1G1KA

Cohesin module from the cellulosome of clostridium cellulolyticum
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
143
structure length
143
Chain Sequence
b'ASLKVTVGTANGKPGDTVTVPVTFADVAKMKNVGTCNFYLGYDASLLEVVSVDAGPIVKNAAVNFSSSASNGTISFLFLDNTITDELITADGVFANIKFKLKSVTAKTTTPVTFKDGGAFGDGTMSKIASVTKTNGSVTIDPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SCAFFOLDING PROTEIN
publication title Crystal structure of a cohesin module from Clostridium cellulolyticum: implications for dockerin recognition.
pubmed doi rcsb
source organism Clostridium cellulolyticum
molecule tags Structural protein
total genus 32
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1g1kA00
1ZV9A 3BWZA 1OHZA 4FL4B 4IU2A 4U3SA 2O4EA 2OZNA 1TYJA 4DH2A 2W1NA 4UYPA 2XDHA 1AOHA 3L8QA 1ANUA 2CCLA 4N2OA 4WI0A 5LXVA 2Y3NA 2B59A 3FNKA 3KCPB 2JH2A 4UMSA 2BM3A 2VN5A 4FL4C 4IU3A 5K39A 4UYQA 3UL4A 2VO8A 1G1KA 3F2LA 3GHPA 5AOZA 5G5DA 4WKZB 2VN6A 3KCPA 1QZNA 2ZF9A
chains in the Genus database with same CATH superfamily
4WJ5B 1BM7A 1FV1B 4MDJA 4RFEB 2EDFA 5FK9B 5C0BB 4NUGL 4WTWA 1JXKA 3OHXB 4YC2B 2AEOA 2EDRA 2EYRB 2WWKT 2APVA 4R4ND 3VFWB 4WIQA 2NX5B 2NY1C 1EXGA 2R51A 3TVMB 3IYLW 1EZVY 3M45A 4F1ZA 4WO4D 1AQKH 4CVUA 2DMHA 3GDCA 5D2LB 2ARWA 5J9PB 4RWYH 2V9QA 1AGCB 4A39A 2H1PL 3BYYA 1FVCB 4P5MA 2B8OT 4L8CA 4XO4A 2A5UA 2W0LA 1TJMA 5FUOH 3HUJF 2NY6B 4EXPX 2D2CC 2AEWA 1I3GL 4JKPL 5EWIL 2ZWYA 1YAZA 4LFHG 3UTZB 2YPLA 1RJZA 2ZYSA 4LPTA 4Z8FH 1Z9OA 3OMAB 3X1NA 3EDKA 4U0RB 1S7VA 1U3ZA 2YZ1A 1ZDQA 4NLHA 1TLKA 3GSXB 3ZZSA 5IQMA 1F02I 3E3QE 2GEEA 3WKML 3WO4B 2LR4A 4CVZB 1FFPB 2DD8H 4LP8A 4O2FB 1EH9A 3VE0B 3VM5A 4BWWA 2VXUL 4XVSH 2HLFC 4HKJA 1LD9B 2J88H 1KCUH 1T80A 5F93C 1RIUH 4ONHB 5DYFA 3ARQA 1TVDA 5MHSE 5GXBB 4B7LA 4UT7L 1ACXA 1OAXH 1SYSB 4M5ZH 1T83C 3QFJB 4NI6A 3UAAA 3QEGL 5HDBB 3ZZLA 5IMLB 5CJOL 2GSIB 4NPYA 1PDKA 2JKLA 3CAFA 5D7HA 2PLTA 5TE6L 5K69A 4H40A 1YSOA 3MA9H 4M00A 4TRPH 4N0UB 2J8UA 2YWZA 1E4XL 4FJ6A 4PJ8B 5C0GB 4FQ2H 3BAEL 2BJMH 3QUYD 3D51A 3NJGA 1QPXA 3Q7JA 4AT6B 1Q0XL 1OGAE 1DDHB 2XICA 1VKXB 1W8NA 3NBNA 4X6EB 1DVSA 3GGWB 1G9EA 4XC3H 3IJSA 5IBLD 3S2CA 1NEUA 5I5RA 3ECWA 5J11C 4JFHD 1T7XA 4JZOA 2A9CA 3DJTA 3VI4A 1TJHL 5FM5M 5E2TL 3RVVD 3HS9A 4WF7A 2DTML 2R2BA 4LKCA 2UZIL 1S7SB 3D3VA 1D5MA 4YVUA 3FQRA 1OM3H 3T1FA 3BPCA 3LHPH 3STLB 2JKWA 3GEFA 1A25A 1HU8A 5H4YA 4JHWH 3QJHB 4ODSL 3VGDA 5H37A 3LS4H 1MF2L 4E2OA 1EHLH 1ZA3B 1TQBB 2QPEB 3FSOA 5FWRA 5TGBA 3FQ2A 2MOGA 4HIIA 4MHHI 4AEHL 3V5KA 1X5MA 4HOMA 2XZZA 2MPAL 5A3IC 4P0DA 3U48A 2AHIA 4I77H 1MFBH 2Q2LA 1X5ZA 3VWJD 4LIQL 3LAFA 4ES9A 3KDMB 5JHAA 1A21A 1CG9B 5K5YA 4S1DC 5IW6A 5J6HA 5I5IA 5GHWL 4NFCA 5CCKL 4NQEB 2P52A 3L1FA 1IM3B 3I6LD 2BHFA 5ESVB 1G5AA 1NEZA 1P7HL 4E9QA 4PJAE 4F92B 4DW2L 3M46A 4M1CD 2EYTA 2XT1B 3KH4A 4N9OB 1A1OA 1OHZA 1BD2B 1ZT4B 4QNPF 5CEYA 1XGPA 3L4CA 5GS0D 1VZGA 2AEIT 5BRZE 3LV3B 3D85B 3DNKA 2P1YA 3U1PA 5E94B 5AVQB 3U1QA 2UVFA 4G6KH 3TONA 4Y4HD 1NC2D 5EOCL 3FBQA 3CHSA 1NDMA 4L8SB 4TQ8A 4YHIA 3VRJA 5BMFL 1EEUA 2DAVA 1OE2A 1LO4L 3QULA 1Z6JT 2CRYA 2A6JA 2IC2A 3GBNH 1LQBC 1HT6A 3O3AB 3WAKA 2BSRA 2WN2A 1IQWL 4M7KL 2IQAB 3CX5J 1M71B 3I6GA 2ZQKA 4B50A 4DH2A 3K6SA 4LLYA 4UYPA 3DX6A 2FH6A 1JTTA 4ODWA 5JIKA 1RHHB 1JGDB 3H3BC 5CCGE 4NQVB 1A7RL 2SODB 3C6EA 2X7LB 2KHAA 1BM3L 1JL8A 3GXUB 4DOHB 2P5WB 2J72A 5CGYC 4F20A 5FUCC 1HHKA 1CICB 1IGIL 4G2AA 4JFFD 1E3FA 1B0GB 2CDFA 1WFTA 3MV8D 4Z7WA 3OKNB 5I6KA 5KJRH 1KCRH 4ZMYA 4MJ5A 5HGHA 1JZ4A 3MUUA 2FD6L 5D7IA 2R9HD 2X70A 3MXWL 4R4BA 4YHOL 5E6IB 3VXTB 1FN4A 4YBQD 5HHQA 4HIPA 4JDTL 3Q9QA 3CLEH 4I0PD 5D4JA 5T5NF 3UZEA 1I8AA 3QCVH 2A9NH 4QGYA 3MJ7A 2J5WA 1J0HA 1QRND 3UZEC 1HXMA 4NN6C 1XIWA 1K8DB 2EP6A 1U6AH 4JO3H 1I7TB 1JNNL 3RUGE 3LQZA 1XIWC 2P3YA 4J3OH 3MGOB 5FFLA 3ZYJA 2EUVA 3QZBA 3QZWA 2NLJB 4WFFD 4BBWA 1UGKA 1HOCA 2Y72A 2H2SC 4N3TA 4EN2A 4DVRH 5J3HC 12E8L 4YBLB 1XEDA 2G5BB 5TF1H 5KVEH 2ZXQA 5B3JE 4ZQKA 4UM9D 5HGDB 5D4HA 5JPNA 4OLVL 1Z3GH 1ZANL 4K3DL 2Z1KA 5KSBA 1JMZA 1P4UA 5JPNC 4MGXA 3ZKSD 1MUJB 3HAEA 4R5VA 1OSPL 1EXUB 3WJMA 1REIA 1A7BA 1YUHA 4DPCX 1HQRB 3KPRA 1OHQA 3GSVB 3X17A 2NW2A 1SDDB 2FE0A 3WELA 1K6QH 3SGDI 4WFHD 2APWA 2DI9A 3UACA 3TEYA 3VI3A 4TUJB 1RLBA 5FGCB 4D0BA 1IBBA 4NDMB 3N42B 4M8QA 4NGHH 3F62A 4H1LB 1CI5A 2GHWB 4TPRL 3ZE2F 1TNNA 1OCCB 2DV6A 1EUUA 2FWOB 3CSGA 2EUXA 1CZ8H 4GMTH 1AOZA 1DLFH 4I9WE 3NJNA 4ZMVA 2VXTL 1O7DC 3F7RA 4NWTL 4BM7A 5FYJE 5JOEA 4MQ7B 4DGIL 3VFUA 3HC3L 1YAIA 2ATPB 4JR9H 1YCSA 3AMLA 1AXSA 4RZCA 3PHQA 3BEWA 2VDML 1DQMH 2YRPA 3FN0L 1GCYA 2XWCA 3HVDA 2EKSB 4HK3J 4R96A 4YNYA 3KBEA 4UOQA 4Z77B 4BEIA 2YLKA 1I1FB 3FQ1A 3FRUB 3HE6B 4PYHA 4U4IA 1MAMH 1E6JL 4C83A 4KVCL 5D4QA 3D9AL 4AWJC 5ADOL 2X40A 4XX5A 5E9DB 4JGNA 5IVXF 1KG0B 4RMVA 1R4XA 1RXLA 1ZV2A 3D4YA 3IS1X 1AP2A 4ZMLA 1V27A 3U25A 3IK2A 2XWBB 3I2CL 4GG6B 5GGUB 3CXHJ 3L9RB 2VLJA 1JOIA 4QRFA 1HYSC 1XR9A 1Z0NA 2RACA 2IF7A 3PGDA 2BLFA 3LQAL 1CD0A 1NFDB 4PJFB 1WC7A 5DC9B 3JWDH 2CPUA 2AQQA 2IXQB 4MJHA 1RZGB 1SRDA 2PKDA 3PHAA 4KQ3L 3CDGA 4NBXB 4QY8B 4PIBA 2R1XA 5E08L 3BVNB 3FRPA 1MJ8H 1JUFA 4JQVA 3FOLB 1Z1WA 3UL4A 3H2WA 