1G1KA

Cohesin module from the cellulosome of clostridium cellulolyticum
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
143
structure length
143
Chain Sequence
ASLKVTVGTANGKPGDTVTVPVTFADVAKMKNVGTCNFYLGYDASLLEVVSVDAGPIVKNAAVNFSSSASNGTISFLFLDNTITDELITADGVFANIKFKLKSVTAKTTTPVTFKDGGAFGDGTMSKIASVTKTNGSVTIDPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a cohesin module from Clostridium cellulolyticum: implications for dockerin recognition.
pubmed doi rcsb
source organism Clostridium cellulolyticum
molecule tags Structural protein
molecule keywords SCAFFOLDING PROTEIN
total genus 32
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1g1kA00
3KCPA 1QZNA 1G1KA 3GHPA 4IU3A 3BWZA 3KCPB 1AOHA 4U3SA 5K39A 2VN6A 4N2OA 1ZV9A 2B59A 4WI0A 4UYQA 4FL4B 1ANUA 5AOZA 2XDHA 2Y3NA 4FL4C 4WKZB 4UYPA 5G5DA 1OHZA 2ZF9A 3L8QA 4IU2A 2OZNA 3FNKA 2VN5A 3F2LA 5LXVA 2O4EA 2VO8A 4DH2A 2CCLA 3UL4A 2W1NA 1TYJA 4UMSA 2JH2A 2BM3A
chains in the Genus database with same CATH superfamily
2G75A 1FZJA 3AM8C 3BJ91 1IEBA 2QSQA 3DMMA 1OK0A 3O3AA 4N2CA 3DUHA 3TH3T 4BRVA 5CEZE 1CF8H 1HXYA 3HNSL 1U3HA 5D6DA 4HWNA 2DLFH 2DTMH 4AUJA 4PPTA 4JFYB 4LZKA 1YYMH 4G6AD 3BPNB 4ZRGA 3S98A 2F7OA 1KIQB 5DD6B 3L16A 4ISVB 4I3GA 2PW2B 3UEZA 4PCTA 4JE4B 4XMPH 2APXA 2G75B 4JANA 1ZTMA 2OYKA 5K9QG 1HWGB 4KY2A 5AALA 3KD4A 1UGNA 4ALAC 1HEZA 1NGWA 3IFPB 2DMGA 2CMRH 2FEEI 1INEH 1WS8A 3VFOA 5AOJA 4KGJA 3BSZH 4R8WH 4MKTA 4S1DC 3TOPA 1Q9LB 4JM2B 4M8VA 1BFVL 3PABB 4UOZA 5GJTL 3CFCH 3FT2B 1P4IL 1YG9A 2WLLA 2WBXA 4AQZA 4PJXA 4ZS6C 1RP8A 4M43H 4GRLD 4YHIA 1GS6X 4R83A 2VDRH 3RU8H 5B4MC 5HVHB 3RL2B 3C6EA 1AO7E 1QTPA 4KUCF 2Y7QA 2AJUL 2P24A 1M3IA 4GRLB 2I27N 5CBAA 5C0CD 1G6RA 4WO4B 1BJ8A 3ZE1F 5AW8B 3FUMA 1EAQA 1WC7A 2H32H 2UVEA 5FO8A 3LJ3A 3F7RA 4PJGA 4BKTC 4YDLB 5JIIA 5KVDL 4WY7L 2DBLL 3HRZA 2BY3A 3ZE0B 3HC4H 2C7FA 2X6UA 3D50A 3WLBB 1L9RA 2EXWD 3B2VH 3DOSB 4PLOB 2AHIA 3MLTA 5I75B 1EEYA 1UKSA 4P5TC 4TLSA 3SKJL 3EBAA 3MV9D 2EIKB 2WB7A 5DEGA 4JFXB 2BP0A 2W92A 4WK4B 5EEXA 5FW8A 2RAMA 1OAZH 2D0FA 3FB7A 3LKOB 5IMKB 1F58H 3DRTA 1CXIA 2DDQH 2YIHA 1KJ2A 5EZLB 4AL8C 1P4BL 2F53E 1BQKA 1XT5A 2TRYA 2VW7A 5B1CA 2Y9RT 1IAIM 3N1FC 1NA8A 1H5BA 4X8XA 2UWEB 1UYWL 4N2DA 5LB1A 2VDPB 5CR1A 1SM3L 1EJFA 1PKOA 3Q3GA 4XNBA 3TIEA 1QFWI 4URKA 1BQLL 1OAXL 3A0OA 4DNLA 1WE5A 5TE4H 3NFNB 4YHPB 5DEGB 3MBEA 2WXPA 2RR3A 5I71C 4IHOB 5F1IB 1RK0B 1W0WB 1XGRB 2A9CA 5FHAH 5I76A 2BIIA 4KTGA 2JJTC 2DQDL 1VFAA 5LN8A 2ADIA 3QNZA 1EJ6A 3HA0A 5H2BA 1BW8A 2DTSA 2WUCL 4PRID 2DY2A 2IDUA 4Y9BA 1JV5B 3KHOA 3F2LA 4A7TA 3CZEA 3MJ9L 2NY1C 3MV9B 2AJSH 2CH8A 2BO0A 2IDSA 3Q5TA 2FSEA 4RA0C 5F9WC 2YKLL 1GGBL 1LK3L 4PJFF 4LKXA 4L5FE 3HI1A 3MA7A 3K71B 1PSKL 4DAGH 3Q43A 4DT2A 4Z9KB 1CTOA 1T2XA 1B9ZA 4X8JB 2QV2A 5AB9A 1GSMA 2OS7A 1FV1A 2X2IA 1TFHA 2C1PA 1YC7A 4HKBA 3JUZA 1KGYE 2JIXD 4QJ4B 1RPKA 2O5NA 1RJYA 5B38A 4DGUA 2E56A 3RVXD 4KRPB 5I18L 4D0CA 3QZWG 1OE1A 3D39A 4LT7A 4NAQA 4L3EB 2K6ZA 1M4KA 3O45B 1KTJA 3NCEB 3QDGB 4QMEA 2JCCE 1B0WA 3PGFL 1CICC 4NC1C 1ZLUH 3MRNA 3C8DA 3W2DL 2P8LA 5JPNA 4G6JH 3SO3B 5KSAC 3CLFL 2FBJH 1KIPB 3GDBA 5FECA 1E3FA 2ZOWA 4HUWA 4JKMA 5GIRB 5GZNC 4JQVA 5KS9A 3BUQA 3PGDB 1RIVH 4M9OA 4NQUA 4C59B 1EWHA 2YOCA 3CZGA 3MUJA 4LQFH 4I3SH 2DQUH 4FQXB 4P59L 4QKXB 4TUJB 1T04B 4I8DA 3C75A 2X1XR 3LXUX 3FO9A 2H26B 3SE3A 3VGGA 4D0CB 4FFYL 5HGDB 4B41A 4HSCX 3ZE0F 1MQKH 3N9GH 3ULVD 3A5VA 3BE1L 5F7YC 1UEMA 4YR6B 5CO1A 2UXTA 3F7QA 6CGTA 5D4IA 1L7IH 1DSWA 4G82A 2F08A 4OGAC 2BSRA 4JBSA 4YSRA 4GAGL 4ORGA 2CO2A 4FNRA 2XT1B 4RNRA 2DF3A 3TXAA 2EDWA 2W95A 1BEYL 5HGBB 5FDWA 2SEBB 4L1SA 5ABZA 3UBXI 1SYSB 4PP1D 4AZ8B 4APQC 5BQ7A 3FO9B 1MQ8A 5MHSE 4I48B 1JHKH 4PVLA 3BIAX 3HUJA 4F7CA 1TZAA 2W07A 4KH9A 25C8L 4ANUA 2GTWB 5EBWB 1XF5A 3LPPA 3INUH 2FECI 4J8QA 3DX6B 1W72B 3EYVB 4YXLL 4HKXB 3BUTA 3KPPA 4ZTPH 1IGFL 5ICYA 4PRPA 4OZHA 2C4FT 3JWDC 3MPCA 4F7TA 1E3XA 4P5MB 2AERT 4WI4A 3DK0A 3NZHL 3RUGE 4BH7A 1OZUA 1N8OE 3LD8C 4LGPB 2ZWZA 4ZAKB 3AY2A 2KLRA 3ARFA 4YC2C 3IJYA 4NKIH 1QSFD 2HKAA 3FHEA 5F7WC 1A3ZA 3JVFC 3EH3B 1YPZE 1K4DB 4NZUL 1QO3A 3B5GA 4B53A 4X4YB 2NLJA 3P40A 4U1NA 5E8DL 5F9JA 2WHVA 4U6YB 4Y5VB 5LBSL 1GZQB 5LKNA 5DJAA 3UTTD 3KCPB 5CLZA 1VESA 2ORBH 3NJJA 1F6AB 3SBRA 3ULUC 3GBMH 3W9EA 1B9KA 2UXFA 2R2CA 3QQNA 5FYKU 1OP4A 2ESVD 5IW3A 5DHDA 2YD8A 2BIOA 1FVDA 1RIUL 4ZAKA 3X1GA 5D9SA 4JZNA 4Z7VE 4QNPF 2NY4B 4IBYA 4KKNA 3WLWC 2VMDA 5CSBA 5A2CA 2VZ1A 1QO3B 4ZOCA 4HK3N 3IVKB 2VLJB 2NSMA 2QT6A 4PJDF 1EBPA 4MB3A 4Z3GA 2G4GA 4JQIH 1FVEA 1N5YL 5DUJA 1NBQA 5SV4A 2A7BA 2ATPA 1YEFH 5I17A 5IFJB 1F6LL 1NSNH 4F57H 3IU3B 3IDYC 2H6PB 1R5IA 4NOFA 2YXMA 3CD4A 4Y1AA 5GS0C 3OC5A 4BWWA 5M94B 1YUKB 3HI5H 5LXGL 1OT1A 4RBPH 4GI9A 3MRBA 1KJVA 1JMXA 2BY0A 4AGLA 3NZUA 5ES4B 5AYQA 3P4OB 1ETJA 1T1ZA 3RZCC 1MCHA 2O6PA 3BVXA 4PJHF 4YZWA 1FVEB 2C9VA 5EZJA 2OZ4H 1D3CA 1TJIH 5KJ4A 1KCRH 4JHBA 3WS3B 3S6CA 2P5PA 3M17A 4I77H 1OOWA 4GG6F 4CVXB 1IKNC 4G7SB 3D4GA 1USZA 3L4TA 5FOJA 3U6XA 5D1XD 2QGCA 3IMVA 2K9FB 3TBSA 1RZ7L 5I0DA 3QQ4B 4H25B 3II1A 4ELKA 3QEUB 3FBQA 5MEQB 3QUHA 1MVUB 2KLTA 2JB6A 1T20B 3I75B 2WLHA 4FQIH 1WV7T 