4QR7A

Structure and specificity of l-d-transpeptidase from mycobacterium tuberculosis and antibiotic resistance: calcium binding promotes dimer formation
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
349
structure length
349
Chain Sequence
VPKLTASVTDGAVGVTVDAPVSVTAADGVLAAVTMVNDNGRPVAGRLSPDGLRWSTTEQLGYNRRYTLNATALGLGGAATRQLTFQTSSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L,d-transpeptidase LdtB
publication title Structure and specificity of L-D-Transpeptidase from Mycobacterium tuberculosis and antibiotic resistance: Calcium binding promotes dimer formation
rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 90
structure length 349
sequence length 349
ec nomenclature
pdb deposition date 2014-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
A PF17964 Big_10 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 4qr7A03
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4qr7A02
5DZJA 3VYNA 5DC2A 4QRBA 5DZPA 5DCCA 4XVOA 5LBGA 5LB1A 4QR7A 4LPQA 4GSUA 3ZGPA 4K73A 5E1GA 4GSQA 1Y7MA 4HUCA 3ZG4A 2HKLA 4QRAA 4LZHA 3VYOA 3VAEA 4A1JA 4JMNA 3ZQDA 3TX4A 5D7HA 5E1IA 4A1KA 3U1PA 4A52A 5K69A 2MTZA 5DU7A 5E5LA 4GSRA 4JMXA 4Z7AA 1ZATA 5E51A 4ZFQA 3U1QA 4HU2A 3TURA 4QTFA 5DUJA 3VYPA 5DVPA 4A1IA
chains in the Genus database with same CATH superfamily
1IZKA 1YY9D 2IALB 3UGEA 4NM8L 1H8NA 1JV2A 2UZPA 3TO2B 2EADA 4XC1L 3VQMA 5I6OA 1TJMA 5DR5H 1TZIB 4FTVA 2VB5A 3ARGC 1NC4A 5LAPA 3VD0A 5I1HL 4K8RL 1QRNB 4D2NA 2KMWA 1PZSA 2E9IA 5DXWA 4DESA 8FABB 3V0EA 3OV6A 4QD2E 2MOQA 3MRHA 5HXMA 5JIQA 1BPVA 1T0MA 1UOKA 2YC1B 4YR6B 1UWGH 1H3UA 2R4SL 4X4ME 3GK8H 4LNVA 4PI2A 1W15A 2ARJQ 3BPCA 3EXJA 4FHKA 1DBJL 2GJPA 2D4FA 4POUB 4CDGC 4QRTB 3CDZB 1PMYA 3VI4A 4WJ5B 3BRFA 1GS8A 3HG3A 4NC1C 2UV3A 4TUJB 1TTUA 2ZONA 3Q1EA 4D0DA 4QIRA 3MFGB 2J8UB 5FO9A 2JCCA 4PJBF 2QQKH 3MUUA 4UAOB 4DOHE 2G9HA 2N1TE 4ZFZB 4EKJA 1DEEA 3QDJA 1PGRB 1A4JB 5I1IL 4GSDH 5LBVA 4QLWA 4WGVB 3GBEA 4KHXL 3L13A 4Y1AE 5AVZB 5KSUA 4PJ9A 4NHUB 3DPBB 3CXFA 3TZVD 2MCMA 3LEVL 1U8QB 5EZIL 2YPLA 3BDYH 1NINA 3UJJL 3KR3H 4LPQA 1KEML 2VQ1B 1NFDF 2D9CA 5FWRA 4XHJD 3N91A 2A6IA 3FCGA 1LO5B 1TJIH 1GY1A 2PCYA 4HJ0D 1OP5H 4MXVF 4QCIB 3HC4L 3P11H 3V4PA 5L88L 3QE5A 1RPUA 3FU7A 3FUIA 2G5BB 5F3BA 3CK0H 1MCQA 1WGVA 3OMZA 3CX2A 4F7PA 1NAKL 2D0FA 3PAZA 3UO1H 2Z3FA 3WTVA 3ZUCA 1XB8A 2HJKB 1MAKA 3CZKA 3UAAA 5FECA 2FSEB 4KMTH 3ZHNA 4FCAA 2DMHA 4G59C 4MHHG 4NQQA 5G5DA 3LRLA 2XVBA 3GJFB 4N0FA 4OH2A 2CQVA 4OZFH 4ZOBA 2WUBH 2B1OA 1KTLB 1EAOA 3ZT7A 1UYWH 1AYOA 1ZANL 2X4TB 4V2BA 3BGAA 4MNHB 4HX1B 4PJFF 3T09A 4AIZA 3MLXH 1MHEB 2BH0A 3GSWB 4G8AC 4LPVA 5H37H 4JFQB 4NRXB 4AIEA 3X11A 3FC8A 3SPGA 4QHKJ 2AEPH 2PW1A 4LBEA 1G9MC 3D48R 1SQMA 32C2A 3NPSB 5CJOL 1QLFB 3P30H 4MAYD 3EO1B 3ZW3A 4KBPA 3SY0A 1CG9B 3FRUA 4UYQA 1CN4A 1I3GH 3I6SA 3D9AH 5ANHA 1RP9A 2LV4A 1CBVH 3NFNA 4M4PA 4XI5C 4AC2A 2KZ1B 2MWCA 1EFXD 1J9QA 2OMUB 1DQMH 2DAVA 1JGLL 1F90L 3QNZA 5E4EC 3F2LA 3EH2A 2V7NA 3LKPB 3KW7A 5D7JC 5DZNA 3WFHA 3U2IA 1KLUB 1SGKA 3VCLB 3MCLH 2VR7A 4NUGH 4PW9A 4AK1A 4JM2D 3ULSB 1VFAB 5TJWK 2DH3A 2JMRA 3EHBD 1XGQB 5CAYB 3O6LL 3T77A 2HFGL 5C0AA 1J0KA 2CA3A 2VITB 4JS7A 3U6XS 5TD4A 1F42A 4R2GB 2WO4A 3MRMB 2IV8A 2M83A 4XC3H 1N4XL 4JGUA 2L3BA 4NOBA 2DLHA 1JPTH 3OG6B 1XTLA 4HOMA 4BCZA 4UTAH 5FYLD 4AVKA 3NT0A 3RZCB 1SN5A 1PKOA 4N85A 4HSQA 2OA9A 1RXLA 1E4XL 1M05A 2YQBA 3SDXE 5D7SL 4NAJA 3TA3D 3VQLA 1E5BA 3WJLA 1JPFB 2BHUA 5TQ0H 1PCSA 4PUBL 5FM5O 4JJHA 1MFUA 2WCGA 1JVKA 4HLZG 3FUKA 5AVUB 2ETWA 3BQUD 4HD9A 4OUUA 3L4CA 3H9HB 4JPQA 5F9AC 1DVYA 4W9FC 5ICYA 5DJ0A 1AHWB 4EZLA 3U4BH 2BVQB 1FLTX 2XSKA 4OF0A 4UOW1 5T5FA 3S3DB 3O2VH 1OD7A 3CZLA 2WNXA 3QFGA 1NDGA 4XVSH 3WDJA 3ZZ1A 1D9KC 2HT2C 1X5KA 2QKIB 5I66B 1TMCB 4DOHB 5C3IA 3MYZA 3OLEA 5KJ4A 5IHZB 1T0OA 4QTIL 12E8H 1J0JA 1HNGA 1QOKA 4CC4A 4R7LA 4ZX4A 3BDBA 1YEFL 1VKXB 3TWYA 2XA8H 4L1HA 1O5DT 3DHPA 4Y1AB 2HRPL 3BVDB 3FN0H 4K9JA 3VWKD 4FQLH 5FYLE 3NN8A 3KYOA 1EEYA 1R75A 1P6WA 3UERA 2V7HA 3B9KA 3QEQD 1HILB 2OYPA 2F9BT 5GIRA 5FB8B 1A4AA 3VFSA 5ALCH 4XBGB 2E4TA 2DQDL 4ZI8A 2GBVA 1IGCH 1KJMA 1QEWA 2VN4A 3I9IA 4JCWA 1OK8A 4HFUH 4PJ8C 1QFUH 3D4GA 4Z5RA 3IMTA 1YQVL 4RZKA 3ASOB 2KQNA 2I07A 3FCTA 4LU5L 4RA0C 5E9DD 1OSZB 5LGJB 1W9XA 2NCEA 3LV3A 4H25B 2CHWA 4NRZB 4KUZL 5FO8B 2ADJA 5KN5B 1DLFH 5GS0L 2GJJA 3BGFB 4FQHB 5GRWA 4ZAKC 4H0GA 1TQBC 3MRKA 5AL8A 4F9PC 1M56B 2PN5A 3VXTB 1NGYB 4H7VA 2LVCA 3BP4B 4RESB 5B1JC 3GBNL 1E4WH 4HAKA 1UJ3C 2C4FU 2QJDA 3INUH 3PFQA 4HV8A 5GSVA 2WKLA 4ODSH 1A6TB 3WL9B 2BOCB 3TZVB 1A8ZA 3DO7B 3KL0A 3P77A 3QQDB 4WI4A 2F1BA 1J9SA 4M7ZB 3N42B 4XNBA 4JANA 3QEQE 5AAWA 4HC1L 2OSYA 4NJ9L 3TL5A 2YEZA 1AHMA 2BCKA 4YS4A 3KYAA 3HB3C 3BIKA 1U91A 4Y88A 4FI7A 4UV4H 1A7RL 3N2JA 4RBPK 4M1DL 2DWYA 4MAUH 3ZRSA 4WCYH 5EZPA 6PAZA 2D3LA 3QCVH 4HUUA 4X6DE 3C08H 4HF5H 4JDVB 1EDHA 5D55A 4KQ3L 3NIDF 3QH3B 4AQOA 1QASA 2F8IA 5K33A 4AJVA 4F2MA 4GKZA 5DO2D 4HCRA 4BA0A 3L3KB 4QAMB 3ZVVA 2BOBA 5E9DE 2ZCKL 5FYKD 5JIDA 2LQRA 1VIWA 1MF2H 4NQDD 4BZ2A 2BSDA 4XXDA 3JWOH 1SJXA 4Y5XA 2LU7A 2GJZB 1KB5A 2NNRA 2ZCHL 5ESQA 1N5YL 1S6NA 1F11A 1CXHA 3MV9A 1RJZB 2R15A 4NX0A 1X5GA 3TIDA 