1G1KA

Cohesin module from the cellulosome of clostridium cellulolyticum
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
143
structure length
143
Chain Sequence
ASLKVTVGTANGKPGDTVTVPVTFADVAKMKNVGTCNFYLGYDASLLEVVSVDAGPIVKNAAVNFSSSASNGTISFLFLDNTITDELITADGVFANIKFKLKSVTAKTTTPVTFKDGGAFGDGTMSKIASVTKTNGSVTIDPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SCAFFOLDING PROTEIN
publication title Crystal structure of a cohesin module from Clostridium cellulolyticum: implications for dockerin recognition.
pubmed doi rcsb
source organism Clostridium cellulolyticum
molecule tags Structural protein
total genus 32
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1g1kA00
2JH2A 2Y3NA 1ANUA 2B59A 2VO8A 2OZNA 3F2LA 1TYJA 1OHZA 3BWZA 2CCLA 4FL4C 4DH2A 2O4EA 4UYQA 4N2OA 3KCPB 4IU2A 2W1NA 1ZV9A 4WKZB 4UYPA 3KCPA 3FNKA 5AOZA 2VN6A 3UL4A 2XDHA 4WI0A 5LXVA 3L8QA 4UMSA 4IU3A 1G1KA 4FL4B 4U3SA 2ZF9A 3GHPA 1AOHA 5K39A 2BM3A 1QZNA 2VN5A 5G5DA
chains in the Genus database with same CATH superfamily
3VXUD 2N1TE 4WLCA 1PKQA 2IXQA 3A24A 3INUL 1ZLDA 5D1QD 5CKAA 5ICXA 3B9DA 1PLBA 1KBPA 3WKML 1AD0A 1OIOA 1UURA 2GUOB 3AY4C 2NNAB 3HAEH 4NHCH 5GZND 4J3UA 3BRDA 2B5IB 2WWKO 1LNUB 1GCYA 3IPFA 3MA7B 2WVSA 4BSJA 5BMFL 3B1TA 3CVDA 5LN8A 1K8IB 1AIFB 1HXMA 4PJ6A 3ZTJG 5KVFH 1I4FB 4JDVA 3QCUL 2NMSA 4LRNH 5ID1A 2HJKB 2VLLA 1Q94B 3QZBA 2OZ4L 2X4UB 4DGIH 1RZ7L 4YHIB 2A6DA 3D3VE 1WD8A 2XZZA 3QUXC 4I89A 4L5FH 3U9UB 3CVBA 3ZDXF 3AADB 4YPGA 4CGUB 3M7FB 2Y5EA 3HHSA 3QDHA 5F1OB 2GTZA 4GG6F 1N0XH 3AXLA 3UEZA 3DSFH 3EJCA 4P06A 4QRRA 2I24N 2F19H 3F58L 2XC8A 1C08B 2ORBH 3FTXA 5SV3A 3JWDC 3K8KA 5JOEA 2UWEB 3V5DA 3B8YA 5CEZL 2VQ1A 4NM4L 1DL7H 3TJHD 2VL4A 3H9SB 2GSGB 4R26H 2BLFA 4W9IC 2BSTB 1EDQA 4MNQE 1LWHA 4YUEL 1UCBL 5D7LA 4BFFA 1UH4A 5LXGH 4ISVB 5DEZA 2J8OA 3AG2B 3WO4B 1GIGL 3D7PA 5CLYA 1L9SA 3HZMB 4EDWH 4JO4L 4GNKB 3QQ9D 2EDEA 5IF0B 2O6CA 3BDBA 4BFKA 1FO0B 4QRAA 4GP5B 4XCNA 1VACB 3QJVB 5ANME 3UTSD 3QDGD 4KRLB 3BWUC 1SJVA 2OSYA 5DHDA 5DLML 3PGFH 2IADB 1QZ1A 4RAUB 3SDDC 3C5ZD 4L2YA 3OVUB 4KKLC 5FW6A 3SPGA 5DZLA 1RUAL 3JTSB 3I6LD 4LLVB 5I1HL 1YMHB 3E3QE 4XNXL 5IMOA 4NT6B 2PW2B 3L17A 5IHZA 4AGPA 4TYUA 3KW8A 1FZMA 1A4KA 4KU1A 2BY1A 3Q3GA 5CINL 2V8MA 3STLA 1F86A 2YOCA 1TJHL 1GGCH 2WXNA 3KLSA 2G2PA 3HNTH 3QG7H 4H7VA 4UIMB 4M03A 3REVA 3FT9A 2DM4A 4JKPH 3ROLA 3D18A 1CDIA 1HNYA 3JYBA 4NQED 2XTJE 5IR1A 3ZE1E 3SBWA 5D72L 2ATKB 4UINL 2AZAA 4DN3L 1PZSA 4PVMA 3ULSB 1SDDB 5D70H 4LLUA 1EANA 2MHAB 2VR6A 3W9EB 4LRIA 5IB4B 3BAYA 4BHUI 1E27A 1KJMB 4IBQA 4Z7QE 1W8EA 3L3KA 1KWGA 2EDFA 5E8OB 2VXQH 3S34H 4PGCB 4KKCD 2HSIA 4K55A 4NO0B 5CN2A 2D7TH 4HQQL 5F7MC 2LVCA 1NKGA 4A7VA 3FHEA 5K1JA 2FD6H 2IQ9L 3OKEB 3AB0C 5INCB 3C2AL 1NCDH 3D0LB 1JP5A 4KKRA 3ARBC 4WEBH 3V0AC 4NUMA 1FGNL 2E47A 2XZAL 3DXAA 4JAMA 4MJIB 4LDCA 2WCPA 2F1AA 5DYOA 1JWMB 5SWQA 1OSZA 3GLEA 4Y1TA 1JDAA 4JPWL 1EFQA 1EEUA 1X5FA 4KQ4L 3FN0L 3ARED 5JPNB 3U6RA 1UACH 1EEYA 5L4JA 3QXTA 3V4UL 4BJLA 1KLUB 3EF4A 3MLSH 4LARH 5KS9B 5F9OL 2GT9A 3QNYA 1FVCA 2AQ2A 2CPUA 4YFDB 2AV7B 5CJ8A 2EH7H 1DJYA 1XGYH 4O51A 3FO0H 3MRGA 8FABA 3BDXA 4D94A 4PGEA 5DRWA 3V6FA 2B77A 4ZW8A 1Z3GH 3WFHA 2BIQA 1RPUA 3IFLL 4MXVE 4M93C 4BE5A 4YSQA 4BK5C 5E70A 2APBA 5HHME 1XR9A 3UTTA 3DX9A 4ZFZA 2DW5A 1JRHI 5CEXA 3FCGA 4Q0XH 3EBGA 3WXVH 4N22A 3GTTA 4G7YH 4X7FC 4ZUWB 1RZFH 4OFDA 4P23A 4L0PB 5E94B 1UWGL 4R8WH 4S0SD 5C0CB 4PJ8D 2HRPL 2X4RA 4X7DC 1B90A 3AQZA 1KBVA 2XG4B 3DIFA 1TTGA 3JTTA 2IC2A 1XGRA 2C7FA 1UM4L 4Y16D 3TZVD 2HN7B 4OZHA 1BQLL 4YHNB 4OLZH 1KTJA 1O6VA 2AQ1A 1NBYA 2NNRA 3H55A 3LZFL 3RTQA 3V4PH 3CGTA 4RLDA 1T1YB 5C8JA 4NO3A 3DGGB 1WFJA 4GKSB 1YUHA 4JPVL 3UAAA 3NDZE 2X88A 3T4YA 2W59A 2BNRA 4PGDA 5D93C 3DUSA 5JIKA 3FO2B 1TEGA 3ABGA 3QVAA 4DQOL 2O5NA 1OAJA 4HS8H 1HX0A 5IWLA 2IDQA 3B9AA 3VD9A 2WXQA 3HE7A 4QPEA 3BPLB 3FSAA 2C9UA 1QLFA 4Z7NF 1MJUL 2XY1A 4JREB 1U8CB 1Q9KA 4KXZH 1L7IL 4HCGA 1IBGL 1UKSA 4Q74A 3WN5A 3X11A 4XC1L 3UPCA 1RIUH 4CVXA 7FABL 2C9SA 1E6OH 2GJ6D 1MN4A 1JL8A 2OMBA 4DVBA 3HNSH 3S8WA 3TJEL 4AEEA 1S7VA 1FNSL 1RVFH 2ZCLH 3K4AA 5IJVA 1W0WB 3MQIA 5J1AA 1A3ZA 1O5DT 4LSPL 4AM0B 5FB8B 2UZXB 5C2UB 3CZFB 1O7SA 2AJYH 5KSBB 2GTQA 5AB9A 2PABA 5FO9B 5DC9B 2X05A 1CICC 5AOLA 2EDMA 2GTWB 4MRCA 5FC9A 5LVEA 5HPMA 3V55A 2JI3A 4NN5C 1IGIH 4XPFL 3EOBB 3LQZA 1A6UL 4PJBB 3O8XC 3ZKMC 3OM3B 1XSJA 4E5XA 2DIAA 4TULH 1E4XI 3CK0L 3IF1A 2VDNB 1AHWB 2J20A 2UX7A 1IEHA 1D7BA 1FPTH 1NCBL 2FATH 4G11A 3UG4A 3OR6A 4PB0H 1R5IA 3VWKB 2K6YA 4Z7AA 2DYPB 3LQAL 4C83B 1BF5A 1QNZL 3FUFA 3HRPA 2VW6A 1HHJB 4AENA 1PFOA 3IJ7A 2BP0A 4QRQB 2YBRB 4WU7A 5BVJB 3AMLA 4X8CA 1TJMA 2AS5M 1CLZL 2PPCA 1TT6A 2GAZA 4OF7A 2E4TA 1AGEB 2O6PA 1MJ7L 4OZGA 4O02H 1H6TA 2F58L 2H3XC 1A4JB 1IGTA 4WU5B 5C0BD 3L1FA 3O6FC 4TQPA 4XPAL 2DQUL 3WHXB 4F8TA 5IB2B 1AQHA 3FQXB 2JVUA 2OAAA 2JQZA 1Q4NX 5D2LE 3UAJC 4PG2C 1KJVB 2FEJA 4W6WB 1O7DE 4QNPE 4H8QA 1AGFA 4JLRA 4EXPX 4F2EA 5EZPA 2DN7A 2DEYX 3I3DA 3L3GB 3T5WA 4XPHL 1BM3H 3Q8EA 4BZ2A 5E9DD 1XR8B 1FGVL 4LCWB 3D4CA 3IRPX 3TN0C 4LCUB 1A9EA 2NQ3A 5C70A 3M07A 5C08D 3FFOA 1N7ML 2EIJB 1OAYL 4OF5A 3T6VA 1UKTA 4N5ED 