1G1KA

Cohesin module from the cellulosome of clostridium cellulolyticum
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
143
structure length
143
Chain Sequence
ASLKVTVGTANGKPGDTVTVPVTFADVAKMKNVGTCNFYLGYDASLLEVVSVDAGPIVKNAAVNFSSSASNGTISFLFLDNTITDELITADGVFANIKFKLKSVTAKTTTPVTFKDGGAFGDGTMSKIASVTKTNGSVTIDPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords SCAFFOLDING PROTEIN
publication title Crystal structure of a cohesin module from Clostridium cellulolyticum: implications for dockerin recognition.
pubmed doi rcsb
source organism Clostridium cellulolyticum
total genus 32
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1g1kA00
4WKZB 2O4EA 4U3SA 1G1KA 4FL4B 3BWZA 2VN5A 2VO8A 5K39A 1AOHA 4IU3A 5AOZA 2B59A 2Y3NA 3UL4A 1TYJA 5LXVA 3L8QA 1QZNA 2JH2A 3KCPB 4FL4C 1OHZA 4UYQA 1ANUA 3FNKA 3GHPA 4IU2A 4N2OA 2ZF9A 4UMSA 3F2LA 3KCPA 1ZV9A 4WI0A 2CCLA 2VN6A 4UYPA 2OZNA 4DH2A 2BM3A 5G5DA 2XDHA 2W1NA
chains in the Genus database with same CATH superfamily
3I6GA 4ZFOL 1ZSDA 3MCLL 4JX0A 3ULUC 2FLMA 1AD0A 4ZFZB 1BBJB 3GHBL 4HIIA 5EU5A 3VWJB 3JWDL 1A2YA 3SDCD 4ZK8A 3UFIA 3FO1B 1HHKA 4E42B 1L0YA 4KI5C 5J12C 3CFKB 4RISL 1C1EH 3F7RA 4ZMXA 1OM3L 4R6UA 4HS8L 2VLKA 4DFIA 4TNGA 2QPDB 2YMOA 1FZOA 3VD4A 1NLDH 3EGXB 2FX7H 4WI7A 5L2KB 4ZDHB 1PZBA 2MHAB 1HHGB 2JCCF 2Q8BH 3GSUA 3NA4A 4EVNA 5IVXB 3ZE0E 2IF7A 1IL1A 1FVCA 3CFEA 4WUUE 4LDEB 1FG2B 1NOLA 4HCRA 4NGHH 5CN2A 4LCIL 5I1HH 2RAMA 1KZQA 4OF3A 2XWRA 4NM4L 5IOPB 3W38A 4ATTA 2HJLA 1FYTD 4WFHD 4OZHA 5HHOB 2DTMH 2NY2B 2RMNA 5FV2A 4ZPTB 4LF3B 5I24A 7FABH 1BA9A 1KN4H 4YQXH 3NCFB 3R4DA 4K71C 5MP6H 3LNIA 2G4EA 4H0IA 2I9LB 1ETB1 3WLWD 3D3VB 3MXWL 4PREA 3TBYB 4AT6B 4XAKD 4L8SB 2A9DA 5F9WB 1ZK5A 3HS9A 2ESVE 3V4LA 1PD1A 4E9XA 5LQBL 3MRLA 4LHQB 4OZHE 1HZLA 4YSOA 4PUBL 3AT0A 3FK3A 3RWGB 2MOVA 1JZ3A 3VWKA 4I1RA 5H94A 3MSPA 3VH8G 1PZ2A 2QTEA 4EN2A 5CFAA 2OMXB 2CBMA 3UACA 3ECUA 1YCSA 3T2QA 2VDRH 2K6ZA 4NRXA 2R7EB 2WLLA 2RB8A 1ZLSH 3TVMD 4XXDB 4OF5A 2EDMA 5LDSA 5EB9A 3TEYA 3DVGA 4JJ5A 1G9HA 3T0VA 3VCLB 1T4WA 3BHBA 3EXJA 2XNAA 3B7SA 1WFOA 4W4OC 4KJYA 1E9OB 2WGNB 4JFDA 4XWOD 3AACA 1R3IL 3GRWL 3MJ8B 4J3SA 3H53A 4Q52A 4A7TA 2AMGA 3MRFA 4JFVA 3RX5A 4Z7VE 3SGEH 4YZWA 3C87A 43C9A 4K94C 3L3DB 4LQ1A 2JB5L 4LOUC 1OM9A 3TPUA 2UY7B 2KZBA 2Q9OA 4LKXB 3HR5B 5ESQA 4JFDE 3D33A 4C54A 4NQDE 4HLZH 1CFSB 2ED6A 2YLHA 1KCVL 3CX5J 4IK6A 2NY4D 2HT4D 3P77A 1XH3B 35C8L 4J27A 1OW0A 4J3VA 3DGCR 2XETA 1G7MB 1HTYA 4IDJH 5BXFB 2E7MA 4EBQL 2I85A 5EU4B 1LXMA 5I18L 1USQA 3VSQA 2DKMA 3PF2A 4QRBA 4ZFZA 4HPYL 4E5XB 1BBJA 3K2MC 5TDOB 1CDIA 3VWJA 4GMSH 2XX1A 1T2QL 2Z8RA 1M9WA 3V55A 3FO1A 2XV2A 2J8HA 2F5AL 2WTRB 3CFKA 3MBEB 5I1GL 4BBWA 5HVGB 3KHQA 2HA1A 1NWPA 2DN7A 4MA3B 4IRSD 4OCMC 2Y1ZA 5LO7A 4O5LH 4JMXA 2BRQA 3EGXA 2Y36H 5L2KA 4ZDHA 2MHAA 1HHGA 3BIKB 5IVXA 1R9FA 1V3JA 2B08A 4GXUM 2MTPA 4NOFA 3ZGIA 1FG2A 3FQYA 2NXZC 1UWGL 4LSDA 4ELMF 3MTXA 4D7PA 5IOPA 5E1HB 2VXVL 5BMFL 2M2DA 4M5ZH 1DQLL 3N40F 1UM5H 5HHOA 4ZPTA 1KGYE 2DMHA 4LF3A 4LE8A 5L2KE 3VM5A 2HCZX 4Y1AD 3WJMB 5J1SC 2WP3O 2ZAHA 2I9LA 2J4WH 1U8IB 3D3VA 4L5FH 3TBYA 4AT6A 4L8SA 1KEGL 1IGIH 3T0BA 4HETA 5B21A 1V55B 2N0KA 4HIPA 4A2MA 3WHE1 1PG7H 1QTYT 1EDQA 4A7SA 2F7PA 5GGQL 3V0GA 2L04A 3HB3D 3RWGA 2EAEA 2IAAC 3D3VE 5DZNA 4OSUH 3B1TA 4L9LB 2WWMD 1SBSL 2OMXA 2AABL 3F6JA 1JPGB 4DFHA 2R7EA 1O7DC 3LVTA 1UWFA 4XXDA 3WLBB 3VVWA 5F7EL 3VCLA 3FN9A 3NTCH 2DYRB 3PUUA 2XBZA 1SGKA 4ALAC 1N12A 1E9OA 1DQJB 3ARDC 3SCMC 2HKHH 4MCZB 1U8MB 1FG9C 3MJ8A 4R5TA 4MJID 1MFDL 8PAZA 1NGQH 1VGEH 5EZPA 4GKLA 3OZ9H 2DL2A 1PJWA 1H8LA 3L3DA 4MMXB 3K8LA 3NIDE 2W65B 1UVQB 3HG5A 2UY7A 4LCWD 4WW1B 4LKXA 3AM8A 4NQED 5I0WA 2JB6B 3HR5A 4MA8H 1YEEL 2GK0B 1WS7A 2C9RA 3RTQC 3OC5A 1CFSA 4PRIE 5F7BA 2FJSA 4FMFA 5IY5B 5IFHL 3WD5H 3D50A 1ORQB 1QBBA 1KGJA 1JTOA 1RSYA 2NT1A 4XZ4A 1XH3A 2BHUA 3JZYA 4GQ9H 1EXGA 1G7MA 4XE5B 5BXFA 5AVSB 4GG6A 2KH2B 4FQJL 1WEJL 4H1LB 3LZFL 5IT2H 1MFAL 1DJZA 4E5XA 3PUCA 5TDOA 3NIFE 3BI9X 4A6YL 4UM8B 4ZO6A 2OSLB 3WELA 3BZEA 4W4OA 4WW2C 5AW8B 2Y72A 2BPBA 3SCMB 2WTRA 2IDCA 3H1ZA 3MBEA 1MZYA 1NMAL 4P05A 4HS3B 2FD6H 2BSED 1N64L 2VC2H 2OW6A 5GZNA 5T8IA 4MA3A 1R1CA 1U2CA 1YRKA 2E76C 2PTUA 1XTMA 2IGLA 5GRWA 2PN5A 3INUL 1LEKB 3NPZB 3T6ZA 3WFCL 1XCQB 4H5SB 1O0VA 1ZLDA 2XYBA 3LZQA 4JFFD 5D5MB 3BIKA 1UWYA 4L1LA 5I6XC 2AHIA 4AVKA 3B5GA 1BJ8A 3WI9A 2E9GA 1AE6H 3MCYA 5IJKC 3QEQB 2XBDA 4M5YL 3OBAA 3D18B 2X6AA 2QGEA 2HX8A 1FNGB 1RIVL 4ZXBC 4LL1A 4UQEA 1S7WB 2IAMB 3WJMA 2O6FA 5DK0B 1K8DB 4LHUB 1U8IA 3NSJA 5LG1A 4Z95L 3BWSA 1R5VB 2B4CC 3QA3B 1G7LB 3NN8B 3L1FA 4YHKH 1K85A 4I0CC 4Y9GA 3IVKB 4M6OH 1N4XL 3BZFB 2FBOJ 4EOWL 3CE1A 1IRAY 1PU0A 1I3VA 4HXBH 2NY5H 4QRPB 3T2PA 2I26N 2COVD 1MCOH 1Q0XL 1UD6A 4YHOL 3BWAB 5DSCB 1LP9B 4L9LA 5CJXA 2AJVL 5IM7B 4BCXA 1NLBL 3BP4A 1JPGA 2B9BA 4P57B 3TZVC 1P4BH 3CXFA 3B5HA 1PFOA 2RFXB 3WS6A 3WLBA 4X7SH 3S88L 5F97E 1QUNB 5CZXC 1HEHC 3C60C 1SJXA 2NCMA 4A2EA 2BVUA 1DQJA 1QWNA 1IGYA 4OCYH 4MCZA 3GQFA 4ES8A 1U8MA 2P80D 4WWKC 5B38B 3BRGC 1IU1A 5I74C 2ICES 4NQQA 3E1ZA 5DJ0B 2XBTA 3QQ4B 2P43B 5B4MC 1S3KH 3B2VH 3PQYB 4JEGB 2N59A 1F3DH 