1OD7A

N-terminal of sialoadhesin in complex with me-a-9-n-(naphthyl-2-carbonyl)-amino-9-deoxy-neu5ac (nap compound)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
118
structure length
118
Chain Sequence
TWGVSSPKNVQGLSGSCLLIPCIFSYPADVPVSNGITAIWYYDYSGKRQVVIHSGDPKLVDKRFRGRAELMGNMDHKVCNLLLKDLKPEDSGTYNFRFEISDSNRWLDVKGTTVTVTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lectin/immnue system
molecule keywords SIALOADHESIN
publication title Structure-Guided Design of Sialic Acid-Based Siglec Inhibitors and Crystallographic Analysis in Complex with Sialoadhesin
pubmed doi rcsb
source organism Mus musculus
total genus 22
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2003-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1od7A00
3BH8A 4XNZC 4GKNA 2YRPA 3RU8H 3QIBD 3VW3L 4ZUSB 4MNQA 2Y36H 1JYWA 4XP1H 5DJAA 4HDIB 4PGBA 5FKAB 4FHBD 1WTLA 1WK0A 1UACL 2OI9B 4DGYH 3UDWA 1M05A 3D0LA 2D7NA 4XNYH 3VI4F 4G6AC 3D39A 4XNMA 5IEKB 4X9IA 5K59F 2YD5A 3U36B 1KELL 4NQCD 3QXDA 2Z91A 4I0CC 1A1NA 4JY6A 4OFKA 4TSBH 4EBQL 1UYWL 3W0WE 2GK0B 3EYFA 4Y4KA 2GW5A 2AXHA 3WN5C 4ZO8A 4LAJH 4GS7C 4GS7B 3KLDA 4PJXB 4W6WB 1XF5B 1MCPH 4K94H 4EDXB 3G08A 4N0FB 4G8EB 4LRIC 2HP4A 2VZUA 5BS0A 4MD4B 3H3KA 3AS1A 4ZUWA 3LEVH 4PV8A 4L4VE 5DEZA 4Q2ZB 1UB6A 4HIHA 3HR5A 2LTQC 1YPZB 4GLRH 2LTQB 3MRFA 3Q3GA 3EGSA 4I13B 4YDKH 3UTTD 2H26B 1PEWA 3O9WB 1D9KA 4O2FA 4MHHG 3EAKA 4LL9A 3PGFH 4NQEB 4EN3C 2XTLA 4EN3B 3OXRA 5E5MA 5IJKA 4OCXL 4MSWA 4K71B 1CFTA 4U49A 5A3ID 1INEL 1YY9C 5MEOB 1WC7A 3L7EA 1AO7A 3PG2A 2OTWB 4NO5B 4O5LL 3RIFK 5KS9F 1A6WL 3T1WA 2VDPH 2PW2A 1A14L 3MRPA 5MENB 3BW9B 1N5AB 2ZCLL 1CF8L 3SE3C 3WFDH 4HG4J 4XNQA 1YN7A 5BQ7A 5DJZA 3VH8A 2QEJA 1D6EB 1QD0A 1OP5K 5KS9A 3H42L 2IPKA 4G8GD 2R69H 4JE4B 2FSEA 1FNGB 2P8MB 3HMXL 4HIJB 4IOIA 1JK8B 4JO2L 5D4QA 1MVUB 1RQ5A 1S9XA 2P48B 3LQZB 5GXBB 1B90A 4YQXH 3TP4A 2G5RA 1TTFA 4XHJC 4XP6H 3WKML 5JLZB 1E6OL 3WBDA 4KUZL 2HTKC 3EYOB 5E70A 3RNKB 2E7MA 1JNNL 4OM0L 2P45B 1GGCH 3PWJB 1KFAH 3PP4L 2BVPB 4W70A 3RNQA 4ETYA 1QOKA 5T1LA 4YJZL 2XWTB 3U1SH 4HUUA 5GRXG 2X09A 5C0BB 2OJZL 4FXLA 4U3XA 4P4KB 3MNVB 4G80B 3ZDXE 5I18L 2AV1B 2YN3A 3O2VL 4WW2F 1LGVA 1DVFC 1DVFB 4LIQH 4PRNA 3X3FH 1YN6A 4OLWL 4DKDC 1GGBL 1QLEL 4WW2A 1F3RB 2WV3A 4PRPB 4HH9B 2DTSA 5F1IA 4M03A 4F58H 4QGTA 3WHXA 2ICWB 4WEBH 5EZLB 2FX8L 1CD8A 1MFAH 2ORBH 4JVWA 5BW7A 5D7JA 1JPSL 5GRZA 3HUJB 3R06B 2R9HD 3L3DA 4MB5A 2X9WA 2GCYA 2FR4A 3C6LD 3TCLB 5LGHL 4Q97A 1RULH 1BAFH 4RBPK 4U6XB 3VGAB 2P7TB 5T3XH 1RJLA 3C5JB 5C0EB 1FZMB 2Q1EA 4F37F 4B53A 4LNRB 1K4DA 3QPQD 3ARED 3DSFH 5FECB 4ZTOL 3ULSA 4R90L 3BPCB 2IPTL 2DQIL 1H3XA 1BQHA 3TFKC 5C08B 2AEWA 4HBCL 4FFYL 1FNHA 1T1ZA 2FJFB 3A0OA 4K3DL 4F9PA 2DI9A 3VFMB 4LEXH 1X5XA 5JXAH 3TBTA 3WUZA 4R2GD 2QQKL 4KXZI 4XI5C 5HJ3B 2ZOLA 4MX7B 4P9HC 1NKRA 2D03H 3SGJC 1T20B 5MP6H 4KKCD 4XBEH 4JKPH 4P48A 2CDEB 3WXWH 1DL7H 3OR6B 4JO3L 3VFNA 5I76B 3CLFL 1T80A 3FB5A 1MHEA 2ESVB 4TNVK 3LKOB 4MVBD 3MBXL 3LPGA 5C2BH 3LS4L 3SDYH 2VXTH 1KC5H 5GZND 3QR2A 5GSRB 3R1GH 2Y72A 5I1GL 3KPMB 5ESQB 4NGHH 1RZJC 3VRLE 2FECI 2GITA 4I18A 4KMLB 1UFUA 2ED9A 5EORL 2OL3B 1G9NH 5LAXB 4ELMB 1X7QB 2IF7A 1RSFA 1Q94A 12E8H 1J9CT 1MCRA 3ZHLA 1F4HA 4PGDA 4O9HH 5DHXB 1TVDA 4HXBH 5F9JA 4OV5B 1T03H 2NZIA 3UBXA 3NGBC 3DXAE 1HSAB 1ZSDA 1EJ6A 2OJEB 2VDOH 2OK0H 1UWXK 2HJFA 2HLAB 2UWEF 3QUYD 3VWKB 4HLZH 4QTHA 2UY7A 4Z78B 3M1BB 5J3HD 3FQWB 2A38A 1ZLVH 4HUWA 4M48H 4N8VB 1AXSA 3PV7A 1T0MB 3TO4A 5HHPA 3MCLH 2VL5B 5FV2A 4GW5B 3T2NL 1N8ZB 2UWEA 5C0GA 3DROA 4S1DC 4UDUA 1YMME 5C0JB 1YEKL 4MJIA 2R2HA 5CBEA 2XG5A 5MEPA 4IRZL 1Y0LB 1MJJA 2HAZA 3NIFF 1EPFA 3SCMA 3CZFA 4HWZB 5T3ZH 1CGSH 3D18A 4MJ6B 4X5XB 4ONHA 2FATL 3DX9B 3PWVA 1JPGB 4JZOA 5K9KB 5I8KL 1A3QA 1BJ1H 2E9WA 1WJ3A 3FFDA 2UYLB 1BQSA 4JFDB 3QG7L 4DKFL 2OXHA 1X5KA 4TUOB 4Z5RA 3PUCA 3HNTL 1BOGA 1MHCA 4YFEA 4NO0B 1RMFH 3UTPE 5E99L 1SYSB 4QCIA 4F7TA 3WE6B 2OTUA 1NUNB 2P4AB 1RIHL 1V7ML 4JRXD 4NPYA 3AVEA 2VDQL 3GNMH 5DEGA 4ZS7H 4Z7NF 3VMNA 3X12A 3QDME 1HXMB 1OM3L 15C8L 1G1YA 1OAQL 1QVOB 4JFYB 4KK9C 5KOMC 3L9RA 1UEYA 3KAAA 2X4NB 3KPPB 3UAJD 5CJ5A 2BVEA 1I7UB 4K3GA 4XWGL 3WHE1 3VXME 3AS0A 2PR4H 4P23C 4DVBB 4P23B 3ZTNL 1KTLA 4XPFH 4PJ5D 3DURB 4RGMB 3KLAB 1P4BL 2R0WH 3GBNH 4L8CB 1D5ZB 4J3TA 1TIUA 5FYJD 3X11A 1DUZA 3FB7A 1I1AB 5D1QB 1BFOA 4YDJB 2ICWJ 3ZL4H 4ALAH 3F5WA 4OT1L 4UB0L 5DTFA 1MWAB 4HX1A 5DVLA 2P8PA 3QUZC 5GHWH 1ZS8B 3PJSB 1FO0B 5C9KA 2G2RB 3MNZA 2J7LA 3AAZB 3WSQL 5D2LF 3S3PA 4QT5B 3ILQC 3U4BL 3RJDA 1MCKA 4WUUB 3GGWB 3DVFA 2EE2A 1FVDB 3CFEB 3F6IA 3D85B 4PLKD 5D2LA 5K9OA 5DURB 3MLPA 1QSZA 2IH1B 2ATPB 3QRGH 3GMOA 4XNXH 5GGQL 4ZUTB 3D3VA 1MIEL 4M7KH 1RHFA 4Q74A 4I48B 1U8PA 5C70A 1JZ4A 5DQ9A 1FL5A 1SEBB 2FGWH 3LZFL 3W11C 2W38A 4G42B 1O7VA 3HG1A 1KN2L 1Q9KB 1AXTH 1JFQL 4K9EC 4X5LA 1FJ1B 5EFIB 5DLMH 3QEQD 1OSPL 4JJ5A 2Y23A 3BSZL 1FSKB 2EE6A 5TH2B 2L4OA 3SGEH 1RUQL 3SOBH 1LD9A 4ERSH 5I0ZA 5EUKA 1U8KA 4HC1H 4OD3L 1PFCA 3BUYB 2VISA 3QQ9D 4HUXB 5I75C 5DJDB 5I75B 1MCNA 2FEEI 2Z35A 4P5KB 4FQHB 4WFGE 1QLRA 3RDTD 4M7LH 5FA4A 1HEZB 4RIRB 5KSAC 5EBMB 2FYYA 5KSAB 3KVQA 2Q87A 4D9QE 