1OD7A

N-terminal of sialoadhesin in complex with me-a-9-n-(naphthyl-2-carbonyl)-amino-9-deoxy-neu5ac (nap compound)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
118
structure length
118
Chain Sequence
TWGVSSPKNVQGLSGSCLLIPCIFSYPADVPVSNGITAIWYYDYSGKRQVVIHSGDPKLVDKRFRGRAELMGNMDHKVCNLLLKDLKPEDSGTYNFRFEISDSNRWLDVKGTTVTVTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SIALOADHESIN
publication title Structure-Guided Design of Sialic Acid-Based Siglec Inhibitors and Crystallographic Analysis in Complex with Sialoadhesin
pubmed doi rcsb
source organism Mus musculus
molecule tags Lectin/immnue system
total genus 22
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2003-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1od7A00
3ARED 3OJ2C 3MRQB 3S37L 5T5NF 4HJ0C 4EN3C 4WWKC 3EAKA 3WUZA 2CK2A 5EZIH 4NZJA 1OGAD 2D4DA 4K3JL 4G5ZL 1D5IL 4DTGL 1QRND 5C08D 3HI1A 1KB5H 3OKMA 4HGKC 1AFVH 2PO6D 2EDRA 1BIHA 2IALB 1K8DB 5D7IA 2IFFH 1T66D 3GK8L 4NOBA 2DTSA 4N5EC 4ZUVA 3QDMD 1CLYL 3O6KH 3NCJH 3RX8A 4ALAH 1T1WA 4JKLA 2P44B 4HDIB 4OGXL 3FOLA 3IDMB 3OHXA 1H8OA 4AL8L 4IDJH 3SCMA 4P57A 5ID0A 3SGDH 3WIHL 2HH0L 4NQCA 3NCYP 2FBJH 3ULUF 1JGEB 1Q0XL 2R1XA 3C5JB 4KRPC 3WSQL 2HLAB 2NY6B 4JM2F 4WJ5A 2YA1A 4IRSB 3SGKC 4QHKI 1KPRA 4Y19B 1XF3A 2P5EA 2P8MB 1BBDH 4HIXL 5DEFB 4D94A 3ARFD 1BQLL 2FHCA 2L4OA 3ARGD 1NGXA 2WW8A 1F3RB 2A0LC 1BWMA 1NBQA 5CKGA 2Y23A 3O4LE 4J1UA 4UBDC 3QUYB 2H3NA 4A2MA 2L7JA 5D6CB 5A16B 2DIAA 1IC4L 1QSFB 2J12B 4K23L 3I6LD 2GFBB 3E2HC 4JPWL 4NRZA 4O2FA 2E6QA 5IVXB 1NEZB 4P5MB 1GZQB 2CXKA 2J8UF 1YMMB 3FOMA 1NUDA 2QADB 2DQFB 2LTQC 3BHBA 2BRQA 5IHBA 3LN9A 5I66A 4TUOA 4KJQD 4NJAH 1NCBL 1TQCB 1CGSL 1MELA 1MIEH 5C0AD 4NQDA 5E00B 2OMBA 3B9AA 4H0IA 1QLFB 4CVXB 4PJ7E 1I3UA 3ARQA 4PG2A 1RURH 2AABH 2NYYC 3QDGE 3HZKA 3MODL 2GEEA 4NN5C 3V7AG 3GKZA 4WCYH 4RGMB 2FO4A 4N9OB 2Q86B 2PCPA 4DGVL 7CGTA 1SVCP 3WNOA 4LHQB 4QTHB 1K9TA 5D2NB 3MGTB 2X1XR 4UILH 5DZLA 5E8EA 2HT3D 3MNZA 3OXSB 1QYGL 4KK6C 3RRQA 1UM5H 4MJ6B 2L7UA 2ZUYA 5CZKA 2OXGA 1G6RA 3FQUA 4O58H 1OPGL 4O4YH 3BUYB 4HUWA 3X3FL 1RFDL 1O0VA 1L7TL 3GO1L 4GKSB 4XMKH 4NYLA 3U4AA 3WUWB 1YJDL 2HJFB 1MHEA 1J1OL 1ED3B 2EE9A 5DRZA 3H7BB 4JQVC 5D7KE 5C09D 1MVUA 2WM0A 2D0GA 3CFKB 5EUKA 1HZHL 1SBSL 3OPZL 2Z35A 5INCA 4WW2A 4XPTH 3C8KA 4O2CA 4ZTPH 4LIQL 2Q8AL 4UQ3A 4L8DA 1C12A 4ZOCA 1GAFH 4X4XA 1OSPL 3DXAA 5F7MC 3A6BL 3FRUA 2VXTH 4FZ8L 1QSZA 1NMAH 1WBYA 1AQDA 2VMFA 5DLMH 4YC2B 1H5BC 4U0QB 4I0CC 4JDZA 1AGEB 3FT4B 4LK4A 3FQNA 3RKPA 2BOBA 5I18L 2GITA 4P49A 3LS4H 3ES6B 1ACYH 4I48B 3L3OB 4JM2B 4MJIA 5GRZA 3TVMB 3V4PL 5ICZA 3MO1A 1JPTL 5AWNL 2PTVA 4OLZL 3FB5B 5DQJA 4EJ1C 5CLWA 5D5MF 2EYRB 1V7ML 1RI8A 4QYOB 4LVOC 5HHXH 1MJ8L 5KAQF 1JNLH 2ZCKL 3ETBF 5LGJA 5FK9B 3VFVB 5HVHC 4KV5F 3UTQB 4MVBD 2YD4A 3LSOB 4JY6B 3SDAA 1Q9OB 3B2UC 1RHFA 4XXCA 2APVA 2YS4A 4OKDA 3MV9E 5D2NE 1YYLL 5ESVA 1XCTB 1QKZH 3MLZL 5CJXC 3PP4L 1J7VR 3BIKB 1MF2L 5KVDH 3RNKB 1OTUC 4D0CA 5BVPH 1U92B 1CT8A 2E7LC 5DJ6A 5E7BA 4JREC 1K4CA 3T0EC 3TIDA 1J18A 1DLHB 3MROA 1WGOA 4NBZB 4S1DC 4OCMC 3DNKA 1WQVT 3BN3B 1UWXH 4GG8A 1INQB 4AEHL 5I15L 2BVQA 4KDTA 5IFHH 2VAJA 3IVKB 1I7ZB 1ZT4A 3MPCA 2E6JA 2NXYC 4U1MB 3VG0L 3VRIB 3V6OA 2ZG3A 2OP4H 2W91A 2PYEA 3T0BA 3RP1A 2OM5A 4DN4H 3HPJA 4GW5B 3D48R 4YUEL 2CRMA 1T20A 4CU8A 3GNMH 3L5IA 4XPBH 3ULVF 2V17H 5D7LE 4RGOL 4KY1H 5CBAB 2QSTA 3EDFA 3ULUE 5JUEL 3WKNA 5C0NC 3QUXB 3H7LA 4PJ8C 5DVOA 1CDUA 2WUBL 1TNNA 4ISVB 3ZKNC 3LPWA 2ARWA 3ARDD 5HYJB 3VWKA 1G9ML 4PY8J 1T7YA 2VNCA 3X11A 1GRWA 1CE1L 4FQQB 4MNGB 4O00A 5F96H 5C3TA 5EZIL 3X12B 3QPQC 4K9EC 4PJXF 1HH6B 2GJ6B 1MCKA 2XA8H 5MENB 1EX0A 4Y4FB 1BJ1J 1KB5L 2JKXA 3R0NA 4WI5A 1JPFA 1BIIA 3DRTB 4OZFA 3LQMA 5B8CC 2LE9A 4IHOB 4NZUL 1QNZH 3UZQA 4OGAD 1INDH 3O6KL 4HFUH 4ALAL 1FE8L 1NDGB 3UTSA 1FJ1B 5FA3A 1MFEH 3EDDA 4JB9H 3ZYIA 2UWEB 2J8UE 4PJBA 1KB5A 2V7NB 1FPTL 1ZVSA 4YHML 3QRFM 3AREA 3GMRA 1P84K 3WIFA 1MEXL 1YY9C 3OMZA 1IM3A 2FBJL 3U79A 1ZLWH 2E8ZA 3LPFA 4ZAKB 1QRNA 2VDMH 2RHEA 2C9AA 4LCIH 4UTBH 1ZLSL 3QQ3A 3BAEH 2PO6A 1DUYA 4Z7QF 4YAQB 1JE6A 1PG7X 3VE0A 1CZ8H 3U83A 1BBDL 3MLUH 1OSZB 5IK3A 5BZDB 4U33A 4LSDA 4JAMA 4ELMA 3QG6B 3BVNB 