1G1KA

Cohesin module from the cellulosome of clostridium cellulolyticum
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
143
structure length
143
Chain Sequence
ASLKVTVGTANGKPGDTVTVPVTFADVAKMKNVGTCNFYLGYDASLLEVVSVDAGPIVKNAAVNFSSSASNGTISFLFLDNTITDELITADGVFANIKFKLKSVTAKTTTPVTFKDGGAFGDGTMSKIASVTKTNGSVTIDPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a cohesin module from Clostridium cellulolyticum: implications for dockerin recognition.
pubmed doi rcsb
source organism Clostridium cellulolyticum
molecule tags Structural protein
molecule keywords SCAFFOLDING PROTEIN
total genus 32
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1g1kA00
4UYPA 2Y3NA 2W1NA 1ANUA 2BM3A 2CCLA 2XDHA 4UMSA 2O4EA 5LXVA 4N2OA 4FL4C 1ZV9A 5G5DA 5K39A 4U3SA 1G1KA 4WKZB 2B59A 2VN5A 4UYQA 1OHZA 4FL4B 2JH2A 2VO8A 2VN6A 5AOZA 2OZNA 3L8QA 3GHPA 1TYJA 3KCPB 3BWZA 4IU3A 3UL4A 4DH2A 4WI0A 1AOHA 3FNKA 2ZF9A 1QZNA 3KCPA 3F2LA 4IU2A
chains in the Genus database with same CATH superfamily
3EHBB 5EF1A 4E9SA 5GISL 5DZOA 5EEXA 4BSJA 4RGND 1R33A 2QQLH 4P9HC 5F1SA 5I71B 3EFFA 1G84A 2CZNA 4A7QA 5FGBC 5CZXC 2ZICA 4ABWA 3PGDB 2PCPA 3GTTA 4DCQB 1HQRB 1A3ZA 1BQLL 4H13C 4X8CA 5FM5M 1N0XL 2AEQL 2EXTA 2CLZB 2D3JA 5AVWB 5ECGA 3RA7L 1AHWB 3K71B 3QXAB 5B4MD 2YN5A 2EIKB 4GRWE 3NP3A 2A9NH 3ARWA 1OLZA 4ELMB 5E08L 5ALCH 4JG5A 5DYOB 3K3QA 4XAKD 3H2QA 3BGMB 3OAUH 4XAWH 2L0DA 5CSZB 1CLYL 3VO0A 1FG9C 3I84A 1ZEAL 3QUMH 4LVNB 3MRJA 4BH8A 1CGVA 4NQCE 3UEQA 4APXA 5D7HA 3PS6A 2H9GA 2MMXA 3SGEH 2R2HA 1CF8H 4M62H 2QGBA 3FQRB 3WD5L 1C08A 4N0FB 3UPCA 4J5VA 5G4OA 1G4RA 2X6CA 5C6TL 1LGVA 3GSQA 4K7FB 3DROB 3RVXC 4JG1L 2ZWLT 1GC1L 4WEMB 2QPUA 3I6GA 1MN4A 1DZBA 2FBOJ 4YBHA 5CJQL 4Z8FL 1XTMA 1YNTF 1THCA 3FN0L 4FNQA 3HRZC 5ESQA 4NZ8A 4ZD3L 1S46A 4P4RA 1LL1A 2VXUL 1WZLA 3LKNA 4N28A 3WGUB 5GGUB 5BS0E 3L9EA 3Q2NA 5ICXA 2J88L 5JR1L 4QY8B 4RDQG 4FFZH 3BRDA 1P69B 1D9KB 1KBWA 1YN6B 5AVYB 3ZZQA 1HXYB 3QUKA 3JWNC 3RWFB 4DN4H 1TYEB 2LU3A 3MV8D 2C1OA 1A6AB 2NY1B 4O02L 1YEKH 4A2HA 5JHLH 4ERSH 5IMKB 4TUJA 2AJZA 3RFRA 4PJ9B 3WN5B 3K2UH 1YNKH 5EIIA 3VW3H 1KB5L 4ODXB 3MRJB 3QEGH 4AJVA 4BH8B 3EJSA 2Z65C 2HX7A 5FKPA 3TBYA 1IKNC 3IKKA 3BIKA 1QFOA 12E8H 4R4ND 4W9FC 4K7PL 2DIBA 2XQYG 3B83A 1AKJB 2CIKB 2NX5D 3BSZL 3MLWL 4L1DA 4LLWA 5BZZA 3ZUCA 2FVNA 3EF7A 4HJGB 3NFSH 3VDAA 4BK8A 5DZLA 3M8OL 5EU6D 2NY1D 4EI5B 1A3LL 3VA2C 1XD1A 1KTBA 2RALA 1AO7B 3WIHH 2AF2A 1DQIA 4A7GF 6PCYA 1TSRA 4OLZL 4KJYA 5FAAA 3UG3A 3PDOB 4D9LH 2B1OA 3GRBA 4M4RB 1CLYH 4C83B 1MXDA 1OGPA 3O45A 4IK6A 4OFDA 2G2PA 2IQAB 2KC0A 1GZHC 4BUQA 1ZDQA 2HT2D 2F7RA 3FUMA 2AVFA 2JV6A 5DUBB 2WXQA 2XYBA 4LDOB 4CC4C 4DN3H 4F2MA 4HOWA 5ABZA 5EUOF 4KQ3L 3KR3L 2J6WA 4AQ1B 2VDQL 4XPHH 3NRPA 2EEFA 3BZ5A 5E4EB 3MRFB 3LD8B 1DCEA 1U8OB 2JQMA 1T2QL 3LRKA 4KK9C 3V6OA 2Y2YA 5C0CD 2X4SB 4NM8L 4PRIB 1FDLL 2VTFA 2CWRA 2YKLH 3BEWA 4UQBA 4F33B 3T2QA 2CUAA 3ZKMC 1I3RB 3QJZA 2F5BL 1J0ZA 2YD7A 5IJVB 3OG6B 4PJXB 1GYWA 3GGWA 4GQ9H 5C0JA 1QKZL 2ZWKA 5AUMA 4HS3A 2OTWB 2HJKB 1GGIH 4FHKA 1KT2B 2BSRA 1RZGA 4G8FA 4R9HA 4BDVB 3BESR 4D0BB 1AD9B 1NTDA 4Y5YC 5EPMA 1I3VA 3LN5B 3U30C 2WNWA 4PRID 4OCYH 3ULSB 5GXBB 3ZHNA 3KXFD 2Q86A 1SOQA 4OV5B 4MVBD 3MKGA 4JFYB 3ZDXB 5HYFA 1G6RH 1P7QD 2EVJA 2BSEA 3HI1B 5HPMB 1PD0A 5GRJH 2IBGA 3X3GH 4JUTA 1PZCA 3ULVL 5C0GB 3VE0A 4FXKC 5HHOA 1VESA 5JHDE 2ZUYA 1DQMH 3SE4C 1M6OB 1WE5A 4JQVC 3VH8A 4GP5B 4HHWA 3PAYA 4G8GA 1JDAA 2FH6A 2JLPA 2XU9A 5LB1A 1OCOB 4EZKA 3M1CA 5HHOB 2NR6D 3Q01A 5ADPL 1ZLWH 2WXGA 2B4CL 3TPKA 1VRSA 5E70A 4AYID 1LK3H 1HL8A 4HF5H 2X4PA 3AREB 4O2EA 5C0BD 5CBAB 4S0HA 1QWUA 2G60L 4XPGH 5GZND 1TQCB 1M05A 2XWTA 3CXDH 3EOTH 1J1PL 3NCJH 5HGAB 2R56L 4QIRA 2CJ3A 2QSCH 1PF3A 4P2AA 1MH5A 2BP5M 1LEKB 2XVLA 5ACMA 4QEGA 1D5BA 5GRUH 3B3IB 1L9PA 3EYFB 1J8SA 3PQYD 3VACA 1D7DA 1IC5H 3VFOA 5KANI 5L6YL 3AB0B 1J8HD 3AQDA 3KPRD 4PGDA 4XPAL 5I26A 4LL9A 4X5XA 4DZ8A 2MPAH 2O5XH 3C60C 4HK3J 1UH2A 1M4KA 3L5XH 2ZE0A 4LPTA 4CSPA 2AS5M 3NFPB 3OMAB 5GRJL 3IYLW 2O5YL 3TO4B 3WJMA 3ARRA 1UWFA 3FCGA 2EDHA 3CFKA 1P7HL 5IK3B 3EH1A 1SQ2N 1FNGA 2EC9U 1H5BC 2QVFB 3UTZB 5CZXD 1PSKH 3VSVA 1KGIA 5DRNA 1QO3A 3NJHA 4X7TA 2XT1B 5F0LB 1WHOA 3L4CA 3TBVA 1KBBA 3AROA 4AV4A 2AHIA 3NTCH 25C8L 4GRLA 4KVCL 1CFSA 2DQMA 2GUYA 2VXQA 2W60B 1S7SA 2BSBA 2OA9A 2K6ZA 4A2MA 1IGYB 1PMYA 2FBJH 3PJSB 5J1SC 5D5ME 1G6VK 1OKEA 1U95A 4LCIH 4BZ1A 1IAIH 1QRNB 1EFXD 4HUCA 2HFGL 2A73B 4I18B 5CGTA 4QRPE 2QBWA 4QRRD 3DHMA 3T0AA 3GSNH 1CXIA 1B0RA 1ROCA 4DAGL 4Y5XC 4RNRB 5C0BA 5DD5H 5JXEA 6CGTA 2YEZB 2K78A 3KHQA 3GZOA 3C5ZC 4KI5F 1QNZL 4XVJL 4YEEA 3EIFA 3MV01 4RLDA 2HFEA 3WY3A 1VFUA 4HJ0D 2CO1A 2QVIA 1JNLL 2RMNA 4XMKL 5CILL 1U3HA 4XT1C 5EO9A 4MJIE 5SV3A 1ET7A 1KB3A 1A5FL 1LWRA 3NPZB 3O8XD 4OGXH 5EHFA 3UCQA 3ZZ1A 3LEYH 1MVFA 5GRVK 1XB8A 2CU9A 4Z78A 1LO4L 4HCGA 5HHOE 3T09A 3LPWA 4F27A 5IJVA 2EVFA 5DURB 1CQKA 1U42A 2XJLA 1KBVA 5MEQB 1FE8H 2BERA 1D6VL 2YEQA 2O93L 3B7RL 1KCSL 3FT9A 1IBYA 2BFVH 1IC4L 5I1CH 2CCWA 3EFDL 3ZDYF 4HLZH 4NIKB 4DKFL 4E41E 1FNLA 4S0TD 3CQPA 1QSVA 4JY4A 1M71B 4EVNB 5E6UB 3KE0A 5FYKD 1EFXA 1WIPA 1ZTMA 2OMBA 4F24A 1ZS2A 3APCA 