4C8XA 4D9RE 2XZCL 3LIZL 2DBJA 4NHCL 3J8F7 5GRVL 1FL3A 4S11A 2X1QA 3TVMC 3ZIYA 2R56H 2OW6A 3IJSB 4XHJD 5ESQA 4NKMA 3F7QA 1RD6A 2CCWA 4WHDA 5LJYH 1UXSB 3HVDA 3U1SH 2WNKA 1P5UC 3PWVA 4L8BA 2MCAA 4YHKL 5BZZA 4P9ML 1C12A 3L4VA 4HUNB 4K5MA 4BH8A 1S7QA 4K4KA 3QUMA 1TZOA 2NT1A 2GHWB 1ID5I 4ZFGH 4GUQA 1NZRA 1PLGL 1GA2A 3OB0H 3BSZH 5T1JA 2QPSA 3C12A 4J3OC 4D2NA 2XX1A 3FC8A 1HHKA 2CGZA 2F19L 4GMTL 4ZFFA 3RDTA 2ORBL 3OPZH 3VXMD 3BRGC 1E5UI 2EKSA 2HRGA 5HHQA 4PJ7B 3DTXA 3C8KB 1EZVX 4QRTB 3S36H 1OQOA 3JV6A 3RZCB 2HTLD 3BAWA 3CZNA 4KDTC 5E8EB 3UJIH 3WNKA 1LO3L 2FBJH 3P9MB 1JRHL 2Z31C 3MBEA 2P52A 5FFLA 3RWGA 1CMOA 2J3SA 2E59A 4HCRA 5J13C 1MJJB 4DTGH 2AK4A 3G5VB 1BF2A 4ALAC 5JHBA 2OL3L 1ESOA 1XCQB 4X4ZA 2FO4A 3PUUA 2E9WA 4F1SA 4AL8L 1P84J 5B4MD 1DJIA 1S8DB 3O4OB 3CPLA 4HC1A 1PIGA 4QYOA 3RJQB 1R34A 4ABWA 2DH2A 5FCUL 2N01B 2G2NA 3ES6B 3VDCA 1AKPA 3NPSC 2O5ZL 4N6RA 2D7PA 3T8VA 3GSVA 5AKRA 1AKJA 2C4XA 2OS7A 3S9DB 2ICEB 1IGYB 4BUHA 3DHMA 4BDVA 3KBFA 3UZVA 5IESH 5I76B 1A8ZA 1MOEA 1AGDB 4PJIE 2BVQA 2R23B 3LNEA 4ZUTA 4YWGH 3FQUB 5C9JA 1VEOA 3MXWH 4UB0L 4WGWB 4TQHA 4HH9B 4JDEB 3HFMH 4IRZA 2Y7LA 5D2NC 3FUNA 4U7SA 1TCRA 1N4XL 3F84A 2VMFA 2FJHA 3A23A 4PG9B 4GRLB 4XVOA 4F7CB 5MERB 4E0RB 1S7SB 3N1MC 2Y23A 4PJXA 5DMJB 4PJEB 5D5ME 2V9UA 1OK0A 1AI1L 3STZB 2DKUA 3KVDD 4UQ3B 4MAYC 3ZX1A 1EV2E 5E8PB 3IKCA 2Z0BA 2EDQA 4PIRF 4EO5A 1NAMB 4I4WA 1ZGLM 4LNRA 2WLJA 4N28A 1UZ6E 3KYMB 4HGMA 2ZZUT 2WYIA 3HG3A 2V5SA 2MCPH 1G1OA 4UZGA 5KSBF 2PXYD 1KTLA 2YHGA 5HDQH 3RKDC 3UO8B 3ARWA 1IZKA 3S34L 1V3KA 2FEEI 4MD0B 1QA9B 4NJ9H 1E4KA 4AUYA 2ZQKA 3SJVA 4G8IB 4L3CA 3HG4A 4LLMA 5IMMB 2B1AH 3QUZC 2NZIA 5DVLA 2Z1KA 3FT4A 3H54A 4HBCH 2NNCA 3MCKA 3FOLA 4PI0A 1ORQA 1SOQA 3ARDD 2AQQA 4ODVH 4FI8A 4XX1G 4PSRA 1FLTX 4DKAA 1N26A 2QDWA 4NQXA 1G9HA 3NYKA 4X83A 3SE8H 3VFTB 1Z5YD 5F7EL 3DMMB 3IM1A 1IL1A 1JZ4A 3VGEA 2B8OT 3LMJH 4RDQG 3FJTA 4XCEA 4MA7L 3S36X 2LU7A 4N85A 4J5VA 1MCKA 1UA6L 1UACL 4WHTA 2N0KA 4XPGL 5CGTA 5MEQB 3L3HA 2BCMA 2J12B 3HZVB 3C8HA 1JZEA 5IQNA 1DBMH 2DLFL 4JO1L 5IB5A 1PU0A 4KDVA 4C4KO 4NRZB 2GJJA 2CM5A 3B5TA 2NXYD 2Y6TE 4XMVA 3RY5A 2XHNA 3JV5A 4HPYL 1A02N 3LPFA 2OI9B 2WGNB 1MF2H 4JJOA 3BAJA 3ETBJ 3BI9X 3L45A 2OK0H 5D1XD 2XVBA 3I85A 3PDOB 1I1AD 3QZWA 4Z3FA 1RZKC 3SDCD 1HHHA 2W60A 5IZ7A 4KRPD 5HJ3B 1D2OA 1LTXA 2J1KA 4KBPA 3S4SG 3VG9B 3NN8A 1M05A 3UOAB 4DW2H 2P5WE 4LL9A 3NH7L 3VMPA 1JSYA 3NCMA 2WVVA 3OC5A 4JFXA 4Q2ZB 3A4FA 1WP6A 4MNQB 1SYSB 1XGQA 3F7RA 4R0LA 3CUPA 1O9WA 1DQVA 1I9JH 3WNJA 1ZIAA 2LVEA 2XWBA 3FK3A 3QG6B 3BT2L 4XNQB 3X13A 5C86A 4IDJL 3MLPA 3FO1B 1ZXKA 1QHQA 4LT7A 4WZ9A 5LB1A 2X2YA 3UPRB 3W1ZA 2FNWA 1IKOP 4HMCA 1NCWL 3TU6A 2WN3A 2OXHB 4KTDH 4C4BA 5ANMB 5AW6B 3BJ91 3KPMA 4NZFA 3IDNA 3ZLQC 5HVWA 2EZ0D 2N7SA 3HC0A 1EBPA 3P3YA 4QHUB 3MRIA 1RZPA 1DJXA 3EZJB 4M61A 5JOFA 3TA4D 1U41A 2D7NA 1EJOH 2W0KA 2YJQA 4J3VA 3CXFA 4XAKE 4IMLA 1CU4H 4PAZA 4NQQA 3NCEB 3DSNA 2YK1H 4GH7B 5ADOL 2KT6A 1OTTC 4K8RL 2DQJL 1KPRA 3WEBA 1HXYB 3B56A 4GAGL 5IBTH 1MCWW 4JZJA 3HNSL 3RBGA 3L8QA 1GC1C 4NKDA 5C09D 2KUTA 1BG9A 5JORA 1VFBA 4XCFH 3NRQA 3I6GA 3DV6B 5DD5L 3QIUA 5KVDE 4Y5VC 3Q5YA 3VRLF 1X4XA 5BZXA 3TA3B 2ENPA 5GRZA 3G6JB 5F7YC 3TIEA 4H8WH 2NY5C 4BFGA 4EZJA 3TBSA 1GGBL 2J72A 1T6VN 2AJUH 5PCYA 4G6JL 2Z4QB 3WIIL 3VI4A 1HCFX 1GZPA 2RH0A 1PIFA 2NQDA 1GS7A 4LVEA 4M1GL 1IKFL 1BZ7A 1FFTB 3G6AB 2HX7A 4YXKH 2X3AA 4XNMB 1QLRB 1ZDSA 2JKRM 4HPHA 5DMYA 5E4OA 3K46A 1A5FH 1NLBL 5F6IC 3VFWA 1VPOL 1LEGA 4F9PC 2O5XL 4Z5RB 1V8HA 1XH2A 4OU3A 4WO4C 2EE0A 4M7JL 5FA4A 2X3BA 3QNXA 4UNTA 2QQLH 4OZIF 2CBTA 1EZUA 4TSAH 3MBWA 2IQAB 2OMYA 4U3HA 4HF5H 4GW4A 1SDYA 2AW2A 2ZOKB 3KNBB 2J4WL 2O26U 2Z35A 1RZGB 3O2DH 4Z76B 5KZCD 3FUEA 4FQXA 3LEVH 1FZOA 1IAKA 2JIXA 3L5WA 2R0WH 4BZ1A 4M3KB 5EOQH 4BD4A 2D31A 4IMKA 3ABLB 3GSXB 4NN6C 3B9KD 3TBWA 3KYOB 1FIGH 1PEZA 3IDXH 2QBWA 3KS0J 4QXTA 1BW8A 3CU7A 3KPTA 4CSPA 3LHPH 3RX7A 4X6EA 3LS5H 2XV2A 1ND0B 2K8QA 2X2UA 1H0DB 1U21A 2LU4A 3C5ZB 2X9ZA 1XGUB 3R1GL 5GZOD 1RU9H 2NTFA 5TDOA 1UXLA 2J71A 2UXGA 5HHMB 1QRKA 2P8MB 1MFDH 3KPPB 4HEME 5TK4A 4HOXA 1SLVA 4IRSD 4N2AA 5DSCB 3PWUB 2FEEL 4JFOB 2VR7A 3G5YB 2GQHA 3ME0A 4IGBD 1K8DB 1F4XH 5JW3H 4JMXA 4MS6A 2YUVA 3IMVA 5EOCJ 5TTRA 3G9VA 4OSUL 1SBSH 2R2EA 2YD1A 3MROB 5EN2B 4U3CA 5FGCE 4XVTH 3NPZB 2CMRH 5DQDH 5C0AD 1KLFA 2FIKA 5J6SA 4ELMA 1BOGB 1G7LB 3VGBA 1FFPB 2MSPA 2OJEA 4UOW1 1SOSA 3VJ6B 4A7UA 4OV5A 2W1NA 4Y19D 3S35L 3BJLA 2FGWL 4X6DB 2UXFA 3B2UC 2OP4H 5C7ZA 2WLIB 1FC1A 2R59A 1FUNA 3EG9A 5F1IB 3NZHL 2R51A 4XNUH 4MFHA 4CVWA 4ZD3L 3SPVA 4XNZB 1ET7A 2CK0L 3KYNA 1YA5A 3TIDB 4ZFGL 1LE9B 1MW3A 3FUHA 3PABA 1XWVA 2AERT 2WNXA 4M62H 3C5SA 2CHDA 2O6FA 4JM2D 5T3XL 3D51A 2IFFL 5KVGE 4MXQC 3GNMH 2Q8BH 5HGGS 4XN7A 3GZOA 4WNSA 1B2WL 3H9HB 3T2LA 4NPKA 5C0EB 5D6CA 3H0TA 1FL6A 4OFVA 3NIGF 3RVWC 3PL6B 1BM7A 1CFTB 1JOIA 3B7YA 3IRZA 3WY4A 2C34A 3LXCA 3BKJH 3P1VA 2JFCA 5F0LB 2AQSA 6FABL 2E0PA 4F7EA 1ZHBB 2YPLA 3T4AA 5K1NA 4AV0A 1NC2A 1BIIB 1ZE3H 3VA6A 2QZQA 3ABMB 4WGVB 4U1LA 5GRJH 3BKCL 2FR4A 1A3LH 3P54A 3BSGA 3N9GH 1JPFB 5I1KL 1L5GA 1UXWB 3WY1A 2BIPA 4PWJA 4P2RB 5H37A 2FUQA 2BP8A 1JVLA 2J8UF 