4XVJH 4C59B 2FIRT 3QDMA 4U7SA 2EZ0D 1LP9A 3L5HA 1ORSA 1VERA 4J3VA 1IRAY 1DE4B 3C8HA 5EIVA 4NQSB 3TC9A 3JTTB 4MAYD 2XZAH 2QKIA 4XWGH 1F6AA 4WU7A 5HYJE 2HRPH 4G80B 4YE4H 4MNGE 4DAGL 3HZYA 3T8XA 3EFDH 5JLZB 2MFNA 1QO3A 5CGTA 5DK0B 4WU5B 5F9WB 3ARFA 4PP1C 1NEUA 4XPFH 2BK8A 3ARGA 4WI2A 4IJ3C 4XCCL 1MIEL 4OCYH 2IMNA 3L3DB 4MSWB 4XVTH 1A9EA 4LSSH 3S4SA 5IOPA 1INEL 1D9KB 2IWGA 1IGYB 3I3EA 1RURL 2DYPD 3SCMC 5ADOH 5AZ2H 3G6AB 2IBBA 4PPTA 4ZDHA 5IUSA 3BZFA 5BXFB 4R97C 5HPMB 3D0LB 4HFWA 1JYXA 5H94B 3GIZH 3O6FB 1N2RB 5TE6L 4RMQA 3VRJA 4JVPA 1UM5L 3LV3A 1QSED 5D5ME 4Q74A 3HA0A 3Q6FA 4GOSA 1M05A 4O58L 4XCEB 3TT3L 5C0AA 1G7IA 3AB0C 3LRSB 2C7UB 2Y6SD 3UZVB 1N4XL 1QR1A 3LMJH 2FEEL 4KV5E 2FATH 3ZYJA 1WCQA 2VLKD 3T2QA 5D70H 4N9GB 4FN0A 4QRRB 4NO0D 2HP4A 4OCSL 2A6IA 43CAA 4DEPB 4ZTOH 4KJYA 2QQKL 4Q6IB 4U1IB 4Q9QH 1MWAL 4ZTPL 4R96A 1OCWH 4P4KB 4HBQA 4YHYB 4FP8H 1AGCA 2VLLB 2VXTL 2WINB 3KXFE 2HTKC 1NMAL 2Y07H 1LHZA 4IRJB 1OAXL 2XKUA 5BW7A 4NKOA 4NQVB 5GGRB 5L6YL 5K9KB 3QNZA 5HI4D 4HUNB 4IOFD 3ARPA 1KYOK 4XX1G 1CXFA 5D96C 3LS4L 5T1MA 4KI5F 5E7FA 5EU6E 1KG0A 2H32B 4PG2C 1OLLA 3OQ3B 3EOAB 4XGZA 5C09A 2XNAA 1Z9SA 2WAHA 43C9B 4GRLB 1T83A 2F8OA 3ZYZA 4BSVB 2A2QT 2JIXD 3D3VE 2FEEI 4JPVH 2FX7H 2JCCA 5IESH 1L9NA 4YBQC 1RZGB 3ULVE 3U36B 1NKOA 1GVIA 3BH9A 1SJEB 5GPRA 4P3DA 1UEYA 2EDJA 3MMEB 1HSBA 3VFRB 5KVDL 3U30C 1U95A 5IKCB 3NAAH 1XF4B 3VJ6B 3DROA 1IAIH 1T04A 1IQWL 3HR5A 3SJVD 5HI5C 5DJAB 1JZ5A 2VZSA 3ECBB 3SOBL 5CJBA 3T0XA 5IGXH 2GJZB 4BM7A 1HQRB 1CIUA 2IGFL 4HZLA 3H9SD 1QR4A 3CH8A 3GSRB 5MI0C 2DD8H 4OFVA 4XVSH 4WW2C 3MV11 3AU1B 3CFBA 1OARL 3QHZH 5GRVL 3VA6A 3TPUA 3O0RL 4QRRE 3RWGA 4ELKA 3ROLB 2OP4L 1JPGA 4GG6F 2D4FA 5F1IB 2ATKA 3O3DB 3KPTA 2Y4SA 4DN4L 2HFFA 3ZT5A 1B0WA 4BH8B 4YXHH 5IP4A 1AC6A 5C70A 4BZ2L 4PBWD 3P4MA 3D85B 1FNLA 3PGDB 1RJLB 1YMHB 2QEJA 4LHUD 1FORL 4QLRA 1KULA 1NFIB 4FXKA 2GCYA 2R0WH 4XMLH 5DD0L 5IR1A 1ZLVK 1ZLUH 1S5IH 4JG0H 5DEZA 2Y9RT 1P4LA 4OAWB 4PBXA 4Z7QE 3TCXA 4GT7A 3R0MA 2IPKA 2E27H 1Q9LA 5F96L 4JRYB 1J88A 4HWNA 3GB7B 1LEGB 4EI6B 1DTUA 4FQIL 4W4OA 2XA8L 2X1QA 2DQIH 1I7RA 4JFYA 4YX2H 4PRHD 5A1AA 4JDTH 4JFHE 5DEGB 3V5DA 3QH3B 3F5WA 1QNZL 1NKRA 1INDL 2EXYD 1NBZA 2EO9A 2XKNB 3BT2H 4RDQG 3RIAK 5D1QC 2CD0A 3QI9D 4ZO8A 3O41A 4JB9L 5HHOB 1QHPA 4KDTC 3EYOA 3ARDA 4QOKE 3OZ9H 3BWUC 3DHMA 4OD2B 3RWCB 3GBNL 4TNVK 5HTSA 3MBXH 3Q3GA 3V6OC 1FZOA 3BO8B 1CQKA 4OIIL 2A6JA 2R1WB 5KSUB 2VDML 5LCVH 2DQJH 4ENED 4PJHA 4OF5A 3BAEL 1ITBB 3F7RA 1VENA 2BVTA 5GGTL 3HE7B 1MCDA 5BQ7B 1U93A 3BP4A 3ZE2F 1WLHA 2W9DL 1A5FH 4XVJL 4DFIA 3EOBA 2I9TA 1NGZA 2R4SH 3O45A 5FYKU 4HS3A 4PLOB 4XMPL 3ZT7A 1LNUB 3QT2A 4PB9H 1J0KA 3EO1B 5GS2D 3I6KB 5B4MD 3TV3H 3MLXH 2D03H 2AI0H 2O61B 4XXDA 5ITFA 4F8TA 3VWKC 4J4PD 2XZAL 3HFMH 4UV4L 3IFNL 3MQIA 3OKKB 4ZPTB 1MNUL 4LRIA 2LQRA 4LNVA 5GS2H 3LH2H 3WDIA 4KMTH 4EDXA 4YE4L 4Y5VA 3TNMB 3UJJH 5AG8A 4JRYE 4ONGH 3BGFB 2R2BA 3EFDL 4D3CH 1EO5A 4D9LL 3O3UN 1XR9A 4HPYL 5C9JA 3BRGC 2I60H 4CJ0A 1X5XA 4XPFL 3REWA 4FZEH 2CQVA 3NACH 4LP4A 1J9CT 2A83A 2FECL 4TNWF 3S3PA 4OCYL 4F7MB 5E8OB 4XVTL 1T1XB 3MJ6A 4LSSL 2EDOA 4GG6B 5F21B 3G08A 1NCUA 4G42B 4ZXBC 3QPXL 1MJJA 1HSAA 1RULH 2H9GB 5DQDL 5AZ2L 1RK0A 2ICCA 3TNNA 2EDEA 3AREC 5B3NA 4NNXA 3UROR 1NCCH 3WEXB 4S1SL 5FKPA 5GJTH 1F42A 4U6TA 2AW2A 1TFHA 3GIZL 3FB6B 4QRPD 3GJFB 2UYLA 4R26H 3TBTB 1ZHKB 5IHZB 4ZPVA 4DVRL 4BQ8A 3EYSL 3K74B 4KI5E 5GGSB 3HE6B 2XOTA 4XI5C 4OZGF 5HD8C 4QCIA 5KW9H 2HJKA 4P2OA 1BPVA 4WW1B 4Y2OA 3D0VB 5FUCC 4PRPB 4Q9BA 4Y4HD 3UX9B 3Q5YA 4LQ1A 2EDWA 2V5TA 3FT3B 1W0YT 2OR9L 4G9FB 1D6EA 2DYPA 2FATL 2XA3A 4NT6B 4G8FB 5KSBB 3IFLH 1JYNA 3GHEH 1LE9B 1GOHA 1JGUH 1ZHLA 1UXWB 3MFGB 4ZTOL 3IXAB 5ESQB 1XZ0B 3QB7C 4HKXA 4M5ZH 3L7EA 4PY7A 4Q9QL 4FFWD 1R24A 3FN0H 1G7HA 1OCWL 3EO9L 4Z5RB 4OZHF 4OZIA 1MHHB 4FP8L 4PJIA 4Z7NF 2ITDA 3LN4A 1HWHB 2AEWA 2Y07L 3ARFC 1A3RL 1QSEA 3BPLB 3THMH 4TSBH 1FRGH 3ZTNH 5ENWA 3DARA 3DUUA 2EE3A 5T3XE 3GSNH 3DVGB 1MUJB 3QWOA 1U8NA 5JA9A 4GG6E 3QFDA 3DX9A 2VLKA 3G5XB 4NFBA 2OJZH 3NN8A 1G7PB 3P4NB 4NO0A 1JVKA 1IGTB 1YQ2A 4JGUA 5HYFA 4JPVL 3C6LD 2R29L 4FXGA 5IESL 4IRZL 1GSMA 1K85A 1NDMA 4BKLB 1AO7B 3BJLA 3NPZB 3Q0HA 3FRPA 3RVUC 1KTKE 2YC1B 