2W59A 4JQVC 1E27A 3BQUB 4TUKL 3S88L 1YG9A 1O6VA 3E1F1 3P4NB 2YN3A 1MCQA 1WHOA 3B6SA 3V5DB 4EJ1C 2C9UA 3AS1A 1NC4A 3FTUA 4YZWA 3EW3B 4MLIA 3GZPA 2CCWA 3NSFA 1DBKH 2V2WB 4IU2A 2ZICA 1NGZB 2O1AA 2VOTA 1Y0LB 3JT2A 3H7BA 2EDYA 1KB9J 2Y5EA 3BVUA 2PXYB 5HYJE 1DQKA 2A77L 4QXGH 1JSYA 2BMKA 43C9A 3LRSB 5MENE 1IRAY 2ATKA 4Q6KA 4Y1AD 3TT1L 4DQAA 5CD3B 1S7WB 3QIBB 4KI5F 3BYTA 1OP4A 2E6QA 5I0XA 5I6MA 1BVLA 2Z31B 3N1GC 1BF2A 2N7SA 4PGCA 3BH4A 3QWQB 4K0OA 1CYWA 2ZSVA 4ZBJA 1GGIH 1TQCB 4K07A 1JP5A 3GUTA 2DWEA 3TN0B 1PNDA 1N3NB 4Q4EA 3OV6A 4KXDA 1C5BL 3NOIA 4FG6D 4PJ9A 3RB7A 3MGTB 5C86A 3CN2A 1GGBH 3DYMA 2XXGA 3ZZQA 1KTBA 4RIRB 4PJ9C 4D0CA 2Z8WC 1SBSH 3CHRA 25C8H 3Q8AA 4NIYE 1YYLH 3IMRA 4IRJD 3BSZH 1JGEA 2DL9A 4E68A 3CV5A 2EICA 4Z7VB 2WO3B 3DV6A 1K4CB 1LWJA 3VNYA 4HS3B 2L7EA 1WTGT 4E42A 3BH8A 2I60H 2DWSA 4L4VE 4DKFL 2VSCA 4BH7B 4WFED 2CA4A 5KBPA 2A9DA 1UASA 2Q86A 4OJDH 4GQPH 2RBLA 1C5CH 2IOOA 3P3TA 3QAQA 3PWVA 4ODUA 5EOCJ 3JTTA 3RIFF 2FX9L 4F7EB 1MIEL 3AT0A 5LNGA 1HCFX 5D2LE 1NOAA 1U36A 4CA4A 5DJCB 5J1AA 3CWGA 3N06B 2YFNA 1Z9MA 5A2CA 1RZ7H 2DH3A 4K5NA 4GAAA 2DH2A 2NY5H 3SKMB 1OO2A 4XGZA 5BZDB 1EAPB 4XVJL 2DQFB 4N1HB 4YQXH 4GRWH 1JI1A 5DRWB 4GEIA 1MFVA 3E80A 3T08A 2WSDA 1X44A 3C5XA 3LEVH 2BP0A 2A38A 2G60L 2G3NA 3BWUF 2AK4A 3R06A 4X5WB 4LSUL 2XNAA 4FQXD 3T4YA 3N91A 1OZTG 3UTPD 4UNVA 5ID1B 2EC9T 1J5IA 2K3TA 4F58H 4PJDE 1T03L 3DHPA 4OFVA 3WFEH 5E8PB 4KY1L 2V2XA 2XTJB 5ALCH 3OLIA 4MCNA 2AQ3A 2WCGA 3BKYL 3BP6A 4HUUA 2VC2B 4JHAL 2E76C 3QFJE 3RGBA 3TBVB 3D05A 4HIQA 1A7PL 4DEUA 5E1AA 4AW4A 1UGNA 2PWHA 5C09B 4N85A 3L95B 1MWAB 3CFDB 4N0UE 2B3RA 3DC0A 3QNYA 5BQ7B 5ADPH 2F53A 3LKSA 4YFLI 1BZ9A 5ITBL 1Q9KA 5KAQG 1CL7L 4DVBA 5D5MA 1D6VL 2XN9D 2O6EA 3RPIB 1AQ8A 4WEEA 3ZY7A 1RD6A 1RH8A 3MX0B 1CMOA 4TNEA 4OQTA 3OKKB 5HYSG 4ENEC 4U3SA 3F7LA 3T2LA 2QHRH 2QT6A 4ZSOE 1KACB 3TC9A 3KAAA 2WKLA 4QRRE 1LE9B 3U7YL 3IB4A 4RVBA 1AO7D 3VU1A 4GQQA 1XVSA 2APTA 3MKKA 3SQOL 1HIML 2BO0A 4P46A 1I3RB 2G2PA 3I6SA 5D55A 2ZE0A 3EYQD 4P46C 4XMKL 3HMXH 4CGTA 3DUHA 2IAMC 4WO4B 2EAEA 4ZX5A 3RWCB 3REWB 2E9BA 2PCFB 3PUUA 1N2RB 1MHEB 4M5TA 5CJQL 2CR0A 4RISL 3OPZL 2YUZA 3MGAA 3NAAH 5FV1L 5FW6A 2WBKA 1FCCA 2VDPB 5JLZA 5FM4A 4NRXB 1R3LB 3QXTA 2EXWD 2VC2H 4NO5B 3TX4A 1OIOA 3RWJB 4X7EC 2V8LA 5C0JA 2XZCL 2VRQA 1LGVA 5ILTH 3FQUB 4FQJL 2EO7A 3P1VA 1NUFA 5EU4A 3CMGA 4AUJA 3R8QA 4CMMA 2KS0A 4JCMA 5ITFA 4QIRA 3K0YA 1MWAH 3MJWA 2O6DA 4LOEA 3PUCA 4NENA 2D9QB 2VLLB 5FS5A 1B4JL 2W9EH 3EUDA 4PY8J 3ZYZA 4JDZA 5C0EB 1OAZL 2R0WL 1CE1H 2WQ8A 1JK8A 3OKOA 5D6DA 1RCYA 3WG7B 5DUPH 3RL2B 1OSEA 3PIQA 4X6BB 1VERA 5D6DC 5HDBF 2CIIA 2D7PA 1NINA 3T0BA 3W39A 2ADFH 1A6AA 1N4XL 5F6HI 2ZX7A 2ZUWA 3UO1L 3HZMB 5DS2A 4XWOD 3ZW3A 5EDSA 1YNLH 4G6ML 2LU3A 3B7SA 3QUYB 5CN2A 4GUPA 1G43A 4MX7A 1LO3H 3ET9F 5IHZB 1OAJA 2CHXA 2EIMB 1M7UA 1OEZW 5BOPA 2X2JA 3B3IB 3H4HA 2Z35A 5M94B 3WIFA 4I3SH 5TDOA 4IK6A 4R7LA 1C7SA 3FXIC 4H4NA 4QT5A 1AZZC 4G5AA 1ONQA 1RPQA 5I19L 1R34A 1V54B 4L3AA 4DOHE 2P5WE 3AQDA 4X6DF 5ERWA 1KWGA 5SV4A 1LJMA 3CE1A 3UEQA 3OKYA 3FCTA 5GGRB 3U6XS 1OV8A 1P5UB 4C58B 1FIGH 1DJSA 2YC1B 1ZV9A 3IFLL 3MUGB 5B3SB 1TZHA 3ZHDA 1OK0A 5D96B 1IE4A 5B8CA 1NL0H 1KB5B 3FB8B 4WUUA 5B8CC 1ITBB 2WQXA 2WP3T 2PP9A 3DX9B 4NC1C 3A6OA 4M6AA 1KYDA 3M1CA 5DGQA 1S8DB 4MTMA 3LXBA 3L5WA 4R0LB 2KT6A 3VWJB 4EQ2A 3FB6A 3IDXL 5HSFA 3K2UH 1E4XI 5DJXA 4LRNL 4EOWL 3ZKMC 1Y6KR 3MLVL 4NFDA 3O8XD 2P44B 3GRBA 4KJWC 2YUXA 4W68A 5B4MC 2W0KA 3FCSB 3SKUD 1ETB1 1NLDH 1T2JA 3DRTA 2FJSA 2R0LL 3F00A 4HS6A 3D25B 4C4KO 3JV4A 3L9EA 2G2RB 4JG1L 1WDAA 2N0KA 5GISL 5I1KL 1TNMA 2JXMA 4F15B 5E2WH 3OR6A 2OMYB 3OC5A 4OLZL 2NY0C 4J3OF 1E28A 4U1GB 2UZYB 3ROOB 3WI9A 3WIHL 4HULB 4Y4HB 1NC2B 2BNUA 4HUWA 4B95C 4BKLB 4ZFOL 1FYTD 2ED6A 3HI6H 1O7VA 4BV1A 1JPFB 3V4PL 1MREH 6PAZA 3NJJA 4A2GA 3FB7A 4MJ6A 1VEMA 4FFYL 4HLZG 1YEJL 4YFEA 4XPTL 3DVGB 4PG9A 5HJ3B 1CFTB 3CNKA 4DGYH 5I0WA 2F54D 2O5XL 1FL5A 5E8DH 1AKPA 5IR1B 1ES0B 1KN4L 2EZ0C 5FO9A 1LE5B 3TPUA 1KB5H 4P57B 2GJ6D 3DOSB 3LPOA 1X5FA 1A6ZB 2AAVA 4ZFQA 5CJBA 2EYSA 5CZVH 1CGWA 2Y07L 5AOMA 2NNCA 5CJ5A 2HMID 1A1MB 3UCRA 5HBBA 4P2QA 4JFFB 2DQJH 4KDVA 4EPSA 3TURA 1WZ1L 3NIGB 2A9BA 4X6CA 2A0LC 3C9NB 3MV8B 3JWNC 4WU5A 3PV6A 5I6NA 3ILPB 3U7WL 1XBRA 3QBTB 5CGTA 4JRYD 4G8FA 3BVWA 3VVWA 1AZRA 3CIAA 3BKML 1G7HA 2R29A 1W72A 5DFVD 4I0PB 2N1TE 4OTXH 1F6AA 2BDNH 3TXAA 1QWUA 4QTIH 5T33L 3E0GA 1QD0A 3QDGB 5TQ2L 3T3PE 4BK8A 4XP1H 4K3GA 4WW1B 1FQ9C 4XPHH 3S3PA 4WCYH 4PJFE 4LNVA 1JHLL 1QNZH 4FTVE 1BFVL 3HB3D 2EE2A 3C8KA 4ZPTA 4HIXL 1XH1A 3MNWB 1I9JH 4P2RA 2PP8A 3UJTH 5F7EL 1CFQB 2OI9B 1W6WA 1LO2L 5C71A 3GYRA 3KCPB 2A6KB 2WO2B 1QPPA 3E8VA 3IJEB 2JB5L 5KJ4A 1TZAA 4PCSA 2D7OA 4KFZC 3RJQB 4M62L 2AJYH 3ZDXB 2QGDA 1MEXH 1KTKE 3EGSB 4OD3L 4DTGH 1PQZB 2Q3ZA 2R23B 3SPHA 3VRIB 3X3FH 5D93C 5GGSY 2F5BH 3M7OA 4JY4A 4O9HH 1IQDB 1KCSH 5INDA 3M8OH 4RNRA 4FG0A 5DD5L 3BP5B 5FB8A 5H94A 4V1DB 3OF6D 3IEAA 2YD3A 3V9CA 1CWVA 4GLRH 1YEKH 1X9LA 4K9EL 5D4IA 3FUFA 3T0XA 4WY7L 2ZUVA 5GRVL 2AGJH 4LVOC 4E0RB 5KBKA 1DJIA 2ZOTA 1OP3H 3S5LG 1CIUA 1G7MB 2X2UA 4NKMB 1KTJA 3V5HB 1J1OL 3KXFD 1KFAL 5H2BA 2EVGA 1A0QL 