1KTJA 2Z4TA 4MMXA 5DRNB 5DUPH 1OSPL 2W65A 3N1FC 3SDYH 2ZUUA 4WO4C 5KSAB 4WW1A 1H6TA 1RJZB 2VZOA 3HBZA 4L29B 4U2YA 4YR6B 2JB6A 1GGCL 3MV8B 4KZ0A 5J0BA 1M3JA 2GK0A 1UC6A 3GHEH 3QUYB 4NNYB 4YBHA 1TTRA 2XUWA 4YDNA 4OZFG 2CALA 4X7FC 4DP5X 4L3EE 2IDUA 5I6KA 4NWTH 4BXSV 5LGHL 1M1XB 1ORQA 1T4KB 2IG2H 3OR7B 4S1SL 2Z34A 4OU3A 4XN5A 4FQCH 5FUOL 4D9RE 3U6RB 3K3QA 4UZUA 5TH2A 4GXVL 2YAPA 4R97C 1E8WA 2Q7NA 3BISA 1I9JL 3WDHA 5IMKB 4H1LA 2B14A 4C83B 3QHZL 3DOHA 3BFQG 3ILEA 3X3FH 2O6EA 3UO1L 4UM8A 1X4ZA 4H0LC 2OSLA 4NHUB 1VDGA 5GGVL 4HOZA 2YXVA 1T89A 1WJ3A 2AJZB 3SCMA 2XICA 3IGFA 3RWEB 3IU3B 4JPWH 3R7QA 4G3YH 4HS3A 3WFHB 1KTKE 1F97A 4XCNB 4KJQD 1AH1A 2X3BA 1LEKA 3GS4A 4TULL 3ECWA 1XCQA 4H5SA 4ZD3H 2Y69B 2P9RA 1CVRA 5D5MA 3GZPA 1QFWM 5D70H 4DETA 1XTLA 4NUPA 3LZNA 4I87A 1S78D 1SDYA 1EWHA 1QSEB 2YEZB 4LXFA 1P6WA 3QEQA 1V3MA 3LRKA 3D18A 4GUPA 4N8UA 3W82A 4GAJL 4U6TA 1FNGA 2F18A 2X6BA 1S7WA 1AKPA 2IAMA 5ALBL 4TQIA 5DK0A 5IBTL 1K8DA 4IOSA 2BNRD 3AXHA 4N2KA 3LRLA 2BW5A 1TZGL 1R5VA 3QA3A 1M9SA 1G7LA 2KERA 3NN8A 3MLWL 1QASA 3MCKB 3VI3A 3QEQE 5L8LB 2A6KB 1DJSA 1MQKH 1XGYL 3MJWA 3V6ZA 3OAUH 3BZFA 5KSUB 1T7ZA 2DQIL 4GSRA 4QY8B 3LIZH 1KBGL 2FSDA 2WN3A 2XWXA 4QRPA 4HZLB 2WXQA 2A6IB 4AV0A 4GI6A 3EH3B 1E5CA 3WIHH 2WPGA 3C6LD 3BWAA 1KXTB 1LP9A 3GS7A 4W9FC 5IM7A 1E9QB 1WTLA 4XN2A 5LWYL 3WS3B 4P57A 2JCWA 4QXGL 1KG0A 2VTFA 3VI3E 2IPKB 5AOMA 1NINA 3KPRB 4YSAA 2AJUH 3O4LB 1QUNA 5D7KE 4Y9FA 3U4EB 2X4UB 3GRWA 3VMNA 1XD1A 4RQQB 1BFVH 4OFVA 2V3FA 1OV8A 2WBWB 1CB4A 5B38A 3BFWA 4KI1A 2X7LB 3QQ4A 3TFBA 1C08A 3PQYA 2ZX8A 3EXLA 5IGXH 5DRNA 3O6ML 5F89B 5KSAA 1D6VH 3U4BH 4M8QA 4L29A 4I88A 4UMGA 4YR6A 4XBEH 1YY9D 5JOFA 1WGOA 3MV8A 1CGVA 3DJRA 4NENB 4BZ1L 4C47A 1MPAL 3QUYA 4NM8H 4NNYA 3VGFA 5A43C 1XF4B 4M7LH 4IBUA 3PREA 4JO2L 4HFUH 4DP6X 2C4FT 1M1XA 1T4KA 3PQYE 4JHBA 3OR7A 4KRLB 4PCTA 3RP1A 2AVFA 2GITB 4M9OA 1QFWI 2BP5M 5BS0D 2UWEE 3FAWA 1A14L 4P2QD 4Z3GA 3MV8E 1UZ6E 5AAPA 1FPTL 5D93B 5IMKA 4C83A 4JFXB 1KLGB 1P53A 4WFEE 4FXTA 1A4BA 5AW1B 5LN4A 1JPST 4QHNB 2MNWA 1JDDA 2C3VB 4NHUA 4APQB 4BM7A 1L7IH 3UMNA 2MPAL 1KCBA 2AJZA 4IGBC 3LVEA 3CUPB 3RWEA 1DE4B 3IU3A 4BK5C 1FO0L 5SWSB 5I1AB 1F4HA 1UUSA 3HNVH 3WFHA 2VLME 4XCNA 3AUVA 5E70A 1DJGA 4RMQA 4G70B 2F5BH 3SPCA 4AM0Q 3EBAA 3H2WA 4HCGA 1XGRB 2LU5A 1F6FB 1RJYA 1BQHG 4JDTL 4JPKH 5EUOE 1SVCP 2DMBA 1QSEA 2YEZA 4PMFA 5F6HJ 1EEZB 1CZ8L 5DUML 2W07B 5DQ9B 4WNSA 5E1QA 2D4DA 5FX3A 3MLSH 5TF1H 1Q1JH 4BIKA 4MBRA 3LRMA 1CTOA 4TSBL 4GKSB 3US1A 1E5BA 5DZPA 1T0MB 1V10A 3PHOB 4MLSA 3MCKA 3ZN6A 4NN6C 2A6KA 3L3JB 3M46A 4IGBB 3PL6D 5KSUA 3T0EE 1D5ZB 4LOVA 1BVNT 4QY8A 1EGJH 1BD2D 1YQVL 3O8XB 4J8RB 1S46A 3AAZB 5T1LB 2A6IA 3ZDXB 4TVPD 1P7HL 5DVKA 1IQDB 1KXTA 4N3UA 1E9QA 1YEHL 2DH3A 1E4HA 4YDZA 3WS3A 3MOAH 2ZE0A 4L3CB 2IPKA 1IJ9A 2RCSH 3ARBD 3FU7B 3SDCB 3SDXA 3KPRA 1G5GA 5IK3B 2F53D 3O4LA 1LLAA 3U4EA 3UTQB 4Z7NF 4RQQA 1R3KB 3IGLA 4PP1C 3WXVH 5HYSB 2H0EA 4Z8FH 4OFYD 3ASOB 4OB5L 2UZYB 4UTAA 1PKQE 2GIXA 2EDKA 2EYSB 4ODWB 2X7LA 3IE9A 3MNWB 2YGOA 3SDXE 3HBQA 1P9MA 3O4LE 3TVMC 1MCPL 4LRNH 5F89A 4L0ZA 3KGUA 3EOAB 1GGUA 2B1OA 1E30A 1XWVA 4HKXB 2P46B 4U1HA 4NENA 1UXMA 5B22A 3N44B 1FYTB 1XX9C 1XF4A 4K3EH 2EDJA 4G6AD 4HDIB 5DEGB 1TJIL 4YBQD 1WDAA 1PQZB 4JM4H 5IW6B 5AZ2H 2P52A 4D9LL 4NUMA 4FQXD 4JFXA 1KLGA 1WWAX 4HPHA 1LJMA 2JI1A 3QJTB 1A6ZB 4XC1H 1G9ML 1Z0MA 3LJ3A 3MRRB 3G5YB 4QHNA 4AC4A 4FXGB 2C3VA 2OMZB 3EDFA 4APQA 2VUYA 2NY4C 2VR9A 3LCYA 2OCJA 3OL2A 1OGPA 2HT4C 3CUPA 1DE4A 3FXIC 4ODHH 3BYYA 5SWSA 1M7UA 5I1AA 1G6RH 3OAYH 1OCOB 1NIBA 2WB1A 5AW6B 3LS5L 4I89A 4MX7B 4LOFA 4NZRH 2JCCB 3HPLB 3SE8L 3PG2A 3BRFA 5EV7A 4M43H 3TVMB 2XTSA 2CKNA 4AK1A 4IHBA 1BGXL 2VN6A 4EAEA 1J0IA 2DLIA 1K4CB 1XGRA 3F7YB 5EPMB 1JJUA 1LMKA 3VXNB 1EEZA 4OLXL 4IRSC 3TYGL 5DQ9A 1E42A 2YD2A 4LMQE 1EAQA 1QFOA 4HUMB 3D0AA 2G5RA 2YD0A 2CUHA 3CC5B 4GKSA 3O2VL 4QRRD 1A7NL 3HKFA 4Z3IA 1LO5B 1T0MA 1V7MH 1CD0A 2ID5A 2YGQA 3PHOA 4JQXA 4DGYH 4AXWB 3QGVA 4P4KC 1WT5C 2DM3A 3L2LA 4HWNA 1NKOA 4FLHA 3L3JA 2NY4B 5F7NC 4PY8J 5GSVB 1T03L 4IGBA 1KYOK 1P6AB 3AT8A 1D5ZA 4K7PY 4W81A 4W4NA 3DX6B 3UAJA 2J7LA 3S3CB 1MCJA 2B2XL 3O8XA 5T1LA 3R7RA 1XCTB 1KN2L 2F8IA 4DPCX 1IQDA 3DPBB 5CUSH 4ZQTA 2VDNH 3GI9L 4L3CA 4DP4X 4JO4H 1BWWA 1YNKL 3FU7A 3SDCA 4F91B 5IK3A 5E51A 1CGXA 4U1GC 4MD5B 3ARTA 3GHPA 3R0MA 4JLRA 1B9KA 3UTQA 1AS7A 3DPDA 1XBDA 3HB3C 1A6VH 4UAOC 1R3KA 5CGTA 4DO4A 4IRSB 4OT1L 3B9AA 4OZGB 5HYSA 3BW9B 2UZYA 5LBSH 4HJSA 4YBLB 2WWMC 2EYSA 4ODWA 5I73B 4OI8A 2GG1A 2F7OA 3MNWA 4WRLA 2BMKA 1W8NA 1R17A 1UACH 1F90L 4NC0B 3ZDWA 4F7TB 3V0AC 2WOYA 3IMWA 1ADQH 3EOAA 4LSVL 3BAIA 5DT1H 2K6YA 4HKXA 2HX9A 4HEMA 4AQ1B 1FYTA 4N2NA 1P4LA 4YXLH 4YHYC 4XP5H 1DJHA 3BE1H 1CDCA 4MSWB 3HRPA 2X38A 4HDIA 5DEGA 4Y1AB 4R5VA 2Y7SA 2NY5C 1HVXA 1N6UA 4LSUL 4OGYH 1PQZA 2ED7A 2RD0A 5IW6A 4X4KA 2PR4H 3T0WA 2ERJB 1YDPB 4YHLH 3E8UL 3GLZA 1A6ZA 1QWUA 4CSPA 4HG4K 3MRRA 3G5YA 4FXGA 2OMZA 4G9FD 3HB3B 3WTWA 3HMWH 5F1KC 1CD9B 4PD4K 4JKMA 5TE7L 3KPOB 2F1AA 3KLSA 4MNGE 1J5CA 1UD3A 4MX7A 3IDYB 2LV4A 2QMJA 2JCCA 3HPLA 4JKPH 1JGVH 2F7QA 4RAUB 1TMQA 3CXDH 2QKIC 3N1QC 5JW3H 4N20A 3TVMA 