWA 4Z3IA 3P02A 3UIZA 2IV9A 2XVBA 1UB5A 3P30H 4QHKI 4XB7A 1ETJA 5D2NB 5C0AD 2HLFD 5GGTL 1B3IA 3GB7B 3EH2A 2R2EA 3ZMNA 1NCAH 3SKJH 3LQZA 2HAZA 3IDIB 5KSUA 2AQNA 3BH9A 2IGLA 2A6JB 4N2CA 4ODHH 2NY2D 3SE9H 2CBOA 3NH7L 2VDML 1XGRA 2DQCH 2VXQH 2ZXWB 2IGFH 3ALPA 4CU8A 3MI6A 3HB3C 3MODH 4JL1A 4FI6A 1T5XB 1G7JB 2ED9A 3BOVA 3VW3H 3KBEA 5AKTA 1HKLH 4DVRH 1D3CA 4BV1A 5CSBA 1K3IA 1OM3L 1WRFA 1QWUA 3FU9A 4OSUL 2WB1A 3CH1B 4MAYC 1OLLA 3PWLA 3AJ7A 5GGRB 3LXAA 4WFHE 2P48B 3U2JA 1KJMB 4KX8A 1X4ZA 1CR9H 3SCMD 4HDIA 2NCMA 4F1SA 4LLUA 3BQUA 4YBLC 3TTSA 3IPEA 1KEGL 5AUMA 1MY5A 2FECL 4OLZH 1DSFL 5C0FB 3QDMD 3RPIA 5CCJA 3CN4A 5HHQA 3TV3H 4PAZA 3TA3B 4NO2A 4QMEA 2GTWB 2XFXB 4NZ8A 4PJEB 1E3XA 2R29H 4UQIM 5DMJB 1E5BA 5C6TH 3ZKQD 3QZOA 2JKLA 2IANA 4PRID 2QJDA 4OZGF 1VLXA 1WZKA 2YQBA 3T9WA 1EMTL 4APQB 4JFFB 4QRUB 1P5VA 2YN5A 3LMJL 4CRPA 1CGSL 4XP6H 2XRAH 4LFHD 1RZIB 4L5FE 5F71A 3W9EB 4FRWA 1ZKAA 4BFGA 1OTUC 4A2MA 1XF2B 5IV2B 3FC8A 3ZPDA 1KJ2L 5AOIA 5IFJA 2CRZA 4X6CA 2CIIB 3UP1A 1QA9A 4NC1C 5EBWA 1GGBH 1RJLB 4ABUA 4PM1A 2A9DA 4JDEB 3A6BL 5EUKB 4ZMZA 2XN9B 2HUEA 5AVYB 3O41A 5LCVA 2H1LM 2WIMA 4PJHB 1QFWI 3S48A 1EHLL 2HFFB 1JYWA 1ZVNA 1QSZA 4NI3A 2WVVA 4C54A 5CFHA 3I74A 1I3RA 4MDJA 1T4KB 5E2UL 1U8MB 3MUY1 4PWEA 5DRNA 3S5YA 5K59E 5KSVB 4JS7A 1HVXA 5CINH 5KVGE 1TNNA 4IU2B 3GMQA 4MXWH 2VN7A 2GCYA 4G9FA 3VWKA 1O7SA 4PEEA 3B83A 2YPLB 3MRIB 2P8PB 1EEZB 2W65A 4FL4C 2IXQB 3SKMA 5A6LA 4AOFA 3AS1A 5KBKA 1FNEA 3TO4B 4YUEL 5AW5B 3GBEA 3M1CA 1B2WL 4P4KC 2ADJB 5C6PB 5AVTB 2DMHA 3Q9QA 1S9WB 4NDMA 3VGAB 2HFGL 1MREL 4N25A 1AIZA 4XOAA 1SDAB 4NUJA 4FA8A 5ADPL 5I18L 3DYOA 1TKWA 1N9PA 1MJJB 2HUHA 2IH1B 3JWNE 2FX7L 4JHVA 3V0JA 2IG2L 5B7MA 2IO5A 1NSNH 2N01B 4JRYB 4MJIA 2J25A 3S37L 1B3JA 1JFQL 2Y6SC 5E4IA 2E7LC 2X6AA 5IQ9B 1W16A 5B39G 2VDMB 2VLME 5KTEL 2GUYA 3WCYA 4JM4L 4DEPB 1DL7L 4NQXB 1Y1UA 3TEXA 2HXAA 1C08A 4M93C 1F4HA 1CF8H 5JOPD 1F11B 4PG9B 3CVHA 3PQYA 2P5EA 4L1SA 5DJCB 3RDTA 5JIQA 3L81A 2YWYA 2VABA 1N10A 3OMIB 2MRYA 4YXKH 5IMOA 2B3RA 1FLRL 2FR4B 5IUSA 1FYTE 2I25N 2Y3NA 1BW8A 3HI5H 4JFOB 5HHOD 4QLRA 1X5AA 2DIBA 4ZODA 5CJBA 3DUSA 4L2LA 1X5FA 2XTJB 4RAHA 5CILL 3HE6C 2Y1ZA 2PYEE 1MCOL 1WT5A 4ZO6A 5ESVA 1BYNA 4NN7B 4NYLB 1KIRB 2BSTB 1T5WA 3BKMH 3OKMA 4R90H 3MRLA 3ARFC 2ZPKL 3IB4A 1A2YB 4OZ4B 3IMTA 1NUGA 5CU5A 1O7DC 1AGCB 1AZBA 4KGJA 1WFTA 1PIFA 1U8JA 2XWTB 4NKMB 5ILTH 4OB5H 5T1LD 1N6UA 3MJWA 1WIOA 3MRPB 4GLRH 4KXZH 4MVBC 3TVMC 3VFNA 2CMRL 4Y2OB 2C9UA 2J2ZB 5BS0B 4HD9A 3GGWA 4QJ4B 1Z5YD 3P3RA 2ERJC 4PP1C 5SWZB 3AWFA 1MW1A 2BHFA 3QPKA 4M1CC 2Z65C 1I1YA 1I82A 5JDJA 3AABA 4A2GA 4EBQH 1KXVA 1KFGA 2JXMA 4FLSA 2BIQA 4CMHB 3FQUB 5LO7A 3T65A 5IMLB 5SX5K 5BRZD 3VDAA 2XIBA 5DD6A 2DQMA 4Y4FB 4IOIB 2QPDB 3MNDA 4X8GA 1YUHA 1ETB1 5TFSL 3OKOB 2FYYA 3NEEA 2LR4A 2WANA 2WZ0A 4ZFOL 3FSOA 4NRYA 4YE0A 4WI8A 3FQWA 