2CDEB 3OD3A 4U3SB 1T22A 4L29B 1OAXH 2CAKA 4XMLL 5IJKC 4MNQA 4YDLC 3BC9A 2DYPA 4U1JA 3C8KA 1MCLA 1EZVX 5T1KA 1SXSA 3ILPA 4JCLA 1EGJH 3NRQA 5E99H 5E23A 3DGGA 1QPKA 4W1TA 4IEFA 4MAYB 3CC5B 1BFSA 2MHAB 5EUKB 2YGNA 1T3FA 4KJPC 3GB7B 4XP9L 5EZOH 3KLAA 4WO0A 5SWSA 2A83B 1RZJL 4K3EH 4G9DA 1EFXB 3S6CA 4JO4L 5JZ7C 4CAGA 3BGMA 3MBEC 3BRDA 2D7TH 3NA9L 5GJSH 4LLMB 2VSDA 2H0FA 1J18A 4FQ1L 2PXYA 2G3ZA 3RBGA 5FYKE 2XFXA 5JTWA 4JM2B 3BAWA 2HN7B 3FAWA 3D5OF 3BOVA 2JQZA 3FMGL 3EHBB 4NQDE 3H85A 1QWUA 4PJGA 3ZX1A 1GPOL 3RIKA 2B1HH 4HIHA 2BP5M 1PY4A 1F3DH 2WMPA 4NC0B 3S35H 5D4QA 1TEFA 5DD1H 5EO0B 4ZMZA 1CT8B 4NQEA 3RGVA 1AR1D 1IC5H 2OMNA 3QUYC 1WZLA 2Y7SA 4ZD3L 4IBLT 4QKXB 1DBML 1L9TA 4HHGA 1A6UH 2NLJA 4DWHA 2PCPA 2QFRA 3ZYIA 1UADC 3F58H 3GNML 3Q8EA 5B39A 2OW6A 2EIKB 5I0XA 1BG9A 1OTTD 2K4WA 3HKZA 2CRIA 3GSQA 1EZLA 3BCFA 4OV5A 3QIWC 3ZMNA 3TA3B 2QHRL 3GIVA 2IAAC 5EIQA 1FNSH 1AVAA 1ZT1B 1JXFA 3ZDZE 4YHNA 4G8GD 5C07D 3Q6GH 4YDVA 1KDIA 4GKNA 1U8JA 3C9NB 1AR2A 4R84A 5KVDE 5CINL 5FPIA 1GZHA 2AQSA 1ZVNA 2B39A 4WW2A 2X3AA 1NDMB 4WV1C 2W0FB 3GHBL 3ABMB 5EF1A 3GSUA 1FO0B 1U92B 1VEMA 1XX9C 1PPIA 2G30A 3EG9A 5FM8A 4IK6A 1FLRL 1A3QA 3ETTA 3LDBB 4LF3A 2IDCA 4UNUA 5TTRA 2B16A 3K6DA 4FRWA 4JFXA 5ID1B 2CHNA 4N2KA 2XQBH 3KAAA 4AVJA 1RVFH 2FX8H 3F85A 1NZRA 4FYSA 3VD2A 4QXUL 2IQAB 2QMJA 4Q8BA 3VWKB 1XSIA 1EHKB 2XX0A 3O9WB 3II1A 1EK3A 5F3HA 2IDSA 2IGFH 3MRRA 4MCZA 5IQMA 2DM3A 3QEQB 4P0DA 1S7TB 5LKNA 1FJ1B 4TLSA 3HE7A 2Y6SC 4M56A 2F5BL 5I1DB 1P7QB 4EIUA 4X7FC 2DI7A 4ODTL 3F7KA 1F4XL 3CVHB 3GMLA 2R2EB 1AMYA 2GTZB 1WD9A 4QRAA 1K72A 3WEBA 1L7TH 3MBXL 4X6DB 5AD0A 4GW1A 4G8GE 5C07E 4X7SH 2YARA 2QFPA 4S1RH 3U9PL 1KCVH 3SDXF 4GAYA 2FB4H 1KENL 3P2BA 3P1VA 1SBBA 1U8KA 1T21A 1XD1A 4JFDD 5E9DB 4QHMA 2X6BA 2NNXA 3ECBB 5ESVA 4IRSB 3ARQA 3MRQA 4MDIB 4MD0A 2WOBA 2PKDA 1ASOA 3HAEB 4N87A 5F71A 2ITDA 4YC2B 4KHTH 3JT2A 4FZ8L 5M95B 1E9PA 3U36A 1YQ2A 4U1NA 2QV2A 1HHHB 5GZNC 5KSAC 3US0A 2J6EA 4PW4A 3AGWA 1E4HA 1QHOA 2UZIL 4QHKI 1WITA 1YY8A 5AALA 2ICCA 2WSDA 2XN1A 5F7UA 1MSPA 2YD1A 4QHLA 3K4ZA 5HGGS 1SBSH 1OXYA 2K45A 1T4KA 5DD0H 4A68A 1TQWA 1ZVSA 3CDGB 3H54A 2R0ZH 2YD5A 1HI6B 4DGUA 5LNEA 4XBMA 1AGFB 4ZFGH 5MERA 4YHKL 2PYED 4CVZB 3MNZA 4Y19D 4CUCA 3CIQA 2P52A 1KY6A 1U3NA 4X0KB 5BUGA 3QUZA 1U8OB 5CIPB 2UX6A 1BAFL 4UUJB 1FN4B 4MSWA 2EE0A 3TV3H 4DCQA 4NO5A 1JPSH 4JFDE 1HQ4B 3D0AA 2Q1EA 2Z7WA 4E2OA 4P4KD 4N6RB 1HIMH 1UEMA 3BKYL 4NQDB 4NWUH 4J4PC 3FBQA 1I1AC 3EYSL 5ICZA 2K9FB 4HXAH 1E9QB 4Q89A 2KQMA 2OMXB 4NJAH 2X44D 3CSTA 4L3AA 3CFDB 5AEAA 3UGUA 4R0LB 4CADB 2YUWA 1NJ9A 3MFFA 4NZTL 1YYLH 5ERWB 2W60B 3EYVA 1DCLA 4X5XB 4ZUUB 5E1QA 5EG6C 4OJDH 1AG6A 2JJWA 5TQ2L 1CFNB 1N19A 2OSWA 4F92B 2HLEB 2NMSA 2ZG1A 3EDFA 2FGWL 5HGDB 4ZPVA 3ML8A 5IMMA 4O5LH 3QJFA 2VAAA 3SJVA 1ZHBA 4HH9B 4N28A 2ZUQB 1KFAL 1DQDH 1KBGL 2P5ED 2ZJSL 3SBPA 1H3VA 1WZAA 1MCRA 4AXWB 2VUOA 3I85A 4JQIH 4IKLA 4ZJ9A 1KSRA 2PYEE 2CDGA 1KTDB 1FZJB 1NLBL 3B8YA 4M1GL 4Y19E 5LN4A 3ZDZB 4KNUA 1JD9A 3LKRA 4WW1B 3UTSA 1JGDB 1SYSA 2A9MH 3ARGD 4TQIA 4Z8FH 4W93A 4XN1A 2EH7L 3FQYA 4G6KL 3X1EA 1S7RB 3PWLB 3VNZA 5GGVL 1ZT4A 2HTKC 1ZLWH 4XNZC 5E95B 2AQ1A 1EA9C 3PP4L 5EIIB 3HHRB 3ORJA 3K3QA 1K4CB 4LP8A 3RUGE 5C6PB 5GGVY 5T5FL 4RISH 2X42A 5FV1L 2BSTB 1EERB 4WI0A 1MLCB 3ESPA 3D85D 1X4ZA 1QBBA 4RAVA 3F3HA 2FQEA 1JWUA 4JPIB 1K3IA 2EKSB 3B6SA 2JJSA 3PWPA 2N7AA 3L1OH 4XMKH 2HLFD 3FPYA 1EMTH 1PAMA 2CHDA 1ILUA 3G5ZB 4XVJL 1KTBA 1TF4A 4Z77B 1M57B 4XP4H 3VRIB 1JF5A 3AWEA 1CLOH 4J23A 2P5EE 4H40A 3UP6A 4O9HL 4H13C 3KDMA 3N0PB 3LQAC 1RLBA 1L0YA 1BQLH 1EDYA 2IPKA 4BE6A 1UWEL 5ADOH 2WM0A 2X70B 5EC2B 3P3SA 1MJ8H 4HEPG 4KKNA 2H3KA 3AUVA 3VFVA 2CUMA 4G8GB 5C07B 2OL3B 2P5PA 3ZZSA 3QGVA 2P7TB 4WHDA 3HNTH 1A9EB 3P73A 1DYZA 1RK7A 1ZV9A 3VFMB 2DQIH 4QO1A 5AQ0A 1XT5A 1XH0A 5C0JB 4FYTA 1ECZA 2OYLA 4JO5A 3QUXC 4JREB 1ZGLP 1ZS2A 4HPOH 1VPOL 1R3JA 3R06B 2NSXA 3R0NA 4NC1E 5IKCB 4PLOB 2ZKWA 2BVUA 3VXOB 4XT1C 4N2MA 1QUNB 4OI9A 4U1KA 1PX8A 4PS3A 5HHOD 3G9AB 3P4NA 4YSSA 3SE3C 1TEGA 3K81A 4U3HA 5HDRA 4L8SA 1UD8A 3KEHA 5JUEH 2I27N 5F88A 1FIGL 1NBCA 3B4NA 3Q1SL 1WBXA 1KEGL 3WD5L 1KN2H 2RIKA 1G7IB 2XWCA 3NA4A 43C9B 4YAQA 4F33B 2NY2C 4P2OA 3WO4C 3U2JA 4G6MH 1SHWA 3L4TA 2OLDA 3JWNH 2FH6A 3LMJH 2YA1A 2AVFA 4LSVL 1IL1A 3NZ8B 2RJMA 5FFGA 3MLYL 3LNHA 4WEBL 4KDVA 4Z23A 4JFDB 4M6OL 3VFUB 4OD2B 5B39G 2O6CA 1EBAA 4XI5D 4N8CH 5IIEB 3VFNB 4HCRL 4XE5B 3R1GL 4W9EC 4TRPL 2MQ3A 4NS0A 1H6TA 5MEQB 4M6MH 4C56A 1G7JA 4X9GA 4NN6C 4BZ2L 5D7JD 5FA4A 3UAEA 5IG7B 3SY6A 2RALA 1KDJA 4G7VH 1KB5L 3OMIB 1RZ7L 5ISZA 2IAMA 2MRYA 2XG4B 1FL5B 3X2QB 4I0KA 4XOEA 2JELL 1QSEB 2XY2A 1WAPA 5IZ7A 1TJHL 4Y9EA 2ADIA 5I2IA 1FFPA 1KY7A 4LSTL 4OCYH 1UACH 2LU4A 3P4OB 5F1NA 4GUQA 1BJMA 5ADPL 1PLCA 1F8TL 2P49B 4P3CL 4P46A 4K5OA 4IOSA 4XMZA 5D2NB 5FOJA 4AVHA 4K71C 1KXVC 4ICXA 3G04A 5BZZA 4QGYA 2PYEB 5D1ZC 3E38A 2XWEA 4Y19B 1KCSH 1NGPL 3IBOA 2VH5H 4MGXA 5D96C 3MRPB 5HHPB 3P40A 2PO6A 3RPIA 4CU8A 4X6BA 5HGAA 3NPZB 4AEIH 1J8HD 2EDHA 4NKOB 4LARL 2NY5C 3W11C 3FQWA 4R90H 4HOWA 4P4KB 2FQGA 1TKWA 4M1CC 5C92A 4Q6IB 2MSPA 1U2YA 3RUGB 2DJSA 1I1FA 1YN7A 2EILB 1IZJA 3M7OA 4U1IB 2R2CA 4FFZH 2DMCA 3NSDA 