4Q52A 4F5CA 4DGVH 4BKSC 1HFUA 5ANHA 1HEZA 4PRBB 3FBQA 2Z7YA 1PLAA 4XB8A 2WSPA 3MHZA 2APVA 4DO6A 2FR4A 5GGSB 2B4CH 2OX5B 5BRQA 4LHUG 5KVFL 1IFGA 1TQSA 1NBCA 3T0DA 2WCGA 2VZSA 5C09D 1GZPA 1PX4A 4B9FA 4XCFL 3VGBA 4MQXD 4PJDF 4P07A 5BV7H 3Q6FA 5EMYA 4B0MM 5JLZB 2GSIA 5F8QC 2Q8AL 4P3WA 1TJIL 4RGOH 4HHAA 3G5XA 4DSYA 5MENA 3MFFB 4M3JA 1JFHA 2Q8BH 1MEXH 1W72L 5LAPA 2F2HA 1KCRH 1NC2B 1T7YA 4KMTL 2X3CA 3QWRA 2O6CA 4QHLA 3GRGA 3HS0B 4XMLH 5JUEH 4P23D 2J73A 4WHYG 5TK2A 1A1OA 3BKMH 3IGKA 4LQFL 4LVEA 4AG4H 3AREC 4G6KH 3C60D 4GIAA 3OMZA 1JF1B 2Q3XA 4X9IA 5E23A 4FD0A 5INDA 3WENA 4FG6C 3H1ZA 4PRDB 1TEYA 1FQ9C 4MAUH 1R3LB 1UUSA 3SE3C 4CN1A 1A3QA 4ZO8A 1AQMA 3ZYOA 2XQYA 4ACPA 1LE9B 1X5KA 3LAFA 4PJ8A 4YZWA 1S8DA 2YAPA 4AUUA 3QCUH 2QZ5A 3H3BC 3E6FB 5FGRA 3U2SB 2BPBA 3MUGA 1WIOA 2XWJB 4YSSA 2Y6TE 3DVNB 4WVRA 4IRSB 1M42A 1Q9KB 5DEGA 4M1GH 4JFHD 4MSWA 1IEBB 2CNYA 5LKNA 5E6IB 5HDBE 3C60B 1I1AC 4Z9KB 5L2KB 1U6AH 3ZT6A 3SJVB 3ULUD 2E74C 5D7EA 4FZEL 4XCCL 3OC5A 1N0LB 4G71B 4ENED 1RMFH 3PJSA 2NXYC 3KVQA 4XN7A 5BW7A 1U33A 5CP7B 3VX1A 2DH3A 1HEHC 4R7VA 3MRIB 4XPFL 2P42B 3V4PH 1VFBB 3IN0A 4ODWB 5T1KD 5DD6A 4MJHA 3U9PH 2GITA 4XVSH 4YHLH 1JRHI 1OXYA 1OSYA 5TPWL 5CEZH 2BW5A 2X4RA 5JMRA 1LO3L 4P2RA 4DHLA 2GHWB 2YUVA 1LO4H 3DURB 5FV1L 5IROC 5LBGA 4LPUA 4BEIA 3UTTA 1URLA 1ZT1B 3NEOA 4MXVE 1MFNA 2B15A 5I19H 1H6TA 3A4FA 1EEZB 1FJ1A 4ZFFB 1L4IA 3NT0A 4APXB 2P9RA 3HUJA 5I1JL 3QHFL 5GSRA 5FCUH 4R7NA 1U8LA 1EO5A 3UCRA 4P48A 3D4YA 4DO5A 4H4NA 1HHJB 4M7ZB 4B9YA 1HHIA 2QZQA 4OJAA 1R9FA 3HB3C 2BVYA 2BS8A 1QLRA 3N3EA 1S7RB 1SHWA 4PCSA 5F7MC 3ABMB 4NZRL 3V52L 2IXQB 1DQJB 1R5WA 4DKTA 3TNMA 4HSCX 3AG4B 2BC4A 4J1UA 4LLMA 3BPOB 1UEYA 1F2QA 2J72A 4Z7WB 4ZX4A 1IKNA 1UYWH 1DUZA 3KJ6L 3P3SA 3ROOB 3G9VA 1CLCA 3H4FA 1M7XA 3IM1A 3IDYC 3FXIC 2VZ1A 3OKDA 3RGVB 4EDXA 4ZI8A 3CSYB 3FN3A 4B53A 1D7CA 1ZWIB 1V54B 4UOZA 1E4WL 1A2YB 2ZOKB 3EYSL 4M5TA 2YOCA 1GA2A 1K6QH 5E2TL 4P9ML 1CGWA 4X9GA 3MSPA 3FHQA 4P2RB 2HRPH 2W88A 4W68A 5EO1A 3RYMA 5GZOD 2VR8A 2XV0A 5FO2A 2WYHA 3B2UC 3MLZL 2AK1H 2ARJA 3QQDA 4FG6D 4K5MA 3RWHB 3IFPA 3NIDB 1KYOK 1IEAA 2XTJE 5DD6B 4ZAKA 3BOVA 3MACL 5D1QA 5K5YA 5KSBA 1RZJL 5GSVA 3KZ8A 1NFAA 1U3YA 2C9UA 4YSAA 3K4DA 5GSRB 2WQWA 3S3BB 1MHHA 5CJOH 2DIEA 3O3EB 4G8EA 1W72B 2JJSC 2RB8A 1K8IA 4WI0A 4PR5A 1SXZA 5JORB 4NPYA 2DQUL 1MHHB 4PJGF 3TEYA 3NCJL 5CR1A 5DUPL 4B3VA 4S11A 5HJDA 2RFXB 4BK4A 4EDWL 4OZ4A 3D6GA 2VW4A 4GAGL 4B95C 4MJ4A 4E5XA 1PG7H 3IDNB 2OMYB 4GAFB 5H8DA 1DN0A 2CO7B 2WXOA 3BUDA 2I27N 2JKJA 3CC1A 4RRPG 3EDDA 4OQTL 1BYOA 5GGRY 4ONHB 2E0PA 3O8XC 5GIRA 5GQBA 5LN4A 1I8AA 2R9HD 4RFNC 1S7XA 4K3GA 2BP0B 1CE1L 4P5TC 1T7VA 4YJZL 1RZ7L 2HPTA 3LPPA 1U92B 4C58B 3H9SB 4NRZB 1CD8A 4PPTA 3BDXA 3GTVA 5AKVA 4PW4A 5KVDH 2HFFA 5LQBH 3OPZL 1VPOH 4QLWA 5CAYB 3AT9A 4QRQB 1SLXA 1UYWL 3MV8B 3S37L 4BZ1H 2GI0A 4PG2A 1F4WL 3GJFK 3TLRA 3NVQA 4WEEA 5E2UH 2VW6A 4CJ1A 4E0RB 4M03A 3BIAX 3N1GC 1KWGA 3MRMA 5CSGA 5I74C 4OCWL 5IVZB 3S88H 1UOWA 1EQWA 3HG1B 3CU1A 2NX5A 3O3EA 4G8EB 4HPOH 1O6SB 1R24A 2WLHA 4XN2A 2ADIA 1CZ8L 2XZCH 3ZE0B 5JPNA 1I1AB 1WTGT 2FQDA 3WIFB 2XQBH 1KJ2B 1PNDA 1AXTL 3NJGA 5KSBB 2VLMD 2ADIB 2AK1L 1OIOA 1WBXA 2X4OB 2A83B 2W0LA 3H42L 4Z7UE 5I28A 2OXHA 5CD3A 5L2JB 4HAKA 1LP9B 1OOAA 5DD0L 5A2BA 1RLWA 1SLUA 3QO1A 1GGTA 1PQZA 1DVSA 5HYJA 5IJBC 1I4FB 2TSBA 3D06A 1A4AA 3HB3D 3OQRA 3CUPB 4LF3B 1Z0MA 5DU7A 1NMCC 1NL0H 3QG6A 2E56A 4MD0B 1KIUB 2QFPA 1RJCA 3LKOA 4NZTH 4ODTH 5D6CB 1BZOA 1UOVA 2GJ6D 2XPGB 4GS7C 5IFHH 4TV3A 2AZAA 5F9OH 3M17B 4IDJH 3X3FL 2AK4A 4MTMA 3WNMA 1X5XA 2EYTA 4WFED 2ZWNA 1W0WA 5DRZA 3SQOL 1CU4L 3OGCB 4Q7DA 3RWEA 1J8HE 3FQYA 2D73A 3KLLA 4GMTL 4F2EA 4XNUL 1FZKB 4J4PA 3QUZA 2YSSB 4DK6A 2KDGA 4HEPG 5DK3A 4BFBD 2O6FA 2DWSA 1SJEB 2UYLB 2IPTH 3DUSB 3MYJA 1KGUA 2F19H 4N0RA 3OB8A 1MKFA 2EE0A 1CBJA 1MHCB 5D7JA 3UO8B 2ESVB 3D0LA 1HH6B 2VQTA 2ZX9A 3KH3A 4ICWA 4F9PC 3IDYB 3MJ8B 1KV3A 4XP1H 2VN5A 1B4TA 4IQHA 2YO3A 4Q6KA 4ANUA 4TYUA 1YDPA 1Z6JT 1IGTB 5ICYB 3OJDA 1FN4A 4AQAA 1AYOA 3CBJB 2OZ4L 4KTEL 4GQPH 1KUMA 4TLUA 4JKWA 3UROR 4ZODA 1E9PB 4NJAL 5EU5B 3KVPA 3DPBA 4B9GA 4Y4KD 4I0PB 4ZW8A 3VD3A 2GI7A 5BXFB 4FLQA 4U4BA 2XVGA 3SYAA 4C56B 5E2WL 3AAZB 1HZHH 4YXHL 4EZJA 1VGKB 3ZR5A 2CHZA 2M1KA 4DJMA 2C4XA 3ARED 5C0BB 3GLZA 3T65B 5FWQA 3FZUD 4WTZG 3APNA 3ESNA 4LU5L 3P3YA 3OB0K 5DMKA 5F89A 2MNWA 4OUUA 2O1AA 1CF8L 4P5TD 5HYSB 1GPOH 2ZF9A 4R5VA 2ID5A 4MAUL 3M17A 3ROLA 1LP9E 1MCDA 3HMXH 4KY2A 4JMNA 5KJ7E 3N6YA 1XXFC 3ZE1F 5T5NG 1AC0A 3VUAA 4LVOB 2GY5A 2TAAA 4NSKB 1JE6A 2BSCA 1NCAH 3RY5A 3OZLA 4NO0A 1AYRA 3FT4B 2E7HA 1EXHA 3WHE0 3CVHL 4PY8J 3ZE1B 4EMZA 4DIXA 3LSOA 2C26A 7FABL 5D6DC 1OCRB 3HG1E 3RRQA 4PLNC 3OHXB 3FQ1A 3WN6A 3B2PA 4FXGC 2E3VA 5TQ2H 3QE5A 1K8DA 2VLKA 3VB9A 3N04A 1UD8A 5BZDB 3GJFH 4LSRH 2F19L 3I6SA 1R3HA 3WAKA 1H3PH 1P9MC 4OZFA 1G9EA 2K9FB 5EF3A 1DVXA 3B7TA 2FJGA 1OWRM 3DX7B 3WO3B 1JWUA 4G83A 3ILDA 1JERA 1DP0A 5DJYB 1KG0A 4WKXA 4G6MH 4MNGA 1FUNA 3DOSB 4M1DH 5FYJU 4PLJC 3DVGB 1D5BB 3FTSA 1OSZA 5F9WB 2C1PA 1HNGA 1WIUA 4MJ5A 5HDQH 4FNLH 2YQ2A 5AAWA 4YDKL 3HAEB 1QTSA 4IRJA 3US0A 1Q38A 3MRBA 1TJGL 4ZO7A 2G3XA 1GTFA 