2B3IA 1WZLA 3LB6D 4GAYB 4MJ4A 1YEGH 2P7TA 1FC1A 4JHAL 1OK0A 1T1ZB 4OGZA 5CKAA 1K4CA 3F7YA 3HG3A 5EPMA 4QRFA 1A3LL 3S5ZA 3WO4B 5C08E 4C4UA 3VXNA 1R5WB 2WKGA 4MJIB 4H8PA 4ZX5A 4MB3A 3QH3A 3C5ZB 2C9UA 1YECH 2MWCA 2XT1B 3N85H 4LCWB 3H9SD 4N2OA 2AEWA 4NQEB 2CD0A 2V9RA 3D0VA 2BXZA 3FB7A 1DUZB 4HBCH 4M4RB 1LO5A 2GJ6D 5CWSB 4AXWA 2OZNA 1YEFH 4KVCL 1X5HA 5GSVA 1BEXA 1FFPB 3P4OB 3DX6A 4P5TB 1TO5A 2JQZA 1I75A 4MFHA 5A16B 1DSYA 4ETYA 4Y4HB 1XCTA 1W72H 2BOBB 2E3VA 3DPBA 2QL1A 1NC2B 2AK1L 5HHXH 2J1YA 4LSSH 3EYUL 4UF7C 1AQKL 1SOKA 3ILQD 3HC4L 4NZTH 2UY6A 3LYRA 2CBOA 1UM6H 3LEVH 1HYSC 4MD5A 5A1AA 4GSDL 1G9NL 3NABH 1M05B 4G6JL 2LTQC 1G4RA 1KELL 2VL5B 2ICEB 4IRSA 2Y07L 1IBBA 4OZGA 3BW9A 2X09A 5JYLA 3QHFH 3U9UB 1E40A 4WY7L 1RFDH 4JFFB 3GO1H 5IIEB 3MRGB 4ZW8A 4XVUD 4F7TA 4BZ1A 4IBVA 1W2KT 2AEOA 1LMIA 1GYUA 1RJCA 4PGBA 4A7GF 4J28A 2R8SH 5JPNB 1E7UA 3BDBA 4PI2A 4AQ1A 5E8EB 4OLVH 5E2VH 5ABAA 1LNUB 3D9AL 3HG1D 3RG1C 5LGJB 1X5AA 4MSWA 3WV0A 1UD5A 1FORL 1J11A 4Y1AA 1HKLH 1IKOP 3KPMB 3TT1L 1T5XB 1T5WB 1M7IB 1DL7L 5F7LB 1YEDB 4JJOA 2MFNA 1QPXA 1YDPA 2Z31B 2QZQA 4K15A 3NPSC 1IBGH 1XT5A 1UADC 5TF0A 3TXAA 3CFDB 1K5WA 1U21A 3Q2WA 3DROB 2GTWB 3QG6B 2GC7C 5C0RH 3MLZL 3KPOA 3QR1A 4HCFA 3FT3B 4MVBC 4KMLB 3WN5C 4KH2A 3K0WA 5LNEA 4RAUA 3GSXB 5K59F 4KNUA 1EEYB 4GAYA 4JHZA 2AQ2A 2ARJQ 4XP6H 4B3EA 5HDLA 4IKNA 3ZVVA 1T1ZA 3I3DA 5EU3B 1KJ3H 3RZCD 4X2UA 1MDAA 2H4EA 1R5WA 1MW0A 4MJIA 5CSBA 1E5YA 3VAEA 2ZWZA 3TC9A 4MHHG 4KDWA 4JFED 4LVNB 4FN0A 2AC0A 4KJQC 3C5ZA 3MBXH 4XMXA 1HCZA 1N59B 4AENB 4DEPC 4PRNB 4NP4L 4ZODA 4ELME 4TVUA 5CNHA 4NQEA 4XNDA 3OD3A 1JTTA 5F0MB 4D9QD 3QRFM 1DUZA 4M4RA 2DF3A 5CWSA 1B4JL 3L5HA 4W9ZA 3IU4L 3HAEH 1S78C 3TBTB 3K5RA 4I0PB 4OR1A 3WIAA 1FFPA 3OAYK 3P4OA 4F37K 4NRZB 4P5TA 1JK9B 2QGDA 4WZ9A 5A16A 3SIKA 4K5NA 3N1GC 4Y4HA 1SEQH 4AUJA 4H40A 2BOBA 2VABB 3HC3L 1NC2A 3ZPDA 4PTTB 4MZ3A 2ICWB 3ZHFA 3IDGB 3L45A 1MJ8H 3LRHA 3K2UL 1R0AH 2ZG2A 3L4XA 1OPGL 2VDQB 4ZAKD 2HFGH 3J07A 1M05A 2D8KA 3S2AA 4O02H 2VL5A 1J5HA 3TA3D 2ICEA 5CJBA 1U36A 1AZZC 4U7MA 3C6LC 4U6VL 3WUWB 3ZE1F 1NGZB 3SYPA 3DIDA 4BUQA 4HK3J 2A38A 1JZHA 1NBVL 3U9UA 3ZKMD 1AG0A 4JFFA 5IIEA 4EI6B 4W6WB 3VGAC 3ML8A 2VZSA 3JTBA 4PY7B 4HUWB 5JPNA 1HCVA 5E8EA 1KB9J 3D4YA 1LNUA 1F00I 4GO9A 4XBPB 4V1DA 4LSPL 1JGIA 2EABA 2QGCA 2UXGA 2YAFA 5HDBF 2BNRB 4MAUH 2JKNA 1ZS2A 3KPMA 4O9HL 1T5XA 1T5WA 1TJHL 1OWRM 1GGTA 1M7IA 2C9XA 2JKXA 1YY9C 1ZJAA 1YEDA 1ZANH 1G5AA 5MEOB 4PHZA 4OF6A 2Z31A 1HHIB 3MUUA 1UFUA 3CGTA 4LAQH 1PYWB 1EJOL 2FX9H 2FO1A 3JV0A 3PP4H 3CFDA 4V1DE 1MUJB 2ADFL 3EOTH 2YK1L 3DROA 1U2YA 2GTWA 3QG6A 1XGTB 3FOLB 4NEHB 5F7WC 1T21B 3MYJB 3FT3A 5C97A 1BZEA 2R0LL 1YYLL 3S3SA 5I19H 3GSXA 2EDXA 1F6AB 3UAEA 4X5PA 1EEYA 1AGFB 4PWFA 1TTCA 4M93C 3WGVB 4QHUB 3AQZA 5F7DB 1GZPB 3M1CA 4XN1A 1WE5A 3G6JF 5EU3A 2NLJA 9CGTA 3S37X 3GHBH 2P80A 4DGVH 1QYGL 3JWDH 1ULVA 1N0XL 3S96B 1XF1A 4PVNA 2IDFA 3X12B 2Z35B 4RDQG 1HL8A 1N59A 4IBYA 1V5JA 3U7YL 4AENA 4RNRB 4NNXB 4PRNA 3S36L 4HS8H 2JLPA 4DN4L 1F18A 4OJEH 2XTJE 1XZWA 3UBGA 4HAFA 5HSFA 2IFGA 3TBTA 3FU9A 4WGWB 4I0PA 2Z7UA 2Y7NA 4TQHA 4NRZA 2FRGP 1JK9A 4LCIH 1ZVNA 2WIMA 3BMVA 5BS0B 1XR8B 3UXFA 4P2QB 5GIRB 3V9CA 3CZKA 2CIKB 3RHWK 2VABA 3WY3A 1QW8A 1U42A 2ODHA 3GGWB 1FFNB 4PTTA 2ICWA 5G5DB 4JPVL 4E5XG 4MCYB 1SLVA 3IDGA 5DMKB 2EYRB 2GTZB 3HPJB 3KM2A 3N0AA 3TN0D 2W1NA 1J8HD 3WFDL 2YEVB 3S5YA 2X5PA 1DVFD 3TNMB 5LQBH 2UZPA 3L7FB 1KTRL 3WUWA 4K2UL 1NGZA 5J6HB 4N4YB 3P3TA 4FZEL 4OF7A 2EC8A 2ATKB 2IOIA 1AIZA 5BO1L 4X83A 3SOTA 2V5TA 1ZXQA 4M7ZC 1IM9D 2VXQH 2DQEL 1NGPL 4D94A 1X9QA 4AIOA 3Q05A 4PY7A 5GISH 1DO6A 4K5PA 5I75C 4R3SB 1NCCL 4DH2A 4HUWA 4U3SB 2WXRA 4TLTA 1R5IB 1BYOA 3N5AA 3UPRA 2M1KA 4I2XE 3QZWB 2OL3L 4NNPH 4NWUL 2IEPA 4AMXA 4XBPA 2X1QA 4CRPA 4CL7A 3EUDA 2BNRA 4BV1A 5C0NC 3V8CA 3HBGA 4OQTL 2FE0A 3ISYA 1RZ7L 2A7BA 2LU7A 5MEOA 3TO4C 1SNRA 3D05A 1MNUL 1J1PH 2APXA 4AQAB 3PL6B 1PYWA 2XI9A 2NUTB 1MUJA 3SDAD 1BD2B 4B0MB 3FOLA 2OR9L 2YS4A 2VW7A 3MJ7B 1T21A 1KCVH 4L0PB 4JW3A 1FIGH 4PJEF 1WVZA 3U1PA 1UA6H 3MYJA 4K7FB 1E28B 5K69A 1GTFA 5GRVL 1KFAL 4WTXA 2EDTA 4FQQB 3ARBB 3N9GL 1XSKA 1F6AA 4F92B 5GGSB 1HHJB 35C8H 4Q0XL 3JWNH 1NGXB 1AGFA 2CRMA 2F53B 4QHUA 4EBQH 2DQGH 2JELH 3FW6A 5F7DA 5I18H 1GZPA 3LY6A 4WFFD 2YMXL 5ESAB 4LKCB 1NANI 2VL4A 4HPYH 1YPZB 5DK3A 1TXKA 5TE4L 3IDJA 1A0QL 1MCQA 1OTSD 2BWQA 3GBLA 4LLDB 1QFUL 3GIZL 2ZG1A 3S96A 2FHBA 1EGJA 2Z35A 4HV8B 3Q44A 3S3DB 4RNRA 4NNXA 4F20A 3O0RL 4DEUA 4Q56A 3JYCA 1ML0A 1OTUC 2VW6A 3OVUB 3QXAB 4FLRA 1CU4H 4M3JA 3X3GL 2WM0A 3L3IB 1CLVA 1CLCA 2CHDA 1EQWA 3F7LA 1T3FB 2K7PA 3RUGF 4BGLA 1UWGH 4H8WH 1IAOB 5BS0A 4P2QA 4UCFA 4KK8C 2VXVH 5GIRA 2CIKA 5BMFH 5DD3L 3GGWA 5T1MB 4FQXB 4H1LG 4WU7B 3UCQA 5G5DA 3WTTA 3TBVB 4MCYA 4FG4A 5DMKA 2EYRA 2GTZA 3HPJA 4DP0X 4UQBA 3L4UA 3V6FB 3T3PF 3DIFB 1T2XA 4U6YB 3TNMA 1XGZA 4OM1L 5AVQB 4YXHH 3HZKB 5IHUL 4RMBA 2OXHB 3L7FA 3W5MA 1KC5H 1A6TB 4FJYA 4W9JC 5GGQH 2IV8A 5DO8A 5FGSA 2LOEA 4YH6A 4AOFA 4DKTA 4F93B 5IB1B 2QVFB 3FFCD 3OKEB 4Y9CA 2ATKA 2O5YL 3CPUA 3D30A 3P2BA 3HS0C 2ZXEB 1E90A 2AABH 2FDBP 1Z6JT 4EO5A 2ZKMX 4Q97A 1IUZA 1GL4B 4R3SA 1XIWB 