1T2QH 1WBZB 2CO7A 2QBWA 3IFPA 3L5IA 5L6YH 2X89A 2WQSA 4GI8A 4ZG1A 2AXGB 4KJWC 3UTPD 1LEIB 2D3NA 3I9PA 2C34A 5EEUA 4ODVL 3SD5A 1Y0LB 4P3WA 3DETC 1D9KD 2HT2D 2XJLA 1NBQA 3TT3H 3FT2B 2FBJH 1IFHL 4PJBA 3GUFA 2ORBL 4BQBA 2WANA 1PEWA 2WXHA 4PR5A 1CTNA 3TYGL 4NQVA 2AKRA 4F7MB 1T6BX 1EXHA 5IHHA 1KT2A 1HXKA 4PRAB 3OGCA 1FYTA 1X5XA 4L2YA 3BAYA 2AGJL 2ZX9A 2QPDB 3O8XC 5SWZE 3N1GC 4UTBH 4KZDH 1IEAB 2CMRL 3OKLB 3GSXA 4IU2B 4JFYB 5TGBA 4IJTA 3KPRD 4PCTA 4PRHD 5BZWB 1J8HE 2ZT9C 2HKHH 2DQTL 2C1OB 4MCNA 3P02A 4ZTPL 4K23L 4QUOA 4LQ1A 1NFDA 5E6RB 2ITCB 2EXTA 1C5DB 4R7NA 4GG6A 3NCJH 4GKSB 4KZCA 4MJIA 2WBJC 3CD4A 3CHQA 2NQDA 3F7YA 3LNDA 3HR6A 1AZZC 2OR9H 2YUZA 1IGMH 2O5YL 3HI5L 1QZNA 4S2SA 4MQ7A 3D85B 2VN6A 2BNQD 1IEBB 3EJPA 1KNOB 4IMKA 3VW3L 3VD3A 4QNPF 1II4E 3M17B 3K5RA 1A6WL 1PZ3A 3KZ8A 5CD5D 1I3VA 2QKSA 4I9XA 3KGSA 1MPAH 1YMHB 3X13A 5F9DC 5FLVA 1KBKA 4ZAKD 2YSSA 1KIRB 4M5SA 5GGUB 5DHVH 3BW9A 3PJLA 3T6XA 4G42B 3RX8A 2YA0A 3NCMA 3LOWA 4PJFA 1ZIBA 2XPZA 1GAFH 3RIFF 1IV8A 1CFMA 2ZUSA 3BD4A 3CN1A 5J3HD 1T89A 2VC2H 3WSQH 3E7JA 3KPRE 3NP4A 3T9WA 4PRHE 3KJ4C 1JHLL 1E0OB 3IEAA 1WAAE 5ANMB 4D9LH 5F9OH 3HB3D 2RH0A 2DPKA 4QRFA 2EIJB 3RY4A 2ZUXA 5JHLA 2EEDA 2R29A 4BFRA 1MW3A 1UJTA 1GGYA 4R96B 1GC1C 1TZIA 2PW2A 4KJYB 4KRMB 2YAOA 5F7LB 4BDVA 2VN7A 4NZRL 2BNQE 1X7TA 1QRNA 3RKDC 5JXED 1WAEA 4LZKA 5CN2A 2OMTB 1HAWA 3RL1B 3SO3C 5AB0A 3IDNA 3HE6A 3LNIA 4N8VB 2J6EL 3TJEH 1PY9A 2ZUYA 3HPLB 3WBDA 1QR1B 3TJHC 2YC1A 3QORA 5C1MB 4A7TA 2YJQA 3CDFA 1OW0C 3HG0A 1WBYB 3IS1X 2P42B 4ERSL 2OS7A 5FO2A 3IT8D 2XZCH 3VXMA 5CCKL 4JGNA 1JTOA 2NR6C 4TVSa 3NFPA 3A6BH 1F13A 2J4WH 3Q5TA 1S9YA 1CL7L 2HP4A 5PAZA 1E28A 1NLDH 2J1XA 2YKKA 3OKNB 5FW8A 2H1PL 5DEGB 4HQQL 15C8L 5JXAH 2I85A 3H2PA 3WFBH 3ULVL 4IK7A 2ICEC 4J3OG 1X9QA 4W4OA 2F1AA 1BGXH 3REWA 5HVFB 3HS9A 5JZ7D 3X12B 1FH2A 3LH2L 2ZX7A 4ZO9A 5B7EA 3QA3B 4PWHA 1N64L 4WUKH 4RDQG 3KWTA 5D7JB 4HJJH 3ZL4H 1A3LL 1HOCA 1HX0A 4P9MH 2DMKA 3ROOB 2V6HA 3T1FA 3OTTA 3DSNB 1J1OL 3O6KH 3MKGA 2X4NA 3PWJB 3WIFA 4D3CH 1DBKL 1M4KA 1MN4A 3D06A 4RRPM 4HDIA 1MCIA 4XNMA 5AVVB 4PJAF 1HT6A 2WBWB 1ZLUH 1M2OA 1W0VA 2Y22A 1NFKA 2Q10A 3MBWA 4WFHD 2MTZA 4LLQB 1CIUA 3QUYD 1TDQA 4KKAC 5I8EB 5JIHA 1A0QH 1DUYA 4CMMA 2Y07H 3VXRD 1RH8A 2WNGA 2DQEL 2W0KA 1A3ZA 1NAMH 1Z9LA 2HFEA 3IJ8A 3U0PA 3I6GB 1QYGH 4OLXL 5SWZB 4E41D 3CVDA 3JTSA 1AZCA 1ZPLA 3T04D 5HHXL 3MJWA 1NCNA 3FTSA 4DVRL 4XX1E 4PCKA 1RJCA 2X4TA 1J8HB 3G5VB 4RX4A 4EI6B 3QIWD 4G5AA 4I18C 3IFNH 3BUDA 2VN5A 2Z35A 1R34A 3CU7A 1A02N 4E42B 2E76C 2DQJL 1TO4A 2VXSL 3H7BB 4MCYB 2WQRA 4KOCA 1PZBA 4F8TA 3EO1A 1SRDA 1HYRC 4HBCH 1JVLA 5K9QG 5D70H 1NBYA 1R6VA 2BFVL 1W91A 2XZAH 3IDMB 3VXPB 1NEZA 3FUFA 1BVNT 2DI8A 2HPOA 5GHWL 1AJ7H 3CZJA 5E6UB 3V4UL 1NEPA 2CIKB 4JGMA 5A2FA 5IMLB 1DQQB 3GMPB 1F3JA 4AMKL 5BOJA 3FB7A 1ZOXA 3RFZC 3IN2A 2BINA 4NRYA 2GJ6D 1NFAA 5IB3B 4WFHE 1NKRA 2H47C 1C16A 4W9JC 1Z9SB 2E59A 4NKQB 5I6PA 1E5AA 4GMTL 2Z8SA 4OIAA 4TQEH 5DZVA 3KLHC 4XRCA 3VXRE 4NDMB 3B83A 5EC1B 4C4BA 3KYNB 3Q2VA 2MPAH 3FUHA 3IF1A 1KOAA 1FG2B 5C08D 4OY9A 4KROB 4E41E 3VNYA 1AH1A 1J11A 4ZODA 2OXHA 3V0HA 2AJZA 3KPRB 3SGJC 4PRHB 2Y6SD 5FYJU 2R39A 2VLKD 2MMXA 2W0LA 1MOEA 1AQMA 1ZT7B 4FQPA 1HOEA 2NY5H 5FUZH 1XIWA 5F89A 1EIBA 3KM1A 5HD8C 5JOEA 1HXYA 4GMSL 3C6LD 3IPBA 1YG9A 4D7PA 3QEHB 4HEMA 5T33L 3QIBA 3W2DL 1WLHA 4JM0A 4DK3A 3ARDC 4Y4HC 2BNQB 2CA4A 3PXHA 3G6DL 1A6VH 2JKSA 4H20L 2BMKB 3EOTL 2F68X 3FUEA 2M26A 1D2OA 3ZE2F 3K2UL 4GPVA 4TV3A 5BQ7B 8PAZA 3CFUA 3U46A 2HKFH 2LU5A 4JPVL 4BUGA 1V27A 2I7SA 2W88A 2ZXEB 3H9HA 5GZND 4GFTB 5KSAD 4ZAKB 1LO0H 1TQBB 1AHWA 1XZ0B 2GJ6E 1KXTB 2EO9A 3FO1A 1QSFA 3QZPA 4W9HC 4NLHA 3MRCA 5KG9B 1KJ2A 3U9UA 3KPNB 5IQOA 4GW5B 4M5YL 3N40P 2F19L 3D18A 4NGHH 4WI5A 3FT3B 5C08E 4ZUVB 2K8MA 4FI6A 1OT4A 1XF5A 4IBUA 1E67A 4ZPTB 1BVLB 2WY3B 2D7PA 1AGBA 4P23A 1ZA3B 2HJLB 2LTQC 2VLKE 4FQXB 3HB3B 4LCVA 5DZPA 1NGXA 3HJ0A 5HY9B 5T3XH 3U82B 3K91A 2R1XA 5EBWB 4N9GA 1DUZA 5E8OB 5C70A 1MCPL 2COQA 5CJQL 5E2WL 1ONQB 2BVOA 4AV5A 2PWGA 3RJDA 1C5CL 3T2LA 2G60H 4DGYH 1IT9L 3VXUA 4DUVA 2JTYA 3I02A 1L5GA 3VX0A 4AM0B 4NBYB 4UB0H 3NK3A 4J4PD 1MVUB 1CS6A 1BX2A 1I9JH 4K9EC 4W4NA 5LXVA 5BRPA 3W39A 4JY6A 5IB5A 3DKHA 4K3JH 2XN0A 1BMGA 1AD0A 1NIFA 1AXTL 1U6AH 1CD1A 3QZNA 4AGPA 5I15L 1AY1L 4YDLB 1CYWA 1ZHLB 5B3SB 3ARFA 4CILA 1ORQB 1BQRA 3C5SB 3L8QA 1AHKA 3N50A 5FO8A 4JFTA 4OKVB 5T1DH 4OUOA 4FQHA 1KYDA 2XYCA 3IWVA 4DUWA 1Q0XL 1RZFH 2ICWB 2K70A 2MQ0A 3VXTA 2OFQA 1B4LA 1RQ5A 2VQTA 3P4MB 4GRLC 3VM7A 4J1UB 3CDYA 1HCFX 3ALPA 1T1XB 2VM3A 2Z93B 3I2CH 4B5ZA 5J7CC 4JN1L 4F37F 5F44A 1IBFA 2BS9A 1E8WA 4L8BB 2BY3A 1GC1H 4AIXA 1W16A 1S9XA 2C4FT 3OX8B 5CP7A 3SQBB 4OGAC 3N9GH 2HTKD 4IOIB 3U25A 3U30B 3L3OB 3HFMH 4AQ8A 2GK0B 4ZOEA 4X80H 1EHXA 3SQOH 5ALBH 1N8ZA 2VZOA 4HIIB 3UG5A 1WICA 2XKUA 3QH3A 5DD5L 1HC1A 3T8XA 3MLZL 1QKZL 5TDPA 1MQKH 2X4QB 5TE6H 1KLGB 3GO1L 3QHZL 4C83B 1YEDB 4HCGA 5GS1A 1HKLL 1RHFA 3QUYB 3MYJA 3BJ91 1MCCA 4OJEH 4WWKA 4YQXH 1EO8L 2OMZB 1AQKH 4BQ8A 3VXRB 4CW1A 5FCSH 4YDKH 3HMXH 3IKCA 4OCSL 3TEZA 3AADB 1HDMA 4G83A 2HCZX 4PV8A 4E41B 4FXGC 4BH8A 4ZMPA 2NDFA 3EYOA 1O6TA 5LCVA 3C60A 5CD3B 5DMIH 1T5XA 3UAJD 1MCSA 