1YNLH 3FB5B 5BV7B 1NFIB 2OW7A 3V4UL 5IBTL 5EZOL 2YQBA 3WKMH 4FL4C 2OSLB 4I1PA 4OLZH 3QUGA 4MDIA 1G5GA 4F5CE 3I6LD 3J27A 4LAQL 1WHPA 3UERA 2WNGA 4QLRA 4DUVA 3FRUA 1NEZA 4X7CC 3SCMC 3G5VA 25C8H 3NFSL 1TVBB 4FYRA 2P3YA 4J6RL 3MJ9A 1F4AA 5B38A 3DRTA 1CGXA 4M6NL 4RMUA 1G4MA 3MGTB 1JZ6A 3MFGB 1XDTT 4KKAC 3EDKA 1NDMB 1OAYL 3LB6D 3GHEH 2B2XL 3MLSL 2UY7B 4TSAL 1N3NA 1BJ1J 1ETA1 2NY2D 4F57H 2LU5A 4P9MH 4FTVA 1SPDA 2GJ6A 3NJXA 1N8ZA 4XPAH 3QIUA 5F0PB 1GVIA 1MWAA 3G08B 2C4FU 2BIIA 3CNKA 3DI3B 3L9YA 2EDBA 1XQ4A 4N2CA 1MCPH 5D7JC 1PIFA 4L8BA 2OCFD 1KACB 3ASNB 2WWKO 2NXZC 4F8PA 2HJLB 4X5PA 5HDWA 1SXBA 5E5RB 1MH5B 1DBJH 5FFLA 4FQXB 3TTSA 2XWCA 1NM9A 1G9ML 1ORSB 2PO6B 3CCHA 4PJBF 3K5SA 2QVTA 4G43B 5ES4B 2HJLA 3U48A 3VD0A 5MI0C 4GLRH 4HG4J 3HG0A 4NGHL 1QBMH 2GSMB 1KEGL 4KK6D 4OZIA 1ID2A 1NCDL 3RKDC 2IPKB 5FECA 2YR3A 4R90L 3T65A 1JZGA 4G6ML 1ZLWK 1TVHA 3A5VA 1CO1A 5F7WC 4WTQA 2VSDA 3A6BH 3HJ0A 5D1XC 2BZDA 1AZNA 4QTHA 4OZIB 4QRBA 3GMPB 3IFNL 2VH5L 4QOKA 2CA3A 3A0OA 3WIIL 2LU7A 3NZHH 4JGJA 2N1TE 2Q5BA 1RSYA 1MCLA 2XICA 3C5SA 4EZLA 2QVMA 1XF2A 1AZVA 1F6FB 3KDMA 2BSED 4BWTA 1CI3M 2NTFA 3BAJA 3QXDB 4KY1L 4YX2L 1X9QA 4XZ4A 1X7TA 4XPFH 4A2LA 3W5MA 5B1BB 2DDQL 4MA1B 3P4MA 4KI1A 2MCPH 3FQTA 3T1FA 4OGYL 1FAKT 4AY0A 4ZZFA 4UUJA 5T33L 4LCCB 4HWBH 4ENEC 1FZJA 4AEIL 5TE4L 2XWTB 1FNHA 1OE1A 2OZ4H 4KTEH 4M61A 3MCYA 4PEEA 2CJTA 2EE2A 2JI1A 3SJVE 5L2KD 4OU3A 3GXIA 1IM3A 1T0NB 3MRQB 4NHCL 3SJVD 1HSBB 4PJ8C 5I24A 5DK2B 2IF7A 3RVWC 4OF7A 5CHNA 1GYCA 2VDPB 1PAMA 4ZS6D 2F68X 4JRYE 2EYSA 3MRFA 3FUJA 3NGBC 4RX4A 4AV5A 4KK5D 5JYLA 2VUYA 3QRFM 4R8WH 1GL4B 1K2DB 2EDYA 5T1KB 1OGAA 2J8UB 4LCWB 1SNRA 1TR7A 2H8PB 1ADQH 3L45A 4BJLA 1TU2A 2FEJA 3QIBC 1QVOB 2IAND 5I30H 1CICD 1S3KH 4WO4C 3FB5A 1X5JA 1PZBA 2F8OA 4XNZC 1J8HB 1PZ2A 4S1DD 2FT7A 2ZYSA 3OM3B 2G3MA 4UILH 3LDBC 5LG1A 1NUGA 3PAVA 5DTFA 2YSTA 2XBTA 3L9RB 3NEEA 3QUXA 5FOBA 3DSFL 4HKBB 2HKFH 3RTLA 5DWPA 3O3BB 1FZMB 1F11A 3QZWB 3NA9H 4YDLC 1GS6X 3PLYA 4MBRA 4J8RA 2GIXA 2NLJA 5I19L 2X4QA 2I32A 5AKRA 2EZ0C 3ATEA 3RUGB 3SY0B 2FL5A 2X38A 2DJ4A 1DDHB 5C0FB 1NAMB 3ESOA 4AYBA 2YD4A 2KUTA 5DXWA 4Q6YA 2BXZA 1X3DA 4Z7OE 2B16A 3SDCD 2XWBB 2AJUH 3HCVA 1SN5A 1RQ5A 3R06A 2IFFH 1FYTE 5ESVB 1AGFB 3FN9A 4R4NC 1ONQA 4QF1A 4EN3A 3FH8A 3NIDF 3R4DA 5I1LA 4A38A 2JE8A 2E86A 2GAZA 3C6SA 3QWOB 4PVMA 3MPCA 2F08A 4PJIA 5F71A 4YR6B 3LEXB 5AVRB 4PS4H 2IALA 1R17A 4Y4KC 5SWSB 3TYGH 1INEH 4C4BA 3I3BA 5GGRB 2GTQA 4DW2L 3HG1A 2E7CA 1Z3GL 1T0MA 4L1BA 1EHKB 2DLHA 3K0YA 4MA7H 5BS0D 1DLHA 4Q9QL 2R4RH 2UWEA 1TETL 5DURD 2ZJSH 3DV6B 4KDTA 5EOCJ 4I77H 1PKOA 1ACYL 4LAQH 3T3ME 5J1AB 1A4KA 2VDKL 4QXTA 1S8DB 2WXRA 4IS6B 3JV6A 2GBUA 3BDBA 3D39E 4I0KA 3IU4H 3R0NA 5EG6C 4CILA 4YNYB 2AAVA 3HNVL 4M6ML 2OJZH 4NBYB 5FYJE 1MLCB 1ECZA 2DLFH 3AM8C 4YXLL 3GJFB 2EUXA 4DO4A 4PSPA 4S10A 3LPGA 2R8SL 3HRZB 4KKCD 1AGDB 1RUAL 1F0LA 1DJWA 1PVHA 2BP0A 3ZLQC 3QDJD 2JKRM 2MJWA 4L3AA 4YAQB 4RVBA 4KQ4L 2H32B 3QQXA 3VG9C 4Z95H 4EIZC 1KEML 1KCRL 3ZDYB 1J5OH 2QJDA 4DAGH 5A43C 5C0EB 4ZMAT 4JLRA 5K9JL 1M53A 1YEDA 4YAQA 3AUVA 3B5HA 2QMKA 3FB6A 4NQCD 4K94H 4A2EA 3ABZA 3N0AA 5E8NA 3P4OA 2RFXA 1OOWA 1QWHA 3IS0X 3LH2H 2Y06H 3GC3A 5MENB 3EOYG 3GXUB 1VEOA 4X8GA 5ID1A 1MG3C 3I02B 2QV2A 2BVPB 3IGFA 3E7JA 1PD1A 3D85D 4MXQD 3L2LA 3SQRA 4CL7A 1OF2B 3IJ9A 3ARPA 3VFMB 4Y4FD 4JL2A 3BISA 5G55A 3TM6A 4MYWB 2N7BA 3PHQA 1EFQA 1E9QB 4LRNH 1AVAA 1HIMH 1QW8A 4NQCB 5FUZH 1VFMA 5TF0A 2UXVA 1UM5H 4UM8A 4EDWH 1T3FA 3HG1D 2P28B 3WJLA 1X7SA 1XGRA 4WCYH 1HHJA 1KDIA 5CUSH 5I6MA 4JDTL 1FL5A 2FB4L 2WVUA 4NCDA 3ETBJ 3NN8B 1IC7L 4WK0B 1K4CA 2FTAA 1HWHB 1FNFA 1XR8A 3RB7A 4I1NB 3MCKA 4Y4FB 1ICTA 1BZEA 1DJGA 1I7TB 5B38G 5E99H 1SJXA 3RZCA 4G7VH 2ZQKA 1MY5A 3ZW3A 3FH5A 1P2CB 3ZTJH 3KGRA 3V4UH 1XF3B 2W0PA 2D4DA 5C0IB 2WBWB 2F54D 3UC0L 2CALA 1FAIL 5F96L 2BH0A 3BN9D 2P47B 3BC9A 5IWLC 1TFHA 4WO4B 3EJYD 2XZAL 4F80A 1N59B 1ZGLP 2JF1A 4IHBA 5I1IH 2H32A 2VL5A 5AAMC 4HUVB 4G1MB 4WU7A 4HOZA 1DQVA 2Y5QA 4ERSL 1JTPA 2CUIA 4GT7A 2DTML 2GJRA 5TF1L 5CFHA 4Q89A 4LK4A 1YO4A 4XZUB 5HYJE 4P57B 3KWTA 2H1LM 4KKNA 1WA2X 4RMQA 5DUMH 4IRSA 3L3HA 3RGHA 1FIGH 4UM8B 1Y18B 2VERA 2DWYA 5IMLB 4XBEH 5EN2A 3ISYA 2E59A 1C5DA 4QGYA 1HINL 1I9JL 5KG9B 1GCFA 3V9FA 4XPTL 2Q7YA 2OJEB 3P0YL 4M8QB 3N55A 3SZKC 3HZMA 1JPGB 1IZKA 4HZAA 2IQ9L 3GB7B 4JFUA 4POZD 4Y1AA 4BCZA 3JZ7A 1MF2H 1OK8A 3NG5A 3RX7A 4KK6C 1DFBH 3SO3C 3STLB 2ZX5A 2W59A 2HVKA 4X6DB 1OARL 5C97A 4NBXB 4OZHE 1T1WB 3TZVB 3RPIB 2KDYA 1A0QL 2CR6A 4Y4KB 2H2SD 4GI6A 3LMJH 1FL3A 4EBQH 3FQRA 3KYOB 1SY6A 2WHVA 4L1TA 4OGAC 4PQXA 5FYJD 4PR5B 3ECBB 2X4OA 2YK1H 4TXVB 2P8PA 3J7HA 4MD5B 3GSVA 1MXGA 4N6RA 1ZT4A 4PCKA 4IKKA 4JKPH 3HVDA 5AOMA 1NANI 4YHYC 1HYSC 1H3VA 1XIWA 5I2IB 3W9DB 5ILTH 4PWIA 5AENA 3UC0H 2GCYB 3ZL2A 4OD1L 3KCPA 4MASA 3EOAA 4XMLL 1A6PA 2FLBT 2FNBA 3OZ9H 2HT4C 1NGZB 1G7MB 4IMLB 2HKAA 2IVFC 4QHMB 3EJZC 3OSVA 4MAYC 4YHPB 3MREA 1PS3A 2N59A 1MWOA 4BE6A 1J5HA 4JPVH 1IC4H 5I1CL 3WNNA 3ZO0A 1KB5H 3VGHA 4R97B 4WHDA 1O5PA 1WC7B 5J1TC 5I6NA 3RUGE 2QTEA 2VC2H 3D0VA 2VJXA 4JFOB 3N85H 4OFPA 3BDYH 1UOLA 35C8L 2NY3D 1T1WA 3KJ4C 1OB0A 4R6UA 4U49A 4P2RE 