3HOGA 5HI3C 1B6UA 3QRGH 2DWYA 4HUWB 2HX9A 1VZIA 5A6MA 5DEGA 5GSVB 5JW5A 1ID2A 4PLKC 2LHAA 4AUUA 1BAFH 1BQKA 2TSBA 1KB3A 1OO2A 2X41A 1U8LB 4UIKL 3HFML 3MV7A 1E6JL 1YEDB 5CS7A 3ATDA 2V5RA 3T0EC 2XQ0A 4BKSC 4MQ7A 2APXA 2Q7AA 2HXAA 4NUJA 3C6LC 4XCCL 2XFXA 3OKNA 4P5MB 4U6YA 3FZUC 4HCRH 4M3HA 1TTFA 2P24B 5KAQG 2P8PA 2M8XA 1YECH 3CE1A 1KXHA 4JFQA 1ZGLA 2J5WA 1D9KA 1RJCA 1TQBC 1IU1A 4GW1B 5IKCB 2BY3A 3N44B 3KH3A 5D2LB 5LDSA 1UWYA 5E00B 5EZOL 1AY1L 4G59C 5J1SC 3Q8CA 3BEWA 2X0WA 1SOKA 2GYSA 4N9GB 1IBZA 2B1AL 2AMUA 2NCEA 4P2OB 3SGKC 4G1MA 5IOPB 4ORGB 5CEZD 4UAOB 3A4EA 5EO9A 1VFAA 2QR0B 3NFSH 3Q5OA 3ZL2A 4I88A 2IIJA 5ADPL 4PS8A 4G8EB 1SF3A 1ZHNA 4PWHA 5GS2D 5DHVA 4AQ8C 3WFZA 4YHPA 2FRGP 2GJ6B 4NQCE 5BQ7A 3BAEL 4Y9BA 5F3FA 1OWRM 3X12A 5AW9B 1MCJA 2QKSA 5E5LA 3U0WL 4OIFA 3P4OB 4U0RC 2NR6C 1EAPA 1EHLH 1QWHA 4XOBA 3L7FA 1Z0MA 4ONHA 4APXB 4JRFA 4QGYA 3TNMB 5J6GA 4AUJA 2FYYA 2K3HA 2QKIB 2O61B 2XKNB 3GMOA 4OIAA 1THAA 3QHZL 2DJUA 1KDIA 2AEQH 5ABZA 5L4FA 2C4FU 2P5EE 5ERWA 2ZF9A 1LO4L 3IVKB 3UZQA 2YXWA 3HG5A 3VXRD 3BZDA 3G5WA 1VERA 2YZ8A 3AVEA 4Y4KD 1FHNA 2WBKA 4PRIA 2WXJA 3EFDL 1LD9B 5J5EA 3HUJE 3I3EA 5J11C 3C9NA 3HEIB 4GOSA 1IM9B 1OLZA 5DFVC 5SV4A 3US0A 4JVPA 3GMQB 4YHLH 4ODXB 5FLVA 3BDYH 3SE3C 3KCPA 3QIWC 3RY6C 4TVPE 1Q72H 2IGFH 4MD4B 4DP9X 1TQUA 3RNKA 4GMSL 3VAEA 5ID0B 3RNQA 1Z6JT 2BK8A 4OGQC 1BFOB 4MMZA 4JRLA 1I9JL 1FAIH 3VWJA 4NWUL 2BM3A 2GC7C 3NJFA 4P3WA 5ELIA 3O3EB 1AS8A 3RWCB 1QTSA 2JJTC 3TFKC 5D71H 1CE6B 4ODUB 3RL1A 3PQYD 3M1CA 2F53A 1CF8L 2OSXA 4M8QB 4XE0A 5GGSA 3VFOA 4X6DF 4G9FE 4Z7UA 2YD0A 3COOA 3GT6A 3P2BA 4KNUA 4RBPK 4XC3H 4L18A 5FUOL 1TIUA 3ISYA 4E41D 4H0IA 1E42A 2DTML 3JWDL 3C08H 5F88A 5KSAC 2X4OB 3FN3A 2JQAA 3BO8B 1JGUH 5B1CA 4F58L 1D6EB 3ZDZE 3KS0H 2HFTA 4CVUA 5D7JA 5T3ZH 4K94C 5AG8A 3ZHLA 4LSRL 2JELL 5E6UB 4ZUSA 1P7QD 1BMZA 1ETA1 2DQHH 4YGVA 1B4RA 3VX0A 3RWIA 1CFQA 1NUNB 5D5MB 3WELA 3LZQA 2GIYA 3L4CA 1T20B 3KPLB 4M1DH 2XX0A 4HWZB 4S2SA 1WHPA 4H8WL 4N2EA 2DLHA 4JFDE 4YBQD 5EN3A 5C6TL 1HKFA 1TPXC 1UKQA 1T1WB 3ECBA 2XA8H 4NQTA 4OF6A 3QFJD 4G70B 1S5HA 1KC5L 3OV6A 2WUBH 3P0YL 4HJJH 3I2CH 3AROA 1LDPH 5ISZD 1PW3A 2HA1A 3VB9A 1YEIL 2CO1A 2FH6A 2X6MA 25C8L 3GMMA 4QHNB 1QTPA 4FLOA 4TLTA 4YXLH 3U7YH 2QGCA 4L3ED 2KDGA 2WXMA 5TE7L 5BJTA 3ARGA 3P4MA 3OKOB 3TBYB 5E4EC 4F91B 1YMME 1U6AL 2R1WA 5EOTA 1YN7B 4WI0A 2WOYA 1GGYA 4K0OA 1MELA 4X5QA 1INEL 1N6VA 4W4OC 3EH3B 4HWBH 3SGEH 4R2GB 2NDGA 4Y9EA 1JNJA 1T0MA 3FU3A 2WO2B 3MJ8A 1IBDA 4K3EL 3KXFE 1OAKH 4WTWA 2D03L 3EBAA 1YEFH 1MWAL 1ZD6A 4PLJD 1I8KA 4CKVX 4HW6A 2ZPKL 1IAIL 4LHJB 3F7LA 3MNMA 4N2OA 5DCCA 2XQYG 4J3XA 1EJ8A 2CCVA 3WJMB 1N5AA 5D4IA 5BV7B 4J8QA 1KCVL 4YDVA 1PPIA 3L2NA 2UXVA 3SDYL 1CFNB 3LRSB 4ZT1A 3ULVC 1DCEA 5CJQH 4F7PA 4NKOB 2A6JA 4L8SB 3V4VL 1OOAA 5H4YA 1YQVH 3N44F 1XF5A 3GYRA 1IBBA 5T1LD 2PW1A 4HK0A 1FL5A 1NAKL 1RJZB 3DX4A 2VNCA 3WY3A 3L3OC 4OCRL 4LLWB 4ZYKA 2Z91A 5B8CA 2BX5A 3K6IA 4PS7A 1U91A 4RX4A 1JTPA 2E74C 4B9YA 4M9OA 1AXSA 1NMCC 2G5BA 4YX2L 4JKWA 4CA4A 4R97C 5EPMB 1UXMA 5GJSH 1QQDB 3ARFD 5DQDL 3PF2A 3W38A 1JUFB 1U8MA 3K3QA 1CDYA 3EH5B 3MA9L 1A6WH 1HIMH 3UBFA 4L37A 2ED6A 2NY0C 2VN7A 1TZGH 2YIHA 2ZOOA 3MRFA 3QR2A 2ALAA 4JFUA 4XGZA 5FYJD 3I75B 3G9AB 3QDAA 3RIFK 5CEYA 1BDYA 2KKQA 5AFAA 4RGOL 2ZYRA 1KTCA 2YOAA 3MOQA 3OKKA 2BW5A 3P73A 4LCCC 5DJCB 2HJFA 3UEQA 3O0RH 2EVHA 4B9ZA 3K91A 2EUVA 3TBVB 3MJ9A 1L7TH 2YRBA 5DUPL 1KB5B 3K0WA 1Z0NA 1S5IH 4AITA 2DMKA 1JDDA 3GIVA 3REWA 1H3PH 3DV4A 1F18A 4FQLH 4ZPTB 3EUUA 4DWHA 4FMVA 1XD0A 3KJ4B 1T83C 5DK0B 2TSAA 2VWEC 4CMMB 4A37A 3DX7A 4G2AA 2NT0A 4FQ2L 4G7VL 4MB1A 5T1MA 4WJKB 5TF1H 5HYJB 2VL5B 1NDMB 5CZXD 3D1MC 4XNBA 5ESAA 3CHQA 1AD9A 5GGRY 4AEHL 2AK1H 5DVNA 1L0PA 5INDA 3AG1B 3B2PA 5TD4A 3QIBC 4GBXA 3L2LA 2YEQA 1KIQA 1WGVA 2VAAB 3MRPA 4WWKC 2ADIB 3VXSD 1RP9A 4LLAA 4JANB 3RI5K 2NXZB 1IKNA 4WFFD 5EFIA 4UILL 2EE2A 3G08B 3N3EA 1CGYA 5E8NA 1DQLH 4X7SL 2CKBL 2GY7B 3O4LD 3OHXA 4GAAA 2J21A 5F7DA 5HVFB 4I3GA 4OFPA 3LEXA 1HQRB 3RILA 1FZKA 4Y1SA 2FWOA 3GMLA 5DJYA 2F61A 2XETA 2WTRB 4UM9A 5D1XB 1SOXA 4DUXA 1I1AB 1B4JH 1K5NA 3SDCB 2ZXCA 1L9RA 3TPKA 1Q1JL 2GUOA 2X40A 2NNAA 1JI1A 3QHFH 5E5MB 1N18A 1ZDQA 3MLVH 3D08A 4FP8H 1LNUA 3MXVL 3WD5H 4C59B 3MA7A 5I1AB 4R5XA 1NGXB 1K8IA 4ZBJA 1AIFA 1E43A 2BZCA 2W8CA 1I4FA 4RZKA 3WV0A 4A2MA 1Q94A 4YHIA 5E1AB 4JDTL 1M7DB 4XMUA 3GSQB 3U9UA 2J73A 3FAWA 4EI5B 2XN0A 2FIRT 5FFGA 3WFCL 3CFBB 1H8LA 3ZGIA 1PX3A 4JQXA 3DVNA 3P2TA 2OMNA 2VLME 1MFUA 2FL5B 1ET8A 4JGUA 4WFGE 1DJWA 3TLRA 1C08A 4JO3H 2X87A 2UWEA 3ARYA 1N3NB 3IJEA 1KYUA 4QOKD 1ONQB 2Q0ZX 4F8NA 5C97A 1WIPA 2WAQA 3H9SA 1J5HA 2GSGA 4GI8A 4FFYL 1P7KB 3DO3A 2BSTA 3K0YA 2CA4A 4FG2A 4KO9A 2XVLA 1UA3A 2E7CA 3LKOB 5ITBL 1PZUB 3ZO0A 4LKXB 5DVMA 3QJRB 3B43A 4X7TB 4ISVA 1TQTA 3F01A 3RKPA 5JXEA 2F54B 5DHXB 3SE9L 3TGXA 3HZMA 1KGWA 1TFPA 4MWFB 3CMOH 5FGCB 5IF0A 1RCYA 1FO0A 1AO7B 5CMAB 1I9EA 1VACA 4RGMB 5IQ7H 4LHUG 5CXPA 4FDWA 3MREA 3L5JA 2J6EH 3RX8A 1EMTH 2IADA 4RAUA 2APTA 3C87A 2NY2C 3S98A 2QPUA 3JTSA 1E3FA 4LLVA 1YMHA 2AZUA 3QXUA 4NT6A 4X9YA 5GPRA 1OVZA 2Z64C 1NMBH 1VRSA 2GCYB 3ZE2E 1KEGL 1T2QH 2LW3A 2WVTA 4M48H 