4FNSA 1CK0H 3CMGA 3HCVA 2W94A 3QIWB 43CAB 5FDWB 4E9QA 5LWYL 3MO1B 4O00A 4M7KL 3HLAA 5IV2B 1F0LA 1N0XH 1MNUL 2NY0B 5DC0A 4RQQA 3GMMB 5C8JA 2BWIA 3CC5A 3CXDH 4G43A 3SDCC 3GB7A 1ND0B 3SDXA 4AZ8B 4WV1B 4KQ4L 1L9QA 3ZTJH 1SY6A 3I74A 1VA9A 1JNNH 4LLVA 2OTPA 2FR4A 4L1BA 1OP3H 3BHBB 4GQ9L 1BZ8A 3CPUA 3MRLB 3PDOA 3L17A 4XPFH 4ZTOH 1F00I 3MRJA 4PJ7A 2GJ6B 3RRQA 4BSWA 5IJDC 3SGEI 2XTJC 1GYCA 2J7LA 1Q0YL 4HWBA 4NHCH 3GPSA 3QIUC 2WZAA 1HSBA 4Q14A 2EYSB 1FAIH 3EH3B 3MLSH 3RTQC 1OQXA 5C08B 3KLQA 4GEJA 1E8XA 2I9LB 2YJLA 2VR3A 4PLJC 6FABL 3G3LA 5CEZD 4YSEA 4A2HA 4YSUA 4KZEH 3TBYB 2VLKB 1OTSC 1FBIL 4HUVB 2NY2D 1AAJA 5JW4N 1F4WH 2OM5A 2VO8A 1NMCC 3C6LB 3JV4B 2MKLC 5JHLL 1XXDC 4AH2A 2VDQH 2R29L 4MWFA 3HS0C 1RL1A 4Y7MA 4X6CE 3RVTD 5TF0A 4L9LC 1E7UA 1NUDA 5J6GA 4X9HA 3ABKB 2MPVA 3LKQA 2XVKA 4PRIA 2WP3T 1JRHL 2FHCA 2KZBA 4BHUI 2EIMB 4P49A 4ZW8A 4M8QB 2X4UB 2CBTA 1R5VB 3BQUA 4WHYG 1MRDL 2CBOA 4APQA 3VWJA 5KSAB 2CK2A 3A6CH 4XO9A 2P3YA 4KVCL 4QRUB 4LLYA 1R3HB 1LO2H 1Q9LB 1CCZA 4PJEE 2WVVB 2YAQA 1UA7A 2W0FA 3QJUB 4OZ4B 3QUMH 1LO4H 1OVZA 2EABA 2AJXH 4O2EA 1NCOA 3WNKA 4Z3JA 4HHAB 1TXKA 1NEZG 4YIQB 5CEZE 1ZGLA 1HNFA 5E70A 3BVTA 5FYJL 4QT5B 4LQFL 2OTWB 4QTHB 1N3NA 3KHOA 2EXWD 4LPCA 3JV6A 3ZSTA 1CDHA 3GZPA 2Q7YB 3OVUB 1ZE3H 3SGKA 1V7NL 2CLRA 5M94B 1ZHKB 4WNSA 2J57A 2GTWB 5HJGA 2F1EA 3MROB 3QEQA 1MIEL 1E9OB 2IAND 5DUJA 4ISVA 3NH7H 4RMQA 3GLZA 5A1AA 5I1DA 4ACPA 3F84A 4YXLH 4YHIB 2P48B 1ZVYA 4OCRL 4PWJA 4WNJA 4ANKA 2WB1A 1E4KC 4M1CD 4JFUA 3ABGA 2C1PB 3CPLB 4FQQA 1CD0A 3I75B 3FQNA 4NKDB 2QL1A 4FP8H 4JHWL 2BHFA 3DYMA 4F9LC 1S5IL 4KJWD 4BZ1H 4IS6B 5T3ZH 1KIQB 4XO4A 4AKOA 1BECA 2G75A 4OM1H 2AC0A 1OANA 3ECBA 1GMEA 4HK3N 4Z18A 1OAKL 4P57B 4XMPL 5C0EA 4TN9A 5JPMA 3TF7C 2ADFH 1KCLA 1H8LA 1MCBA 4OCNC 5JORB 4Q9QL 2AANA 3MCKA 3CGTA 1QO3A 4NENB 5DWPA 1MFBH 3V0AC 3IYLW 2YMXH 5LG6A 2X4SA 1PSKL 4LPWA 4RMTA 2JJUA 2CKBB 3F8UB 2DBLL 3WCYA 4N3UA 3AABA 1D5MB 2E5EA 5A2LH 1UXSB 5E56A 2HX7A 4UINL 1B4JH 4XNQA 3RIAK 2IANE 2WLLB 3AAZA 3IXAA 4OLVL 3ATAA 3OR7B 4TSBL 5KVFE 1AGFA 5T3XD 4J7RA 1J1PH 1W8NA 2GUOA 1A1NA 3KGRA 4BH7A 2WBJD 3QZOA 4K9EH 3CNKA 2DLEA 1HINH 5F0JB 1M1XB 3HFFA 3H3PL 4UUJA 2X40A 5F8RC 3BAKA 1YNLL 4LCYB 3RU8L 5DJAB 5AW3B 4XBEH 1WUZA 3H9YA 2IADA 3S3JA 1OZUA 2K1MA 1I8IA 2YGVA 3O11B 2BW4A 1V3MA 4DKDC 2HFFA 5DZ9A 1E9QA 3D25B 1RIVL 4ONGL 4CADA 4CBPA 2EEXA 1U8HB 3X3GL 4FABH 4QAWA 3IE9A 1SMAA 1MFDL 1I9IH 2ATKB 2PR4L 3HIZA 2WLZA 2DKMA 3GMNB 2NY3C 4JQXA 4NM4H 2R2HB 3M8OL 5T1MB 3LS4L 3ATFA 2BC4A 2WQXA 2OAAA 1JIBA 1LEKB 5EBMB 3ZRFC 4ZDHB 1U30A 4CVWA 4AX3A 1H3WM 2CPCA 4X6CB 4YSAA 3OLIA 1HL4A 5T3XE 3VRJB 4LVHC 2ED8A 4X50A 4DKFH 5D1QD 2SODB 1P84J 3SCMC 1ZCRA 3U7YL 1JZFA 4CKVX 1XF4B 2ID5A 4YLCA 4LVEA 1A2YA 5AYUH 3RKDD 4B9JA 1BZEA 3SPHA 4PJEB 5GGSA 1J0IA 2Q3XA 2MNUA 1IGYA 3TJHD 1XBDA 1RULH 1CPUA 1RURH 3HUJE 1Q94A 3QRGH 3L16A 1KJ2L 4UQ2B 3CIAA 5CILH 3N41B 4CA4A 3AY2A 4KKBD 5DMKB 2XRAL 2EKSA 1PNDA 2NR6D 3VXSD 4XMVA 2IBZY 2UWEE 5IHWA 2GI7A 2VJXA 3IDYC 3K6NA 3C2SA 5DC2A 2R69A 1BXAA 5SWQB 2NY2B 5EZJA 2JCWA 2XU9A 3WO4B 3WMQA 5I1GH 1E27B 1O9WA 3BPLC 4OZFA 3V0WL 2WQ8A 2FVNA 1RUMH 3SE4A 5I76B 2BVPA 4XZUB 5H37A 3MNMA 2H2SD 4M6NH 3DBSA 2HMIC 1MFCH 2JE8A 2FNWA 5EHFA 4LE8A 1BWMA 5D1QE 3T2QA 3FW6A 2GKIA 3OR6B 3CVIH 3FONB 3OZ9H 1CDGA 2YAPA 4YL9A 4I1NB 5M7QA 4GIOA 3I6KA 1SJVA 4JQVA 1EHAA 2P7TA 2QADC 4LSSL 2VMJA 3C09B 3R19A 4JDTH 4LEEA 1E6OH 4Z3EA 1XCWA 4RVBA 2ZAGA 3X1FA 4G7RB 2DTML 4N4YB 3QJTB 2Z4QB 4AQAB 3T0EC 3UDWC 2E7LA 1XGPB 5TFSL 3DGDA 1EWHA 3HMWL 3R06A 1P5UC 3GS0A 2Z65C 3R18A 5GRZA 3VXSE 4PD4K 1TOXA 3AQDA 5JPNC 3FFCD 3C5JB 2UVFA 5E5MB 4ZX6A 2WKGA 2YFNA 1I1YB 4XNXH 3KLDA 4WHCA 3O41B 1KZYA 2WXRA 2FJHB 4PREA 4N0YH 3IGAA 5D96B 3TONA 4B97A 3W9EA 2UVEA 2VDLL 5IT2H 1RUAL 1DN0B 5IEHB 3L9RB 1FZKB 5CZVL 1RZGB 2IANB 3WNMA 5HYQA 2B15A 1FA4A 3QHTC 2QR0B 3ETSA 5D7EA 5EOTA 4UTAA 5F6HI 4F33A 2Z4TA 4KTDH 5JW3L 3MZGB 1R3LA 1RZPA 4X99A 2XWXA 4G11A 1BM3L 4DN3H 1A25A 2VR4A 2L8AA 4UBDC 3S4SA 4B5EA 3QR1A 4X6CF 4UILH 3AXLB 3EH4B 4JFDA 1SJHB 3B2UD 5IIEA 3HG2A 1N18A 2YN5A 4N20A 1WPCA 4KKZA 3PY9A 3OKEA 1CLZL 2P46B 1ZA6A 1YNKH 4XO3A 2MQCA 3T0VA 5KANG 2ALWA 4J8QA 4P5KB 3Q05A 4OFIA 1OGSA 4LCCC 4M3KB 4RWYL 2UY7B 1UWXK 2Y7QB 1K6QL 3KLHD 3FFCE 5DK2A 3MTRA 4H5SA 5LCVL 3QAZB 2WHVA 1T83C 2R0KH 1AGCA 3O81A 4J6RH 1EZSA 2B1AH 4F5CE 1AC6A 3ZMEA 3SO5A 1J86A 1HEZA 2ISDA 4RA3A 1JUFA 2CD0A 3BH9B 5H4YA 3GDCA 4P5TA 1BFVH 3RWHB 2B3RA 5JHDA 4Y9BA 4TOYH 3A24A 3D4CA 2AJ3B 3HG1A 3QHFH 1OB0A 3D87B 3FFOA 3VH8A 5HD8D 5E6IC 2WBJB 1AZVA 1VDGA 4FQJH 2V5SA 4OV6F 1AGDA 5MEND 3FU9A 3ARDD 4M7LH 4Y4HD 2ZYSA 4ZZFA 5JO5A 4NKOA 3B2DC 3ZE0B 5HHVH 1RK1B 3BFOA 3B3IB 4KXAA 1U4FA 3L3HA 3FQ4A 1XH1A 3M1OA 3DI2B 3DIVA 2CE6A 4TVPH 2OR8A 2VRQA 1E5ZA 4HWBL 2A9NH 4P3DA 2VW7A 3FXIC 4NCC1 1B0RB 3AREC 4IQHA 2OP4L 2F74B 1J12A 1FVEA 2GHZA 4DNLA 1Y0LA 5ILTH 4LASL 3WTYA 2ODHA 3DUSA 4HS3B 4R4FH 5TPWH 1AQDB 3OLGA 2AQNA 4B9YA 35C8H 3AC0A 5HDQL 3KJ4B 2P5EA 5DJ2A 5AW0B 2AK1H 3U6RB 1O7DE 3IU3B 1P53A 2IH3B 3AQXA 5LDSA 4FHJA 5CF3A 4FN0A 2VLRA 4LCIL 2L7JA 2VL5B 2QZ5A 3IAPA 5D1QB 4IGBD 3PHQB 3VFWB 1LLAA 4LPXA 1QFHA 5MENE 3ARGA 3L5XL 