1Y6KR 4U3SA 3TTYA 3VXSE 1R5IA 1QG3A 4Y2DC 3ARED 2VLRE 3QZWA 2EVFA 3CX2A 4OJAA 4GAAA 3K8MA 1DUYB 1U8JB 4JZJC 3NH7H 2FHFA 4U4IA 3WCYA 4RMWA 2LGNA 2LLLA 1MFDH 4LHUG 4QRRB 2XN0A 1N6VA 1KJVB 2D3LA 2D9CA 4HUCA 1YUKB 1E6OL 2IALB 4UT7L 2DDQL 1WFIA 5D7EA 3TH2T 1XEUA 5HI5C 3NRQA 2APBA 1NQBA 2O5ZL 1E7VA 1LGVA 3RB7A 4R4ND 3MGAA 4F24A 3PL6A 2V9UA 2XKNB 2NUTA 1GW0A 2H2PD 3CN4A 4P46A 3GXTA 1QRKA 1UM4H 1BD2A 2Q7YB 1VFUA 2EILB 4M4PA 2H2SC 1WFTA 3VJ6A 1WLHA 4B9PA 4KRPC 4K7FA 1E28A 2C8NA 2CKBH 4UQAA 5IFHH 3ZTEA 1NBYB 4LQFH 4FQQA 3ARBA 4RCAA 5GGSA 1HHJA 4MNHB 3MI6A 1NGXA 3NFSH 1RUQL 3LSOB 2F53A 1QVOB 2QHLA 2DQCL 2OULB 5BV7L 4FQJH 4D7BA 3MRCB 2WSPA 3LZFH 5ESAA 1MFAH 3OLDA 4LKCA 2YN3A 4ZZKA 4BWTA 1I9EA 1YPZA 2WCPA 3S2CA 2FLBT 4A6YH 5B38G 1YAZA 4F7EB 4KK6D 1WGVA 4LLDA 1IB5A 4JFPB 1GY2A 2N01B 3PXHA 4HV8A 4YDMA 3FQWB 1L4IA 1OL0A 2V33A 3K4DA 3KMDA 2F08A 5LCVH 5H2BB 1IC5L 4MJ6B 3INUH 4YHZL 3WFCH 3QXAA 4Y8AA 3L3IA 5HVFB 2P28B 4C4KT 4F2EA 3M45A 5ADOL 2ZQKA 4HUKB 1B4TA 3NCBB 2A73B 3D2TA 1RAMA 4KX8A 1T3FA 1JZJA 3B7UX 3GDBA 4NO0D 1IAOA 2H0PA 4TQPA 1KTLB 1Y0LB 5JIQA 2YARA 3QK0A 4M5YH 4FQXA 1NCGA 1IBHA 2YFOA 4WU7A 5DD0L 5DFVD 5KVGH 1RIVH 5JXEA 3TBVA 1GGBL 3GZQA 3DX7B 4G9FB 1FVDB 4PB0L 1GPOL 3BLPX 4Z95H 3M07A 4UQCA 5D4HA 3D1MC 4X4MA 3V6FA 3UTPE 5C71A 3DIFA 4U6YA 3ERXA 2B1AL 2H6PB 3P02A 4JK0D 2B39A 3HZKA 2Y06H 1N4XH 2OXHA 3MMEB 5T3XL 2JLLA 4MKMA 5ICXB 1A6TA 4EOWH 5BJTB 2QFPA 4JO8A 5IB1A 5FIEA 4XH2B 4A2LA 4YUEL 4Z7NE 1OTTC 4A04A 1YJDL 5C0BD 1NFDF 1Q0XH 1SUJA 1KF9B 3ESUF 2WQRA 4IOFD 1QABA 3QAQA 3Q43A 4L48A 1IGML 1VZIA 2EADA 3P4MB 4GSXA 2EVHA 1XIWA 5DMJB 1IT9H 3MREB 4FA8A 4K8RD 3S88H 4XMKH 2F54E 2BCKB 3SJVD 1DUYA 1MCRA 1U8JA 4F33B 1RUKL 4HA1A 5GSRB 1UH2A 3H9SB 5DS1A 2CGRH 1QO3B 1JV5B 4XVUC 4QRRA 4KOBA 2JK5B 4Z7OB 1KJVA 2GJ6B 2IALA 1TYRA 4BFFA 3VGDA 1ECZA 3FH7A 5FYKL 2JJTA 1PLCA 1OSPH 1MCNA 2XKNA 1TYEB 3NJKA 3OQ3B 3VFWB 1BQ5A 2Q7YA 2VZUA 4B53A 2AEPL 3T1WA 4P8QA 5DMYA 5CEZD 1JZIA 2AAAA 1NBYA 4LCUB 1WAAF 5GS0D 5IB5B 3MC0A 5FUOH 3H2PA 1FZKB 4MNHA 4R90L 1F42A 3CH1B 4LSQH 2I24N 3LSOA 1E3XA 2EH8L 1QVOA 1H3GA 2Y24A 4PI0A 5DJXB 3ZKND 5I1DB 2MSPA 1JZ6A 3IWVA 4Y89A 3MRCA 4HMCA 3QHZH 5BQDA 5BOPA 1NTDA 3UO1H 2JWYA 4H2CA 1ZLVH 4F7EA 1QA9A 1EFXA 3OKNB 4JFPA 3K6OA 2AXFB 3HS8A 1A6PA 4WEMB 3FQWA 2HVJB 1M56B 2E0PA 4BFJA 2JXMB 4XMLL 2Z8WC 4DKFL 5H2BA 3UBXB 4MJ6A 2YBGA 1H6EA 2BH0A 3L3KB 3NZSA 4MRCA 3CHRA 4TULH 3RZCC 4NQVB 5EIVA 4K9EL 2WNXA 1WHOA 1JS4A 4KY2A 2YRBA 4BK4A 1A6AB 3HG1B 4IKJA 2F8XC 4KUZL 3JV6B 2A73A 3DBXB 3TWCH 1WCBB 2PO6C 5K9OB 4NT6B 2VXUL 2K7QA 1KTBA 1B3JA 1KTLA 1Y0LA 2I5YL 4FADA 2V9TA 4CC0A 5A2KH 2EP6A 3PYCA 4GAJH 3AWEA 2V3EA 4K8RH 4XI5D 3DX7A 4G9FA 1FVDA 5CO1A 3CV5A 1TZGH 4JFHD 3BVWA 3MLWH 5EC2B 2H6PA 2IIJA 5SV3A 2HLAB 1XGYH 3MMEA 1VFOA 3JWDC 5BUGA 5ICXA 2CM5A 3AROA 3KLHC 1KBGH 1U8NB 4XH2A 3RYMA 3BVDB 4FQLL 1SOSA 2E56A 2VSMB 4N2IA 4CW1B 5F7FA 4BHUA 2X87A 3I9GH 3QJUB 3G7TA 1BREA 4QXGH 3L1EA 2HT3D 3P4MA 5B7MA 3DNKA 3MV7E 3MREA 3VG9B 1MFCH 4JFEB 5IBUG 4Z78B 1EEQA 1ZWIB 2BCKA 2HFEB 3GXDA 1YAIA 2FH8A 1E50A 4F33A 5J5EA 5GSRA 2EECA 3ZKMC 3H9SA 1QHQA 1X7QB 1QO3A 1MVUB 1JV5A 4IJ3C 3QG7L 1EMTL 1J0JA 2GJ6A 3KDMB 3OXSB 4M6ML 1MCCA 1E43A 1Z1WA 1F2XK 1PNDA 3RKDD 1O6TA 3L7EB 3HNTL 3MRMB 3O6MH 2BS9A 1XD0A 4PJCF 3U9WA 2VLJE 4PJ9B 4HOMA 2XQYA 3TEXA 2WINB 5DUJA 2GSGB 5CEYB 2WSKA 2WWNA 4POYA 4JO2H 4LCUA 3EH4B 5HDWA 5F9AC 5SX5H 2IDQA 3CVIH 3C5SB 1MCDA 5IW1B 1ZTXE 3UGUA 1FZKA 2JKJA 1IFHH 3CH1A 1A14H 2FATH 5DJXA 5I1DA 2FX8L 4XCFH 4ZAKB 1GXEA 2L8AA 5KYYB 3M7FB 3QB7C 4HLZG 1YMHA 3TA3B 3MLVH 3II1A 1IM3D 5HYSG 3HI1B 3ATFA 2X10A 5I30H 2C3GA 2EO1A 3OKNA 1WZMA 2MPAH 4Y9EA 2AXFA 1T0OA 1AGEA 1FO0H 2HVJA 3VYOA 3BLKA 4IJ3B 2DI8A 1JNLL 4XAWL 1SXNA 2JXMA 3MGTB 3UBXA 4DF9A 3L3KA 5IHLB 1JFHA 4IM8A 5TQ0H 5EN2B 2XY1A 4DHLA 4OD3L 4KDVA 4NQVA 2QSCL 3O3EB 4P4RB 1OAKL 1ZGLP 3Q8AA 5GS2D 1A6AA 3HG1A 4G42B 3ZZLA 3JV6A 2IXQB 3DBXA 5K9OA 1WCBA 1NCBL 4NT6A 5HHVL 5KSBF 5KYUB 1YMME 1CZ8H 5EN3A 5DUMH 4FGMA 5HPMB 3C8HA 5I2IB 1BLNB 1WUNT 3UDWC 1KXHA 2AK4D 1MFEH 2BIMA 1RUAL 4TSBH 5L4MA 5BVPL 3JWNC 4HOXA 5DC2A 3Q13A 4OQ1A 2ZX7A 4PG2C 1D9KB 4JB9H 5EC2A 3B3IB 4APXB 1EAOA 4B9YA 2HLAA 3FPYA 3H54A 1XH2A 1ZLEA 3D39D 4X9YA 5SX4H 4G80B 1U8NA 4UAHA 1YQVH 3D25B 5A7BA 4JY5L 5AENA 4CW1A 4KOCA 1RZFL 4PYHA 1IEAB 4NOBA 3ILDA 1YEHH 3TN0C 3VI4F 1FNEB 4YJZL 2KS0A 3Q6FB 1IZKA 2BVQB 3PWJB 4GQRA 4BQCA 5IMOB 1VPOL 3GPSA 4XP4H 4Z78A 4JFEA 4R8WL 5HDBB 1YLBB 1ZWIA 1JPSL 3R1GL 2HFEA 1AXSB 2ZUWA 3ENEA 4P5RA 3SSGA 1OT4A 3HE7D 3S8GB 1X7QA 2QPUA 1MVUA 4H8WC 4HZ1A 4OB5H 4L3FA 4EMZA 3KDMA 1MHEB 3LAFA 3OXSA 5IQLA 2X40A 3L7EA 3MRMA 2MCG1 1MCPH 4DK5A 4LFHD 2NZIA 3T0EC 4PJ9A 2VDPB 4UT9A 2WINA 4NC2B 1TMCB 5DXWA 1CLZL 1KV7A 5D2NC 2GSGA 5CEYA 1BJ1J 5EG6C 5IHZB 4O2CB 5LAPA 3C5SA 3Q1SH 2V5YA 5IW1A 3FSAA 2XA8L 2BM3A 2Z9TA 3TN0B 1J8HB 3M1OA 3EJUA 2FTAA 1HDMB 4ZAKA 1DVFB 5KYYA 1WBYB 3TA3A 1RHHB 5K59E 1G9MH 5F8QC 5ANMB 1PG7X 2O5NA 4G6KL 5FPIA 5HHQB 3HI1A 4HALA 3M6DA 2J8OA 2NYKA 3I74A 3PDGA 1A65A 1EDYA 1GZHA 2JMRA 2ZF9A 2BVOB 4MB4A 1IM9B 2LVCA 1HC1A 2VR5A 1U8HB 3PWNB 3LS5H 3MGTA 2WLIB 