3D18A 4LSVL 3UBXB 4YE4L 5F6HJ 3SE9H 2ICES 1RMFH 3FTVA 2HVKA 3TX4A 3RPIB 2IXQB 3QIWA 3MLVL 3AQZA 3NCFB 5C0EB 5DVNA 4EVNA 3Q2NA 2DWEA 1BJ1J 1AH1A 1ZHKA 1DN0A 3RTQC 2A0LC 1JCVA 3H2QA 4OIAA 3D25B 5MEQA 1ACYL 4L3CB 2AJVL 3RWEA 2NX5B 1KCWA 2QVTA 2H2PC 1PS3A 3I75A 4JFQA 4X7TA 3ZPDA 3QK0A 5IHHA 4MQSB 2YA2A 4KY1L 2L3BA 2C3HA 3IJ9A 3JWNG 3OB8A 3TA3A 1AC0A 3LRLA 3KVQA 3FRUA 3D07A 3FONB 1SHSA 4X98B 5C0EA 2DIBA 2H1PL 1D5BB 1UD6A 5E1GA 2YRBA 1QACA 1MFDL 2CKBL 2DIEA 5CJQL 2X9ZA 2VC2H 1KLUB 4OV6F 2Z31A 5DI8A 2Y6SC 3P02A 1HHGB 3KE0A 4X80H 1ZT4A 3FCTA 3KL3A 1SN0A 2E6PA 2BPBA 4U1JA 1W8OA 3B9AA 5T1KB 4AYDC 4QRTB 2KH2B 2H9GB 1FVCA 1KTCA 3POCA 5CSGA 5KVDH 5BCAA 3A21A 3U1SH 3DPDA 2CLVA 3LMJH 3FONA 4NQXA 4JFUA 4QYOA 3IE4A 2WXLA 2YD4A 4JGJA 5E03A 2GKIA 3HPLB 4X0KB 2VABB 1I3RA 4G9FD 4FXGC 4LSDA 1WA2X 4PRIB 4MXWL 3DVIA 2H2SC 3VXSE 2H6OA 4WFEE 5E6YA 3PWNB 1A4AA 1F58L 1UA3A 2O5ZL 3SE8H 5DO8A 1UUNA 3VE0B 4YX2H 4PM1A 2OMTA 3P9MB 1P2CA 3KL0A 1Y18A 3QFJA 1NC4D 1G9NL 1NKOA 4NX0A 2MNUA 5FGCE 4BZ1L 1GYAA 4FJYA 1R3HA 4Y4KA 4PMFA 3I6KB 2O72A 3SGKA 3LKNA 3LN4B 3P77B 3QPXL 4KROC 1ZLWH 4K4KA 2LFGA 1R9FA 4NYLA 2VDNH 4X4ZA 1E2WA 5JHDE 5FK9B 1FI8C 4XB3A 2C3VB 3MJ8B 3QZPA 4AH2A 4XZUA 3GSNL 2H0EA 3VE0A 4UTCA 4FLSA 1G9MC 4OLEA 2ENJA 3GD1C 2J6EA 2XQYK 4AI7A 5H4YA 3VGDA 2I9LA 3FO0H 2JLLA 1KJ3H 1KACB 1JZDC 2CGYA 1I1FB 2BDNH 3FO2B 4PCSA 2VNCA 3AS0A 1EO8H 4J3XA 2VDKB 3RI5F 4M1DH 5D5MA 3C6SB 2Q7YB 1MRCL 4Z7UE 4OY9A 3ARUA 2J1KA 4HIIB 2JTYA 2IWGA 3WKQA 1CPUA 3VXMD 1CE1H 5FGBA 3T6VA 2WM0A 1AAJA 3KNBB 1FP5A 1RV6X 2JI2A 4M3HA 1N6QH 1WFJA 2CQVA 3FO1A 1ZAGA 4MJIA 2VN4A 3LRGA 5MP6L 2CHNA 2JMRA 3G5YA 3TBWA 4DKEH 3VSUA 1L9QA 5IJKA 3ELAT 2OMZB 2EE3A 4YSPA 1SOKA 2EYRB 2MQGA 3GRBA 3LY6A 1LO3L 2DJSA 4HIXL 4OCWH 5KBNC 4ZMPA 1J0JA 2CIIB 1HCVA 2R0ZH 3AMKA 5CGYC 3WGUB 2PCPB 3MBXL 3M7OA 2NQDA 2UY6B 2Y2WA 3C5SA 2WLZA 1THCA 3UTPD 1PQZB 1IBYA 1HNGA 2X89A 4MVBC 4K5MA 4Y4FD 4DP0X 2EEAA 3KNBA 2YAPA 3BAEL 4NRZB 2EXWC 5AAMC 3HC3H 4GXFA 4ODTH 2FATH 3MUUA 1CGVA 1MFEH 3WFEH 5I1LB 3RGVD 2QSCL 5F7BA 3IS1X 2VB5A 3DX7B 2CK0H 1IUZA 4HS8L 1EZSA 1FO0B 1WFNA 1PIGA 2EECA 2G0LA 4CU8A 1VF5C 2HVJB 3NG5A 3F05A 3GHPA 3B3BA 2KI6A 4EAEA 1YZZA 4I5BB 2QTEA 4U3SA 1HVXA 5F44A 3HRPA 5FEBA 2OZ4L 2Z1PA 1JXDA 4MHHI 3WFDH 3O3BA 1TO4A 3QCTL 4LCUA 1EXUB 2WZAA 5CSZB 3OKEB 4JY6A 1CL7I 1KBWA 4QRFA 2VQ4A 3MJGX 2HWZL 5AVUB 4PP2A 5JPMC 5HGAB 1GC1H 3CSYB 1TJGH 3MLXL 5DJ6A 3ZDZF 2ILLA 5HPMA 1P7KB 2QVMA 4J1UA 3FN3A 3C2SA 4AX3A 2NDGA 3ARFC 3T0DA 3L5JA 3ECWA 1S9XA 5DMKB 4RMVA 3NH7H 3WXVL 3BT0A 2LR4A 4YE4H 1UASA 2MFNA 3R4RA 4LLWB 2EO7A 3IAQA 2ODIA 4FJ6A 2GFBA 3MLVH 3WEXB 2ZWLT 1XQ4A 2E6JA 4GG8B 4A55A 2CO1A 3EJTA 5AD0A 2WLJA 4EOWL 5IGXL 2GIMA 1YPZA 4J8RB 1MPAL 1A3RL 3BIBX 4ZX3A 4GQ9H 1E9PB 1TCRA 2EADA 1XCWA 1QFWM 2V2XB 5EEWA 1NUGA 1SJHB 2A9DA 2H5UA 4MZ2A 3BKYH 5DR5L 2MCMA 2ITCA 3WKMH 5L9DH 5DMKA 3T0EE 3HG3A 3LPOA 2JH2A 1NIAA 1HK6A 1M3JA 4NC1E 1NGZB 3GRWL 4OQTL 2XVGA 1FIGH 2XIBA 3QCVL 5LBSH 3BO8A 3IGAA 3MRRB 3JXAA 5HGHA 1QR4A 1HSAB 3N41F 2EYSA 3KBEA 4H8HA 4ZUUA 5DZVA 5HI5C 4ATTA 3BJLA 4OLWH 3Q2VA 1HI6B 5AVQB 5FA4B 2VH5H 2YMXL 4Q52A 5AOLA 3CFNA 4NM4L 2ITCB 4LVOB 1EERB 2J25A 1NC2D 5FCUH 3RJDA 3KLSA 3CN4A 1TJXA 4J7RA 4YJZL 4MDRA 4ZUTA 5TGBB 4TMPA 2DLGA 2IDFA 4E0RB 3OKMB 1E8WA 3NFSL 4PJHB 1AHWC 4N8CH 3DX0A 2YHGA 1J8HD 1G9MH 1QSVA 2FO1A 1LE9B 3FF8A 4IRSD 3FRPG 1T3FA 2A1WH 1NGXB 1U92B 2BIPA 3G6AA 4WKZB 3FSZA 1IT9H 2GJZA 3VWJB 2EXSA 5C09A 4A7GA 1YEHH 1DQTA 5KBDA 3WN6A 1S2EA 3ALXA 1I8KA 1IIIA 4JJ5B 1EH9A 2E75C 1CGTA 2JJUA 1DSFL 4DVRH 4IK6A 2MQCA 3GBNH 2Q10A 2P44B 4LL1A 1NCJA 3VYNA 1AKJB 5CJ5A 3TEWA 4G8GD 4AM0A 3ARGB 2ZXGA 4M8QA 3IPFA 3NUKA 4K3EH 3ZYOA 5D96C 4F15B 1A4BA 4FC3E 4PI0A 1GCFA 3G6AB 2YZ1A 4NQSA 4NNYB 4TNVF 3UTZA 4E9VA 2YEZA 3SN6N 2BOCA 2ZWSA 1BD2A 3QFJE 4Q6IA 4ADIA 2EVFA 3HR5A 3ZW3A 3T9WA 4HKZA 3BUBA 3B3IA 5FX3A 4JW3A 5DRXA 4ABQA 5J89A 1HHIB 2AKRB 2XPZA 2JQMA 4ZS7L 3QAQA 4U1SB 3BN9C 4PVBA 2GABA 1DYZA 2P5ED 1IEBB 3DMMB 3O3AB 5IK3A 5I8OL 2V9TA 4PRBA 1TQUA 4WTWA 2RBLA 5IKCA 5C07A 3LPWA 3ZDYE 3IDIB 4HIHB 4KK5C 4AQAB 3W5MA 2Y36H 4PJGF 1CFBA 2HFFB 4KKCD 1J05B 3UOAB 1IEHA 5DHEA 3NJMA 3V4PB 4C56E 1BIIA 5I75C 4NPJA 2DEYX 3QWRA 3H6AA 4OLVL 1MI5A 4NQVA 5ITFB 1JTOA 5L88L 3CVHH 4HIXH 4N8UA 5INCA 1R3JA 2AK4D 4YAQA 2XWBA 2NR6D 5IKCB 4DP4X 4M43L 1IARB 3W39A 3GHBL 4H1LH 1K85A 1NH6A 1KGCE 1I8LC 1TO5A 4FXKC 1T83C 4NENA 5JIHA 2A6JA 2QKSA 3S36X 3EFDH 4N6RB 3ZKND 1ZDQA 1J8KA 2QGEA 2HTKC 3P0VL 4FQ1L 1SYVA 3V4PA 7PAZA 1C08B 3RNKB 2DYPD 4PHXA 2GB2A 3HZMB 2VDLB 1QBBA 3LZFL 3WU1A 3QIBB 3QQDB 4RMTA 4HS8H 4HP5A 2XWBB 3TVMA 2ARJB 1E90A 1XCXA 2YN5A 4BD4A 1X5IA 5SWZB 5B38G 1B4JH 3W0WD 4E42B 3HBGA 1HZKA 3MCLH 4S0SD 5EOQL 3L3OB 1A9BB 2QL1A 3AQXA 4BQBA 2ZAGA 5DZOA 2H3NB 4IMLA 4TM9A 1QBLH 3TT1H 4Z7QB 2C3GA 3PNWA 1BYOA 4HIJB 3EO9H 1BZQK 1U2CA 4I4WA 4AWJC 2P5WB 1QUNB 1URIA 3DX8A 4FYRA 3AUVA 4S10A 5ICXB 3TNMA 3GLAA 4TNWF 5E23A 1TVDA 4BIKA 2ED7A 1G9NH 3KM1A 3U7YL 4HOZA 1LEGB 2KQMA 1XIWC 4XVJH 4FG2A 2L7JA 4HWBH 4KK5D 5I0ZA 1LWJA 4JG9A 2BZ7A 3DRTB 3ZMEA 1FORL 2AEQL 3DVGB 4ZW5A 1HSBB 2Q8AL 4IMLB 4P46D 