2BJMH 5D8JH 5AOKA 5BZWA 2ARWA 3H0TA 3S8FB 3V5DA 1XF2A 1I9EA 3QEGH 3EGDA 2Y2YA 3SO3B 4X5WA 1RSFA 3R4RA 1DLHB 2ITCA 2NW3B 5TE7H 3QYCA 3WE6A 1GOGA 4DZBB 1NGZA 2W91A 5IK3A 1U8MA 1B2YA 1I85C 1V5JA 4GUPA 4PJAA 4C8XA 4F8PA 4OIIL 5ITBL 3GM8A 4G6FD 3ALWA 3VXSB 4BK8A 1UB5B 2HTLC 4Y2LA 4IJ3C 3VXNB 4N2HA 3LQMA 1E6JH 3GJEB 2EUWA 1NCDH 1XEUA 2K0RA 2KLSA 1IU1A 2PTUA 2VDRB 4TNWK 3TTSA 5I6LA 4YHMH 5DI8B 1R3KB 1N0LB 5EBLB 1IGIH 1OALA 5GGTH 2XN9A 1MELA 2ICEB 4Y2OA 4YPJA 4UT7H 3CXHJ 1P6AB 1RUPH 5DQDL 5HHQA 2W07B 1ZSHA 1EGJA 3NJMA 4TULL 1G5AA 1YCSA 1UD5A 2OV0A 1F58L 4HLZH 2FQDA 5DD3L 4KMQA 5GGRA 2HJFB 4IMLA 4EDWH 3K8KA 3FN9A 2ENPA 2FX9H 4OGAD 4P5SA 3FB6B 5KYUB 2OJEB 4O2FB 2QPSA 2V5YA 2UXTA 1JN6A 3F7LA 3SDAC 3T6VA 1C9SA 1RIUH 4PY7B 2ZWLT 3UYOD 4YPGB 1YUKB 2VTFA 3HPJA 3FSOA 2OCCB 5J57B 1KELH 2R7EB 1Q0EA 2WSPA 1OLLA 4BQCA 5FO7A 4IKJA 2CUAA 1KIUB 3RWFB 5T5NG 1S7XB 4U1HB 1F02I 3CMOH 3FFCB 3TBVA 3HUJF 1INEH 2Q5BA 5HHOA 4JHAL 3FPXA 4N68A 3UH8A 1RU9H 2QV4A 1JWMA 4NPYB 1FNHA 2UWEF 4FQCH 4L5FH 2F7OA 2K78A 2IFFH 5JW4M 1QBLL 3KPLA 4PJHE 4I18B 4BBWA 3MXVL 4AKQA 1IB5A 3PWUA 5GGQH 1A6ZB 2PPCA 2YD2A 1PEZA 1EHNA 4XPTH 1DVTA 4WVRA 2F54D 1D5XB 3OKNA 4W9DC 1S5HB 2APWA 1A7BA 3KWXA 3IXTA 4HG4K 1OAZH 4X8JA 5DR5L 2H26A 3LSOA 3O3BA 5FWQA 1RZKH 4Z3HA 2M8XA 1NL0H 2WN3A 2V8MA 2CJUH 1G0YR 4JRYD 2CM6A 2DQUH 4OZFG 4XGZA 4DEUA 1AP2B 2YD4A 5JQHC 4DVBA 2XQYA 4DW2H 5H37G 1LDSA 1WK0A 1UWGL 4MKTA 3RFZB 3V6BR 5INDA 3GK8L 3TP4A 1MHHA 2PYFB 3PDDA 2XTJD 3VD5A 1VFBB 3DURA 5DQJB 5A43C 5ECJE 1JZGA 2P5WA 2PWDA 3RTQD 4H0HB 4ZBJA 2OMWB 3AG3B 3L7FA 1EAQA 1ID5I 1N59A 4U6YB 1ZMYA 4PLJD 3ESNA 3V0FA 2QQKL 3MA7A 5CLTA 3HRZC 4L0PB 2DL9A 3UC2A 1WGOA 4LLQA 4TUOA 2VRAA 3SKMB 1HJCA 4BD4A 5I8EA 2R2BA 1OTSD 5JOFA 4GSDL 3TBWB 4ZQKB 4ETQA 3Q2WA 1E4XI 1P1ZB 4ZUWB 2F54E 4G8FA 4JKWA 3ILEA 2GEQA 1M1SA 4MHHI 2CU9A 1IIKA 3MLWH 3WS3A 5MENB 3ARDB 3BDYL 3WV0A 1Q9KA 1NCJA 3KR3L 5I24A 4MLIA 5EUOE 4JRYE 1ZS8B 3RVVC 2VGLM 4RBPH 5DUBB 4QXGH 1PDKA 3LPPA 2V9TA 4LRIC 4Z7WF 3MJ7B 5IVXE 1TJIL 3VD7A 3L3JA 3H7BA 4LLWB 1AI1H 2Y25A 3QW9A 2CRZA 3P11L 3CFNA 3KPQA 3Q43A 3CK0L 2X28A 3LKNA 5CBAB 5BPPA 1UTDA 2XTJE 3DYOA 3KWUA 5IMOB 3PV6A 2VUYA 2JSFA 4B0MM 1I4FA 3IMUA 3S4SG 1JXDA 5B7MA 3UYPB 2FLMA 4PJIE 3U2SA 1D9KA 4ZX3A 3BUQA 4KMTL 3ARBA 4CSSA 5I6KA 3FS9A 1D6VH 3CSFA 1HN1A 1JPGB 3VI3E 3K1DA 4KI5C 1PQZB 3VRLE 4EI5A 2LTQB 5A40E 2E7MA 2WUBL 1GVIA 1EEQA 1TQCB 1UYWL 3RWGB 3MGOA 4ANVA 4HULB 4M5TA 3L3IB 3MLXL 1UEYA 4IGBB 2Y1ZA 4YEFA 2AEPL 5J89A 2VUKA 4LEOB 1HWWA 3CSYA 4FA8A 3P30L 4L1LA 3KPPB 1ET5A 2BM3A 1AZNA 2WIIA 1GGIH 4N2NA 1I3GL 1RJLA 3D9AL 4DN4H 5A6LA 1ZTXH 4JZNA 1CBVL 3BUYA 4RMVA 4O2CA 1N68A 4PJ8A 3LQZA 3TFKC 4Z78A 1DQML 1XGTA 4AQ1C 2NZ1A 3CJJA 1VACB 1YEGH 4AUYA 3VACA 3VH8G 1TTCA 3V4PH 1JHTA 5CWSA 4G6FB 3MCLL 5ACZB 5JQIB 4NUGL 5I16B 5E4AA 4ZOCA 3T65B 4FNLH 3ULAB 4E0RA 3VE0A 4H44C 4TMPA 3RY6A 4JDZB 4ZAKA 2WXJA 3DJ9A 1KPVA 1XF1A 3N06B 4F9PA 5KBKA 1HWHB 4LIQH 1KXTA 4N0UA 4XC3L 1AOZA 1S9WB 1CFSB 5B1JA 4ZNEE 4PJHB 1UJ3A 4H0LC 4PTUB 5I75C 3VD9A 4LRNH 1IIIA 2BX5A 1JPTL 1RJYB 2ZOLB 1GGTA 5E00B 1TQVA 1CYGA 5H94A 1OCRB 3RKPA 4I89A 4L3EA 2HKAA 4JQIA 4WTQA 1BD2A 4R8WH 3ERXA 5EORH 5KYYA 2QSQA 2WK2A 3LIUA 2XOTA 2H8PB 4CN1A 1WCBA 4MA1C 3FTGA 1U4EA 3P3UA 2D31B 5E8OA 1E8YA 5TQ0L 1G7LB 2CO4A 3V4VB 2UZXB 1YEHH 1S3KH 2HG5A 3AS3A 2RACA 4FC3E 4GO9A 3B56A 2EYRA 1KB9J 3PHOB 3U4BL 2BIPA 2AAVA 1MVUA 2V9QA 2PMZA 5HHMD 3O2VL 1KTRL 4ZUTB 4MS6A 2A6KB 1LO3H 3RWCB 4HHWA 3LTVA 5EZLB 2R8SH 1TTAA 4LVNC 4XVSL 4FEMA 1OAQH 2UZYA 1HQRB 4KO6A 7PCYA 4JRLA 3IDXH 3UYRH 5GRXG 1FWXA 2G2RA 3L5WB 5IJKA 5I1KH 12E8L 3CZNA 2NY3D 3LZOA 1MY5A 4HU8A 7FABH 4B9CA 2F54B 2XA8L 2F15A 3TO4C 3FN0L 4I0PC 4Q0XH 2I9TB 2YOAA 4FQLL 2ICWA 4DGVH 2XV0A 3FFDB 4YMPA 5EU4A 1SXZA 1ES0B 3BUTA 1QI5A 2RD0A 3U1QA 2V2XA 3S96B 3T3ME 5EUOB 2CLZB 1YJDC 2RCSH 4LLDA 1IFGA 2AP2A 5ALCL 2IWEA 1NOFA 4G71B 3SCMD 5IVXB 3MBEA 1IGCL 3QQ9C 3PUCA 1TCRA 4PGDB 5GS2H 1KACB 2O4EA 2A99A 4HFUL 4A2EA 1QFUL 1UKTA 3EYUH 1NMBH 2IH9A 1CICA 3U9WA 3CBRA 5HHME 3F7VA 1T2XA 1M53A 1MEXH 2VDOH 4PJIB 5EU5B 4FZEH 2ZKYA 4FLOA 1DLFL 1JMZA 3KCWA 3V0IA 1QW9A 4ZX5A 1KLGA 5AAMC 4DEPB 3PGFH 1LMKA 3CQQA 3VI3B 3QUYA 4X7TB 5AOZA 2GT9B 5HSFA 4EDXB 3OB0H 1IC7L 2Q3AA 1DFXA 1A1MB 1E4WL 4YFLI 2EVGA 1PZ2A 3WEMA 3INUL 1NOAA 1HHKB 4ODSL 2MJWA 2WLIA 2N56A 1HAUA 1CUOA 1F97A 3O3AB 4XMTA 1FFOA 4J3VA 5E2JA 3WTTA 4QI3A 4I9WD 1Y7VA 4PJHF 5LHDA 5CD3A 1DJYA 2Y5TB 1QA9B 3CFEA 2GIXA 2Q7NA 4RFEA 3QIWA 1LYQA 2HMID 5IQNA 5IJVB 3EJZC 1E90A 1AXSB 1NFIB 2CO6A 1X3DA 4UT6H 1LQSR 4UV4L 1B4RA 4MAUL 4R5XA 1L3NA 1UC6A 3WDIA 2O61A 3RGHA 3QCVL 3AITA 4IRJC 2EE2A 5CZXC 3QDMA 3C08L 2QADD 4HF5L 1Q90A 1XTMA 4WV1A 3CFCH 2RB8A 3OF6D 5HJ3B 3RWJA 4ZT1A 3PS6A 1MF2L 2VSCA 1DTUA 3L1EA 3KNBA 2HKLA 1NCCH 3PIQB 4PG9A 4EBQH 4YHLH 3JWOL 4Z7UE 4AQEB 3GZOA 1XZWA 4N0CC 3FF7A 5ETUA 3NABH 1TTGA 3T0ED 4JL1A 1X9LA 2HLAB 2CCLA 2WQVA 1JZIA 4YBLB 2GJ6A 4WDIB 1DVFC 2XG5B 3RPBA 4BKLB 5L2KB 1MWOA 3GLEA 1UA3A 2XQYG 3RA7H 5J0BA 2K3HA 2PPEA 1OAXL 5DVPA 3DOHA 4IKKA 3KWWA 1P5VB 3NRFA 3WJJA 3ARWA 1NBZA 3FN3A 1Z3GH 1A3RH 4L5FE 3AWGA 4CVXB 4I9WE 1EGJL 2A4ZA 2VWEC 2VERA 