2R0ZH 1E4XH 3EADA 3TH3T 4LKCB 1ZV9A 2FK9A 5E9NA 2L4OA 1P7BA 4F7TB 4AQ1C 3TBSB 3STLA 2EDNA 1XGYL 2W81C 4Z5RB 4DGVL 4QXVA 3BVNB 1FVDA 2NSMA 5INCA 4I3SH 3MYZA 3RNQB 3KYKH 1WCQA 5F7EL 1E3FA 3PDDA 5GS2H 3IAPA 5TH2B 2HT3C 32C2A 2XG4B 2BVQA 3A47A 4U6XB 3RY6A 1REIA 1F58L 1N10A 3MLPA 1J8KA 2GTWA 4ZUVA 2Y5TA 4M7LL 2HKFL 2VDRB 3EHBC 2EXSA 3WFCH 5AEAA 2Z8VC 1LYQA 2QELA 3FYIB 1SEBB 1J1OL 2DQFB 2QQNH 3LQMA 3L1GA 5K9KB 3SGDH 3SDAA 2VRQA 5EO1B 3F7QA 5K1JA 3MMEB 4YPGB 1PZSA 2N0KA 1FIEA 4PJHF 5I17B 3WEBA 1K4DA 4JM2C 1C9SA 3ZL1A 5E08H 1O7SA 3HS9A 5BMFL 2PP8A 4AZ8B 1YQVL 3OQ3B 3PP4L 1FG2A 1E4XI 4MQXC 4W9GC 3VM7A 3GRWA 4HQQL 1A7QL 1AHWC 1MHPH 3Q8EA 3VE0B 2B14A 3EUDA 3A24A 2H3NB 5BUAA 1EV2E 5DVOA 3LNGA 4F7CA 3GSWA 5J6GB 2VQUA 3C2AL 1Z9PA 5GHWH 3WNKA 1JGUH 3S96B 4HHGA 5KBMA 4GY4A 2I69A 4JQIA 1R3KA 2NY5H 1WBYA 4GJTB 1AQ8A 3WHXA 5EZOH 5JPNB 3AG2B 4NO0D 5DMJB 1X44A 3FUNA 5F7EH 5AVTB 5FW6A 1GYAA 1FYTB 2H0JA 1SUJA 1A25A 4WDIA 3KH4A 4OKVB 3VYPA 4N2MA 4LDEB 2DQIL 1U58A 1OCWL 1F56A 3OG4B 1KCBA 1MFUA 2H7WA 4BGDA 1LO5A 1ZV2A 1UA6L 5CP3H 4W1TA 3UPRA 2GJ6B 3LYRA 1ZT7A 2CLRA 1QABA 1JZIA 1T89C 3HFMH 5IREA 3OKKB 2QHRH 4OZIF 3O6ML 1DBBH 4XVUC 1NCHA 2I60L 3SO3B 1RUKH 2HSIA 3AGVA 1HK6A 4M6MH 2OW6A 4MFHA 4YLQT 4KX9A 1TU2B 4N86A 1SVCP 1KIRA 4ZBJA 5C0NC 3S35H 4GUPB 4HPHA 3Q7JA 3FUIA 4N8VB 4FJYA 4MMYB 3TZVC 5GRUL 4DTGL 1LNUA 2HG5A 4GNKB 4ICXA 3N9GL 4W9CC 5LNGA 1NFDE 3HG4A 2LAGB 3GXPA 2GT9A 4LESA 5D7LB 5DQ9B 3QPXH 1DEDA 3U6XA 1AP2B 4J3OD 3BWSA 2O61B 4U0QB 2LW3A 1U8JA 3QEUA 3W82A 1DQDL 4OKDA 4X4YB 3BN9C 2YZ1A 1FH5L 4Z3TA 5HI5C 2Y5EA 4GMSL 3M86A 3V6BR 4G82A 1Z5LA 3QDJA 3WY2A 5DJAB 1LVEA 2I9LB 4NWUH 3G5ZB 5CGYD 5FGBA 2EDTA 1HEZB 5FWRA 1UD6A 5JQHC 4NRXB 4LEOA 1NGWA 4J3XA 5KSAB 5CIPH 3UJJH 2C1PB 5IROD 4ZFZA 5EOTA 3EH3B 3NABL 4GO6B 4I0PD 4UNIA 4GYBA 2ZYIA 3LKRB 5KSAA 1IMHC 4LP5A 3QCVH 1XSOA 1A1NB 3MBWA 1G7LA 4N26A 4F7TA 3RVUD 2C3GA 4U2ZA 1VGEL 4GBXC 3P73A 3QNZA 3MA9L 4JR9H 5KEZA 4IJ3B 4JRXB 2XTLA 3ZR6A 3BEWB 4M3KB 3L4ZA 4TRPH 4JN1L 2VIRA 4P8QA 3GS7A 2I07B 1CI5A 4YHOH 3INUH 1F3JA 4HEMA 3CN4A 4PBXA 1UM4L 2G0LA 2E7MA 1OPOA 5D2NE 3SDXB 4ANXA 2Q3ZA 2JVUA 3QPQC 4ZX5A 2R69L 4AT6B 5IVXF 3VGAB 3QPXL 3H7BB 3GZQA 3QRBA 4M3HA 3G7TA 5BQ7B 2AMGA 1VFOA 2L04A 3PGFH 4K8RC 3JV0A 5J13B 5DEJA 4EUPG 1KN2L 2Y2WA 3BLBA 2H2SC 3Q9PA 5I8CA 2I9LA 2AQ1A 3QYCA 1UH3A 4KXDA 4QCIA 3QCUL 4NQEB 5I8EA 3WG7B 3WNIA 4FNLL 3CZLA 4OGAD 3RUGF 1DQQA 3LRGA 1AOHA 4OFVA 2J71A 2NYZA 4L8BB 1T04B 1N9PA 2ZKHL 3I3DA 3RZWA 4U33A 2OMTA 4M1DL 3O3AB 3OR7A 4OQTH 3V0VA 5CSBA 2FH8A 3P0YH 3V7AE 4EN3B 5C8JA 4XGZB 3WO4B 2WLKA 4OM0H 2KH2B 3VG0H 3KNBB 1C7TA 2NRDA 1HINH 4O00A 4KKLC 2ENYA 4MMZA 3RFZC 1D5MB 1P9MA 1BQUA 1E30A 1E3XA 1H9VA 4J6IA 1KELH 3U4EB 2XA8H 3P2BA 1NFDF 2P52A 3UDWC 5I66B 5I75C 1BM7A 4FXGA 4UAOC 1SY6H 5DI8A 1XHHA 4QHNB 2W65B 2V8LA 1OANA 5E1AB 4JHZA 4R96B 2V2WB 1HCYA 4AK2A 4ZTOL 1IC0A 2OSLA 3WU1A 1CD1A 3LQZA 4BFIB 1ORSA 3KPNA 3QZWA 1OAYH 3EO0B 3K2MC 3V79C 5I8CB 2DLGA 4H0GA 3TVMB 3ZKMD 2B08A 1V7NH 5ALBL 4EOWH 3CQFA 4Y7OC 3BD5A 1DQQB 4U0RB 3UTPD 3CVHA 4UZUA 4YMPA 2EIZA 1YEEL 1KBPA 2YFNA 4BHUI 1ASQA 2VKXA 4N2HA 1S5HA 4RAUB 4JVUA 3TVMA 3QIBD 4IHOA 5JDJA 4A37A 1L6XA 2VXUH 3LS5H 3KPSE 2CGRL 4LHUA 2ZG1A 3T3PF 3AACA 1FL6B 4WUUB 3X13A 3OVUB 12E8L 1AXSB 4YHZH 1XFPA 5JTWA 4TNWF 3WS3B 1GMIA 2QVKA 3BAWA 3O8XB 1OM9A 1YUHA 1R0AL 1TMCB 1BXUA 3IRCA 3QDJB 4ZSOE 1JMXA 2W92A 2FGWH 5K33A 1R3HB 1G9HA 2A6DA 1R5VB 3QXDA 1DJSA 1FHGA 1XIWD 5I5IA 3ZYIA 1ZIBA 2A4ZA 4P2CG 4ZJ9A 1MCHA 3LHPH 3NCMA 5DHVA 1A7OH 1V3JA 4IBVA 4MNGE 2KLRA 3NTCL 1ODUA 4LRIC 3BGAA 4QTHB 2WKOF 4NJ9H 1MRDH 3L6FB 2OQJA 1KGYE 1XB3A 2EKJA 3HW7A 4H8QA 1RK0B 3EJCA 4NB7A 2FT8A 4O4YH 3BQUC 2CO6B 2QFRA 4K4KA 2WTRA 3T8XA 2HTLD 3K2KA 4HIHB 1AD0B 1IU1A 3V7MA 1MFAL 1OQXA 1MFDL 3C9NB 4NDMA 5D8JL 1B9KA 1JSYA 3QQ3B 4MB3A 5KYNA 1QHQA 3PGFL 3C5ZB 4YUEH 2DV6A 2DDQH 2YPKB 3G6JE 3GZPA 4XH2B 3GI9H 5F6IB 4U2YA 2MPVA 5TFSL 1Z9MA 2AQSA 2LFGA 4JM2F 1JGIA 3ZT7A 2CGRH 4PP2A 4KHTL 5DEFB 1CLOH 2P24A 4DKAA 5BQ7A 1T21B 4UYQA 4NO5B 5DFWH 1E6OH 3G5YB 4QHUB 4M9OA 2I9TA 4M48H 3O4OC 2Q7NA 4BKLA 1B2WH 4Z77B 1SXSA 3I6LE 4ZFOA 2ZTBA 2XNAB 1VADB 1PZ5A 2R29L 3VXMB 4CAGA 4UBDC 1OTUC 4WWNA 4ZRGA 5HDQL 3WDHA 1PL3A 1NC2D 1X7QA 1CR9L 3GBNL 3ZHLA 3VD1A 3C8KB 1WPCA 1I9IH 3L3IB 1UT1A 2ZCLH 4UQIM 3ARVA 4XNQA 3K8MA 4JZOA 4Z3FA 1KYFA 5F7DA 2WAHA 3O3UN 3TBCA 3OB0H 2VMCA 5JPMA 1FO0L 1NMAH 1QBML 4PJDB 2AVGA 4XC3L 1HZHL 1AGDA 5I1EH 3WIHA 1H3WM 2DQHL 1BVKB 1NAML 5I6LA 3GSOA 3MRRB 2ZIDA 1U21A 3DWTA 3S4SA 1L5GB 2FUQA 4WTXA 3UZQA 4KVCH 1CFBA 4X6EA 4JHVA 3QJSB 4L1LA 4LMQI 3E9UA 4H8UA 4M6OH 4N0UB 5IVZA 5C08D 3HC3H 2AJXL 3QJUB 3UG4A 1KEMH 2XIDA 4TLTA 2Z35A 4GXFA 4CUCA 4Y16C 3ESPA 3F58L 1NKOA 1MEXL 2LABA 1AZRA 1CFQB 4YSTA 3G04B 4Z7VB 1SUHA 3FTWA 4FGMA 4OD2A 4PVNA 4F57L 5ICZB 1KTDA 2CLVB 3AABA 3RVVD 1N68A 3KPNB 4YR6A 2VITA 1OM3L 4H40A 1GY2A 4Y2DB 5EC2B 2APXA 5D7LE 4EXPX 2ZKYA 4XVUD 3W9EA 2K9UA 1HHKA 3MC0A 4ETYA 4IM8A 3L95B 1PLCA 2BNQD 2FX9H 2I60H 1C12B 2DD8L 3D50A 5K9OB 4H26B 4XNQB 3HS0C 3IEAA 3CX5K 3PWJA 4M7JH 3OKNB 3E2HB 3PWNB 4WNSA 5A2AA 2DN7A 1CT8A 2FJFB 