3G6DH 5BXFB 5LCVH 2WZ5A 1FQ9C 1ZWIB 4B96A 5HYIA 1MCLA 3LY6A 4UIMA 2CE6A 3KM2A 3EYOB 1FE8L 1A4BA 3L13A 5DHVH 1UM5H 5HJBA 5E51A 1USZA 5K69A 2ATKA 1L9PA 1OCCB 3ULSA 1SDDA 4RGNE 5DU7A 3W9EA 2MHAA 4NZUH 1REIA 5KVFE 3SBWC 4Q4IA 3QUKB 1D7FA 5IB4A 1W2KT 1FAIL 4I48B 3SQRA 2FO1A 1KJMA 2LU3A 2K6ZA 2VR5A 4Y1AD 4ENZA 4K2UL 4LRIC 5E8OA 4L5FE 2CLVB 4PGCA 5I17B 4HKBB 2ZG1A 5DVPA 4IRJA 1F90H 3V52L 5DS8B 3MRDB 2NCMA 2O5YL 2QADC 1U8NB 5CLTA 4GSQA 2YKLH 2NY6C 3ZDWA 4YSUA 1E28A 3KLKA 4EIBA 4HFUL 4GUOA 3D0LA 3ORJA 4WCYL 1FSKC 3IAGC 4YDLC 3C5JB 1NDTA 3PAZA 1PZBA 1OAZH 1A7RH 4LU5H 3CHRA 4MJIA 4X80H 1JWMA 5GGVH 4JO2L 1J88A 3DTUB 3T0EE 3EGXB 5KOVC 1R6VA 2V9RA 4OCXL 2VXUH 1CO1A 4IGBB 5JPNA 2FZ3B 3PXHA 2WP3T 2A9NH 1I1YB 2WWMD 1KLUA 1GGUA 1U8OB 3N50A 3LTVA 4X6CF 5F1SA 5KS9A 2E7LA 4ALAL 5KSVB 3WEXB 7PAZA 3NSJA 5C0AB 5BOZG 1AGBB 1RFDH 4FABH 2AV7A 1Z5LB 4FAAB 2Q3ZA 2ZCKL 4LSSL 2Q3XA 2HFEB 3KYAA 3KWUA 2CBOA 4G42B 4PBWD 3OKMB 4MHHI 4NCDA 4R4FL 4X8GA 1IBFA 5DFWH 4PJ9D 3BKML 1MCOL 3EJYD 5EOCL 3BIBX 5IB3B 2XBZA 2NSXA 1X5XA 3QSKB 5C07A 2QMJA 1X5IA 3OZ9L 3U7WH 1MXDA 3HC2A 4FXGB 1A9BB 1UQSB 1X9RA 4XB3A 3O9WB 3R06A 4ZUWA 3ARPA 4OCWL 5E94A 5C0CA 2OBGA 3K71A 1J11A 2EXSA 2A0LC 1HHGB 2Z34A 1QAWA 1T6WA 3AUVA 3S3SA 1J1XH 1PX4A 1N8OE 2XG4A 4KDWA 4P23C 3WSQH 1T7ZA 4XP4L 2TAAA 4N2NA 5D1ZC 3TURA 5LG6A 2HN7A 1MHEB 1IGFL 5CCJA 3QWNA 4NNXB 1FI8C 4HWBL 4RIRB 2R29L 3RVVC 4MMXB 1Z66A 3DC0A 5DD1H 2CRIA 4HH8A 3DGGA 2DQEL 4OVVA 5DQ9B 3UYRL 3ECWA 4Z7OE 4GKSA 3RTQC 1CI5A 3EYFB 1HOCB 2DMGA 4UT6L 4MCNA 4PWFA 3WGUB 2OX5B 3FO2A 3QDJE 1B0GA 3VQMA 1ZS8B 3ZDYE 3ET9F 1Z9SB 2AGJH 4R4ND 3II2A 3BKYL 3QJSB 4NXKA 4Y4FB 1DBAH 4EZLA 5G5DB 4FKHA 3D9AL 3L3DB 1U8CA 1IUZA 1U2HA 3TV3L 5IWLC 4DAGL 3HE7C 4NPJA 4ACPA 1G6RL 3IDIB 4B60A 1YQVL 2MKWA 4DVRL 4BQBA 4APQB 3LD8C 4K8RD 4NQVB 2NSMA 3HC3H 3KYKL 1YDPB 4BUGA 1DDHB 4GRWB 3KWTA 5DHMC 2H1PL 4NB7A 3WN5C 3VB8A 1W0WA 1MFCL 5FYLE 5LBGA 1RJYB 2J1ZA 4AM0A 5B7FA 1BZ8A 5FB8A 2UZXA 1OAXH 1CXIA 3CZFA 1C9SA 1XVSA 4TRPL 4BQ9A 5FO9A 2JJVA 2XWRA 4RMRA 4MGXA 3RU8L 1Y6MR 4MCZB 5SWSD 2GTWA 3L16A 1QLEH 2CJUL 1S3KH 1A6WL 1H5BA 4XOAA 3EOBA 4G8GD 5I18H 4ECNA 1W6WA 3CVHL 1VZGA 4ONFH 2B2XH 4PJBA 1KBGL 4AE1A 3VI3E 1NUGA 5GIRB 4WRLA 4NM8H 1LK3H 2HUEA 3KLAB 1AHWA 2IEPA 4R96B 2H0EA 1JZIA 5FYJU 3IGAB 4YEFA 1RZKL 2XNAB 4EQ3A 5T33H 1OCWL 1P7HL 5IK3B 1HWWA 1Y07A 1ECYA 2BHZA 3VWKA 4AGNA 2DYPA 4C83A 4F8PA 3ZKXB 2DPKA 5I30H 1HHJA 2ZOWA 3KZ8A 3OWEA 4G6KL 2WIIB 3X3FH 1S9YB 3O3DB 5DZAA 2WWNA 1XMWA 2ZT9C 4H4NA 2YBRA 3ZDZB 4U1HB 1EZLA 5I71C 4I3RL 1AGEA 5EC1B 1U3HC 1KELL 3ATFA 1ZA6B 4F8LA 1A4JA 1F45A 1A6VH 3ARTA 1GMEA 5J12C 4KVNH 2BHUA 3WHXA 5IB2A 3FQXA 5AENA 4ELDA 1KJVA 2J6WA 5C0IB 3WKQA 4JFDB 4YHYB 1PFCA 3SQOH 2WLLB 1DQLL 2EUWA 3L3GA 1CG9A 1H3GA 1VGKA 4TUOB 5C7XH 5DMKB 1UFUA 3VA2C 4WDIB 4XWGH 1XR8A 3TEZA 2GBVA 3MJ9H 4I0CC 4OM0H 4PV1C 4XE5B 1T1XB 4PYGA 1QSZA 4XXWA 1BWMA 5I15L 1B4JL 4G9DA 1A7PL 4Y4KB 1EXUB 5GJTH 4OF8A 1GGIH 1TTRA 1UZGA 4DP0X 1BVLB 1ORSB 4HAFA 4LSTL 1GC1L 1PD1A 1YMMB 3BPNB 4X6FB 2V9TA 4I3SL 4N0CC 1T0NB 2K9UA 3PP3H 3RAJH 4YSRA 4TQEH 1JWSB 1AQ8A 2NY5L 4PP1D 1YLBB 3MKGA 5L6YH 1ILUA 5D9SB 5DZOA 4JVUA 2G2RB 1L9NA 3CC5B 4IKIA 1KG0B 4HS3B 1KTKE 2BOCB 4KNTA 1XSKA 4QLWA 2CO3A 4FJZA 5KW9L 3AS0A 4L3AA 2H26B 3H8NA 4XVJH 4JO3L 3MX0B 5IJDC 1JF1B 2NY3D 5T3XD 3QJUB 4KK6C 3BD5A 3OQ3B 3L1GA 4PJ7A 4I77L 2VJ8A 3C8KA 4QRTA 1I8MB 3VXTB 4HPOL 3RZCA 3MRHB 4NKIL 1QKZH 2Y06H 3P9MA 3U4BL 1KOAA 4D9RD 2PKDA 4I7ZC 3HG1D 4G6FD 4KK9C 3BN3B 2DEXX 2EE6A 4Z0BH 1MJJA 4JM2F 3MBEC 2ALWA 3G5VA 2IH3B 2OR9L 5D7SH 1OCOB 1XCQA 4G7QB 5E2JA 5EWIH 1GW0A 2Q7NA 3QORC 2FEDD 2IPTH 2ADGB 3GRWA 5C6WH 1S8DA 1TJGL 2WMPB 4XWOC 4JRYD 3SGJA 3ES6A 1QO3B 1GHFH 4FHJA 1ADWA 3VFRB 3HKZA 4HX1B 2MOVA 3QR0A 4PVBA 2ICEA 1IGYA 1FYTD 3BZFB 5GXBB 4WUUE 5I76A 3MV8D 4QUOA 4HV8B 3RP1A 3QFJB 1AGDA 2R23A 3FQUA 4M48L 2JKSA 5AYQA 4JDEA 3DDGA 1MAMH 4HUXB 3BAKA 4PG9A 4F7CA 5L9DL 3K1KC 3HB3B 3KEHA 5MERA 4ZS6D 1S7SA 2EC9T 1YPZF 1DLFL 1PZDA 5TH2B 1CWVA 1Y1DA 2GK0B 5EIQA 3ARRA 3VRJB 3I50L 4PJEA 1T66D 4Y8AA 4UQ3A 2CXKA 4P2YA 3ASWA 4GRWF 3T6QC 4L29A 4CMHC 3QEQD 5E8PA 3DRTB 1MI5A 3LV3B 3LZNA 1U3YA 1DSYA 4PS3A 2EDOA 4XB7A 1NWPA 4L48A 3KYMA 1NICA 4NCC2 3WFBH 4X4YB 4XXDB 1J1PL 1PQZB 5FWRA 4M02A 4L2LA 2CO6A 3A6BH 3KWXA 1KCUH 2WY3B 5CFHA 3F65A 3FCUB 3LH2L 4Z3GA 1QA9A 2FQDA 2VLRD 2EXTA 2N1KA 4G8IA 5KYYB 3OXSA 4JPKH 4KKBD 3GXIA 3FUKA 5E6ID 3CQQA 2ZKYA 4GP4B 1B0WA 2EEBA 1E4KC 1WTGT 3F64A 3GHBH 5EZIH 3PNRB 2V5MA 4Y8DC 4RA3A 2PR4H 3FB6B 2R0KL 4WF7A 3IFPB 3O6ML 3VFTA 4IHBA 4OZ4B 4X80L 1A7RL 5T1LB 2JJUA 3DMMA 1OTSD 2IAMB 3DX1A 3CU1A 5LBSL 1JVOA 2ROYA 1MQ8A 4S1SL 1GGTA 4S0HA 4Q97A 4FCAA 4NC1E 1EERB 4PB9H 5MEQA 3DO7A 4UQ9A 3HZVA 1OM3L 3L4YA 2OA9A 4KI5D 2V2XB 4UV4H 5GS0C 4OZFG 3LKQA 5BZWB 1BGXL 5CUSL 3GI9L 2QFPA 4OB5L 3HNVH 3D3VA 3HMXA 1XH0A 3PWJA 2B9BA 3PDOA 4TTGA 4KITB 4FNUA 4MHHG 4W9DC 4GAJL 1XSOA 4WJ5B 1KGYE 4PIBA 1OGPA 1URIA 3KCWA 1PKOA 4HMDA 3CVCA 2VN5A 4TNFA 3LSOA 3QDME 4BK8A 4F15C 2HFFB 1H8OA 3V4LA 2KHAA 3GM0A 5FO7B 4F9LA 1LO5B 5KYXB 1MFVA 4MNQA 1SYSA 4O2EB 5SWZD 1NDGB 1NGWB 2WXFA 3QG6A 4XNQA 