3LRHA 1CFNA 4P2CG 4ANUA 3BUDA 1NZRA 5C2BH 2XA3A 4JJOA 1HH6A 4UAHA 1XF4B 4LARH 5F7YC 1K5NB 2D7MA 1QR1B 5E6SB 2Y3NA 4P2YA 4JAMA 4JN1L 3KGSA 2JNZA 4XMVA 4HSCX 3LRLA 3L7FB 4F33A 1CU4L 2DJ4A 4AG4L 2BCKB 3O4LD 4XP6L 5G5DA 2W0FB 4G1MA 3TNMA 4GJTB 2HLEB 5KW9L 4FFZH 2PO6A 3PNRB 5L2KA 2OJ1A 5HJGA 2PO6C 2CBPA 1HNYA 4Q9QH 3RQ3A 4IBWA 4HUKB 2J12B 5HY9A 1AD0B 5H8DA 1WBXB 5IB4A 1I7ZB 4B9YA 4NRZA 5I6LA 2Y36H 5DSCA 5EHFA 5FHBL 3UTSA 1MVYA 4JDVB 4S1QL 5F0JB 4DP8X 1NAMA 1GY2A 3UBXA 5CP7B 1UWEL 3UZQB 5DVNA 5CEXA 5EV7A 2P9RA 2X6UA 4PWGA 3C12A 4IHOB 5BVJA 2Y7SA 1FAIH 3S96A 3P30L 2QQLL 4JPWH 4XVUC 4OF8A 1RMFL 3SPGA 3ARDC 4Z7AA 3JZYA 4ISVA 3KPPB 2HKHL 3FCGA 1XGUB 2AJVL 4XNZB 4HYTB 3T0AA 1INDL 4PN6A 2L7UA 4BFRA 4GEJA 3ZE1F 2YQGA 3P0YL 4DK5A 4CUCA 5F6IC 4FHJA 3HG4A 1VFMA 3US1A 3DX3A 5FA3A 4AM0A 1VJSA 1LP9B 1ZOXA 2WXMA 4WENB 1BQHG 2R1YA 4K73A 5ICZA 3IJHB 5DYOA 2DJUA 5DUBA 2WZAA 4HWBH 1YY8B 3RY4A 1LEIB 4GRWF 4OBSA 5K33A 5ACLA 3ZQWA 2K6WA 1IAOA 4Y1AB 5LGJA 3OJ2C 7PCYA 2FQDA 1MAJA 2BOBA 3TCLB 4U6HA 2NY2C 4PRPD 3WGVB 3QQDB 3VFTA 1QLEL 2O6CA 4ZS7H 3SKJL 1FAKT 4G7QB 4GXVH 3VSTA 3PWPA 3IDMA 4OF0A 1UB5B 4WGVB 2G5UA 5L7XL 5IHWA 3MOAL 4LT7A 1UHVA 2NY1D 3MLXH 4NAJA 2IDFA 1TPXC 3QVAA 2CGZA 2A83A 1IM9A 4Z7VF 5DZNA 4HUCA 4IRJB 3QUMH 1BZ8A 3C09C 4Y0GA 5JPMA 4JG0L 4JRWA 5IT2L 5AVVB 1TTAA 1DL7L 4QXTB 2OZ4A 2D7TL 35C8H 3BVXA 4MMYB 4QHNA 1FZJB 3L3HA 4PBDA 4ZFZB 5JPMC 1AFVL 1CYGA 1PCSA 4LHQB 4KXZH 3V6ZB 4MRBA 2X1WL 4DNLA 2OMUB 1OP3K 1F2XK 4AQ8A 4BHUA 5KS9A 3SKOB 2O72A 2YPLD 4PRIA 1YPZB 3GD1C 3ZU8A 1JNLL 4MS6A 1BVNP 3L54A 3Q5OA 4AQ8C 4CU7A 2APXA 1QABA 3CCHB 3RGVA 1SVCP 1QO3B 4GINA 1KYAA 2H1PH 2X9ZA 3KWWB 4RMQA 2HLFD 1EO5A 4S1SH 3TBWA 1EDQA 5CILH 1UVQB 2BPBA 1WBZB 1I3GH 3JWOH 4Y8DC 32C2B 5E5LA 4FI6A 1U8QA 2Y3AA 3GM0A 4A2FA 3SE8H 1DEEB 4HK0A 4QLRA 1ED3B 2OL3B 3LKQA 3CFNA 1JIBA 4N8CH 3WFBH 3CSPA 5I15L 3D18A 3L6FA 4X4XB 4JPSA 1UH4A 4BE5A 1G7IB 2YUWA 2YA1A 4MKTA 4PJBA 5FX3A 4R5XA 4QUOA 2PW1B 1DE4B 2SEBA 3SYCA 1GJWA 1NBCA 4XH2B 2N7BA 5EBLB 1TQUA 2GBVA 2HVKA 2MH4A 3CLFL 4PB0L 4EMZA 1C9SA 4UT7H 1JGVH 4U1MB 3L3DB 1JVOA 3A4AA 2QDWA 3IDJB 3Q2NA 2H8PA 4ZYKB 4AW7A 1SMOA 2X4SB 3ESOA 5C0CA 3K80A 5TE6H 3DX7A 1SZNA 3H42L 4MJIA 4P4RA 1RJCA 3W5NA 2IVFC 1P4IL 2PYFA 4FNLL 5F89B 1E4XH 1UTDA 3HHSA 3BAEH 2VTFA 1YO4A 3LN4A 2GJJA 3PWLB 5LCVA 2XQBL 3D3VD 4BZ1H 1Q0XH 3KPNB 1F97A 1QAWA 2IGFL 2MCG1 4PRNB 2Z91A 2BVYA 1WFUA 3I9GH 4BH8A 4KH9A 1JDAA 1IAKA 4L9LA 4OVUA 5E4EB 1CC3A 4RMRA 2PPEA 2Y1ZA 1I75A 3T0VA 4LCWA 4NERA 5E2TH 4BFBD 3S3CB 1LEKB 2K4AA 1W15A 4JFHE 4MJJA 5A3ID 4KGJA 4YLQT 4F2MA 1N59B 2MCAA 1KGYE 4HPYL 5I1LA 2EADA 3IDNB 5TTRA 4S1DD 4ODSH 2G4GA 4PJ7E 3DURA 4GB9A 3ZO0A 4KKBC 1MF2H 1PU0A 2OL3H 3U83A 2X3BA 3HCVB 2GJPA 1KT2B 4I0KA 1X5LA 1E43A 3QJRB 4LE8A 3KYKL 4MWFB 2VDNB 2MPAH 4P5KB 2QJDA 2CM6A 5LQBL 1XDTT 4OF5A 5BW7C 3HZYA 5DGRA 4ZW8A 1E2ZA 1CLCA 3A4DA 5E5MB 5L0QB 2BP3A 2OJEB 1BOGA 3BFWA 1PFCA 4LIQH 2OSLB 3QQNA 3ZPDA 3NRQA 3MLRL 1FNSH 4GMSL 4HJJH 3E38A 4LCIL 3VCLB 1WAEA 4LPXA 4NBZB 4NO2A 1MCWM 3P11L 4J8RB 4D9LL 1LMIA 2BZ7A 3AACA 4MZIA 5CIPH 4UNIA 4RGMB 4K71B 4GW5B 4DW2H 1CL7I 2EKJA 2GBUA 4HJGB 1JZEA 4MMXB 3IRCA 1OTTC 3LKOA 5F72S 3MMEB 1OP5H 2WXKA 2J1WA 4XP4L 2JB6B 3KL0A 4WFGD 4OKVB 1FC1A 3QJSB 5IMKB 5EZLA 4PS3A 2IMNA 3P9MB 3WV0A 5IY5B 3QPQC 1BYOA 2DRUA 3PAZA 4NQUA 3WKNA 1QHPA 2WXLA 1PLGL 1NCWL 3KPLB 4MJ4A 4Z5RB 3LX9A 5CGYD 3QR2A 4XCCL 2KH2B 2YAPA 3SPVB 3EH5B 4LVHB 4P5SA 3EXLA 3R18A 4PGZA 2AKRA 3IFPB 1YEDB 3QDHA 4M7KH 1WP6A 5B1BB 4G43A 4A63A 5DJ8B 3DETC 3DSFL 4QYOA 1GCFA 2NUPA 5DQDL 5GJSL 2EUWA 4GKSB 2EXSA 4OLWL 1A3ZA 5KWYC 1T1ZA 1U2YA 2VDNH 2ZP0T 2VSDA 3QPKA 1A7RH 1XMEB 2NSQA 1KLGB 2QKIA 1HDMA 4WVRA 4ABUA 4OLXL 3SZKC 3MNZA 2XWJA 2QKIC 3RVXC 4F93B 2Z7YA 4DN3L 3AY2A 3CXHK 4FQ1L 43CAA 4W70A 1UD8A 1IGIH 2BSEA 2XJKA 4GKLA 2VXVL 1NMBL 3RTQA 1XIWD 1UENA 1GYCA 5EUOF 4JFFE 3RTQC 1K3ZA 4F8QA 1BJ8A 2Y25A 1QQDA 3MRQA 3PFUA 3L48A 4OLYL 4MD5A 5ESAA 3OM3B 1A1NA 2H2SD 3VM7A 4DUWA 5B38A 1H3WM 3PAYA 5DEFA 5J3HD 4JFTA 3GXIA 1FZOB 4LCCA 1TQWA 4LBEB 2F58L 2W0PA 5FGBA 1CGTA 2DF3A 1KENH 3DSNA 3PDGA 2LU4A 4LCCC 2D31B 3AG2B 3QZMA 1UJ3B 2JKTM 2RB8A 1XB6A 3CH1A 4IMLA 4RX4A 5B7MA 2ENJA 3LDBB 3L4ZA 4NSKB 2LAAA 4AUUA 2NT1A 2ZOUA 3QDGE 5IFHL 1NKGA 4APXA 2DL2A 1UD6A 2XG5A 3VFVB 3KPRD 3O8XB 1R3HA 12E8H 1HAWA 2VAAB 2V0AA 4WU7A 4WFFE 5J12C 1R75A 1UOLA 5FA4B 4JX0A 1ZANH 4NKQB 3VQLA 1FO0L 4RDBA 3JV6B 4K23L 3K4DA 1QUPA 5I73C 4OGYL 2A4EA 1IVLA 5EUKB 2XN2A 3WBDA 3K74B 4UM8B 4XVOA 3GIVB 5I75B 3APCA 1WK0A 2X4TA 3MFGB 3BPLB 4I0CC 3NPZB 3OAUH 1UM5L 3MLZL 1IEAB 2E6JA 4TUOA 1FYTB 2W65A 3LSOB 1A2YA 1NCGA 4KAQH 4V1DE 1U58A 4HWUA 2FO4A 3CPLB 4EUPG 1J8HB 4UOW0 3GPEA 5IOKA 4TPRH 3HNVL 3SDAD 5AZUA 2XX1A 3ZSTA 2X10A 2VUYA 2F74A 3EBIA 1RAMA 3Q8BA 4OZ4B 2QKSA 3INOA 1Z5YD 2ESVE 4J7RA 3S4SB 2F7RA 2RGSA 2R0ZL 1SQMA 1ACCA 5TDPA 3HC3H 3HBZA 2BSSA 3B2PA 1H5BB 1OP5K 1EA9C 1IZKA 3FN0H 5LWYH 2GJ6B 2CJSA 5E0FA 3QHTC 1QEWB 2FL5A 4I89A 1HYSD 1HSBA 3KPSB 3O6KH 4H0HB 3DUSB 2VLJD 3NFSL 3L3OA 3QXWA 1PG7W 3PS6A 5LBVA 1XF2A 1HOEA 3NIGF 4KVCH 4UTCA 4AENA 3L3OC 3GMLB 3I3BA 3QO1B 1BBJA 3EZJB 