4Y4KD 3KPMB 5E99L 1OOWA 5AZEH 3IETB 2OQJB 3SHSA 1X9RA 2L7EA 1XXFC 1SNRA 4ELME 1KV7A 1PF3A 3C5ZC 4WUUD 4GO8A 1UOLA 5EZOL 2VLJA 5LAXA 4HUVA 2AITA 4HUWB 3TH4T 3AB0C 3H42H 4ZW7A 2V33A 3DECA 4K3EL 5GGRY 1D2PA 4UBDD 2DL2A 3GSRA 5B1AB 1OM9A 2H3NB 2D7TL 5A7BA 5GJSL 3OJDA 1F6AA 2YWZA 1BQHB 1T03L 4NI3A 4Y2DD 4MMXC 3ARTA 3MV7D 5IVXF 4DF9A 4JVUA 4ES9A 5DWUH 4U1LB 3EO0B 3LXCA 2X4UA 4FFZA 4G9FD 1E3XA 3T0EE 2B1HL 5K9JH 5KSAA 3S35L 1FPTH 3SD2A 1FVDB 1G7MB 3D30A 4JZJC 4KX7A 1T1ZA 4ODBD 4PYGA 5DD1L 3OBAA 3N85H 4NQUA 3K6OA 3MV8A 5BV7C 1IC5L 3ECVA 4RAUB 3TURA 3GKWH 1FL3B 4GT7A 1LEGA 4KY1H 5I1JH 4FFVD 1A6UL 2B20A 2FJFA 3VI3F 4HXBH 5E2VH 3F58L 5CJ5A 1NC2B 2GAZA 4BV1A 4TNVF 4WUUE 5J1AB 4AG4H 3IU4H 3T3MB 1HE7A 8CGTA 5E6ID 1IKNC 3A4FA 4UTBA 1EAPB 1PZ5A 1W2KT 2IOIA 4WY7H 2M1KA 4K5NA 1FNSL 4M3HA 1TIUA 3BZFB 1E9OA 3LRHA 3A0OA 3Q6GL 4YHIA 4FLSA 3MV7E 5CMAA 5I6NA 1I1AA 5HHMB 3BI9X 4MB4A 5CGMA 3Q3GA 3CPLA 4G9FE 1GIGH 3VB9A 2E6QA 4WENB 1SYVA 2H45A 3ARED 3LH8A 1JWSA 3ULUH 4H1LB 3UTZB 3O2DH 2IXQA 3RWDA 3F5WB 3ZZLA 1LD9A 3DX9B 1Y18B 3OXSB 4D94A 3O3EA 3RNQA 2NY3B 2XQBL 1RVFL 3AROA 5FFOA 4H2AA 1YEKH 2DWDB 5DHVA 4M7JH 4IBQA 2P8PB 4LLAA 3S88H 3BT2H 1XH3A 1FCGA 3S98A 2IGFL 1X4XA 3N6YA 5I26A 5C0GB 3UPRB 4LVHB 4X6FB 4HWEH 1Y6MR 4PRNA 1L3WA 4UQ3A 4A6YB 5D93C 1ASQA 2Y2TA 3S7GA 4O51A 3SCMB 1MRFH 1I75A 2YSTA 4UIMB 4XCYA 2V5MA 4MNGA 2KC0A 4OLYH 1L7TL 3PHSA 3L9YA 1ETZA 1U33A 3GRWL 1WS7A 4X7SL 4F91B 1BZOA 5PCYA 5E5LA 1KCVL 2ADGB 2WJ5A 3UABA 2FB4L 1S7SA 3SKOA 3MUGA 3L81A 2AZAA 5HPMB 1UXMA 2APFA 1CR9H 4WWID 4Z7UB 5EEVA 1M1XA 2ENQA 2YIHA 4KHTL 3BP5B 1HTYA 3QNXA 5AKTA 4FXTA 2X09A 3EDDA 5L7XH 2SEBB 1U58A 3D8MA 3IDYB 4PP1C 5ICUA 1TVHB 2H41A 2X1QA 4WI2A 5C0DB 3S5LB 3B7TA 2B2XH 3HRPA 3MNWA 2P80A 3UTOA 4FNTA 2ZXDA 3VG0H 4C4KO 3TN0C 3FK3A 2VISB 1USQA 4BFBD 1SBSL 3H7LA 4TL5A 1T7YA 3PU7A 2VABB 3RG1C 3FHQA 4ELMB 3D39A 1F6LL 3HHSB 5DD0L 1L9RA 1T5WB 4EIZC 2R0ZL 4ZFGL 1PY0A 2C9RA 1YJDH 4S1DC 1PVHA 5SWZD 3SN6N 5HP5A 5AKRA 1I7RA 3QO0B 1NPJA 3HI1B 3LPFA 4ZMAT 1NUGA 2E7DA 2QADB 3DUUB 4X6CA 3SDAD 1JZ4A 2B08A 4LSRH 4NO3B 3TV3L 4UNIA 1JPSL 5C6WH 1HIML 4NWUL 2X88A 4XX1G 4LAJH 1XF4A 3QUXA 3T0EB 2HSIA 3ET9F 4HXAL 2ZOKA 5I17A 4NJAL 4I48B 3VG9C 4EJ1C 4PV1C 4YSOA 3VJ6A 1YYLL 5JPNB 3NJGA 5FOBB 1OLZA 5E8PA 2F8OA 4GRWH 2HB0A 2BSRA 2YBRB 3A4EA 2JIXD 5DS2A 3ZYOA 3VTMA 3BN3B 3SE3A 4FL4C 1K8DB 1SDYA 4O5LL 3Q9QA 5AW4B 4OM0H 4OFPA 1GR7A 4Y4KB 5DMKA 1JGEB 3W82A 4TSAH 5FKPB 5HI3C 1DQDL 1AS7A 1WUNT 4Y4FA 1L0XA 4WUUB 1QBAA 1NAMA 3PUUA 5KOMC 3ZYJA 4JQIL 3S3PA 4F57H 3QXWA 3T2PA 1ZXKA 4Z7VE 3OKMB 4FG0A 2ALAA 2Z91B 1ZPUA 3EGSA 1BQUA 2VMDA 5GQBA 2NYYC 4Q9RH 2A9ML 1T1WA 4Z8FL 3V0VB 3DX6A 5GRUL 1MRCH 1ED3B 4XWGH 4Y2DB 3MV7B 3MJ6A 3FRPB 3STLB 4EPSA 1EEUA 2OZ4H 4G9FB 4A1RA 1OF2A 3IGUA 2HVKB 5B8CB 1JK8A 4HS6B 4RISL 5DJ6A 4AL8C 2NRDA 1QHPA 1WFNA 2F53D 4HKBB 5LQBL 2C7FA 3T8VA 3VGEA 2NQCA 2VDMH 3JWNG 3PPSA 4N22A 1X5AA 4HVBA 1MKFA 1UH2A 5HYSA 4Z7UF 5IMKB 3L1OL 4XMKL 1EMTL 4PY8I 1D5IH 1ANUA 5DURB 1XH2A 4NT6B 4AQAA 3WTWA 1WFOA 4Z95L 3KXFD 5E9NA 4ODUB 4XP4L 1CLOL 1QSZA 1M3JA 3FB5B 1TFHA 4K15A 1YYMH 3BWZA 3HHMA 5D1ZA 3SDYH 5AOJA 5E6IB 3IVKA 1BQLL 2VDNB 5ADOL 3GWJA 2DQ6A 1MJ8L 5DTFA 1CFVL 4Z76A 3E6FB 3ARZA 4OZHA 5B1KA 3MCYA 5JYLA 4JFFD 2HVJB 3FB8A 1QMUA 3RVVD 3HNTL 5IY5B 2WXKA 4R4BA 4X7DC 5A2CA 4JKKA 4YK4C 3W0WD 1PKQA 2VM9A 5KWYC 3MRFB 1RMFH 3DV4A 1ZWIB 2GITB 2DDQL 2F53E 5IBUB 4JPKH 5ESAA 5E2UH 1BXUA 1CDYA 3P3YA 4HPOL 3JWDC 4ZFFB 1WS8A 2ARJB 4OLUH 2A6DB 1D5BA 4NZDA 5AG8A 3H56A 1QLEH 5BV7H 5L4FA 5TK2A 4K8RC 5TDNA 1JPEA 2J1ZA 4LL9A 3B8SA 3NCFB 3KXFE 4KOBA 1R24B 3K7UA 4P5KA 5IQ9B 1KIPB 1X5HA 3FOMA 1U8LB 2DIAA 4D0BB 1BFOB 3PP3K 1XCQB 5IFHH 3X3FL 5JUEL 2EDWA 3U0TA 3Q6FB 1TG8A 3LJ3A 1KN2L 2AK4D 2NX5D 3O8XA 4NUJB 5A2KH 1ZATA 1U0QA 1UD2A 1OB1B 4G8IB 4G6ML 5DRNA 3LMJL 4JFFE 1MH5A 3ESMA 3NZHH 4M48H 3IJSB 4E9LA 3HBGA 1YNTA 4CKQA 1N2RA 4N8CL 3W0WE 5GZOC 2WBJA 4UDTA 4DETA 3D3VD 4QJ3B 5EU3B 1R46A 3TFKD 4XOAA 3LZPA 4M6ML 2LT9A 4G3YH 2XWJA 1G7HB 3FCSB 5KAQF 4YZFE 3BEWB 5CP3H 4MA3A 4PBVC 3TPUA 5A2JH 4G7VL 3UTQB 4IJ3B 1FH5H 2YBGA 4MMZC 1OP4A 3T8MA 4S1QH 3D0VB 3HUJA 3TTYA 3HZKB 4QOKD 1J5OH 4EZJA 3FYEB 4RZCB 1QABA 1YHPA 5EO9A 2BP3A 4OCYL 3UCQA 5T1LA 3NGBC 1UACL 4PV9A 4DUXA 4H0IA 1U8IB 3GYRA 1S78C 4X4YA 3T1WA 3B2VH 1QTSA 1J0YA 4U6HB 2UWEA 1WO2A 1ZDQA 3G08A 3QO1B 1M71B 4TL4A 1SHMA 4K2UH 3MRDA 1C5BH 3OAWA 3E6HB 5HYIA 2AK4E 4HJTA 2NX5E 1J0HA 4L2LA 5BMFH 1Y1DA 4Z7VB 1XCXA 1OP9A 4L8DB 2RHEA 1KCSL 1J5DA 4RNRA 2VH5L 1ETB1 1QQDA 4O58H 3VFOA 3BVXA 2AV1B 2DLTA 4DO6A 2ZSVA 1P1VA 3IDIA 3IU3A 4GAFB 2Z8VC 5F7WC 4AEIL 3US1A 5IBLC 5B1CA 2VKXA 1JZDC 1CWVA 4R90L 4J12A 2FZ3B 2B7DT 3CZUB 5K39B 3D3VE 3ASNB 4AGNA 2VR6A 4Z7QF 1AXIB 4BFNA 1GA2A 2ESVD 2WSKA 1CZ8H 4FFZL 1EXGA 1T04B 2LLNA 3IDGA 3PWNB 3QJRB 4LDOB 5L6YL 3NPSC 1Y07A 1U8NB 4JMNA 3KYMA 1SLXA 1U3HA 2YXMA 1UUNA 4DP4X 5CCGE 4DK5A 3J8F7 3S2AA 2XNAB 4PRPD 4QOKE 2JIXB 1OW0A 2VMCA 4NQSB 4OCXH 5F3FA 1CL7I 4GSXA 4MD5B 4MRCA 4ODHH 2N1KA 1DDHB 2W9EH 3TT3L 4PIRF 4HKZB 2FBJL 3NIGF 2H9GA 1PLGH 4QHNB 1FI8C 5SV3A 3HMXA 4XN5A 1CQYA 4ZRGA 2A7BA 4G6AC 5FUOH 1MFEL 3HR5B 3NEXA 3FQ2A 3CHPA 