1HZHH 5HYEA 4JFDB 4TVPE 4AY0A 5JOFA 1V7ML 3OHMB 1UB6A 5SWSE 3LQZA 4G1MA 1I9IH 4MS8D 2R2BA 3TIDA 1RULL 2FNBA 1F02I 5FC9A 1I9RL 1IGML 2YOAA 2ZYHA 4N85A 4WHTA 3V6FB 1TJHH 2VZSA 4Z0XA 2J20A 4HPYH 3QUKB 4LOFA 4WW2C 4LSQH 1EO8L 4XNZC 5BOZG 4WAFA 4ODVL 3SCMA 4JKNA 4ALAL 4ZSOB 1NC4B 1OHZA 2IPUG 4JFOA 4POUB 2WO4A 5PCYA 1NBYB 3TC9A 4N9GA 4CC4A 3FYIB 2NYZA 3OBAA 5HSFA 1Q9KA 2F74B 3TJHC 3VGFA 2FWOA 4YBLC 1EEZB 4PBXA 3FQXB 2VMJA 3WY2A 4TTGA 3GTNA 5F3FA 3QS2A 2VDQL 2IPTL 5ITBH 3ZE1E 4Z0XB 3DUUB 3GSOA 1DBAL 3JYCA 4G8AC 3N50A 4NN7B 3FXIC 1XSKA 1X7SA 4X4ME 4M6OL 3VXQA 4WHCA 1IAOB 2Y1AA 1KCKA 4N8VG 4PJ8C 1XCQB 4HKBB 3NN8B 2DWSA 3H85A 2EYTB 3QYMA 3QO1A 4LCVA 4AQEA 1UJTA 3KXFD 4J3OD 5B38B 1B0IA 3MLUL 1P5VB 1AJ7L 3G5XB 2WKGA 1BZDA 4X7SL 4YHPA 4XC3H 4PJCF 2BERA 3U9PL 3MZGB 3QIWC 4U7SA 2EDEA 2FL5A 4G1EB 1PZCA 3ARDC 2DQIH 4RSYA 4HPOL 1BOYA 3EJYD 4OD2A 1E7UA 4XX1G 2WSDA 3UGUA 3VXQB 1FHGA 5GRUL 3O8XC 4E9SA 1YNTB 5FECB 2P5EA 1TUPA 2O5YH 3KPNB 3ECUA 3QSKB 1ICTA 1HN1A 4Q8BA 3INOA 4PJBB 4RAHA 1NCBH 3MV9A 4FF9A 1H0DA 4FMVA 4OCLC 1VRSA 4FI8A 1SF3A 4DKFL 4KI1A 3BPLC 4YXKL 5H94A 4HF5H 3O3UN 4A7QA 2J5WA 2F7PA 3NT0A 4OLYL 5GS2H 4X8JA 5E1QA 5BZXA 1DFXA 3NH7L 3QDJE 2C1PB 3I6LD 4Q9BA 1X7QB 2YPKB 4XN8A 1OP3K 2PO6C 4F9LC 5A6MA 2GBVA 5A7BA 1MJ7L 5IV2B 5EUOE 1AGCA 5FDWB 5D4HA 4N2FA 2K4AA 1CFSA 3GRGA 4PJBA 2N4IA 4AZ8A 4G8GA 3MROA 4J3SA 4XOEA 3RFZB 3IGFA 2FHBA 3SHSA 4OZIF 3QR0A 4F9LA 4Z7OF 1FFPA 2BVOB 5I73B 3Q8EA 1HYSD 4L2YA 5F7EH 4HXAH 5GGQH 2IMNA 4LRNH 3IKCB 2GTWA 4QLRA 1YYCA 3D3VB 1MCPL 2IF7A 3RVVC 1QLRA 5JPNB 5B1JA 3D08A 3AG1B 1HDMA 4F80A 4YHNA 3CXHK 2QPDB 2VL4A 4R7NB 4WK0B 3VFRB 3WGVB 2PUQT 3QXAA 4MCZB 3QWNA 4PSPA 3RAJH 1X5HA 3SGEH 4FQXA 1CFSB 2MPAH 1OGAD 2E27L 4N8PA 3MROB 4Y1SA 1FL3B 3VTTA 4RMBA 4U1LB 2FO4B 2WLYA 4P3DA 2WXGA 1U8KB 4MHHG 3FMGL 2E7LC 5F93C 4UU9A 2YC1B 5F9DC 3LKPA 2F54B 4D3CL 2W59A 3ARRA 4H2CA 2BSRB 1BREA 7CGTA 4JFPA 2AXHA 3RPKA 5DJZA 3GMPB 4XCYB 2ZNWA 4MCZA 2BVPA 4UOJA 2QPFA 2Z64C 1BEXA 2SEBA 1QBAA 3RKDC 1EO5A 1DJIA 3EDDA 2J8UE 4TLTA 1D7FA 5BQ7B 1XB3A 2NMSA 1S7XA 2IBZY 3C60D 2YBGA 1QWNA 2HT2C 3BUIA 4PY8I 1TZGH 5H8DA 3V0DA 4FGMA 3MLSL 3CSBA 4Z7AA 1OAQL 3ZKMD 2QKIA 4ZNCD 5IWLC 4HT1H 4JVWA 4WDIB 4AG4H 5CLWA 3K72B 4NQEB 3ZK0A 1E5BA 4K2UH 3WELA 4D0BB 3CVBA 1JFQH 3H9HA 5I1JH 4JFDD 3RVWC 5IFAL 1U8IB 2C34A 1DE4B 4FA7B 3VFNB 2MNJB 5ICYB 1J8SA 1BWWA 4X50A 2BS8A 3JT0A 4KVCH 1XVSA 1YYLL 4NPYB 4KJYB 5B8CB 1CFMA 1S7XB 4NI3A 2Z93B 2G2PA 3LV3B 4JDVB 2NSXA 4BE5A 1QASA 3IJYB 1AMXA 4Y7OC 5CCKH 1IILE 3UC0H 5F3BB 4A38A 4XXDB 4D0BA 3OKLB 4L1HA 4CRPA 4DO5A 4AV0A 3VFNA 1DQDH 3GO1L 5KN5A 4FI7A 3IS0X 3QUZD 5FM5O 4WIQA 3AC0A 4DGIH 2A9NH 2BP3A 4Y7MA 4OIBA 2BK8A 4MA1B 1KTDB 2ADGA 2LQRA 3W1ZA 1Q0XL 3W11C 4MQ7B 2N7BA 3FQNB 3SYOA 3VWJD 3GZPA 2OCCB 5D7EA 3BZEB 5ADOH 1TLKA 3ABZA 3OLGA 3S88H 4UQ3B 5F88A 4OF0A 1CS6A 2M2DA 2OXGA 4FEIA 1T2QH 5B3JE 4P2RA 3SOBL 4GAJH 4MA1C 2GCYA 2JB6B 3JWNC 1KGIA 2PW1A 5HJGA 3O41A 3T09A 2FX8L 1LQBC 3SBQA 4HS6B 1DEEA 4PMEA 2ZUQC 4JFFE 5E4EC 4U4BA 3O4LD 4P0DA 3ABGA 4JPQA 1H3XA 4GW5A 3SKOB 2H6PA 3FQWA 4DGVH 5CGMA 5GS3A 1DLFL 1PJWA 2PPAA 4LP4A 5E51A 2E76C 2DQEH 1DN0B 4N20A 2EC9U 1C5DA 5J12B 2YK1L 3IJ7A 5DQJB 5HHNA 3RWFB 5JQIB 1SFDA 1KJVB 3GXMA 1A47A 1L9PA 1N59A 5E4EB 1CYXA 1KYAA 1MCKA 3P4OA 3KPRB 2VITB 4JFQB 5EO1A 4JO1L 4P06A 4HFWA 3QORC 3BOVA 1P4UA 1YY9C 2Y69B 1T0MA 1E8ZA 3K46A 4P8QA 2MCPL 4L1DA 2V9RA 2BFVL 1QPXA 3QO0B 2Q76B 5EU7C 4UV7H 3P2BA 3HCVB 4TL5A 1WSST 1A64A 1JGIA 1FNGA 3DETC 5GS0H 4QAMB 1AQDB 5F8QC 4J3VA 4UT6L 4DZBA 3Q7JA 4KROD 1HXKA 5DWUL 4L8BA 5CEZL 3BSGA 4LHJB 2K0RA 3PWVB 1ZHNA 3SDCC 3BSZL 4R8WL 3OJ2C 4U1JB 5C0FB 5LNEA 3D9AL 1FYTA 4GH7B 3GTVA 5CBEB 3LVTA 1MCWW 1MCBA 2Q76A 4AGOA 1O5PA 1B4TA 3FB5A 3QIWB 3ATFA 4OQTH 3GMMA 4OLXL 4L3ED 1P4LA 2DS4A 4N0UA 4HS3A 1DVFB 3US1A 4FJZA 5T3XE 1AQDA 2CA3A 3QZNA 4H5SB 3IJHB 4GQZA 1K8DB 4MAYB 2RALA 3ENEA 2NX5A 5HI4C 1PFCA 4AE0A 3G9VA 5GGVH 3DYMA 3FUNA 3SCMC 4PCKA 3PWNA 4PLKC 1MCIA 5E8OB 1FORH 2AEQH 3VXSD 2JB5L 4MJ4A 4LASL 5CBEA 1Z1WA 1GJWA 3P9MA 3WTSA 1JPTH 2K3TA 2D3NA 4YDMA 4YVUA 3N1MC 3RPBA 3WG7B 3QPKA 5T3ZE 3L7EB 1LO2H 4YWGL 1PZAA 1FLRH 3EYUL 3S3JA 1MCPH 1XGYL 3HJ0A 2A9ML 3LB6D 3V55A 1K8DA 3X11A 4QD2E 3T77A 1KXVC 1Z5LB 5D7LE 5L2KD 3C8HA 2TRHA 3O81A 4RDQF 3WI9A 4XPFL 2R2HA 1F13A 3PPEA 1W8NA 3OAZK 4XBGB 2OI9C 1CK0L 1FVCB 4LSQL 1EFXB 2FGZA 4JRYB 4ONGH 2CO6B 1F97A 3HE7A 3U0WL 5MERB 1EHNA 4G6FB 4Z7UF 4KJWC 5DHVA 4XCEA 4PJ9D 4Y5YA 2A5UA 2BNRB 2V3DA 4A67A 4A66A 1CE1L 1UURA 2Y2YA 1SM3H 5EUOF 2IH3B 1KCUL 5I5JA 1CR9H 2X0WA 3HMWL 3MLYH 3H9ZA 5AW1B 4CUCA 4HG4J 1L0QA 3JT2A 3B5HA 2WP3O 5F7KC 1KSRA 4KKAC 5DXWA 2PXYC 5GS2D 2QFRA 4XN1A 5CEYA 2DLIA 2JF1A 3VNZA 3L8QA 3QWOA 2YSSB 2LLLA 1NPNA 4U1HB 2FBOJ 1ACCA 2Z35A 3SQBA 3CN1A 1DBKH 1NFDB 2CKBB 1NOLA 4P46B 4TTDD 4LNVA 3VRIA 1MUJB 1HYSC 2A0LD 3LKNB 3LN4A 3P77A 3SDDD 5J1AB 5IUCA 5KSBA 4BKSC 4PJEF 5I1JL 3FTSA 4M61A 5DEFB 1NFDE 2PO6B 3RHWK 2QZ5A 5TPWL 1YQVL 5FKPA 3FH8A 4XZUB 3L3OC 4W4OA 3CSPA 3QDME 2GJ6B 3UIYA 3UTPE 1U6AH 3F04A 3S35H 2LOEA 1BVKA 2X3CA 3D05A 3OD3A 1KNOA 3K6SB 4WGVB 1TOXA 1XFPA 4D8PB 4GEIA 