4LSRL 1R5IB 5C0AA 3T6VA 3RLSA 3X12B 1R3IH 2A6DA 4MCZB 2NW3B 3GMOA 4JRYB 3WNNA 1BF8A 5FM8A 5KSVB 3ZTEA 2ICEB 5IKCA 1XGTB 2JJWA 4G8GA 2CH8A 4JRXA 4RWHA 3SE4A 1P1ZB 3GLAA 2HT2C 3MRMB 5H35A 1KIPA 5JOFA 5CBEA 3LQAH 1E4HA 3SE4C 4RGNB 3LKPB 1BIIA 1NC4D 2BP5M 3LRKA 4KRPC 4YHNB 1XXDC 3ZE0F 4KQ3H 1K2DB 3OKDB 1J05A 1XCTA 3U6XA 4EE2A 2K70A 5ECGA 3HB3B 4YXHL 4AGOA 2AABL 2HRHA 1GS8A 2FJHA 4JDEA 4TQPA 4WHCA 3BD4A 4N8VB 1S5HA 1GTNA 1JZ2A 4LMQE 5FYJU 2WVUA 3BAJA 1AGEA 1YEFL 3ZDXF 3RFZA 1AXTL 5JORB 1D5BB 4YFLF 5HDRA 5J8OA 1L9MA 3RFZC 2EDEA 2ILLA 1UACH 1UM4L 2VIRB 5BCAA 5E99L 3K71B 4W9IC 3O9WA 4KVNL 2ZG3A 3C60A 3OXSB 3O9WC 3UTTB 4HMEA 3C60C 4Y7MA 5CXPA 4EDXA 1LP9E 4OGQC 2I07B 1AZNA 4PJ9D 5HHME 3OX8B 1WPCA 3TT1H 1L9TA 4LEOB 3FT2A 4PVBA 3MRCA 3RVTC 3V0HA 3ZUNC 1OF2A 3ZTCC 4HZLA 4R7NB 2AK1L 4HJIA 1PG7L 2XTSA 4Y1AE 1JXFA 3QR0A 5C07E 1ZWIA 2Z92B 1E6OL 3AROA 3S8WA 4QAMB 4YJZL 3K6IA 4MB4A 4PV9B 5AWNL 2ICWB 3S35L 4M1DL 3QDJA 4R8WL 3NGBC 3O3DB 2NXYD 4FG4A 3CFBB 4QOKA 4E9WA 4Z7UB 5FV2A 1BDYA 4Q97A 1MLCB 5EU7C 2AEPL 1ZCRA 3EUUA 1J9SA 4YDNA 1HHGB 4GBXD 2XV2A 1R5VA 3FYIB 4WUKH 5JUEL 5I1HL 2VISB 2G75A 1PVHA 1CGYA 4OAWA 4OI9A 4RMTA 4Y5VB 1QKZL 4NYLA 4XP9L 3ULUC 4XNAA 2J21A 1NH6A 4QXUH 1QLRB 1SQ2N 3O4LB 3NZHL 3W1ZA 5ENWB 3CZFB 3OKEB 4JKKA 1PW3A 3L2NA 3FU8A 1ANUA 3CFIC 5ES4B 3GMQA 3DK0A 3AS3A 4GO6B 3MRJB 4B6ZA 5IWLA 2FX9H 3H3PL 2DEXX 3BP4B 2ZSWA 4H1LG 4MBOA 5IWLC 4TVPL 2ID5A 2X09A 2AK4D 4R4FL 1R3KB 3HG5A 2DQIL 2Z8VC 4PP1D 1MW3A 1G9NC 5DCCA 4ABQA 5LDUA 3AAZB 4WHYG 1WAAF 4PP2B 3I3DA 1B2YA 4XVJH 4V11A 4Y2OA 3APNA 3KM1A 3NDZE 1F4XH 4OU3A 2CO3A 5CSZB 1CPUA 3T6QC 1P9MA 1SJMA 3GMNA 4NM4L 4PGDA 4LLDB 2G60H 5G2NA 5GGTA 1EAJA 2BXYA 2CWRA 4LSUH 4BE6A 3NABH 2LT9A 2J5LB 1T03H 2VW6A 4KY1H 3SDXA 3S37L 4W9GC 4BFNA 5IHUL 2C9AA 3UTPE 1ZHNA 2F53D 3BKYH 3QP3A 3QORA 4GAYA 4W9EC 1D5XA 3LNIA 4YOKA 5FFOA 2X4UA 3QORC 3EJPA 4LSDA 4CBPA 3BP7B 4IBVA 2OMTA 2XSKA 2IH3B 4XBGA 5K9KA 2OA9A 1EPFA 4ENED 1JPGA 4YSCA 4LU5H 3QJUB 3QXDB 4LEXH 1AGFB 4NZTH 2OKMA 4AQOA 1MELA 2QGCA 1E0OB 1T20A 3MRBA 2VDOB 2QSQA 3FUHA 3CHOA 4PRPB 4EVNA 5ITBH 4MDJB 2MTAA 4Q6IA 1F4WH 1CL7H 1N9PA 1WT5A 3X2QB 4ZK8A 3T0WA 4JO4L 4Q6IC 2Y23A 1R5WA 1WT5C 2YSTA 4UV7H 4K8RC 1QFHA 1CS6A 2NY1B 1A4BA 4QRBA 3QXVA 4OCXH 2Z64C 5M7QA 3TIEA 5BV7C 1CFSA 1F86A 1JPTL 1WIOA 2AQ1A 4H2CA 2OYMA 1A65A 4CU8A 1ZLWH 3LB6C 2FX7L 3BZ4A 3U7YH 1A6WL 4Y8AA 5MEQA 4P5MB 2DMGA 2C9VA 3VXMA 1MFCL 4L8CB 3REVA 4P23A 3SHSA 1HIMH 1D2PA 2F8OA 4XXCA 1JG9A 3V4VL 4Y16A 5JYMA 1YPZF 3P3SA 4ZD3H 2YJLA 4P23C 2R0KL 4XXCC 3G9AB 7FABH 4Y16C 5B39A 1RJZB 2YAQA 1NANI 3ARFA 1G7PA 1S7VB 4G6AC 1DCEA 2CMRL 3PRZA 3QYMA 3FU7A 5DDHA 3VW3L 2XWXA 3ARFC 3VXQA 4PJHA 2P5EE 3C5JA 5CJQH 2LLLA 2DLIA 3FSAA 3OKLA 4RISH 5CCHE 2BSBA 5D7JA 1XCQA 1UG9A 4HKJB 2GW5A 3P73A 5D7JC 5IQ9A 4KZDH 2QZQA 4EIGB 5MEPA 4XN1A 2YPKA 3FW6A 4C56A 5I1EL 4FQJH 3FC8A 4UI2A 4PB9L 4WI5A 3WEOA 5J7CC 4M8VA 4XCEA 4YHML 5DQ9A 2FBOJ 2YMOA 3VA2C 1QP1A 3SN6N 4NPYB 5LN4A 1PDKB 2VDOH 1UXSA 1NGPL 1B4JH 4PRBA 4NC0B 1Q9LA 2J8UB 4JRLA 4ZO8A 1BVNT 1Y7VA 2VUKA 2WK2A 4AK2A 4E41B 1HAUA 4OCYH 4YSAA 3UADA 2BNRE 5EU3A 2I25N 5J11B 1OSYA 3IJSB 2ADIA 4FEIA 2PPCA 3Q6FA 4JZOB 1F4YH 1CDCA 3VI4B 4P3WA 4OQ1A 4JM0A 4S1RL 3PY9A 2OLDA 1IGYA 4Q14A 2KQNA 2I69A 1J8KA 3WDIA 1M3IA 2R2BB 5F70A 4KZ0A 4LKCB 1IC4L 1L4IA 4MCYA 3D3VB 1DN2A 2BNQE 1D5MB 4LHJB 3FQRB 3T1FB 3BPCB 3QUXC 1NKRA 4PW9A 5A2KH 3QFGA 4HU2A 1IT9L 1M4KA 3WIIH 3FDWA 4DO5A 1Q90A 5SWZA 5TGBB 2IAAC 3GM8A 5GRXG 1VFAA 4YHKH 1OY3B 5I19H 4GUQA 3MODL 1OE1A 3V5KB 3CD4A 4WUUD 4JMNA 2FX8H 3BDBA 2PR9A 5KSUA 2XG4A 2VXQA 1FGNL 2YXVA 3CZKA 3OC8A 4LSSH 2FQEA 4DAGH 4JJ5A 3ATDA 3AITA 3ZKMD 1T1YA 1Z2KA 1TTGA 4GYBA 4JLRA 5B1AB 1NSNL 5ACMA 5IW6B 4PRHB 2BHYA 5J6HB 4QRTA 4KJWD 5DD0L 3OLEA 5B4MD 1GHFL 1OD9A 1B6DA 3T0DA 1NEZB 2H2PC 2MEJB 4OCSL 2X1XR 3UXFA 1G1CA 1NKOA 3KBPA 2R8SL 1L9OA 2EYTB 3C8DA 1A1OB 1MIML 1OAKL 3IDXH 1XGPB 5I82A 3GBEA 2YAFA 5CEYB 3HLAA 4LRNH 3PL6D 3MLVH 3M07A 5CSBA 1ZLWK 2F7PA 4M8UA 1OAUL 2DLEA 3RUGF 2WXJA 3QS2A 4B9CA 4YFDB 5EU6E 1NDMB 4YHIB 1VEPA 3KR3H 3VRJB 2DQTL 3DJ9A 4JG1H 4LSPL 4XWGL 1MG3C 2G4EA 2VM4A 1TEGA 1WSST 3VJ6A 3W81A 5IREA 3QULB 2VDRL 3F7PC 5KVGL 2A6JB 5I1KH 3MR9B 4I9XA 5ANMA 3BLKA 3T2PA 1T7ZA 3NT0A 3G5ZA 1ZPLA 3H3KA 2WXOA 3AJ7A 3WNMA 2EZ0D 5IP4A 3ILEA 3O11A 3K6SB 4LLYB 2WZ6A 3IKKA 3T5WA 1BG9A 1N6UA 2Z4QA 4ODWB 4NXSA 2X4RA 3K5SA 2C1OA 1HWGB 3MVSA 5IW1A 1FYTE 3O0LA 3MLWH 2M83A 2PPAA 1J8HE 1HHKB 1BPLB 4XPTH 1MG2C 2O5ZH 3DVFA 4P2QD 4B9KC 4PJCF 3TBYA 3K6FA 2O5XH 2CDFB 1HL9A 1QFUH 4GOSA 1T7WA 2EEAA 5EFIA 4Z7WB 1X5HA 3Q5YA 3HLKA 2GHZA 5HGHB 4BQBA 5D7IB 2X70B 4R4BB 1RZKL 4R3SA 1CTNA 4NQCA 1FN4B 2AERT 1WIPA 2P28B 2Y07H 3QEHA 4P3CL 4KI5C 5HHQB 2IV8A 1DJYA 3H9YA 4L2YA 3MJ7B 4I1RA 5BVPL 4NN6B 3KPSE 1WZ1H 2CK0H 1HEZA 2WUBH 3MNVB 3LPPA 1EFXA 3GINA 4H8PA 1XSIA 4BIKA 1XIWB 3KPMA 4TTDD 3LRGA 5DD1L 1HZLA 5JIPA 2H32A 1ZY9A 2VL5A 3IT8D 4PD4K 3BKMH 3ZN6A 3QZWB 4FX5A 2FR4A 3L5IA 2Y22A 1HOCB 3B9AA 3HI1A 1WFOA 3DI2B 3QDAA 5E2UH 3NQKA 5T33H 4U7KA 4ZQKB 2DBJA 2Y7OA 5JPNB 2YK1H 4RGNE 5KSBB 2P8PA 5GGQH 3BAWA 3HAEB 4HIXH 2XVKA 1BEYL 