2JB6B 3GI8H 1VADA 2NNAA 5FLUA 3T5WA 2HX8A 4J3OC 3GPEA 4NO3B 5D71L 3WIAA 2WC7A 5CLXA 1LE9A 3FRPG 1DQJA 4N2DA 5ERWA 1AIFA 4N0YH 5DJZA 3DTXA 1IARB 1FHNA 3MRNB 3S8GB 3N44F 4G1EA 3QFJA 2VXQH 5JPMB 4ELMA 1J10A 1AHMA 2KZ1B 2KL6A 2AAAA 2CGZA 4ELMF 1S5IL 3F04A 1RHHB 5LXVA 2F53A 3FQXB 5E6IC 1ADWA 2C3WA 3UACA 3VWKB 1T4WA 4YFDB 3E6HB 1K3ZA 4WI4A 5CMAB 3TP4A 1G6RB 5KUKA 1XB6A 4GKZA 2NXYB 3WKYA 1S9XA 3CPLA 3K72A 4L0ZA 2AXWA 1A64A 1KJVB 4PJ7E 4OFYD 3H9HA 2Z31B 5T33H 2ZSVB 1J9RA 4DEWA 3U36A 3I2CH 4YHPA 1ET8A 1IFHL 2GUOB 3DPBB 4FFZL 5DD5L 1YEHH 1EUTA 1TQTA 3QI9C 2CMRL 3E38A 1YEDB 2A4CA 4LE8A 1XGRB 5H35A 2R83A 4UV7L 4KMTH 4R0LB 1C5CL 2WGNB 2BC4B 3FTZA 4J1UB 5HDBF 4A68A 3RY6C 3GD1C 2QMJA 2E9WA 5I2IA 3BH4A 1DBKH 2ZSWA 1JPGA 5KZCB 2DJUA 4HJSA 2ZKMX 3L3GB 2Z64C 5EF2A 3BW9B 4KZCA 4K8RD 3KCPB 2E7LA 5L9DL 5BV7C 3S8FB 3W0WA 3BUTA 4AEHL 2DQDH 2ZCZA 1D5RA 2DQJL 1MFMA 2COVD 1MJJB 1A6UL 3T6XA 2R15A 3MXVH 1DSWA 1F86A 4BELD 4OQTA 5IESH 2O4EA 3W0WB 2X6UA 4AEFA 2CDGA 2UXTA 3J07A 2WBJD 4MB5A 5I18H 1RK1A 4WGVB 3D85B 35C8H 3C6LC 3HKFA 1QUPA 3BHBB 1OT2A 4Y9EA 3GDBA 3N1MC 4JRFA 3IDMB 3ZOAA 4P2QD 5BOZG 4WAFA 4KROB 2ZSVA 4X9FA 2JB5L 3RU8H 1DVYA 3FB7B 3B2MA 3BCFA 5E4OA 4A7SA 4WU5B 1BZDA 5D1ZI 1NPJA 3MOAL 4XMXA 5FHBL 1JXDA 4UTBA 5HI3C 4MAYD 5FA3B 4JFZH 3B37A 1OHZA 4JN2A 1MCCA 4PS7A 1FC1A 1V55B 2APFA 1KGJA 3WJLC 4JKKA 4ZXBA 1LXMA 3CZGA 2IAMD 1K5NA 4KROD 4OCYL 4MCMA 2X09A 1A47A 1W72A 1J7VR 4E9LA 1VACA 1EIBA 3L2MA 5BW7C 5AW7B 2PCFA 1P4BL 4ZFQA 4R2GD 3TURA 4KTYA 1WAAE 1KJ3H 3MBEC 4KTDH 2PCYA 3IMWA 3VXRA 2TSAA 2PTTA 3L3OB 3HFFA 3IDXL 2MSPA 4Q4IA 4QDGA 4TN9A 2FJFA 4MMYA 4GSUA 4N24A 1WBYB 2B7DT 3G6JF 4LF3A 2JH2A 4RGNE 3FULA 4NO3A 3SN6N 2EECA 1C16A 3TBWA 1QR1B 2Q1EA 5BRZD 3AJ7A 3FSWA 4KMQA 4KZ0A 1CVSC 3SDAD 1TEFA 2VDMH 2Y7OA 5I23A 3I02A 1Q0XL 3LIZH 3CVBA 5DHVH 5B22A 1ZT7B 2CLRB 2BXYA 3WFBL 4PLJD 3GB7A 2NMSA 2WLNA 3PREA 4IIQC 4U1NB 2WZPA 4OY9A 5L7XH 3F7VB 2P80D 5B1KA 4U1KA 2JXMA 4ONFL 4XXCC 2FEEL 1NKGA 1JCVA 1U30A 1G7MA 3GT6A 4PRPD 4XMPH 3SDAB 4WJ5B 2PN5A 3MRKA 4Q14A 1BX2B 3T6ZA 4HD5A 2FECI 2WQVA 4GO9A 5I74B 5F88A 2N4IA 4UQ3A 1NCCL 3NJJA 1HZKA 3IDGA 3U7AA 2K45A 3GWJA 3DJRA 1BX2A 5DCCA 4FDWA 5EPMB 2JK5B 8FABB 1PGRB 4YSCA 3DOSA 1ZGLM 3VWKC 4FQCH 3QEQE 4RGMC 4LGSB 2X1WL 2VAAA 3BP5A 2PR4L 5DHDA 3DK0A 4U6HB 3LKQA 1PY9A 4WHTB 2VSKB 2F0CA 2FJGB 1RZJC 3BWAA 2NSXA 4YZFF 3DYPA 1PY4A 4AQ8C 5CEXA 3MGOB 3QXAA 2Z0UA 1DN0B 1KDJA 2CO7A 1LDSA 2A6JA 3MGAA 2YGPA 4K23L 1YPZB 2IAAC 3DNKA 3DXAB 1WJ3A 2XXCB 3GJEB 1UATA 1P5UA 2HLFC 5IM7B 3GM0A 2ZXEB 5D7LA 5DQ9A 4DFIA 5CEXB 3RVVC 3S3DB 1NMCB 4NN5B 2A0LC 4HETA 4MS8D 1NEZB 1U8KB 4NQSB 5E8EB 3TOPA 5IOPA 4UNUA 5DUBA 1SVBA 4F2MB 5T8IA 1EX0A 1DE4B 2WVVA 1DQLL 3S4SG 4K3JL 2X7LB 1QRNE 1CFTB 2I24N 3S2CA 1PX3A 1BMGA 4I3SL 3HPJB 4NIYE 4N5UA 5E00A 4HIXH 3QS3A 3QJFB 4UT7L 4AXWB 3DO4A 1UD4A 2GVYA 5F88B 4YHLL 3MUJA 3TBSA 4PRPA 4OI8A 4ZDHB 4PJEE 5KJ4A 3QJFA 4ISVA 1TQBB 1AKJA 2CIKA 3AWEA 4HK0B 4DNLA 2N0MA 3SE9L 1UURA 2ZX7A 2X2IA 1F6LL 2QSTA 3HI5L 2D2CC 1B0WA 2NZIA 4YHOL 3TBYB 5AZUA 2CKNA 5IB1B 5C9JB 3QZOA 2PO6C 5SWZA 3JUYA 3F6JA 2DMKA 4YQXL 2WP3T 3FU5A 4A6YH 5I9QC 5IB5B 2EXYD 2H6UA 5ACZB 5D96B 3LNIA 1F4HA 2EYRA 5FO7A 3SE8L 4LVHB 4TSBL 5C7XH 1DCLA 5K93A 1E9PA 1TFPA 2VWEC 1HI6A 5EU5A 4U1IA 3RJDA 5IMOB 2NQ3A 3VFGL 3T2NH 3VGEA 1QSFD 3MRCA 5CN3A 3G5WA 4ODSL 1TSHA 5KVGH 3VTTA 4RMRA 2OYPA 3V5HA 4A1RA 2H6PB 3FO0L 2CRMA 3NAAL 2VUOA 5HYEA 4LARL 3Q48A 3OLEA 5TK4A 3TBTA 5GGUA 4FERA 5IFJA 3DTUB 3HN5A 4OKVA 3CZEA 1L3WA 3GTNA 3PYCA 4V1DE 5C07E 1WQVT 3ZRFC 2B3RA 5AG8A 3CK0L 4MX7B 1J0KA 1AD0A 1P5UC 3G5VB 4PJAA 4TQEL 2F1BA 5F7FA 3T0VA 2ISDA 4B60A 1U2CA 3I3EA 3C09C 2Z7WA 4PV8B 4X6BB 1NGQL 3T77A 1A8JH 1IAOB 1NBZB 4JFQB 4M02A 2VE6B 3LXAA 4HKBA 3SKMA 2CR0A 4TUJB 5GS0H 4PS8A 5EFIA 1F11B 4G2AA 3JBG7 4GRWH 3B7UX 1TQVA 1LQBC 2XFXB 3QULA 4ILDA 1E5AA 5DRXA 4CVWA 1MQKH 1NLDL 1XR9B 2FWOA 2WYTA 3IF1A 4ADGA 5IY5B 3U7WL 4FZ8L 3LQZB 3MROA 4H25B 2V8MA 1KENL 2JXMB 3Q8BA 4PLOB 1XH0A 5ETUA 3AQXA 1VHPA 2YAEA 1MY7A 2R1WA 4ZOAA 2AC0A 5D93B 1PTZA 3ARUA 5HVHC 4GBXD 3MV9A 1A9EA 1DLFH 2H26B 1IILE 3NPSB 5A2KH 1JPEA 1J05A 4I9WE 1IGMH 4FXGB 4AQEB 2IJ0C 4OF6A 3UBXG 5D2NA 3RWCB 4OLVH 2YAOA 4RH4A 4IRJB 1FIGL 1O7VA 5FO7B 1NCNA 4HYTB 5DFTA 3ECQA 1KLGB 4I0CC 5JIQA 4DK3A 2XXGA 4X6BA 1N7ML 4BDVA 3QBTB 2GFBB 4P23C 1CXEA 1RJLA 1L9SA 1U93B 1ET5A 4JB9L 4DGUA 5IIEA 4WEBL 1RFDL 1XF5B 4HJIA 1LEKA 4MLIA 1D5XB 4M62L 1WAPA 2X0UA 4UT6L 4MS8C 4M43L 5A6IA 1Z9SA 2PTUA 3FQ4A 1T04A 2IAMC 2J8OA 3QJRB 4YHMH 3VGGA 3WEXA 1M05B 1VDGA 2PO6D 3EJRA 4QMEA 1E5ZA 1F8TH 1YSOA 4POUB 2WTRB 4GSDL 2O61A 3KM2A 3ES6A 2VLRD 1JIBA 3QCTL 4ZT1A 1UB5A 2Q76B 1C12A 4J6RH 5IEKA 4UWQB 1DQTA 3PABA 3R19A 1UZ8A 1NDMA 4Y9CA 3MLVL 5GGTA 2DRUA 4NNPH 4BKTC 1GZPB 2R1WB 3PDOA 1J9CT 2FJHB 4OLWH 5EF0A 4FA8A 3P77B 4V1DA 5AWNH 5DK2A 5JO5B 4JM4L 2ATPB 3HI1A 3S7GA 2Y07H 4FABH 1NBQA 1F41A 5HPMA 2HJFA 1DBBL 4G43A 3BUQA 2VLRB 3ESUF 1UWGH 1UXLA 2W07B 1YUHB 1KXTA 4DPAX 5BPPA 4HV8A 2WMPB 3I75B 2GC4C 4XE5B 3US1A 1BBJA 2VGLM 1H3UA 2DQEL 4FRWA 4YHNB 4BQ9A 4XBPA 3BZDA 4PJ8D 4YL4A 1KGXA 3O9WC 2D9QB 2E5EA 