5L6YH 2ZAHA 3GXTA 2DLTA 5CZXD 1I1FA 2XQBH 1J5CA 2H2PD 3W81A 1U9KA 4BEIA 3ZLQC 3KCWA 1WT5C 3DRQA 5AAPA 1XSIA 3ARED 1OHQA 5L88H 4UTBL 3ULVH 2X4PB 4JZJB 3LNDA 2WXOA 3OPZL 5IF0B 3GGWA 1J11A 5D1QA 4I5BA 1E42A 1WZ1L 4K94H 1LE5A 1P9MC 4KI5C 5D1XA 2JKJA 1ECZA 2XG4B 3MACL 4ZXBC 5L4FA 3C09C 5H35B 3WL9B 6FABL 1WICA 4UQEA 2IGTA 2XVBA 5I6KA 1BVKB 2PR4H 3ATBA 1KCLA 1MJ7H 3CFMA 1CU4L 2OMYB 5HYQB 3SY0B 5HGAA 1OGPA 4HK0B 4P4KC 5JHAA 5D4JA 1F41A 3L5XL 1ACZA 2RIKA 2VAJA 3HOGA 4YSEA 1YEIH 1H5BC 4R4BB 4BUGA 5HHME 3ATEA 2UVFA 3JWNH 1BBDH 3LN5A 5IROA 5K9OB 4ZOBA 3S97C 5C2BH 3FUJA 5DRZA 4IOSD 5AG9A 4U1KA 4NRZA 3U9UB 2HH0H 4MJ5B 3HAEG 3TEYA 1R3LB 4LVHC 5EIIB 5JOPD 1EBAA 2OMXA 2Y7MA 3PJSB 5GJTH 1IC4L 1OSZA 3K81A 3VXUE 3MTXA 3CVIL 2O6CA 1FIGL 2VN3A 3QCVH 2MCPH 1IQDB 1MFMA 1QLEH 5C70A 4NKMA 4GRWH 3N55A 4TXVB 4L1LA 2WVUA 4R6UA 1CI3M 5D5MF 2K1MA 3L1OL 1UZ6F 3QYCA 2HKHH 3UAJC 2XETA 1HSAA 1LO4H 3QNYB 1WAEA 3MRLA 3SPHA 1MRFL 1ORSA 3EGXB 3MODL 1N18A 2DB8A 4M6NH 4NNXA 5IB4A 1C5BL 5AUMA 3AREC 2XG5B 5KVGL 2KZWA 3L5HA 4G8EA 4JO2L 3NFSH 3VRJA 3D2UB 4OTXL 2AGJH 5CCHE 3FN0H 5FYKH 2NX5E 1AXSB 4TYUA 4Z5RA 1RZKC 5AD0B 4A6YL 3W38A 2PKDA 3IXAB 5DUML 1Q72L 1UACL 4X4XA 5I1DB 2UZYA 4L3FA 5JHDA 5BZWB 1XF4A 1N0XL 5LCVH 4CAGA 2J8HA 1EMTH 1Z66A 1NMBL 3AWEA 3CN2A 3GIVB 3KDMA 4HQQH 4PLNC 1V8HA 3VQ1C 2AAAA 4ODBD 3FUKA 1JGVH 2W1NA 4L0PB 2VXTH 2VGLM 4Z76A 2F5BL 1AXSA 3C2AH 4ZW8A 5D1QE 1BIHA 3B37A 5IMMA 4XVUC 2NY6C 4YWGH 1UZ6E 2IH1B 3KYKH 4ANXA 4NJAH 3TZVC 2UZYB 4TRPL 2N0MA 3NSCA 5DK2A 5EDSA 4H20H 2C4FU 1S9VB 2QHLA 3DETD 5FF6B 4EXPX 5HYJA 5FA4A 4H0IA 2AMGA 4NNYA 1NC2B 3GIVA 2J1XA 1WIOA 3KDMB 3UAJA 3HI5L 2DBLH 4LNRA 4OQ1A 4R7XA 4UDTA 4HSAC 3RBGA 2EC9T 4NGHL 4GOSA 1CXFA 1TETH 3DV6B 1E4XH 4AVKA 1J9QA 3HFFA 4B3VA 4WWKB 5JZ7D 2AKRA 3GSQB 1GRWA 4MCYB 3FQUB 3HZVA 5FCSH 3UGEA 3WN5B 4BQ6A 3NP3A 1CFTB 1UKQA 3LXCA 4AQ8C 4KQ0A 4UCFA 1XSOA 5HYJD 5IJDC 1JXFA 1D6VH 5C09B 3FU7B 5KSAD 3CAFA 1U8QB 4B9KC 4JJ5A 3LSOB 5IT2H 1P4BH 3B4NA 4MSWB 2YK1H 2G60L 2DAVA 2KPWA 1AKJA 4NCC1 3K7UA 4K7PY 3MRCA 4ZOAA 3HNSH 3T2PA 4NQED 2D7PA 5ILTH 3ELQA 2CE6A 1L9SA 2DWTA 4M02A 12E8H 1SDYA 2HLEB 2NY3D 2AC0A 5FFOA 3V0IA 3WIHL 1L0XA 5BJTB 4F7MA 3QNXB 5AW6B 3ARBD 3KM2A 1OTUC 1TTBA 2WWMC 1FGNH 2ZCHL 2BOCB 5G5DA 4HCGA 1F3JB 4MSWA 1I1AC 5ESVB 4HKZB 2IG2H 2OMUB 3MMEA 4C57C 4P9ML 5CEZH 3B7SA 1JWSB 2IDTA 1UXSB 1GOFA 4PLJD 4JHUA 2DOCA 5DRWB 3ET9F 1RZFL 3RUGB 1D7CA 1R17A 2AQ1A 2X6VA 4NAMA 1QYGH 5IBUG 1MAJA 3QNXA 4AITA 2QQLH 4BBWA 4YLQT 4E42A 1JZFA 3SGEI 3LH8A 1HH6B 3MBED 5BO1L 4KKAD 5DMIL 2BNUB 4JFDE 2JJVA 3ORJA 1U93A 3GJEA 1HKLH 3AY4A 2HUEA 2LAGB 2VDKH 2WQWA 3AT8A 3PNWB 1NFKA 3OXSA 1BAWA 1LNUB 2ZUYA 3RX8A 1MI5B 2X42A 4NQVB 5ITFA 1I4FB 3APFA 2GI7A 2X4QB 1GXEA 4JHVA 1VFBB 3WHXA 4ANVA 2QJDA 3H0TB 4PBDA 2DIAA 2VLKA 3KYNA 4GKLA 4KAQH 4XAKE 5GRXG 1HJCA 1GGIL 1T83A 1UH3A 5FO8B 1J10A 2HCZX 2OULB 3P0YL 4WUUD 3B2VL 5CP7A 3F6IA 4FNQA 3P1VA 1PZ2A 1GH7A 3O0RL 3L9YA 3SE4A 4QRBA 3WLBA 1G6VK 2ROXA 3FJTA 5DUPL 4JANB 1IBHA 1OAZL 1N4XH 5B22A 2ZUXA 5IHLB 4LP8A 5TJWK 3VI4E 2D7NA 1O0VA 2YD2A 5DC0A 1UXWA 4MNGE 2IANA 3ZSTA 4DIXA 3V6FA 4TVSa 4XWGL 2V37A 1TLMA 1AXTH 5IFHL 2EDTA 5C86A 3RZCD 3UC0L 4HD5A 4BFRA 4YHIB 2J43A 1Z9PA 2RFXA 1S7SA 4G72B 2IPTH 3WJLC 1YEWA 3CDZA 3OL2A 5ITBL 2F1AA 2WMPA 4D9RD 4QRRA 4NO0B 3TIEB 5DHVH 4IQHA 2DJUA 2EZ0C 1OW0C 2WZ5A 1J12A 1YN6B 2X28A 5AKSA 3S5YA 3ULVE 5DVMA 1RUAL 4IHOA 2H32A 5D6CB 4AMWA 4YXHH 3OAUH 3FTYA 3GMLA 2HRPL 4KKCC 1TSRA 3R7QA 2NZIA 2EDOA 3BKCH 3ZVVA 2CK2A 4LSPL 2LABA 1KBBA 4FNTA 4WWID 3QNZB 5C0AA 2YPLE 5A2LH 4ZNEE 4HIEB 1F1GA 2ZKYA 3N91A 2H0FA 5LCVL 3DOSA 1FAIH 4GSXA 1S7UB 2O6EA 2A73B 5JHLH 3A4AA 1MFAL 3ECQA 2AJZB 4JFXA 4Z7IA 3QRFM 5IOKA 2O26U 2VXTL 1W72H 2D9CA 4ZK8A 2VDLL 3W0WB 3C2AL 4YDZA 1UJ3A 3SY6A 5HPOA 4A2LA 1KGJA 4G8IB 1T5KA 1U3HD 2QVKA 3CXDL 4KO9A 4PVNA 1CUOA 5F7DA 5HHXH 1FV1B 3U9WA 3OXRB 4D9RE 1I7TB 2VO5A 1WBXB 3PPSA 3H7LA 3KPMB 4JO5A 4Z7WE 1X5FA 4O4YH 1OSEA 1EEZA 1HHJB 3S4SG 3W2DH 4ODTL 2AJZA 3RI5K 5KYXB 1QTSA 1SVCP 1URZA 5KYUA 3QUMB 5KSVB 1KCBA 3QQ9D 2VDMH 2H2SD 2WZPD 3VX0A 1J0ZA 4OF3A 4J39A 2A2QT 4OFPA 2EUZA 2LU3A 1X7QA 1A3LH 5T1LA 3VI3F 3PGDA 4YHZH 4QRQB 4UV4H 1ZDSA 4TUJA 4ZMAT 1JV5A 1P5VA 3K4ZA 5CEXA 4MD4A 4MLSA 5HGDA 4K3DH 3HE6C 3T3MB 4MX7A 1ZPUA 1IO4C 2JI3A 4PW9A 4K5PA 2XA3A 5E2UH 2A6KB 5D7LD 4LU5H 3PHSA 3ZE0E 1LTXA 1UTDA 2WXFA 4RWHA 5IQ9B 1KIUB 3CGTA 2PWGA 4P5SA 1CE6B 1XH0A 2V5YA 4ZMVA 2P5EB 2L04A 1Z6JT 1F3DH 5CJXA 1KBKA 1AD0B 1XF3B 2WBJD 5IVNA 4EZLA 1KJMB 4CBPA 2WJ7A 1EHLH 1AS7A 4H8WC 3VFSB 4N2EA 5HYIA 4I48A 3IFNH 1MJ8H 3QIBD 4OZIE 3H54A 4JDEA 3FUEA 3QDGA 5BS0E 2GTZB 3MHZA 5EBWA 5IW1A 4KMLB 1OSPL 3BW9B 3HS0A 3CG8A 5CINH 4WW1A 5IB2B 5JPMA 1ZEAL 2J55A 3ASWA 2PCFA 5DFTA 4OZHB 2BVPB 3TYFA 1FPTH 3T0EB 2B0SL 2EIZB 1QSFE 4F7TB 3V7MA 3RDTB 5FYLH 2W60B 5KVEH 3VFSA 3CQQA 1CGXA 5JIKA 3L2LA 2AV1B 4FE9A 4P49A 4ZDHB 1K6QH 4WDIA 1CIDA 1IGCH 2AJ3B 2PWEA 4G8FB 4NHUA 4U6YA 1FCCA 5ISZB 1U8IA 4XVSL 4RMSA 3S4SB 1EV2E 1JXGA 3TYFB 4UIKL 3QPXH 2Z7YA 1SYSA 1MEXH 4MWFB 2VRQA 4URTB 4GP5B 3D48R 3K5RA 4U1LA 1AR1D 2Q3ZA 3OR7B 4ZYKB 2RQEA 2I9TA 