3MLPA 4KITB 3WJMB 1YUHB 5F7EH 1LO2H 3LOWA 4PVMA 3KPRB 4QEGA 4KJQC 4H5SA 2JB5H 2NW2B 4XB8A 2AJUL 1MRFL 4HQQH 5AOZA 3MZTA 4TL4A 3VMOA 4M62H 4CSPA 1AYOA 3VI3B 4D0BB 3DI3B 4AM0Q 4TVPD 1QPKA 5C0RL 1RIHL 3AT9A 4M8QB 4NHUA 5DJ2A 1I8LA 2H9GA 1QBMH 4Q58C 5TQ0L 3CXDH 4WQOA 5DD5H 3IFOA 1I8LC 1E4WH 4C57C 2DMBA 3G6JF 3UROR 2IH9A 5HGAA 3UTTE 4K9EH 1L0YA 3BWUC 1ZT7B 2OR8A 2J8OA 3BEWB 3PHQB 4NKDB 4R96B 2W5PA 5A6IA 1ZVSA 4YNYB 5C92A 3RB5A 2KKQA 4HIEA 2BHZA 2VLME 2ZJSL 4ZOEA 4AMKL 4I87A 5K9QG 4JK0D 3TT3L 1A0QH 4NC2B 4C83B 3KHOA 1EZUA 3G6DH 3NRFA 2PO6D 4GXUM 5L2KD 2IO5A 4KZEL 4Z3GA 2Z8SA 3L8QA 1UZ8A 5IJKA 4NKDA 1AP2B 4JQIL 4O58H 1NCHA 3IGAA 5IJKC 2VLJB 2DQDL 2NZIA 1XR9B 2YN5A 1T5WB 1S7TA 3U6RA 4DZBA 1CU4H 3PGDB 3HAEH 4EN3A 2A74A 1EMTL 4F37F 1R1CA 5KW9H 3UTSD 2AANA 4EN3C 2A74C 4AGPA 5DD3H 2EC8A 2XPYA 5AVSB 4LSQL 5EEVA 3BD3A 5I66A 3CDGB 2ALWA 3O4LE 4H8HA 4JFQA 2R1XB 8FABA 3BT0A 3FRPB 1HSAA 1JUFB 1F56A 3BKJL 3NJXA 2ARJQ 3QH3A 2RALA 3NSYA 2QQKL 3KYMA 1ADWA 1E27B 3I75A 3SDCA 3B6SB 3QISA 1DSWA 2CLRA 1NC4B 3NQIA 4UQ3A 1SN5A 5FGSA 3SDCC 3TL5A 3WJLA 4AJ0A 1R3JA 3GK8L 1UWEH 4IU2B 3N41B 4IS6A 3WJLC 2EH8H 2WOYA 4CMHC 3UAFA 4Q9RL 1BG1A 4KNUA 5E4AA 5DZ9A 3H7BB 3P30H 4JFZL 4KUCF 2BMKB 43C9B 2HKHH 4KX7A 2AJVH 2HJLA 4OGXL 1INDH 4PJGF 2ATKB 2WZPA 3P0YH 4H8QA 5C0NC 3INUL 3PXJA 3TEUA 1N5YH 5HDQL 1BVLB 4D8OA 5DC0A 1JWMA 4I88A 4PGCB 2ZSVB 2F1EA 4KRNA 4WTZA 3GUTB 2DWEB 3PWPD 1UOVA 4EIUA 4XN8A 4ZNEA 4PJ9B 4N22A 1GGUA 1YRKA 1XEUA 4D0CB 1MH5A 4XNBA 1CDUA 4G80A 1IM9D 4AQZA 1KTDA 2HUEA 2EIDA 1JGEB 3DX2A 2W1NA 3FO1A 5I23A 3DO7A 4DP1X 2OBGA 2VJ0A 2MNUA 4F3FA 1QLEH 3DV6B 1WGVA 3L4WA 5JXAH 5KTEL 2BFVL 3P3YA 2E7DA 1U41A 1UCBL 1QYGH 4E42B 1X3DA 3BH8B 4N2KA 4NCC2 4AGQA 4A7UA 5L7XH 1QW9A 2A7BA 4Z7UF 3U1SL 2EVFA 2Q86B 4ODBD 1JHKL 4PRID 1BYPA 1RVFL 4I1NB 4IBLT 2VDLB 3GSRA 4JG0H 4ODUB 3RGVD 3JTTB 2Z7WA 1DL7H 4WO0A 1PPIA 4B27A 3DYOA 4BRJA 3UEZA 3DTUB 1O5PA 1DANU 3LZOA 4QRPA 5GRVK 5BUGA 3RWIA 4NP4L 1XH3A 3BUQA 2GUYA 1KCVL 4ONOA 5J1AB 3BSGA 1T21A 4ELKB 3NA9L 4P4KA 1ZLSL 1JNLH 1NCCL 5DK3A 2WXIA 4UWQB 4XGZB 3T3MB 1CFVH 4M02A 4P4KC 4KKAC 1VPOH 4NUPA 4X6DA 4FXLA 1PYWA 5FWQA 3UYRL 1PGRB 2BP0B 2BX5A 4BGDA 4QRSA 2FZ3B 4LAQL 1ODUA 2JELL 2VZ1A 2E7BA 4XB3A 2W88A 3ZHFA 3R06B 2QVTA 2XNAB 3HN8A 4AEFA 2YD4A 3T4YB 3SQRA 5IOPA 1FFOB 1KPRA 4ADGA 1YUKB 4GSQA 3HVNA 2WMPA 2PWGA 3MKGA 2V2XB 5I15H 1BSIA 1N5AA 4YLBA 3BP6B 3BW9B 4HUUB 4PRAA 1U8JA 1MCJA 5C0CD 3OAYH 5HYEA 2LVCA 3FHEA 3ULUL 1E5AA 4P2AA 5E1AB 1CIDA 4AJYV 4PB0H 2BINA 1KULA 5E24E 1CF8L 1JF6A 1YEIH 3CFCL 3FQYA 1HINH 3D07A 1CVSC 4E41E 1KELL 2ZCKH 5IBTL 2YD2A 2F53B 1MFDH 1BZ9B 1Q9KB 3NK4A 4DVBB 5D5MB 3CTTA 3H42H 1ZTMA 4LCWD 1P4IH 1FLRL 4RMSA 4FNUA 5EEZA 1C8QA 2XY1A 3MOQA 4A7VA 1OM9A 2B4CC 1SDYA 3V9FA 3VI4E 1H6UA 1N0XL 4XPGH 4QJ5B 4N0CD 4Z9KB 4IK7A 4MA8H 4U3SB 3MUJA 3N40P 2DQCH 4EEEA 2IMMA 3GI9L 3D3VE 3V6FA 4J3OC 1DR9A 1XD0A 3DROA 5C6TH 3T4AA 1ZK5A 1VB9A 3B3BA 4P46B 3T4AC 4I13B 5GGTL 1L0PA 4P05A 2IAMB 4JKNA 4I4WA 1F13A 1WJ3A 4HPYH 3O3EA 4F8NA 3IPEA 1JAEA 3GJFA 2KC0A 2V5MA 4TLKA 3IE4A 2J1ZA 4AQEA 2GJZA 4IBZA 4YHYC 4YSQA 4JFOA 2FO1A 1TCRA 1KJ2A 4O5LH 2XBDA 3X11A 1AKJA 1GRWA 5SWQA 5JLZB 5I17A 2QPUA 3ZUCA 4C8XA 2H0PA 5C0JB 1JI2A 4L05A 1YC7A 3QIUA 4OFQA 3HG2A 4PRHE 2KPNA 3L1OL 2XZQL 5IZ7A 1MCPL 3VA6A 3QIUC 2RTTA 3JVFC 5EU4B 4HDIA 4UDTA 5ITFB 4BQCA 1OTTD 4QHUA 3MLRH 4M1GH 4K5LA 4XBEL 2ROYA 4UOJA 4NENB 2ICWJ 4LCIH 2NY4C 2V7NA 2W07A 3E2HC 4FKKA 4YSUA 5IHBA 1AS8A 3N0AA 4JDZB 4CBZA 4D9LH 1JK8B 3OKOB 3MRPA 4K8RL 3B9KA 3PIQB 5BV7L 4GIPD 2CIIB 4PPTA 2JK5A 3B9KC 1DFBL 4OQTH 3W39B 1A6AB 1NIDA 3CDFA 4G5ZL 4M03A 1N7ML 2CO6B 1TZOA 5L88L 4PGJA 2X4NA 5JW3L 4J3XA 2AXWA 3DETD 4JFDD 3ZSSA 1INQB 4XP4H 1ZAGA 2H6OA 1ZT1A 3L5XL 4GUPB 5KYYA 4MX7B 2BCMA 5EZOH 4YZFE 5GJTH 5I28A 1D9KA 4OD2B 1PLGH 1D9KC 4WFGE 5F9OL 2YA0A 5TDOB 3NZ8A 4XCCH 4R26L 3RVXD 4S2SA 4XXWA 5C3LD 1IKNA 2Z0BA 1PIGA 1VFBB 4XXWC 4QT5B 5AL8A 4EO5A 1IKNC 4ABWA 2BSED 1ONQB 1CXLA 1WFNA 3QQXA 5FUCE 3OAYK 5ERWB 4DPRA 4D94A 5C70A 3RTQD 1QMUA 1KZQA 3FCTB 4HIJA 3PAVA 3PU7A 4W6XB 3QDMA 3T77B 1FNEA 4IW4C 1SF3A 4OLXH 3PQYE 3Q0HA 2FEEL 2OJZH 3HN5A 2XX0A 1F90H 4A55A 1TZHB 1UZ6E 3IDUA 4J3SA 1PJ9A 1QLFA 5AW8B 3RI5F 1GW6A 5B8CB 5F7AA 3FN9A 3S8FB 2NUTA 1B90A 2VXVH 3RWEA 4WUUB 2EDDA 3D1MC 2WUCH 2AQSA 2FTAA 4RX4D 1NMCC 4XMWA 4LHUG 2IH1A 2VITA 3L5WB 5IB1B 4NQXA 3GRWA 1E9OA 3FB6B 3RZCA 3BUYA 4I48A 5DJXB 4MAUL 4MXVF 5EOTA 2FEJA 4PJXE 2DQHH 2AV7A 4MVBC 3RZCC 3B5GA 3N50A 4MS8C 1Y6NR 1ZS8A 3FFOA 4EBQL 1KB3A 4X80L 4BHUI 5AB9A 3KWTA 4Y5YA 3FTYA 4HS6B 1XB3A 3JV4B 4Y5YC 2Q8AH 4LNRA 5IFHH 4NJ9L 1JFQL 4F5CA 4HXAL 1OGPA 3UAEA 2JXMB 3VD4A 2NY0B 2HRLA 4FN0A 1WWWX 3OR6B 4OFKA 2YHGA 2K7PA 4X0NA 5EEYA 2CRMA 2PR4H 4ODVL 2MCPH 2BNUB 4HUWB 1GIGL 4HAFA 4OGYH 4EDWL 2WN3A 4QHMA 1Y07A 5D7KE 4XMUA 2BVPA 5D2NE 3BGFC 4MJ6B 2VXQL 5CD5C 3ARZA 3VWKD 4HJUA 2HT3C 1ORQA 3QQ4A 3IS0X 1VHPA 4ZTOL 4I85A 1DZ0A 4CN4A 5C0IA 3B83A 4PG9B 3MLZH 4K7PY 1FL5B 1O7DE 2LOEA 1WZLA 1A4CA 4ANXA 5FO9B 3UIYA 1EO7A 3CDYA 1QTSA 4JPIA 3TPUB 3IXAA 3HNVH 2X42A 1OARL 4XHJD 3WSQL 2EYSB 2KPWA 3DWTA 9CGTA 4X9IA 