4XNAA 2BIPA 5EN2A 3RVTC 2DQ6A 4FRWA 1CGSL 3WTXA 3O3EA 3OJ2C 4P4RA 2FT8A 2GB2A 3SE3C 4G42A 2IXQA 1KCUL 5TD4A 1MRDH 1S5HB 4AEIL 4Q6IB 5KYUA 4IMLB 1BAFL 2CLVB 3BPLC 4OLXH 3RTLA 5HPMA 5I2IA 3F04A 2R29L 2F15A 1BLNA 4OD1L 2NT0A 1HEJC 1QNIA 1KULA 4JKWA 2WSDA 5E7FA 4G82A 2H8PB 5DJ2B 2R2HB 4OUUB 3SDAB 1X9UA 1A7NH 4N87A 4ENEC 1A6WL 3EGDB 3QCTL 1NICA 4WJKB 1D9KA 3DXAE 4PJDB 1CYXA 3B3IA 4G5AA 4APXA 3CHQA 2CAKA 1IKNC 3WIFB 1T03H 2EEAA 1ASQA 3FCSB 5GGVY 1YEKL 3TGXA 4G80A 1RIHL 3EJSA 2P8LB 4KQ3L 4AGPA 2CJSA 5FFGA 4I3RL 2M26A 2X1WL 3D25A 3QE5A 1DEDA 4C58B 3SHSA 1TKWB 4KKQA 5HYJD 1IEAA 1I3UA 3IK2A 4RH4A 2RGSA 3ZE1E 1FNEA 2X1OA 4Q7DA 3GI9H 3Q6FA 3NG5A 2Y9RT 3T65B 3PWJA 5IMOA 2BZDA 4R83A 2FBRA 3W9DB 4M1DL 2CZNA 4N1CA 2QSQA 2OCCB 5IESH 1AXSA 4UV7L 4AQ8C 4KHTL 4YSQA 4N68A 1J1OH 4HP5A 4QHLB 4ZMPA 4MASA 3BPLB 2FWUA 4OT1H 5EZOL 3N06B 5JHDE 2EC9U 1YN6B 5AAMC 3SDDD 4PJAB 2J2ZB 1JCKA 1UH4A 4IBWA 1MHEA 1ZE3H 4GNKB 5HHPB 4F3FB 3GZOA 5AW5B 1X4YA 4J3UA 2ZYRA 4PJEB 1NDTA 3FNKA 5LB1A 4HGMA 2E46A 2X4NB 3CMOL 4IKLA 4Z3HA 3JWOL 3DRTB 5FYKE 2K8QA 4OJDH 2WUCL 1KCLA 3KWWB 1CFQB 2VSCA 4QWWD 4G1MB 1AFVL 5IHZA 3H42L 4O2CA 3UJTL 3KWVA 4G8GD 4S11A 3P3SA 2BVEA 3BWZA 4FP8L 3TN0A 2IPUG 1J8HA 4LSUH 2DQHL 2JJWA 4R4NC 1HDMA 3T04D 2ZSWB 4GG8B 2VN7A 1U6AH 1G7JB 1DVFA 1WBYA 1CMOA 2MOQA 2DQMA 2XWZA 3MX0B 4PLKC 2W9EL 1RHHA 1L9PA 5ANMA 2B5IC 5A6MA 3PXJA 3FB5A 4WLCA 5HHQA 5FM5O 5ITBL 4UTBA 3FFCB 4XNXL 2G9HB 3G6JE 5TE7H 2BVOA 1IM9A 2GJJA 1H6FA 1U8HA 3PWNA 2WLIA 1L9MA 2XRAH 4LSTH 2F19L 3BJ91 1TJXA 4H0HB 3G6DL 3AREB 4QJ5B 3RUGB 5I71B 4CMHB 4PRPD 4OBSA 4JHAH 1FLRH 4KK6C 1HXYB 3H7BB 4DW2L 1A3LH 3VFGL 1S5HA 5SX5K 4Q6IA 2B1HL 3EBHA 3UAFA 3QDAA 1D5BB 4IMLA 2CLVA 4YK4B 4HWUA 5FK9B 3WENA 1A7OL 1SHSA 1MIEL 4TTDD 1TOXA 3T3PB 3NK3A 4XBMA 5ANHA 5C0IB 4WFGD 3KHOA 2H8PA 5DJ2A 2R2HA 4OUUA 3SDAA 2XWDA 5LGYA 3UCRA 1E4XH 3EGDA 1CD8A 3IMRA 2XZQH 2ZUQC 4PJDA 3ETSA 1HSAB 3VACA 3WIFA 2NX5B 3MXVL 2IDSA 4R7NB 3FCSA 1WV7T 5I8EB 1RIUH 2P8LA 4LEBA 2KI6A 5DJ8B 3VGEA 1D6EB 2DM7A 2AW2A 1E27B 3DUSB 1KBWA 2NTSP 4JKLA 3QUGA 5D1ZC 5FO8B 1TKWA 3ZE2B 2Q3AA 2AK1H 4XVTL 3W56A 4C59B 1DVTA 4MS6A 1DQIA 1AQKH 2PPAA 3QI9B 5E4EB 3HC4H 3T65A 2YPLD 2KUTA 4CJ0A 4X4YB 1NZRA 3W9DA 4TF4A 6CGTA 2OXGB 2BHYA 4GSDH 4DPRA 4NQSB 4P5SA 4G6JH 4PRHE 2G3MA 2XXGA 4FNLH 1KELH 4QHLA 5AB9A 4KKLD 1F4AA 5JIPA 2Y07H 3I9AA 4UM9D 5DGQA 1YN6A 5F1IB 1TQVA 4XVJL 5KUMA 1HJCA 4PJAA 2J2ZA 3CHPA 3RX7A 1G43A 5HHPA 4GRWH 4F3FA 1MF2H 2BWDA 5AWNL 1EO8L 4QXUL 4K8RC 5SWZB 4G71B 4KK9D 4PJEA 1MY5A 1T0NB 4NO0B 2X4NA 3VUAA 5DO2D 1E2ZA 3CSYB 3I6LE 3DRTA 1VESA 1W0VB 3CDCA 4F80A 4ZMVA 3OSKA 3KWWA 1CFQA 3GRBA 1DFXA 2EDNA 4G1MA 5L8JB 1RV6X 5JXAH 3GPEA 4HBQA 1T2JA 3J2PA 4D2NA 4PJEE 1TQBB 5LCVA 5JHLA 2ZSWA 4GG8A 3VQ2C 1G7JA 2XWEA 4J6RL 3OHMB 5ABDE 3MX0A 5AOIA 4EPSA 5IQOA 1MHCB 4PJ6A 1S7QA 1ZT1B 3U2SB 4AQ8A 2C1PB 4LCVA 3FFCA 3IXTB 4WI9A 2G9HA 5C0BB 4ATWA 3MLZH 1OAZH 2VDLL 2FJFB 2IMMA 1ZTMA 4M5SA 5E1AB 4XO3A 5JIMA 2FGZA 1WG3A 4P2OC 2R69A 3OPZL 1JZDC 3ZRSA 3A6CL 4AVIA 3QJVB 3AREA 1R46A 3U2JA 1ADWA 1WP6A 3RUGA 5E5RB 2CK0L 1IAKB 4KY1L 3KD4A 5C2BL 1MHHB 2AF2A 3VTTA 1G7QB 1HXYA 3K2KA 3H7BA 2FUQA 3PAVA 3VMOA 3LQAL 3NK4A 3QDJE 4N6RB 4RFNB 4EI5C 4XPTL 2Q8AH 1IC4L 3N40P 5FK9A 3WFEL 1YNTB 1A25A 3SGKC 5C0IA 3UTSB 3ABGA 2NY6D 2CMRL 4EUPB 3PPSA 4N2LA 1D2PA 4JREC 4NZJA 1B4JH 1BEYL 2EEFA 3OWRA 1HSAA 4FLSA 3IU4H 4HSQA 2ILLA 4NQCD 1NFDB 2NX5A 4R7NA 5GZOC 3AC0A 5I8EA 3T3PE 3ZIYA 5DJ8A 2LHAA 1D6EA 1E27A 3DUSA 4DGUA 5DJAB 2VDKH 3GDCA 5FO8A 1SOQA 4DKAA 5E8OB 2APSA 5FKPA 4WI6A 1KYAA 4PQXA 1H5BB 1JRHI 3QI9A 1PLAA 5CSGA 3ROOB 4AYGA 1I7ZB 2NX5E 2YO3A 3CVBA 1OPGH 3QR0A 1KACB 4X4YA 1MNNA 3FB6B 1A64A 2OXGA 1KYUA 2BFVL 2NY3C 3B8YA 2G0KA 1S9XB 2X89A 3BH8B 4NQSA 1ZDQA 5ACMA 3EH5B 2JJSC 3WFZA 5KJRH 3UYPB 5F1IA 2J88L 3H56A 2BIHA 3VSVA 3VD0A 5HJ3B 2P1YA 3BP6B 1NBVH 1MFMA 3HG2A 4MA1B 5E6UB 1LO3L 5I6OA 4E41B 5SWZA 3ZYIA 1ZA6B 4JREB 3ZZ1A 1NUFA 3TFKD 3TA4D 1KYDA 3CFCL 4L05A 4NO0A 3KWUA 3CSYA 2EDWA 5IW3A 1W0VA 1HNYA 3KVQA 4RZKA 3ULVL 3OF6D 4XMZA 4AW7A 4LSPH 4QIRA 4N2CA 1B2YA 5SWZE 2WN2A 3GM8A 4N90E 2APTA 4ODTL 4O9HH 3ZL1A 3TYFB 4IW4C 1TTFA 2FB4L 4WQOA 4KMTH 1IZJA 1JI2A 4MYPA 1EBAA 1AR2A 1MHCA 2O93L 1WAPA 1IC1A 4IMKC 1EJOH 1ZT1A 2E27L 5IQ9B 2VITB 2ADFH 4B7LA 1P7KB 4TNVK 2C1PA 2PXYD 2YK1H 3IXTA 5C0BA 1INEL 4XMVA 5FLUA 2FJFA 4AEFA 4W68A 5E1AA 4NN7B 3QXDB 1HIML 5J6HA 2CDGB 2WTPA 1HINL 2QSVA 1YY8B 4LEOB 2PWHA 3IS0X 1TQWA 1PY4A 3Q1EA 5GJSH 3NVQA 2C9VA 5I1KL 4ZUWB 3FQXB 3SYOA 1P4UA 4TQEL 1IAKA 1OWWA 2QADC 1MHHA 4JO1L 5D72L 1G7QA 3NRPA 3TV3L 2N7BA 4X99B 3ZHLA 3BUYB 2HX7A 2Y1YA 4DJMA 3MLXL 2DYPD 4N6RA 4Y19B 1ZXKA 1BM3H 5FO2A 4HHGA 1YNTA 1ECYA 5CGYD 3U7YH 1C7SA 3EFDH 2L0DA 1JWMB 3UTSA 1M4KA 3W11D 4EUPA 2YRZA 4PJGF 3UZEC 1K8IB 1S3RA 4RGNC 4X9HA 3Q2NA 5DWUL 2QDWA 3FU0A 2BP0A 4QGTA 4Z23A 1PF3A 3KYKL 2BX5A 5ETUB 1NFDA 1G9MC 4U1KB 5J06A 2P3YA 3CHXA 2ZONA 1VENA 1A9BB 5EBLB 1EHXA 4RLDA 5DJAA 3UTSE 5A3ID 5E8OA 1H3PL 2Q20A 2D31B 1MJUL 4OZIB 2FO8A 1SMAA 1IM3B 1H5BA 1QFWL 1SY6L 3BVUA 3ROOA 1I7ZA 1QKZH 5FWQA 1D2OA 2VKXA 3PV6B 1GRWA 2EDFA 3BPOC 3FB6A 