2NYZA 2IF7A 3FO1A 3PG2A 4R0LC 4EZMA 1WFIA 5AB2A 3U4KA 3UPRA 5J7CC 1JHKL 1JYNA 3MUY1 2BFVH 3QUXD 2OXHA 4YDIL 5ANMA 2BWDA 3ZMEA 1PLAA 3FFCE 4OCLC 5BZDA 3HPLA 4QHUA 4FNLH 5FHBL 1QRNE 1U3JA 4JKKA 7TAAA 1DBAL 1YN6B 1CD0A 3O4LB 2R8SL 1SVCP 3BUTA 3H6JA 3ZE2B 4L9LB 3L4UA 1HXYA 4MMYB 5B1JA 4HUKB 4XXCA 1CXLA 3O6KH 4XP9H 3PWPE 3OJDB 4P5TA 5K5YA 2OPCA 5LAXA 4JM0A 4IBZA 3FHAA 2WQ8A 1X5GA 2ZSVA 4KWUA 5JDJA 3DV6A 4JFZH 4DK5A 4HULB 3HAEB 2AEWA 3TA3A 4PH8A 4RRPG 3S48A 3G6JA 2VXTH 4FD0A 3QIUC 1VCAA 3DJ9A 4IIZA 2BMKB 3QUYB 3JQOB 5HDBE 3FQWB 2Z4QA 3S7GA 4JKNA 2AI0H 3G6AA 4ONFL 3SDDD 3CDZB 1YHPA 2X10A 2Y7QB 1QLRA 4XNMA 4TQIA 2QVMA 4I9WD 4KKLD 3SYOA 1IC5H 2EINB 3BZ4B 3DJTA 3ZBMA 2G3NA 3SYCA 4Z5RA 3Q6GH 4N3TA 3B5HA 5T33L 1M71B 1ANUA 3SBQA 4HALA 4BKTC 3Q44A 2E7HA 3HAEG 2EADA 4ENEC 8CGTA 4QOKB 1AC0A 4MZIA 3WTWA 4RFOH 2IQAA 3HJEA 1SYVB 2FB4H 1EH9A 2ZOKA 5EU4B 3OX8B 4NP4H 4D9QE 1RZGA 4PJ8C 3L1EA 1KZQA 1WFMA 3DKHA 4YZWA 4JR9L 3UMTA 3KM1A 1FNEB 3CFKB 1C8QA 3GMRB 4OLVH 4YR6B 5AL0A 4Z18A 4ZZFA 4BQCA 1MNUL 4FXKB 4FQXC 1CQKA 2X53A 1DVXA 1U4FA 2G75B 3L9EA 5JMRA 1HYSC 3TO4A 3KYOA 4PU2A 3VM5A 2C9AA 3ZRCC 1CBJA 1H3VA 2BNUB 5LGYA 1A7NL 2FX9H 3H9YA 5JW4N 4LVOC 1SFDA 1ZLUK 1ND0A 3D0VB 1H0DA 5C7XL 1XGUA 1Z9OA 4WHYH 4OM0L 2Q10A 2P8MA 3DTDA 3KPPA 4J3SA 2HH0H 5DSCA 3UTTE 3PWUA 1JGEB 5MENE 3ARBD 4JFOA 4WSKA 3G5YA 1IAMA 4L4VD 3BGAA 2IG2L 1DZ0A 1K8DA 3AITA 2AEOA 5T8IA 1U8IB 4G1EB 4A6YL 2Y7NA 2GSMB 1T21B 1SHWA 1TKWB 1BF8A 2JCCB 3L2MA 3MROA 4K94L 5L7XH 3MBXL 3MVSA 2A1WL 3K8LA 1BOGA 1G7LA 1FFPA 3GSOB 4OZHE 3VJ6A 2XWJB 4I0PB 3SHSA 4L4TD 1MFBH 4QKXB 4WWID 2BHYA 1KN4H 3FT3B 5AYTA 1TJIH 3RWFB 4LQFH 1VFMA 3AFLA 4Z3TA 2WLIA 4S10A 4QXWA 3KR3H 4XN1A 5F1IA 4Y5YB 4Z7WF 6PCYA 2VDKH 3CZJA 3Q6FB 4Y1AB 1KENH 3V79C 2QPEB 1LE9A 1XIWD 3QDJB 4LHUD 2KBGA 1BQHB 4WJG3 2Y2TA 2W5PA 3GKWH 4DOHE 3ZL4H 2YAFA 4DH2A 4XZ4A 2BVOB 4AMXA 2K1MA 3D69B 1DEDA 4U4BA 4QGTA 3H3KA 2VXVH 35C8H 4L1DA 1QFWM 3H9HA 3IAQA 5C0EA 4LFHD 4R7VA 4LSDA 3MNVB 3PL6A 3QZMA 1CFTA 3HLAB 4KROB 5IQ9B 5BS0D 1RUML 1WVZA 4KK5C 4M29A 1KJ2L 3NG5A 3LKPB 2GIXA 3A67L 3AQXA 3HE6B 3M8OH 1ZHBA 5EEZA 4Z0BL 1BZ9B 1CK0L 1KXTB 2ZTBA 3I6KB 4BFRA 1BIIA 1TO5A 1JNHB 3B34A 4XVSH 5EWIL 4X4XB 4IYKA 1LL1A 3T4AC 3NEOA 4HIHB 1OCRB 5I6XB 2P3YA 2ZXBA 3QUGA 1UXWA 4P9HH 1RIHL 2ZX7A 3QW9A 1ADQH 4P2RA 5DFTA 4JJ5B 3WAJA 1YY8B 4OJAA 5PAZA 2LABA 2IAAC 4FS0A 4KZ0A 1EJ6A 2DMHA 4OD1L 4OGXL 5I74B 3VI3B 4YHZL 2G9KA 4HUWA 1JGLL 3GF8A 1M9SA 1DSFL 1PJWA 4YIQB 3R19A 3ARZA 5GSVA 3ULVL 4FF9A 1KCLA 1RIVH 4WEMB 4NX0A 2W81C 5F6HJ 2DQGH 2JKWA 3MLXH 1NJ9B 1FG2A 1U8LA 4A2EA 1EUUA 1WYJA 5DMIL 3ILPB 4LQ1A 4F37K 4H13C 5CD5C 4MAUH 4ES9A 4FFZH 2ZKHH 1JPGB 4HD9A 4TNVF 2FYVA 4TXVB 3B7UX 4M7KL 4P3CH 2VW7A 1HHIB 4M5SA 4NRXB 2P24A 1FCGA 3S5ZA 1EHXA 4MA3B 4QXUH 2FT7A 1CICD 3FQNB 4OZGE 4F2ME 5AWNH 3NCBB 2ZAIA 4GW1A 1KGXA 4KNSA 3LKNB 5IKCA 5D2LA 1D9KC 3ZKMD 3CFEA 1ZV2A 5E00A 3EYUL 5TE6L 4WV1B 5TQ2H 1K9TA 4XBGA 4N9GA 2JQMA 2P43B 1V7NL 4P2OA 2GEEA 4FYQA 4N0YL 4ORGA 2VLJE 2VLKE 4PRPE 4DO6A 4Y2NA 5IOKA 5LNGA 5EZIL 2QR0A 1AXTH 4UMSA 4G8EA 2BCKB 4PJ5B 1WCBA 3EZ8A 2B15A 2ADJB 1QSEE 4JO5A 4JFEE 4FLSA 1EWHA 3FONB 1BD2D 1I8AA 1V3MA 1RH8A 1VADB 4MD5B 4M6ML 1F3JB 2A83B 1FH5H 2Y1AA 3GDCA 1NTDA 2F68X 5EZJB 3P4OA 1J9RA 4U0QB 4B3EA 2YD4A 1VAHA 1NAMH 3FNKA 3ML9A 3O6FD 4WAFA 3ZGHA 2V17H 2XBDA 4X7EC 3HI1B 5FV1L 3TNMA 3UAJD 3WTVA 2IH1B 2QKIA 2O61A 2WO4A 2XKNA 4LP5A 1XGZA 2AABL 4R3SB 4MASA 1JVKA 3IVKA 5I9QB 4UOQA 2DJMA 1J1OH 3CFQA 2GI0A 1GPOL 3ULUL 4U6XB 2YEZB 4CJ0A 4Y5XB 3NZUA 3OKDA 3TN0D 1XV8A 2D9CA 4E9QA 1LD9A 4IEFB 3BVXA 1QD0A 2YD3A 4HIXH 5DEFB 3BEVA 5JUEH 1JK9B 2JKJA 4XBEL 5AVYB 1XCWA 5DEJA 1C16A 2QGBA 4K5LA 3WNNA 1IM9A 1NCHA 3O6LH 3W0WE 4C56D 2GABA 5KVEL 4ODXA 1YNKH 3RE0A 3CSPA 1WT5A 4N2GA 3VYNA 1JZJA 4NQCD 2QVIA 4MD4A 3TVMD 1D5IH 4EIGB 1F6FB 5ID0A 4N8PA 1BFOA 3LPPA 4ZW3A 2WQAA 4PJCF 1P5VB 1QZNA 3LNIA 1EEZB 4NZRH 1F8TH 2JCCF 5AW2B 4OLWL 4LBEB 1SEQL 1TCMA 2B59A 3AAZB 2W65B 4MMZC 3RWCA 1A0QH 1CE6A 4ODUA 5TPWH 3VWJC 3UAEA 4RISL 4J4PA 3V9EA 2FT6A 2QQKL 2P4AB 1SJEB 3H53A 4M8QA 1FRGH 1OP9A 1WICA 3ZMNA 4XN4A 3OLIA 4J3OD 2P5ED 2VSCA 4PYHA 5E9NA 3IDGB 3RA7H 3GGWB 4CN6A 3H1ZA 3UO1L 4WUUB 1SM3H 5F93C 2X4OA 1RZQA 2F7OA 1MVYA 1S7UA 2FSDA 2WLYA 4UUJB 1QPKA 1D6EA 4BFJA 3ZJAA 2JJWA 3RLSA 1YAZA 5JDSB 1TXKA 4AJYV 2FJGB 1LYQA 4J27A 2OMXB 5BQDA 3T1FB 2Z31D 4NJAH 4CU6A 1NBVH 4JFZL 1ZEAH 1CPUA 3W2DL 5EEYA 5D7JC 3F7VB 5D5MA 3O81A 4PJXE 4YDJA 3U9WA 2CLRB 5BRZB 3FUJA 3KPLA 1M1XB 3BQVA 3QP3A 4HWZA 4U1KB 1R5WB 2VXTL 2XICA 1YNLH 5DWPA 5DS2A 1T1WA 2ZCHL 2C1OB 4WI5A 3NTCH 1OPOA 4MX7B 2LGNA 2IBGA 4IBSA 5E1IA 5JHDD 4F7TB 1QASA 3ZE1F 2CRYA 2ZKMX 3MGTB 1VFOA 3NEEA 3ZTNH 5KUKA 1IO4C 1WTLA 3C09B 1FZJB 1MFNA 3MI6A 4FZ8L 3VFVB 4G9FD 1H19A 1KDJA 4IHOB 3SJVE 1JFQH 2HLAB 4QHNA 2J7LA 1G9NH 1CJYA 4ZTOL 3D39D 5FHAL 3OKOA 4Z7QF 2X4PB 3TBYA 2W9EH 1TU2B 3TP4A 5TQ0L 5IVXB 4HIEA 5H94A 4FRWA 5HYSG 1W72H 1JHLH 3VGAB 5J4MA 1YN7A 2WSDA 3ARGC 4AC2A 5GRUH 2NRDA 3CBJB 3VXPB 2JKLA 4D9LH 3RVTC 2B1HH 3L7EB 4ATTA 4MAYD 1Z9LA 5E1QA 3C75A 1EGJH 3V6ZB 4DZ8B 3ZQ9A 4DZBA 4IJTA 4HU2A 2X9YA 1FFNB 