3KPSE 3CXDH 4KJQC 5IEHB 3UDWC 3TZVB 3QHTC 4NC1E 5J1AA 2KZWA 1RJZB 2O5XH 1ES0A 1ONQB 1IAIL 3FFDA 3A0OA 4D0DA 2QSCH 4QTIH 3G5ZA 1ZEAH 4LDOB 5HHVL 1WZKA 1KENH 2CR6A 1CFSA 5J11C 5IGXL 1RUPL 4M6ML 3GMNA 3TH4T 4G9FE 1Y6MR 5EO9A 1ZGLA 4HK3J 4I5BB 4RSVA 3N50A 2JIXA 2ARJA 4NUGL 5SWZB 3BPNB 3DBXB 1JBJA 4NPYB 4JE4B 5AUMA 2IBZX 3TPKA 3NFPA 3M1BA 2CK0H 3AVEA 2R0ZH 2BNRD 5BW7C 3DV6B 1T0MA 5T5FH 2BVOB 4NJ9H 2QQQA 5H35B 1UVQB 3P4OB 1ND0A 2OI9B 4WV1A 3SJVA 1C16B 3CK0H 5GGVL 3IF1B 2R0WL 4XMLL 4WO4A 4O5LL 1S5IL 4JG0L 2XZZA 1CFQB 1KPUA 1JZ8A 3SDYH 1QD0A 2B5IB 3HPLA 4HGWA 4OZGB 4XNMA 4EI5B 1J8HE 1IAII 4I13B 2AVGA 4J3SA 3ZE2E 4R2GC 1CDYA 2DL2A 1KNOA 1BF8A 1A4JB 1AGBA 3UTPE 1LK2A 1T5XA 5D1ZD 3LKQA 1NBVH 5TDPA 1KIRB 3OAZH 1S7SB 2YSSB 2DQIL 1K2DA 3BIAX 3S3SA 3QIUD 4YX2L 1RJYB 3LKNA 4JDTL 4U6HB 1EMTL 3QDAA 3D39E 3MRIA 1GGBL 4G8IB 3WS3A 3HHRB 3MCKB 4LHUA 2V5YA 5D7JC 2AXFA 5EOTB 3O2DH 4RGNC 1N5AB 4E41E 3TJHD 1B9ZA 2YPLB 4ZNEA 5CKAA 2XTJC 3V4VH 2ZCLL 2BHYA 5I9QB 1UZ8A 3RWFB 3DX6A 1LO4H 1JWMB 3EW3B 1I8IB 4KFZC 3E3QE 3NTCL 4ZQKB 5F7YC 1YZZA 4G6AD 5CD5D 3IDJA 1SJXA 5CEZD 5ITBH 4KWUA 4PRHA 3T4AA 3HNSL 2BXZA 3V8CA 1ZHNA 5DD5H 4KZEH 2R4SL 3K46A 3N1PC 1DN2A 1Y0LA 3KLAA 2DI9A 3PDDA 2BVPA 4PB9L 3TV3L 3AUVA 5CEZH 3QI9A 3IDUA 3MLXL 2D03L 2AI0L 3ILPA 4Z78B 3C2AH 5FYJE 1VCAA 4F57H 4FQLH 4JO2H 1GPOH 3MXWL 1P4IL 1DP0A 2C1PB 3KPRB 1W0WB 2EYTA 5HI3D 5JPNB 1JNJA 2COQA 5EUOA 1XGPB 4OZGE 1AE6H 2E9IA 2KUTA 3L1OL 3BKYH 4J3UA 1NFDA 3LH2L 4CVZA 4KMTL 4NP4L 4X7DC 5F3HB 4EQ3A 1KXTB 3FQRA 1ZANH 4K7PL 2F53D 4W4OC 4GXVH 4D3CL 1EO8H 1CFVH 1Q0YL 1T1YB 4JFEB 3SKMB 3WHXB 3S9DB 5D72L 2JELH 4YO0A 2I9LA 2I60L 2N56A 4H0HB 4FZEL 2NZIA 3NACL 4KVCL 5GZOC 5E1AB 3W5MA 4G8GA 4NWTH 3W9EB 2BCKA 4NNPH 3VFMB 3OGCA 3C5ZC 4GW4A 4OZHE 5TPWH 2ICEB 4I2XA 4J4PA 5AZEH 2Y7QA 4UIMA 3D18B 5DURD 4KK8C 3BN9D 1V3KA 1NCCL 3MJ7A 5ABDE 5FGCB 5GJTL 5ALCH 3IJSA 1AIFA 4YHOH 3ZHDA 5EN2A 4PJEF 3K2MC 4R26L 2DQTH 4LAQH 4I77L 3Q1SH 1CICB 5HYSA 3HKFA 3EOYG 4JQXA 3S8WA 1S7WA 3E8UH 2DKSA 1VEPA 3QHFL 4JZOB 3MRFB 4OGAC 1GXEA 3RX5A 4OV5A 3CVIH 2XZQH 4N0UE 2B7DT 5JNYA 5GRXG 5EZLA 4FQCH 4N5UA 2EO1A 4RNRA 2MQ0A 4UT7H 4CVWA 3UPRA 4F3FA 2K7QA 3IFLL 3B9KD 4LRIC 3MV7B 1WF5A 3FO1A 3K4ZA 3WCYA 4QRQA 3KPRE 3VH8A 3IFPB 4M5ZL 4JDVA 4QRPA 3QXUA 3BYTA 1LO0H 1UWXK 1CLZL 5CILL 1U8JA 4G43A 5F8RC 2IQAA 4PRDB 4RWYH 1IEBA 3LEXA 3MLRL 2GTWA 1KUMA 4A2LA 3T2NH 5J56B 1MJUH 4HUXA 4TSBL 4G7YH 4Z7UA 1SM3H 3D69A 4LHUG 1TITA 2EZ0C 1FRGL 1JTTA 3WFEH 1FZMB 4Y4HA 5TDOB 1DQLH 2HJLB 4R7NA 2Y72A 1FZKA 3VFSA 2VB5A 5KVFH 5EG6C 3P0YL 5GS1C 2AKRA 2OJZL 5T3ZD 3HS0B 5L8KB 2AV1B 3ZSSA 1K3ZA 3N1MC 1RY7B 3CDFA 2Y5TA 1S9KC 4IEFB 2DTMH 1N5YH 3SPVB 5H8DA 4H8WH 5FGCE 1N6QL 3IKCB 1KGCE 2R2HA 1IGCL 4EUPH 5T3ZH 3KJ4C 5AAMA 2P5WD 5D8JL 3GSNA 1DQML 1UH4A 1VGKB 2IALA 2WWMD 4LDLB 1MJ7L 3CXDL 1YPZF 4P2OC 1E4XH 4WUKH 4YIQA 1KJVA 1EDQA 3CFDB 2O5XL 2QSCL 4Z77A 3OKYA 3MGOA 4MXWH 4NQEE 2WZPD 2EKSA 1AD0B 1E4JA 3PABA 1PFCA 5CEYA 4PGEA 4LLVB 1HHGA 5DWUH 4LF3A 4ODSH 3TGXA 5EBMA 3S5LB 3O9WD 3EHBC 3C6LA 2OTPA 4KKLD 1K6QH 3MV7E 5C7XH 1GC1H 4K3EH 3C5JA 4YHKL 1NCTA 3RUGA 2FBOJ 2Q20A 2CK0L 5J13C 4BQBA 5FB8B 1AXTL 3LZFH 1U91A 3S36X 4UAOC 3H42H 1A1OA 3D2UB 2P8MA 5HGAA 3AXLA 5T5FL 4NJ9L 4W4NA 2PTUA 4CMHC 3VFNB 1JNHA 4APQC 4K7PY 2I07B 4LLYB 1FNEA 2R0KL 4DJMA 3CK0L 5K59F 2VAAB 1FVDA 1G6VK 2J88H 3ROOB 5GS0C 1D9KD 3IFOA 4PV8B 4F7EA 1EEZB 3OR6B 2MCPH 4AEIL 5FV2A 1WIOA 2W0LA 1FNSH 5D6CA 5ISZD 1VFBA 4PJGA 3BFOA 1FCGA 1JZ4A 5CCKH 1M6OB 3PHOB 3QO0B 4MMXC 4K3DH 3B6SA 5EULV 4OLXH 4K2UH 4CAGA 2FHBA 3KLHC 1J5OL 1NEZA 1GZQA 1B4JH 2HG5A 4BFBD 2ADJA 3TN0D 4P46B 4R6UA 5JOPD 3LCYA 5DMJB 2LAGB 5FCUH 2BNRA 5JXED 5EBLB 5JQ6H 2FJHA 2Q87A 2P42B 3CSYA 1NAKH 3L5XL 4XPGH 1FGNH 3ZL4H 3HRPA 4M1DH 3O2DL 3QEUB 4CVXA 5I75B 5EA0H 4DZ8B 2HFEB 2KBGA 4R4BB 2VZ1A 2CMRH 1DDHB 2R4RH 3V4VL 3JBG7 2XZCL 1RUQH 2BP3A 3VH8G 1PDKA 3MC0A 2ZOKA 1LO4L 2AJUH 3WKML 3LAFA 5FHBH 4K94H 3IDNB 4ZS6D 3T0VA 2IAMD 1VACB 2IPUK 4P4KD 2DI8A 3CU1A 1S5HB 3O2DA 2Q8BH 5J6GB 1JK8A 3FCTB 5DR5L 3QIUA 3RWJA 1IAMA 4HMDA 4PJ5D 3CFEA 3E6FB 4EBQL 1HCFX 1J0IA 3BUYA 4XNUL 1DQDL 4DGYH 4FTVB 4KZEL 4HUUB 1L4IA 1NCDL 3P9MA 4WO4C 