3TO4D 1E40A 4I0PD 3ROLB 1IAKA 3ABLB 4HAFA 4ORGA 4F7EB 3DVNA 5K9OA 2Q8BH 3WUWB 2DBJA 2TRHA 4KZDL 3VVWA 2NXYC 3CHSA 2ICEA 3DHUA 4Z3FA 1TPXC 2BP0A 1SUJA 1YEWA 2HKHL 3QJOA 4JG9A 5DRWB 2GVYA 3DX3A 3P9LB 3RWIB 4LEXH 1OARH 2Z1KA 3BP6B 4Z7WA 4XR8C 25C8H 3QQ9D 2AXHA 3M45A 3NCJL 1T1YB 2HT3C 4U1MA 5E8NA 4XXWC 2ESVE 2OR9L 1BYNA 5C09A 1IGML 2F53B 4KAQH 3FB6A 2OJEA 1M7IB 3NRPA 4O02H 2ATPB 1FFNB 3QUKB 1HYSC 1RERA 2EC9U 1BBJB 1P2CA 2VCOA 5E0QA 2EYTA 4PRPE 1G9EA 1IX2A 2NUPA 3BE1H 2EDKA 3HW7A 1MPAL 1JK9A 3L95B 4OZIE 3QEUA 2DJMA 4U1GB 5FKAB 3KXFB 4G82A 4URTB 1CI5A 3NAAH 2E6PA 2IC2A 2VDPB 2Z31D 4ONOA 1CF8L 5C2UB 1GAFL 5DVLA 2CHZA 3QJVB 3BEVB 3UEQA 1RI8A 2QHLA 1WSST 2QKIC 1PBYA 2VC2L 5I8CA 5DHYA 3UZVA 3WSQL 1DP0A 4JFFB 2FHBA 4DKAA 1LK3H 1A6ZA 5F9OL 4D9LL 4EUPB 4Z7VF 3DX0A 1MWAH 1D5XA 3W0WB 4J6IA 3U0WH 1QLRB 3QWRD 4IRJD 5CZXD 2D0HA 2WXOA 1QI4A 2HXAA 2I5YL 4AEFA 5DK3A 3FO9A 3I50L 4AL8H 3AU1B 1YUHB 3CLFL 4KKRA 5GRYA 4JY4B 2EDMA 5C0IA 1PW3A 4GLRI 4N0CD 4NQTA 1IM9D 2DYSB 2C3VA 1DQJA 1SHXA 5J4MA 3MLUH 4FNUA 2J8HA 3NJVA 2PYFA 2VE6B 1DVFD 1A1OA 2DM2A 4G5ZH 1VFBA 3QUMA 2XZCL 1K2DB 4DKEH 1RUKH 3TC9A 3W9DB 5HYEA 1ZSDA 2QGCA 1MLBA 2BFGA 3EUDA 3A6BL 3V5HA 2AK4B 2NTSP 2J4WL 2NX5B 4UNTA 4YDZA 1ITCA 1ZDSA 1TQTA 2HRHA 3ES6B 1V7MH 4U6YA 5L2JB 1NLDL 1RHHB 4A7QA 3SGJA 1PZUB 3LIZH 5HYSG 3N43B 1DL7H 3QPXH 1UVQB 3BAJA 1W72L 1X5FA 1ZK5A 3C5ZD 4ANUA 5GS0C 5JXAL 3SE9H 3WFBL 4EN3C 5KS9B 2E74C 2LFEA 2VLMD 1KZQA 2VRKA 1CFTB 3HG4A 4XNUH 3OAYH 1BGXL 3GFUA 5HGHA 3D3VB 5DD6A 2F7IA 4ZXBB 1PFCA 3DA0A 3UOAB 4GAAA 3FOLA 4Y4HA 5MENA 4WUKL 4MJ6A 4M7ZC 4HJJL 3ZL4L 1Y1UA 4YNYB 4P9ML 4I3RH 4OLWH 5DUBA 2EDOA 3O6KL 3JWDH 5E6SB 4E5XA 1BZDA 4D3CL 4XC1H 4IYKA 3E1ZA 4LLWA 2BIHA 1F2XK 3K6IA 4JFWA 4QOKB 1BM7A 1HH9B 3AUWB 3PQYA 4BZ1A 7CGTA 3AJ7A 3DVIA 4ADIA 3FQUA 2O5NA 4PSRA 5K9QI 3SYCA 4ZQTA 1FNFA 1BP3B 1WZMA 1Z5LA 3E8UH 1A0QL 1M2VB 2IJ0C 5C6TH 2Y07L 3IDJA 4QEGA 3CZFB 4YSRA 4KV5E 2LAAA 1NAML 1ORSB 4QRSB 5D7IE 1DVZA 3PJSA 2VWEE 1QYGL 2X0VA 4PWIA 4RMWA 2DRUA 2Y06H 1KPUA 2F58H 1N5AB 2Y7OA 4LSUH 3QXAB 3WY2A 2HH0H 2J2ZA 3E2HB 2X9WA 2VLME 3MOBH 3IFNL 4MA1B 4BGLA 5FX3A 5FF6B 3TVMA 3P0YH 3OKKB 1RCYA 4W9GC 2ESVB 4CMHC 4HBCL 5D70L 2XZAL 3OSVA 5I74C 3QG6A 4JJ5B 4H26B 5EZIH 3VDAA 1NANH 4X8XA 5I30H 2DQCH 1AJ7L 5F9JB 4PRPB 2GTQA 1GY2A 2BZ7A 2FIKA 4LVNB 4HWZB 2Z7UA 4OZIB 1RZJC 4GOSA 1TVBA 4A2GA 4KFMA 3NZSA 5E1AB 1N7MH 2EE3A 3QZWB 5BXFA 1H5BA 4XH2B 3QI9A 4TQEL 4LHUD 3K1KC 3TO4B 1G7QB 4I0PB 2MPAL 4KI5F 3BZEA 3ML9A 1NAKH 3EKCA 1DO6A 4U31A 4GRLA 1JVOA 3T3PF 3BXNB 4Y7OC 4UDUA 5F1KC 2AV7B 3MRNA 5IROA 2OMBA 4X98B 2K7QA 1YDPA 2ZSWB 3GJFH 2D2CC 1MUJA 4J2QA 2X2JA 4OZGF 2NY5L 5FUZL 1BQKA 4FQ2H 1ZRUA 5I82A 1JNJA 4WHYH 1Z5HA 3DBXA 3C2AH 1S9VB 3QWQB 3CE1A 5EO1B 3GHPA 4X7CC 4NI6A 4HKXA 1A6VL 2WNWA 4F93B 1GJUA 4DP8X 3D0LB 4A1IA 1TZOA 3TA3C 2X6AA 3MUZ1 3ECWA 4Q74A 2HKFL 1O0VA 2EVHA 1XGUA 3ZO0A 2ZP9A 2WBKA 4OW6A 2APSA 1LO0L 1MJJA 1AGEA 3A6OA 4E9XA 2Z31B 5IOPB 5KSBB 1CF1A 4PP1D 3ZOAA 3CH1B 3F6JA 1S7VB 3N44B 4PVLA 3DX8B 1W0WB 4OQ1A 5JNYB 4NGHL 4V1DA 1IM3D 2N0KA 3TN0D 4JNXA 1OGAD 4FXGA 1HQRA 4L4VD 4Q2ZA 1RLWA 3EFFA 3VGBA 3DTDA 4MYPA 3FQRB 1ITBB 3VFTB 3L5WA 2B4CH 3HJEA 3WU1A 2APVA 5JDSA 3EOAB 3EDKA 5DGQA 2Q86A 4FJZA 5C97A 4S1DD 2F54A 2VN3A 5LGKA 3ZKSD 1XHHA 2BZCA 4ODXA 2I9TA 4Q6KA 5T3XL 5I9QC 1H8OA 2WYTA 3O0RH 4B0MB 2MOVA 1R5WA 3P3TA 4HWNA 4IRJB 4R3SA 3VWKC 3O9WC 3FFDA 3SDDA 1KPRB 5ACMA 1C08B 1TR7A 2QGDA 5BRZA 1FNGB 3SDCA 2GG1A 1VCBC 5GJTH 2G60L 4DGYL 4JRYA 2CLZA 3CC1A 4YFDB 1CI3M 2YPKB 4UB0L 4ZFQA 5A2IH 3ZDYE 3PCYA 5IVXA 5HVWA 1I9JL 2IH1A 5E9AA 3WY4A 1IM9B 4AUJA 3DMMD 2XTLA 3NSYA 1D5ZA 3DHJA 1FAKT 5D1XA 3VXQA 5IGXH 1AZBA 3MREA 5FEBA 4K3JL 1K9TA 4BXSV 1DVFB 4HFWA 1E3FA 3MUJA 4JG5A 1U6AL 3QIUA 2VR5A 1XAUA 3H4FA 3KG5A 3QCTH 5EMYA 2ENYA 1L9NA 2DWEB 3RTQA 4KU1A 3ZTJG 4OZIF 3LYRA 2PCXA 1OGAE 4IRSC 5D7IB 4M4RB 5T1DL 3VI3A 1JERA 4YC2C 5DLMH 5HI3D 1RZFL 4MZ3A 4N90D 2GT9A 1NCWL 3C5ZB 3SKNB 1ZIAA 3MCG1 3AB0B 3BSZH 1XL6A 4D0CB 5A16A 1UD4A 1JRHI 1JHKH 2WCPA 3I2CL 4LKXB 3ARVA 5IHUL 2NYYD 2JKLA 3HS0A 2Y5TA 3A21A 1B88A 3HTLX 4L9LA 1H3PH 3LD8C 3KVQA 1GC1L 4A66A 2G3MA 4KQ0A 4BSVA 4DGIH 3HFML 4KO9A 3EF4A 4APXB 4MDJB 4OVVA 1BVKB 4X80L 2K6YA 4MCMA 3SQOL 5ALBL 2FT6A 2W9DH 3O3DB 3FTUA 2C7UB 3QFJD 3IJHA 5IB2A 1X5MA 2P8MA 2DQDH 4JZJB 5TE6L 3MC0A 1QLEB 3BZ4A 4AC4A 5DO2C 4CU7A 5C0NC 2VKWA 4PGCB 4A7UA 1S8DA 3DJZA 5F7DB 1XCTB 4YQXL 1TVDA 5E4OA 2OCJA 1AQKL 4YDKL 4ELKA 4NUQA 3MGTA 4Y9CA 4R26H 1VZIA 4PGEB 5A2AA 4GRWF 4BKLA 2OSLA 4N90E 4F7CA 4H8HA 4K3DH 3N44F 5DMIL 2R1WB 5EN2B 4WU5B 4ZMTA 1K5NB 4HOXA 4L23A 2ZICA 4XCNB 1N0XL 4BFIB 4UU9B 5LGYA 3KPMA 1VEOA 4MX7A 5CXPA 3X17A 4G72B 3CXDL 2ZUQC 2YQGA 4EE2A 2R0WH 1E4KA 3V7AE 1MG3C 1JF6A 3T0XA 2CJ3A 3ZN6A 2WW8A 3WJMB 1VGKA 4AGOA 5K59F 2XVGA 4XBPB 1ZK9A 1JNNL 4G1EA 3VFPA 1GJWA 3QFJE 4YGVA 4UM8A 3SB3A 1UZ8A 4NAMA 4XPFL 4ZTOL 5BCAA 3HC0B 1VB9A 2O6FA 2JK5A 2YRPA 1GKOA 3EO0A 4NHCL 4U1LA 2MCG1 1OP5K 4K8RD 4LHUB 1MHCB 2LABA 4NSKA 1FAIL 3MLSL 4LFHD 2W38A 2WVUA 4LNRB 2GCYA 3L48A 4L0ZA 5H35B 4E5XG 2R23B 4Z7NE 2A9CA 2OMYB 2AJYH 3QBTB 5EOCJ 5I5RA 4PN6A 2R27A 3KL5A 4KZEL 1YC7A 