4IU3A 4RRPA 2XQ0A 4HHGA 3QS3A 1A6UL 2CUIA 4Z7WF 4KOCA 2R0ZH 4P2QB 2O6FA 2X88A 1RP9A 2BC4A 1MJ7L 4NUMA 4X6CB 5C0AD 5LO7A 5TF0A 3ZGHA 2NY5C 2J6EA 4D2NA 4WU5B 2HJFA 3PV6B 3LS5L 4OB5L 4ZMAT 3JUYA 1WYJA 3ESUF 4GG8A 2OMXA 4PJIA 4Y1TA 1UB6A 4G8FB 1J87A 3TYFA 1AR1D 1QBLL 2HX9A 3CVBA 3QIWA 3WNKA 1G7HB 4FQQA 4G8GD 3NFSH 4NCC1 4IOFC 1W72B 4BJLA 2F5AL 5HPMA 3QIWC 4NKOA 4P2OD 1PMYA 3IMVA 3T04D 4KRPD 3ME0A 3DIDA 4LSRH 1F6AB 2YAEA 1KPVA 2IALA 4J3TA 4WWPA 3H6JA 2WAQA 4HALA 3QCUH 3R4DA 3TV3L 2Q1EA 2CLZA 3CPUA 3N43B 5IVZA 3P77A 4L18A 3C8KB 4ZPTB 3N40F 3TJPA 4UT6A 1H3GA 4CSZA 5JHDA 1ZE3C 4P2RB 3PWNA 3FL7A 4OLUL 2OFQA 3BLBA 5K9OA 2OW7A 1P53A 1OLZA 3K1DA 2HWZL 4XT1C 1NCDH 5KSBF 5D1XA 2WLLA 3N1FC 3MJ8A 5D93B 4W4NA 2IFFH 3P9LA 1MPAL 3ZR5A 3O9WD 4M5SA 5EEWA 3LZLA 4GT7A 3C60D 4JY4B 5T3XD 5FR3A 5INDB 4R97C 3MFFA 2CO2A 3HEIB 4RNRB 2IOMA 2OYKA 2EECA 5AQ0A 3VXNA 3RVTD 5H94B 3VI3F 5FM5O 3KVQA 5EN3A 1JCVA 3PP3H 1DUZA 3QAZC 4BZ2A 1GYVA 4KUZH 2E74C 4LVOB 5DFWH 1EVTC 5FKAA 1UM4H 3B9EA 3JWNH 3LZNA 3WUWA 1AY1L 1ZA6A 2R69A 2X38A 4EF3A 4KVNH 3AXLA 4UINH 3KG5A 3AG4B 3BRDA 3VGFA 3VXSA 4QHPA 3G9VA 3UG4A 2AJ3A 2Z6FA 3QDJD 5KUMA 5SWSA 3R1GL 2R29H 3HNTL 4GSXA 1W72H 1CFNB 4KVPA 1HI6A 1UC6A 5JHLL 1HH6B 3GTVA 5J13C 1CD8A 1KYUA 1PG7H 4J6RL 3ULUD 1UOKA 4JAMB 1JV2A 2EDLA 1E6OH 4FLOA 3S3JA 2XTJC 5EF1A 1ETZA 2LGNA 2P5PA 2WWNA 5DURD 3S35H 1KC5L 4F33B 3F04A 4UZGA 1A9EA 1OPOA 2W95A 4Y2LA 5G5DB 2DQEH 4G1MB 2J25A 2ISDA 3TIDB 4PFEA 5K9JL 1H3PL 1EDHA 1KJ3H 2IIJA 2PO6B 1YEHH 5L2KB 4JFYA 5DMKA 2A1WL 3OHMB 5AZEH 4ERSL 2H1XA 2CLVA 1LEGA 4KTYA 5I1HH 3FHQA 5JUEH 1N12A 1U8IA 2VR4A 4DFIA 5HY9B 1DJGA 3GSNL 4XP9H 5IB4B 4P5TD 2HKFL 4NRZB 5HHXH 3RPKA 5DSCB 5C0FA 2GCYA 2IQ9L 1KLFA 4PJ5E 1WFIA 1RPKA 3UTSB 2VH5L 1KBPA 1NAMB 3IU4H 4XMLL 3UBXB 3OMNB 1H3XA 2Z9TA 4KY2A 4R83A 5C7ZA 4ZW6A 4CAGA 5CEXB 4H8UA 1TJGL 1WA2X 4KO5A 4O02L 5E8EA 1CBVL 4BQ8A 5BVJB 1XSKA 1PS3A 3ARDB 4X99A 3S96B 4BQ6A 4TVPH 4QTHA 4YHLL 1U0QA 2JJUA 2ADGA 1IGFH 1PKQA 3A23A 2O5YL 2DQIH 4R4FH 4ISVB 5F6IB 4QCIA 5F1IA 3ARVA 1U8KA 2D4FA 3CU1A 1JCKA 5FA3B 4L2LA 5IJVA 4AM0B 5KVFE 3QORD 2R1YB 2EIJB 3S5ZA 5ICZB 1G6RL 5DUBB 3ULSA 3O0RH 3SZ6A 4WI2A 1TJIL 2CPCA 1Q1PA 1SN0A 5GS1A 1B4TA 1FNGA 1IAOB 5LGJB 3Q1SL 5GS1C 4OFPA 4U3XA 2H3NA 5EF3A 1TYEB 3DV4A 4HCRA 2BOBB 5IHUH 1LK3L 1RURL 4U6HB 3HOGA 3WFHA 5DUJA 3RYMA 1IC0A 3PXLA 4HHWA 3N5AA 4K8RD 5DUML 3PWPB 3IDMB 1GSKA 4WTXA 1PZ2A 1TPXB 2W9DH 1EJ6A 1L9NA 1KLUA 2IANA 4U1HA 3PAUA 3C09B 2A83B 3KZ8A 3BGAA 3LB6D 1IM9B 2J44A 1H15A 2BY2A 5JPMB 3ZYIA 2HTLC 1NAMH 5HHVH 4QHNB 1O7SA 3L3HB 3PP3K 2Y1AA 3MLYH 3VXMD 1DQLH 1L7TH 3D87B 4P23D 3MREA 3V0WL 4N8VG 5DJYA 4KKQA 3POHA 1DYZA 4ZMOA 1NBVH 4Y16D 4GRMA 4MFHA 4AY0A 4G6AD 5KS9B 2Q6WA 1OCWH 4PRIB 4M9PA 3Q2CA 4CJ1A 1KDJA 2EILB 3ARFD 4Y4KD 1YJDL 1EEZA 1RUKH 1U9KA 2FX7H 1HS6A 3F83A 5B1KA 1TTUA 4N2OA 1YYCA 1USZA 3RG1C 2X2HA 1A8JH 1MFCH 3HJ0A 4LVEA 4M5YL 3TBWB 1P1VA 5D7JD 5IBLC 3V4VH 1SHXA 2XJLA 4HUVA 2R0KH 3QR1A 1U8QB 1TSRA 5IFAH 1KJMA 4WKXA 4ICXA 3T3MF 2ETWA 2CBMA 3NJLA 1MCKA 2B1OA 4C56D 3LKQB 4DHLA 4HC1A 2F18A 1BZ7A 3D18B 5DR5H 3BKCH 1NIAA 3L6FB 1RZJL 4PJBB 1DBJL 2Q7YA 1ORSA 2SEBB 4F91B 5FOJA 3B2VL 1FPTL 1P6FA 4JBSA 1GZHA 1IMHC 1LNUA 1COBA 1ZJBA 1J18A 2I85A 5IB5B 6FABL 3L3JA 2HVKB 1GZHC 4ESKA 2ED9A 5I1EH 2EDJA 3U9UA 4FNTA 4YHMH 2H8PB 4JFPA 1EK3A 2YGQA 3KYAA 4HZ1A 3BIAX 5CSGA 3U7AA 2RQ8A 5C0CB 2F7OA 3DX7B 4M6ML 1NBZA 4MJIB 4P4RB 4QXVA 2OZ4H 2PYFB 1J0IA 5EBGA 3OZLA 4H25A 3VXPA 4XO5A 3LN4B 5DC4B 1W0VA 2NR6D 5MP6L 4OLEA 3SIKA 5AG9A 2FNBA 2FHBA 2OAAA 1A7OH 1JPST 4ALAL 1WA0X 2Z91B 1EANA 3ZKNC 5D5MF 1IAKB 3P0GB 2VLRE 5SWZD 4LCWB 4X4KA 4M1CC 3EDJA 5KJ7E 1G5GA 3HN3A 1IC4H 1AQHA 2OM5A 3ZGIA 3MV7B 3SCMA 4HJTA 1X4ZA 1SJXA 2C1PB 4NFBA 4F2MB 2X89A 5DRNA 2GSGA 4LGPB 3SCMC 1DFXA 3A21A 1F1AA 2VZOA 1LYQA 1IT9H 1ILUA 3MUY1 1V3LA 2V5YA 5HYSA 3DURB 2C5DC 3OLDA 1B9ZA 5E0QA 3RWFA 3ARWA 3K0WA 2Z8RA 3MODH 4NI3A 4UNUA 5D71H 2H2PD 2R15A 4ODHH 3P02A 1I9IH 3VFRA 1A5FH 4N0YL 4F7CA 3HZYB 2BW4A 1FGNH 3EYVA 3NJIA 2FECL 3RX5A 2K8QA 3IDYC 4WUUE 4NC1E 1BOGB 3GEWB 4G7YH 4HT1H 1R0AL 4F7MA 3KMDA 1NSNH 4L3EA 2Z65C 4TQEH 3ARGA 4NO2B 1AG6A 4WWKA 1WGOA 1GHFH 4Q74A 1NDGB 3L7EA 2ZAGA 3ARGC 4X4ME 4WWKC 2L04A 3HR6A 1JBJA 2X87A 4DN4L 2BOCA 5DO8A 1ND0A 5LCVH 3HI5L 2PF6A 4B9JA 3H1ZA 4R7DA 1MIMH 5D8JL 3EHBD 4N2HA 1U8HA 4M3KB 3LKOB 4L29A 1HVXA 3NCEB 4XNYH 3MRNA 5HYIA 2ZX9A 4ZAKA 1OAUH 3WE6A 4KJYA 4WWID 3D30A 5CLYA 4ZAKC 5EZLB 3U4AA 2Y2YA 4HPOH 1C1EH 1VENA 2DI8A 1GC1C 1QUNA 2EXTA 4G6JH 2DQTH 5K1JA 3DXAA 3F7YA 4N68A 5EDXA 4LDLB 5DS1A 1TIUA 2BOLA 3UZVB 3ZT7A 2QDVA 4AJVA 3T6WA 4L1DA 2YKLH 4JGJA 4FXKA 3BFQG 2AKRB 4TVSa 2N3JA 4FXKC 1DANT 4OJFL 1J1XH 1KJ2L 4QYOB 4U1SA 2NUPB 1KCLA 1MCIA 1T1XA 4QAWA 3E6HA 4UM9A 1AGDA 4AKOA 1T1ZB 1TVBA 4Z3JA 1A6VH 1CDGA 1FSKC 2QKIB 1HDMB 1QSEA 4NQCD 4G8IA 3K4ZA 5I5MA 4Y1SA 3MNZB 1UEYA 2XWJB 2H6PA 3NEEA 5EIQA 43CAB 3QHFL 4RH4A 2FT7A 3WEXA 3ZDZE 3WY2A 3ZTNL 3MV11 4N5UA 1NAKL 2PWFA 3ARUA 1EFXD 3RTQB 2DJSA 4ZMTA 1QQDB 3MRQB 4WNJA 2XFXA 4Y19A 5CNHA 1MCDA 2QFPA 1FUNA 3FB5A 4MD5B 5ESAB 1GJUA 1A1NB 1MQKL 3K8KA 5DA0B 1RZFL 5DEFB 