3SQBB 1OAXH 4GIOA 5HGAA 1Y7VA 4PREA 2YAFA 3D33A 3HAEH 3IGLA 4HLJA 1KLGA 3QR0A 4XC1L 4PP1C 5J6HB 1WA1X 4K0OA 1S6NA 1UJ3A 2HH0H 4O02H 4AUJA 1SXNA 4N2LA 4ZW7A 3UDWA 2GK0B 5MI0B 4CDHA 5KTEH 5D96C 1WFOA 3KDMB 1BQHA 3ZE1E 4C54A 4IIZA 1EHLL 1BXXA 3BT0A 4MNQE 4IBUA 2BNQA 3U0WH 1RKRA 4L4VB 4O51B 5E8OB 3RWGA 1KCUH 2VR7A 2XTSA 4X7SH 3Q8AA 2Z3FA 2HT3D 2FIRT 4AKQA 3HMXA 4N1HB 2IFGA 5F8RC 1Q72H 2BNQB 4HX1B 4WNQB 4IMKA 3C6LA 1TIUA 4Z3EA 3D3VB 3CXHJ 1EEQA 1DEEB 2CLVA 1CICB 3VI3B 1ACXA 1F02I 2QADD 4FYTA 5C07A 4YHYB 1KXVC 3T6WA 1OB1A 1NGWB 1SRDA 1OWWA 4RNRA 2CA4A 2MOVA 3FB8B 4D8PB 2MQGA 5A2JH 4QRUA 1LO3H 3S34H 4BFEA 1WF5A 4JY6B 4FNPA 1I8KA 4FN0A 1DJHA 4FQLH 4YE0A 3OKMB 4N3UA 4YC2B 4HIEB 4Q0XH 4UU9B 4YHNA 3GEWB 2B9BA 1HAWA 4I48A 4ZTOH 5E1AA 3UO1L 3BWUC 1B2WL 3KWXA 1HHHB 2XWRA 4MCZB 3X11B 4NUJB 1TZOA 3U79A 4PTUA 3W2DL 2EEDA 2Q2EB 3BUBA 5D1QB 5SWZE 2A4EA 5EOQL 5JHDD 3HTLX 2BHZA 4OBSA 1ZT1A 5D9SB 3VJ6B 4HUKB 4YN3A 4PMEA 5DLML 4AX3A 3ULUC 5C09E 1T5WB 1LK2A 3BAEH 4W9ZA 2X0WA 1VKXA 3MLWH 4IU2B 3DGDA 1WZ1H 3RPKA 2NXYD 3VFMA 4G5ZL 3C6EA 5DDHB 4PRPE 1KCSH 3AXHA 2VZOA 5KVEH 3DHUA 1PZ5B 1TVDA 2PPDA 3MCKB 3EYOA 5IJDC 4X4XB 1S2EA 4ODWA 1NIAA 2UUDH 5D1QD 4WV1B 4JDZA 1Y6NR 3QA3A 4BSVA 3DA0A 1W15A 3QIBB 1BWWA 4A7GA 3NJNA 4Z7WA 1I9RH 5AW9B 4F37F 3X13B 1DO5A 1LWJA 4E41D 2VDNH 3WEMA 5L2KA 1R5IA 1FZMA 4RA3A 2KI6A 4Z95L 4QRUB 1R47A 1DTUA 1CG9B 2EDFA 5LNDA 4P4KD 1AG0A 4LLQA 2DWEA 2ZOTA 4GSRA 5IW1A 4JQXA 4JFEE 1RZIA 1EHAA 2J6EH 4XODA 3BT2H 3CD4A 3E6FA 1XIWB 4NP4L 5HYQA 4R7NB 3H6JA 4J3OH 2IDSA 4ZD3H 1TJHH 3QHZH 3L3JB 1NC4A 4LGPB 4A67A 4L4TD 1Q94A 1MWAH 3L3GA 4MVBC 4HUVA 2WBJB 3CV5A 4ONOA 4J2XA 2IADB 4WHCA 5CN1A 2VDMB 2D3NA 3JT0A 4OIAA 5E9AA 5GJTL 1A6VL 1BAGA 4ZMQA 2P5WB 3VFGH 1QMUA 4U6YA 2C3VB 4S2SA 1QQDB 5AAPA 3P3TA 3ECUA 3IWVA 2I26N 3QEGL 5AW3B 2UY6B 4H8WC 2VRKA 4ZMZA 5HHPA 2DYPD 4K7PX 2FB4H 1HQ4B 1YY8A 2N7AA 4KMLB 1IEHA 1XF4A 1RFDH 3K6OA 2CCVA 4WW2A 2BSTA 1E43A 1TCRA 3T04D 4XNMA 4CVUA 2VJ0A 2DYRB 3AADB 3GMLB 3G6DH 4I9XA 4Y16A 3ZMRA 2QLVB 5DC0A 5B8CC 4FLOA 4N0FA 4BXSV 3B7YA 3BO8B 4HKXA 4NDMB 1DUZB 2WKLA 1TZHA 5DMIL 1BGXH 1RZIB 3LIZL 5BS0A 2GEQA 3ZYZA 3B6SA 2G30A 2BVTA 1TTBA 4X5WB 2A1WL 1F4WH 5JIHA 4HMEA 5B3NA 3MOBL 1XF1A 2PMZA 2EYTB 3GSRB 4IRZL 2OCCB 2ATKB 4IYKA 1O9ZA 1XSIA 5CJ5A 4K94L 2HXAA 3B9AA 2G5BA 4EKJA 1FVEB 4KKPA 4KFMA 5FUOL 4F7EA 1O6TA 2V2XB 1N59A 2FQFA 2L7QA 2A6KA 4RISH 5ITFA 1DSFH 2BY1A 4PJGE 1WDAA 4GKZB 1AHWA 1CT8B 3WTXA 3WNJA 5GJSL 7PCYA 1N5YH 5GS2D 4G8AC 1X5YA 1WD8A 3APFA 1OM3H 4TL4A 5JIKA 4AJ0A 2HCZX 1PJWA 3L7FB 4FP8L 2AEPL 3QUYD 4CBPA 3T4YA 2VXSH 4FYSA 1ZLVH 5IVXA 2ADFH 2X9XA 1H0DB 3T3MB 4JRLA 5J8OA 2DQUH 4FFYA 4FJ6A 4DOHE 4JPVL 4TOYH 5E9DD 2YA0A 1DJZA 3G6JB 5KSAC 4G6FB 2NY5L 2F7PA 2DBLL 4Y1AE 5JIMA 3MNVA 1V3LA 2E4FA 4R3SA 3BPLC 5F1OB 4PRPB 3WV0A 5JW4N 1B0GA 1RZKL 1VZGA 4UOW1 3MLUH 1D6VH 3QUZB 5IT2L 2FHBA 4JM0A 2XN1A 5E1GA 4CN4A 2UWEB 3Q0HA 4N0UE 5D1QC 5T1LB 1NEUA 5CXPA 1XSKA 4NPYB 3MRPB 4HISA 1FF5A 3PU7A 5D1ZD 5FDWB 3U7YL 4H0HB 4BQBA 4UDUA 1YUKB 1WFNA 2XSKA 3EO1B 3IDJA 1HHKB 4N8CL 1X5GA 3AY4A 3TT1L 2ZOWA 3H4HA 5DLLA 5E51A 3B9KB 3QJOA 2J8HA 4X80H 5GIRB 4O58L 4ZXBD 4XX1E 1EJ8A 2Y6SD 5K59F 1PQZB 3SD2A 1MLBA 3WXWH 3K71A 5FHAH 5MP6L 1YMMD 2XYCA 1YMME 4OJYA 4UV7H 3DBXB 5AYQA 3SODB 1I53A 1CLZH 2CDEB 3SKMB 4PHXA 4TNFA 3KW8A 5EOQH 3MNVB 4R3SB 3TT3L 4YFLF 2DM7A 3BKCH 5CSZA 3IB4A 4K55A 4P2QA 3PJNA 2IDTA 1WVZA 1AKJD 2IGTA 2NX5B 1ZTXE 2Z31D 4KJQC 1RV6X 3BDYL 3RWEB 3DX7A 3ARBA 3T0XA 4HWEH 1L9MA 5T3XH 5A2IH 5BNXD 2YC1B 1GZHA 5T3ZL 3S96A 2R4RL 1AR1D 1W0YT 1A65A 1VPOL 4LU5H 4O02A 2Z8SA 5C0ND 4Y19A 1B2YA 3EAKA 4K94C 1F00I 1ITBB 2BJML 5DMGC 4BCXA 2MHAB 5HGGS 5ESAA 5CM1A 4FQ1L 4G6AC 3CHSA 3P9LA 1AQHA 3CFNA 3LSOB 3VRIA 4A2GA 2LHAA 3TT1H 5AG9A 3GXFA 3U36B 1TYJA 1JHKL 2X1OA 2BLFA 3RZCB 1KMGA 1BQKA 1FVCA 3ZN6A 4ELKA 1I4FA 3CFUA 1D5ZB 2AABH 4KNQA 2QT6A 4WO0A 3QUYC 5J0BA 2L8AA 4M1GL 4FX5A 1YAIA 3VFRA 1KPRB 5FXCH 3QW9A 1RI8A 4JZJA 4ZPVA 1DZ0A 4NZDA 2CDGB 4WLCA 1MFDH 3UBXA 4U0RC 4ZW5A 1DBJL 2Z9TA 4WRLA 3S98A 4HU2A 3TWCH 2AV1B 4L3EE 5I8OL 4RZCB 2F5AL 4UNVA 1EBPA 5AZEH 2ZXQA 4NNYA 4YE4L 4P99A 4NP9A 5F1IB 1S9VA 4P2QB 4FCAA 3HPLA 4G9FD 1JZEA 3IU3B 3JVGC 4R7XA 5HI4D 3D39D 3DMMD 3ZHFA 3DBXA 2G75A 1U8NB 4GIPD 3VFPB 2FGZA 1KPUA 3G3LA 4XAWL 3OX8B 4NQSA 5JW4M 3BH8B 4HS6A 3X17A 3KEHA 2WXNA 3W3BA 4N2EA 3RHWK 2VH5H 4KTGA 4MAYB 1S7QA 1CLZL 4PS3A 4WI7A 4GRMB 4NFDA 2YPVA 3GS0A 4RMVA 3G6JA 3QORC 3WAJA 2JTYA 4JAMA 5ICYA 2FO4B 4LSQH 5FV2A 1QNIA 4X5RA 2DTSA 3QO0A 1BFVH 3O11B 1F4YL 4NZTL 3IETA 3LN4A 3MODH 3TBBA 2VDOB 2VDRL 2NY1C 1JPTL 4OCXH 5CD5C 3OKEB 5K69A 4PJHE 5JMOC 3FZUC 3H9SE 5K59E 2MOGA 5JDSA 3V0FA 3LIUA 4HIJA 4QRPB 1LJMA 3M7OA 4WQOA 4TTDD 4XB3A 3IDNA 3U4EA 3KJ4B 1P84K 2BWDA 2MQ3A 2YD3A 3AXLA 3FFOA 3DO7A 2WBXA 2X4UB 1PCXA 4P59L 4Q6IA 5HJ3B 4C47A 1KJMB 1J9TA 3AT8A 5JW5A 2CHNA 2IWGA 1MJJA 3MO1B 5HBBA 1BFOA 1X5HA 4NQVB 1YC7A 4JY5H 4RSVA 3T4AB 4NWTL 2J6EA 2Y25A 3SPVB 5DJYA 1KENH 5AUMB 1TQUA 2NQDA 3CN2A 4PGDB 4D3CL 2R4SL 2WZPD 2D31A 2K1MA 4H5SA 4KKLD 3ARYA 4ZSOA 1F1GA 1OQOA 2ZWYA 2KT6A 3BKYH 3HBGA 4ODUB 4LLDB 3BP4A 