1FSKB 5D9SB 3HUJB 1Q9WB 2AV1A 4R96A 3TFBA 2OMBA 1KIRA 2V9UA 3F7KA 3LKPB 4FD0A 3N42F 4QOKD 1K5WA 4LSRL 4XNYH 1X7TA 1A9EB 1A1OB 4JCMA 3UPRA 2PP8A 1BQSA 1MF2L 3VI4F 4B96A 3O6MH 2CDGA 4Y5VC 2VLJA 3ABLB 1A7QH 1RURH 4YLBA 1KJ3L 3EYSH 4DVRL 1FFRA 4HKJA 3VGBA 2HMID 1YY8B 1GYVA 2X41A 1RFDL 3MJ7A 3IN2A 4BSWB 3CFEB 4LPWA 1X9LA 5FKAB 4QRSA 2BY2A 2Z7UA 3OR7A 1F4AA 4QNPE 3BWSA 5B7EA 4KUCD 1QBMH 2FX8H 4EZJA 2FSDA 3T2QA 2E7CA 2BXZA 1WCBA 1DQML 1U30A 1U8LA 5L2JA 1ZD6A 3OMZA 3SDCD 4WENB 3GPEA 1FL6B 2R56H 4Z7OE 3TO4C 1GZQA 1E8YA 2N56A 5CXPA 1X6NA 1F6AA 8FABB 3CZUB 1QQDB 3KPQA 3APDA 5TD4A 4BSWA 4G80A 3EOTH 3QI9C 5AVYB 3QEQD 4NUQA 1ZJAA 3DOHA 4N2AA 2J21A 1WUNT 3VTAA 1NFIB 4FQIL 4JDVA 3TT3L 5C1MB 4NNPL 2KBGA 2Y1VA 3FU8A 1T2JA 1N59B 1T20A 1TYRA 4OGAD 2NXZC 2DQFB 1C1EH 3WUZA 3L4WA 2G0KA 5K9JH 5GS0L 2BOBA 1OAKH 4XH2A 1LEKA 5J7CC 1JGDA 3S3PA 5DTFB 3WN5C 3EYFB 4MQ7A 4Z7UB 4MZRA 2R8SH 5IVXE 2DWYA 5H37H 3D39E 4LAJH 4M1DL 4TNVK 5GGTA 1OL0A 3C60A 3H56A 4S1SL 4UOW0 1DVFD 4DZBB 5F88B 4I2XA 3BT2H 4GLRH 4L8BB 4HH8A 4PJDE 5I1HH 4H26B 3P3SA 5LGYA 4G8GE 1T1ZB 1E9QA 4PJAE 3CFKA 3LNHA 3ARWA 3QXUA 3UERA 5T3XD 1FYTB 1Q0YH 2IJ0C 5DTFA 2JXMA 1JK8A 3M17B 5EN2A 4HJEA 3GSXA 4W70A 5JYMA 4M48H 1QEWA 1GAFL 4PWGA 2VRKA 1CQYA 4OCWL 5KUMA 3C60B 4X5LA 1KTRL 3IMTA 1MDTA 2VDMB 1TF4A 2BMKA 4ORZC 2KHAA 5D7LB 1NCOA 3ARTA 1FGVH 4M03A 1S3KL 5AL8A 4ENED 3A67H 3FU3A 1M7DB 2YD9A 3MOAH 4JO3H 3DBSA 2R4SL 3TWCH 2PXYD 4MD5A 1IKOP 3E6FB 3MCLL 2H9GA 4Y9FA 4GKSA 4J2XA 3WO3B 3NA9L 2AEIT 3VUAA 2EH8L 3RNQA 4JVUA 1PX3A 1OD9A 1L5GA 5F9WB 3HCVA 3QI9D 4TTDC 2QEJA 4KI5F 4X9BA 4LAQL 2HLFD 4HEPG 3UTSE 4J6IA 3WUWB 1JVKA 2BRQA 2F68X 2YD0A 3IJ8A 4ONGL 3X11B 3PGCA 5K93A 1NCNA 3KWTA 3FSOA 4X7TB 2VXSL 3F62A 5C0FA 5I6MA 2GUYA 4GKSB 1EFXA 5IFHH 4DUVA 2Q8AH 3HE7B 3GMQB 3DGDA 3FB5B 4P5RA 2A99A 4N0UB 5K59F 1R3HB 4UTAH 2VERN 3GNML 4HWEH 2DM3A 4PWKA 1VLXA 5E4OA 1E40A 1II4E 1OSPH 5F97E 5I6LA 1NWOA 1N67A 4IKKA 4JM0A 3MRKA 3BMVA 2JCWA 2KC0A 1IGJB 4JZOB 3FRPB 1U4FA 4PRAB 5BRPA 1GMEA 2E5EA 1SF5A 4QRTA 1C8QA 4M1CD 4B0MM 1TTAA 3QIUB 2IBGA 4NGHH 4EUPA 4ZQKB 3QWOB 4FP8L 1MPAH 2WZ6A 4PR5B 3SO3C 3BKCL 3ZTEA 4KNQA 2ZCLH 1DDHB 2VXVL 5GGRY 3VGEA 5KVFL 1IVLA 5LUMA 1BCIA 3BVVA 2XN0A 5E8PA 3HPLA 3FBKA 3EAKA 1YQVH 4QHLB 4ZO9A 1HWWA 2I7SA 4NQDB 2CDEB 3P3RA 1SJVA 2BS71 6TAAA 4WWPA 1IGJA 3FT4B 2CGRH 4Q2ZA 4XVSH 1MIMH 3CVHA 3HBPA 4I0CC 4ODSH 4PJBF 2MSPA 2R27A 1Z9LA 4I3RH 5CJXC 5IB5B 4AT6A 2ALWA 3OM3B 2Y06H 3GIZL 3WIFA 1J5DA 4WFGE 1TEYA 4R26L 3T4AC 2OMTB 1QG3A 1NL0H 1RVFH 4XPBH 4FNLL 4Y5YB 4H44C 3L3IA 4GW4B 2BNRA 2W94A 4GKZA 1BGXL 1BXXA 2CHDA 3L3DB 2BVEA 1KB5B 3T3MF 4KXBA 4XC3L 2F8VA 3WIIL 1SUJA 3IWUA 3CVHB 4UTAA 5TDOA 1F11A 2NYKA 5AKTA 4DERA 3QORA 5LG1A 4P2OA 4J27A 2CO4A 4XNQB 3WL9A 2Z35B 3SQBB 1WAAF 3A4EA 2I60H 4ZX6A 5DJXA 1OGAE 1SQ2N 1HCFX 4IGBD 2BHYA 1LJMA 3S48A 1YEIL 2BS9A 2HLAA 2ZKXA 3N2JA 5I1LA 4PIBA 4DTGH 2A6DA 1DBML 3CIAA 1JRHI 3VQ2C 3VX1A 4RMWA 5CZVH 2VJ8A 4M4RB 1ESOA 3BP5A 3QRGL 2ZOOA 2QDVA 4Q4EA 1A6ZB 3DHMA 4U31A 4U3SB 4Z7WA 4R4BA 4FI6A 3N1QC 3G04A 1TQWA 1UYWH 1PD0A 1GC1L 2YGNA 1UC6A 3I2CL 3BAYA 3LHPH 1UH2A 2ZOKA 4MAZA 4MJ5A 1NAMH 1W2KT 5AYUL 1LQSR 4O02H 1GJIA 4UI2A 4AIEA 2H1LM 4D8PA 1TU2A 3F58L 4PP2B 2DD8H 2NY1B 5BVJA 2DQCH 1DJSA 5HJBA 4AYFA 4L5FL 3GGWB 1BVOA 2UY6A 4CC4C 1AY1L 1GGIH 4QOKB 4XO4A 4ZS7H 5GGQL 1JF5A 4HMCA 4NKMB 3FQ2A 4Z3JA 4I18C 3MODH 4PJIF 3UTTE 3WD5H 2ZUWA 3DGCR 1NDGA 1U3YA 4DEUA 5IEHA 1DO6A 2ZOKB 2ZOLA 1JVLA 3EDFA 1IBZA 4QUOA 5DHMC 4ZUVB 2G3ZA 2LTQB 3RY6A 3VAEA 5ID0A 1TQTA 2HPTA 1DUYB 3NIGB 1E9PA 4PGDA 4PJ9B 3NAAH 4A7GF 3B6SA 2OJEA 1X6LA 1H8SA 1ACXA 1NCHA 4JRLA 1UM4L 2WLMA 3JTSA 2YFOA 1S7QA 4A6YH 1T03H 3V5KB 1E27B 3WJLA 5BQDA 4DGYL 3ILPA 1ZS8B 2YWYA 3GSRA 3MDJA 3LN5B 4PV1C 5KBKA 1FBIL 2F2HA 4ZMXA 1NGZA 2ZF8A 1KPVB 4E5XG 4Z5RB 4U1KB 1TNNA 4PTUB 4B9FA 5KBMA 2V3EA 5CSZA 2ZQKA 2XWRA 3MRRA 4PG9A 5HGHB 3UJTL 4HWZA 4OZGF 3QXVA 2OMNA 1IC1A 3TURA 5SWZD 3WAJA 3CFDA 3K8LA 5HPMB 1OSZB 1CVSC 1N12A 3ESVF 3KH4A 2X10A 4XXWA 2HSIA 1MI5D 3QH3A 4N2IA 2LVEA 2VT0A 2YMOA 1DCLA 4PVMA 1U95A 2C9PA 3HI6L 2HFEB 1OAYL 5AVXB 1ZGLA 5F1OB 1CBVH 1ZS8A 3GSRB 3L48A 3KYKL 3LTVA 1MHEA 2APSA 4S1RH 4YUEL 3RL1B 1I9IL 5T1LD 5AB0A 3TJHD 1EJ8A 3NESA 2Q8BL 2HRPH 4XNYL 4XMPL 1DJHA 4GAYB 5IMMB 1NGPH 4GFXA 5EULV 2NY2B 2QLYA 3V8CA 3IGLA 1UGKA 5F0PB 4Y2NA 4HLZH 3IDNA 1NFDF 1OGTB 1YHPA 1SJMA 1T3FB 3VXTB 1FAIL 6PCYA 2XYBA 5IB4B 1U3JA 1SJHA 2DMCA 3CVCA 4DN4L 3AQYA 4XNUH 1CICD 1FNSL 4PN6A 3AQDA 4KUZH 1AS6A 1W72L 1RUPL 1SGKA 3CDGA 1NDMA 3DTUB 3A4DA 3BO8B 3IGAB 1ADQH 2DLHA 3H9SD 4OZIA 1XF4B 2DH2A 4N8VB 4F7PB 1ZSDA 2ZPKL 4ILDA 1NBVL 3TP4A 4M6OH 3VXRE 4ZW6A 3E3QC 4N2MA 4LDLB 4CKQA 3MLPA 3HC4L 4K7PH 1Z0MA 3FAXA 4H40A 3ZDZE 3RKPA 5I5IA 12E8L 3GKZA 3T4YA 3RVXC 5F96L 5KS9F 4HUNB 2PN5A 4EXKA 3VXPB 4ZZKA 2CCWA 1UD2A 5E6ID 4HEME 1WWAX 2LVCA 3CHQA 3CN3A 3I74A 2ALAA 4PRBB 4F93B 1KEGH 5IQOA 2WXNA 4OSUH 5B1AB 3QJZA 4Z7QF 5F7MC 1LK2B 1NANI 2IOIA 4HIHA 5EC1A 2NUTA 1RZJC 1YDPA 5G5DB 2A74B 2Y1YA 4BFIA 5TE6L 3X17A 1OANA 4D9QE 3ZZSA 2CLZB 3TNNA 2H1XA 4GXVH 3APMA 1JPST 1MIEH 4L8SB 2F15A 1ZVHA 5G4OA 