3OKNA 1HNGA 3H3PH 4FG6D 4KROC 2MFNA 2UXFA 1PG7H 2J4WH 3CSPA 1Z9OA 5JIPA 3ABGA 1BQLH 2YRLA 4N3TA 1VPOH 1RY7B 4OLWL 4TLUA 4IRSA 8FABA 3GSVB 2DBLL 3TS8A 1QEWB 2YMTA 4JO5A 2ICWI 3IMUA 2OYMA 4R0LA 4BUQA 1U91B 2OZNA 1A7QH 1UA3A 3D18B 2ZAIA 3GS7A 4WO4C 5J1AA 2Y1YA 4B60A 2WXRA 3IMBA 1DUYB 3EJJX 4XMLH 5I1IL 1ZGLP 2CUAA 2GIXA 3BAJA 2RQEA 3MBEA 4ZS7H 1AOZA 1OLZA 5D2LF 5F96H 3FRUB 3QGVA 2OMVA 3DSNB 3VD5A 2HMIC 1BPVA 3HG4A 2CNZA 4W9GC 1ZPLA 5IK3B 1F6AB 1JYXA 3RUGA 1FPTH 1DBAH 1GYCA 1IGTB 2FHBA 3WIIL 1DQLL 2HA1A 1CQKA 3FO0H 1AS8A 3MOAL 4L1BA 4OCNC 3WU1A 3FTSA 3FB8A 3VFRB 4HAGA 1MFAL 1GPOH 1J12A 3WXVL 1GAFH 3FQRB 3I6GB 2FSEA 4QRRB 4R2GB 4X5WB 4HH9B 4BYHA 4TYUA 4L1HA 5JNYA 1J48A 3G3LA 1HEZB 3HI6L 5I0ZA 4OGAD 5CJ8A 2OI9C 5BO1L 4FCAA 1M3JA 3PAVA 4I0PD 5DFAA 2BIIA 4IOFC 4W9CC 3V0IA 4BFIB 4FTVD 4LNRB 4KY2A 3RHWF 5IEKB 2X9WA 3RFZA 2XICA 3BZ5A 1FBIL 3RIAF 2VGLM 1ZV9A 4BKTC 1TVHB 3RVWC 3RQ3A 2FJHA 3WD5L 3S5LG 1QR1A 1L9OA 3PWPE 1DQJB 3B7YA 3MRJB 4U1SA 4AVHA 3APDA 2DYRB 3BN9D 3MV9E 3LZLA 5IJDC 1KC5H 2Z8WC 1NCNA 1QPKA 1IAKB 4XCYB 1KCVH 3TH4T 1NAMA 2C9XA 1PSKL 1RV6X 5D6DC 3DIFA 1ZT7B 3NGBB 5D1QB 2FO4A 3MMEA 2DEYX 3DX1A 4OZGE 4KTYA 3GTVA 1I7RB 2BLFA 4MA7H 2UV3A 1N5YL 1CGYA 3SJVA 3LH2H 2BNUB 2J72A 1OCRB 5LG6A 2C3GA 4NUMA 1CXLA 5I82A 2V2TA 4R7XA 1NGQL 4POZC 3UC0L 1XIWB 2DS4A 5T3XH 4QT5A 5DVKA 4LGSB 5EG6C 3OF6D 2V9TA 3T1FB 5E56A 2F1AA 4EE2A 1UWEH 3E8VA 5C0CE 1O0VA 3VWJC 4RISH 4L18A 5GS0L 3FTWA 1IBFA 2IOOA 4DOHE 2KLRA 5I15H 1J05B 3J27A 4JFED 2DQTH 1Z3RA 3QZBA 5DK0A 3IXTA 1CIUA 5E8DL 3IMWA 1K85A 1D5BB 5GSRB 2B4CC 1L5GB 5E0FA 5D8JL 5AB0A 3TIDB 1R17A 1CIDA 4RZKA 1OGTB 1RD6A 4RSYA 3RGVD 3KDPB 3HR5B 4F8PA 5F89B 2FEJA 5D5MA 4OQ1A 4N8UA 1KGXA 1TJXA 4HLEA 1FNGA 1UM5L 1AC0A 2P80A 2VDQH 2GFBB 3FCSB 3VO0A 3W0WB 3IJ7A 1FVEB 2NMSA 1DBJL 1ODAA 4TTDC 1LGVA 4UV4H 4WJKB 3LSOB 1UACH 2BCKB 2H3NB 1J9CT 4I48B 2CRYA 3D25B 4QXGH 4M5SA 2D0GA 4N28A 4NJAH 5DSCB 2Q5BA 2WLYA 4U3HA 4G71B 4JM0A 3CXFA 4EIZC 4U7MA 1F58L 2WUCH 4N0FA 1EXUA 4KTDL 3AADB 3ZYIA 4OJDH 4Y16B 1UOLA 4M1DL 4CU7A 3CSGA 1UG9A 3B5HA 3L3OC 4WK2B 2FATH 2GJZA 5IG7A 1UKTA 2VL4A 1G7LA 5B39A 4GMSL 3AG4B 3I02B 4IGBD 2ALWA 4Z78A 5A2LH 2BRRL 1KGIA 4J4PA 2E7BA 2F19L 2HRGA 5ACZB 4P5TD 2BP5M 4PS7A 2AXFA 1TIUA 4F7MB 3VG9C 4HF5L 3QZWB 5ALBL 5IQNA 3LD8B 2EABA 1WC7A 4NWUL 3PJSA 5CM1A 4LP5A 5F88A 1OF0A 4ENED 5GZOD 3ARED 1PYWB 2APSA 25C8H 5I75B 1RIVH 3NCEB 5E6ZA 2G4EA 3IFOB 4QWWC 4RRPG 2ITCB 4P3CH 5FKAA 4ANKA 2ICEA 1R47A 5IQ7H 2OQJB 4BH7A 2N7SA 3O9WC 5D72L 4XP4H 4J3UA 5DZLA 5JLZA 3PXJA 1RZKC 4GQ9L 1A4JB 3ABLB 2JJSC 2HKAA 5DURD 5DRWB 3JTBA 5IJCC 3MLWL 1BQRA 1DANU 3ZTJG 4ZK8A 1GIGH 3LEXB 1N3NA 4DKTA 4XXCC 1W0VA 2Q3XA 4PP2A 2QPUA 3RL1A 4NP4L 3WS6A 3H9HB 4X9IA 1JV5B 3P9MA 2AJVL 4AQEA 5E9DE 3TPUA 2J71A 1OSZA 3KJ4B 1YHPA 4LOFA 2JKSA 4QF1A 3HRPA 1M9SA 2EH7L 