3TJHD 2J1KA 4ZOBA 1FI8C 1JMZA 4WEBL 1IE5A 2YUZA 3BH8A 1S9XA 3FUFA 4RFOH 4B95C 4Q14A 3RVUC 3UYPA 1M42A 4K2UH 1N68A 4LPWA 1XCXA 3OMNB 5HJ3A 2O6DA 3BP6A 3H6AA 3L81A 2LT9A 2XTJC 4FULA 1PKOA 1IIIA 4NJ9H 4E41A 5ISZE 4BZ2L 3RFZA 4YSUA 2DQEH 1NGPH 1TSRA 4HD9A 1ZA6A 5CLXA 2WTOA 3DUUA 5C7ZA 3BKCL 3A67H 1I1AD 2Y6TE 2YXWA 3X1NA 2Y23A 3HE7C 3BUPA 2EUZA 2X1XR 1IGFL 1RLBA 2HTKD 2OPCA 1PIFA 4NKOA 4NO3B 4NUGL 4NWUH 1RQ5A 3ZMNA 1S2EA 1EO7A 3HA0A 4F1ZA 3HEIB 1NOAA 1CO1A 4GEJA 4E41E 1AG6A 1OP5K 2Y1AA 3PGCB 5L9DL 4KTEH 1I7RB 1LK2B 2HRPH 1GOHA 3KL5A 3NIGF 4OQTH 2AV1A 5MHSD 1M6OB 3L4YA 3PABB 4G1EB 3TYFA 3CAFA 1I31A 4YDLC 2PABA 4A2FA 4F9PA 1WAAE 2YGVA 4JO3H 4AW4A 1U8QB 1W80A 2YXMA 2WWOA 4XPHL 3X13B 3D39B 3KWXA 5IQ9A 2VITA 3S3BB 2N7SA 4AL8H 1A3QA 1P7KA 1F4YL 3BVNB 4PWEA 1X5JA 4ODXB 3EO9L 3WHE0 2CWRA 2WZPD 3HHSB 1OAQL 3QXDA 1K2DB 2CDGA 4RFEB 5DC4B 3UABA 3T71A 3UAAA 1YY8A 4LEOA 2CM6A 4Q0XH 2O30A 1ZE3C 2NYYD 3QIUC 4ZUWA 3FQXA 4AG4H 1AI1L 1M7XA 1H8NA 2D0HA 2VQ1B 1LEIB 1Z5HA 4AM0B 3HE7B 4X99A 2VDOB 3VU1A 3BUYA 2EH7L 4Y4FC 2D2CC 4PS7A 1AMXA 3VFSB 1A0QH 1X7TA 4OTXH 4Y4KD 4Y19A 1QFUH 3GIZH 3HZVB 4LLAA 3BQUB 3TBBA 3ULAB 4KBPA 1RZKL 3OKKB 3KPSE 5E4OA 3HE6D 2IDTA 4IU3A 3SQBB 4J2QA 1MXGA 3WYRA 3ZL4L 3A3YB 3QR2A 5CCKL 3O0RH 1JWMA 2NOYA 3OKLB 1NGWB 3FTUA 2V2XB 1MIMH 4LVOC 1K8IA 4PS4L 2CUIA 1B6DA 3AABA 5A2CA 4Y19E 3KYNB 5FC9A 4RSYA 4JO5A 5ETUA 4DVBA 4U1KA 4DUWA 5EBLA 1A9BA 3VI4B 2DWTA 1G84A 2J8UF 2WWKO 2MRYA 4Y5VB 4WHYH 3L3GB 2YOCA 3BN9C 1AACA 5AYQA 3QBTB 5DD3H 5JR1H 4YZFF 2XVLA 2D31A 1S7RB 4XO9A 4KXBA 3R8BB 4U3XA 5JW5B 4J12A 3LX9A 1L0XA 3DUHA 1IM3A 3FUHA 4HC1A 2WBJC 5GJTH 5D2LF 2DIAA 3PV6A 4Z0BL 3DI3B 1SBBA 1KBVA 4N2EA 5I26A 1CXFA 1Z3RA 4XBGB 4XMPL 4FG6D 4C8XA 1MAJA 4GAGL 4JM2D 3LKPB 1GR7A 2IH1B 3GT6A 4IBTA 1P4IL 1BPVA 3FRPB 3ZX1A 2ZXBA 2VOTA 3MLRH 4ZS6C 3BKJH 3BKYL 5B8CC 4OKVA 1SEBB 3AWFA 1KXVA 5EU7E 5D96C 4J3XA 3BCDA 2FO4B 1RCYA 2C7UB 2VZTA 3DVFA 3P0YL 4OLEA 5ADPH 4M9PA 3X14A 5C9KA 2CPCA 4NO3A 4FC3E 2NR6C 2WMPB 3B7TA 4PJCE 3A6OA 4HKZB 1Y6NR 2IBZX 3PGCA 3PP3K 1I7RA 1LK2A 3DLQR 4UOQA 1M6OA 3PABA 4G1EA 2TSAA 5DJZB 1CFTB 1UA7A 2DDQH 3U4AA 2O4EA 1U8QA 3CNKA 5F7AA 3X13A 4ZZFA 4G7QB 3D39A 2X53A 4TUUA 1QW9A 4N5EC 2CHNA 3BVNA 4QWWC 4HQQH 3I9PA 3QJRB 4ODXA 5CCHE 4R2GD 1MI5E 1SJHA 3HHSA 2XZAL 3MJ9A 5HYJB 5E24E 1K2DA 4RFEA 3CZUB 3QDGE 2BSSB 2BZCA 5BW7A 1RUQH 5F7KC 4LU5H 2ICWI 2DQCH 2NXYD 5BV7H 5KSBA 2HLFC 2VQ1A 2Y7QB 3B9KC 1LE5B 1LEIA 3QZOA 4AM0A 2HXAA 3HE7A 3WXWL 1B90A 1NCNA 4TYUA 5DTFB 1FDLL 3VFSA 1V7NH 1YEJL 2DQUH 2HVBA 2Q76A 4S1DD 3DDFA 4QRUB 3SDDB 3ZHNA 1RL1A 3HZVA 3KCWA 1F58H 3BQUA 3OKKA 2R2BB 2Y4SA 4NIYE 3SQBA 5CP3A 2QV2A 1HXMB 3JV5A 2J57A 2WQSA 3OAWA 4EIBA 5KSBE 3BSZL 4OGXL 3FOMB 1IC5H 3OKLA 4W9EC 3CFIC 3HKZA 5PAZA 1NGWA 2XQYG 3BGFC 3CU7A 2V2XA 1FHGA 4N1HB 4YHZH 1JV2B 2D2OA 1GAFL 3QORC 3WTSA 3KYNA 1MRFL 1PY9A 3UTZB 3AB0C 1S7XB 2H3NB 2UXFA 1UD4A 1KPVB 4G8GB 1E2VA 3VI4A 5T1JA 5I8CB 4LESA 2ZSVB 4PR5B 4U1MB 4Y5VA 3L3GA 2GUOB 4Y16D 1KEML 3FO0L 4GS7C 1A8JH 1S7RA 1XL4A 2CO1A 3WOVA 5JW5A 3FTWA 3TESA 3HAEG 5E6ID 1GGBH 4PB0H 4ANXA 1GPOH 1EIBA 5G55A 2EO7A 2ZOWA 3VI4E 4XBGA 2GIMA 4P2RB 3EJPA 3N43F 4P9HL 3LKPA 5T3XH 1KGWA 4YC2C 2IH1A 2D3VA 1F5WA 4LEEA 3SYQA 4YUEH 4PRPB 1SEBA 2EEDA 1TSHA 2CRZA 2F58L 1MRCH 3GLEA 3O6FD 1IGMH 1P7BA 2FO4A 3IBEA 2WXNA 2VXSH 5CIPB 5IHHA 4KKLC 4PBVC 5E6YA 3GNML 1QP1A 2WMPA 4L4VD 2CU9A 5DCCA 2VAJA 1I8LA 4NCC2 4IU2B 1J5DA 2AAVA 4N2MA 5J13C 3C6SA 3VTMA 4CC4C 5EEYA 4DOHB 2AJXL 2GPZA 3A5VA 4FKKA 4MQTB 4F7CB 4KK9C 4BWWA 3EJTA 4OFIA 2A9NL 1CFTA 4B0MM 3ULVE 5DLML 3PU7A 1JNJA 4N0YL 1I9RL 4EN3B 4ZTPH 3W39B 2CSPA 3V9EA 4G7SB 4IYKA 3QFDB 4TPRL 4A7VA 4PJXF 2OP4H 3GB7B 2WQ8A 4ZUUB 3MAWA 5HYJA 3IS1X 4Q9RH 1NFAA 1RD6A 2BVTA 3RA7L 2A77L 1TZOA 4LASH 4LPVA 2H32B 2Z7YA 3ELQA 4QHKI 4EIZC 2EDBA 5FGCE 1T7WA 2BSSA 2XN9E 5AALA 4R90H 3OKOB 2YPLB 2JKIS 2PR9A 1DLFL 3FC8A 3LN9A 4XOEA 4XN8A 5ESVA 1LE5A 1WD8A 2Y7QA 2WZ5A 2ZKHH 3MJ6A 5GS1B 5E0QA 3B2UC 1RK7A 4PLJD 2K6WA 2QT6A 3QHTC 5DTFA 4UM9B 4YLQT 1QLEL 4QRUA 3SDDA 1TVBB 2PKDA 2L7QA 5J13B 2ITDB 3EHBD 5CBAB 4PBXA 3OQRA 4DKFH 5I28A 3FOMA 3NYKA 1JV2A 1RURL 2R2EB 3CN1A 4N2BA 1ZLWH 4IJTA 2BRRH 4K9EH 1CJYA 3NACL 4QOKD 4YHMH 1FSKC 4FDWA 2H3NA 4KUZH 3L08A 1UWXK 1KPVA 5GRVK 5DD5H 2BIIA 5I8CA 3WIIL 2VXUH 4N6QA 1FL6B 2ZSVA 4PR5A 4U1MA 3W57A 5LXVA 2GUOA 3ZTNL 2AI0L 2ZF8A 1SY6A 1RH8A 3SN6N 2NDFA 1GIGH 4F27A 3ESVF 5KVMC 3WGUB 4NXSA 5D4QA 3CSFA 1I9IL 2UVEA 4B9IA 3N42B 5EFIB 1AO7E 1ID5I 4YDKL 2W92A 3MRNB 1XZ0B 2VSDA 2CRIA 1LK3L 4HZAA 4XHJC 2KZKA 4P2RA 1NCHA 1MWAL 4N26A 3EBGA 3T5WA 4BFBD 1SN5A 4L0YA 2BCMA 3S4SG 2HJKB 2EKSB 5DVMA 5EEUA 2FHCA 3GXIA 4PRPA 1NEPA 3QAZC 2VERN 3CN2A 3SY0B 4P2RE 4GP5B 5C0AE 5CIPA 1HWWA 1XHHA 3LNEA 5AW3B 1SFDA 4LDOB 4KZCA 2CCLA 2ZT9C 4ZW6A 5HY9B 3HZ3A 5F6IB 1LEGB 5HVWA 4IU2A 4UINL 4EZLA 1JIBA 3CXHK 2NY6B 2C4FU 3QG7H 4L2YA 1PLGL 3WNLA 3FQRB 2DI7A 4F7CA 4M6MH 4I3GA 1LDSA 3VXQB 1ZHKB 4EN3A 4NQCB 3W39A 1MFBH 3CZEA 2VRAA 1SQ2N 1TJGL 2Z4QB 3QFDA 3GB7A 4DUVA 5KYNA 4DOHE 1OLLA 2K9FB 4ZUUA 5L0QC 4Z7QB 4OM0L 4X7DC 2H32A 2VQTA 5TPWL 3OKOA 2NNAB 2YPLA 