4NERA 4AEEA 5DRWA 1OTTC 3KPOB 1ES0A 3AXHA 4JRXA 3N44B 4K3JL 4LE8A 5EIIG 5FYJE 1J7VR 3ARDA 4P4KA 3B2PA 3HNTH 1Q0YL 4LHUG 3O9WC 4XCFH 1ZY9A 3FF7A 2ZG1A 3LDBB 3NTCH 2Z91B 2NUTB 1T4KA 5INDA 1DJWA 3Q48A 1MCCA 2PPEA 4QPEA 3HR5B 2VLJD 2DM7A 1S3KH 1T5XB 2DQGH 5KYWB 5IOPA 4AENB 2R2EA 5DSCA 5C0JB 3HZMA 3VU1A 1ZEAH 2MKWA 4FKKA 4A68A 2V2WA 4LBAA 2F1EA 4W9DC 1ID2A 4I0PB 1AGBB 3P4NA 1GGBH 1LK3H 1O7DE 3X13B 3O0RH 4IKJA 3BYTA 3TT1L 4HZLA 5DMGD 2ZXCA 3TWYA 5JW4N 3KBPA 1T7VA 2ZP9A 5ESVA 1AGFB 2MH4A 3TF4A 4NFCA 4V1DA 3TBTA 4NOBA 3JVGA 4UNTA 3RTQA 4YSAA 4HZAA 1UXSA 4FQCL 3MXWH 2QHRL 4DK6A 2AK4E 4IRZL 4XVJL 4QRRD 2YS4A 2DQTL 2D2CC 4PJIA 2DQCL 5IMOA 3P4NB 2ZUQB 3TNMB 1N8ZB 1JS4A 3EF4A 2NYYC 1DL7H 3LYRA 3O9WB 4KU1A 4LVNC 1AR1B 1AIFA 1K8IA 2YEVB 5JHBA 2IANB 3LQAH 4WI0B 2XACC 3WLWD 1O9ZA 4HFUL 2Y5TB 3UACA 1Q4NX 1TDQA 2O5XH 2NSQA 2VR5A 2ZONA 1OCWH 5E6SB 5EC2B 1G7HA 1A6UH 4JGUA 4DFIA 4HJ0D 2ADFH 3TBTB 4L9LA 4I3SL 4XC1H 3HUJE 2A6IA 2JCCF 5CEZD 1AGEB 3BDXA 4AGNA 3QDGD 4J4PC 2CWRA 3SPCA 3RX7A 4ZNEA 3CDZB 3H4FA 1NCCL 1N8ZA 2FCBA 1HEZB 4HXAL 2J1WA 3F84A 3ZHDA 5IVXB 3IAGC 4W9GC 5TFSH 1OF2A 4KTEL 5HD8C 2XZZA 2H4EA 1QHQA 2NY2C 5ESQB 2FX9L 2G3XA 3FOMA 1BEYH 1CFVL 5ABDE 3GMOA 1NC4A 1NLBL 2EKSA 2NNXA 4JFOB 4LHUB 4DO6A 3T65A 5MENE 5A2FA 5ICZA 4R26H 5ICXA 2BJML 1YQ2A 5I6XC 4MGXA 2XI9A 3WY1A 3B8YA 5CJQH 2R59A 4NIKB 4XPBL 2GSIA 3ARBC 4S1RL 3O6KH 1H3GA 3DUUA 3RIAF 5C9JB 3ES6B 5E4IA 1UJ3B 2PTTA 4YXLH 3UROR 4K07A 4G8IA 3MLUH 2HJFA 3KLKA 4FFZH 2GQHA 5EFIA 5TE7L 3TF7C 1VPOL 5FM5M 1AZRA 3T2OA 1GS7A 1N70A 3I9PA 3JWDL 4JFEE 4ONHA 5ID1A 4HX1A 3KPMA 1SFHA 1TZGL 2D7OA 2WMPB 1HHKA 2WXHA 3SPJA 4HPOH 4EI6A 2VDML 2FZ3A 1O7SA 5DK0A 5IESL 1OT2A 4N0UE 3OQRA 2L4OA 4OH2A 3WJMB 5IB3B 2YD1A 3U2SA 5G4NA 2VLRA 4DTGL 4IOFC 2PTTB 4OD2B 3T0ED 3SE8L 4I77L 4XMTA 5I0YA 1SJEA 1KJ2B 5EZLA 1K3ZA 5C0GB 2OQJA 3AVEA 2Q3XA 3KLLA 4W6XB 1TQBC 5HBBA 1NGQL 4R4ND 4TVUA 3GJFB 4NO5B 2Q86B 2HRGA 4ONHB 5ID1B 1DZ0A 3B9DA 2AFNA 4Z3FA 1NBVH 1KBPA 1NWPA 2FWOB 4FKEA 4UUJA 4ZUWA 3ZGHA 2CHWA 4PFEA 4OLYH 1NCTA 3BRGC 2Z4QA 2WNKA 4Y4KD 3LKQB 3FB6A 4I7ZC 3NCXA 4FFTA 3N44F 4OZHF 1XCTA 4MX7B 2Q2EB 1UCBH 2QGBA 3H7BB 4O2FA 3F7PC 2C5DC 3VD7A 5JHDD 5EU6B 2DD8L 3TJEL 4KJPD 2VXUL 4R5TA 2QVFB 2YAFA 3MRIA 1E28B 1QPPA 1R5WA 3C5ZC 4X6FA 5B7FA 2NW3A 4AMKL 1I7TA 2Q86A 1XF2A 5IV2A 1AD0A 3BUDA 1KJMA 4KKLC 4BJLA 1R0AH 2IAMC 1KG0A 2X4OA 3G5XA 4PJ9C 2VUKA 5HHPA 3VU2A 4L9DA 1O5DT 1WGOA 2OCJA 2BSSA 3QG6A 4QTFA 4M9PA 4DKAA 2OPCA 1DVSA 3H7BA 4O2FB 4C4BA 5ERWA 5IW1B 4NWTH 5T33H 1JGLH 2VZTA 1GOGA 5IB2A 2DMBA 5J6HA 3RZCA 3OF6A 1WS7A 3DYOA 4M3JA 4JFTA 1JGUH 1U2HA 3QXAB 4DKEL 4U6XB 2WN3A 1RJYB 2WWOA 2QMKA 3JYBA 4W9ZA 2CLRB 4G9FB 3K74B 2ZF9A 5DQDH 3NTCL 2B39A 5CWSA 5E9AA 5CEXB 4LO9A 4P3DB 5MENA 3PHOB 3UJTH 5EOCH 3D39B 1Z32X 5DZLA 1HILB 2NT0A 4UU9B 1EVTC 3VQLA 5D2NC 1MXDA 4ZDHA 4HWEL 2A6KA 2GEEA 4UQIM 5EH1A 4P9HH 3QEHB 4LSVH 4DWHA 2VLMD 2AJ3A 3DSNB 4G8FA 1F45A 1H19A 4NHUB 3RA7L 4HG4K 3UDWA 5ISZA 1KIPA 2EVJA 2OV0A 4FYSA 2EZ0D 2CA4A 5JOPE 2AGJL 5FA3A 4FABL 3WFEL 4ZW3A 1XH2A 2ZZUT 3CMOH 4H8VA 4MWFA 1D7DA 4XMXA 1QFUL 1S7WB 4O2EA 4OIFA 4F37K 1DJXA 4LSUH 4LEOB 2AJVH 2WCGA 3QR2A 4JDEB 2C9XA 1U8NA 5E8NB 2MRYA 4KTDL 4NJ9L 3KEHA 2TSBA 1HDMB 3DSNA 3HG5A 2CDGB 2UXVA 5EB9A 2DKSA 4YHNB 2G2RA 3VFRA 5DS1A 1SLWA 2PR9A 3AM8A 4WNSA 2UZPA 2VMCA 3P30L 3EO1B 2J56A 1CCZA 2W60A 1S7WA 3O9WD 4JFZH 4O2EB 5E2JA 3S5LG 4YSUA 3HUJF 4NJAL 1U3ZA 3GK8L 3MLZH 1WCBB 1U8NB 4B9ZA 3MU3A 3FTGA 4WFED 4G6MH 1N9PA 3FUFA 4CKVX 5IVZA 3FS9A 4KHXH 4HKXA 2VR9A 3RQ3A 3QQXA 1A14L 1PZ3A 4TOYL 3R0MA 1PYWA 2HG5A 2B1OA 5ESAA 4FFVD 1LP9A 1MI5E 5F7NC 1J5OL 2I60L 4I0PD 4PUBL 4IOSA 2GK0A 4XVTL 3HE6D 3GDCA 2WLKA 2YO3A 1FJ1B 1CFVH 1D6VL 1CK0H 4X4YA 1A1OA 1OP9A 2GCYB 3GRWH 35C8L 5IVZB 3O11A 1O9WA 5DJ8A 1JZ5A 3ME0B 3QP3A 2XQBL 1H15B 2BOBB 4XMZA 3STZB 4G5ZH 2VLRE 2NOYA 3MJ7B 4CADA 2OK0L 2NPLX 1JGDB 4YVNA 2HG5B 1A7NL 4FS0A 3O2DA 1GS8A 4LHQB 5FKAA 2FIRT 3FU6A 5GHWH 1FVDB 3NCWA 2E8ZA 4RESB 4F7EA 5EEVA 2VM4A 4O02L 4X6DF 1ZCRA 4FA6A 2VDNL 4N90E 4JAMA 4LIQH 4NO0D 1IB5A 3BAEH 5E7FA 3RWFA 1U8LB 2W0FA 5HP5A 3QUZB 1T7ZA 3WFBL 3ZOAA 2F0CA 1MJJB 3KPRA 3WTXA 3IVKA 2E3VA 4QF1A 5DDHB 5CCJA 4LGRB 1IJNA 1JPGB 8FABA 1AY1H 3STZA 4WFHE 1G9ML 5F70A 3ARGC 5D2LB 4LCYA 5E5RB 2X38A 5GS1A 2B2XH 2BDNL 2DYSB 2IV9A 1KLFA 3DUSA 4APQD 5IJCC 5KW9H 4OZ4B 3BZEA 4UB0L 5HGGS 3DHUA 4TPRL 1XR8A 1SPDA 4OAWA 3FAWA 4H8PA 1MG3C 4BZ2A 3GMNA 4WHYH 4NP4L 2CXGA 4FQJH 3WFHA 2PW1B 4BGDA 1I8MB 1I7UA 4C58B 1X44A 1VZHA 5LXVA 5EUOA 1HNFA 3U0PB 5AZ2H 3SD2A 3T0XA 5EZJB 3VA2C 2BP5M 1OWRM 4UILH 3EYFA 4MAUL 4Z7UA 3LIZL 4FQCH 1EEQA 3C60C 4B6ZA 4FQQB 3QDJB 4DK3A 3VDBA 5B39B 1RUKH 5HHNB 1QSEB 2QFPA 3LNFA 3E6HA 2NZ1A 2W88A 3EDEA 3EADA 3DMMD 1BV8A 3WFHB 2GHWB 4ZTOL 4NEHB 1UKTA 3U0PA 4G7VH 2D7QA 3OAZH 5E8OA 3BRFA 3GZKA 4MDJB 1EHXA 4FNPA 1JK8B 1S46A 1T1YA 4AQOA 5EF1A 5D1ZC 2AP2A 2NRDA 4W9JC 4M6MH 2UUDK 1A0QH 1WYJA 2PPCA 1Y07A 2APBA 3H3KA 4KI5E 4XAWL 3S37H 1QA9A 3LH2H 5B39A 3DV4A 2DH3A 3KLHD 2AEPL 5JQHC 2B4CC 1CYWA 3U0WH 2AQSA 3ALPA 1O6VA 2ZKMX 3VH8G 2RGSA 4PYHA 3RNQB 3W56A 1KB9J 2OSXA 2HWZH 1MJUH 