2VN3A 5DUMH 3ECWA 2K9FB 3SO3B 3MCLH 4HPHA 4UIKH 3C6SB 3LY6A 5DK2B 3WNJA 1KT2A 3GHEH 3HNVL 1CXEA 4QY8B 4Z7WF 3HUJA 5DZ9A 3ESMA 4XZUA 4B41A 3NACL 1SNRA 4GRLA 1MCLA 3R8BB 5BXFA 1QSFA 2MQ0A 3LZFL 4YSTA 1EDQA 4A38A 1W9XA 5I6XC 2VAAB 3IGFA 4G1EB 3REWA 4Q9RL 1RK0A 1PKQA 2EUVA 1VZGA 1JPFA 3PF2A 1KN4L 2XOTA 4G1MA 1NBZB 4MMZA 1F41A 3SOBH 2AABL 1OANA 1OO2A 3CVCA 3NRQA 1GOHA 4JPIA 3L5JA 2VO8A 3UC2A 1JYNA 2Y5EA 3MJ8B 5H4ZA 5IF0B 1MCDA 4B0MB 1UFGA 4L3AA 4F2MA 5KSAA 3O6KL 1F3RB 3Q5YA 1T66D 4FNLL 4DW2H 4NC1E 5ID0A 3QG6B 1BAWA 2DQEL 4KI5D 2A0LD 2QKIC 2CKNA 4H8WC 2LVCA 8CGTA 1T83A 2DH2A 1V7ML 4Y4KA 2XYCA 2JJWA 4O58H 5DJZB 1KBGH 1TTFA 3AS3A 3F7RA 3FUJA 3G6DH 2B0SL 1UD4A 4TUKH 2BSED 4JRXD 1FGNH 5DS8B 2OMNA 5C0GB 5C0RL 3RTQB 3MRGA 3S35X 1U8PB 4NQSB 5F1NB 2NZIA 3FONB 4AGMA 1EVUA 1CBJA 5JIKA 3ZZQA 1TYEB 1MQ8A 4K94H 1K3ZA 3FN3A 3KH4A 4L8DA 4TULH 1IC7H 1WO2A 3EO9H 1NGWA 4FXTA 2J21A 4JO4H 2XXMB 2FX8L 1IM3B 4LHUB 4XNZC 4BKLB 4L9LA 4WFGD 5E7FA 1QRND 1PTZA 1CU4L 3FQ4A 4LBAA 5I73C 2DLGA 1IO4C 3CFMA 4ODVL 2X1QA 3TT1L 4Q9QL 2VMFA 4KUZL 2BP8B 5D7SL 2MCG1 5E1IA 4MNGA 4POUB 1KCUL 4Q9CA 1M9WA 2A6KB 4KTGA 3VSVA 5F6IB 3VFGH 3LNGA 2GJ6B 5HGHA 2OM5A 1EFXA 3OPUA 4Z7UB 3EH4B 3S5LA 4H0IA 3ULUF 3QXVA 4XPBL 2ZONA 3HHSB 2UY6A 2FO1A 1XB6A 1RZJC 3DX8A 2FCBA 3VTAA 3GSOA 3ZUCA 3LKPA 1P5UA 3KEDA 4JFFD 5IVNA 3NG5A 3D6GA 1UQSB 2D7PA 5F7AA 4LXFA 5L7XH 4F37F 3INUL 3MRNB 5CCGE 2G5BB 5E6IC 5FPIA 4FQLH 3GMLA 4X5XB 5TE4H 1WWWX 3U2IA 1MF2H 4HBCH 3X1EA 1NCTA 2HH0H 4LIQL 4XO5A 4XTRC 1UXMA 4OUUA 4H1LH 4P48A 4X6EB 4F27A 2J6EA 3Q7JA 4OZFB 2G60H 1VERA 2J5LB 5HDBB 1NANH 5LCVL 1PLCA 1ZLUH 4YXHH 4TQ8A 1U95B 3E0GA 3VM7A 4BQ8A 1I8MA 4JZJB 4E9RA 3F7VA 1MCWM 2AV7B 3PHQB 1RQ5A 3QW9A 4YNYB 3MV8E 2BCMA 4M7JH 1JPSH 3R06A 3NRPA 2CA3A 5GGRA 4LPXA 3OR6B 4KDWA 5BQ7A 2IPKA 1O7DE 2UWEA 5H37G 2WKOF 4N3UA 1EZVX 2VDLH 1YVLA 3VXSB 3CN0A 2X89A 4XCEB 8PAZA 2ZX8A 1Q9OB 3ZKXB 2JLPA 1EFQA 4FQQA 3TFKD 2VQ1B 4XH2B 3HEIB 1CJYA 1RMFH 2YPLD 5LAXA 1U8HB 2FIKB 1EBAA 3IDJA 1YEJH 3KM2A 3O45B 1JWUA 4PJEA 5E8NB 3JWOH 3K6FA 2NR6C 1LE5A 3T3PB 3KNBB 4OFVA 3U79A 5L2JB 4YC2B 1SVZA 4YXLL 3KBFA 1JGUL 5J3HD 4OKVA 1U4EA 3HMWH 5FV1L 3DHPA 4PJAA 2WSDA 3THML 1MIMH 3RY6C 1BJ8A 3SY0A 5I23A 4Q0XH 1QRKA 2CCVA 2CIIA 1MCPL 2CO4A 3AB0C 3GHBL 1JK8B 3Q13A 4OGYL 1KNOB 2Y07L 1XQ4A 3SKUD 1S7RB 3V8OA 5DJ2A 5JW5A 3UYPA 4R7NA 5T1MB 2XN9A 3BRGC 3U7YL 3LN5B 1SYVB 2CNYA 3WO4B 2HJKB 4LSTL 3H0TA 3CFDB 2YUZA 3HTLX 4GSDH 2Y7QA 5AZ2H 1JDCA 1NGXB 1ROCA 4K8RH 2AI0H 2NZ1A 4FQXB 3U7AA 1A66A 5ABDE 2YSTA 4NZRH 4U1GB 2C4XA 3SBPA 5TDPA 3KYKH 4P2QE 4RRPA 3RWGA 4L5FL 2IWKA 1IEAA 4GUOA 3OLDA 4U4IA 5I76A 2R51A 2C34A 2HRPL 2LAAA 2E0PA 5AYUL 2WZ6A 2P8MA 3N91A 3OJDA 1IGYA 2XQYG 2XV0A 3D85B 3FULA 3CLEL 4EDWH 4A2EA 1LEKA 1OGAB 4LLVA 4DGUA 3MACL 1I1FA 2HJLA 1ZATA 1U2YA 4G8GA 4KO5A 1S7QB 