2HFTA 1VPOH 2VE6B 1JRHL 3UYOD 1ZGLM 3B5HA 3OKMA 3PDOA 1WBYB 4TQEH 3O4LB 3MJ7B 4L3EE 2N1KA 2A6IA 1ACZA 5E8PB 2JIXA 5KVGL 1ZLUH 1H5BB 2FCBA 1I3UA 5KAQG 3MA9L 1A6TA 4QF1A 2HRPH 4FQLH 1QFHA 4HJJH 4XZUB 1BD2E 5HGDA 5CGTA 3UYRH 5B38G 3T0XA 4AYFA 4P5TB 3NCCB 4XGZA 4GG6B 4YNYA 2C1PB 3O3DA 4PJEE 2W0LA 2R23B 1I8MA 1OAUH 3P0VL 2ADFL 4NQDB 3RUGF 2HN7B 4HS6B 2F74A 4H0HB 4OSUH 1R3JA 1CT8B 4MD5A 2VWEE 4NWTH 1JGEB 3NH7L 1RURH 1RZ7H 1H3UA 4HWBH 4E5XA 1ODAA 1HSBB 3E8UH 2FH6A 4UUJB 4ONGL 3RUGA 1AGEB 5E8OA 2CGRL 4IHOA 1F13A 2IBGA 4PY7B 5F9DC 5I19H 3IRZA 3RVXD 1G6RB 4FG6C 1GAFH 2Q3ZA 2YZ8A 2J8HA 3QAZC 3C60D 1XIWA 4HWBA 3VFGH 4N0RA 1QKZH 1TNMA 1ZLWH 1NFDF 4MS8D 2O5ZH 1EMTL 4WTWA 1INDL 4PJAB 5TQ2L 4ZUUB 4LFHD 5MI0B 3X3GL 1IGJA 1OLZA 5D1XC 3LKPB 5D1XB 1MPAH 4LPTA 1MFBL 1NFDA 1GC1L 3BKCL 3I6LE 1YC8A 4P99A 3U9PH 1OAYH 4R26H 3IF1B 4P46D 3KWWA 5CMAB 4U1NA 4C59B 2BMKB 5IESH 3GSNL 4LMQE 4LVEA 3UJIH 4RGNC 1II4E 1TENA 2O61B 4IMKC 4Y1AB 1NCBH 2FZ3A 2NY6C 4D8PA 2NY6B 2PYEA 3BAEL 5DR5H 1OTSD 4EUPG 5AZ2L 1CFVH 4DW2L 4X7DC 3QA3B 1J0KA 2R8SL 3PHQA 4GAJL 5KSUA 4Y5XB 3VFSB 1KJMB 4ZYKA 4OLZH 1MI5D 5EN2A 5TDOB 4P3CL 4ISVB 1FC2D 5F6IC 5F6IB 4ZQKB 4E42A 3JSSA 2BNQB 1EFQA 1NCWL 5IBUG 1G7MB 2LE9A 2QKIA 3CSBA 1BFTA 2YRZA 4NKMB 2R1WA 3JWDL 5F89B 4U0QB 2GQHA 2VSDA 1FDLH 3GMRA 3FTGB 4V1DD 1IGMH 1NCCL 4RFOL 2PO6C 4H26A 2Y5TA 5EA0H 3W2DL 3GK8L 3QEGL 3LD8C 3PWPE 5T1KB 1LO4H 3LD8B 3TBYA 5GSVB 5ANMA 1OGAA 1UJ3C 3LKNB 4WFHE 1IFHL 2Y7QB 5DA0B 2BFVH 1Q72L 4DEPC 8FABA 4ZFFB 2WBJA 3DO7B 4GRLA 3B6SB 1ZHBA 3BEVB 2NXZC 3U0PA 4JQVA 4JDTL 5IR1B 3QDJD 4GMTL 4ZXBD 4AEIL 1KBGL 1J0ZA 1HHIB 1IM9B 1FNSL 3UEZA 3BDXA 5DUBB 3TVMD 3BO8A 4Y4FC 1JHTB 4R96A 3O2WL 4UIMA 1AGDA 4E41B 4G7YL 2IFGA 5DO2D 2EICA 5JR1L 3UJTL 3GUTA 3U6RB 1JUFA 3STLB 4XCFH 4XVUC 4NRYA 5CSGA 2CJUL 3G6DH 5C0RH 1C5BH 5I1KL 3NFSH 3NTCL 3F7VB 4X0KB 3WFHA 2UZYB 1CDYA 1I8KB 3QEHA 3QWOB 4PTTB 1G0YR 3TJHD 3IKCB 2DBJA 1S7QA 3MRMB 4KZDL 4EZMA 2C4FT 3X17A 3ARFD 5D7LA 4EVNB 1RUKH 2HTLD 4IRJD 3MACH 4MHHI 2DYPA 1KEGL 2EYSA 4LLDB 2LU7A 3BXNA 3IB4A 5HHMD 4X8XA 1QRNA 5D6CA 2X05A 1KCRH 1JZ5A 3C5ZB 1ZEAL 4Y16D 3CSYB 5DWUL 2ICEA 2UVFA 3U82B 3OGOE 2NLJB 3W0WB 2ADGB 4GJTB 2ZUYA 2NY0B 1AQDB 4UI2A 4YFDB 4PLJD 3I75B 4ZO7A 1Q38A 4QRUA 1RZGB 3RTQC 2Y25A 4BQ6A 3DVGB 4JEGB 4G3YL 1MCSA 4XC1L 1CFQA 3MOAL 2C3VB 4L4VB 2B1AH 5ERWB 4LRNL 1SBSH 3KDMA 4HIXL 5C0NC 3E6HA 5H2BB 4IRSB 1I9RH 4BH7B 2R2EB 5I16B 5HYSG 3B9KA 4RRPA 2AJ3A 2IBBA 4YEEA 3O8XA 4K3JL 4PJGE 3GSUA 4LSVL 1KXVC 5J13B 4GRWB 2A1WL 5SWSD 2A77H 1ZHLB 1IAMA 1HE7A 4IIQB 1EO7A 1EUUA 3HE6B 2YHGA 4F8QA 3WUWA 3BGMA 3TT1H 1G84A 4DTGH 3NACH 3MRRA 1SHMA 2ERJB 4PLNC 4PJFF 5BRZD 2VN4A 4KK5D 4I18C 2P44B 2BDNL 4I2XA 1Z0NA 4L9DA 1DLHB 2J4WH 5C07D 3G9VA 3OKLA 2AJSH 1BIIA 1FZKB 3KXFD 4JFQB 1G1CA 5FGBA 2X4SB 5IM7B 4PJFA 3S6CA 5KVEL 1TJHH 3ULVD 1EAPA 1ZVSA 1Z9SA 3DX8B 4U7MA 3VXQA 1DEDA 2DOCA 1IJ9A 1CL7I 2WQRA 5FF6A 5J8OA 4TRPH 4CBPA 3DUSB 4HCRH 5IB2B 1FIEA 4P5MA 3ARGC 5DRZA 4OI7A 3B8YA 1AI1L 1S7RA 1U92A 1WFNA 4EI5C 4EI5B 3BD4A 2CIIB 1RJYB 1AD0A 5A16A 4OQTH 3O3BB 3GMLB 4N9OB 5IF0A 4M7ZB 1U8HB 4TVPH 3P77B 3HCVB 4ODTH 4HCRA 4HKBB 3HNSH 3HE7A 2FJGA 3IJYA 2VKXA 4U1LA 3BEWA 2JTDA 1A1MB 1U8OA 2P1YA 4ESKA 3AM8A 5CJOL 3UTSE 5F7DB 1OL0A 3O2DH 4OQTA 4TUKL 1CIDA 3STZA 1ZMYA 1ZWIA 1S3KL 1EBPA 2BCKA 5BZDB 2YBRB 4MA1C 1LDPH 1M6OA 2WUBH 3G6JE 4OGZA 5TF0A 2CKNA 2FHFA 4EXPX 3B43A 1MREL 2CLRB 4M5YH 3LY6A 5INCA 2YPLA 3RWCB 4PR5A 5C6TL 1HIMH 3CH8A 3IRPX 4WENB 2P5EA 3O2DA 3MV9E 1P9MC 1EEQA 3OJVC 3HAEB 5J6GA 3MRNA 3NMEA 1VFBB 1G7JA 4TUJB 5BV7L 3B8SA 1T4KB 2AJVL 5J1AA 4YHNB 4OZFB 3LIZH 3GMPA 3LN5B 5F7LB 5I73C 1MHPH 1M1SA 1A7PH 3LEYL 3TH3T 3DMMB 4PB9H 4JO4L 2X4UA 3G6AA 3T65A 4ZAKC 4ZAKB 3NBNA 5JO5A 3PNWA 4Z7UF 3SO3C 1ND0B 3SO3B 5IWLA 4FQCH 3HN3A 4NP4L 1CD9B 2LAGB 1C5DB 3OKDB 3CFCH 3JV0A 4JQXC 2Q6WA 4Y19A 1IGFL 4Z7UA 2H8PB 4JVUA 1GHFL 4GQPH 5CEZD 2P5WA 1R5WB 3AXLB 3MYJA 5E94A 4FXKA 3C8KB 3SJVA 1Z5LA 4HHAB 5CD5D 1MELA 4ZUVA 2A6KA 1DDHA 5EZJB 3O6KL 2ATKA 1RPQA 3VRIB 1YMHA 3FQRB 1V7NH 3QO0A 1K6QL 4PREA 1EVTC 4MQTB 4WCYL 4JM2C 5FYKE 3MLXH 4LLVB 5I30L 2EDOA 1T04A 3I9GL 1A0QL 1CK0H 2WQ8A 1ZXQA 5F9WC 4HQQH 4PTUB 5FUCE 3RPKA 4PJBF 3BYTA 1A2YA 1Z9LA 3OR7B 3BH9A 4JPKL 4XPTL 3BZFB 4CMMB 3S35L 4JFXB 4LHUG 3P0YH 1UB5B 2H6PA 1MAML 4NUGH 4UIKL 4PJBA 3WJJA 4GW1A 4HPOH 3G5YB 5CZVH 1LDSA 4X4XB 3LS5H 2E27H 4HIIA 5DS8A 4Q9RL 5ITBL 3WFCH 4FQJL 5F6HJ 4L5FL 2F5AL 3DXAB 1EBAA 1X5JA 3MBEA 3IJSA 4BQ8A 3FHQA 2EECA 3QG6B 5CD3B 4JFZH 4WY7H 2HH0H 3QUKA 4OTXL 5DEFA 2AJXL 1JN6B 2N7AA 4X6DF 3DRTA 3QPXL 1XMWA 4PRIA 3R4DA 4D0BB 3MXVL 4RQQA 1FG2A 1FGNH 3U7WH 1J8HA 1EIBA 1X44A 2EDFA 3VI4E 2DBLL 3P73B 1YMMB 5F88A 2VDNL 4X6DA 1N6QL 2R0KH 1IKFH 4JFHD 3IFNL 1QSVA 3OKNB 5HYJE 3O9WD 1MFEL 1NAMB 2E7LA 1ZT1A 4MAUH 1UKTA 3NZHL 3FQNA 4NZTH 5F1OB 4NQED 2ZNXA 2RAMA 1ACYL 4EN3D 5A2FA 4BKLB 1FZJB 4QXUH 5BS0E 5E2UL 4JDVA 3WNOA 4JKKA 3RI5F 1YY9D 4ZFZB 3SQOL 4MXQC 3MCKA 4Q9QH 5DJ6A 1DSFH 5F3BB 5CP3H 2AXFB 1XGRA 3VD9A 5IHUH 5EBLB 1HI6B 1VGEL 32C2A 4L29A 4NZRH 2GJZB 3LEXB 3QIWA 1NCNA 4R6UA 3PWUA 5ID1A 3AROA 3QCVH 3RU8L 4I0PA 5F96H 