1S9WB 1E6OL 1T1WA 4OLZH 3F6JA 1SLUA 2QADD 4QJ3B 2XVKA 4FNSA 3CVDA 4U4IA 1KYUA 4CVZA 1FSKC 2Y23A 1REIA 3PHAA 4XVOA 3V0VA 2F5BH 4ZFOL 2BJMH 2BSCA 2IH3A 32C2B 5DRNB 4WJKB 2WTPA 4MAYA 1KGWA 4IRSB 5E2VH 5E56A 4KZDL 4MB1A 3ML9A 3WNMA 4Y2DB 3Q6FA 4JX0A 2NNAB 5JQ6H 1CTNA 4XN4A 2Z6FA 3X14A 4KK9D 1LO4L 1N6UA 4PGJA 4X6DB 4JVPA 1DQQA 3SSGA 4LSUL 5ALCL 3TCLA 1FZMA 3RTLA 5JW5A 5LVEA 2CKNA 2CKBA 2JK5A 1VB9A 3BUPA 3APCA 1G1CA 2HTLD 3JQOB 4KQ3H 1OQXA 3VXME 1A1MA 3DIVA 4LCCB 2WWMD 4FZEL 1NPUA 1RPQA 4QHPA 4JZOA 1CLCA 2D9QB 3G6DL 4EEEA 1QBLL 1QKZL 1UQSA 3SBWC 2R2HB 2R29L 2NNAA 2FWSA 4XBGA 4N6QA 3RRQA 4XE0A 4Z23A 3G5VB 2FVNA 4NUJA 1YEDA 1ZS2A 1JL8A 4M7KL 2WBWB 1JNJA 1N0XH 1TMQA 2ESVE 2R15A 2WIMA 1G4RA 3TCLB 5DHVB 1WBZB 4YSTA 5HYSB 5LGHL 1KCVH 1CDIA 3ZRFC 2NYYD 4S2SA 2X0UA 4E68A 4GINA 4XBEL 3ABMB 3L95B 4JREB 4OZFH 2FJGB 4M4RA 5DMGC 3GS7A 1D9KD 3IXTB 4Y2OB 5GPRA 4IRZA 4O58H 4HJJL 5IB5A 5C0CB 3EO0A 3NACH 4AUUA 5BVPH 4FLRA 3BKML 2VSDA 4FL4C 2O61A 1GGTA 1YVLA 3AS1A 3QJTB 1DQIA 4TQIA 4DP9X 1HL9A 5JHLA 3BZFA 3FNKA 4NSKA 2P45B 3CUPA 1VKXB 4FN0A 3VFVB 1NCDL 4QTIH 3FQYA 1MUJA 3L45A 4ZODA 1A7PL 3HE6B 4C47A 2R7EA 4AGPA 4YQXL 3TBYB 3RDTC 4OGYL 1BBDL 5AW5B 4A7VA 3UYPA 1DQVA 1DUZA 2R0LH 3TEXA 2A38A 4E9XA 3A24A 1L6ZA 4XHJD 1F11B 1INDL 2QR0A 3ASOB 4NQEE 3JV4A 2O61B 4K8RC 3DC0A 4NZFA 1JHTA 2E59A 2ZOLB 4WFFD 3QS3A 1RP9A 2B15A 1P5UB 1BVLA 3AFLA 3SEPA 4F91B 4LIQL 1JI2A 5FUCC 3R8QA 1DUYA 4PJ9A 4XE5B 3K6FA 3AT9A 2IGLA 1YJDC 3B6SB 1KZQA 2XICA 2B20A 4N0CC 2Y1ZA 3RGVB 3O2VL 1DUZB 1PZ5A 2ZOTA 3MFGB 3U4EA 1CJYA 2WUBL 2Y7NA 5E4AA 5CP3H 1MLBB 3B7YA 3AS2A 2XTSA 1NUFA 5BRZA 2R1YA 4NN6C 4AYID 4JG1L 4YK4C 2AVFA 5H35A 3IETB 3NCYP 2CG9X 4PTUA 1ZLSH 2IIJA 2JKIS 3IGUA 2AJSL 4R97C 5CHNB 1S7TA 3LKRB 3L08A 1BVLB 4MS8C 4YDKL 1I53A 1VFUA 2OMYA 5HYQA 3CFDB 3JV6A 2B0SH 4NNXB 4C56B 1NTDA 4ESKA 1QFUH 3BP7B 2PTVA 3MO1B 3F8UB 2WXMA 3KWXA 1ZGLB 3VXSA 3OAYH 3WSQH 5KOVC 1WZKA 4F2EA 2DJ4A 3I84A 5BRZB 3ILQD 5DRZB 2VDOL 1NPJA 3PIQB 1O6TA 2MTPA 2EVIA 3NJNA 1NCBL 4QTHB 2J12B 4DN4H 2ZUUA 4P2YA 4XNUL 1NLBH 3VG9B 5I1DA 5C09E 5D7SL 5L8JB 3IDNB 1PG7L 4DP2X 1CFNB 2ZWNA 1P7KA 2VR4A 4R7LA 4C56A 3ARVA 1QNIA 2GITB 2WYTA 1HH9A 4L4TA 3SDDC 1GOHA 5DMJB 1EAOA 4PGCA 1BPLB 1UXMA 1CLZH 1PMYA 3FQ4A 4RQQA 1PZSA 4J4PA 4X6CB 3SGDH 2KT6A 2YJLA 3WEXA 5J57B 3HC0A 1UWGH 4KKRA 2JLPA 4QKTA 2XV2A 3Q05A 1H3UA 1YEKH 4IDJL 4WEMB 3OX8B 4NQCB 5D93C 5IJVB 3Q6GH 4UQ9A 5F7EL 4UYPA 4N8VA 1NEZA 1LMKA 4CNIB 3FCBA 5FDYA 3D2TA 4LPCA 1EJOL 1I1CA 1A2YA 3PHQA 1Q90A 1ET5A 4LLQB 1G7QA 4JKLA 3HKZA 2J71A 3VD0A 4UM8A 5DJ2A 1IC7L 1QI3A 2K9UA 1SDDB 1WD9A 2I5YL 3ECVA 3WMPA 2MCAA 3ZJAA 3GS0A 1X5MA 3DGGB 4G43B 4WTXA 3T08A 3LH9A 5L0QB 3O4OC 1JHKL 4RMQA 3U7WH 1OGTA 5I1CL 3BVUA 1FZOB 3EJYC 1SHMA 1OSYA 2ZAIA 4GRMA 4KNSA 2XBDA 1CIUA 2ZXQA 1G4MA 4ICXA 4Z18A 3M1OA 2CALA 3HNTL 1IE5A 4P3CH 1ROCA 1T5WB 3GI9L 4WV1B 2I7OA 1QPKA 5GZND 3U9PH 3UIZA 1HKFA 2J88H 1HL4A 4QXGH 4AEHL 3CK0H 1C1EL 1CC3A 1RULH 3HB3B 1AHMA 1AQHA 4WFHD 1J18A 4OZIB 1QNZL 3FFCB 4LSTH 5FV2A 3VJ6A 1TVBB 4TN9A 1PY4A 2YD7A 5BS0A 1BSIA 3PFQA 1B6DA 3DO7A 4LNRB 2FLRT 1B90A 1TR7A 4TVPL 1QRNE 3KW8A 1O7VA 4FLQA 4LSPH 4YLCA 4UV4L 3RWIA 1WJ3A 2XC8A 4OVVA 2NY0C 1BX2B 4PQXA 4N25A 1QFWL 4HUMB 1T5WA 4XO5A 3VRLF 4OM1L 1ECYA 4FEMA 5K1VA 1GPOH 3NJVA 4HH9B 4U3CA 5E2UL 3VG9C 5C0RL 2D7TH 3KXFA 1I9JH 5IBUB 3GZQA 1I7ZA 4Y19A 1FZKA 4YHLL 4HLEA 1GYUA 1U8QA 1TYEB 2XZAH 4PJGE 4Z3IA 3DO7B 2GC7C 4BFEA 1FQ9C 2Q87A 3V0WH 1E6JH 2UXGA 3A6CL 4WGKA 1FGVL 3WNJA 2A9NL 1U93B 3A67L 1HHIA 3GJEB 2P43B 4U0QB 4V1DB 4P9HL 4EDXA 4XVUD 3CZSA 4TQEL 5FW7A 2X4RA 5GJSL 5SWQA 1OF0A 3ZDXE 4OGYH 3TZVD 5IK3B 1ASQA 3LXBA 4R97B 2VOTA 3QARA 5EBLB 3WHXB 5I16B 3UO8B 1ADQA 5C07B 3BUYB 1RAMA 3KYNB 3K5SA 1AIFB 1INQB 3R0NA 2KERA 1WDAA 4LKCA 2IWKA 1ZK5A 2Q2LA 4NC2B 1ZLVH 1J05A 5GRUH 3U2IA 4PV9A 1Y6KR 1XZ0A 5ANHA 2E7LA 5IOPB 1VADB 1E4WL 1TJMA 3EYOB 5L8KB 3O3DA 3Q1SL 3UAEA 2DJMA 3CCHA 3RUGA 2DQEL 1HXMB 1P5UC 1BQ5A 1SN2A 5KVMC 2M26A 5I16A 3C6LD 3ZYZA 2DM4A 1TQSA 1KEMH 5D7JC 1NICA 2BP8B 1UXWB 4LFHG 3W39B 4B50A 1J1PH 1OF2B 5T5FA 4X7CC 1N68A 3TO2A 3TCXA 3PFUA 1IBGH 2J6EL 2K70A 3OSKA 3UJJH 1U8PB 2GJ6E 2EH7L 1G87A 1XSJA 4WI2A 4TUUA 1HINL 3RZWA 3JWOL 2OKMA 4AEFA 1J0IA 1MCDA 3QDMA 3ZUNC 5JQ6L 2XA8L 3NABL 2NNCA 4KFMA 5ICZB 4EI5B 5IMOB 4OD3L 2YBRA 4NO0A 4TOYH 3OSVA 3H0TA 3WTWA 5CKAA 1THAA 1G6RL 4QRPE 2VLKB 3P73B 2R39A 3ZHFA 2ZG2A 4DZ8A 1EIBA 5FOBA 4IKLA 2GSIB 1MN4A 2BC4B 1OTUD 2DKMA 3BWAB 3EYSL 3FU0A 4N28A 4PJ5B 4WI0A 4BZ1A 5TQ0L 3KG5A 4GIAA 4PJXF 1BM3L 5KTEH 1NAKL 1CDBA 4HV8B 4F1ZA 1MIML 3E2HB 1KXTA 3VFGL 4OI8A 3G6DH 1I7RB 1LO5B 1E8XA 1JIBA 5HDWA 4XCCL 3MNDA 5SWSA 1CFQB 5BMFL 1WITA 2XHNA 5AEAA 4EI5A 1W0VA 5FPIA 4N86A 4EE2A 1MFDH 2CKBH 4D2NA 3N04A 4TUOA 1JPEA 1CLZL 5DQ9B 2ARWA 4DZ8B 2LW3A 1LEGA 1DQDL 2XN9A 2I26N 4NCC2 5AG8A 4PJ5A 2NT1A 3QUZC 2Z8SA 4XWOC 3AGVA 1ZT7B 4WNQA 3PG2A 4OB5H 1KB3A 4X6CE 3H2WA 3HRZB 3JVGC 1KXTB 3I6SA 3R1GL 3S88L 1M7IB 3GJFA 4NO5A 4P2QA 2PF6A 1CFQA 2EDHA 1KF9B 1AXIB 4Z7NE 4QRRB 5FM8A 3WHE1 1XGYH 2CPCA 2CJSA 3T04D 2A77H 2NCMA 5E9DB 2VXUH 5E5UB 2Z4QB 2FBRA 5FLUA 5BV7L 