3ZZSA 1SLXA 2R2HB 5AZ2L 1WBYB 2ZOTA 1QYGH 1YEGH 5KSUB 3WJMA 4X0KB 3RKDD 1CGWA 1CC3A 1HL4A 2J1YA 2VIRB 5CHNB 1R24B 1CFNA 2VDPL 4JRYB 3LRSA 5FWQA 3OMNB 3QUZD 4PGJA 4NKOA 4L8SA 3SGDI 2EZ0C 4JN2B 3D8MA 3EO9L 1JMZA 1I8LA 1X6NA 1ZGLP 1RJZA 5T1KD 2HH0L 4R5VA 3ISRA 3OLGA 3N1FC 1MW1A 4NS0A 1J9SA 1P9MC 2D7OA 3T9WA 2EYRB 1SRDA 3QDMB 1QSFE 2VZ3A 3KLLA 2P5WA 5DHYB 3IKKA 4HJGA 5AQ0A 3MLYH 4IM8A 2IGLA 5T3ZE 2CO7B 4TPRH 5I5JA 5B8CC 2QEJA 5AAMA 5ECGA 4O2FB 4OD2A 1QQDA 4DGYH 2A2QT 3W39B 3G04B 1JUFA 1QBML 3GXPA 4XNAA 3L08A 1JERA 1NFAA 3IE4A 3KBPA 1PNDA 4HLJA 4O4YL 4HCFA 4FTVE 3LRMA 3SKJL 3WY2A 3WDIA 1J5OL 1I7TB 3EYVA 4AYID 3I75A 4RZCB 2WSPA 5DJCA 4D8PB 3A5VA 3TCXA 4NWTH 1CLOH 2EVJA 2HKFH 3FFCB 4RETB 1AOZA 3QJQB 2OXGA 3TBVA 3I9PA 1KB5A 5CAYB 1QRNB 5GGTL 3DOHA 3VFGH 2E6QA 5EU5A 1KB9J 1M1SA 2XQYK 5ANHA 5CO1A 4ZPTA 3SSGA 3HR6A 1VGEH 5DK0A 2VXVL 35C8L 5KBMA 2HFGL 4CMMA 1J8SA 1UVQB 5HYJA 2OYKA 1GZQB 3GDBA 3HC4H 4J23A 2EO1A 2VL5A 1NDMA 1UGKA 1MCHA 2CJ3A 2LTQB 2ZUSA 3T0VA 3PWPB 4EXKA 2HRHA 2VR3A 4CW1B 4JHAH 4FADA 4PJHE 2Y3AA 2YD5A 2JE8A 2X0VA 3HRZA 4TN9A 2IPUG 1KTBA 2NX5D 2VAAA 2W07B 5K59E 4KJWD 1BG1A 3WFEL 2PCFB 2W88A 2H2PC 3POCA 5I0XA 4D0CB 3GJFH 4G3YL 4XVSL 4JANA 1SVBA 2E27H 3G08A 3BXNA 4NPYB 2R1YA 2K45A 5HDBB 4NQDE 3VFMB 4PTUB 1IGCL 3VI4E 1IKNC 1D5BB 1HQRA 2PYEE 3ELAT 3GK8H 5FKAB 3SPIA 2WTRA 1XHHA 5D1XA 1XCTB 1DVFB 3FO9B 3FB7B 4NZJA 2CDGB 2DQGL 4A66A 1BXAA 1OTTD 2YRPA 3LXBA 3MLRL 4S1RL 5MI0B 4X5LA 4HOMA 3UCRA 5E5MA 1HFUA 1ZJBA 5FX3A 5ECJE 5TE4H 2D7MA 5A3IC 5C2BL 4F20A 2D3JA 2COQA 2W9DL 1CE1H 2G9HB 4FFZL 4PRHD 2ZJSL 5FUCE 1KY7A 4TLKA 2B5IC 3BPCB 4GXVL 4HKJB 5F7BA 3KMDA 1AR2A 1KYOK 2K4WA 2J8HA 5E1AA 1M7DA 2YLHA 4N4YB 3GSQA 4WY7L 1G1CA 4EI5A 5HHOD 1FN4A 3MRKB 4GUPB 2RFXA 2CLZB 2R2CA 1MFEL 3CFBA 4P5SA 1EHKB 1OW0C 3BN9C 4R4BB 1AAJA 3T77A 2FL5A 5TQ2L 5DD6B 4DP4X 2R4SH 3RUGE 3ZU8A 2F5AH 2NUPB 3H42H 1N3NA 4JQXC 5K39B 1ONQA 4ESKA 1BPVA 1N0LB 4OLUL 3HBPA 4OLYL 4WO4D 5MEPB 1P7KA 4K9EH 5EU7C 1AXTL 1VEMA 4HEMA 3LKOA 3WI9A 5MENB 4LKXA 4MQXC 1VFUA 2BS9A 4H5SB 1XT5A 1YRKA 5FEBA 1WC7A 5I19L 2OW7A 3ZRSA 2F54A 3VACA 2MIZA 1UTDA 2BWIA 1WCQA 5IVXF 4MWFA 5IHLB 4X5XB 5JXEC 1AO7A 5CMAA 1JYXA 1E4WL 3TCLB 3TT3L 4ELME 3LXAA 1EXHA 4O5LL 4GQ9L 4LF3B 3VSVA 3IN2A 4XI5C 3KJ6L 4LASL 5B7EA 1GR7A 2AKRB 3GLDA 5EORH 3HS0B 3NCJH 4GW5B 5DR5H 2GCYA 3QPKA 3NACL 1ZLSH 6TAAA 3GPEA 5A2CA 4KJYB 5EG6C 5BXFA 3AT8A 2FHFA 2VDML 2LR4A 1ZWIA 4U1NB 1TZHB 2XN9E 5JIQA 3OMAB 4K7FB 5JO5B 1CIUA 4BZ2L 5DUJA 4YH6A 1EFXB 3BP5B 3EOTH 5IIEB 2D3VA 1L0YA 3EYOA 1OP3K 1P84K 2NY4B 3TXAA 3CDYA 4LGSB 1ZLWK 3GXNA 1NCIA 1KGUA 1YNKL 3L9YA 3L9BA 3BAXA 1UYWH 5LN4A 1EO8L 3ARSA 1QR1B 1D5IL 5EZLB 2YPVH 3BH4A 3M1BB 4IOSD 3NSXA 1F4YL 1TDQA 4YJZL 3WXWL 3R4RA 2X4NB 1M7IB 2XV6B 4I48A 3IU4H 4FYRA 4I5BB 3BH8B 3IJHB 2ZXEB 4KXDA 2WQVA 3B2UD 2YQBA 2CLVA 2DB8A 2R69H 4HKBA 3MN8A 4MVBC 3FF7A 1BVZA 1QFUH 5I17A 1DQDL 4JUSA 5DS8A 1UATA 3MRDA 5KTEL 3C2SA 3CFCH 1XGTB 2PWFA 1U8NA 2ESVD 2Z9TA 3MOBL 4IRJC 3QUML 1MZYA 1PMYA 2ZNXA 2G0LA 3DOSB 3D09A 2ID5A 3MRLB 5I16B 2NY7L 3GSNL 1F3DJ 3MV9B 3C5JA 4X50A 1CT8B 1HS6A 4MXQD 1SGKA 3IMWA 4IU2B 5CU9A 2BERA 5HGHB 4M7LL 3EGXA 3BMVA 1NLDL 4ZX6A 3RVWD 1RMFL 3IK2A 3O45B 3H4HA 5HI4C 2FZ3A 3AQYA 3M88A 3CN2A 5IFAL 1ZEAL 1I1YA 4PJIF 1U8OA 3BGMB 2CGRH 1ZJAA 3BPOC 3GSRB 1UD4A 3HI6H 3ROOB 4UQAA 5KSVA 3WEXA 3GO1H 4BQ6A 5JPNC 3WNMA 1AGBA 5CIPH 2OTWB 1Z5LA 4N5UA 4ETQB 4B9FA 2YMXL 1T7WA 4K7PH 1MLBB 2E7LC 1DVYA 1TYJA 2HFEA 3DO4A 1HSBB 4HGKC 4E5XG 1INDH 3OKMA 1P1ZB 2VC2L 2G60L 2B4CC 2EDXA 5IB3A 1U9KA 4JQIA 1HQ4B 4QIRA 1MAKA 1WA0X 5HI3D 2QLVB 4KI5F 2DD8H 4FXGA 3QFGA 2VXSL 3QS2A 1A9BA 5TJWK 1UQSA 2DF3A 2H2SC 4NIYE 3O9WA 4WK2B 3UJJH 1QI5A 4PLKD 4LDLB 1F41A 4U1IB 5KJRL 4NENB 1NM4A 1JV5B 4HLEA 1MREH 1JXGA 2VLJB 1IAOA 1NMAL 2VLKB 2IOMA 3F04A 3KWVA 5CJ5A 4I2XB 1T04B 2BVPB 1IGML 4DO5A 2I25N 5I1EH 3NIDE 1DFBL 3M86A 3T0ED 3ZHNA 2A9ML 5DI8B 1MHEA 4IRZL 4NNXA 1G7JB 2IH9A 1KCSH 2SEBB 4RIRA 5E08H 1CBVH 1B88A 3C6LD 1QSEB 4Q7DA 4LSQH 5F96H 4JFEB 4OT1H 3PU7A 4MMXA 3FZUD 3V9FA 2Y4SA 2R0ZL 4WKXA 1CD1B 3FBKA 3PGCB 4HS6B 4GXFA 3EYFA 1HOCA 4WHCA 3KPSE 5EDSA 5L2KE 4UT7L 4L8DB 5IM7B 4QXVA 5GGQL 3SDAB 2OX5A 4YHMH 5EBLB 4JFHD 4FFWC 1ZS8A 3KPRE 4F8QA 5C92A 4TS6A 1Z9SA 4KKQA 4Y4FA 3DIVA 1ULVA 3NSYA 1J87A 5D93B 5BVPL 3D2UB 2ZWSA 3L3DA 5ACMA 3LRLA 2I9LB 4LPUA 4F80A 1WQVT 4RBPH 3RB7A 4N26A 3IDIA 4KTEH 3DX8B 2E5EA 1L9MA 1I3VA 4APQA 4JREC 1DQMH 4C54A 2HJLB 4AIOA 1YDPA 2X09A 1TYRA 3TPUB 3TTSA 2HVJB 3WNOA 2AXFB 3HUJA 1RJYA 3APNA 2AJXH 3TTYA 1BP3B 2K70A 3GXMA 3W0WB 1H9DA 2BNQD 2G3ZA 5LGJB 4AEIH 4DP2X 2F5BL 4OFYA 4MCZA 4U05A 4O58H 2X4QB 3GHEL 4GSDL 2Q86A 2UVEA 3MCLH 2WCGA 4CSTA 2FVNA 1WISA 5IW6B 3OJ2C 1CICB 3SIKA 3R0NA 5GIRA 4WVRA 1H5BC 5B22A 5I1LB 1F1DA 4K7PX 1GS6X 3ZXAC 4XP6L 2HKFL 2XNAA 3O8XB 5EF2A 5I6MA 1ZTXH 5IK3A 4XMKH 1AHWC 2F7QA 2V4LA 3V9CA 4EN3B 1T2XA 1WAEA 2X44D 2AP2A 3GS4A 1CFVL 3BWUF 2F7IA 2K78A 4G8FB 3VWKC 3GBDA 2Z7UA 1S9YA 3O3DA 5ABDE 1QR4A 4V1DB 1B3IA 5DFVD 4U1HA 1T5XB 1TVHB 2IANE 3K2UH 4GKZB 5JR1L 5FYLD 3UTPD 3QIWD 1K4DB 3F7KA 3JWOH 1BVNT 1ZA6A 2EIZB 5GRYA 5FW8A 