1DVZA 3CTTA 4XP5H 1URLA 3K6SA 2EO9A 1P4LA 4LSUH 1CTOA 4DN4L 5MENA 3SBQA 5JIMA 1KIPB 5KS9F 2C7FA 4A6YA 2EEDA 2ZOLB 1B4LA 2Q7YA 2ADJA 2G75B 4A2DA 5J5EA 4GXVL 3QDGA 5HHPB 1FL5A 1VGEH 2XZCH 3QJOA 4N2LA 3CSTA 5E00B 3WNPA 3QQ3A 2VSDA 2IH1A 2NW2A 5CAYB 5KVGL 3ECUA 1A4KB 2IAMD 2ZNXA 3O3EB 4GXFA 1HCYA 2J88L 4ODXB 1XVSA 4FABL 3HZVB 3H42L 4IIQA 3DHUA 1W8OA 2AAAA 4CVZA 4JQIA 2XQBL 4LEEA 2WB7A 4ZAKB 2JH2A 1L3WA 1MCWW 2Z31C 2DMCA 3ME0A 4TVSa 5CZVH 4OLXH 2WN3A 3DC0A 2NNXA 5I9QB 3O6FA 4RBPH 4DPCX 1XF5A 1IM9B 4KHTH 4Z7WE 1WEJH 2A6IB 4QXUL 3M1BA 5EOCH 5SWSA 5AENA 5CBEA 5CD3A 1VA9A 3ROLB 4J39A 3T4AB 3DPDA 3HI1B 4E41E 2VIRA 4F3FB 1THCA 4DVBA 3ELQA 4DUVA 2AXGB 5HDQH 2P5PA 4F7EB 3BUDA 1UZ6F 1NAMH 2VLJA 1BFTA 1CWVA 4NO5A 3RB7A 1UZ8A 3ZX1A 5I8CB 5LBSL 4KMLB 4E5XG 1BX2B 4LBEA 1F13A 4XXDB 3LB6C 4GI8A 3HG1D 1S7VB 4Y7OC 4AQ1C 2A9MH 1E28B 2XWTA 2WKGA 3AS2A 2QQNH 5H8DA 1PQZA 1Q9LB 2ZWSA 2YJLA 3BVVA 5TQ2H 1QASA 3MRDA 4JN2B 4W9JC 1TZGH 2WLLB 1DCEA 3TWYA 5CIPB 5HDOA 2Y7NA 3FAXA 1BZOA 4KJQD 1WFOA 1QP1A 3ARDD 2BNRD 1FG2A 1Z66A 2A74B 4U4BA 5CF3A 5T3ZE 1RIUH 1N70A 1SMAA 3BAIA 3GF8A 3BP7B 3HNTL 2B8OT 3A6CL 4QRRD 4S0SD 3MXVL 1XO8A 1Y6MR 2R0KL 4B9FA 4WIQA 3U9PH 3NJFA 12E8L 4D7PA 4YLQT 5ESAA 7PAZA 3SDDC 1RP8A 2FB4L 3S35L 3PJNA 3ARSA 4RGOH 5CLXA 3ENEA 5IGXL 3K2MC 3UACA 1UEMA 3KWWA 3A23A 3QQ4B 4OQTA 3RWJA 4R7DB 4NT6B 4O02H 3TIEB 5AW1B 2PO6C 2BVQB 3TT3L 4H88L 2XKNA 5EC1B 2H47C 1L9QA 1M7DA 1LNUB 4OBRA 3SYCA 2YAMA 3TPKA 3L1EA 1UWXH 5EO9B 3QUKA 5D7LE 5DMKB 5JYMA 3ESNA 2B2XL 2ATKB 3QHFH 3OVUB 4J23A 4Z9KB 4ZDHA 4KRMB 1CLYH 3BWSA 3O8XC 4FNRA 1QFUL 3MXWL 4HKXA 4KKCD 1U8OA 4J3XA 1I85A 2WUBL 3GI9H 3K4DA 4XCFH 5FYKE 5E4OA 1T1WB 1CXHA 5DMIL 3ASOB 4NO0B 3UROR 1VFBB 3EFDH 4GKOA 1FSKC 3QWOB 2NXYC 3V7AE 4AYEC 1DZ0A 3ARGC 1ETZB 2AJUL 4WNQB 1KLFB 3ESUF 3UTPE 1TMCB 1SGKA 2DLFL 1JZ8A 3TYFA 3CFNA 4HC1A 3GBNL 2JI1A 4KRPC 1P4BL 2XG4B 2QADD 4HJTA 1BXAA 4R5VA 4X5WA 4HH9A 3ILQD 4ZUTA 1ZGLB 4UDUB 4ABVA 2XWDA 3P4NA 5H37A 1YY8B 4WGKA 3GRWA 3R7QA 2VERA 3BGMA 4L4VD 1CE6A 5EOCJ 5HYJE 3ML9A 5DLML 5GGRY 1BLNB 2F15A 4UCFA 3TOPA 1LK3H 4LNRA 4LL4A 3AU0A 3LAFA 1FVDA 1NGYB 3CFKB 5FM4A 1AQKH 4W9FC 2RJMA 1JNLL 2HPTA 3X1FA 4NNPL 4ZTPL 5HGBB 4FEIA 3MJ9L 4ZS6D 4HS8L 1JGLH 1GCYA 4KXDA 3T8XB 4G59C 4GQRA 5KYYA 1DQML 1CPUA 3BEWB 2Q2EB 3WTSA 4ZQKA 3QUZC 3NN8A 4Y8DC 1JS4A 4YWGH 4GT0A 1L3NA 2WXJA 3PGCB 4D8PB 1J9SA 5DD0L 3B9AA 3GSNA 1TTBA 3FYEB 5GSVA 1TQUA 4AQ8A 3EYQD 1ASQA 2O6EA 4NEHB 2BNUA 4YL4A 3KLKA 1F90L 1MCJA 3BISA 1YN6B 4C58B 3LTVA 3SDCC 3IFLL 1BFSA 2F54B 3ZDWA 5JW4N 1KJVB 2BXZA 2JF1A 3K2IA 4LO9A 5FYLE 2JTDA 4G3YL 4OAWA 4XBGA 3T1FA 4ZMLA 1KTBA 2H5UA 4AQOA 1SJHA 3MREB 1KBKA 1KIUA 1E4JA 1S7TB 4XMWA 4BE6A 2EADA 1VFOA 2OW6A 1F6FB 2APTA 3UDWA 1FYTB 1QNZH 3GI8L 4HHWA 2OP4H 1OAUH 5FM8A 4MD5A 2WBXA 4JKPH 4BCZA 3HE7B 4D0BA 1TCRB 2PYEB 