5F6HI 3C2AL 6FABH 4RAUB 3O4OB 1MFDH 3NCFB 4HBQA 2EYTA 2A9NH 3QDMB 1IL1B 1IEAB 2FD6H 2V7HB 1IBGL 5E08L 5CP3A 4XHJD 1LO3L 1WZLA 2HTKD 4ZFOB 1BVLB 2AABH 2F53E 3IDIB 4HH8A 3TYFA 4O51A 1L0XA 1BZ9A 1DE4A 3GSRB 2J12B 2ZKHL 5J57B 1XZ0B 4JJHA 4PYHA 3V6FA 7FABH 1XF4A 1VFUA 3DV6A 3GSWB 5KSVB 2VH5L 4P4KD 4S1SL 1XIWC 1U91B 5J4MA 3QNXA 2R29H 3GO1H 1AQKH 4JY5L 1DVFD 1NUGA 5HPMB 2EKSB 4ORGB 5HYSB 2FRGP 3MRIA 2WW8A 1W0VB 2VITA 4QRPE 5B8CC 5DMIL 1JZ3A 4OUUB 3AFLA 1NFIA 4PRPD 2FHBA 5E8NA 2YN5A 5JQ6H 4YE4H 4JHWL 3A67L 3OGCA 1PQZB 4LVOC 1VA9A 3U4AA 5L88H 3LRHA 4PGZA 1UXSA 1R5VA 3E3QC 1I1FB 1QP1A 5EC1B 4ODXB 3SQBA 3O6FA 4GKZA 4DN4L 4BELD 1F8TL 4RMQA 1WF5A 3FT2B 2LU3A 2H9GA 2X6MA 5BVPH 4XH2A 3S88H 5L2KA 4G6KH 3CUPA 4GO6B 4LIQE 5IHBA 3KS0J 4WGWB 1A9BA 1DQJA 3WXVL 1E4XI 3L5XH 3WFDL 5C08D 1LP9F 1MRDL 1EVUA 5C1MB 2CLVA 4PV9A 1X5HA 2E7CA 3DX7A 1BQUA 5LGJA 3CFKB 2WBJC 4G5ZL 4XI5D 1LP9A 4XP6L 1ZHNA 4YBQC 5ESAB 1X5IA 4K3EL 4OZHF 3HPJB 2APTA 4P57B 1XGTA 5T3XE 4JG0L 1GGCL 4F7CA 5DSCB 3MFFA 1S9WB 2B5IC 4Z7OF 3B5GA 3CK0L 1OGTA 4YWGL 2XPGB 2ESVD 1LO0H 5FO8B 3U1SL 4OZHA 4PG9A 1UKQA 4D9RD 4CN6A 4L3EB 3LPFA 5JIKA 1MF2H 3GMQA 1QFWH 1KIQB 1KN4L 2DRUA 1EHAA 3PABA 1A3RH 25C8H 4AM0A 3I50L 1BD2B 4WHYG 2P8LA 1MLCA 1GC1C 5I1EL 2YD9A 1B4RA 5GGRB 4LCIL 5I1JL 1CFNA 2BERA 4UTBH 1PKQE 3GSNB 2H41A 4M3JA 3BPNB 1G7IB 5CWSB 1J5OH 5D1ZC 2DN7A 1HKFA 1IT9L 3IU3A 4QRRA 4L8SB 2VWEC 3FQUB 1ITCA 3DECA 1DBKL 5A2IH 4GAYA 3X14B 3B9DA 2JF1A 4LSPH 1GPOH 2R2BA 5KVMC 3VWKD 2XWBA 4R8WL 4XCEA 3V0VB 3LKQB 1T1YB 3KNBB 1CD0A 3B4NA 3K1DA 3UROR 3QBTB 3BIAX 5TE4L 5FOBB 1KGCE 4H1LG 2V9RA 3V5KB 3LQAH 1UCBL 4N9GB 2XXMB 3VE0B 4KROB 3JWDC 2Z9TA 1LQSR 3I85A 4XXDB 2I9LB 4Z0XB 1HQ4A 2C1OB 3LKRB 2X4TA 3WNPA 4PRBA 2BRRH 1T22A 3K0WA 1YYLH 3CDCA 5D5MF 2EIDA 3N1QC 3K74B 1T7YA 3E6FB 3L3OA 1S7WB 1E4KA 2UWEE 5JXAL 2EO9A 1QHPA 4JFDD 4U6VL 3LHPL 2LAAA 4OCWL 5D5MA 1G7HB 1X4ZA 2YEZA 5SWZE 3BIKA 3RZCA 3TBWB 3AU1B 3I6GA 3N85H 3UPRB 3EJJX 1EFXB 2CRYA 4NO0D 1XAUA 2YS4A 1FGVH 5I9QC 4LHUB 1EJOH 4K7PY 5F3HB 4DGVL 1CZ8H 3DV4A 2Z8WC 2IQ9L 3DGGB 2QADC 4X4ZA 5JPMB 2GTWA 2QHRL 3CVIL 4NBYB 1TJGH 2X89D 4KK9D 4LPYA 2BNRE 3UTQB 5GGVL 2O5YL 3FCTB 2A6JA 1PYWB 3LDBB 3Q6GH 1G9NL 3PGDA 5D93C 4P23D 5D93B 5E00B 3PIQA 4MD0A 4M1GH 3PWPB 3T77B 5EO1A 5T1MA 5HYEA 4YO0B 1UWXH 4QHNA 1AY1L 4DZ8B 1KJ3L 3D0VA 3MLWH 5D1QD 5I15L 5FO9B 3QWRA 1GOGA 3IFPB 3MZGB 3S5LB 4OIBA 3IETA 3QI9A 1QA9B 2VJXA 4A6YB 5L7XH 4JANA 5E2WL 4AT6B 2W0FA 4Z7NE 4IJ3B 1H8NA 1KB5L 4G8GE 4M48L 3GHBH 5BZWB 1N2RB 1HHKA 2Z93A 4U31A 4WUUD 5TQ0L 2WINB 2CUIA 3PQYE 4EOWH 1KENH 3D85D 3TBSB 4ODVH 4P4RA 5BOZG 5DURD 2BVQA 3SKOB 5FA3A 3RPIA 1FH5H 4LARH 2BOBA 1HH9B 2VZTA 3CX5K 3P30L 1RY7B 4A2LA 1YEDB 1YC7A 4J1UB 1U58B 3K4ZA 3OKOB 4HFWB 4KRLB 3W11D 4RNRB 3S98A 1FE8L 4S2SB 4DGIH 3ZYJA 3BRFA 1CIUA 4GXVH 3V6ZB 3PWNB 5H8DA 1DCLA 1P7KB 1F4YL 4M1DH 3BZEA 1RZFL 1UQSB 2W9EH 3IKKA 4C83A 4RGOL 3L7FB 1E28A 1ZGLA 2QQNL 2WIIB 5F8QC 1IGYA 4LCYB 3BZ4B 3MLVH 5F21B 2I9TA 3ZSTA 1ZOXA 4X5WA 5FK9A 5L9DH 2X7LA 1YQVH 1MLBB 4NO3A 3BQUA 5GQBA 4MAYC 2IMMA 4MAYB 4JY4B 4PRAB 3Q48A 3ILPA 5LCVH 3O11A 1HWGB 3BVNB 1R24A 3D48R 3VH8G 5KSAD 4Q0XL 4OM1H 5EU4B 2P43B 4LBEA 4NQCA 2XN9E 4LLUB 3FT4A 3O4LD 5FKPB 2KDGA 2UVEA 1B9ZA 4BZ1H 1IQDB 4H25A 4FQ1L 4E0RB 1KYOK 3NIDF 1IC5L 5IW6B 2CR3A 4OJFL 5C3LD 1PZ5A 1QACA 2V17L 3DOSA 2NTSP 4J4PC 1S7UB 1CXHA 1K5NA 4QXTB 3P4OB 2EXWC 5GRVK 3V0WL 1T5XA 2NY5H 3JV6A 5DJCA 1MFNA 5DF0A 3WIIH 4NQVA 2A83A 5IB3A 4NQDD 1AFVH 5IB1A 2X70A 5GS0C 3WD5L 2CK0L 3QRGL 5IW3A 4LCCC 4LCCB 3RWHB 3H9SE 1EXUA 1RK1A 4XTRD 4A2MA 1CBVH 4M4RA 5IMMA 3K2UL 4FG6D 4KC3B 2OM5A 3GSXA 1FNEB 2H32B 2Y07L 1MNUH 2FWOB 4OLUH 3SPVB 1QBAA 4NOBA 4ZDHB 5L2JB 1OCWL 3GMMA 5FHBL 4W6YB 1DP0A 3OBAA 5E8DH 1JNHA 3KYOA 2IJ0C 3TM6A 3SOBL 3RWFA 1P4LB 4GRMA 5D1XD 4MNGE 1WWWX 3W5NA 2C3HA 4X9FA 4WV1C 4WV1B 1CVRA 1ZVHA 2ZG1A 2ILLA 2GAZB 4GUPB 3IAQA 1F58L 1N59A 1JWSA 1U8LB 1UC6A 4Y1AD 4EQ3A 5DUMH 3EO1A 2DM2A 1MEXL 4UT7H 2E6QA 1DQDL 2NY6D 5L8JB 5DRXA 4BH8A 4KV5E 4HKZA 5F9OH 3WDHA 2IALA 1BQHG 3TIEA 3UTSB 1CICB 1XR9A 1MFCL 2JCCF 4XNUL 2DWEB 5FUZH 1IM3B 4PJIF 5SX4I 2AP2A 4M6ML 4P2OC 1MHHA 4P2OB 3K2MC 4TSCH 1J7VR 1CG9B 1DN2A 3RGVC 5CJXA 4OF5A 1RZ8B 3G6JB 1S7VA 2JCCA 2BNQD 4PJIA 2VDML 4ZD3H 4ZPVA 2XZZA 1HNGA 2RFXB 3L3KA 3K81A 1MRCH 3MV9B 3MUY1 4PJ9C 2E7BA 4PJ9B 4CW1B 3CFBB 4CRPA 4YDLB 4LMQI 1Q9OA 3UYRL 1O5DT 4Z8FH 5T1KD 4K7PX 1TVBA 1BJMA 3BPOC 3BPOB 1BVZA 1VACB 3GEWB 3MUGA 4OAWB 5LBSL 3EFFA 3THMH 1PLGL 3PL6C 2V2XA 1ZTXL 4KAQH 3PL6B 4CVZA 1H0DB 3QP3A 5J6HA 3IJHA 4FFVC 2VDRL 1LE9A 4OF8A 3C6LA 1IM9D 3B3IA 3BP5A 3E8UL 3H7LA 3I3DA 4O4YL 5DJ0A 2Z31C 5J9PB 1I1YB 3FJTA 5JORA 2I5YL 2YMXH 1PKOA 5HPOA 1QSFE 4MQ7B 2BRQA 2A74A 5ANME 3IFOA 5C0IB 3AREA 2DDQH 4PJ7E 3UBXG 1PZUB 2J6EH 4E41D 2X4PB 1KPRA 1WICA 4O58H 4Z0BH 5EU7C 1J88A 2R1YA 4WHCA 3EJYD 1XR8B 1F3DH 4G7VH 2FBJH 2H2PC 4QHKJ 4OD2B 1SM3H 5ADOH 4Y2DC 5GZOC 4N8CL 2J6EA 4RWYH 1GZPB 5DC9B 2HJLB 3HTLX 4CL7A 3P4MB 3HI1A 3GI9H 3UJIL 3MGAA 4BA8A 2AI0H 4X7TB 5GS1A 3TA3B 4I4WA 5DC4B 4JAMA 4BQ9A 1IILE 4XBGA 5K9JL 4LLYB 4DFHA 1MCFA 3VFUA 3BH8B 4GKNB 3MV8A 3VG0H 