2BOLA 3PGDB 4KV5F 4N2CA 3MRBA 2PTTA 1QAWA 3K0WA 5I1LB 3R8BB 1DVSA 1SFHA 3LEXA 4JDEB 4U0RC 4G8EB 5KVEE 1F4WL 2JKWA 4UM9A 5KYWB 1VESA 2X87A 5BJTA 1QBMH 3WNPA 5CCJA 4K0OA 5HGBA 4F58H 2DQFA 2ZUVA 4U7SA 1OTTC 2VDQL 2GBTA 4NERA 3D2UD 3DIFA 3TPKA 4Z7OE 1G1YA 2JJVA 5GZOD 3CVCA 3MX0A 2E3VA 3ZDYB 3C12A 3MJ8A 4RGNC 2FH8A 3BZFA 1SY6H 4WKZB 3B9KC 1BAGA 1Z32X 1V54B 3A6CL 3L4WA 4NN5B 1BJ8A 4HJ1A 1TENA 1LO2L 4HMCA 1F1DA 4HKJB 2O5ZL 1LE9B 4K7PH 2KLRA 3QUML 2AJXL 1BXVA 4PWGA 5FK9A 5I1AB 1OCWH 1OGAB 2XLLA 4XWOC 5E6ZA 5CBEB 2I26N 1MXDA 3BZ5A 1CDUA 2V9RA 2XXGA 2NUTA 4WEMB 3MA9H 1JTTA 5DJXB 3FH5A 3VGAB 2LFGA 4FNPA 1IC0A 3RHWF 1AO7B 2O93L 3DXAA 2K7PA 4IIQB 4AV4A 2CDFB 5DS8B 3P9MA 2CO2A 3QNYB 5D2LE 3MACH 5GGTA 4FYQA 5F1IA 4ONHB 4DAGH 4NZUH 4PVNA 3UJIH 1ACYH 1K8IB 2QQQA 3TBTA 2JFCA 5FYLH 1TJGH 3AXHA 3NH7L 5I1CH 2EQDA 3NDYE 5IBLD 2EE6A 3TBSB 5AZ2L 1Q1JH 3X14A 4YXLL 5CJXA 3F64A 4M6AA 2FO4A 3SCMA 4YJZL 2A38A 4RIRA 3QRLA 4N3TA 4AVIA 3DMMB 3DO3A 5AAWC 1YPZE 4F3FB 4EVNB 3VG9B 3DHMA 4J3UA 1MHPH 2ZP8A 1DQVA 4FP8L 5DZOA 3SEPA 1IJNA 2GSMB 1T0NB 5T3ZL 2IWGA 4OM1L 4G80A 1YYCA 5J1TC 1D7FA 4HWUA 3OM3B 5DQ9B 4DP6X 2VDKB 2ADFL 4LAQH 1G4MA 2BSSA 1VRSA 4XN2A 1KXQA 2AMGA 1FO0H 3UFIA 1MCNA 4IU3A 3GMQB 3WKMH 1MFBL 1P4BH 1UT9A 4N2EA 2YMXL 1Z9OA 4G6AD 4OU3A 3DROB 2GQHA 1VADA 3CFBB 2FHFA 1G6RB 1M7DB 3WELA 3GSNB 3WMPA 1J87A 1FZOA 3QFDB 3WGUB 4OFYA 3VDBA 2NXYD 1BZ9A 3BH8A 5DUPH 4HP5A 4LHJB 5CN3A 1B4JL 1SJEA 4Y16D 2QQLH 2OX5B 4JZOA 1T5WA 1GOHA 1MCWW 5D2NC 3WEXA 1H9DA 3MQIA 1J1PL 1DJWA 3K4DA 3KMDA 2VIRB 1IAOB 3G5XB 4W70A 4KH2A 3QO0A 2HT3D 3CVHH 1G9NH 5CUSH 1P7KB 2QSCH 1UFUA 3QFJB 3RBSA 1HINL 3P69A 4NXSA 4ABVA 2Y24A 1F1GA 1OSYA 1ERNA 3IBEA 3OF6A 1HYSD 4IBVA 4TUKH 3ZDYF 1CLYH 2JXMB 1XGZA 2GIMA 2DJ4A 4XBEL 3V6ZB 3SZ6A 2GEEA 5EA0H 5EH1A 2YR3A 4P4KC 4P2QA 4N0RA 5IEKB 2OCFD 4AM0Q 3VVVA 4Q6IC 2E9GA 2XETA 2XKNA 1P5UA 3IAGC 3DRQB 3HAEH 4Z7NB 3IFOB 4LP4A 1E43A 4W6WB 1I9IL 4FA6A 5D6DC 4NM4L 2Y36L 3B34A 5CKGA 3C75A 3BQVA 1MJUH 1K8DA 3ELAT 2WBXA 5FW7A 4PJ5D 5IR1B 5HHNB 4RSYA 1B3JA 2O26U 5FKPA 1PG7X 3I3EA 1J05A 4PS4H 1I3RA 3QJQB 1U95A 1U93B 2VQ4A 3ISWA 4R9HA 3LRSB 5DJZB 5LGHH 4OCWH 4YK4B 4YHPB 1S7WA 1I7TA 4DKFL 4TM9A 2P8LB 2WINA 1M9SA 4NNYB 2UYLA 5DJYA 1M6OA 4LKCA 4PGBA 4F20A 1CGXA 2B59A 3E1F1 4P9HC 5AYUL 5IW1A 2C9VA 4NN7B 4KVNH 4OJFH 5CIPH 5DC4B 1SMOA 2ZG2A 5D7LD 4HUCA 2A3TA 2X4RB 4JHUA 4FADA 1WC7B 4LT7A 5MEPA 5FYKH 1RURL 4PB9H 3QRGL 3O0LA 2FYYB 3K8LA 2ZNXA 4HKBA 4LCCA 2Q20A 1Q9OB 1GZHC 2FX7H 1GKEA 2OBGA 3KVDD 5CILL 1MW1A 4I3SH 1SOQA 2BRRH 3EFOA 3VYPA 1OTUC 3LN4A 1T83A 1B0GA 4ECNA 1ADWA 3BLKA 5CM1A 1O6SA 1FRGH 3BX7C 4OBSA 3K72B 2HLFC 3UG4A 5D2LB 4PJ5E 2UY6B 5I1GL 4NO0D 3AXIA 3V9EA 1KGCD 2VW6A 3ZO9A 1Y7MA 1RUML 1VERA 3QWOB 5GS0D 4EN3D 3D2UB 5C86A 1AZRA 3GTTA 4IBSA 3ME0B 1Z7JA 2H6PB 4M6NL 1MFCL 4HK0B 1AYRA 3N1MC 2FEDC 4U6XA 1KYFA 3S3SA 5B7FA 3CVIL 3OZ9L 3WGVB 3SODB 4R7DA 1YPZB 2NNCA 1FZMB 3IJ7A 1I7UA 3R7RA 2F61A 4AYEC 1I7ZA 3Q0HA 1OY3B 4UQDA 3POCA 4L1SA 4MMZB 1AS8A 2X7LB 3B1TA 3JTTB 4JDTL 5AB1A 1E6OL 5D7LE 3ZZQA 1PFOA 5KVDH 4GG8A 1RUQH 4WI6A 1EPFA 3WTXA 1DQKA 3M46A 2K3TA 2YEVB 1DCEA 1ZWIA 1KLFB 3NGBB 3CN0A 3AREA 4H8UA 1NOLA 4QXVA 2YLHA 3HC3L 4I5BA 4PJDE 1F1AA 2A6DA 1MFNA 3D50A 4E9TA 4HLEA 1PD1A 4YHZH 3W38A 3CZEA 4OI8A 2FWSA 1SVBA 3T2OA 5EF2A 5MP6H 5FS5A 2C3GA 5HVHC 4XNXL 3SE8H 3A23A 4MMYA 4U2YA 4N0YL 5ITFB 5KANI 2ZNWA 1KGCE 5IT2L 1DJSA 2R69H 5IW6B 3PXLA 1GGCH 4D0BA 3P9WB 3QDGA 4PS8A 1HS6A 3GSVA 4HUXB 3WTSA 3DVFA 3FT1A 2R1YB 1WIPA 2AXFA 5E8EB 4NUJA 2C9AA 2OXGB 4KTDL 1BMZA 3LEYH 4ZW5A 3NTCH 4DN3L 3TNNB 1JV5B 4UILL 4Z7OF 1HSAA 2K6ZA 1YA5A 1C12B 5BOPA 3IJSA 1AIFA 1RZ8A 4MVBC 1I8MA 3PYCA 2OL3H 4LBAA 2J5LB 1XQ4A 3MDJA 5EU3A 3BUPA 3KPTA 4KXZH 5EFIB 1LNUA 1YNKL 1I85A 5D5ME 1SJMA 3GM0A 4GW4A 1ML0A 4JN2A 4XE0A 5HTSA 4F24A 3SPCA 3D4ZA 3L7EA 4ZSOA 3EYFB 2Q76A 1IJ9A 3SPVB 3RL2B 3MUHL 4AMXA 2XWDA 1Z3RA 3FAXA 4JKMA 2X6MA 4UT9A 3IMWA 2Q8AH 5HYJA 2R0KL 1XF3A 2ZWYA 4RCAA 3KCPA 3U48A 1U42A 1KGIA 4J6RL 1IAIH 3HG5A 2B1AL 1F56A 2HT4D 1P6FA 1R9FA 2NXYB 3LVTA 4X5RA 2WTRB 2X1XR 1BFVL 3II3A 4AJ0A 3O6FD 4U6HA 4Y16B 3QO1A 1TPXB 1OM3H 3T4YB 2I24N 1H15A 3QCUH 5LB1A 4TOYL 3QHFL 4AYFB 5D2LF 5L8KB 2J8UF 3BKJH 4Z7VA 1GH7A 4FQJL 3NJHA 5GSRA 2X4OB 2BERA 2BNUA 2YD3A 3BVUA 4GXUN 2QPUA 4M7LL 3SDAA 4XNAA 3IPEA 2DI9A 5HHVL 4UOW0 2FECL 1QZ1A 5CEYA 5I6XB 1XEDA 1O9ZA 1A66A 4FXKA 2AABH 2D7NA 2B9BA 1HHIB 4MRBA 1B0WA 2FE0A 3DSFH 4TVPL 4J3XA 1NC4D 2A9NL 2G5UA 5EEYA 3G6AB 1ESOA 1MW0A 4L1TA 3VFRB 1HXMB 3UBXI 3V9CA 1U8NA 4FI8A 1DZBA 3WXWH 3EJQA 4B96A 5F72S 4FYRA 3VYOA 4NQXB 2J56A 2NT1A 4MJ5B 4U6TA 1F3DJ 2XWZA 3CFKB 1GZPB 2Y3AA 3PE9A 5HYFA 4R4FL 1XMEB 1X7QB 4PJ5B 3WN5C 4GEIA 3NCXA 1RV6X 35C8L 3GINA 1MW2A 4NLAA 2AK1L 5AVWB 1IKOP 1CDIA 4U33A 5CCHE 5BUAA 1R5IA 1S7UB 1IGTA 4N5ED 3K2IA 5D4JA 3K4AA 2DV6A 3CLEH 4WKXA 1UQSB 1ZY9A 4XN7A 4P3CH 3OPZH 3UPCA 4JFPA 3O9WD 3QDJD 1SXNA 2A9DA 3C6SA 4KROC 5BVJB 1A6AA 4JFOA 3S5LG 1WIOA 1KYOJ 1SEBA 2BJML 5D8JL 5C0BA 2A1WH 2V2TA 2OTUB 1FV1B 3FZUC 3QEGL 3KD4A 2VZTA 4PJ9D 4UT6A 1S4IA 2RFXA 1P7QD 5D7LB 1I8LC 3BFWA 4WSKA 3RWIA 1G1KA 2D73A 1M7UA 4H8WH 5TE7L 1HHJB 2W1NA