3GLZA 3MO1A 2BH0A 1T03H 1A25A 2YGQA 4Q89A 2XQYA 3A0OA 1J8HE 4WSGA 2WO3B 4S1RL 1OGTA 4B96A 4EVNB 5EU4B 3TM6A 4I9WE 4EN3B 3L3KB 5IKCB 3BKYL 5F89A 3EHBC 2IOIA 1U92B 3L3HA 4OGXH 3TXAA 5L8KB 1WE5A 3EW3B 4YO0A 3RLSA 5I1CH 1KEGH 1ZVHA 4Y89A 4JM2D 3OB8A 1PLAA 4MXQD 1QKZH 4GAYA 2L3BA 1CDHA 1TO4A 5FA4B 2I32A 3DMMC 2YD5A 1D6VH 1OAJA 4PWFA 3LSOA 3DTXB 1CLZL 3NJXA 2MQGA 1LEIB 1QFHA 5KS9E 4YHKH 2AMGA 3B3IB 3MV11 1FF5A 5AVSB 3MU3A 1T0OA 4ZUVA 4W6WB 4FZEH 3MBWB 3EDKA 3F2LA 4ODWB 2HLEB 2O6PA 4NSKA 4P07A 2F58L 3DJZA 2J8OA 4YHLH 6TAAA 2VDKL 2R56H 5D7KE 4I5BA 2OBGA 1RLBA 4Y19D 5ACZA 1WSST 2UZYB 1FL3A 3E3QE 4Q8BA 4QTHB 3C12A 5MI0B 3SBRA 5JHMA 4JVPA 2DEXX 3QIBD 3HR6A 3V0DA 5FGCE 3H6JA 3ZDXF 3UTSE 3S5ZA 3P0VH 1P84J 1MRCL 3NABH 4HXBH 2ICWJ 4MZ2A 1W72B 4LKXA 4PREA 2BXYA 4K5PA 3P11H 1FDLH 4N5ED 1H3PH 4FQHB 2Q76A 2IDCA 2ITCA 4UBDD 1A6UL 5DR5H 2ADIA 2WXHA 4W4OA 2H2SD 5ANMB 5A3ID 2YA2A 3MV7E 3BDBA 4LRNL 2F61A 3BHBA 3GMNA 4IBYA 1INEL 4IBTA 5E4EC 4AE0A 2DM4A 4EXPX 5EIVA 3TO2B 5F7KC 4G5ZH 5GS0D 2Z6FA 4HX1B 4ONGL 5IHUH 1TQCB 5INDA 2OXGA 2ZUQB 1ET7A 3GXNA 5HHVL 4DWHA 4E5XA 5EU3A 1XGUA 4Y9EA 3NBNA 4U6HB 1M6UA 1UZ6E 5D1XD 4YE4H 1EHNA 1WZ1H 1TVDA 2PCFA 3LYRA 1DBKL 1QABA 3UBGA 1JK9A 2VLKA 4LZHA 1EJ6A 3WGUB 3WIHL 2DWXA 4ONHA 2J6EH 2V5RA 3KL0A 5L2KA 1VZHA 3RTQD 5CGMA 2VE6B 1EA9C 1G9NC 4I13B 4LPUA 3IF1A 4BZ1L 4X80H 3WGVB 4KU1A 2X2YA 1YN7A 4MB5A 4JFXB 4Y4HD 4JO1L 5CEZL 4G7RB 4MTMA 4HKZA 4J8QA 1LO0H 1WP6A 4JG0H 2EE0A 2LFEA 4PGBA 5TF1H 3KGSA 3LRSB 1SBBA 5CHNB 1F56A 4YPGB 3S36H 5A16A 1HILB 4ZQTA 1ORSB 1S78D 2IQAA 3S3BB 4IBWA 1FHGA 4GG8B 3VB8A 1K6QL 4XPHH 2WLIA 3LN9A 1CUOA 4DESA 4G6JL 4YFDB 2ATAA 3US1A 1DQDH 2WTRA 1CYWA 1NMBH 2B5IC 5D9SA 1GHFH 1DVYA 3PWPB 3TCLA 1NC2D 5B1JA 4KFMA 4Z7QF 1MFEH 4Q58C 4TUOA 4UM9A 5D71H 4L1TA 3EDDA 5DD1L 3MV9B 3IS0X 2KI6A 5IF0A 1T1YB 5J57B 4DP1X 3BYTA 3G5VA 4TNEA 3Q1EA 2ODIA 2PYFA 4XPFL 2EYTB 2IH9A 4RH4A 5I17B 1H19A 2EKSB 5FA3B 3W3BA 4BD4A 1F4WH 4OZGB 3NJGA 5DJ8B 7TAAA 2BVOA 5C08D 4X4ME 1FO0A 3KWXA 4AV5A 3T0WA 1H8NA 5DJYB 2W95A 2JFCA 4ZJ9A 1BM3H 4I77H 1DBMH 5EZIL 3V8CA 4H0GA 2E4FA 1PZSA 4ZSOA 3QNZA 5E51A 3ULAB 1GZHA 4GAGH 4H5SB 2EYSB 3WL9B 3TU6A 2OX5A 1JTPA 2OSXA 3L9BA 5C0CB 3EO1A 2FD6L 3QJZA 4DEUA 4JFPA 3ARBC 1AKJD 4HLJA 3S97C 5C8JB 4DOHB 2Q87A 4PCSA 4BSWA 5E5MB 4LHUA 1IM3A 1RL1A 1ZGLM 4EDXA 3HPJA 3K74B 1Q1JH 3ZHKA 1MFDH 3NSCA 1DEDA 4OCWH 5E8EB 3O0RH 5M94B 3E2HC 1U58B 1JUFA 3LQAC 1AQDA 5JORA 1U21A 4PLJC 2K3TA 2VDKB 4XVSL 3VH8B 5D6CA 4HWEH 4XAKE 2GJ6A 3ZT6A 2J5WA 4IS6A 5EPMA 1I1AD 2OMXA 4GG6F 4CUCA 3CK0L 4YBQD 1NTDA 5F9AC 1KXQE 5CNHA 3EBHA 3BAYA 3DETC 3HPLB 1I8KB 2OJZH 4IDLA 5EU7C 4OTXL 1I4FA 2IH3B 1F8TH 4YHMH 3A21A 1D5ZB 1NEZB 1WQVT 3QH3B 3RILA 1R1CA 2D73A 4F9PA 4WEBH 3KCWA 1ZOXA 3ARZA 4FERA 1WAAA 4OD2A 4R7VA 3VFUB 1IGFH 5CD5D 2AHIA 3Q1SH 4G9DB 4X5XA 4GKZB 