4XX1G 4R3SB 3C5ZD 2AJYH 4NKQB 1L7TH 4OLZL 3SE9H 4MNQB 4NM8L 4CVXB 4NJ9L 1H15B 1ED3A 1RZIA 4NRZB 3QNZA 2BNUB 4NQSA 1JE6A 3W0WD 3ZDYF 5A40E 2NY0D 5I1IL 2GY7B 1A02N 3MRBB 4O02L 3RQ3A 3IDNA 4KQ4H 2EDTA 1D7FA 1M05B 1ETZA 2V5YA 1IEHA 2DQEL 1A7NH 1OTUD 4PGEA 3TPKA 1F4WL 2DL9A 4XNMB 3P4NA 5J89A 3JZ7A 1QRNE 3MYZA 3NN8A 1LO4L 3VA2C 4QHKI 4L4VD 5CAYB 2Z91B 3Q6FA 1IC4L 5C9JA 1A1NB 4CU8A 4WGVB 5FYJL 3FB8A 3MTRA 4XPHL 4QWWD 3O3AB 5HYJB 4Y4KB 2E9IA 2XWJB 1N0XH 1T7WA 1UXWA 3QUYA 4JRWA 2X41A 3G08B 1NJ9B 3GIVA 3CDGA 3ZO0A 2MCG1 5BS0B 4S1RH 1UH2A 3MJ8B 3U7YL 2PYFA 5F7EH 2IWGA 5JMOC 4U2ZA 1B0RA 1FVEA 3ARQA 4PV8B 1Z9OA 3C8HA 1DTUA 1FPTL 3MRFB 4XVSH 5HI3C 3EGSB 4CJ1A 1WT5C 5T1DL 2IAMA 3ZE1F 3GSVA 4XCFL 3MJ9H 3EFDH 4M8VA 4FP8H 5C0RL 2CMRH 5JHLH 3MROA 4Y2OA 4LSTL 3OXRB 5E5MB 3RAJH 2HJKB 1DQML 4YHML 4APQC 3BP4A 2Q3AA 4AEHH 4APQB 4J23A 2F9BT 3HRZA 3L7EB 1AO7B 1S7XA 4JPWH 3S37X 3BKML 2Q76A 1U41A 4QHLA 4DJMA 4F7MB 1PW3A 2PW2B 3V52H 3MRPB 1G0XA 2OSLA 3SDCA 1IAKA 4EIZC 4I2XE 4EI5D 1Z3GL 1IMHC 5C09E 5EZOH 5K33A 1Q1JH 1NC2A 5HDQH 2AEQL 4JRXA 5EU5A 3RKDC 3WFBH 1MCIA 3T4YA 5IHLB 1C8PA 5DD3L 1KOAA 1O0VA 1CLOL 5ACZA 3WNMA 1EZVY 2G75B 3ROOB 4X6EA 3RVWC 2BOCB 3TN0C 1BFVH 3MODL 4XMKH 5D71L 5TGBA 4EIGB 3EOTH 4MXWL 4PJ5A 2APXA 3RNQB 3IXAA 4QRPB 1JNJA 3UC0H 5T1LB 4BSWA 1BVKA 3TT3L 2ARJB 5I1AB 3VG9C 4K07A 4NNXB 3VG9B 4FQXC 2B1AL 4FQXB 5LXGL 3I2CL 4PJ8C 1K2DB 1T2QL 1D6VH 5HHQA 1E4KC 4HLJA 5SWQA 2VC2L 2Q8BL 5FGRA 4R4NC 1VCAA 3PF2A 4PRNB 1Y18A 2QR0B 3KPQA 3MRLA 1C08A 2V5MA 3V79C 2YD8A 4WUKH 4WU7B 2OR9L 4XP4H 3ZMRA 3D5OF 3RP1A 2ZUQB 1J8KA 1MCEA 3RWJA 2YPVH 5KN5A 4YXLL 4TSAL 3L5HA 1ZA3B 2Q86A 3MREA 3NACL 2AJZA 4TNWF 5D7JB 2P5EE 4ZAKD 3T0EE 4MJ2A 2GCYB 4XCCH 3LB6C 4YDIL 3WS6A 5HDBF 4KI5F 4YAQA 1RJLB 3EHBC 2HT2C 5ALCH 5IW1A 1I8IA 3MO1B 2X1XR 5D2NA 1R3IL 4LDOB 2DQGL 3JVGA 5FYLE 4M5ZH 3ARWA 3ROLB 4M6AA 2CRMA 3QEQA 1J05B 4M1CD 2XY1A 1OAKL 4P3DB 3EJZC 3ULSB 5EDXA 3A6BH 4H88L 2JB5L 1ZT4B 5BJTB 2EDHA 3PDDA 3ARDC 3ARDB 4R7NA 3VGHA 4W4OA 4KJQC 1YEHH 1BM3H 4NT6B 5EOTA 1DBML 4Y19E 3VGFA 4GKOA 4M93C 4ODTL 2JJSA 3RDTA 1D5XB 4M93B 3M17A 3SBWC 2DM4A 2FL5A 2ZOLB 5EH1A 2DQHL 1Z2KA 3S97C 3U7AA 2BHYA 1U8IA 2BY0A 1KTRL 3FB5B 1ES0A 1MHEB 5T33L 1PKQB 1X3DA 2QSVA 1LNUB 5IJVA 4NUJA 5DK0A 1HXYB 2EE9A 3BISA 1A7BA 2I07A 5F70A 5FYLL 3REVA 3DXAD 4CDGC 2L0DA 1N5YH 4M3KB 5B39A 4HGMA 3MLZH 1KEMH 2XZCH 1DN0A 2BSSB 1DBJH 3QIBC 1Q94B 4ELKB 1WWAX 4ZTPH 1P5UA 3SE4A 4K8RH 1F45A 2VNCA 1GIGH 3C08H 1QNZH 3VFWB 2NY7H 1HKLH 5J1TC 3QDGE 4OB5H 1YMMD 2F5BH 4NN6C 4CNIB 2F19L 4K2UL 1MSPA 1A7PL 1RAMA 2LQRA 4OFPA 3BDYL 3UBXB 3VXSE 1G9NC 5E0QA 5ELIA 4HUVA 1G7QB 3U0TB 1FIGH 1A1OA 2W0KA 3ARVA 4KVNH 4GMSL 4NKDB 2EH7H 2QSCH 4YGVA 4D0DA 3HB3C 3QQ3B 3CVHL 3H9HA 5DVNA 4PJDF 5HHPB 5KW9H 4YPJA 3C60A 5HD8C 2UWEB 4UV7L 3K7UA 5HHXH 4MXQD 1X5FA 4MZ2A 3SEPA 2GKIA 3A6CH 5CEYB 5SWZB 3TESA 3GSOB 4OBSA 1A5FH 4PJDA 3ZE2F 1MJJB 4LK4A 4MJ5B 4PB0H 1CE1H 3O41B 3FOLB 4YLQT 3UTPD 4C56E 3CZFB 2BC4A 2ZOKA 4F2MA 3N1PC 4KDVA 4FZ8H 1NGPH 1YEJH 3MRDA 4JZOB 5AD0A 4LAQH 3ZKMC 2EH8L 3IAGC 3U9UA 5IQ9B 3QDMD 4JZJA 4Z7VF 4ZNEE 4AH2A 2ADIA 1OF2B 4KTEL 3LSOB 1JZ6A 1N64L 2BNRB 4HEPG 1XGQB 3OJDB 4Z5RB 5MEQB 2AQ3A 4YFLF 1BOGB 1EA9C 4HFUH 3WFEL 4Z7VA 1C5CH 3T2OA 3G04A 1QSEE 2PKDA 4F7TB 2OTUB 2WBWB 5A3IC 4GXUN 3KPRA 2WP3T 1NBQA 5DEGB 2Q7YA 4UV4H 1LK2B 3KYMB 2ITDA 5JW3H 3X12B 4F37K 3CSPA 1GGYA 1I7TA 4P2QE 3QJHA 4U7KA 1ORSA 5DMGC 5E4EC 4RA0C 4LHJB 1K8DA 2Y06H 2DMCA 4V1DA 3HLAB 4G8FB 1EGJH 3HC4L 4N0CD 5D96B 4GLRI 1DJSA 1KTLB 3HZKA 5CGYD 1FBIH 3RA7L 2WAHA 3DBXB 5AG9A 2XT1B 1KJ2H 3RRQA 3HI6L 4LCWA 43C9B 2VOTA 2IFFL 3FB7B 1CDUA 1FL6B 4XB8A 5ITFA 5EIVA 1B3JA 3SGKA 1N4XL 4LPWA 5TE7L 3TWCL 2DQCL 3QDJA 1XF3B 4ZXBA 5DTFB 4LPXA 4HX1B 3S36L 3TH4T 5IT2L 2P8PB 5DDHB 4J6RH 4AIZA 4Z18A 1CDHA 3CVHA 4P59L 3NFNB 3GJFH 4JN2A 1AJ7L 1ZE3C 1KJ2A 2GTZB 3F58H 3TVMA 4LLWA 1MCCA 3KYKH 1O7SA 1VGKA 2JJWA 3GRWH 1XF1A 3ARSA 3IDJA 4J3UA 3SKNB 1I85A 3NAAH 4H20H 4IMLB 4KRPB 5ICYA 5C6WH 3RY4A 4RRPG 2UY6A 2G9HA 1NCAL 1TZGH 3GJFA 3HR6A 4GBXC 4RMSA 5CUSH 4GBXB 5FYKU 4IDJH 3FN0L 4JQIL 4PJHE 5D9SB 1NBVH 5HHVL 3GRWA 4OLEA 4NZRL 5CILL 1TDQA 5I1DA 5F96L 3V4UH 6FABL 3WUWG 4XT1C 4PRHE 4HPYL 4I5BA 5FB8A 3ARFA 4F57L 4POZC 4WFGD 3ULVL 4NKIH 4JN1L 4IRJA 4G6MH 4YBQD 1AGBA 5TE6L 2BK8A 1WZ1H 3MC0A 4D9QD 2BVYA 4HGKC 4NO2A 5IMKB 5DD5H 1U8KB 2XN9B 4JKMA 2FIKB 4RFNB 4RFNC 4EUPH 4Y16A 2JB6A 5I8OH 4PG2C 4L3ED 4KVCL 3P9MA 3M07A 4Y5YB 4XAKE 4MNHA 2VISB 4LQ1A 5I6XC 5I6XB 3GSQA 3CXDH 4YHPA 4DN3L 2VDLH 2R29L 3TJEH 3C6SA 1FFQA 1BD2D 2A9ML 2IGFL 2COQA 3PGCA 4XCNB 4DZBB 3RWIA 1CGYA 2FYYB 2RB8A 1ONQA 4YHKH 5CP7A 3E2HB 4FABH 1SJVA 1RFDL 3PDOB 4OCYL 4U1GB 4H8WL 2H3NA 4YE4L 3D25B 3UZQA 4N0YH 3MRJA 2PN5A 4R2GC 4WHTA 4QF1B 5JUEH 3WL9A 1IAIH 4FQIL 2DIJA 3H9SB 3OTTA 5SWSA 4RMTA 3X13B 1I3RA 1OB1A 2RQ8A 3VXTB 3FN3A 3VRJA 4DKEL 4BZ2H 3V7AG 4NNPL 4WI6A 4S1QH 3GHEL 4QXGH 3VWJC 5GZNC 3VWJB 1S5IH 5BVPL 6CGTA 3V4VH 2FBOJ 4KROD 1A7RL 1I9JL 4X8JB 4QRRE 3U4EB 1R3JB 1M71A 5BRZA 2DMKA 3ARBA 3PWLA 3ZE0F 1U6AH 3KJ4C 3RL1B 3KJ4B 4L9LA 3GFUA 3KXFA 1XF2A 5E8OB 4MNGB 3OKYA 1MJ7H 