2HLFC 1CT8B 3QWRD 2WYZA 1LGVA 3WXWL 4Z8FH 1V7NL 3QUMA 5KSVA 5C9JA 4BDVA 1GCYA 1J8HA 3KLAA 4DVBA 1OGAB 4MYPA 3LAFA 4MJHA 1A6VL 1PGRB 4PCYA 4ES8A 1NBYA 4P2QB 4BZ1H 2FH8A 2AANA 1H5BB 3L4ZA 1BZEA 3O2WH 4F7KA 2B9AA 4XP9H 1F3DJ 1I1AA 2P80D 4OGXL 3Q3GB 4ODHH 2A73A 1TZHB 1AKPA 1K9TA 4WKXA 3FQXA 1TENA 2FZ3B 3OMIB 5DK0B 1Y7VA 2NXYD 1OD7A 3IYLW 2XWJB 1YRKA 2E4TA 3MRPA 3ZE2F 5FV1L 1W0WA 1XGRA 3NQIA 4EIZC 4PJCB 1BLIA 4XNAA 4L29A 5D71L 3WY3A 5AB1A 3CK0L 2ADIB 5AYTA 1EUTA 1GR7A 4WWKC 1XCQA 2WQXA 5ISZD 1S78C 3IFNL 3KAAA 1P1VA 2EDYA 1YYML 5DWUH 5CWSB 2XTJC 3W9DA 2VSCA 5JNYA 3GUFA 5KYXA 2ICCA 4KKBC 4M8RA 2CBTA 2WPGA 1R4XA 1HILA 5KYUB 4N0FA 5EU6A 2V5RA 4NQCD 1G1YA 1CICB 4L29B 5B4MD 3SDYH 5A3ID 3QHTC 5K9JL 4OM1H 5C2UB 2WY3B 5PAZA 2NY6B 1E9OB 1U6AL 2NW3B 5EORL 3KPNA 4AKQA 1CGYA 1JDDA 2F8IA 5AW2B 4QRQA 3GHEH 5CILH 3TCTA 2C3XA 3D0VA 4KJWD 4M5YL 5L4IA 2BY1A 4QGYA 4FXTA 5FO9A 3B9KC 4NN5C 5HHPB 2VXSH 3FU9A 1AI1L 4YDLC 1QEXA 2P8PB 1MREL 1OTSD 2LE9A 1A7OL 5BPPA 3SDCA 3MRQA 1HT6A 2PYED 3A3YB 1J1OL 4DK5A 3MRNB 3FQRA 4J23A 1TXKA 5J6HB 1YMHB 4JG0H 4UBDD 1RK1B 3BHBA 1E9OA 1DFBH 1PX4A 2CR6A 1QSED 2G2RB 4HEMA 1COBA 5F89B 3RURA 2JQAA 3DURB 1ZRUA 2EE9A 1CU4H 1N64H 4JFFD 3GK8H 1OY3B 3MLZL 3IK2A 1KXVA 3OKNA 4P4RB 4GO6B 3ZT5A 1ZE3C 1WF5A 3QXTA 1IU1A 1T0PB 1ZOXA 3NSYA 2WBKA 5CZXC 5IIEA 5BUPA 4E5XB 2AQTA 3U36A 5CIPB 4ORGB 1RK1A 3BHBB 4M5TA 4BXVA 3PV6A 4RNRB 4N5EC 4H88L 4OLXH 5HGBA 3TN0A 3PDOB 3F12A 3T0EA 4LGSB 2AITA 3OKNB 5E9DE 1D5IH 1JNNL 3S34H 4ZG1A 4YHYC 5KVDE 1PJ9A 2IAMD 3QAZB 2RQ8A 2FO4A 5CZRA 3ARYA 3OC8A 2NR6A 3VFMA 3CVIH 4OFYA 1RIHL 3CH1B 1P7QD 2WXRA 4LCWD 5JORA 2WTRB 2F6AA 4N24A 3O6LL 3O3EA 2BX5A 4GUCA 3BCFA 4KJPC 2P3YA 3DJZA 3QZLA 3D0AA 1FL6A 4AK2A 4WI8A 1E65A 4K9EC 4YFDB 2XA8H 3NABH 2AZAA 3ME0A 1G0XA 4KX8A 4XCYA 1D6EA 4K7PL 2NY1D 4PRPB 4KRNA 2VYRE 1E67A 1G6RH 4G80B 1CGSL 3DA0A 3QQ9C 3PP4L 1C5BH 3WFBH 4P5KA 1TQBB 4B9CA 3KYAA 1SUHA 2DQDH 1Q9WA 2WTRA 4HJUA 1EAJA 1OTSC 1NAKH 1WFMA 3GKWL 2P5WD 5JXEC 4ZQTA 3DYPA 5DEJA 4N90D 2X4SB 4YNYB 3VGAC 2HX7A 4PJ5E 4AYGA 2AW2A 3C09B 4M8UA 4M6AA 1RY7B 3KCPA 4Z1PA 1OW0A 4HKJB 4P99A 2GK2A 1LEKB 1FNFA 4XN9A 3B7TA 4LLMB 3KWVA 4F2FA 3V10A 1WWWX 4KTYA 4UTBH 3ULVL 3V0FA 1JPSH 1ZV5A 3QCUL 4LCYB 5B8CA 3B9KB 5AQ0A 5EU5B 3VXUB 2Z93A 5C0NC 4CVUA 1NCAH 1O9VA 3KLDA 4FFYA 4NDMA 1XR8B 5FCUL 4WWNA 3O8XD 6FABH 4I89A 4FG4A 4XXDA 3RVVD 1G7LB 3MRGB 5ACZA 1KFAL 2X4SA 4Y5XA 4YNYA 1I7UB 3O11B 1NMAL 1DDTA 5T1MA 5IWLA 4YOKA 3CFKB 4JPSA 5FYLE 3ZDYB 1AS8A 4TRPH 2UYLB 5I6NA 3WV0A 2ADGB 1FNEB 4HWUA 2XTJB 3FQNA 5F7HA 4OUUB 4WJ5A 2HKFH 1NFIA 4RGMC 5FGCB 1PLAA 4UZUA 1J87A 1H3PH 3RWCA 4OKVB 5FUOH 3X3GL 1KV7A 4JAMB 1KGXA 3MCG1 5T3XL 8CGTA 4GIOA 4LOUC 3G6JB 4UAHA 3RBSA 4JDZB 4LQFL 4RCAA 3FT3A 4P2OC 4UMGA 4HMDA 4KPHH 4PTTA 4LAQH 3L17A 1RZKH 1A0QL 4XAWH 4Y4HC 4OCXL 3LH2L 2Q5BA 2VTFA 2YAQA 3FQWB 3ARQA 1DBMH 4O5LL 3VI4A 2AQPA 2IAMA 4DGYH 5KZCD 2QHRH 3R06A 2E7DA 4GAGH 1SVBA 1ZLDA 3B9VA 1H3VA 2OX5A 1NDTA 3DTDA 4JG5A 3VXOB 4UM9B 1G84A 4HHWA 3H8NA 3VWKD 1K4CB 3H9YA 1SEQL 3ZL2A 3PQYD 4ZO8A 3DX2A 3VTMA 3F6LA 2YRLA 3RIFF 1EX0A 2LAAA 4PTTB 5GZOD 4L18A 1AR1C 2KPNA 3CXFA 4X4MA 1SXAA 4XMVA 1XD1A 4KFZC 4E9TA 4M1GH 4HXBH 3GSXB 4QRPB 5IQLA 3KR3L 1ZHKB 4CVZB 1KXQA 5C08E 5G55A 4R7DA 3NJLA 1WAAA 5GGSA 4E41D 3WTVA 1A6TA 2A83A 2VXQA 1RK7A 4PRAA 3TV3H 1ZHNB 3CZNA 5C0AE 3E6FA 2D7MA 4G7QB 5I1AA 2BXYA 2HH0L 3PWJB 1MW3A 2X44D 2HN7A 4I0PC 3QJRB 5LJYH 3C5JA 4WFFE 4FZEH 2Z8RA 5JW5B 1D5BA 5CJ8A 4NLHA 4JRXE 3SKUD 5E2WH 1JGVL 2F5AH 4HS3B 2BLFA 1FIEA 3WUWA 1IL1A 4X99A 4H5SA 1DVFC 3LS5H 4AV4A 5DMIH 4Q2ZB 1HHGA 2X6BA 4ZSOE 2IAND 2ATAA 3UPCA 4AMXA 1KCVL 2OFQA 2BW5A 4POZC 2QLVB 1MKFA 1U4EA 2LV4A 5HHOB 2X40A 3FTXA 3MNZB 4MMXA 5IQNA 4D0DA 3EJQA 3HS0C 4JQIA 1CL7H 5T1JA 4XAKD 3L7EA 4KAQL 4EI5C 3TASA 2OMVA 2OR7A 4L8SC 1MCOL 3Q5OA 5D5ME 3NACL 3P9LB 1VAHA 3V52H 1JD7A 2Y5EA 2F53D 4XZ4A 2YD3A 4S0HA 1KB5A 2ZWKA 4P2RE 4CSSA 5BV7H 2XRAH 4HDIA 5FYKL 5HY9A 2Q8BH 1W15A 1AYOA 2N59A 4KHTH 2WGXA 3UFIA 4GPVA 1KBGH 1KEGL 3MNZA 4MMXB 4UT9L 3TLRA 4D0DB 5IHWA 3NJIA 3PL6C 1DDHA 4CN1A 2OW6A 3PWUA 3THMH 1PTZA 1RIHH 3F65A 4RZCB 2AZUA 3IE9A 2WW8A 4BFKA 2IQAA 3I6KA 4NO3A 2I25N 4YBQD 3WTYA 2EIEA 1I9JL 1KELH 2ESVA 4L9LC 3UYPB 4HUVA 2G9HA 1WD8A 1HAWA 3NGBC 1IFRA 1NAML 4NUMA 3S37X 2C3VA 5CGTA 1OE2A 4XP5L 5GQBA 2PWFA 1E6JL 3FK3A 3NP4A 3KS0J 4BKLB 2IO5A 3MVSA 2ZPKH 3CPLB 5KYYA 5HDRA 1WHPA 2F7QA 3ZZLA 1QSFA 1TU2B 5DEZA 4RAVB 4UWQB 1LD9A 3T0BA 4RBPK 2N7AA 1HOCA 4HPYL 5BVJB 3L95A 3UO1H 3L81A 3NIFB 4J3OF 1E3ZA 3SE9L 1L0YA 4IRJA 4PLJC 2PO6A 4I9WD 1IC5H 3LKSA 3IWVA 2WKOA 5I9QB 2ICWA 2AEWA 4XODA 4OU3A 1I1RA 3M6DA 4P2OB 1RZPA 1TITA 4Z7VF 5JPNC 3GF8A 5JR1H 3NAAL 1TTCA 4MKMA 3E3QE 3QZMA 3FO1B 1IAIL 1Z3GL 4DETA 2Z8WC 4HISA 1JZHA 4RDBA 3VFVA 4QIRA 1PZDA 1AZUA 4FQHB 2R7EB 3WIHA 3ZYJA 2VDRB 3V6OA 3LB6C 4GMTH 3RIFK 4XXCA 5HHOD 3UZQB 3DECA 3KWWB 1NIDA 3MXWL 2FRGP 3ULUL 3TEZA 4DQAA 2WBJB 2YKKA 5CUSL 4EO5A 3IEAA 2W9DL 4UYQA 4DKTA 1CXHA 1E5ZA 1WWCA 2FEEL 1U8CB 2ZX9A 4K55A 4PGEA 1HINH 3D7PA 5HHMB 1Y0LB 3OZLA 2V3FA 1FG9C 3P0YH 1UWEL 4LPTA 4HK0A 4A04A 4M5ZL 4PHZA 3MNWB 3NOIA