2H2PC 4PJEE 1ED3A 3C2AL 3W2DH 1WFUA 3H7BA 2OQJB 3BD4A 3RGVB 4JO2L 1GPOL 1I8MB 4H1LH 3ZE1F 4L9LC 4XP9H 1OP5H 2CRZA 3RPIB 2JK5B 1X5IA 3BH8A 4OI7A 1FN4B 1HCVA 4JR9L 3U4BL 5EZJB 1BLNB 2H32H 2DJ4A 2ICWB 1ZANL 1DVFB 4HKJB 1EO8L 5HJ3B 4FFVD 4M4PA 2JELL 4OD3H 1YUHB 1BOGA 3EBAA 3F12B 1XEDA 3JXAA 4WWKB 4WRLA 3VFOA 5L2KE 1U8HA 3TA3B 4HZAA 1BF2A 4RIRA 4XRCA 4WFGD 3ZT6A 1EFXD 4NNPL 3V52H 3GI8H 3TVMA 4RQQA 2KQMA 4PD4K 5GJSL 5F1NB 5TPWL 5CUSL 5IJKA 1MRCL 5AZEL 3B9VA 4QYOA 5F9DC 2Q1EA 5F70A 5HHPA 3LQZB 3OX8B 5HSFA 4RAVB 4X6BB 2X4UA 5IBUB 1FYTB 2DQEH 4ETQB 2AEQH 4YHOL 3VFVA 1A6ZB 1M7IB 4PGDB 3LSOA 5EC1B 4LAQL 1LE5A 4PJ9C 2ZOLA 3Q1SL 4JRXD 1XCTA 4FOMA 3BDYH 3DUHA 5E8DL 3BDXA 4YFLI 3B5GA 3RNKA 2X9XA 3AM8A 5L2JB 1M71B 1HINL 1MLCB 4U31A 3QEQD 4XT1C 5JDSA 3D85D 3CVIL 1ZTXL 3QI9C 3KPQA 3UPAA 1DBAH 3WBDA 1QBLH 3UBXB 3HCVA 1SY6H 3UAJC 4F37F 4NHCH 4BZ1L 5SX5K 4MAUH 4QF1B 1KCUH 3IVKA 4FFZH 4MNQD 1I1AB 1CF8H 2R1YA 3GMOA 3T4YA 3BOVA 1YPZE 4HIHB 4K8RD 3WN5C 2AJVL 4Y16C 3WNPA 4L4VB 4HIEA 3ARBB 2NY1C 5EOQH 4NO2A 3OBAA 4HIIA 5DD3L 4RCAA 1BMGA 2XG5A 5IBLC 5E2WH 2DLIA 2K1MA 1MJUL 4GW5A 5LAXB 2JLLA 1ZHBA 5H37H 1QBML 3FFCD 1I85C 4LSPL 2ADIA 5B4MC 2JB5L 3SDXF 4OFKA 3MLSH 2VE6A 5IMLA 3W9DB 2PTTA 2EEDA 5KVFL 1I4FA 1RZIB 2VABA 1NPUA 3TYGH 3WO4B 4M62H 1NUNB 3B9KA 3MLWL 3SDCD 4RBPH 4WFHD 2D7TH 2HVJA 3GSOB 2CKBB 4FQQA 2DTML 1Z0MA 4FQHB 3ARYA 3X12A 2HKFH 4A6YH 6FABL 4WGWB 4X6CA 4GH7B 3SQOH 5T3ZL 5K59E 4JQXC 3OTTA 4AIXA 1NGYB 2XWJB 1G1CA 2DKUA 4X6EA 5JQHC 5KSAB 3UTTD 2GK0B 3NABH 3U0WL 3HMWL 3IDIB 1ZWIB 2B4CL 1BAFL 4X9FA 2OTUB 4LPTA 3AS2A 4JKWA 4WTXA 1NDGA 4L8SB 3KPOB 2AJ3A 2IJ0C 2NY3D 4EUPA 3BQUC 1DSFH 1IGIH 1OTSD 1UADC 2DB8A 2UWEA 2Z91A 3CC5B 2MQCA 2V7NA 5DWUL 5I76B 1DBML 1MSPA 4ODSL 1NMBL 2GAZB 5E6IC 1MI5E 1BOYA 1K6QL 4MQXD 5I1GH 5L7XH 4V1DD 4OZ4A 4PLKC 4ONFH 2B8OT 1JZ2A 1PG7W 2FX8H 3QAZC 5I74C 4DVBB 1A6VH 2P5WA 4YHLH 3LZFL 2X1PA 3OKDB 4YAQA 2R2EB 1YNKH 3H42L 5FKAB 2R39A 1CYGA 3UTZB 1XF2A 3QG6A 1T2QH 2K3TA 1DLFL 5IWLA 1VADB 1VA9A 1UG9A 1X4YA 4LLDA 5I1CH 4PFEA 1HI6B 2VLRD 2ADFH 3DPBA 4NQSA 5I73C 1HQ4A 2E9WA 2XPGB 4CVUA 2W0KA 3O9WA 1WT5C 5TQ0H 3TBVA 4FFWC 5AD0A 5DRNB 2C3WA 4K2UL 4KTEH 4X9IA 1B4JL 4GRMB 1CDBA 2VITB 4EDWH 1ODAA 1G9NH 4AIZB 3V8OA 5DK0A 4AG4L 3VXSE 3TO4D 1KT2B 1QLRA 2Q7NA 3L7FB 3ZE1E 4YGVA 5I8EA 1NAKL 5IW6A 1UT9A 1RIHH 1JNNH 3ZE0F 5HVHB 3ZL4L 4M1DL 2NNAA 5IM7A 4MD0A 5EA0L 1D9KA 2C3VA 4LSVL 1K8IA 3SN6N 3GJEB 5LJYH 4JFQB 1R3JB 2R4RL 4AEFA 3G6AA 5ISZA 2Z92A 4L3CA 1RUQL 5K9OA 1F3DH 5BXFA 3HC0B 4K3HA 3D0LA 5FHBL 5H94A 4QWWD 3O6FA 4UTAH 1GOFA 5C07D 2NY6C 3TN0A 4IRSC 1KJ2B 3CCHA 4YHZH 5D7IF 4L3EB 4S0TD 5JXEA 3CIQA 3PHSA 2YEZB 4XCEA 5FF6A 3MRGA 1UA6H 2ENYA 1CR9H 5HYIA 3S36L 1KLGB 2CUIA 4MA8L 1MCQA 5I1JH 5C0BD 2GIYA 3QUYC 1U8QB 2E7CA 5C1MB 3I02B 5F9JA 3O2WH 4XP9L 4TVPL 1SJHB 2M26A 1W72B 3ZKMC 3MUY1 4OCXH 4U1IA 4JJ5B 2IAMA 2EDNA 2BSRA 4PRNB 4Q97A 3VXUD 5ETUA 4P4KA 2P24B 4UUJB 2VLJB 3HAEG 4KVNH 2DWDA 4I9WD 4CNIA 4J3TA 4XCFH 1F4XH 2QADC 1OB1A 2YUVA 3WYRA 5JR1H 2PW1B 3MRMB 3EYQC 4JZNA 4LKCA 1D3CA 3MJGX 4MQSB 4U6VH 3TZVD 2YPKB 4H1LA 1TQCC 1DN0A 4GXUN 3CLFH 4B53A 5DT1H 5K9KA 5C8JB 1T22A 1XT5A 4Z0BH 4DCQB 4UINL 3RVVD 4NBYB 1KBGL 5KVEH 5J3HD 4EUPG 3V52L 2H32A 1OTTD 3EOAA 3N85H 1IGFL 1CXKA 5ALBH 4EEEA 2DJSA 4M43L 1DFBH 3U9PH 2Z93A 3EDEA 4RGMC 1OAZH 4JHAH 4M48H 2K7PA 4WY7H 1A1NA 4WI6A 1OAUL 3MBEB 5DFVD 4ZFFA 4LMQE 4HF5H 4LARH 4U3HA 3VFUA 3BXNB 3SDXE 3R06B 2ZG1A 1JPSH 4X9HA 1IMHC 1O7VA 3BDYL 4NCC2 4GBXD 5TDNA 3RY4A 3T1FB 2XFXB 4HJGA 1GHFH 3U7AA 1OAKL 1NGWB 3VFRA 1Q8MA 2ESVE 2Q76B 2PNDA 3DMMD 1KCSH 4IMKA 4L4TE 5J57B 2O93L 1EFXA 4LBEB 3HMXH 4N8CH 4LCCA 4X6DB 1DBAL 3IAPA 2RQ8A 3MNVA 4OM1H 3ECBA 4KKAC 3W0WE 1SY6L 2EH8H 3QWRD 2O5ZH 4NHCL 4MAUL 1PYWB 3B9EA 1HQRA 1KCUL 4FFZL 3U48A 2BNQE 3QDJD 32C2B 2VXSH 3K1KC 5D71H 1BZQK 4BA8A 5FYLE 3D25A 5EOQL 1L7IH 5IB4B 3DX7A 3VXRE 5FHAH 3WFHB 4JRXA 4DZBA 3V2AR 4M1GH 4DK6A 3MV8D 1DQJB 2QHRH 2VLJE 1SY6A 4YC2C 3RHWK 4K8RL 2IQ9H 2AK1H 5FUOH 3MRRA 1IKNA 4KPHH 4JGMA 3QEQA 1MCEA 1IAIM 3D85A 3PGDA 4JKPH 1RJLA 1H3PH 1YMHA 3TH3T 4Y1AD 4HBCH 5E9DE 1RUMH 3MLSL 3OKMB 4BH7A 3TVMC 2QSQA 3P30L 1A7NH 2J8OA 3RX7A 5IJKC 