2YPKA 3F6LA 3DLQR 4OZGF 3I6LD 5IP4A 1S9KC 4BSVB 3T8XA 5I74B 2DQFA 4FZEH 4POUB 1JPTH 5IROA 2FECL 2OQJA 4WFFE 3VXPA 5SV4A 3F7YA 4OZIF 2FX9H 1JGDA 4IEFB 3SGDH 1R3LA 4OZGA 4CVWA 1WQVT 4Q58C 4U1KB 1NL0H 2GUOB 4UT9L 1T2JA 5JQHC 1EFXD 2NZ9C 4OZIA 5FUOL 1CXFA 1BJ1J 2NY1B 4FMFA 3UBXI 3HZYA 4QHUA 1PG7X 3KWWB 5K9QG 4R4FH 4NBZB 5DHYB 4U1NB 2YWYA 4LHQB 1A6ZB 3WKNA 5HYFA 3WIFB 1KJVA 2HVKB 3EO9H 1UH4A 1CU4L 1MCLA 2FZ3B 3CFIC 3NIGF 5I66A 1ZHKB 1OAXH 2JELH 3MLUH 4MQXD 4HJ0D 2RCSH 4M00A 2F54A 4ZSOA 4AENA 4WWID 1MJUL 3PWPD 5KSUB 3OXSB 2QQLH 4ZYKB 2HT4C 4WFHD 5EIIA 3CZJA 1KB9K 1RU9L 2XI9A 3WO4B 1UT9A 1Q0YL 2OBGA 4QNPE 5A43C 3T2PA 1BLNB 2QKIB 5E8EA 2EIEA 5MENE 1QFUH 1GPOL 1I7RA 3GMRB 5DJYA 2A2QT 4KWUA 1KLGB 2YR3A 4H26B 2Y5TB 1NAKH 2HG5B 1QSFB 3HI5L 3HC0B 3TBYB 5ANMB 3T3PE 1W2KT 4WI9A 4PJ7B 5FDWA 1IQWH 4DFIA 3MNWA 8FABB 5KSBF 3N0PB 1ZHBB 4U6HA 1NLBH 5IVXE 4Z76A 3U0PB 2HKHL 3GIZL 3VXUE 5IBLC 3W9EA 1U8JB 2X1QA 1M7IA 5KSBA 3TYGH 2NW3A 1IEBA 5IHZB 2FH8A 2D7QA 4LKCA 3BO8B 2DMBA 2Z4QA 5C0BE 1MUJA 3ORJA 4R96B 4DQOH 2DLGA 1KB9J 4ODUA 4UIMB 2OZ4H 5AYQA 4IS6A 1TCRA 2YD2A 2A0LC 1NMAH 1KPUB 3QXWA 4RMUA 5B3JE 3HC3L 1QZ1A 2N4IA 1EEUA 2IMNA 4NRYB 1CXKA 3T1FB 4R9HA 2M8XA 1CQYA 4ZUSA 3QSKB 5IGXH 1E6JH 4XP5H 3WFHB 1L7IL 1IKNC 3QEHB 3G5ZB 2NX5E 1JHLH 1KCKA 2VTFA 4CAGA 5FKAA 4MAYD 4S0SD 5GIRA 4XPAH 2X10A 4X7SH 2E9BA 4GKSB 5GGSY 3B2VL 4UOW0 1DLFL 2GJ6E 5JIIA 1JHKL 1AE6L 1Y6KR 1A47A 5IEKA 5EO0B 3U36A 1QRNB 5D6CB 1QBMH 4ODWB 1RIVH 4PS4H 4XPBL 2QLVB 3V0AC 2XZQL 3WN5A 3QQ4A 5B21A 4YHIB 4X7FC 1XF5A 2I60H 3QUMH 4GAGL 4EDXA 2VAAB 3QIUC 3KPLA 3QIUB 4QRUB 4J4PD 4G8EA 3O0RH 5D8JH 4LRIA 5M94B 3LMJH 4CADA 5DYOA 1MCQA 4MD4A 2EXWD 2JJTC 5TFSL 1JTTA 3WDJA 5J12B 3GHBL 1ZLWK 1QR1B 3QQ9C 4LU5L 4EOWL 3RDTC 3E6HB 3IDXL 1SEQH 4AL8L 5GS0D 1YEGL 2DLFH 2ID5A 3FAXA 2AJ3B 1DFBH 3O8XB 4EN3A 1H3VA 5HY9B 5F8RC 1KNOA 2FEEL 5IK3B 2J2ZA 3O45A 4WI7A 4LPCA 4YHYB 5I2IA 2X4RB 3H3BC 4JO1H 4URTB 3SGEI 3ZYZA 1SY6H 5E6ZA 5JW5A 1A6AB 1HZHL 1W72L 3NCJL 5C3TA 3WUWB 3BGMB 3VJ6B 3MV7A 4P3WA 1XH3B 2JE8A 4FFWC 2HT3D 1OW0C 1UVQB 2Y4SA 1C7TA 3VFPB 1T21B 2W9EL 3PP3K 5FO7A 3SE3A 4I2XB 2G60H 1T0NA 4HUMB 1IGIH 1D6EA 3EDFA 5C09B 1X4YA 3OKLB 1BIIB 1SY6A 3QCTH 1JK8A 1BFSA 1MVUA 3MLVL 4JG1H 3LQZA 5L9DL 1EAPB 1ZVSB 5KJRL 2MPAH 4K7PH 5JLZA 1VEMA 5TDPA 1PD6A 2D7PA 2XTJE 2ZWLT 4HWEH 1Y6MR 3PWJA 1RUAH 3UTSD 5L6YH 1CICD 1S7RB 1U92B 1XCTA 2P46B 2XWTA 4P2OD 4MCYB 1JWUB 1AD0B 5A16B 3RVXC 4OLXL 4QHMA 1NCTA 2AV1A 4DWHA 4V2BA 1YJDL 2X9XA 2VABB 3O3EA 3HE7B 1IRAY 1DVFA 1X9QA 3IJYB 3TIDA 1RVFH 4MS8C 5E95B 2B0SH 3DJ9A 3MV9D 4PJ9D 4OIIL 4EDWL 5F71A 1BEYH 1KCVH 1A9EA 5GRUH 3CC5B 4K7FB 2OL3L 2EDJA 3STZB 1EEYA 5DVKA 3HUJF 1UWEH 4WEUD 4UT6H 4HH9A 2BCKB 4NSKB 4P46C 1NGXB 2ICWA 3AGVA 5EZLA 1AFVL 3PL6D 3VD7A 3HUJA 3R06A 5AWNH 1F6AB 1OTSC 2P5EB 4FFVD 3T0EC 3TCLA 3MA7A 1BECA 3C5JA 5GRWA 3MRNB 1X5GA 1I3GL 4UILL 3RL2B 1G7JB 2Z31D 3BD3A 5C0EA 1CBVL 4R0LC 4R0LB 4OGYL 1FFNB 4F9LC 1HYRC 3H7BB 3GMPB 4OGXH 2VB5A 5C0FB 1MNUL 3RGHA 5FECA 3Q5TA 1EK3A 3OKEA 4F15C 4DCQA 2HKFH 3ZT5A 1R0AH 4NZUH 2B4CH 4P9HH 4DOHE 3DPBA 5T5FL 3BPCA 2OR8A 4Y2DD 5C0AA 5FYKD 3TBVA 4X4ME 4NZJA 3ARZA 1YYMH 1AHWC 4RFEB 1AHWB 2W59A 5GZOD 1J87A 1A7OL 4Y19B 3T0BA 4DVRH 1FNLA 1F02I 4RWHA 4MX7A 1YDPB 4ODBD 3MLYL 2C3XA 5E94B 4FXKB 3SGJA 3TA3D 3SJVB 4HT1L 1QYGH 1U9KA 4KHXL 1TVHB 1RUPL 4ZUVB 1RZJH 2CDEA 2A6KB 3OR6A 1SVCP 1HILA 2ARJQ 2ATKB 1YMHB 2ESVA 4PREB 3KPTA 4JPIA 3TVMC 3LKOA 2VLKE 3RWEB 1IGCL 3T0AA 1UM4H 5EPMA 4L3AA 4KFZC 4ELMF 3HZMA 2LVEA 5EZIL 3KPMA 1OTTC 4KY1H 4ZO9A 2DD8L 1EHLL 4GG8B 1BWMA 1A2YB 1MIMH 3BH9B 2VR5A 4ELMA 1X7QA 1NMCC 4K3HA 5JA9A 3MV8E 4HKXB 3PE9A 3N9GH 4JDZB 5IMOB 1CDJA 4BK4A 4XAWH 4OV6F 1FZOA 3G9AB 4D3CL 3TJHC 5KTEH 1FLRH 3QDGB 1LK3H 1UA6L 1KLUA 2VLJE 4J3SA 3DRQB 2EDWA 5M95B 1HSAA 4NN5B 3VXSB 3SE8L 2HFGL 2OJEA 7CGTA 5HYJD 3T0DA 4Y4KD 3IJSB 3RWDB 3S37H 4OLVL 3VWKA 1SMAA 3M1BA 3FQWA 5HVGB 3VXRE 2X5PA 5DEFB 4OLYL 1T0MA 4FRWA 5BS0D 1FO0L 1A6UL 3QZWB 5AZEL 4Y16C 4YHOL 5D6DC 4GW5A 5IKCA 2K7PA 4X9GA 3LRSA 3B2UD 3GB7A 2FO4A 1J8HB 3K1KC 1U8MB 5C0JA 4KHTL 1WCQA 2XNAB 2IG2H 3J8F7 4NJAL 3RFZC 5HI3D 5JNYB 2VL4A 2XY2A 3FQNB 3AY4C 4C56B 4X5XA 3DX9A 2AJUH 3EO0A 3WO3B 3SDXF 5FEBA 2C5DC 4NHCL 1B0WA 2UYLA 4JDVB 4WU5A 4APQD 4L8BB 1ORQB 1N6UA 4JFDA 3IFLL 1JPST 2VQTA 3MCKB 4TUOA 3HFMH 5DK2B 5DJ6B 2F53D 2AI0L 5AYUH 3SDXA 4TYUA 3KPNA 5DMKA 1XGRB 4QTIL 4TULH 5ECJE 3CCHA 1SYSA 4J8RB 4XMLL 1FHGA 32C2B 3BKJL 3QIWB 1QSEB 4HS8H 3WE6A 3BMVA 3PWUB 2E5EA 2ZCHH 3ULUE 1FORH 4OCRL 3NZ8A 2EEDA 1P1ZB 4OCLC 3ZE1E 2EYTB 1REIA 1HXMA 1Q0XH 2WBKA 1QVOA 4JFYA 3U0WL 2X89A 1UM6H 3IDMB 2FB4L 4P2QB 2X4NA 2PCPB 3KPPA 1YEIL 3HZVB 4U6YB 3Q1SH 1I7UA 1BBDL 1MWAH 1I4FA 4I77H 3TYFB 4O51B 1CFSA 4P23A 1DE4B 1NGQH 1PX3A 3DURA 4QRPD 2VLRE 1D5ZA 5T1LD 1ADQH 3ULVC 4YDJA 1WBZB 2XZAH 4FQXD 5FCUL 3QXAA 4LSSL 1KTDB 1B2WH 1XEDA 3L3HB 1MWAA 3O3UN 2H45A 3FO9B 3QNXB 3UMTA 3UZVB 4YBHA 1MCBA 3QUZA 4R4ND 1ZS8A 3PJSA 1FO0A 2G2RA 1FRGL 1U95A 3MMEB 5GGUA 1ADQA 2IBZY 3MRIB 1TJIL 1CL7L 2VITB 4TVSa 4WUUA 3GGWA 4TPRL 3CFEA 1BZ7B 1E4WH 3D85A 3ULUL 2YK1H 3UJJH 4ZODA 5DK3A 3MLRH 