3HC2A 1H6EA 4O9HL 5D7JC 3UO8B 4ALAH 4DGVL 1R9FA 2QSCH 3GZQA 3KR3L 4NO3A 1JHKH 1S7WA 3AUVA 1VESA 4GINA 1BVOA 4OZFA 2YJQA 3DVNB 3PP3K 1JZ7A 4EJ1C 1IFHH 5FW8A 1R5WA 1RVFH 3WIAA 3KBPA 1H5BA 2ZSWB 3KWUA 4YNYA 3EYFB 5C0JA 3VSTA 2RACA 2XFGB 4O2CA 1JRHH 5L6YH 3HB3B 1ZVYA 3P73B 3P2BA 5IESL 2AJXH 3U82B 3I3BA 3FB5A 5AWNH 1V3JA 3CFIC 2CHNA 4MSWB 2Q8AH 5EORL 3U1SH 1IKFH 4HP5A 5L4IA 4N5UA 5E1AB 3HS0A 1FRGH 3N44F 1W0WB 4WLCA 2QELA 2J20A 3BQUD 5L9DH 3QAQA 4MAYB 1XH3B 4A6YL 1KTCA 1AGFA 4HUUA 4P3DA 4U2ZA 2FQDA 2DPKA 2WWMC 5E9DB 5KVDH 4PUBL 4FKHA 4WWNA 3PFQA 5KAQG 5L2JA 3ZYZA 4YBLB 3F62A 1AJ7L 1QTPA 4RMQA 1MAKA 1DJGA 3WYRA 3FQNB 2WQVA 3BVUA 1F86A 2IAND 3KPQA 2CK0H 3MRRB 1TQBC 1E9PB 2H9GB 5J13C 4TVPH 1ZE3C 3FK3A 3KPLA 4XCCH 4LF3B 4JQIL 4JKLA 1S7RA 4OM0L 4KDTC 3C87A 3N85L 3QUMA 1NPJA 1ZRUA 2PXYA 4V2CB 3CFDA 1KMGA 3NJIA 1CLOH 1U8KA 4JY4A 2IADA 3TEUA 3DSFH 4UUJB 4ADIA 4OQTH 4YHOH 2XN0A 3D2TA 4FFWD 5CUSL 3RWIA 5AB9A 3GIVA 3OZ9L 3PJLA 1RUAH 3ZDXE 5ITBL 5BOPA 3IXAB 3KG5A 1CCZA 1NL0H 5LG1A 2QPSA 3MLRL 4HCIA 1OGAA 2CXGA 3NAAH 1IAOA 2VJXA 5C07A 3T0EA 3EFOB 1ORQA 2NT0A 4PRHE 3CUPA 4FG2A 4KNQA 5EC2A 1RZQA 2VW7A 1BD2A 2WZPA 3UPAA 4G9FD 3VWKD 2ZAHA 3FTUA 5K1NA 1IVTA 2G75A 4AUUA 2JKTM 1MFCH 3D9AL 4L05A 3VFSA 1TTCA 4WY7H 1OCWL 3NIDF 4O4YL 2ARJA 4HISA 5FF6B 4CVWA 1YNTF 3KPTA 4XPTL 3WJMB 5J11C 4F5CE 2D7TH 2DIEA 2HWZH 4LCWE 1JG9A 4FL4B 2QVTA 5D1ZC 1QO3A 4IK6A 1GGIL 1U8LA 4HC1H 2IGTA 4MX7B 4AJVA 5IBLD 1XR8A 3VAEA 2BFVH 1NCCH 1JNNH 2L0DA 4P4KB 3LHPH 1A9BA 3GRWH 5EOQH 3OKEB 2C3XA 4LSVL 3L4VA 5GGVY 4MJID 1A7OL 3EJTA 1TSHA 4M7LT 2F8XC 3QNXB 4CU6A 1SDDB 3I9PA 2XSKA 2Q2LA 5DMYA 1XGZA 3SBWC 1LILA 1IGIL 1WYJA 1SEQH 1DZBA 3ECQA 1LLAA 1R6VA 1MI5D 1CDCA 5FX3A 3E1F1 4X9GA 3QIWC 4L4TD 5DJ6A 1LK2A 2D0HA 2X6VA 3INOA 3CHRA 2ITDB 2L7QA 1C12A 1X4XA 4I7ZC 4N86A 3S96A 4HUVB 4F7EA 2B16A 5I1LA 2FH6A 1NFDF 2YBGA 3PQYD 3RDTD 4XVJH 4Y88A 4OFKA 4Z7QE 1CGWA 5LGYA 5EIQA 4OIIH 4M93B 4OCXL 1UA6L 3KPPA 4IHOA 3RWFB 4ZI8A 1CICA 4X2UA 2IC2A 4PB9H 5DO2D 3T08A 2HYMA 4RFEA 4XXDA 3GSNH 4UTBA 1D6EB 3AAZB 1A1MA 5CP7B 2H1PL 3LQMA 3W2DH 4PY8J 1WLHA 5EF3A 1MWOA 2EUXA 1XSIA 1C16B 4NQQA 1N5AB 3OSKA 1A7NL 2OTWA 3IYLW 3MRFB 2OMYB 2Y06H 3HE6B 2WLLA 4Z0BL 3MV8B 5CIPA 3MLSL 4QRFA 3V6FA 2X70B 4NKIH 3MFFB 3IJ8A 3PLYA 4MA3A 3WDIA 5TDNB 3MLZH 3ARFB 2HSIA 4YSEA 1J86A 2H32A 4Y5YA 1MJUL 1XDTT 4XBEH 1LDPH 3GMOA 3P2DA 5I19L 2GBVA 3TBVB 1DVXA 2WKLA 3QSKB 5TH2A 3NFNB 5IB1B 3TVMB 1BMZA 4HUWB 1RZFL 2V2XA 4UF7C 1DR9A 2DICA 3QQXA 4JFYA 3K2KA 1UA7A 2ERJB 3T6WA 3GJFB 3W9DA 4N2FA 1S5HA 1WK0A 2DY2A 2EO1A 4R8WL 1TMQA 4UNUA 1SUJA 2VQ4A 3BX7C 4Z3JA 2JCCB 2QGBA 2Z91B 3JSSA 3B37A 3N04A 4ODTL 4Q6IA 5IIEA 4NHCH 4NM4H 1T20B 5T3ZL 3CDFA 3DDFA 3DX0A 4HS6B 4GG6E 2NY6C 3ZDYF 3FZUC 1J0YA 1QEXA 3U7WL 1GJUA 4IMLB 2VZOA 1I8LA 4IRSD 4TLKA 5C3LD 1E5CA 2J6WA 