4DKFL 3ZDXE 4AGOA 5DS1A 2DI9A 3U9PL 2E9BA 4NZTH 1PSKL 2FTAA 1UEMA 2LLLA 2YD6A 3C60B 3JYCA 2N4IA 3P40A 5C0IA 3FCSA 4GG6E 2XPGB 1WLHA 2DDQH 3GZKA 4JFDA 3TFKD 1JF6A 2E27L 4LOUC 2AQ3A 2WLLA 2NLJB 3JVFC 1YY9C 4CILA 5DMKA 3S3DB 1MIEH 3GXUB 4WDIA 1B4LA 5T1DH 4BGLA 4UYPA 4AJWA 1T1XA 1DFXA 1CN4A 4OI9A 1NKRA 5KSAD 2BP3A 1EXUA 2EIBA 4ZUVB 4NYLA 4XXWC 1RXLA 5MHSE 2CKNA 4TSBL 1FDLL 1WWWX 2H7WA 1BVLA 1ORSA 4Z7VF 1GTFA 2OJ1A 5TE4L 1YMMA 1QFWH 4X6FA 3JWNH 3CSTA 5E4IA 3QI9B 1AR1B 1I31A 3QJFB 1T0NA 3BC9A 1CE1L 5CP7B 3WJLA 4C56B 4KZDL 1LP9F 5E03A 2J2ZB 1RY7B 3T6XA 4YBHA 2X6VA 2FT8A 1JWSA 4JE4B 4FZEH 2R2BB 3OZLA 2V2TB 4LAQH 3KXFA 1A22B 1JNNL 2WZPA 3UJTH 3V0WH 3F7YB 4YNYB 2VRAA 4MA1B 2VKXA 1FNAA 1I7RA 2CUMA 2FBOJ 3QZOA 4C57C 4AH2B 4E9VA 5BNXD 1MHCB 3CC5A 1P4BL 1KG0A 4HS3A 2BOCA 1U93A 3BLPX 3L9RA 5DT1L 4YDKL 5CCKH 1DDTA 3TYGH 2H26A 1JMXA 1TQVA 2X1OA 1ZVNA 3MX0A 4HHWA 1JF1A 3H42L 3S37L 1CGXA 1XCXA 1LK2A 3JT0A 2B0SL 3FOMB 1I8MA 3Q5TA 3O3UN 3MRHA 4LXFA 4YL9A 5LO7A 3R8QA 3LQMA 4EUPH 5ESVB 2NY1B 2OMTB 3TNNB 1S9WB 1E65A 5D55A 5E2UL 4K3HA 3RZCC 1QSFB 1HNFA 3E38A 1JI2A 3I74A 2L7UA 2IH3A 1MSPA 4ONGH 1FCCA 5DLLA 1ZSHA 2XY2A 4E42B 1LLAA 2QJDA 3FPYA 3QJOA 1CGUA 3KPNB 2ADGA 4JHWH 5AVRB 2WMPA 5J13B 4OGYL 3L1OH 4Q56A 4FTVB 2KZKA 1QO3A 1WZAA 4HT1H 4BZ1L 4M9PA 4MZ2A 5KBPA 3IFNL 3QEGL 2CSPA 3O4OC 1QVOB 3CXDL 3P02A 1FVEB 5CCGE 3SGJC 4QKTA 2CR6A 3BSHA 3PHQB 4HV8A 3VSUA 5I82A 2LOEA 5K93A 3ULVD 1N67A 2ZXAA 3NPSB 1IBHA 2ICEC 4ADJA 2CALA 1A47A 5FECB 4UANA 2D73A 1IFGA 2J88L 2QSQA 4HUXA 5DJ8B 4F1ZA 4DEPB 3KL3A 4WIQA 3A6CH 1NC4D 2JTDA 1AJ7H 4DF9A 2FLMA 1F42A 5TH2A 1GZHA 2GK0A 2Q3AA 1A3QA 1NGZB 4LEOB 1MJ8L 3S3PA 4WGKA 1ZT7B 4BA0A 1BFVL 3L48A 2BVYA 4QLRA 1N6QL 3EO1B 2V9QA 1MRCH 3HS8A 2DICA 1AFVH 4FEIA 4ZXBB 3DRTA 3LV3A 2YPVL 5B1KA 2QHRL 1BXUA 4PJHB 2Y1ZA 4YK4B 1K5WA 4X4YA 4XXDA 1PQZA 4PEEA 2GG1A 2OMVB 3QEHB 2NY0D 3ETBF 3QQ3B 2R69L 3G3LA 1B6DA 1ZHLB 2Z93B 3VD7A 4AK2A 4AEFA 5KYYA 1RUPH 5T5NF 3BQUD 3CFCL 4R90L 4YHOH 4X6BB 5HHXH 1HL9A 1Q0YL 4NQDB 1DUZB 5K9OB 3K6SB 4PJFB 2EVIA 2VDQL 3GD1C 4LHQB 2PYEB 3QPXH 3X3GL 1XAKA 1DJSA 2RD0A 2MOGA 3FB6A 3QUZB 4UU9B 3IFPA 2ZWNA 2BW4A 1PZAA 4ZS7L 5T5FA 4K3JH 4OZ4A 1G6RB 3J7HA 3IETB 1KCBA 1MCPH 1MQKL 2IAMA 3E1ZA 3OD3A 1NPJA 1TQCC 4JFFB 4G6ML 3LN4B 4XP1H 1WD9A 4OCYH 2KQMA 5HDRA 2VUKA 3ESNA 3DMMC 4MYPA 3TEUA 1R0AH 4IOIB 4PMEA 4B50A 1DSWA 2V2XA 3QIBD 2VQ4A 4WWKD 1HSAB 1X5MA 1CLYH 2WAHA 5BZWA 1A6TB 4AV4A 2BPBA 2C8NA 1Y7VA 4UTAH 4KO5A 1EX0A 4NP9A 2FWUA 5E2WH 2BFGA 3FMGL 2GITB 4Z7NE 4BRVA 5LXVA 1F56A 3JZYA 3CVHB 1COBA 2CIIB 2WQRA 4KZCA 2OI9C 4M6NH 4B6ZA 4WJ5A 3ZTJH 2D7QA 5D96C 1J0HA 3UC0H 1KN2L 2UV3A 5DXWA 1G87A 3GBMH 3BOVA 3W11C 4HZLA 4JGMA 3RUGB 4KAQL 1PVHA 3UBGA 3QC6X 4JMNA 1S46A 2HFFA 2YA0A 1MREL 3ZUNC 1JGVL 4YE4L 1V3LA 1M2OA 3VG9C 4QHMA 5D7IF 1LO5A 5KYXA 1NDGA 2HB0A 1NGWA 4S1QH 1I9RH 4R7NB 3FTGB 4F9LC 1S9XB 1WAAF 4ZMLA 2XRAL 2XN2A 2YUWA 1ZOXA 3IXTB 3UBHA 2YKKA 2DQTH 1CYGA 3OGOE 4NGHH 3KL5A 4X4ME 4KRNA 3P9LB 1AMYA 2XV3A 4YHML 5C0RL 4DPCX 4ABQA 3BGFB 1VJSA 3D85B 1XF4B 3EADA 4BWTA 2DQIH 2JB5L 2Q2LA 3N43B 5BCAA 2WYZA 1GAFH 4OUOA 2E3VA 1YN6A 5F89B 4KJPC 4PY7B 2C26A 2F6AA 1SHMA 1A64A 4JQVA 4ZW5A 1RSYA 2V0AA 4PR5B 3LOWA 4QRRD 4QMEA 4L9LA 4V33A 3E3QC 4MMYA 4JPSA 1FORH 2XTLA 2XXGA 3D34A 4OQTA 3F7PC 5JHLH 3OJDA 2XN9B 2WUCH 2K7PA 5ENWA 4IBYA 1O6TA 5B1JC 4K71C 3HHMA 2PTTB 4Z0XB 4XXCC 3W56A 4J3OF 4MQTB 3SDXB 1NSNH 4L4JA 4DPAX 4P5TC 3HAEA 5HDLA 3QB7C 5CSGA 4ZJ9A 1ILSA 1JS4A 5E99L 4HIJB 5D7LD 3WIFB 3P2DA 1D6VH 4PRHB 3QJZA 4X8JB 3QRFM 1F6AA 2BMKA 3QUYA 4O58L 4Y5VB 1SXNA 3MO1B 3TA3C 3FQWA 2XTJC 5CJOL 3EFFA 5K9JH 4YXHH 4YSOA 1PL3A 2AEPL 3MCYA 4JY6A 4ZO6A 3KD4A 1W91A 2H6OA 4N8VB 2ZAHA 3SBRA 4TQ8A 4JCMA 1NFDF 1OARH 3WIHH 1VHPA 5AW1B 4XO5A 3U1QA 5I1IH 4LKCB 1G9EA 2EECA 2F2HA 1AQKL 5E0FA 3AY2A 1FFOA 3ZRFC 1M71A 2DIBA 3ABKB 4XMKL 1ZLEA 4ZAKB 1HH6B 3CH1B 5CP3H 3VYOA 2EE9A 4QOKA 1XFPA 4RMWA 1Q0EA 1YYLL 4IW4C 4GRWH 1R19A 1SYVA 2XXFA 2FQFA 2VR8A 3F6IA 4WO4B 5EU4A 3OX8A 3F12B 3QBTB 3D33A 3WKMH 3CFUA 4PUBL 4AM0Q 2LV4A 3D4GA 3AS3A 1FNEA 3CFKA 3GMRA 4YR6A 2VSMB 4N8VG 5AVTB 3CDGB 4FXKA 5EU6E 3LAFA 1D5RA 5BMFH 1X7SA 1EAJA 2G75A 4H8UA 5H35B 1OAQL 3QCUH 2OZ4H 3UFIA 1RZ7H 3US9A 2YXMA 3TO4C 1QG3A 3D0VA 1UB6B 1T5WA 2QADD 4KHTL 1DZBA 1QUNB 3WO3B 2NY6D 4HJ0C 2W0FB 1J8HB 2V6HA 1JZFA 4NKQB 2YD2A 4FYTA 1JGEA 3DI3B 3EBHA 3WNLA 3F58H 3EO0B 3KEDA 4PJFF 5A2KH 1C5BL 2WWKT 1M9WA 5EUOF 5CEZH 1G0DA 1U8IA 2CAKA 3CC1A 4NM4H 5IQLA 3RVXC 3MTXA 4PRAB 1MHPL 1TKWA 4ZPVB 2VM3A 5HVHB 3DXAD 1K3ZA 4MBRA 4N0UB 5GS2H 3NIDB 4KX8A 4BV1A 1UG9A 4YUEH 4PLOB 4BWWA 3GSOA 1U8QB 2XWJA 4I0PA 4P59L 4G72B 3FT3A 4MB3A 1GIGH 4RWHA 1F3RB 3MRRB 4JO4H 4Y5YA 2B1OA 5E4AA 4FG0A 5L2KB 3T0DA 1R9FA 3HN3A 4WFEE 1T6BX 4EI0A 2W92A 5E23A 2WBJB 5FM8A 3QDJA 2F8VA 3KPRB 4EOWL 5IJKA 1OGAE 1BQHA 2I26N 1HE7A 2VXQA 3INOA 5A6IA 2BVOA 4LO9A 1F4AA 1RUAH 2ATPB 2NQCA 4XNXH 5I1HH 1OHQA 3UTTD 4P2QE 3ZZQA 3L3JB 3PIQB 4ZX4A 2A0LD 3D06A 4YSPA 5CINH 1A3RL 4CRPA 3BMWA 3DROB 3HLAA 2R7EB 5IQ9A 4ES8A 4P23D 1UEYA 2I07B 4G43B 1K2DB 2WBWB 3BVWA 4QRPB 1OKEA 3LKPA 3UMNA 3HE6A 3PL6C 