4HUXB 3PWLA 3LOWA 3RBGA 3P3UA 5LGYA 3BAYA 3SKJL 2PTVA 5CZKA 4D2NA 3O6FC 2EAEA 4E41A 4F93B 4OLVL 3MZTA 3VFVA 3V4VH 5FA3A 3KG5A 3CLEH 2NNFA 4HS8H 3AU1B 3L4WA 4ODHH 1DEEA 2WJ7A 1IQWL 4FMVA 3RFZB 1YQVH 2JQAA 3NCXA 4M4RA 4HALA 5DR5H 4C83A 3EGDB 4DT2A 1CTNA 2QPSA 1IFRA 5DZNA 5H4ZA 5CHNB 1BZ9A 3LPFA 1ILUA 2W9LA 2WSKA 4WKZA 5EB9A 2WUBL 3U1PA 4Z6AT 4Z7UF 4RDBA 2BNRB 2IAMA 2WIIB 4APQB 5C6PB 4JRXA 5LXGH 2RBLA 5AVQB 4YWGH 4U7SA 3UMTA 4Y5YB 3L1FA 1BVLA 2A77L 3SYOA 3DRQA 1CTMA 4EUPA 2C9VA 4Z18A 3VI4E 3NIGF 1ZSHA 1UA3A 4JO4H 3VVVA 4OCXL 5KSAD 4JS7A 2ZUTA 3BX7C 4AQOA 4POYA 2IO5A 2YIHA 3P4LA 2WZ0A 4L8CB 5A2FA 2GIMA 4PGBA 4JG0L 1UA7A 3QJVB 2YEZA 3BGFB 2NTFB 4K9EC 2CXGA 2WMPA 2G2NA 3I75A 3MRDB 1QHPA 4KWUA 3I2CL 5IVNA 1SN2A 1F1DA 4ANKA 2DLTA 1F90L 4Y9BA 1XGQA 3O0RH 3SGDI 5CCJA 1R3JB 4HH8A 4YGVB 5B38B 4L1HA 1N2RA 3FO9B 4GI9A 1MW3A 1AJ7L 3HRPA 3WEOA 1TJIH 4RGOL 2GT9B 3QGVA 2FT6A 3P30H 2WLIA 3SPGA 4CVXB 5E5LA 3NCYS 1AD9A 1ETZA 5F1NB 2J25A 2Y24A 1EAJA 2OMUA 4JO1L 3WNOA 4Q97A 1SF3A 3UYPA 3OMNB 3KYMA 3FQ2A 4KGLA 3CFKB 1IVLA 4HH9A 2NYKA 5IW1B 3MR9A 3TWYA 3EXLA 1R19A 1IEBA 1FGNL 2A9NL 3BZFB 3LCYA 2OMTB 5TQ2L 3RDTA 2AEPH 3HG5A 1LO2H 3GBML 3VXME 5HYQB 3KYNB 2A2QT 3Q2VA 3T0WA 5KYYB 3CLEL 4LRIA 1HSAA 2X4TA 5C09B 5IMMB 4FFVC 4QR7A 5EBLA 1JGUL 5F7NC 4WDIB 4QT5B 1N8ZB 1NEPA 2BZ7A 2XPZA 1E4WH 4HGWA 1WCBB 1YEIH 3TIDB 2AABL 5FLVA 4NKDA 3WEAA 3TBTB 4JY6A 3MLVH 3A6OA 1KCVL 1KTLA 1XGPA 2R0ZL 3P54A 5E8EA 3LH8A 4ZX3A 3CFQA 3HS0A 1ZANL 3SKUD 4ZG1A 1CDJA 4YGVA 5KSUB 3HBQA 1JP5A 4TUUA 5MEQA 3D3VA 4P2OC 2G3NA 3C5JA 3UG5A 3E3QC 2H8PA 2IGFH 3QUMB 5IQ9B 5BJTA 2YGNA 2H26A 3KPRE 1BZ8A 5JW3L 1QTPA 4HCFA 2OR9H 4TSCH 5E4EC 4DZ8B 5E4IA 3GSUA 1E67A 5TJWK 3D9AL 1I8KB 2FWSA 3UXFA 1NANH 1BQHB 2ZUSA 1QEWA 1I31A 3GF8A 5GS3A 4XP9H 2B39A 4AJYV 5HVFB 2UZPA 3AWFA 3L1OH 4OD3L 2FR4B 1FA4A 2FWOB 2RHEA 4LZKA 3C60A 2OMWB 4RIRB 1Z9LA 2ADGB 5MHSD 2WD0A 4OR1A 4ZUUB 3SOBH 1S78D 4JRXE 3WY1A 3C6LB 1XGTB 2JJSA 2NZ1A 2FX8H 3U4AA 2OK0L 3O2WH 1BMZA 5H37A 3U2SA 3UMNA 4F7KA 2NNRA 4HUWB 4AVJA 1U36A 2UZIH 3FQTB 2VYRE 4C59B 2YOAA 4XCNA 2VXQL 3ATDA 2XZQH 4PM1A 4YSPA 3U4KA 2W94A 3NABH 5HHMB 3SKNA 3TO2A 1GGCH 2KBGA 3KS0J 5T3XE 3FB6B 2FCBA 5CEYB 3UX9B 4KRMB 3L7FA 4Z7VA 1XF2B 2ITDA 1MDAA 1V05A 5EV7A 2OBGA 2Y7LA 2WQUA 5D1XA 3JV5A 3T71A 4GG8B 3P11H 4GW1B 5I6PA 2Z34A 3GBDA 1HX0A 5TFSH 3TN0B 2V7NA 5IEKB 2GHZA 5EO9B 1CGUA 1DO6A 3IGAB 5AB0A 3T1FB 2IH1B 3E2HC 2MCPL 4GKNB 1CK0L 1QEWB 3E8UL 2A74C 1L9QA 1L9NA 3CZJA 3MLYH 4OZHF 4QJ3B 1N0XH 7PAZA 4P46D 2IV9A 2E9GA 3CVHB 5FW7A 1E9OA 3Q3GA 4WZ9A 2XXFA 3OKMA 1CB4A 5FOJA 1RZJH 4K73A 5EU7E 5IESL 4LDCA 3UTQA 2W07A 1RL1A 2X9ZA 4NC1C 2B3IA 1G7JA 3Q1EA 3GBEA 2EE9A 1HHIB 1A9BB 2OX5A 4CJ0A 5IGXH 3VWJD 1JGLH 4IMKC 1QW9A 2FJHA 5EORL 4AE1A 3V4LA 4U1MB 2J5LC 4G42A 4W9HC 4YSOA 1M7IB 2QQKL 4MRCA 4PRNB 4OIIH 5K1VA 3S36H 4URKA 2C9PA 3A23A 3H9SA 3ECWA 4NRZA 1R0AH 2PNDA 4PV9B 4ZPTB 3MV7B 3QRGL 2HA1A 2LFEA 3VA6A 3W1ZA 4NQEE 3TH4T 4H44C 1HC1A 2VL4A 2PW1B 4ZNCD 5IROA 5T5FA 3VXMD 5DDHA 5SX5H 4K8RH 4LLYB 3U83A 4K07A 4GRWF 1U8MB 2OL3A 5LBSA 3P2TA 4WWPA 1MQKL 1NLDH 1D5IH 4UB0H 43C9A 3VD5A 1ZHBB 3J8F7 4OLUH 3ARFD 1XF5A 2BHYA 3HLKA 1M57B 1P4UA 2G2RB 1F3DJ 2J5WA 4NUJA 1X5LA 3QZPA 4HKXB 1KJ2A 5J3HD 2J2ZA 4HC1A 2J21A 4ALAC 2IH3B 3QNYA 3BQUB 2G3ZA 4LHQB 4UDUB 3QPKA 4CW1B 5J1AA 3GIVB 2PF6A 3QNXB 3V6OE 1ZMYA 4HWZA 3QNYB 1C5DB 3W2DH 4J3UA 4RGNC 5C08B 2YA1A 2ZSWB 1GYVA 5HHPB 4DGYL 1SZNA 1TTCA 3D3VD 2JB6A 3TFKC 3A4EA 5D1ZB 4FF9A 3VDCA 1RIUH 5JQIB 1CICA 3CIQA 4C55A 4PWFA 3EFOA 1A7PH 3RNKB 4P57A 3BQUD 2NY6D 3HKZA 3WLWD 4JFFA 4AM0B 4LQ1A 3U46B 2IADA 3KLKA 3O4OB 4RCAA 2EVHA 5A1AA 1QTYT 4U1SA 2CE6A 2PW1A 5DC9B 1H6FA 3CH1B 2R1XA 1KPVB 1YMMA 4H88H 4M5YL 4TQEH 1YMHA 4BZ2L 2D7MA 5F9JB 1DR9A 5K1NA 2WTPA 1L3NA 2CBPA 1PAZA 4ZUUA 1O0VA 3T8VA 1M7IA 4TVPH 1AQDA 3EJYC 1P7KA 3FQWA 2QSVA 3E6HA 5IHZA 4OVUA 5GS0C 3L1EA 5C71A 1CF1A 3Q2CA 3VQ2C 4K15A 4K5OA 1MUJB 3AMLA 5DHYB 4OF8A 3HEIB 3AGWA 3X1BA 1EAOA 2H9GB 1ZJAA 5DYFA 2CAKA 2WXIA 1V3MA 3I85A 4F58H 4KZDL 5DHYA 1L6ZA 3RIAF 2AJXH 5EA0L 5I9QB 1IUZA 3FK3A 2R69H 5CU5A 5LJYH 5FOBB 4BK5C 3OMIB 1T83A 4YO0B 4LOFA 4W93A 8CGTA 2XZAH 2DEXX 1I82A 3VWKD 1E4KA 3NQIA 4QWWD 3ELAT 1M9WA 3ULAB 2D9CA 2F54A 1V10A 3MOQA 3GUTB 3QWRD 5FX3A 3OXSB 2BSTB 5I5MA 4Y2DC 4NENA 3V0WH 2JLLA 4AUYA 2JJTC 3RZCD 3UH8A 2FSEA 3ARDB 4ZFOB 3Q05A 2R0WL 2QV4A 2V37A 5HVWA 1TLMA 5HDBB 4FQ1H 1P5UB 5C3LD 5ESAB 1IC7H 4TPRH 3T6VA 4FAAB 3BSZA 4J12A 4ONGL 2R29H 4L9LA 4FKHA 1RU9L 5G4NA 1FFNB 1VF5C 3L4UA 3BHBA 2XVKA 3GMNA 3X1EA 3GSXA 1BJ1H 1AE6L 1FSKB 4DP2X 2H41A 4UQEA 2RJMA 3ARDD 3O41A 1FAIH 3A22A 2P5WD 4O5LH 4UQCA 4AGPA 5CLWA 4P2QE 2DEYX 1MF2L 1BXVA 2NQCA 3DMMB 3OKYA 4I1RA 1DVUA 1CIDA 4KRLB 4UT6H 1UASA 1DVZA 1ZAGA 4W9EC 3E1ZA 1H8OA 4UILL 4MDJA 1QYGL 1DLHB 1ZVHA 5BZXA 4JX0A 4BA8A 3BWUF 5CLYA 5AOZA 2MRYA 4J4PD 4RGMB 5FHAL 3HMWL 1FFPA 1P84J 3D18A 1T2QH 5J7CC 1JHTA 3H54A 1OP3H 2J6EL 1OGSA 2HVKB 1MRFH 1EANA 2EE3A 5EWIH 4NEHB 3OF6D 1LLAA 4KTDL 2BRRH 1P6WA 3EG9B 3HZMB 3RIKA 2NDGA 3N06B 5FO9A 3QFJE 4HFUL 1QASA 4TL5A 1GKEA 2OM5A 4PJFA 1COBA 3B43A 2BY2A 2ZP9A 