3RP1A 1MFMA 3DVNB 3BT2L 5B38B 3N85H 5JIIA 4LCCB 1QG3A 4JUTA 4OZHA 1GKEA 3DSNB 4HJ0C 4QRQA 2ZKWA 4G42A 3CH1B 4WZ9A 1L5GA 1WF5A 4IMLB 4KV5E 1T2XA 1EV2E 3LZPA 2CHWA 4PWKA 5FC9A 4U2YA 4H88L 1MFEL 3B9DA 4WI4A 2FHFA 4AK1A 4XB7A 3NH7L 1XGZA 1HTYA 4APXB 4KJQD 1XH0A 4WAFA 4TYUA 1F8TH 1B3IA 4Z7IA 1E9QA 2IBZY 1R3HB 2ZF9A 4L4TE 5J12B 1HXKA 3CDZA 5D7LA 2VERA 4WU7B 4DKAA 4P2RE 3CMOL 3WTYA 5I73B 1EO8L 3HC0A 4X0KA 3VTMA 3GXPA 1LDSA 4BA0A 3BJ91 4EZJA 2ZOOA 1BEYH 3C08L 4FXGA 5A1AA 3EO1A 3AWEA 1E8XA 5H37G 3NCXA 5JIMA 4FXGC 1AMYA 2X4TB 2AJUH 2TSBA 3DVIA 2Z7UA 2Q8BL 3MACL 3QUMA 4FP8L 3H54A 1E2WA 4EI0A 4TUOB 4G6FD 2W65B 1A2YB 4N3UA 2EDOA 1U58B 4UTAL 4BRVA 4DPBX 1RIHH 2FO4B 5HI5C 2AZAA 5I1DA 1E42A 2F74B 3TJHC 1TVHA 4I18A 3ULVL 4PBVC 3GRWL 1I7UA 4I18C 3QARA 5TDPB 2YARA 2BSSB 2JKNA 2P8MB 2ZUXA 4RFNC 3V6BR 4XNZC 3KS0H 3DDGA 3EGXA 4B9PA 1CFMA 5GRYA 3O4OC 3GIZH 4DWHA 2FL5B 2I27N 1LTXA 3SB3A 1HSBB 2ZJSH 2R7EA 2Q2EB 3E3QC 1ZD6A 2E9GA 3L3OB 3TT3H 2VZVA 3AUVA 1W2KT 4X6CF 2XIIA 1XF2B 5LBSL 4M3JA 4EN3D 3EJRA 4G1EA 1BBJB 5C0AB 4N2NA 4KZEH 3ZIMA 3QQ9D 2A6DB 3GMOB 4WGKA 4OVVA 1E7UA 3TNNA 3QPXL 5D72H 1L0XA 3FPYA 5IKCB 5L2KE 3AADB 3HMWH 3V0JA 2BS9A 2DQDH 4G8GB 4JRXB 5H35B 4N2IA 5DMIH 5ICYB 1KIPB 3RA7L 5CBEB 5JOFB 4XPBH 2XLLA 1DCLA 4KRPB 3SDCD 4XTRC 1DVQA 1UM6L 1BIIB 1NMAL 2ORBL 2IV9A 2ZXDA 4WI0B 4M56A 3EBAA 1OGAA 1WWAX 1J05B 1XCTB 3HZVA 3NUKA 1AIZA 4FFVC 2YEVB 1FI8C 5AW5B 4CN6A 3BKJH 2FJHB 3OHXC 4JDEB 3U2IA 4PUBL 4NO0A 3FUMA 3FFCE 1S5HB 2WQRA 3A67H 3K72A 4N2AA 3AC0A 5C0ND 1P5VA 1AGEB 3PXHA 3G7TA 4YWGL 3RFZB 2WZPD 5C0DA 3KM2A 3IFNH 1IGCH 2QQNL 3GK8H 4Q9CA 3SBRA 4Q9RH 3ETBF 5IM7A 1ACYH 2YR3A 3O9WB 3QG6A 4HV8B 2J6EL 3DIFA 1P84J 3APFA 3C60B 4JFZH 4CSSA 5C3IA 1ZLEA 4HFUH 3A22A 2K7QA 1RFDL 4EDXB 3FAXA 4NM8L 1AHKA 4JE4B 4OGXH 4U1NA 3L3IA 1N64H 3FT2B 3ZMEA 1ET5A 2X1PA 4OM0L 3MRCB 1M6UA 5EH1A 3LIZL 2WZ0A 4LESA 1OF2B 3ALPA 4K55A 4HZLB 1IFHL 2ITDA 3RPBA 5EF0A 2BVTA 1ZEAL 5K59E 3ATBA 4OSUH 1V7ML 1ZWIB 2OXHA 3QRBA 2JJTC 2CKBL 1HHIA 2W60A 3QZWG 1A3LH 3NGBB 2YD0A 1SLXA 3WENA 4OY9A 3QDJB 5HHPA 1UH2A 4KKLC 4X7DC 4QOKB 3PWPE 4H44C 4PI2A 4XNUH 2HFEA 4FQXC 3VGGA 5I76A 3O2VH 1R5VB 3VSQA 4NQSA 1XXFC 3L4VA 2G75B 3QW9A 4HX1A 2W91A 3L2LA 4OAWB 1S7XA 2BFVH 2AI0L 3HAEG 1FVEA 1UXMA 3EJUA 4NYLB 3V52L 2GY7B 5DURB 1ZJAA 3K4AA 4JANB 5C9JA 2OSYA 3CFEA 4C4BA 4PGBA 4Q52A 5CIPA 1JHKH 1SXSA 4P4KD 4XMXA 2Q20A 4ZUVA 4KKAD 1VCBC 3GLDA 4RMUA 2CBQA 5IFJA 2J4WL 3BZ5A 4OZIE 3GMQB 4W9HC 3Q13A 5KS9E 4KXCA 2ZSWB 3FTVA 4ZX6A 4MQTB 3DBXA 4YPGA 1A02N 2E4TA 4NP4H 5KUKA 4KROC 4LASL 4A2MA 1KCVH 3NVQA 4KK9C 4YDKL 3NA9H 1ZLSH 3PWUA 1OQXA 4RDQF 1DZBA 1CGSL 1NCCH 2XCMC 5FOBA 3DX8A 2O5NA 4Y2OB 4R7XA 2D3NA 2D0GA 1KN2L 3I9AA 3EO0A 4AJWA 5FLVA 1F00I 2WBJA 3GMNB 1DQQB 1CJYA 3DMMA 2NTFA 4PGDB 1T2QL 4LAQH 3R4RA 2JELH 3NSXA 2VERN 2WBJC 5T5FL 4Z7OF 3DMMC 4S10A 4OF7A 4YH6A 2HG0A 4WI9A 1OP9A 2CSPA 3HG3A 3H56A 5F0LB 1FJ1A 2XXFA 5FAAA 1S7RA 4AIXA 4UF7C 2JLPA 3B34A 4I2XE 1E65A 2BRRL 1ZHNB 4QXWA 3QORB 4GAYB 1FYHB 4XNMA 1D5XB 1JZIA 3SPJA 1D5ZA 4QWWC 2A9ML 2OMWA 3ULUH 3K91A 2OMTB 1BQHA 2W9LA 5I2IA 4XBGB 1JE6A 1JNJA 1JPGB 5AVYB 1I9RH 1FG2A 5I1JL 1I8MA 1QASA 4MJIE 1S9XA 4Z3EA 1PY0A 2R2EA 4KMTL 1PX3A 1T20B 3MRBB 1MNNA 2EDQA 3GKWL 2K9FB 2OZNA 3RUGA 4EVNB 4W81A 2MCMA 1QWNA 4Q6IB 3IRPX 4ZDHA 3FRPG 1OAYH 1FLRH 3NMEA 3Q43A 4K2UH 3U36B 2P7TB 4FCAA 5BV7B 1J0YA 4XPAH 3V7AE 3O6ML 3RKPA 1G9NH 3TIEB 4GO9A 4LCWE 2ZWKA 2HCZX 3MV9A 3IGKA 1J9CT 1YQ2A 3GI9H 1RJYA 2B1HH 4P99A 2R4RH 3BZ4B 3MV7E 1BWMA 4F2ME 5MEQB 2ZPKH 3VXMB 4HK3N 3C2AL 3REVB 4P23B 4HEPG 3QI9A 3X13A 2H7WA 2WIIA 1AKJD 5I8CA 4Y16B 5EA0L 3QI9C 1MFAL 2IDTA 2A6IA 4HSQA 5GGTH 4XWOC 5B39B 1YZZA 4YSEA 2QV4A 3BAXA 1BEXA 3ARFB 1G7PB 4ZMNA 3HZKA 3FU7B 3LZFH 3Q3GA 4LFHD 3HE7A 4HFWA 5DDHB 3VXQB 4AEEA 4PJHB 4ZW5A 3C5JB 4B9IA 3OKLB 3RU8L 2OSWA 2MSPA 2GTQA 2BS71 3HE7C 1CF1A 3IDGA 5D7JB 1XCQB 4WV1C 2FBJH 4ODTL 2TRHA 3P73B 1SLUA 5IQ9B 1DN0A 3EO9L 4I3RH 5MEPB 4AYFA 2YPKB 3B9KD 2NDGA 2XZQH 4AL8L 4C56B 3T0EA 1MCPH 3NG5A 3T0EC 4BFIA 5ETUA 5DQ9B 4IM8A 1D7BA 5AKSA 1UXSB 3KGRA 1GOGA 5FCUL 1N68A 4N6RA 2KLTA 4J27A 2FHCA 3HR5A 4PRBB 5BS0E 3OKMA 1J1PL 4J39A 1EAQA 4K8RH 2I26N 4MDIA 3LKRA 3QZOA 5BV7H 1ODAA 3UMTA 1D9KD 1ECYA 3QJVB 1JDCA 1EWHA 3HPJA 5EU3B 5I8OL 1DFBH 1R19A 4UIKH 4G5ZH 4G7VL 3Q6FB 1A9VA 5L88H 1CK0L 1ASOA 2GKIA 4GO8A 5LGHL 2G0KA 1IGYB 2QGBA 4CVXA 4A04A 5BNXD 1XF5A 5HGGS 3KLHD 4MCYB 3OR7A 3QUXB 1AJ7L 3HNSL 3UAJA 4ODXA 1O6SA 2D0FA 4HWZA 2X6BA 3QDMD 2WWMC 3UAJC 3D2TA 4F8OA 1YEEH 5CEZL 2DKSA 5SWZB 1JDDA 2LABA 4FNQA 5TDNA 5K1NA 2VMDA 3FF7A 3FU5A 4HGKC 1VFAB 4NUJA 4R2GC 2XPGA 4NNPL 5DVLA 4XOEA 3ZE2B 2YRBA 3EYOA 3H9SA 4BFEA 3NIFF 3V0EA 2VDQB 4DEPC 5KSUB 1CVRA 2XG4B 3WKYA 5INCA 5CEZE 3G6JA 3F58L 1J12A 5TFSL 3SD2A 5LLIC 4JJ5B 3MRFA 3ULVD 2X6VA 3ZMNA 2N59A 2NY3C 1T1YB 4FG2A 1PD6A 1YN6A 3UCQA 1MCEA 3TJEH 4AKPA 4MS8D 4JLRB 2O6PA 3RZCD 1ET8A 1A7NL 5C08E 3HC4L 5HYJA 2YEQA 4QRTB 1YNKH 4UUJA 2FDBP 5FYKE 5MENA 4EI6A 4RA0C 2DIEA 1SXAA 3DA0A 5H4ZA 4P59L 2YLHA 5IVXB 3B1TA 3F01A 5TH2A 4GI9A 1WEJL 3L16A 4YMPA 2YMTA 3HLAB 4MAUH 1UKTA 1NIBA 4LQ1A 4Z0BH 