5D7IB 5SWQA 3TYGL 5GIRB 4J8RB 1HOCA 4RFEA 4MNQA 3BD5A 4CUCA 4TSCH 4WW2F 1MCJA 3QCVH 1T1WB 2W9LA 2HKFL 2GUOA 4A6YL 3KLSA 3FOLB 3VGAB 3OHXB 2DIJA 2NW3B 3EDJA 2YHGA 4Q0XH 3BISA 4X4MA 5ID0B 1S7UA 5CD3A 1PW3A 2UVEA 4NQCB 3VW3L 2R9HC 4KROD 4HX1A 3MLVH 3S3JA 2HLFC 1KJ3H 4R97B 5DEGA 3FFCA 3QH3A 3OAZK 3PNWB 1F6FB 2R1XB 2ZKHH 4RAUA 2C26A 2HT4D 5E8NA 4WJ5B 5DHYA 4JFDE 1GGIL 1WK0A 3D5OF 4A6YA 5F6IB 1IAKA 3RQ3A 2P5EB 1IGIL 3BN9C 1OOAA 4B50A 3NCFB 4NQXB 1NGXB 3RWCA 1EJ6A 3CDCA 1CDCA 1URLA 4RISH 3ZE0E 4FRWA 4XAKE 4J1UB 1P1ZA 3BIBX 2H3NB 2ZZUT 1YEJH 4L8BA 3S6CA 3WJLC 3AS3A 1N7ML 1KLUA 4YHLL 1SEQH 2MOVA 2K9UA 3HE7A 4H1LG 3TWCH 5BMFH 4NRZB 1OT2A 4DW2L 4O2FB 1L0XA 5CGMA 1FBIH 1KC5H 2J6EH 4HG4J 5FFLA 3LS5H 2AV7A 1UJ3A 3FOMB 4Z7VA 1LNUA 5E4EB 3EO1A 3QXVA 4U1SA 1N8ZA 3J8F7 4PREA 4K71C 5I66B 4U3XA 4TUOB 4YFDB 2HKHL 2VZVA 5D7IE 1VGEL 3RWHA 2NY4B 4ZPTA 4P3CL 1X9QA 5J6HB 4V1DA 4PUBL 5D96B 4MYWB 3EFFA 5GRUH 4QNPF 2DKMA 5J1TC 5HXMA 3GM0A 3HZKB 1WUNT 1F00I 4X4YB 1C8PA 3UYRL 2FO4B 2PCPB 5MP6L 1FSKB 2E9JA 4DQOL 3CX5K 4LEOA 4XH2A 5F9AC 1OAYH 1JNNL 4NQCE 3REVA 4U1LB 4F7MA 1T1XA 3I6GA 3MNZB 1NLDH 4H8WC 5T1DH 5DMGC 1N64H 5JW5A 2VLRA 4YDLB 2A6DB 2VO5A 5MEPA 3WMSA 1OW0C 1OD9A 4WFEE 1HNFA 1M4KA 3BJ91 1BJ8A 5I1KL 4NYLB 4UTAL 1MHEB 1X4XA 5D6DA 5DRZB 3TBTA 3WNKA 5DGQA 2EIZA 1FH5H 2WWMC 3T3MF 5JW4N 1MVUB 4YHZL 3TO4A 3OV6A 1WAAF 5EUKB 4U4BA 2WLYA 2Z35B 4HWZA 5C2UB 5IMMB 3C8KB 1A21A 3D0VA 4O2CB 5IWLC 4UQ3B 1CR9L 3SHSA 1C12B 4IIQA 4O02L 4X4XB 2WBJD 3FT3A 1GC1C 3DXAB 1Z3GL 1AJ7L 1WBYB 5T1KD 1J12A 4G8FA 5KSBA 3JWDH 4JDZB 4LCUA 4XP4H 1LE9A 3FQNB 4OFDA 4KKLC 1A6UH 3GGWA 1UXWA 3CFJA 3WFDH 3IXAA 1PZ5A 1T4KA 4MJIB 5GS3A 4NQDE 4N0CD 2W9EL 5DQJB 1WBXB 4Z5RA 4KVNL 5K93A 1MHHA 1H8NA 5IQ9B 1U2HA 1MFNA 5F9WC 5GSVA 2F5BL 4GRWH 1QSVA 2GQHA 4U6VL 15C8H 5DUPH 4ELMF 4QXGH 5LGJB 3UJIH 2W1NA 3LY6A 1I9EA 3CLFL 4R0LA 1LP9F 1HHHA 5DT1L 4WIQA 2FB4L 4DGIH 3SDAB 1BZ9A 4MJ5A 3BZDA 5C0BA 1D9KC 2GK2A 1XGUA 1MUJA 1E6JH 2DM4A 4KJWC 4O9HH 3TCLA 5F7KC 1MCRA 3RDTD 1G7PA 3U46A 3P4NA 5T33H 3U9PL 1CLOH 4X8JA 1EGJH 1CT8B 1OAZL 4AH2A 1IL1A 4WY7L 1K4CB 2FDBP 3O6FC 5LBSL 4ZOEA 2OCFD 4QGYA 3U4EA 2CGRL 3MROB 3VXUA 3WL9A 2B1HH 1UM4H 4G6MH 4HF5L 4BKLA 5KANI 3MCG1 5IF0A 1AO7A 4GG8B 1YEGL 2BVQB 2PF6A 3BMVA 3SE3A 4HUVB 2FJGA 1XH3B 1GHFL 2YC1A 3TZVA 5MEQA 5ACZA 1NC4D 3BEWA 1RJZA 4NSKA 5D7KD 1Z9LA 1KCSL 3O8XD 3T3PF 4K94C 3V5KA 4N8CL 4GKNA 4OLVH 2PYEB 1FDLL 5KVGH 2NXZD 3HPJB 3DXAE 2DBLL 1B6DA 1T20B 3RVTD 3WS6A 2HT2D 4DEPC 3O3AA 4KKBC 3JV0A 2VXSL 2UZIH 4Q6IC 3DBXA 1YEHH 5D71L 1AR1C 1DEEB 2VIRA 4P4KC 3PQYE 1L7IL 4YHYC 1NC2B 3HMXA 4GBXA 1R5IB 4IRJC 4M1GL 3T0AA 2QHRL 5E1HB 1XAUA 3SE4C 3X11B 3DV6A 2IQ9L 4X5WA 2AK1L 5FUOL 4BFGA 1F3DJ 5GRJH 3DMMA 4JKPL 1U9KA 3TBWB 3P4OA 3U1SH 1C16A 4UNVA 5KZCD 1JGDA 3MACH 4AYFA 1JPFB 1A7NL 4OZFB 3GIVB 4M6NL 5GHWH 1MQKH 4PLNC 4U2YA 5FOJA 3MV9D 4FQPA 5FDWB 5D2LB 2GT9A 3QDJA 1T21A 5J9PA 4PJAA 4TSCL 4DUVA 2VRAA 4OLYL 4P23B 5I0DA 1HKLH 3Q6GL 5BRZB 2FEDC 4MS8D 5FA3B 4UZGA 4HK0A 4DKDC 3BGMB 4PJBB 5AYUH 1KB5B 4C55A 1IE5A 3MV8A 4FABH 3I2CL 1FC2D 3GMRB 3TESA 4F33B 1IFHH 3WIFB 4HWBH 3MLVL 1OGAB 4U6HA 1IC5H 1QRNB 5C08B 5CGYD 1A14H 4Y1AA 1XGYH 4LCCC 4GMTL 3QQ3B 3V6OE 1U6AH 2PO6B 4PJFF 1I9IH 4XP5H 4FHBD 4QNPE 2YPLA 3K80A 4YBHA 3MRLA 4JAMB 3QDMB 4YDIH 4GXUM 1LP9B 2P45B 1ORSB 3D87B 5IVNA 3HB3C 1B3JA 1I8IA 1QOKA 2HVKB 5B38A 4RISL 4AENA 2UV3A 5BS0D 5ADPL 4P9MH 4JN1L 1YEJL 4LPXA 3R1GH 3T65B 4PGBB 1SEQL 1RHHA 5KANG 3DV4A 4J6RH 4WU7B 3TWCL 1T80A 4W81A 1KC5L 2J6EL 4LCYB 4KKCD 3HZYB 3LS5L 3RY6A 3T8XB 4R4FH 2A73A 1X5LA 1QO3B 3V9FA 5JO5A 2RIKA 3BMWA 2PXYD 3OAUL 5JOEA 3AGVA 1VPOL 2DQUL 3NIFF 3ARGB 3T3ME 1W0WA 2ZNWA 5JPNA 2G75A 1RJCA 5BO1H 1WAAE 1XGPA 3M45A 1A9EB 3S4SB 5IOPB 2ZJSH 2YD9A 5F3HA 4F7CA 4HEPG 2J6EA 1KV3A 5GRUL 4H20L 1OP5K 3KPPB 3UTSE 3ZTJG 2APTA 3KJ6H 3FB7A 3WHXA 1PZUB 1A7QH 4ZDHB 4ESKA 3BZFB 3NCMA 5EU3A 2X7LB 4C56B 4HFWB 2GYSA 2DM2A 3QXDA 5E1AA 3VRJB 3L6FA 3V79C 5J12B 5T1DL 1A47A 4HMCA 3I75B 3Q6FB 4LLAA 3GSVA 1QEWB 1X7QA 5C0AB 2SEBA 4WFFE 4ELME 3VMPA 1PX3A 5FUCE 1LP9E 1QR1B 3DIFA 3ZDXF 3LKOB 2AXJA 5BV7H 4U7MA 2EEAA 3HE7C 1CICA 3GMLA 1CG9B 2A6IB 4Q7DA 4KJYB 