4KROB 3WEXB 3GBML 4ATWA 2WYTA 1R75A 4DGYH 1C5CH 1O9WA 1VFMA 2VITA 5CJQL 1HZLA 3GMMB 1J1XL 3BLBA 1WFJA 3CFUA 4NO0A 2FZ3A 2V5YA 3K5RA 1W8EA 2HLFC 2WCSA 2OV0A 3MBED 3FJTA 2F54D 4KVNL 5I6KA 2VDNL 35C8H 1OCOB 5GRJL 2R1WA 4WO4B 1QSEA 1UXLA 1XXDC 3FO2B 3O3AA 3VQLA 2W81C 4P2QB 1A8JH 4KH2A 1PZ2A 1QHOA 3UZEA 2IVFC 3GPEA 4WENB 3UTOA 5T8IA 1IL1A 3TYGH 5BZDA 1LE9B 3FMGH 3FRPG 4KKNA 5DHYA 4FQJH 5CWSA 4IKIA 3HE7D 4A04A 4RSVA 1BLNA 1JPTH 2VUYA 3Q8AA 3ZK0A 1SF3A 3Q2VA 3SGJC 1E9QA 5FYKL 3RWDA 2GK2A 1R3IH 3B2DC 4XPAH 2FWOA 2N56A 3SYAA 2GBUA 3TF7C 4YFEA 5DDHA 1LEGB 1UM4L 1HQ4B 4M6AA 1RZKL 2X4NA 3FU7A 5K39A 1JMXA 3BO8A 1OT2A 3BEWA 4J8RB 5MP6H 1N0LA 2OI9B 1MPAL 3Q2WA 5EBLA 4KHXH 3VYOA 3PYCA 1DLHA 3H54A 3U9UA 1HJCA 1IX2A 1I3GH 1NCWH 3PGCA 5AOKA 2AV1A 2WNKA 3K5SA 2EH8H 2X2IA 4XC3L 4BZ2L 4Y5XA 1RUMH 2NX5A 1R24B 2G3NA 5GGVH 4LCUB 1YEHH 4YGAB 1IBBA 4CSZA 1Q0YH 2KZBA 2VT0A 5I1JH 4BCYA 4XNAA 3TX4A 3A4FA 3MCKB 2BRQA 3A4AA 3LN4A 5C3IA 1H9VA 4H2CA 2NSMA 2YZ1A 2N0KA 3FU3A 4FFYL 2FUQA 4PGEB 3S6CA 3BGAA 2CHXA 1I9JL 4NUPA 4Z7WB 4CNIA 5ERWA 3T0XA 2D9CA 4AITA 4ZW3A 1BVLA 1ML0A 4E41B 2C7UA 4MB4A 1T2QL 2Z35B 4MAUH 3GEFA 3UTZB 3T0DA 4JY5H 3GIZH 4OZHA 2E7MA 2QHLA 3G5YB 3O6MH 1HIML 1GGUA 5DYFA 2XWCA 4MBOA 4EN3A 3H8NA 3C6LA 1P7BA 3KPSE 4EZMA 4RMVA 2XZQH 4PJDF 3VM5A 3KMDA 1HEHC 3P3YA 3DURB 4NUQA 1QX1A 1FO0H 2R0LH 4X83A 2OMTB 3VWJB 3L3GA 4P9HH 1TF4A 2ITFA 3VFPA 1YEFL 4GW5A 2HCZX 4DP2X 1XXFC 1FIEA 1AG6A 3B4NA 1KBPA 3FFDB 4WHYG 1D9KD 4G7SB 1NDGA 3UZVB 4K23H 5ITFB 3RIKA 3X14B 4OF3A 5D70L 4EOWH 3C9NB 1HHHA 1ES0A 1MRFL 1WTGT 4YSPA 4UNIA 2P80D 4KZDH 5JA8B 3N9GL 2B1AL 2G3MA 4AKPA 4F9LA 4YHPA 4RFOL 1RIHL 1WBZB 4FTDA 4J1UA 3WJLC 2VR9A 3WG7B 1E4XL 3NIDE 3TBTB 3QDJA 4EIUA 3H53A 3BKJH 1V7NH 5L88L 1DJIA 4Y1SA 5AW0B 4M5YL 43C9A 3QJUB 2QLYA 1TZIB 1Z9NA 4GEIA 4QPEA 5DJDA 3QG7H 1OCZB 4G7QB 3OB0H 3CZFA 4U6XA 4W4NA 5EU7E 1KXTB 3S8WA 4RDBA 3BIBX 4XMUA 3C5ZA 5FKPB 4AIZB 1ZT1B 1U8QA 4M48H 2MOQA 3WNOA 4F2EA 3FUEA 2P47B 4F58H 2E7HA 3VFVB 3WE6A 3H2WA 3L3OB 2AFNA 2J8HA 3H2QA 3PWPD 4RAVB 5ENWA 2ED7A 2Y4SA 4MWFB 3S3DB 4N6RB 4ZUUA 4JCLA 2DF3A 4HK3N 1EJFA 2AQPA 2ZOKA 4HWZB 4L1LA 3TO2A 4DO4A 5CEYB 2DQDL 2ZXQA 3NCYP 2DQHH 4K3JL 4RMSA 3N41F 4YDJB 3VG9B 5BV7C 4M61A 1XGTB 1YJDL 4F8QA 4QEGA 4YGVA 1C8PA 5IT2H 1NFDE 2JKJA 1LO4L 3X13A 1U41A 3U6RA 3GRGA 4GW1A 4ZW8A 3T09A 2R4RL 4AW7A 5IFAH 3K71B 3O9WB 1SQ2N 4OZFH 1AR1D 1BIIB 2VE6A 3MRCB 4UIMA 5JW3L 3MA9L 1KJ3H 1BF5A 3SHSA 4HAFA 4JFXA 4TKWA 1NC4B 4PBDA 2NY5C 2BOCB 3OAYH 4ADJA 5IVXF 3TONA 4D2NA 5EZLA 3LRSA 5I8OH 4BDVA 5IUCA 2RIKA 4M43H 5ALCH 1A6ZB 1MQKL 3MUGB 2YAOA 5F7DA 2ICCA 4GUPA 2FWLB 5I24A 5KYXB 3S4SB 2F2HA 1HL5A 1IT9H 1O75A 4RQQA 3QUYA 2HPOA 5ICZB 3KWVA 3DRQA 3VXME 3BVXA 3OPZL 3RFRA 2N7AA 1JF1A 1KTLB 1UM6H 3K1KC 3CQQA 1TJHH 2ZCKL 2ZD0A 3ZQDA 1CYXA 2O26U 3C6EA 3COOA 1IARB 