2CGRL 1MVUA 4N2LA 3W0WE 5A16A 1E3ZA 4E9SA 2NY7H 4OR1A 4LL9A 4EBQH 4IMKA 4X80H 3CJJA 4XMPL 5EC2A 5IJBC 2AC0A 2FEDC 4XRCB 5BPPA 2BVQA 1OALA 1M7XA 5CD5D 3FO0L 3VJ6B 5CFAA 1GH7A 1DJZA 4HXAH 4Z7NB 1JGIA 1J7VR 1KY7A 5FFGA 2X1QA 5ANMB 5D9SA 4L4VA 1AGBA 5EOQH 3G5ZB 2OCFD 1TJXA 4MA7H 4JFXA 3MRHA 4N9GA 5DT1L 4F8LA 1OKEA 1TENA 2JMRA 3O11B 2K8MA 4JO2L 3L5JA 4Z95L 1KV3A 3RWDA 2Z4QB 4D3CH 3LCYA 3FH7A 2X4RB 4JGMA 5FYLL 2IGTA 2C1OB 4PTTA 2VXQH 5IW1B 4OF3A 5JR1L 4ZTOH 1N0LA 2UY6A 4KC3B 1AGCA 5DK2A 1B2WH 3TZVA 5GZNA 3TBYB 4L0ZA 2E86A 2FECI 3TZVC 5EFIB 3ARXA 1TXKA 5D1QA 5GZNC 1F45A 4YHZH 4PJGA 4XE0A 5D1QC 4IOFD 4LSVL 4R3SB 4BFOA 4NQCB 3WSQH 4DGVL 3QIWD 2P47B 4MB5A 1BREA 2XWTA 4M3HA 4XO3A 1BJ1J 1L9QA 3LZRA 3EOBA 3T6ZA 3VQ2C 1U30A 1F1DA 4EKJA 1HEZB 2ZKHL 4LCUA 5CKGA 1ZLVH 3EYFA 3VE0A 1EFXB 4X98A 4OB5H 1XAUA 3KPMB 1L6XA 2XOTA 4PJDA 1C7TA 2QHLA 1CLYL 1EQWA 3CXFA 1GC1L 2H32B 2VL5B 4FYRA 1WAPA 3FTGA 2FR4B 2X53A 1WWCA 5JHDD 4ABVA 1MCNA 4RAHA 4LF3A 1MHCA 3HI1B 3KXFA 2J1XA 2GSIA 2HLAA 2Y7QA 4G8GE 4JRXE 5CUSH 1X9UA 5D1XD 3WS6A 1RUQL 1G0YR 4N0UA 2VJ8A 3WS6C 2P8PB 2NQDA 4FZEL 4Z3FA 3ECBA 1S3KL 1SXBA 3TA3A 2QLYA 1JZ8A 2IDCA 3TA3C 3Q48A 2EVJA 4H5SB 3VFPA 2EXYC 3COOA 4HCFA 3U4BL 1J5HA 2OQJA 1IARB 3UDWA 4KDTA 3BMWA 4M43L 4MXWH 2WYZA 1W0WA 4ZSOA 1TEFA 3UDWC 4KDTC 3EF4A 3KGTA 4NHUB 4QHKJ 3H9HA 5DJ2B 4QRRA 2OS7A 3HUJE 4PCKA 2WSKA 1H6FA 2H9GB 4FJZA 2PYEE 1PFOA 1G7LA 1AXIB 1YY9C 3M7FB 3VXSD 3IFOB 3W2DL 3GWJA 4WHDA 1J5OL 3QEQE 5SWSD 3GMPA 2E6PA 3GBMH 4Q89A 5T3XE 2F19H 5HGAB 1NBQA 3RNKA 4HETA 1GYUA 1SBBA 1ZVSB 2B1AL 1T1WA 4HIEB 1UA6L 1Z9NA 4R90L 5TPWL 3T6XA 4RAVA 4MLSA 4EUPA 2H32H 1BBDL 3ZL4H 4Z3HA 5T1MB 4HP5A 3KDMA 1DVZA 3HG1E 1C5DA 5GQBA 2F8XC 5JHLH 1KNOA 5HD8D 3NCJH 1UZ8B 4XMZA 3IMSA 4QOKE 4O4YL 3S48A 4K7PL 3IGAB 4FMFA 3KNBA 5GGRY 3T8MA 3P4OA 1WBYA 2W38A 2XZAL 4Y9FA 5AKTA 3X1FA 1KC5H 1S7TB 4DZBB 3U6RB 3BAKA 1YNTA 3GO1L 1AS6A 4EN3B 2ODIA 2A74B 5K9JH 1OOWA 1H3PH 4YE4H 1UD5A 2CBTA 2JQZA 1X5AA 3BUIA 2YBGA 4ERSH 5I66B 1XBDA 3LPFA 4P06A 4JFQB 2DYPA 1DSYA 8FABB 5E94A 1GZPA 3CDCA 1F3JA 1DQDH 4HKXA 1HSAB 4MA3A 2HKFH 3QH3B 3D09A 3KYMB 1SXCA 4IQHA 3I75B 3IN2A 4NN5C 2IQ9H 3SDCB 1KCKA 4NQDA 5CO1A 2O4EA 2CLRB 3GNMH 2XRAL 4NNYA 5C0FB 4GUOA 1MZZA 2VH5H 2XACC 4CMHB 1IKFL 1IGTA 4XMLH 1R3JB 4PVNA 4BFGA 4IS6B 1QFWH 4O02H 1CBVH 4JO1L 3LXUX 1OTUC 4G59C 1J5DA 3CVIL 3P9WB 3PHOA 1ZLVK 4L0YA 4YHLH 1IB5A 1FGVL 1KWKA 2WBWB 4PWHA 1SN2A 2NNAA 4YXKH 2ZCLL 4ETQA 2G3ZA 3ZRSA 3WFDL 2HJLB 2KZ1B 2HPTA 3JWNG 2P5WA 3TCTA 2BSCA 5I8EA 3RGHA 2LFGA 1JWMB 4GKZA 1G6RH 3NACH 3DDFA 1YMHA 1DBBL 4POUB 4W6YB 4LKXA 2FB4L 5BO1L 2E5EA 1JZ3A 4PV1C 1ADQL 5B7FA 2FJFA 3VXTA 2D7NA 4YXLH 2ADJA 2IAND 1J0KA 4BDVA 1TO5A 1MH5B 2VT0A 4G80B 4JEGB 2JLLA 1MHPH 1KTDB 4M48L 2HTLD 4HF5H 3BDXA 1LK3H 3FO1B 3DO7B 1N67A 1W6LA 3C2SA 4F3FB 2H0FA 4FABH 2Y2TA 1FRGH 3H2PA 4UNTA 3O2WL 3ZRCC 1IEBA 5DHEA 3HFFA 2FIRT 3DLQR 2MIZA 2N4IA 5KSAA 4D8PA 3ULUF 3FF8A 3GSRB 5KSAC 5FF6A 3BO8A 1TYRA 4PWIA 5DZLA 2X6MA 1JWSA 3V0WH 5I9QC 3Q2LA 2HP4A 4OIIH 4QRPB 1PY4A 1XH3B 4HAGA 4HJ1A 5D7SL 3AXIA 5AB1A 1X5XA 3VXME 1T21B 4YEFA 4PG2A 4P4KB 2RQEA 4PG2C 4POYA 1G0DA 3A6CH 3T8XA 4X6DB 1AH1A 1PYWB 1BXVA 4M5YH 2C8NA 3LH2L 2QADC 4IIZA 4QRSB 1INEH 4PTUA 4AYBA 3KJ4C 1D6EA 1JRHL 3WIHA 1VADA 3S34L 4UTBL 4ZFOA 5IOPB 2FRGP 4OCWL 3BN9C 1KPRB 5MI0C 3D33A 1FBIL 1BQLH 2DQGL 2WMPB 3NJHA 3V4PA 4K3EL 3RIKA 4ZTPL 4FFYA 1W80A 3RIFK 1RZJH 1GR7A 4PRAB 4UAOC 3ZTJH 1DBJH 1FC2D 5AVTB 2XC8A 3B2VH 4B7IA 1HCYA 1UWGL 2B7DT 4F7TA 5LNDA 4JZJA 3QB7C 3SDXF 5KANG 1PZ3A 5DZPA 4JZJC 1E30A 3ZKND 5GGVY 4JO8A 4APQA 1D7CA 1TITA 2N56A 1UD3A 4JCWA 5HYFA 4APQC 2KBGA 4DCQA 1M3JA 3OWRA 4NLAA 2X4OA 3VGAC 4QHLA 4BWUA 1GTFA 4AC2A 4TNFA 3S97C 4JFUA 4Z18A 4FMKA 1G94A 3D39A 4L1TA 2WQAA 3WXWL 4XR8C 1NOFA 4FFTA 5DLML 3SCMD 5MP6H 4NO3A 3MYZA 2X89D 4YL4A 2UX7A 3ML8A 4ALAH 2A73A 2EUZA 1Q0YH 3UBXG 1JXDA 2CBOA 1T7VA 3NP4A 5E1IA 4BKTC 2ZAHA 3NPSC 1SOXA 3TA4D 3KLAA 4FTVA 1RU9L 3V6FB 4WEBL 4F57L 4HOWA 2VZTA 3VUAA 4ZMWA 3DROB 3T4AB 4J23A 5EBWA 2WJ7A 4U1KA 4YZFF 2PN5A 5L9DL 2AJXH 2RIKA 3RVWD 3VDAA 5SWZE 1LDPL 3BIBX 3N1MC 4PR5A 5FYLD 2PCYA 2XIDA 1RSYA 4I4WB 3VXRA 3ROLB 3O3EB 1EUTA 2VR9A 3CZGA 2VR3A 3V5DA 3TYGH 3GJFB 2EE6A 4YHYB 4AV0A 2ENSA 2FAUA 5LB1A 1XV8A 4AQEB 2VAJA 3II3A 5LG1A 4JFOB 3TWCL 2FUTA 1TCRB 4L3ED 1KJ2B 3GPSA 3X11B 1AKJB 3ARGD 5SWQB 2F7IA 2K9UA 2P45B 4WWKD 4CJ0A 5E9AA 4L1BA 5I17B 1E4JA 2AXFA 4O51A 1L3NA 3QIUB 4KO6A 1NWPA 3VXUA 2VDKL 4CDGC 2VQ1A 1SUHA 3CFUA 3IJ8A 4PJHF 3LRSA 1C16A 4JM4L 4L8BA 1HJCA 4R9HA 4HDIB 1UZ6F 2JWYA 4HAKA 4TOYL 4QHUB 2NY4B 4U6YA 3E2HB 5DHYA 1R0AH 3LN5B 4XVTL 1EJFA 3MDJA 2V7NB 2W07B 3NCFB 1X7TA 3W11C 4M61A 1QFWM 2MQ3A 3MNDA 5IVXE 4ZAKD 5IQ7L 3NTCH 2JVUA 2NNFA 2B4CH 2LFEA 3MRPB 4Y9BA 1NPNA 4OI8A 2P26A 3PJLA 3B9KB 4K9EC 1SEQH 1TOXA 1IZJA 2JK5B 4P3DB 1MN4A 3HI5H 3DXAD 3N9GH 2GPZA 2EVIA 4PJXF 3VYPA 5ISZA 4WNQA 4GKNA 1FE8L 2YGOA 4OM1L 4N90D 4IKIA 2X4NB 1SY6L 4TLTA 4M6OH 3LNDA 3RY5A 5AW3B 1ZT1B 5ANME 2HH0L 4K94L 3VG0H 1AE6H 4GXUN 2MWCA 4FQIL 1D9KB 2IJ0C 1K3IA 5I1GH 1GPOL 2DIAA 2ROXA 1V3KA 1P7KA 2YRLA 4TQIA 3RWHA 5KYXA