3K0WA 3KR3H 3DLQR 4JY4A 4H25A 1KN2H 5ESAA 1H3VA 5F7EL 5IB1B 1BFVH 4MHHI 5HDLA 3HC4L 4ZFZA 1HYRC 3TLRA 4NM4H 3GMPB 2NY3C 3NA9L 4MDIA 2X4PB 5F9OL 5DTFA 1WEJH 8FABB 4NKOB 1HNGA 4OUUA 3VU2A 5IROC 1BM3H 1LO2L 3DETC 3QNZB 1IT9L 1G9EA 1A6UL 5DHXB 1TZIB 2VDOH 4Z7WA 3QISA 1KG0B 4M6OH 5EU5A 4PJHF 4N0FB 3T3PE 4ZNCD 4MX7A 1C1EH 1UEMA 4XGZB 4XNXL 5FOBA 2XNAB 5C09B 5FO8A 1MCHA 2G2RA 2R56L 3Q5TA 4KUZH 1TNMA 2I27N 1OAQH 4LSTH 5DUPL 5KSAD 5A3ID 3UJIL 2JCCB 5DJ2A 3H3KA 3TBSB 4UNTA 2WBJA 3CXHJ 1F97A 3BH9B 1E6JL 4P3DB 1HSBB 4ERSH 4O9HL 5HVGB 4YDVA 1G9NC 1U95B 5T33L 1OF2A 2AQ3A 4M6AA 1B0GA 1EGJL 1OP9A 3IDYB 2AV1A 5B38G 3DROB 3HR5B 5FV1L 5D6DC 2E5EA 5KVMC 4G6ML 1UM4L 2XACC 5DUMH 4RBPK 4NC1C 3HE6C 1YYMH 2DWEB 2EDFA 4HZLB 4PJ7A 3U7WH 3OJMB 3P40A 4PRBA 1MCIA 1RZFH 3CFBB 3G6JB 5E70A 3RWGB 3TPUB 1EGJA 3DYOA 3RTQD 2VJXA 1JPGB 1LDSA 4P2QD 1C5BH 2QQNL 2ATKB 5CHNA 1RMFH 3B9DA 3NZ8A 2HFFB 4U49A 2X4QB 3RDTA 2LAAA 4KUCD 2X05A 2BRRH 1U42A 3D9AH 1UM6L 4M9OA 3B5TA 3P4MB 2FLRT 2NLJA 4MLSA 4QWWC 3S5LA 3RBSA 3F7QA 4NN6B 1YEHL 4FXKB 1OY3B 4GKOA 5C0DA 2JJVA 5HGBA 2OL3H 1EBPA 5IR1B 3GM8A 2X89A 1P4LB 5F89A 5FB8A 3BPLC 4PJFE 3KYAA 2YMXL 3CU7A 5EU6D 2IPKB 2HN7B 5C09E 1Q9LB 3LQAC 1NC4A 4M03A 5KTEH 3O8XA 2DLFL 4LLYA 4KXZH 4ORGB 3U1SL 2JCCE 3MRCB 3D3VD 2H1PH 3MACL 3QJHA 4YBLC 3ROOA 1Z9MA 3O4OB 5JW4M 4JY5L 4MHHG 1EEZA 5IB3A 4JFYB 5GHWL 1MQKL 4OJFH 3GSUA 5DVMA 3ULVD 3T2OA 4M1CC 3U0PA 4BQ9A 1IVLA 2EDBA 2Z9TA 1P5VA 3F5WB 3QUZD 3P9LB 4Y2DB 3C60D 4LVHB 4BK5A 1HKLL 3Q2CA 4OZIF 3O41B 2CXGA 3GHBH 3QQ4A 4PJIF 3ULVH 3ARDB 3SE3C 4P46A 3RWDA 2QJDA 4K7FA 2BSED 1D5XA 3LIZH 2DAVA 3TZVC 2CLRA 2XTJE 5GXBB 4HWBL 4KQ4L 3Q3GB 2H8PA 1FZOB 1IC5L 3NIFE 1WWAX 3R4DA 2AEPH 3RVVC 3VXMD 2A6JB 3QUKA 1XGYL 2XQBL 4P5TD 5E4IA 4GLRH 1OTTC 3QEUA 3ARWA 2A6KA 4DZ8A 4XP5L 5M94B 3EOTL 3AY4A 1DDHA 1FO0H 2H6PA 1U93B 3MV9A 3WS6C 3RAJH 3EOBB 1U3JA 3O45B 4YDIL 2Y06H 2VUYA 4HS3B 4HWBA 3VXTB 2DF3A 2AQ2A 4XCNA 3IDNA 3FO2B 2X1WL 3QIBD 1VACA 4XXDB 4P9ML 5ITFB 3FZUD 2VZOA 5J6GA 3FCTA 2VZTA 4HLJA 3X13A 1U8OA 4J6RL 3NZHL 1ZVYA 3GMMA 3S35H 4EDXB 1OL0A 5DS8B 4RA3A 2OS7A 4Y5VB 2OI9C 3H2WA 2HFGL 3ZDXE 1XR9B 3ULUL 2B5IC 5F93C 5C9JB 4OGZA 3REWB 5LGHH 4EI5C 3MLYL 2EXWC 4DN3L 3RPIA 2JK5A 1KXQE 4WTZA 4WEUD 4N0RA 5EZJA 2NR6C 4P2RE 5BS0A 4JFHD 2B1AH 1WISA 1MJJB 1W8OA 1HSAB 4MAYB 3KJ6L 3TNNB 5DMKA 3ZYOA 1A7QL 4NNXB 5E8PA 4U1JA 3FONA 4UDTA 5FKPB 3NCBB 3ZHLA 3RFZC 3SDDD 4S11A 4ONOA 3NH7H 4I18A 2UYLB 1BBJA 1D5BB 4ZOBA 4ZPVB 3JV6A 2PXYA 3F7PC 1OT1A 3B8SA 5DO2D 4PJHE 4JCLA 5I9QC 4CADA 3GUTA 4QCIB 4OBSA 2Z8RA 1S9WA 1CGYA 1U8PA 4QO1A 4PGJA 4RMSA 4WI7A 1D6EB 2DLHA 1V5JA 4MB5A 2N4IA 4MZ2A 2ADGA 2DYPB 5EOCJ 4M7KL 2FH6A 4XZUA 2W59A 3ALXA 4XNZB 1ZHLB 4OSUH 4JEGB 1YY8A 1A0QL 2J8UA 4HKXB 3W39A 4PY7B 4OI8A 2BDNH 1EJOH 3KR3L 1N3NA 3RY6C 3F6LA 1KN2L 4UMGA 4Y4KD 4K55A 4OBRA 4OZIB 4PJIB 1MAMH 3OB0H 3ESVF 5TE4H 2ITDB 3X14A 3CH1A 2EC9T 1MIMH 4UT6H 3LN4B 3P77B 2DQCH 1QSEB 4M7JH 3VG9B 2BOCA 2VDRH 4GAJH 2YD7A 4G6KH 5ENWB 3L3HA 5JMRA 4HXBH 4QXTA 1FLRH 3L3KA 1JGVH 4L4VA 3ARBA 4M6OL 3QWOB 5KG9A 1J05A 1Q72L 4KU1A 1C1EL 3QFDB 3DX9B 4Y5YB 1ORQA 2VLKB 3NN8B 4NO0B 4PTUB 3FMGH 4RRPA 4HKZA 3BE1H 1OAQL 4LSTL 3S37H 2N7AA 4ZUSB 3N0PB 1SMAA 4K3JH 3QCTL 4G5ZH 1D5IH 4DTGH 3F62A 2OBGA 1V3MA 4WEMB 1W8NA 4XWOD 3B8YA 1WCBA 4ERSL 2XI9A 4RX4D 5J1AB 2P48B 3GK8H 5EUOF 4QXUL 3JV4A 1N6VA 3GSOA 3RWIA 1NFDF 3FFDB 2AGJL 1GIGL 2ICWJ 5IVZA 3G5ZB 2J8HA 1RZ8A 4FQHA 3WDJA 1CFSB 3RKDD 2VDLL 4OV6F 3GMNB 2F54D 4Q2ZB 1CICC 5EO9B 1ZGLB 2VUOA 3WUWG 3U7WL 3WIHH 5KSAA 5FIEA 2ARJB 1RZFL 3DGGA 3IDIA 1Q0XH 1NL0H 3CFCH 1LEIA 1QFWL 3BSZL 3NFPB 1GZPB 4YXLL 1KN4L 1IGML 1JWSA 5ID1A 3KPOA 3SKOA 4OZIE 4PJIE 4HIXH 1T0MB 1G7LA 1BQLH 4XHJC 1QSEE 1P5UA 4WTZG 1YNTA 1TPXB 1ND0B 4PRAA 2CLVA 4WV1B 3SJVB 4P9HL 2OL3L 4ACPA 1KPUB 4HGWB 4XNMB 5DSCA 1U2CA 2R2EA 3H9SB 5CMAA 5T3XD 3DVFA 1FAKT 3P73B 2VLKE 4K23H 3ULSB 1T7XA 3JWDC 3CXHK 1XGRA 1ZV5A 4AJ0A 1AHWA 4GMSL 1AGBB 3RTQA 1LK2B 4HH8A 4DFHA 1ZA6A 4NRYA 5CAYB 1T5XB 3C8DA 4P2QA 3LKQB 5TDPB 2FR4A 1RVFL 5T3XH 2OL3A 1L6XA 3LKNB 2GHWB 4MJ2A 1NCBH 1QFWI 1CGSH 3WS3B 4FG6D 4LHUB 3KPSD 4N0CC 1I8KA 4JLRA 2RFXB 3BPCA 4M7LT 5AEAA 4N90D 3ULVL 