1B0IA 2WSDA 2ATKA 2PYFB 3CHPA 4GXVL 3PWUB 5EBMB 3EFFB 4NNYB 3ZSTA 1UXWB 2F5BH 5C0JB 3EJZD 3HC2A 1UWGL 4QRAA 5EN2B 1W0WB 5DRZB 2X12A 1LQSR 4Q9QH 2CIIB 4QXGH 2VDOL 1CFVH 4HAGA 4GAGH 5FK9B 4CVZB 3OKLA 2VDKB 4JFQA 2XPYA 4RGNB 5AW8B 5LLIC 1U8JB 2PYED 5ECJE 2EXYC 3LZNA 5E8DL 4ZYKB 3HPJA 3BGMA 3UIZA 4WY7H 5H37H 4WI8A 1AAJA 1PLGH 1SDAB 2GBAA 5E1HB 4NO2A 4KHXL 5FGCB 1X5AA 1KLFB 1A2YA 2ZOKA 1GKOA 4N8CH 4NQVA 5IV2B 2VZ3A 1SJHA 5C9KA 5JZ7D 4MHHI 4NKMB 4LOEA 4EXKA 2KS0A 3S5LG 1AE6H 1Y1DA 1RAMA 1JK9B 2B5IB 2K3HA 3QDGA 4BFNA 2IGLA 1MW0A 3QUZD 4YUEL 2RA1A 4N9GB 3L4XA 4JFTA 5FFOA 1MNNA 1UACH 1I7TA 3S88L 3SCMD 5FHBH 2WTOA 2CQVA 2XRAH 2QPFA 4P4RB 3O2DA 4AM0Q 2ZKWA 5DK0A 2DYPA 4ZMVA 5D4HA 1N6VA 4IRZA 3M88A 2V33A 4ZUSA 4X9HA 5EOCH 2BNRD 4APQD 3MRLB 2MTPA 8FABA 5C09A 1T20A 1X9UA 3LN9A 2ZUQB 1YPZF 2AEQH 4NC1E 1HL5A 4ZAKD 4H1LB 5JHLL 1UM6L 4NN6C 5JIDA 5LAXB 1VLXA 5AAMA 2OTUA 4NZFA 2EUWA 4OJEH 3IFOB 3W39A 3FS9A 3MRGB 2YPVL 4IU3B 2NY0D 1T20B 3D69A 5I16A 2Y1YA 4GB9A 2FJUB 1RZGB 4X7DC 4XZUA 1SVZA 3KWWB 3V4PB 2BJMH 5C3IA 4RETB 4XXDA 1S7XB 5DUJA 1IIKA 1Q1JH 5GRZA 4U1KB 2NW2A 3IMBA 2DQDL 1A4JA 2GTZA 2IPTL 1IGJA 1MJUH 3VMPA 3MJ7B 3P0VL 2P26A 4OM1H 4S1SH 3WIIH 4S0SD 1QO3B 2H0PA 3LNFA 4NYLB 1GJIA 2BVOB 2YMTA 1L9RA 2Q10A 2MKWA 2EVIA 1WZAA 2LGNA 5I73C 5F1KC 3SQOH 1ITCA 4A2FA 1UWEL 1HCFX 1E7UA 4LPCA 3ARQA 1DFXA 3PJLA 1AR1B 2ED9A 3N42B 4RMTA 3QFDB 4NKIL 3AW5A 1E8XA 1UM4H 4U7MA 1FSKC 1CL7I 5B1JA 1FFOA 4GINA 4XMKH 2ZOOA 3POCA 2WLMA 4H20H 2X2UA 4H1LA 4M7KH 4X80L 3CDGB 5G4MA 4FQXD 1YEGL 3FFDB 4UIKL 5TQ0L 4ENZA 5I6XB 4PRIA 3TPUB 1VJSA 1JWSB 4PWEA 3D2TA 3TWCL 1I85A 3D52A 3NYKA 1BQHG 4FJZA 4AK1A 4F9LA 2OSYA 1RURL 4HH9B 5DC4B 4PFEA 5CO1A 4KKCC 4Z7WE 3EW3B 4PJFB 5KANG 1HI6B 4ZNEE 1S7SB 4FG0A 4JVWA 3S3CB 4PWHA 1NPNA 2WINB 1ROWA 4H8WH 4HIJB 3CSGA 4QRPA 5D6CA 4JO8A 1AH1A 4R4BB 3BYYA 5CF3A 1XGUB 4LCUB 4FTVD 3P1VA 3V6ZA 3LXCA 2LOEA 1QBLH 3VFVB 1V7MH 5IOPB 3R4RA 1ZCRA 2F74A 1ZLEA 3BPCA 3QORA 1KCUL 4UT7H 3AY4C 4NN5C 4B27A 4LEXH 1FFRA 4Z7WF 2A6DB 1Q0XH 2VC2B 1NFDB 4RFEA 5AALA 1QSED 4NC0B 4TNVF 5D8JH 2DLFL 1IM9D 4YXLH 2CR3A 4MA3B 1U8IB 3WTUA 1FORL 4CNIB 2G75B 3GLEA 1D6EA 3GMQB 4OM1L 4BXVA 2OS7A 1AXIB 3MV11 4G8FB 5EU4A 1DVQA 4M5ZH 2J8UE 4AC4A 4I2XB 2XRAL 4OCNC 3CVIH 2ZKXA 2UZXA 3QT2A 4ORZC 3UJTH 5E7BA 5DVNA 3VMNA 1B0RB 1MW2A 2QLYA 3KXFB 1MFEH 3P4MB 2CO3A 3CDFA 2DW5A 3F7KA 1Z5LB 5EEUA 2CK2A 1AS7A 3O9WB 4KNUA 2I85A 3UTSA 4PB9H 3T2PA 3LS4H 4GMSH 3BUYA 1KCKA 2ZYHA 1UOKA 2ZPKL 3EYQD 3W11D 2AGJL 3C08H 4HW6A 2PP7A 3V4VL 4N2KA 1JNJA 4AQ1A 1J9QA 3IXTB 4OJDH 5DQJB 2KLTA 5HHME 4XPBH 3TYFA 4IGBC 2I07A 4WSGA 2OSWA 1U4EA 2NZ9C 2XETA 3V5HB 1KTCA 2XA3A 2DBLH 1G0XA 2YGOA 3DX1A 5CBEB 4FTVE 3TO4A 2EVGA 2NY4C 5D2LA 3S48A 2XFXA 3QULB 2IOIA 1OLLA 3G6AA 1S9YB 4IKNA 4XWOC 2GIYA 3X3GL 5J6HA 2WWMD 2OYMA 3VXQA 4YDKH 1ZD6A 1AQKH 3ILQD 2COQA 2PLTA 4DKDC 3KAAA 3F58H 3ZTNL 2H6OA 4B9ZA 1AKPA 4LPWA 1CD1B 5I8KH 2X9YA 4QOKE 3IFNH 3BRFA 4ZQKB 1QSEA 1EWHA 2YLHA 4DPRA 2YRPA 1IGYA 2DLEA 3VQMA 1IL1B 2KZKA 4YIQB 2B1AL 4H8PA 1JNLH 1CU4H 4TLSA 1WH0A 1JNNH 3FB8A 4JKLA 3IGUA 4CKVX 3GHBH 2ATPA 3TBVB 3BXNA 1I7UB 3L5JA 4JM4H 2X4PB 1CGYA 3BUPA 4UTBH 5I8EB 4LSRL 3GXDA 1FRGH 1TNNA 4KI5C 4WWID 4C4KT 1GC1H 3GIZL 4AIOA 4Q56A 3KPPA 2V9UA 5IK3A 3HBZA 1MCKA 5HP5A 4Q2ZA 3JWOC 2OMUB 2WIMA 3R7QA 5DFAA 2XBZA 5I73B 4WWKD 2KMWA 2NPLX 3D4GA 5BMFH 3MUY1 1J1XL 3BYTA 3NBNA 2D7QA 5I1JH 2A6IB 2YPKA 4XH2A 4G42B 5IB4B 4MMZC 1VENA 5JHLA 4XRCA 2PR9A 1VZIA 3H42H 1HSAB 4NHCH 2VC2L 3ARGB 4FI6A 1HU8A 2HVJA 2OR7A 2JWYA 2VLRE 3CFDB 3D4CA 5EWIL 5AVUB 2NUTA 3WEXB 1MHEB 1XVSA 1AOZA 3VFUA 5C08A 5GHWL 1AZZC 5DFVC 1KGWA 1AQKL 1TO5A 3X12B 1AXSA 2G4EA 5I6XC 3THMH 5EBWB 4H7VA 1CJYA 2HLAA 1J0IA 3F7YA 3KPLA 4JB9H 4JHWL 4RBPK 1U8CB 4G80A 2ZWZA 5ALCL 4L8CA 1MLCA 1A6ZB 1IX2A 1D7FA 2A7BA 2VE6A 3B9VA 3GM8A 4FG4A 4PJ8B 3D25A 4R4FL 2OMZA 4HQQH 4D0BA 5DVKA 4F20A 2NCEA 4HEPA 5HD8C 4GRWB 2EJ1A 3P0VH 3Q5YA 5FM8A 1C8PA 1YEIL 3F7YB 3KPLB 4KRPD 4XCYB 2DWDA 3VCLA 4N25A 5FO8A 4LBAA 4YPJA 3ZIMA 1WWWX 1LD9B 4KKAD 4IK7A 5C0EA 2A73A 4XN8A 1EZSA 3OL2A 5EZIL 1A1OB 4RQQA 1LHZA 4JY5L 1V7NL 5ALBH 4JZNA 4EOWL 3ZXAC 5CU9A 1NCCH 3NUKA 4J27A 1XCXA 3JWNG 2GBVA 3L3DA 1R34A 5JHDA 1VFBA 5JYMA 1WP6A 5KN5A 4Z76A 2J8UF 2C9XA 1U3JA 5EH1A 2BOLA 3G04A 2TRYA 1A3RL 4KXAA 1P4LB 1EXGA 1WCBA 3QZLA 3UYRL 1URZA 1OAZH 4HV8B 4NUPA 5A3ID 5DJ2A 1OAUL 3NIFF 2X5PA 4PJHA 3CAFA 4LVNC 2AANA 3KL3A 3IDUA 2WWKT 1XMWA 3QJTB 3QXWA 1HWGB 4HULB 3GRWL 1JV2B 3S4SB 3ZDWA 3HE6A 3EO0A 5A6LA 3VFOB 4BSVB 2V2TA 4JDEB 4A63A 2NXZB 4NAJA 3C8HA 3IVKB 4BQCA 3VU2A 4JW3A 1V8HA 3ZYJA 5JOFA 3QUYA 4QHNA 5IOKA 1ZHBA 4FQXC 3JVFC 5DJ6B 3QUMA 4ZFGL 2IV8A 2JFCA 2D0FA 2W9DL 3DX0A 3HHRB 1Q9WA 1UB6B 5GGSY 4AVKA 2EDLA 2X41A 2XKNB 4JJOA 5T5FL 4F2ME 3MJ9H 3H8NA 3MCLL 1MAML 4AIZB 3E9TA 3DJSA 3B9KA 3O6FA 1AFVH 3O6MH 1BZQK 1TT6A 2NY4B 1DBMH 1M7DA 4OVVA 5EEWA 4GPVA 4NO5A 1Z9NA 1DFBL 3PGDA 1B4LA 4PY7A 4P2OA 3C6LD 2H4EA 5F44A 5L4FA 1SBBA 1JYNA 3PIQB 3GSRA 2EH7H 4JKPL 1NPUA 3MUHL 5DJ0A 3LEVH 2D0GA 3EFOB 3RNKA 5KS9B 15C8L 5DJ2B 3VM5A 2A9DA 3EOTL 4P0DA 1Z66A 2VLJB 3BWZA 4HFWB 4TRPL 4HXAL