2HSIA 1SYVB 3SE4A 3L3OB 1FHNA 2FX8H 2ZCHH 4PM1A 4XB3A 1NAMH 1ILUA 2ARJB 4LDLB 3QIBD 5GS1A 3CVDA 2PXYC 4PRDB 1VACB 1IGCH 1KTDA 2IADB 1EX0A 1Y18B 3U7WH 1DJXA 4UM9A 4ABUA 1TVBA 4ZX3A 5C0CD 3ATAA 5TE6L 3JWNG 3CFQA 4KKRA 3UX9B 5CBAA 3RFRA 1YNLH 4LIQL 2WVTA 5FYJU 4S0HA 3DTXA 2CO6B 1OARL 2R2EA 3B2MA 4OD3H 5LUMA 1XSOA 2RJMA 4Z6AT 4ZW7A 4TN9A 1OAKH 2Z3FA 3MA7B 5FYJD 1AJ7L 3NP4A 1XB8A 1DANU 4PBDA 2P48B 1VADB 5KJ7E 1NCBH 4AL8C 3ARGC 1EUUA 2Q1EA 5L0QB 1FL6A 3N55A 1NSNL 4YSRA 1JFQL 1A4CA 4ZMWA 3IFLL 4PJBE 2IOOA 1IQWL 2MNUA 3GKWL 1ZVYA 2BSDA 1RUAH 4UDUB 1F86A 5EFIA 5F0PB 4FNRA 1J9RA 4G7VL 1TZAA 3MRNA 4EJ1C 1XZ0A 4MMYB 2VMJA 1DQKA 3CVHB 3M7OA 2VN5A 4FABH 1AS8A 3ZKXC 3ZUCA 4AVHA 3VYNA 4ZS7L 5IVXF 2HJKA 2EKSA 3H3PL 4FFWD 5C7XH 5F9OL 3MRDB 4RMTA 2VJ8A 4HJJL 1AY1H 4JY5H 5D1QC 4OJCA 4M62L 1BQSA 5D71L 4FFVD 3SY0A 5IROA 4LCCC 3TJHC 4N9OB 1JHTB 1MFUA 3H9HB 1ZDSA 2DYPB 2D73A 2WYIA 3MO1B 4RWHA 4R8WH 5HY9A 3TBWB 1JPSH 3R1GH 4FL4B 5J11C 1LEGA 3ULUF 4ONGL 4L1DA 2EINB 4KZEL 5F6HI 3CN3A 1NPNA 2BIOA 1OXYA 3VD5A 3GUFA 2YSTA 3FQRA 3IAPA 2GBVA 2V3DA 4KI5F 3VXQA 4B9JA 3UYRL 2V7NB 5J3HD 1ZHKA 1I1AC 1O5PA 3QXTA 4NQCA 3V9FA 3DO7B 1IO4C 1HEZB 2FQFA 4OV6F 5C3TA 2Z4QA 3TLRA 4HUUB 1OE1A 5AB2A 1R6VA 4M1GH 5TQ2L 1WZKA 4GSUA 2EDRA 4YEFA 2H3KA 1H9DA 2AQSA 5K9QG 4F15B 1D5IL 2NNAA 2XA8H 5FYJH 1SYVA 4NIKB 5A2FA 2GKIA 3L3OA 3A6BL 4M48L 1DQQB 4XCCL 1YHPA 1QLEB 5D7LD 2X3CA 5DHYB 1AOZA 2XVGA 4PRDA 1FV1B 1VACA 3NZHH 2IADA 4QTHB 1JZFA 1Y18A 1F45A 4RDQF 5FUCC 4G6KH 4XRCB 4HIJB 4JRLA 4XODA 3ULUD 4JG0H 2XZCH 1MWOA 2X4RB 4Y5XC 3BRDA 1L9RA 4PJGB 5ITFB 4XNYH 1UUNA 3RDTD 4A55A 2P5EE 1Z3GL 3MV11 4KI5D 3QP3A 4WV1B 4IIQC 3ECVA 3VRJB 2CO6A 5C6TH 2OJZL 1I1AB 1G1CA 4L37B 3O2DL 4BHUI 2H1PL 1BOGB 4EZKA 1CGSH 3MBWB 2KLRA 1JHLL 3MA7A 4Y4KC 4D0DB 1VADA 2HT2D 1KCUH 1ZT4B 1KDJA 4W70A 4GJTB 5BPPA 1AP2B 3QWRA 4AEIH 2M8XA 4RESB 1BXUA 2KKQA 3THML 3PFQA 1UT2A 1ZIBA 2R29H 3QUMH 1KXQA 5T5FA 4OD1H 3CK0L 2A1WL 5IQ7L 2V4LA 5D6DC 3FB8B 3K80A 4UDUA 2PWFA 5E1GA 1A6WH 3HBPA 5EF2A 4K5OA 1NDGB 5BV7C 2BNQB 1G7PB 3GZKA 3NJIA 4H8UA 3CVHA 4MMYA 5ERWB 3IDNB 2I32A 1UZ8B 3O2WH 1KY7A 4J3OH 5L2JA 1E4KC 2APVA 4I3RH 5JMOC 1IAIM 4OZFA 1BBDL 2VUOA 3MRDA 3CLEL 2ZX9A 1TT6A 2A6JB 2VLLB 1F41A 1ZLWK 3C75A 3D4ZA 4U6XB 3VD1A 1AZVA 1CLYL 4M56A 4YWGH 4UIKH 4EXKA 3SBRA 1JYNA 5AVRB 5D7IF 3BWUC 1JHTA 3FU8A 4JDEB 1GH7A 3H9HA 3RNKB 2DYPA 3A4FA 4FG6C 3MO1A 4G6FD 4JM2C 1KB5L 3TBWA 3A0OA 4WWID 3HE6B 4UV7H 5AKRA 3T3MB 1IC7H 4MNQD 4WUKL 1FFTB 2W8CA 3M8OH 4S10A 3T8XB 2G0LA 2R1YB 25C8H 2YPVL 4KKZA 1ILSA 1SJMA 2H45A 4RX4D 1W9XA 1LL1A 2P5PA 5JZ7D 1AHKA 4HYTB 3UBXI 3ZQXA 4YGVB 2V7NA 3DO7A 1M2OA 5B1JC 1A7PH 5IVOA 1YEIH 3F83A 3SYAA 1V3LA 4LOUD 2WNWA 1TDQA 2OR7A 1NOFA 3P4LA 4QGYA 4PY8I 2X0WA 2BY3A 3ZOAA 3OJMB 3ZU8A 4DQOL 4XNBA 2F7IA 3FMGL 1BQHB 4NZFA 3UJTH 1CGUA 5MEND 4GG6E 1A3ZA 5CJ8A 5IJVB 3TEWA 3FQ4A 3CH8A 3BXNB 4FP8H 3QJQB 2AS5M 2DQHH 4I85A 1DQQA 2R1WB 5DHYA 2E8ZA 3FPXA 3MUHL 3ARZA 3KBEA 1FV1A 2W9EH 4JM2B 4CGUB 1LO4L 3U79A 4XRCA 4ZNEA 3S98A 5M95B 4HIJA 5ITBH 1GGIH 1WWCA 5F96L 4OCWH 3T08A 2X4RA 3ES6B 4ZJ9A 1PSKL 1WBXB 4PJGA 5ITFA 4KNTA 4NBYB 3ZDZF 5GHWH 4ECNA 4WV1A 1NCTA 4JHWL 3VRJA 1J0ZA 3FSOA 4LT7A 3VGGA 1I1AA 5H8DA 4L37A 5HPOA 1KFGA 3G6DH 3U9PL 4FI7A 1BOGA 3MBWA 2J8UB 1IAII 4NHCL 4J7RA 3UERA 2RIKA 2P8MB 4PJGE 2GFBB 2YZ1A 2VRQA 3VX1A 1ZT4A 3LNDA 3VFGH 5IMMB 4U1SB 1AP2A 2B1HH 3U0TB 3RKPA 1L3WA 2FBJL 4GH7B 2NXZD 3BESR 4P49A 2P5WE 1MIEH 3NEEA 5D2LB 5CAYB 2VR6A 2V17H 3FB8A 4U33A 4YMPA 4HLEA 1KGIA 4JFYB 3D5OF 4IHOB 4Y8DC 1ONQA 3BN3B 1NDGA 2EXTA 3D06A 2BNQA 1G7PA 3HG0A 3CJJA 5EBWB 5ERWA 2WZPA 4R2GB 5MHSE 3CHOA 3F65A 4NC1E 2P8PB 3IDNA 2FJUB 3MXVH 5DU7A 4LLQA 1UZ8A 5HYQB 4BKSC 4AKPA 5FHBL 3ATEA 4Z7UB 5ID1B 4HCRL 1F1AA 2A6JA 2NXYB 2VLLA 5E6IC 4DK3A 5HYEA 2H1LM 4U6XA 3QCUL 4XVTH 1UYWL 2BNQE 5JOPD 1WS8A 2PP9A 2H9GA 2VMCA 3FBKA 1E6JL 3QWOB 1ET8A 3PWVB 4JDEA 3P11L 3RNKA 3T6QC 5E4IA 4U3CA 4B60A 4KQ4L 4K9EC 3HE6A 1SFHA 2ZAGA 4PFEA 4DPBX 2DBJA 1JZ8A 1EXUB 5DGRA 3T8XA 5F1OB 1Y1DA 3GM0A 4C4KO 2R1YA 3ARPA 4EUPG 4XVJH 5AKTA 4WW2F 3ARDD 4YDIH 1TQUA 4N1EA 4OGQC 4FMKA 5DHXB 1X5YA 3DA0A 5A6LA 1EO8H 1EAPB 4QXUH 5DD1H 3KDPB 5E94B 4XNUL 3NIGE 4JCWA 2B7DT 2DJ4A 4JQVC 1LP9F 3ZBMA 4N5UA 2MQGA 4JN1L 4ONOA 4Y16B 2OYLA 1U8LB 2H26B 3RTQD 4HUNB 3WL9B 3A23A 4WAFA 1BQHA 3D87B 5J57B 2OQJB 4LOEA 1KWKA 4AITA 2DLFL 5IJVA 1OGTB 2NY0C 2MTAA 3BXNA 3DBSA 1HESA 1I7TB 1NCAL 4J6RH 1NBQA 4AGQA 2ZJSL 1VEPA 1VZHA 4MB5A 4JM2A 4LLMB 1A9EB 2Z7ZA 5F93C 1T22B 5L88L 3ESNA 3LEXB 3HI5L 4Z7WB 3ES6A 3NQKA 5A2JH 1R34A 1WBXA 1XVSA 4RMRA 5FCUL 2HJFB 3NCJL 3O6FB 5I0VA 2FECI 3POCA 4PU2A 4DP7X 3EBIA 3A6CH 1INDH 4G5ZL 2GT9B 3O6LL 4GRLD 5DA4A 5G4NA 3RI5F 5IEKB 3KPLB 1QSZA 2CK0H 4KY1H 4NFCA 2J8UA 4L4VB 5EOCJ 4ICWA 4YE4L 2CH8A 2CCWA 2EYTB 4LIQE 2P8MA 3T6XA 2GFBA 3GJFA 3EFOB 5IMMA 4WCYH 4U0QB 4U1SA 1BDYA 4ODUB 2GJPA 2XVBA 3U0TA 2GHWB 3NJXA 1TETL 2HH0L 4XPTH 1IC4H 3KLAB 2EEBA 3WFEH 3OGOE 4I0KA 4G7YL 2WBXA 3NJJA 4U0RB 4L1BA 5D2LA 1O9VA 3WTUA 2J8UE 1KENH 2J5LC 2AXHA 1JDAA 4JFYA 3HN3A 3EDEA 3N43B 4ZMZA 3KW7A 4ZXBD 4IHOA 3IBOA 4UYQA 5EBWA 4BSJA 