4HPOL 2VITA 1T89C 1HHJA 1UZ8B 5EU6A 4AIZA 2NPLX 1AC0A 3LIZL 4MCYB 3DX6B 4Z7UF 1L9MA 1LDPL 3UP1A 1NAMH 2AEPL 1Z2KA 2IEPA 3D3VA 1QYGH 3IDJB 1BQHG 5D9SA 1CU4H 1QLEH 1ZXQA 4PRHB 3GJEA 2VN4A 3T4AB 1R3JA 3VRLF 1OPGH 1ZHNB 3X3FH 1RFDH 1FLTX 3RAJL 4CN4A 3K8KA 3C60A 3ILQC 1Y0LB 1L7TH 1HHIA 3GO1H 3KLAB 4XPHL 3QI9B 1YJDH 1J1OH 1KCKA 3K3QA 3PWJA 3SJVE 3V6ZA 2YA0A 4PLJD 3MLTB 4RRPG 1KEML 3MZGB 1WIPA 3WJJA 2EYTB 3KYKL 3ME0A 5EO0B 4R3SA 1SBSH 1FO0A 4PJXA 3OPZH 5I1EH 2YEZA 2WLZA 1NFDB 4CVZB 3CNKA 2JJWA 3S35L 3VXMA 1CE6A 3FQRB 4LIQH 1J8HD 5LQBH 4P5TA 4OCNC 2P7TA 1KLGA 4F15C 3OKNA 2EIBA 1OSPH 2NXZC 2YD5A 5E99H 4YO0B 2QQLL 2WUCH 3UTPD 2I9LB 4X9GA 4YPJA 5DJDA 1MFBH 2AJZA 5I18H 4FFYH 1SJHA 3ZLQC 4GLRI 3H9HB 2BCKB 2YWYA 4HWEH 3OGCB 1WC7A 3RUGF 5E08H 1MCOL 3QIBA 1JPTH 3GSXA 3D39D 4GW4B 4PRNA 4OLZH 3QA3A 4UUJA 2WK2A 2NX5D 1A8JH 1JPST 1V7MH 4I2XB 4P46C 3HI5H 4UIMB 3VXPA 5HYQB 1MJ8H 4ZNEE 4R8WH 3MRMA 4E41D 1AGFB 1I9RH 3TBYB 2ID5A 3MJ7B 5HVFB 3MUHL 3BZEA 3KVQA 1F11A 2ZCKH 1ADQL 2YUWA 1AIFB 3U6RA 2JE8A 5EN2B 4FQ1H 3N9GH 5EPMA 4O51A 2EDXA 1VFAB 3IS0X 5HYSB 3AY4C 3MLZH 1S7WB 3PP4H 4PV9A 3AROA 3SKJL 4NUJA 2X10A 5JHDE 2D0HA 4OV5B 4MS8C 3VI3F 3DURA 4X99A 4QHNB 5IVXF 5KAQG 5JNYB 1A02N 2X42A 4KQ3L 4P99A 5EZLB 5B21A 3R06A 3UPRB 4AEHH 1FZJA 3V6BR 4F3FB 3T1FA 3FO1B 4DWHA 4QRQB 5FYJD 4YR6A 3VH8B 1CXHA 4JDVB 4QRPB 2HTLC 3VG0H 5EUOE 4JGJA 1JRHH 4G43B 1NFDE 1P84J 4AQ1B 3QXAA 5HHMD 4Y8AA 1MAML 2EYSA 4X6DA 5TE4L 3IU3A 5F7DA 1IEBB 1MIML 3LEXB 2GTWB 4UT6L 4XVUD 2DQCL 3AMKA 3UPCA 4HWUA 4OFPA 3RGVC 5FYJH 1VKXB 4HUXB 4HT1L 2VDRL 4YUEH 1KLFA 2FYYB 4Z0XA 1HYSC 4G6KL 4Y4HB 5I6XB 2PKDA 2BVEA 2EICA 1EAPA 4HXBL 4Z76B 4RGOH 1JJUA 2WBWB 4P23D 1JGVL 4R7NB 4G8GE 3VFSB 5F1OB 1DVFC 3TYFB 2IANB 2WUBH 5HDBE 3FAWA 2AKRB 2AEIT 5B39A 1G9MH 3FMGL 4I2XE 1CE1H 3P0GB 2Y5TB 3MCLL 4PRIE 3TA3C 2X70A 3KHQA 4Y4KA 2Z4QB 4KK5D 1T2JA 3ZKXC 2MHAA 2R2HB 3PWPE 5KOMC 1FG9C 4MXQD 5D1XD 4TQEH 3GSNB 3T0WA 1FFOA 2YD8A 5GIRA 4J8RA 4YIQB 1KJVB 4NZUH 4ZS7H 3I85A 5EB9A 4Z77B 4N8VG 1FE8H 3EJZD 3MGOB 2EKSB 4C54A 3PABB 1CL7H 4QHLB 5CEYB 2NW3A 2APFA 4PGEB 3S34H 1HHGB 1FPTH 4YHMH 4LF3B 5EBMB 1MEXH 3C6LB 1AGDA 1PJ9A 3PNWA 1NL0L 3RUGB 3CFCL 5I1DA 1RZJH 1ZLSH 1S78C 4HC1H 1CN4A 5INDA 1S9YA 1U91B 2LVCA 1IGJA 1A1OB 5HGAB 3AXLB 4X7FC 5HHQA 2BC4A 1I1AC 4F58H 4NQXA 5C0CE 1JNHB 2CDGA 3LD8C 3WIHA 3HZMA 4Z7UE 4C4KO 1FNEB 3ARBC 5IFJA 1JZ7A 1FVDB 4HKBA 5E24E 2F54A 3IFOB 2A38A 4F7EB 3L3IA 4LOUC 5ACMA 1VFBB 4PJGB 1UKSA 4YQXL 3VRLE 3B6SB 4C56D 4J23A 2Z31D 2OMNA 4DAGH 2HG5B 2ADJB 2FSEA 4MDJA 5T3XL 2BNRB 3U2SB 2YOCA 2AJSH 3MYJA 2YK1H 3WO4C 2CIKA 1KGCD 4KRMB 2FJHB 3MRKA 4BUGA 3CSYB 1M1SA 4XCCH 2VH5H 1V3JA 1MVFA 4B41A 3NCYS 2NQCA 1INEH 1JHLH 4POZC 5J6HA 3LDBB 2E7BA 1UKTA 3SKNA 1KYOJ 3P4LA 4ZSOA 1YN7A 4X4YA 1I7TA 4ONHB 4NQED 3JVGA 5KSAC 5IHLB 2ZOKB 4RMUA 3UEZA 3IS1X 3G04A 3B2VL 3ZDYF 1NAML 4XP1L 3PWVA 5TE6H 4U1LA 5D1ZB 4OI9A 1KPVA 4L8SC 2C3GA 3V5HB 3RJDA 4HLZG 1JK8B 3RUGE 1U3HD 3QIUB 3RWJB 1CU4L 1F13A 1QLEL 3QFJD 2A6DA 3CFEB 4QHKJ 5DHVH 1U8MB 2LU4A 3TFKC 4Y19E 3TT3H 1NQBA 2BX5A 4JVWA 4M7LL 5DC4B 4CJ1A 2PR4L 3KPSA 5CZXC 3JUYA 5JMOC 3P9MB 1NAMA 1N4XH 5FO9A 1EEUA 5HHNB 1T3FA 5B39G 2OK0L 3BW9B 4FQXD 2CIIA 1G7JA 4OCSH 1LK3H 3PP3K 5I1EL 3BH8B 5L0QB 2QQKH 5IMMA 4W6XB 1QSFE 1MWAH 5DJZB 5LQBL 4F2MA 3VI3E 4LLMA 2YXFA 1RK1A 4JG1L 5IVXE 4RFOH 4HAFA 5E99L 1RZKC 2UWEF 3NPSB 1YMME 2WUCL 1OAXH 2M8XA 1BOGB 2DQDL 2BNRE 1MFBL 5L6YH 5HGDA 3VFOB 2Q3AA 5C0RL 1U8HB 4FFYL 4I3SL 4RIRB 4XRCB 3FB8B 2WWKO 4HWEL 5E08L 4IOIA 4RQQB 1GCFA 1WBXA 4G6FD 5IQ9A 3HI5L 1X6NA 2XN9D 5HHPB 2JJTA 5GGUA 4EXKA 4R8WL 3T09A 2RCSH 1I9RL 2X4UB 5EWIH 4YEFA 2KQNA 4MCZB 3EYUH 1NANI 3CAFA 4FQ1L 3N9GL 2F53B 1J8HA 2LVEA 5CWSA 5F1KC 1LE5B 2ZOLB 1AKJD 4UU9A 1LD9A 1GGCH 4ZUUB 3BZ4A 4R4ND 1R3KA 3O6LH 1G1YA 4JKMA 5D4QA 3F7VA 5JDSB 1IQWH 1WITA 3KPQB 5DYOB 2Q7YA 3RZCD 3HCVB 3OJDA 3SOBH 1C08B 5JORA 2NX5A 3NBNA 2CJUL 3WJJC 1XFPA 5DURB 2IGFH 4E41A 4HUVA 1XH3A 3GMOB 2R1YB 3RVXD 3T4YB 1DR9A 4XNQA 3G9AB 1GL4B 1OARH 3O0RH 2CDEA 3HI6L 3QIWD 4CU7A 1KFAL 1QPXA 4HIEB 4U3CA 1JRHL 2ZP0T 4NO2B 4HIIB 1FFRA 4N1CA 4ZUWA 2OX5A 5FYJL 5CEZE 3JSSA 4BZ2H 1ZHBB 5IMOB 1RUKL 4Y2DD 