4OCSL 2V2TA 2IH1A 2ATPA 4WDIB 3ESUF 4K9EH 1TTGA 5D7JD 1A7QL 2D4DA 4YHLH 4ZUTA 1UXSB 5DVMA 3UO1H 4PJHB 4OKVB 5IEHB 4I48A 4G9DB 1W0YT 3EDDA 2V7NA 5LVEA 5KANG 1G9ML 2HT2D 1SEBA 4LASH 4H8WC 3HPLB 4JZNB 4PRHB 1FJ1A 3QEUA 5EFIA 2LFGA 2H9GB 5GISH 4XH2B 3EW3B 2RGSA 3TNNA 1RZKL 2R0ZH 5TH2A 3EJZD 2YD3A 3QJFB 5ETUA 5T3XD 4QY8B 4XPGL 1A9BB 5EOQL 1WITA 4RDQF 3V7MA 1P2CB 4I3RH 1GGIL 3ARDD 3V5HB 4Q6IC 4CN1A 3BUYA 4ZS6D 5GJTH 4DUXA 5L0QC 3BYYA 4KTDH 5DJDA 1T83C 3STBA 2CLVB 4P5KA 5KVDH 4FQHA 4PV9B 4TOYL 4KZEL 4OFIA 3DX7B 5HVWA 4KI5E 5CEXB 1ZHNB 1LEIA 1HEZA 4RIRA 3SKJL 3KYNB 5EBMA 5KSAA 2OXGA 1KPVB 3VFVB 1KV3A 1BFVL 2MCPH 1OSZA 4F7CB 3MFFB 4FFZH 2X4OA 3QQNA 1JGUL 1OGTB 1WBYA 3ISWA 3O4LA 2YC1A 2ZCKL 2ZJSH 3MJ7A 2JKXA 4CU6A 3GBMH 5E8PA 3OAUL 5EG6C 3GMQB 1CXIA 3V8OA 1OAZH 3UTZB 1J0IA 4U6TA 1MQKH 1U0QA 4G43A 4GG6F 2D7OA 5JA8B 4GW4B 3PABB 4KDTC 4XZUA 3RI5K 1HQRB 5DHVB 3QUXC 2O93L 4XB7A 1YEEL 3VFRA 3FO1A 2P8LB 1ZAGA 4D94A 4GG6A 1PVHA 3WLWC 5DUPL 2YXFA 4WUKL 1KGCD 1CFNB 5K9QI 4YC2C 2XIDA 5GGTH 1XGYH 4YC2B 3PV6B 3L1OH 2KZWA 1T89C 4MXVE 2HN7A 3WHE0 1WIOA 1CT8A 4QRRB 4M62H 1JGEA 1NKOA 2OI9C 1HSBA 5B22A 4UUJA 1LO2H 2W07A 3DI3B 2NTFB 3WNKA 1JNLH 1MVFA 2E3VA 4HGWA 2XWBB 4TTGA 5GGTA 4XCEB 1H3PL 1G6RA 3AB0C 1SJEB 3AB0B 3HNVL 2YZ1A 3HB3D 4HIEA 4PJAF 1X5LA 2UZIH 4KQ3L 4WTXA 1P84K 1V3KA 2DQDL 3RHWF 5HD8D 4KRNA 4ZOEA 1NLDL 4NIKB 2MKLC 3KPSA 1F90L 3LRGA 5DRWB 3DO3A 5SWZD 2VXQL 2D31B 4NDMA 4PJAA 2ZUTA 4ZUUA 1U3HC 2GK2A 1U3HB 3VGDA 5D1XA 3QCUH 4PRBB 1T22B 2XXCB 3TGXA 1A4JA 2BSRA 3IF1A 4GSDH 3VI3E 5CMAA 2BMKA 4X6CF 3ZKMD 3C5SB 3CD4A 2B2XL 1FG9C 1RHHB 4IMKA 4UNTA 1OVZA 1UWGH 2BNRD 2IH3B 3GM8A 4OD1L 3JTSB 4M7JH 2YEZB 1QQDA 3O9WC 3BIKB 2R4SL 4X6CA 3IDYB 3QA3A 4PJDE 4GRWE 3VW3H 4L4TA 4K71C 4ISVA 4ZQKA 1D5IL 2BNQA 5F1NB 2HLFC 2XKNA 1P84J 1UACH 1OY3B 1GYAA 4N0UA 4NKMA 1HDMA 5F89A 3WJLC 5DMGD 3FTGA 1GOFA 3RZWA 1Y6NR 4IBLT 2PO6A 1KELH 2AGJL 3TO2A 4Z7VE 1NEZA 1UJ3A 5T1MB 4C54A 4QHNB 2NXYB 3PQYD 2GEEA 2MHAB 3KPRE 3C08L 43CAB 4EBQH 1NCUA 1UYWH 3B6SA 3BEVA 3K8MA 2UZXB 3D9AL 5IVXB 5TPWL 5FFLA 5IR1A 2UUDH 3TV3L 1A8JH 1HHIA 1IM9A 3VXUB 3IETB 2GYSA 4YPGB 3QI9B 3CLEL 5HHOE 3MLTB 2QBWA 2XICA 4KVNL 4X4YB 2W0FB 5DUBA 5HGAA 3SKMA 4Y4FA 1JHTA 3MRKB 4YDVB 1IARB 1CD1B 2Z93B 3FT3B 4P4KC 4F33B 3BHBA 3WIHL 1A6VL 4LCWE 1NDMA 3S35X 4KRPD 4P4RB 1LO5B 3U6RA 1NBYA 3STLA 3GMNA 1HINH 4NNYB 3V4PL 4MDJB 4Z77A 4GBXD 3SDDC 1MY7A 3SDDB 2BOBB 3L6FB 5F97E 5F7UA 3RKPA 1J1OL 4OCXH 4M02A 3O6ML 2IBZX 3QWOA 1HCFX 4PTTA 4G9FA 1INEH 2NX5B 3MRMA 4X98A 2YUVA 1AGFA 4LSQL 2DI8A 4POZD 4RZCB 4O5LH 5EC2A 4EVNA 4JCLA 1A6WH 2VZVA 2VQ1B 1A14H 2GJ6B 2EDBA 3CFDB 2ZCLH 3BFOA 1WLHA 3LN9A 3FRUB 4JHAL 3VGAC 1E28B 3NOIA 5FGCE 2J3SA 3H42H 4LEOB 1U8NA 1C5CL 5K93A 2XN9D 3HMXH 4JO2H 3CSYA 1CR9L 1PJ9A 1W72B 4X5WB 4WNQA 2B1HL 2R0LL 5DD6A 5BVJB 3BQUB 3W0WA 3TZVC 5MERB 3TZVB 2PTUA 1E6OH 4KUZH 3LH2L 1JNNH 1G7PB 3OB8A 4OM0H 3ILPB 4AY0A 2X1PA 3I75A 4YZFF 2XQYG 1RZGA 4QRSA 3BP7B 3PP4H 3RTQA 3IS1X 3HMXA 3QXTA 2YSSB 3D2UA 1F4XL 4LBEB 2OJZH 4NCC1 2C3VA 4L4VA 3BN9D 3N50A 3L5WA 1MCOL 5IVZB 1ZLSL 3MX0A 2H1PL 5GGVY 5BXFA 1B0GA 4H25B 1BGXL 3O2VH 5H2BA 1E4XL 2NYYC 5I8EB 2WSKA 2R2EA 4X83A 1DUYB 1YNKL 5JDSB 1BP3B 1IVLA 1SYVB 3H9SD 1F2QA 2V5SA 1QLEH 1WEJL 2AXJA 1ZHLA 3I02B 1K5NB 2F58L 3W39B 3BGAA 4HS3B 1T5XB 4CN4A 3NA9L 3JV6B 4WJ5A 2MTPA 1YJDC 1GVIA 5DJCB 4H0IA 3T3ME 2P24A 4RX4D 2A6DA 3VWJD 4NQVB 2FX8H 5IB1B 1JPSH 3NAAL 1PG7H 2AK4E 1CQKA 5EIQA 2VSCA 5HDOA 2YUZA 2VAJA 5JHDA 5LGHH 3FFCA 1DLHA 4LKXB 2R4RL 1NGWB 1HN1A 1EXUB 1FZKA 1MRFL 5EUOF 5I1HL 2EC9T 3OKKB 4JFQA 2X4SA 5IM7A 1OP9A 5IMMB 2HWZL 5ISZA 4PUBL 3S9DB 5C71A 3DYPA 5EUOA 5CBAB 4ZTOH 3LQMA 2XTJB 1Q9WB 4R90H 3OPZL 3ARGA 3B83A 2ZUSA 3GMMB 2YXMA 3KYAA 4LVNC 1QFWI 4RISH 4LVNB 4YHZL 2J88H 2IPTH 2DQIH 4EI5A 1NCDL 1JNHB 3VWKC 2NZ9D 4JFEE 2RJMA 3DYMA 4MZ3A 2CIIA 4HBCH 4FFYH 4NOFA 4K3DH 3O3BA 4BFBD 2NY1D 1U3YA 2OMNA 1CE6B 3OWEA 4P2CG 1U8HA 3ZE0E 1K4CA 3P77A 4R4BB 4NM4L 4HKBA 1N59B 2QQKH 1D3CA 4FTVE 4JM4L 2W60B 5DT1L 3BX7C 4U05A 1A1MA 1G7LB 2V2WA 3CMOL 1CDCA 4JO3H 3TIEB 4QLRA 3QULB 1JCKA 4MLIA 4YXHH 2DTML 3HAEH 5BZDA 4GQ9L 1MHHB 4DK6A 2VLME 3MBXH 4YHKL 3LS4H 4I0KA 1S9YA 2HT4D 3ARTA 4JB9L 2ZPKL 4LLMB 5FHAL 1BQLL 4XC3L 3RWCA 1JIBA 2MJWA 3FMGL 4ZPVB 4FXGB 3QXVA 5EORH 1P9MA 3L3KB 3HAEA 1LVEA 4TUJA 2F54E 4ZSOE 4YHNA 5D70L 4OZFA 1QSFD 3K8LA 3LN5A 1GOHA 4OUOA 2J8OA 3EFFB 5DJXB 5D7SL 2V2XB 2DL2A 5B39G 5KVFL 1F42A 4ZAKA 1FV1B 4DOHB 2D7TL 1WCBA 3KS0H 1ND0A 5IBLD 3B3IB 1WWBX 1JZ2A 1C5DA 1NAML 1L6ZA 4P0DA 4RGMC 3FO2B 5DJ0B 4JFOB 4JQXA 5JORB 3T2NH 1S8DA 1J18A 1NDGB 2A74B 1I1AC 5D1QC 3IFOB 4D9LL 3AXLA 3LN4B 1EDQA 1S7TB 1YEKH 3C8KA 4JM2F 5D7IE 2R1YB 2OP4L 1GZQA 2A0LD 4LSRH 2XA3A 3VRIA 3FQRA 1CYGA 2FATH 4XWOC 2DS4A 4JM2A 1R5IB 5KSBE 4RMRA 2C4FU 2VLKB 2EO1A 5I8KH 3D87B 4JKLA 2VR9A 5DQDL 2DQUL 1GGUA 2CDFB 4PTUA 3QG7H 4DKFH 1IE5A 4U1SB 1R6VA 3KGRA 3OR7A 2YD1A 3HNTH 3BZFA 4LFHG 4CMMA 5GS1B 3WEXA 3H8NA 4MWFB 4PBWD 4UINL 2NY2B 4ZFOL 5E99H 1VERA 3F12A 1QRND 3MV8B 2VIRA 3G5YA 2CLZA 4HWNA 1RIHH 1V7MH 4X4XA 2VDQH 35C8H 1CXLA 1JPFB 4U1IA 2VLJB 1OM3H 5EO9B 15C8H 