1FGNL 3QUXC 5B39G 3P2DA 1AHWB 2P8PA 4F57L 1UXSB 3IFOB 3Q3GB 5HYQA 2EVIA 4WGKA 1LO0H 4TNFA 4Z7UA 5FYLL 5ID1A 5DWPA 4WKZB 1M1SA 2F68X 4ABVA 1E4WL 4KV5F 4LNVA 1KIUB 3IGKA 4B27A 3FT0A 2DQTL 3AGVA 3QWOA 4Y5YB 3MV01 2O5XH 4YSEA 5JTWA 1FNSH 3NEXA 5HHME 3TZVD 3JT2A 4I8DA 2KMWA 2IANE 2BFVH 3EHBB 1L9QA 2ZX6A 3D2UD 2WIIB 3IETB 1ACYL 1EXUA 5EORH 2AJ3B 3C9NB 1WFJA 3C60D 4IRJC 2J88H 5LNDA 5AZUA 5D8JL 4WWKD 2ZCLL 1LO3H 1M57B 1EAPA 4PJXB 4QOKB 2IVFC 5E94A 2CNYA 3OGCB 2GABA 2DMCA 1DN0B 3CFCH 2OSYA 2AKRB 4MXQD 5JMRA 3EIFA 4OCSH 4WO4D 3IMSA 4Y16A 2DOCA 3NP3A 3H8NA 3LHAA 1U8LA 4TNWK 2H26A 3OSVA 1U8OB 4O2EB 3WL9A 1JBJA 3ULVH 4M6NH 1CPUA 5KVEL 3N41F 3CU1A 1OGTA 2ENPA 2FR4B 4JR9L 4R96B 4ZMOA 3OR6B 4RMSA 1I7TA 3TBSB 2HKFH 5F2FA 4JRXE 4K9JA 4R7XA 2VM9A 3SGJC 3FFDB 4LLMA 1BQUA 1A9EA 1AAJA 2E27H 5AKVA 3T2NL 1T22A 3BAXA 3LEXA 4TL5A 2CE6A 4Z7WA 1X6LA 1INEH 2F8OA 1LTXA 3B2PA 2HJFA 4GB9A 1BVNP 2C4XA 3O6FA 4B96A 4JDVB 4FQ2L 4TXVB 2W38A 2OFQA 3CQQA 3T2OA 2H0FA 1TEFA 2GT9A 3US9A 5IEKA 5I1KH 3KPLA 2AXJA 4X5XB 3DV6B 1QSVA 1EANA 5TK2A 3SPIA 2OA9A 4L4VA 1OT2A 5CZVL 1A66A 1X6NA 4JO1H 1P7QD 5D72H 2EYTA 3IFNL 4MAYC 3KWTA 5I9QC 1IGTA 3V0EA 3T4AB 3EFOA 3BUIA 2I60L 4ODUA 3MLXH 4ESKA 3KR3H 4KPHL 3UTTD 2WJ5A 4BZYA 3EO0B 1AMYA 1UT9A 4XXWC 5D7JC 1KGCD 1CC3A 3VFMA 4KAQL 3GMMB 3FTXA 1MOEA 1SLXA 2A4EA 2WC7A 3IE4A 3V5DB 3U4KA 5CN1A 1PD6A 4K94L 3U1SL 5GGRY 5DWUH 2B16A 1ZMYA 2NSXA 4UV4L 1AHWA 2Q0ZX 1QTSA 2CR3A 2H41A 5FS5A 3OHXA 2VYRE 1UXSA 3Q3GA 2EUWA 2JIXD 3CDZB 1I8MA 3ZDYF 3MACL 5EDXA 2BP3A 1REIA 4WKZA 5DEFA 4BKTC 1H3PH 3F7VB 3QIBB 1BXVA 3F58H 4MBOA 1KJMB 1OGAB 4FTVD 1KIUA 4PP2B 4Y5YA 1QFWH 4HH8A 4E9RA 3F05A 1J5IA 5I9QB 1X5GA 4IS6B 4LSRH 2HPTA 4UMSA 4CGTA 2QQQA 5C0CB 2RBLA 3RIFF 4WEBH 3KZ8A 1F4WH 2WIIA 3WKML 5L6YL 3GSVB 3IETA 1XF3B 4LFHG 2AJ3A 3C9NA 3RVXC 4QTIL 1FWXA 2R23B 2EIMB 1P5UB 3EH1A 4FFVC 2J6EA 3VB8A 4XPFL 1VIWA 2CQVA 3MA9L 4PJXA 3EF4A 4QOKA 4HD5A 3S34L 3DV4B 3OGCA 3IJ9A 1IBDA 3RGVC 1DN0A 4N0UB 2YUWA 2AKRA 1A3RL 1THAA 2G3XA 5DMIL 1JXDA 4XX1G 1IGFH 4NUGH 1MCLA 4WI0B 4GLRI 2R9HC 4FFZL 3OMZA 4MA7H 3DHUA 4O2EA 4NKMB 1I8IB 3RY6C 4WHDA 4J3OC 3V4VL 1WICA 3E2HC 3F7QA 4D3CL 3ABKB 3ARFD 5L9DH 5J3HC 3F5WB 4CBZA 3DGDA 1BJ1H 2FR4A 4R96A 4CN1A 3OR6A 2AFNA 1HWGB 3PNRB 3TBSA 1HKFA 2RA1A 4JRYE 4S1QL 3FFDA 3PWPD 1JYXA 3QZBA 3FRPG 2CGYA 4HCIA 1F4YH 4F58L 3EO9H 5DHVA 1VEMA 3RWHB 1OAQH 4ZX6A 4HWZB 4PPTA 3N44F 4ZRGA 3QUMB 2O26U 4JDVA 1PBYA 1OVZA 4RGMC 3FUKA 4KGJA 5GRZA 2VE6B 1DQML 2QZ5A 2W0KA 3B9EA 4P3CL 1AI1H 3DV6A 4KDTA 4X5XA 4NLHA 2ZUVA 4C57C 1RU9L 1QBAA 4CUCA 3T4AA 2EH7H 3ET9F 3RDTC 1CYGA 3WKNA 3HR6A 1TR7A 3EO0A 4JFZH 4DK6A 3VSTA 4PJ5D 4CA4A 5CCKH 3GMMA 1CK0H 2I7OA 2LQRA 3DMMB 4HAGA 5HVHC 1U95B 3U6XS 3RIAK 1ZEAL 3AMKA 4HWBL 4Z76B 2ITCB 2KPWA 3MFFB 1PAZA 2ENYA 4ABQA 2HT2C 1MREH 3WAKA 1XR9B 2IPTL 2K78A 2KQMA 3KPNB 3CDZA 2VLKE 1N18A 5BNXD 1F11B 2J44A 5CN3A 1L6XA 3VG0L 3F7VA 3QIBA 4FD0A 5D7LB 2VDMH 1KJMA 1OGAA 1GOFA 4HVBA 1F4XL 3DK0A 3ZSTA 4GKOA 1FNAA 5KVDE 5T3ZL 1U9KA 3GXUB 1G6VK 1JGLH 4IS6A 4Z0BH 3V0FA 3MOBL 5C0CA 5F0JB 4L4JA 5K1NA 4QHPA 3GSVA 1XF3A 4FCHA 4GAGH 4R26H 5J12B 2DAVA 1OGAE 3PAZA 1P5UA 1P4IH 2WYHA 4UOW1 4OD2B 4PP1D 2FVNA 3LS4H 2Y3NA 5DJCB 3BKYH 5HVHB 3T4YB 1KOAA 4WVRA 5HDQL 3HFMH 4W9IC 3TH4T 1A4JB 3DV4A 2HMIC 4N0UA 2AEQL 1KCRL 3LPFA 3BAWA 4RRPG 1EFQA 2WNKA 4WO0A 1PFCA 5AYTA 3BUDA 4WI0A 1JZ7A 4NKMA 1I8IA 5ENWB 2ZYSA 3SD5A 3VXMD 4BGDA 5JZ7C 3U2IA 4IK7A 3F5WA 2WYTA 5B3JF 3FFOA 4K71B 1Q9OB 4O58L 4OZGF 4PJ8C 2YD8A 2ZP8A 1SRDA 5FHAL 4Y88A 1KLFB 3UC2A 1CR9L 1OCRB 2OTWB 4JQIL 4AGLA 3IRZA 3L54A 5IZ7A 1D7BA 5D4JA 2BSTB 5ICZA 3O4OC 3RWHA 3WEBA 4HWZA 2GBTA 1KYOJ 1AGDB 5EU7C 3MUY1 5LDUA 1MCSA 3QUMA 5KYXB 3UC0L 2FZ3B 1E8XA 4MXVF 5DQJB 4G6FB 2VE6A 4BELD 5C0GB 3CMGA 1KCSL 3QXUA 2XIIA 3CZGA 4NLAA 4ZFGL 1DBAH 2FGWL 5JW4N 1QNZL 4WIQA 3WXWH 1UATA 4MNQB 2EE9A 2J55A 4DSYA 1YEJH 1OE3A 1QWHA 1I3GH 2PYED 4E42A 3MLUL 1D7DA 3IAQA 3JSSA 1YZZA 4L1SA 4E9SA 1RY7B 5JUEH 4LEXH 5E8NB 3DX9B 1VERA 4OGXH 3TURA 3DMMA 1T7YA 2DTSA 1U95A 2ZNWA 1U8KB 4Z76A 2ITCA 5E6ZA 5E8PB 5DZLA 1SXZA 4K3JL 1GAFH 1B2WL 2YQGA 1XR9A 4M7KL 4ODVL 4P4KD 3PPEA 3NEOA 1CF8H 3DURB 3KPNA 3O4OB 1XXDC 2XN1A 4EXPX 1F11A 2HZHA 5E6RB 2JE8A 1ODAA 3V7AG 1WH0A 1J12A 5D7IB 5E08L 4BE5A 3FO0H 2ZXGA 2YJLA 5D7LA 3ROLB 2ITEA 2Z93B 5IVXE 1X5FA 3SKMB 3B56A 3JTSB 3KLLA 5FYLE 4DVRL 2QMKA 3V52L 2VMDA 4XPGL 4OIBA 4F5CA 2J72A 3P0VH 1W8EA 5HGDB 1DSFH 3FU5A 5D1XC 1V8HA 2J20A 5HHOE 3HZMB 3KVDD 1VAHA 1WCQA 2BDNH 4KJWC 4OFQA 4MDJB 5I76B 2V5MA 3RZWA 1IV8A 2G2NA 2LLGA 2J25A 4OD2A 3D85D 1MJJB 5DJCA 4H8HA 3B1UA 3T4YA 2ICWJ 1F0LA 1MKFA 2YAHA 4UT6A 4F5CE 3QEUB 1A4JA 3L5WB 4HIEB 1FE8H 4WK4B 3WSQL 1OB0A 2VIRB 3K6DA 4PGEB 4KI5E 2VKWA 1RI8A 1NCWL 2R0WH 3NCYP 3OG4B 4DWHA 2NXZB 3V4VB 5HGGS 1ORSB 1XF5B 3GNMH 4BD4A 2XY2A 3MV9D 2ZXCA 3CIAA 5ENWA 5SX4I 4I4WB 1D7FA 3L4TA 1Z9SB 2MCMA 2QPSA 3UJIL 4J4PD 4C56D 7TAAA 1A02N 1Q9OA 4FEIA 3NAAH 2A9NH 3QZMA 4X8CA 4UTAL 3BSHA 3QO0B 1JZ2A 3LMJL 4N0YH 5KVEE 4JG1L 3KLKA 5CD5D 1BG1A 4MAZA 2OTWA 5E0FA 1RMFH 5FUZL 4TPRH 5F1SA 3ZDZB 1UOLA 2BFGA 3V6OC 3NBNA 2BSTA 2QJDA