2V4LA 4U7KA 2E4TA 3F7PC 1H0DB 3HMXH 3RX8A 3T04D 4PJBF 2BY0A 5I6XB 5K9QI 5ES4B 3F65A 2BSSB 1JI1A 4NPJA 3TP4A 2CBQA 1V3MA 5KSAD 5CN2A 4AI7A 4KX7A 4ODUB 5CSZA 5CEXB 2VLRE 2YFOA 4CMMA 3ZDYE 1MWAA 1EEUA 2OYPA 4QHNA 5JQIB 4X5LA 1CD1A 4FG6C 3I6KB 1E2VA 3QUMH 3S88H 4S11A 4Y4KD 1GCFA 1YRKA 4HEPA 3TBBA 4WU5A 2XTLA 3BZEB 1VZIA 1RUKL 3QO1B 2QKIB 3FTYA 1UT9A 3CXDL 4GFTB 2AERT 4WSJA 4RNRB 1EXHA 2YK1L 1JAEA 1GZPB 2EDHA 4I4WA 1USZA 2E6QA 2Q10A 4ZMAT 1JSYA 4X4YA 3FRPA 1J8HB 4OLYH 2J1ZA 4ZMVA 1HI6B 4I3SH 4P5MB 4RGND 2L4OA 5E8EA 4LU5H 5K1JA 2D03L 4M4RA 5CEZD 1LHZA 1AZUA 2WNGA 4ZOCA 4IDJH 3VH8A 2VNCA 2BO0A 4PYGA 4ZMTA 3KLDA 1NIDA 1BIHA 1ROWA 3KLQA 3BP4B 4IKLA 4ATTA 2ZYHA 3ZYOA 2GSGA 3SDYL 3BPCA 4MAYD 4XNZB 1ID2A 2J3SA 4PS8A 1G7IB 5HI4C 1S5IL 5KS9B 3U0WH 2BVPB 2E6PA 3MLUL 3QH3A 5DD5L 3ULVH 1EFXD 5D4JA 5EZPA 4G6FD 1B0GB 4JFVA 3V4PA 4OGAC 3VFUA 5J8OA 2XPGA 4LAQL 3IETA 3QFDA 5ICUA 5A2AA 4I18C 2P26A 1FIGL 2KERA 2NY3D 3HG3A 3BWAB 3GNMH 2ZAGA 4G72B 3P4OB 4XI5D 3EGSA 3DX9A 4PJ7A 1CE1H 4K7PY 4KNSA 5T5FL 1QFPA 2W0FA 3T8VA 1YECH 5HYSG 1UGKA 4TQHA 3IDNB 4W6XB 5AEAA 4P3WA 1KTRL 2P7TA 4C56E 5FGCB 4UU9A 1NIFA 3UTSB 1CFNB 4I88A 3BN9C 1EO7A 4L3EA 4NGHH 4BGDA 4TUJA 4NZFA 5FYJU 4F57H 3DI2B 4GBXC 3GS4A 5E6IB 5F7FA 3P73A 1U3YA 1N8ZA 3HBQA 3WNNA 4HALA 3MV7B 1D5IL 4MB3A 4NUGH 2R23B 1YMMB 1EIBA 4WGWB 4KOCA 4CC4C 2CXKA 3EDFA 3EIFA 1EUUA 3OHXC 4LCCA 2CDFA 3BAEH 5KVEL 4PSRA 5TQ0L 2FQFA 4NQCB 4P46C 3V0FA 3DYMA 1UGNA 2OR9L 1DN2A 1AXSA 1TENA 1VKXA 2XNAB 4B9GA 1G7MB 4XBPA 5DFVD 4UTBH 5EA0L 4EI6A 4UT7H 1UFUA 2X89D 5IMKB 4PJDE 4FYSA 4WTZG 4Y5VA 2NNRA 2YC1A 1M7IB 4M8UA 4G6KH 2CD0A 2Q8BH 3WXWL 5CIPH 5JXAL 5IOPB 3UGXA 3F83A 1ZTXE 3OZKA 3MRRA 4X9FA 3RGVC 4ZFFB 2DYPB 2H32H 4M8QA 3A3YB 4OJFH 3N0AA 4L29A 4LOVA 1PZCA 1TTGA 4IU3A 4PJIF 4RZCA 5D7IF 3ZKSD 2FL5A 2EIMB 2UUDH 3KYOB 4L8SA 4M5ZH 2AEPL 4PJ8A 4G8EB 3CFBA 2BINA 3LRGA 5DZAA 3PFUA 5DC0A 3O3DA 1Z0NA 5D4HA 4OU3A 4ACTA 3GJEA 1SYSB 3QJVB 5H35B 4JDVA 4G82A 1OP4A 2PP8A 3VG0L 3X11B 1E67A 1N6VA 2OTUA 4UOW0 4Y1AA 3EH5B 1GOFA 1QUPA 3L7FA 2Y69B 4FLQA 4NPKA 4JFQA 1E4WL 3OWRA 4GKSA 4EZLA 2CDEB 4AL8L 3QJFB 1ND0A 3AB0B 4U6TA 3SKNA 1O6TA 1A6WL 2VDPL 5E2TL 5J6SA 1TSRA 4MCYA 3L5WB 1T6WA 3OJ2C 1C5DB 3CXHJ 5B22A 5F6HI 1PDKA 5C0AE 4IGBC 4ZMXA 3CHQA 3V9EA 2EJ1A 4YDMA 5GS1C 3UBHA 3LRLA 4S2SA 3WO3B 4P5TC 1Q94A 3KPMA 4OW6A 1AGDB 2GUOA 4U1LB 1A3LH 2YBRA 4RCAA 1AHMA 5GZOC 1V3LA 4ENEC 4H26B 3AQXA 5LAPA 3VX0A 3WLBB 4JZOA 3WJMA 5C0IA 1F4YL 4N85A 3ZVVA 4HKBA 2MNUA 4PV8B 4XMVA 5DHVB 5MEND 1BEYL 1YMHB 5HDWA 4CC1A 3T77A 3QXAB 3QPXH 1Z9SA 3MV8D 1YEDA 3FOLA 3QDGD 1DDHB 4LGRB 3WNIA 1EX0A 4U1JA 3ARFD 1U2CA 3NZHH 4PB0L 3IAGC 4MCZA 3ZRFC 2A6DB 2ZP8A 1SDYA 1Q72L 2WWKO 4N8CL 5AAWC 4LPYA 4ANWA 1GYAA 4MNHB 1A7RL 1AHWA 1MVUB 3ILPB 5EIIB 1ZCRA 4LLDB 3VACA 1P7QA 5IVXE 4OI7A 2PPFA 3VD0A 1A6PA