1OAQH 4NQSB 5HXMA 3DXAA 3UPCA 2VLLA 1MY5A 3P3YA 1FSKC 3QG6A 4N5UA 4F7PA 4O2CB 5CD3A 4XWGH 3IDNB 2FX7L 5CIPH 2AEPL 3QIUD 2W9DL 3ZTNH 1ETZB 3VXRB 1JN6A 1P4BH 1J86A 3P4NB 1JP5A 1BHGA 4IOFC 4Y4HB 1MJ8L 3FQXA 3MRCB 4NWUL 1ZGLP 1YEFL 4HZLB 2RIKA 2DQTL 4UB0H 5E6IC 1AKJB 5E6IB 5CIPA 4J7RA 1NBZB 4UNVA 3O8XD 3WSQH 4BKLA 4L1HA 1J1XL 3VGEA 3LV3A 3U4BH 1FZJA 3GIVB 2MKWA 3CDGB 3EOAA 1BF2A 2IADA 4P2RE 1FFPA 2CUHA 2PYFB 3SHSA 4ZFZA 1B0RB 4DAGL 1H5BC 1JYNA 2FLRT 5E2VL 3GKWL 1XCQA 2MQCA 4QKXB 5F3BA 3U46A 1B4JL 4FFWD 5GGQH 4PY8J 2IANA 5EBLA 4MA7L 4ETQA 2BHUA 2IAMB 1HI6A 5EBWB 4JLRB 2VZ1A 4JRYA 1KULA 5C09D 4P5TC 3RVVC 3MLSL 3ULUC 3LZFH 4RAUA 3P9WB 2YD6A 1ULVA 1X6NA 1KN2H 3C9NA 3DUUA 4XP5L 1JFQH 3FO0L 4C55A 3QDMA 2G5BB 1IEAA 3HRZB 5ADPL 1OSPH 4RCAA 1S7XB 4ZFOA 3BSZH 1NC4B 3MV7E 3VDCA 2Q76B 2EDLA 3GSRA 1RUQH 3VXMA 5DA4A 1G9MC 1YECL 1HHGA 4XTRC 3SDCB 2VLRB 1BBJA 3B9EA 4HEME 3P11L 4KRMB 4OD3H 1NC2B 3HMWL 3GSWA 5KSVA 3QFJA 1U93A 5EU5B 1JGVL 1WFTA 3T4YB 1RZKC 1U91A 4LQFL 5JW4N 3U30B 3HE7D 1M4KA 1CI5A 5HPMA 1GCFA 4X6EB 1N6VA 5E9DA 3IT8D 3CNKA 1JRHH 1W0VA 5MI0C 2Z8VC 5B8CA 4G8IB 4OUUA 5BMFL 5JOPE 5J56B 4KJWC 3OZ9H 4PY8I 5ICZB 4X9BA 4WHDA 3VXOB 1KG0B 3MA9H 5HHQB 1KCSL 4KU1A 3FZUD 1QBLL 1IC7L 2YKLH 2Z8SA 2P5ED 1SEQL 4OQ1A 3T0ED 2CKBL 1I1FA 5IB5B 2DAVA 1Y18B 1JGLL 4U1HA 3KPQB 5IUSA 3MRLB 1C08B 1GGTA 4Y5XC 4P2YA 1Q9LB 3PP3H 4W4NA 5FYLD 5IIEA 2BSTA 4MA8L 3P0VH 2ADFH 3H3PL 4P49A 3NH7H 1ZANL 3BT2H 2ZNWA 3MREB 4ONGH 2CGRH 4UTAL 4K23L 1QR4A 4XMPL 3LAFA 2YD7A 3GI8L 5HI5C 1PBYA 2QL1A 4Y19D 4HXAL 3CFKA 1S5HA 3QHZH 3QEQB 5ESAA 5CJQL 1RK0B 1EMTH 2ADJA 3DI2B 3HPJA 3SJVD 1INDH 2XFXA 4JGJA 4X7EC 4P57A 5TQ2H 4JCMA 4PBXA 1S9WA 1RUAL 3X3GH 3ES6A 2DB8A 2ZP0T 2Y1VA 1E27A 1GC1H 3BKCH 4JR9L 5C0AE 4Q9BA 5EU6E 5I71B 4L3EA 4R7NB 5DD0L 1KIQA 3GSNH 4HSQA 5GRVL 1OTTD 3BAEH 4ONFL 3EJYC 4P9MH 2E8ZA 5IFHL 3BRDA 4PJEF 1BD2A 1T7ZA 4OI8A 5GGSA 2NW2B 2PF6A 1OPGL 5KG9B 3MOBL 1YUHB 4GAJH 4YXKL 1I1RA 3BE1L 1U8IB 5GRUL 1DANT 4KMTL 4P3CH 3GSNA 4PJEA 3VCLB 1G7IA 5CWSA 2ICCA 1NCWH 3IDUA 4NC1E 5D1ZA 3QDGD 4L8SA 2I07B 1NUDA 4PRDB 5DVOA 5LKNA 3ZLQC 1J1PL 3VXSD 4MA3B 1U42A 3JWDH 4FN0A 3X14A 3NPSB 4AJ0A 5B39B 2XQYK 3MJ6A 4RFOH 4U1JA 1TETL 1T1YA 3KNBA 3KR3L 3W2DH 4LLQA 3WLBB 3GK8H 3QEGH 3ZZ1A 2FEDD 4FNLL 4A6YL 3C5ZC 4EI6A 3EYUL 5CJBA 1IFHH 1Q72H 4OGXL 2BJMH 2I9LA 2NY0C 4JDTH 3BP6A 9CGTA 4GMTH 4Z0XA 1KBGH 1VESA 1S7SA 2C1OA 3MPCA 1T1XB 4BZYA 1FNSH 3LKRA 1OTUC 4C56D 1OD9A 1KTKE 1YY8B 3CXHK 4K8RC 4YGVB 3PXJA 5CCKH 3QB7C 4S10A 5F44A 3O2WH 2AERT 3E6FA 5HYQA 1I9IL 1S7WA 5DI8B 3FKUS 4MDIB 5GS2D 5JR1H 1OP3H 3UJTH 3QRFM 4IRSC 4JHZA 4WO4C 1NEUA 4QWWC 4WO4B 1YNTB 1S78C 4WW1B 3AU1A 4JFPB 4N90E 5E2JA 5IG7A 3UPRA 1DBBL 2CJUH 4PJDB 5I1KH 5CFHA 1NGZA 3NTCH 5J13C 1N7ML 1NSNL 3QIWD 1QSED 2VXVL 1YNLL 4IIQC 4Z95L 1OARL 5H35A 3MRDB 4HF5L 3HE6C 2BXZA 5AAMA 5JPMA 4KZDH 5LGKA 2CRZA 2DICA 2AK1H 1AR2A 3U9UB 1JI2A 2APFA 4JZJB 4AH2B 2ADIB 2ERJC 4IDLA 4P2QD 1KEGH 3VD3A 3FCTA 4UBDC 3SDXE 1PYWA 5CSZA 5E00A 4TNWK 2H2SC 1P4IH 2J8UF 1S9VA 3F7RA 4Z7VB 3T77A 4AEEA 1ZEAH 3G04B 5C0CE 3SDAB 4DZ8A 2XQBL 1CTOA 2DM3A 2NNAB 5DWUH 4CMHC 3CXHJ 5HHNA 4CMHB 3JWOH 1VFAB 1QO3A 3KPRB 4KKBC 3DHMA 5FO9A 1FLRL 3IFPA 3PHOA 3IGAA 2J8UA 1IAOB 3S5LA 2VKWA 1QA9A 4HMCA 1ORSB 2DWDA 4AT6A 3S34L 5HHOB 3H6JA 4G3YH 4XC1H 1M7DB 4XBPA 3MOAH 1N2RA 4LRNH 4M7ZC 2EDXA 4LCWB 3TBSA 4HIXH 3IU4L 2W92A 1MOEA 1PX4A 1R3KA 2CIKB 3SKOA 4K3JH 4LSVH 5GS0L 1UM5L 1JJUA 2A1WH 1MCWM 4JN2B 4LF3A 3AS3A 1RIUL 1KJ2B 5F72S 5IMLB 3OKOA 4LLWB 5BO1H 4C58B 5B38B 4PRHD 2MOVA 3KJ6L 3KG5A 2ZSWA 2NMSA 3V6ZA 4OIAA 3IYLW 1P7QA 5ICYB 5B4MD 3OAYH 2AQ2A 1UZ6E 1IGTA 2G9HB 1MH5B 3P9LB 2BDNH 3L7FA 4ENEC 3GJFB 3W5MA 4M43L 4YK4C 4YK4B 5FGCB 4LCYA 1OHQA 5KVEH 2ZCHL 5I1DB 3IDGA 4N8PA 4XAKD 4MAYA 5EOCH 3UPAA 4I5BB 2OYPA 3ARFB 3ME0A 4FQ2L 3DMMC 3BVNA 1A3LH 1AI1H 3ZKSD 5DZOA 2ICES 3ELAT 1P6AB 1UZ8A 3K4DA 4LSUL 4LLUA 5FKPA 5A1AA 4PJGF 3S96B 2WLYA 3V95A 4M1CC 1FYTA 1SJXA 2MWCA 3V6OE 3BZDA 4PJGA 5CJOH 3QUXD 3C6SB 4Z7QE 4RAVB 1S7UA 4U3CA 4J4PA 2WUCL 4QEGA 4TUKH 4YUEL 4EUPB 4QXTA 3P4OA 1S3KH 4LCUB 2BY1A 2QSTA 1SQ2N 1DQQA 3WLWD 5IFAL 1ONQB 2WNGA 2WLZA 2XA8L 5JPNB 4U4BA 4TTDC 5I1CL 5TF1L 1MREH 4ODHL 1CLYL 3TH2T 5M7QA 2H3NB 2H32H 1I7ZB 2YK1L 5C6TH 1WFUA 3MRJB 2AK4B 4QRRD 1CGTA 4JREC 4JREB 3OF6D 5IBUB 4LCCA 3FQTB 3RWHA 3WL9B 5BV7H 3KPOA 1CLZL 2AJVH 1OB1B 5F93C 1SJHA 2VDKH 1FNEA 2H32A 5CKGA 4F7EB 4MNQE 1E4JA 3MXWH 1K8IA 1TXKA 3GZKA 4WFFD 1F11A 3LEYH 3ARUA 4JO4H 2CDGB 2KL6A 1JF1A 3OSKA 3ARBB 1LMKA 5DD1L 5DQJA 1K9TA 3S4SA 5C7XL 4I1NB 1U3HD 1DQLL 4UOJA 1P4LA 4JFEB 4NP4H 2ZUVA 4ODSL 4QOKA 3D39E 3EKCA 4NFBA 3U2SB 1XF2B 4FS0A 1DBAL 2XRAL 4WV1A 2Q8AL 5IOPB 1OQXA 3MV11 1ZT7A 5ICXB 1IGFH 3ZYOA 4GUPA 4B7LA 5FYKL 3T8XB 4KKAC 1TITA 1GHFH 2DQFB 5GJSL 5EWIL 4FTVB 2OQJB 4XP9L 3VXPB 1JL8A 3HHRB 5K59E 3F7YB 1JGDB 2GJJA 5HI4C 4Y5VC 3KPSE 1NMBL 4NC0B 3G6JF 3O6KH 4Y5VB 3DTXA 4POYA 4NHUB 1K6QH 3LKSB 4WCYH 3EYVB 4P2OA 5HGBB 1LE5A 4WTZA 1CG9A 2E6JA 3VXNB 5I30H 3RGVA 4OZIB 3FHAA 3I9GH 1TCMA 2EDRA 3G6JA 4LP5A 1T7VA 1LEGA 3GM0A 3M45A 1HHJA 5JXEC 2HLFD 3BKYH 4RGNE 1KJVB 