1BZ9A 1MKFA 1KXTA 1OZTG 3I6KA 5GS3A 2WKOF 2A5UA 3BIKB 3RVVD 1JNHA 5KSBE 3M17B 2WJ5A 1CLCA 5J0BA 5D72H 3ZUCA 1ZSDB 3RTQD 4HIHA 3WMSA 4DN3H 1Q9WB 2W95A 4RMQA 4N2MA 3PWNA 4LEXH 4BFIB 4WNQB 4JJ5A 1YY8A 1PAMA 2K0RA 4HOZA 2BNRD 3VI3A 3E0GA 5IJCC 1UADC 2Y9RT 4HEPA 2VZSA 4PHZA 3UROR 4YIQA 1NCGA 2CBMA 3SPHA 3MRQB 3RURA 4NNPL 5AAPA 3HE7D 5I5RA 4YE0A 4IJ3B 4MJ6A 1NJ9A 4HQQH 2VITB 4J8RA 2IQ9H 5IEHB 3ILPA 3B5GA 1HL8A 4J7RA 4XPBL 3C2AH 2MPAL 1ASOA 2P26A 5GRXG 1JPGA 1ZMYA 1FGNH 4Y2DB 5I1JL 1IC0A 2XZAH 4EAEA 4NQSA 4WSGA 5AYUL 2XCMC 1HHIA 2RGSA 4GKOA 2IANB 4NRXA 5TDNB 4JPWH 4MA3A 4MA8L 5E7FA 1G0XA 3E2HC 2EJ1A 4AGMA 2AJVL 2QVTA 1TTCA 3FN0H 4KQ4H 3FQNA 3HFFA 4M5ZL 3T6ZA 4Y4HB 2QHLA 5SX4I 3SDXF 3ZDXB 2L3BA 3V4PA 3V4UH 1IQWL 1OB0A 1L9OA 1MDAA 4CN4A 3LKNA 3TWYA 1F00I 3FT2B 4FL4C 5F9OH 4R5TA 2H0FA 4WV1A 5ICYB 3CBRA 4GG6B 1TQBB 3FQ4A 4KX7A 3RWDB 2E9JA 4UQCA 3O41B 2LAAA 3ZYZA 5HHXL 3RB5A 1O7DC 4HJSA 4AGLA 4E68A 3IFLH 4Z3JA 4LCWE 4P2OC 3C5XA 4DKDC 2BCKA 4UAOC 3SOBL 4PLNC 4PJ5A 4JFVA 3T0BA 2ADJA 1JHTB 4FNRA 1HE8A 1UWGH 3OXRB 1IB5A 2XXCB 2HRPH 3FONA 3W57A 4MD5A 3ZKNC 3KBHE 4B9IA 1F3JA 2A83A 4FQJL 3RGVB 3TEWA 3MRBB 4TOYL 5A1AA 5EZJA 2XVGA 3DPBA 1UM4H 4PGBB 3FQTB 4WW2A 3TO2A 1BQLH 2OYPA 2XZQH 1MCEA 5JHAA 3LZFH 3HI1A 4QAMB 1CGSL 4F57L 5I8EB 1G1YA 4R3SA 2X2IA 1P2CB 3CIAA 4JPVH 4ODSL 2W80C 3WIAA 2QKIC 2VDLL 5B3JF 4G80B 2MNWA 1UH2A 4DQOH 4U6XA 4Y5XA 3QAQA 4IEFA 3GBML 5DEFA 5FYKL 3V10A 1JK9A 1FFRA 4QRSB 1MJUH 3U1PA 1FA4A 1L7IH 1IBGH 4PJ7E 4XC1H 2DEWX 3NRPA 3VRLE 3E6FB 1YNTF 3II3A 1OY3B 1Y0LB 2ZWKA 3UP6A 5J11B 1JPTL 3MFGB 3TJEH 1FNSH 1PF3A 4GFTB 4N0CD 5F3BB 1WT5C 5F97E 3PS6A 3B4NA 1P5VA 3U6XA 2MOQA 3DBXB 1CDJA 1EEZA 3CZEA 1D7CA 1UH3A 1M6OB 2CHZA 4LBEA 4CVZA 3AAZA 4NQUA 3FW6A 5IHBA 1H6UA 3B3BA 4O02A 5KYWB 1IVTA 4WNJA 1IAIM 2AJZB 1SJEA 1ZK9A 2GJZA 2HG0A 4GI6A 1VDGA 4XPFH 3QQNA 4J4PC 5F0MB 5FYJH 1A6UH 1JZDC 4HXBL 3IDGA 3CCHB 4WUUA 4OZIE 3QISA 1M2VB 2Y24A 1KEML 2D0GA 4KK6D 4UUJA 1CVSC 1NCBH 4JFSA 2VSKB 1JPSH 1X6LA 3RDTD 5JDSA 5JHLL 2FJGA 4A2FA 3LQAH 1C8PA 2OMXA 1XO8A 1QNZH 2EXYD 4GXUM 4GIOA 4KK9D 2P47B 4LCYB 5GGUB 3J2PA 3FB8B 2XDHA 5HYSA 1B4TA 4PJEE 5BRZA 2CLRA 3MBED 2DQDL 3CD4A 2QMKA 1M1XA 2Z92B 3CTTA 1D6VL 1R5WA 1CLZH 4MJJA 2AK4D 2WLHA 1MJ7H 2ZCZA 2C1OA 5I1GH 2F58H 2H4EA 4MX7A 1MG3C 1TQSA 5K9JL 1FO0L 1JWUB 4F7TA 3K6FA 5IGXL 3ABZA 3MGTA 4M43L 5A2IH 1BJ1J 3VFVA 1FZJA 1JZ2A 4L8CB 1A6PA 4IHOA 4KKAC 5JIDA 2HLAA 4LLDB 1AKJD 3SEPA 4Q6IB 4XPHH 2A38A 2X4PA 1TU2A 5LDUA 2MEJB 4PJGF 2WLMA 1FBIL 2CD0A 4XRCB 1N7MH 4B41A 1DBJL 2D2CC 2YMTA 4K07A 3VXPA 1OAYH 5DF0A 3L7EA 2YN5A 2XZCH 4N9OB 3LIZH 1WEJL 3NJGA 4ODTL 1KJ2B 4QRFA 2YARA 4R2GC 3V6ZA 2IH8A 3FRPB 2F18A 2CXGA 5GQBA 1FFNA 2DYSB 1WBYA 4CC4A 5KSUA 5I5MA 4GKLA 4X0KA 4FQIL 4I18B 4HP5A 1UB5B 4YHKH 2VIRA 4ABUA 4P9MH 5CHNA 1R24A 2HLEB 2EIMB 2CA3A 3ZZLA 1IM3B 2X4TB 5I6OA 3FXIC 3N40P 4Z7NB 5BV7C 1G7QB 4POUB 4RESB 2BSRB 4P46B 4JN2A 4QHLB 1PLGH 3SJVD 3V0GA 1M42A 2PPAA 5LGHH 3VFNB 4YFEA 3NIGE 4L8SC 3OPUA 2FJUB 3V0FA 3QE5A 4GMTH 4JG0L 2EYRA 1I8LC 3QDMA 4AZ8B 5JOPD 4AYDC 4POZC 4DGVL 2MCG1 5HGAB 1NC4B 2YGQA 2CO7A 4O2FA 3O2VL 5E24E 1M3IA 3IDYB 1EVTC 1LO3H 1JRHH 3PPEA 2M2DA 2P28B 1QEXA 5AAMC 4M4PA 1PG7L 1LGVA 3ZZ1A 3FCTA 3E1F1 1I7TA 5GS0D 3AU0A 4RZCA 3V0IA 3GUTB 5F9JB 3O3BB 1KT2B 2OL3H 2J8UE 5IFHH 4U6TA 4D8PA 4DK6A 2ICWB 1E8YA 5IROA 2WXRA 4AL8H 3FU0A 4CDHA 3L4WA 1FVDA 3KL0A 1CZ8L 1E9QB 1SUJA 3FFCA 4L1LA 3N42F 3SCMA 1MHHB 5LAPA 2B4CL 1SFHA 5FCUH 1BXXA 1URZA 1QRNA 1H3WM 3EYSL 3S97C 2O5ZH 5EIVA 1JXFA 4Z7OF 1JG9A 1LEKB 1WFTA 1DANU 4E9SA 4EMZA 2VT0A 3BUPA 5ICZB 5IHUL 4KZEL 4TLSA 4AYGA 1L6PA 2BZ7A 4E9TA 1GZQA 4W93A 1JYWA 4UB0H 1DQQB 3QA3B 1ERNA 2LAGB 3KJ4C 3VXUE 3PWPA 1N4XH 3ULUH 4HWNA 1YYML 5D1QE 1NCOA 4PJDF 4Q6YA 3LN5B 3L5XL 4FXLA 4TF4A 3SKMB 4MCYB 4M56A 2PCFA 2GSIA 1AI1H 3MGAA 4D0CA 3HRZC 3G6JE 1A21A 2AJ3B 1P6AB 4NPYA 2XWTA 4R7DB 3NMEA 4ZUUB 4Z3IA 3Q05A 1OE1A 3VFMA 4LEXL 1KFAL 2NXZC 3BVNB 4MRBA 1D5BA 1G5AA 3LIUA 5FKAA 3S2CA 2BSCA 4L0YA 1LJMA 1Z9PA 1XCTA 1DVFA 3FO9A 3FB7A 4XN9A 2BOLA 3GTVA 3N04A 2JCWA 5C0GB 2CDGA 4TNEA 3DRQB 4HZ1A 1DUYB 1VESA 3FN9A 2ZOLB 4PCKA 3JV4B 2H1XA 1NFIA 3V0JA 3WHE1 1E4XH 3ESUF 3H3PL 1MRFL 3W37A 5GGSY 3WU1A 1PKQB 3BPCA 4HKJA 5F7EH 5E1HB 1A7QL 4LPWA 2XWDA 1AD0B 1AQMA 2DQFA 1U36A 3ZQWA 3QIUD 4MA7H 1JZ6A 2A9BA 1M56B 5EUKB 3VMNA 1ET5A 2XFGB 1UA6H 2O6EA 2UYLA 4XPGH 5FO8B 3MRKA 5EU6B 4GUPA 2CLZA 2DLFH 4JO1H 3AG4B 4X7CC 3FH5A 4XAWL 4R4BA 4EI5C 5E2TH 2P9RA 1G9MC 2IPUK 4HPYH 1VA9A 5DD6A 3UTSE 3TJPA 1ZHKA 4ZW7A 2NUPA 3ARXA 5BUGA 2A6DB 1GSKA 3SE4A 5DUBB 1WPCA 3N41F 4P8QA 5K39A 5DJAB 1N0LA 5J9PB 4YPGB 2DV6A 2VDNL 1FNGB 1XIWC 3NJLA 4N2LA 4LIQL 5MEPA 3DJZA 3I6LE 4W1TA 3QQ4B 4B9JA 4ENED 5MENA 2AQPA 4QRRB 3K2KA 4I0KA 4AV5A 4N1CA 4JDZB 3MRCB 3R0MA 2YAEA 1DQKA 2D9QB 3NH7H 3FPXA 1AHKA 1N9PA 3QXWA 5C71A 3B6SA 2MMXA 3BYTA 4NOBA 3P3SA 4QWWC 2H0PA 4X5XA 4C4KT 5G55A 5DC0A 3TCLA 4JZOB 5D7LB 4FQXD 4KRMB 2DJSA 5JIIA 2XZQL 1DYZA 2JIXD 3BT2H 4LF3A 4EF3A 5DJXB 3GIZL 4IDJH 1HYSD 2A4CA 5EEUA 4RGMC 2ZONA 4X6DE 3T2PA 4QR7A 2AKRA 4JBSA 4JHVA 3HS0A 4GW5A 1NCWH 1QBBA 1MFAL 2NY2