2RFXA 2JJVA 4JPKH 4XPTH 3GJFK 3S35H 4PJ9A 4XXCC 4JGMA 4X80L 2KBGA 5I66B 5MEND 1MAMH 1BPVA 4CW1A 3R0NA 1FFOB 3CFBA 3NABL 4UIKH 4XCYA 3NVQA 4X6CE 4AG4L 2Z8RA 5HGGS 2F54B 3OQ3B 4ZSOB 2CXGA 2P49B 2XOTA 4L4TE 2NXYD 3O4OC 4OAWA 4Q9RH 1CWVA 2Y36L 5ITBH 4XP1L 4HK0A 5C0DB 3PL6A 4FQJH 4L5FH 3CU7A 2F5AH 1AO7E 3EYQC 4N0UE 5E8EB 1WTGT 5INDA 3VXUD 3QI9D 4DGYL 3DWTA 1LO2L 3L3JA 4XNYL 4OTXH 1I7RB 2AJXH 2GFBB 5DJYB 5J9PA 1I1YA 2Z31A 3QPXH 3W9DB 5KS9E 3MXVH 5C0BD 5C0IA 2UZIL 5DJ2A 2DBLH 4I9WE 2ZZUT 2VDNH 5FDWB 4I3SH 1N6QH 3MNWB 2X4QB 3IFNH 5LWYH 5D7IB 4TSBL 1XR8A 3VGGA 4U6HB 1MFEH 4Z76B 3NCBB 3NZHH 4HAGA 2A73B 4M6OH 2LVCA 3SDDD 1ACYH 4Y2DA 3W9EB 4N0CC 1L0QA 1MCPL 4K94L 5KSBB 2NW3B 1AC6A 1IEBB 5CGYC 2VO5A 1KT2B 1H3GA 1Z0MA 5E2UH 1GZPA 3CPLB 2NX5D 3P4MA 3SQOH 3LEVL 2C26A 3EYSH 1BWWA 1CS6A 1JMZA 4HZAA 5DJ8B 2GJ6D 4KUCD 4YDKL 1VGEH 4XNZB 4R3SA 5C2UB 1HOCA 1UGNA 3PGFL 3C2AH 4XRCA 4CVXA 4S11A 1H15A 4C4KO 1WIUA 2ZSVA 4G9FE 1J0JA 4NRZA 2BNUA 4BUHA 3BQUD 4NBXB 1IBGH 3TZVD 5E08H 1I8LC 1LO3H 5GIRB 4UU9A 3T04D 3MRBA 4ZPTA 2VDPL 1OT2A 1J0YA 2ZG3A 1NH6A 4CVUA 2ZKHH 1FVCA 3DGCR 4GXUM 2W9LA 5I17B 2ED8A 4OCNC 1JV5A 1U3JA 5A2KH 2R69L 2VH5H 3ZHKA 5TDNB 4S1SH 4AMKH 4HKJB 4L4JA 3L5IA 4YQXL 3O3AA 2NYYD 5HYJA 4M7LT 4JY5H 2XWJA 4M8QB 3WN5B 3RX5A 5MHSE 3QQ4B 4HG4K 3KPLB 1EEZA 1NJ9A 1KFAL 5I8CB 5DMIH 4CADB 5DYOB 3MJ8A 3QDHA 2ITCA 4P2RB 4JHWH 4YZFE 1B6DA 4W81A 5I1LA 4AQOA 3A67H 3FB6A 3CFJB 4D0CA 3QUMB 1WT5A 5JZ7C 1HINL 3LOWA 4LIQL 2F8OA 3ETBF 1W0WB 1EO5A 3X3FL 2GHWB 3KLSA 4X7CC 4DN4H 2D9CA 2HFEA 2HJKA 1F8TH 4MYWB 1OQOA 1KNOB 3O45B 3VFOA 1X4XA 3BPNC 4APQA 5I2IB 3M8OH 3GKZA 5JW5B 4CU7A 5DFWH 3JUYA 4L8SC 2CKBB 2VXSH 4F58L 4WEBL 2XTJD 2F53A 3BPLC 3DX6B 3MV7B 3BPLB 4F7MA 1MFAL 2ORBL 3WXVH 5JHDE 5E5RB 2DKMA 3FFCE 3G5XA 5FO7B 1RULL 1BAFL 1T0NB 4L3CB 5IFJA 5HTSA 5T3XL 4K55A 3B9AA 5LQBH 3DHJA 1MRDH 4JFFA 1VB9A 3V5DB 5E1HB 4WWKC 4WWKB 1FNFA 1OLLA 5ISZE 3S36X 1RJZB 1NFKA 3RY6C 4G5ZH 4KROC 5EUOE 3OX8B 5TDPB 4K3EH 2G75A 3DSFL 3ROOA 1FL3B 2BOCA 3TN0A 2DI7A 4JG0H 3CK0H 4N68A 4YWGH 4QRPA 1XCTB 2B39A 3W81A 3RX8A 4KPHH 2ARJA 2AXGA 1IAII 5I1AA 4RDQG 4NNXA 4FQXA 1KN4H 4QHMB 4LEXL 1K2DA 4O2EA 4PJ8A 3JV4A 1KIPA 4YIQA 3IAPA 1TZIB 3O3EB 3I50H 4MJIE 3TIDB 2D03L 2QR0A 5MP6L 2PTTB 5I1EH 4QXWA 3B5TA 4XBEL 4JKPL 2WMPA 5C92A 3WXWL 4LCIH 5I1JH 1I1CA 1A9EB 1DL7L 4WU7A 3L95B 1EEYB 4XX1E 5C2BL 3GJEA 3SDYL 3NIFE 1IT9H 1DEEA 2VXTL 3RIAF 3TLRA 1AP2A 3QH3B 1KC5L 4NCC2 1ZA3A 4Z9KB 3AMLA 3R1GL 1PY4A 4KJYB 1PG7L 1DBKH 3QT2A 1FC1A 4NGHL 1D5MA 3MA7B 5E5UB 4R8WH 5T3ZE 4MQXC 4HJ0C 3LDBC 5DC0A 3MRQB 3LCYA 3SGDI 2E8YA 2PTVA 3NCYS 3MO1A 5TE4H 4H5SA 3BOVA 12E8L 1T66D 2K1MA 4UNUA 1MCJA 1ERNA 1UCBH 3QFDB 4O9HL 3ROLA 1X5AA 1I1AD 3QWQB 2WZPD 2AKRA 1J05A 3I84A 4P3DA 4HXBL 3OKEB 1T03L 4DCQB 4RISL 2VDOL 1ZT4A 2OK0L 2J88L 3ZDZF 5BJTA 4IJ3C 2GIYA 1BX2A 3ARDA 4XWOD 5C0AB 2JK5A 2VLKD 3L5JA 5EU6B 3TBVB 4YX2H 4F3FB 3WMSA 1C12B 3FONB 4NT6A 4UQ2B 3MCLL 1D5XA 4U6VH 3SBWA 3LHPH 5J7CC 4OCWH 2B4CC 3CH1A 3S8WA 4BFIA 2KQNA 2NY2D 4UQ3B 1V3LA 4PJCF 1HILB 2HVJB 4LPVA 4DGVH 4YXHL 5T3ZL 3MV8D 1CGSL 1PKQA 2IQ9H 4JPIB 3MGOB 1LNUA 1A4KB 3D69B 3AC0A 4NC1C 1HXYA 5EPMB 4PJCA 2VLJD 2QHRH 3HZMB 3CVIH 1ZA6B 4L8DA 4U3HA 5D2LE 2CQVA 4PP1D 5GGVH 2O5YH 5FOJA 2D9QB 1PAMA 3EDKA 2BSSA 3MOQA 2B20A 3D3VE 4OZ4B 3VXRD 1RMFL 1JWMB 4ELKA 3QIBA 1AY1H 4IOFD 4Y4HD 1KJ3H 3VFWA 5EULV 1FZOB 3TNMB 5I15H 2VERN 3GNML 2Z0BA 2GSGA 3HG1E 4ZS7L 4CNIA 5ABDE 4X99B 1KLUB 4F8TA 1AKJD 1T5WB 5E6ID 4NRXB 4U1MB 3NGBB 3EOBA 2EEBA 1G7QA 2YA2A 2ED7A 3U0TA 3INUH 5E2WH 1C7SA 2XG4A 2OR7A 4NKDA 1NEZG 1XGPB 1KB5H 2PR4L 4XPFL 2EDNA 3QQ3A 3CX5J 4B41A 2R0WL 4WFEE 5TQ0H 3GBNL 2VZOA 5IKCB 4LDEB 4U0RC 1QFWM 4U0RB 3LRSB 4HAFA 3GB7B 2FO4B 3WS3B 5SWZA 5CEYA 3GSOA 3ZL4L 4ALAL 2APVA 1J11A 2PNDA 3E0GA 4LSRL 4MJ5A 3O41A 3FOLA 5A2JH 1KB5A 2DF3A 2IAMD 2BXYA 1KIUA 5H37H 4ZMAT 5GHWL 3P30H 3H0TB 1EH9A 4P5TD 3RVVD 3ULUD 1FE8H 3EO0B 2WWMD 2PXYC 2PXYB 5IQ9A 1ZK9A 4WU5B 5D7KE 1HCVA 1WVZA 1OF2A 2Y5EA 3OL2A 3LSOA 1F4YH 2BNRA 1RZFH 1XGQA 4M61B 1NC4D 3OJDA 3UTTA 5MEQA 4RGOH 3BGFC 3BGFB 4XNXL 5FM8A 3SDXB 4KJPD 2GI7A 2QQNH 3KPNB 2IANE 5DMKB 2VZ3A 3CCHB 3SDCD 4M7KL 2VLRD 3DNKA 1P69B 4JRYE 5C0CB 1NC2D 5CHNB 4QRQB 4HW6A 2CO6B 2FGWL 4OFYD 3NZ8B 2FJHA 1NGYA 3SY0A 1X6LA 35C8L 1LK2A 3KYMA 1AXTL 2SEBB 3I6KB 4X6FB 5DLML 2HT3C 1KYOJ 3NFPA 2EEAA 4I3GA 1FNAA 3HLAA 4HJGA 4Q0XH 4R7DB 4G8FA 1I4FB 1CFSB 4FOMA 1T1WB 3RVTC 1QFPA 4ERSL 3RUGE 4G8GA 3DBXA 5SX5H 3T4AB 1BOYA 5HSFA 3PQYA 4KJWD 5L8LB 1XGUB 4HC1L 43C9A 4FQQA 3QFJE 4FQ1H 1FL6A 2K3TA 1U8QA 3QXAB 1IC5H 4N1HB 4EQ2A 4PP2A 1XF3A 1VADA 2DQJH 4OJFH 2V17H 4M7LL 5DDHA 1D5BB 3QUZB 1CICC 2HRLA 3NFNA 5E9DE 2GTZA 3P40A 1U95B 1LEKB 5GGUB 1VPOL 3V0WH 1GJIA 5ESVB 3BRGC 3DIFA 1RI8A 1NFDE 4TQEL 3MR9B 1QG3A 3SKNA 4IMLA 3Q5YA 2V2TB 3WD5H 3L3IB 2CK0H 1CFBA 1PGRB 2PYEE 4GBXA 1F3JB 2HRPL 3QO1B 3E3QE 4FQLL 4QRTB 4HJJL 5D9SA 4YDLC 3K2UH 2R1XB 2V7NB 4Y88A 2NR6C 2DJ4A 2Y07H 5HI5D 5E4IA 1OAUL 3QEUB 4H1LB 1OCWH 3RX7A 2VUYA 4KKLC 4KI5D 2IQAA 5FHBH 5DRNB 4OSUL 3TNNB 3OHXA 4X6BB 4NWTL 1RURL 1RZ7L 4HWBL 5ETUB 5IMKA 4UDTB 2XN9A 3REWA 2FIKA <