2ADIB 1FORH 2XTLA 1UXSA 2VE6B 1JHTA 1DEEA 4OLUL 5DD0H 3FZUC 1RD6A 2A9MH 4LVNB 5F7UA 5IMLB 2PTTB 1I4FB 3KS0J 2VABB 5L2KD 3MRPA 1NC2A 4XTRC 4K71B 5C92A 1HILA 3B9KB 1R5IA 1A6TA 2HVJB 5JIIA 3TBWA 5IIEA 3GMQB 2VZUA 3CMGA 4X6CB 4FQIH 3MOBL 4TQEL 3QR2A 1H8SA 1YEDA 2WSKA 4X6EB 1U8LA 2B2XL 3GIVA 4HSQA 4JANA 4CN1A 2DM3A 1G0DA 1JRHI 4IS6A 4OGYH 4ZS7L 1NSNL 4NFDA 5D2LA 5FDWA 5EIQA 3MBEC 1SMOA 4P23A 5C0JA 3VWJD 1FC1A 4POYA 5BRZA 1S7VA 2AJ3B 1CL7L 3DI2B 5TF1H 4EUPB 3BKCH 3ALPA 3BGMA 2Z91B 3S34L 5ICYA 3G5YB 2BSTA 5CJ5A 3K2UL 4F33A 3GBNH 3MRHA 1OGAA 2X4RA 4OIIH 4OZ4B 1TVDA 5C08A 1PAMA 1EHXA 1YC7A 1RZJL 4F9LA 2P5WB 1ERNA 5D1XA 4HC1L 4ORZC 5GGTH 1RZ7L 5BOZG 5DC9B 3Q48A 1XF2B 5E2VL 1A2YB 2CRYA 2W9DH 4F58L 1QFHA 4XCYA 3HLAA 4XMPH 4YNYB 2HVKA 5SWSD 4OIAA 5GSRA 3ZDYE 1LGVA 4LLDB 1TVBA 2EDTA 1BQSA 3T65A 5DA0B 4PGBA 1HQ4B 4HC1A 4N0UA 4HJ0D 4EN3D 4UV4H 3IFNH 4U1NA 5F72S 1MNUH 3O9WB 3TBVB 5AD0B 3MREA 4GS7C 2QV2A 4NN7B 1CL7I 2X40A 3V0VB 5JDJA 1A6PA 1X5AA 4LCYA 1X5YA 2FIKA 3L9RA 4H26A 4D9LH 2IADA 4X6CE 2GJ6E 2AJSL 5MENE 2YK1L 4HPYH 4N5ED 3O3BB 1QLRB 3NFNB 1P4BH 4YGVB 5I8EB 7FABL 2V7HA 5IW6B 4YHNA 2VH5L 1UCBH 1BFTA 3FO9B 2DS4A 1JHLL 2NNAB 4MD0B 5IM7B 3KYOA 5FO7B 3JWOL 2C3VB 3VGAC 1ZKAA 2CDFA 1K8IB 3QPXH 3VXNB 3C9NA 2E6PA 3KPPA 4NKDA 1QFUH 5T1LD 5DQDH 4IM8A 5ISZB 4QXWA 2Z92B 4L3CB 2J7LA 4BUHA 4O2EA 3IDXH 2UWEE 1I75A 5K9OB 3C5SA 4S1SH 1U36A 4KRPD 3W81A 1BX2A 2X7LA 4C56A 3KPNA 4WHTA 4ZD3H 2Z31A 1N0XL 2VISA 3PV6A 4XWOC 5KJRL 3TN0B 4DVRH 1CFNA 4JFPA 1J1PH 3EYSH 4U1HB 5F6IC 3IT8D 3CCHB 1MI5D 1BVKA 3I75A 5FF6B 1QEWA 4E0RB 3MRGB 2A0LD 2ENSA 1I1YB 3CGTA 2ILLA 1PG7H 2FL5A 4DOHB 5IW1A 5I8CA 4UBDD 1JYWA 2D9CA 3TF7C 1W0VA 2FD6L 2OR9H 3MJ8A 1IAOA 5IB2A 1PY4A 5JXAL 1YQVH 3CVHH 1CTNA 2AJXL 2W07A 3LKOA 4M7ZB 3UXFA 4NQEA 5F9JB 3K7UA 4QHMA 1FCCA 4LNRA 1CG9A 1LK3L 4G8EA 4NZRH 5DHVA 4F7PB 4IMLA 5F3BB 2IAMB 2BSRB 1D5MB 4OCWL 5ETUB 5IB1A 3EO9H 12E8L 4CNIB 2DWDB 5E4EC 1FHGA 1OB1B 1H3WM 1U3HA 3GMPA 4RFOL 4TOYL 4J2XA 3QFJA 1A3RH 4JZNB 4PJ5B 1QP1A 2X4PA 4LKCB 5IQ7H 4Z8FH 5DI8B 5E56A 8FABA 5E2UL 4H1LB 1ZAGA 1CXIA 2NY4C 2W60A 1DN0B 1WTLA 3OB0K 3SE9L 1T22B 3MYZA 3RA7H 1TZIA 3VXSD 2P8LA 4LSQH 1P6FA 2NYYD 4MXVF 1G0YR 1MWAA 4KMLB 4N0FA 1KTLA 1EZVY 3JVGC 2Z93B 1A7PH 4G9DA 1UWEH 1FSKC 2RCSL 1DEDA 1A1NB 5ISZE 5EWIL 2M2DA 3EYUL 2R29H 2IH1A 4U2ZA 4KK6D 4X8XA 4ZUTB 4ZFFB 2MTPA 4IRZH 3TBSA 4Z7VF 3VFUB 5TDNB 4YDLC 2J4WL 4HJGB 3VGEA 1GGCL 4G7VH 3O6LL 4FG6C 1KTDA 5DDHB 1R3HA 3IRZA 5SX5H 5CBEA 1EFXB 4LU5H 4LCCB 1S7XA 3BWAA 3MNVB 5HHVH 4YLQT 1F58L 5DC0A 4OF3A 4R90H 4KHTL 1RUPH 4M6MH 2DICA 1AXSA 2NY5L 5A2LH 2XN9A 2ED8A 2DWEA 1FNGA 1MY5A 1LO3H 4GAFB 1F4AA 4NUGH 3HC3L 2ORBH 3G6JA 5D7SH 3QP3A 3D25B 3DX7B 1TVHA 3PIQA 2YRPA 1PKOA 3ELAT 1JCKA 4JRXB 4DZBB 1YJDC 1D5ZA 1AKJA 1LEKB 3RJQB 3VCLA 2X4QA 4YPGA 1YNLH 3MRRB 3QJFA 2AAVA 3QEQB 1DQQA 1EHLL 5F6HI 1QHOA 2ITCA 4KK9D 5GGVH 4BH7B 3RZCA 4X83A 3HG1D 5DXWA 1EUUA 4O5LH 1W2KT 3QZWG 2A9ML 1J1XH 2NTFA 5FGBA 4YFEA 5SWQB 1HOCB 1U41A 4MNQB 4RFEB 1L0YA 2VWEC 3MA7A 2HN7A 3IRPX 3QIWA 2YUZA 3B2UD 1JHKL 1QFWM 3SDAC 4UIKH 2GUOB 3S96A 1UWGL 4XXCC 4ORGA 3UJTH 3MRCA 1KJMB 5EBWB 4D0BB 1OTUD 1S7UB 5CD3B 3O3EA 3A6CH 1Q1JL 5KSBF 4HX1B 3MV01 3T0ED 1EMTH 3CPLA 1SYVB 3FFCB 4OGYL 4GQ9H 1GGBH 3P9LA 4Y2DA 4RAUB 4ZFGH 2AERT 4S1DD 4XAWH 1MFAH 2VQUA 1VFOA 5E8NB 5DHYB 2BFVL 2KDGA 1BVLA 2WP3O 4A6YB 3QQ9C 1CGTA 1IAKB 5TF1L 1I3RB 3BKCL 4L4TD 2ZCLH 4BSWA 2H41A 5IHUL 2NXYD 3SDCB 5TFSH 3W0WD 4JHWH 1VSCA 4WI8A 3NTCH 3VDBA 1P1ZB 4G3YH 3IETA 2BNQD 2EC9U 4L8BB 1KLUB 1AH1A 5E2TH 1FL3B 3QUMH 3BYYA 3UTTB 2HMIC 4DKAA 3HNSH 3VXRD 3EYFA 4NCC1 5C0ND 4PJ8D 2AV7B 3VWJA 3VXTA 5A2JH 1UJ3B 3BGAA 4Z7VB 5AYQA 5I19L 5LXGH 1CD0A 3FO2A 2NY3B 2A9NL 4U1SB 1N8ZB 4PJCA 3DVIA 4PREB 3WE6B 3MXWH 5CIPB 1S8DA 1P4IH 5GGTA 3RWHB 4ZFOL 3QPQD 4GAYA 3L1OH 3DOSA 3W11C 4MNQE 4V1DB 1JUFA 2ZSVA 4NP4H 5DS8A 5E5MB 1A7OH 4K7PH 3EFFB 3NCEB 1R5WA 4YDKL 1YPZA 1Q0YH 2VR9A 5D72H 4K9EH 1CGUA 4CMMA 4X4ME 1G9MC 1UB5A 1P4BL 4KVCH 4XH2B 4LEOB 5DMYA 1UCBL 3REVB 4P23C 3I6GB 1CD1A 4JVUA 5SWSA 3FFCE 3PGFL 1X5FA 4FQ2H 4M02A 5JW5B 1JV5B 2VLRB 1C7TA 1JFQH 1EEYA 5FYKE 1QFUL 4MAYA 1MCPH 1CQYA 5MEPB 4EN3A 1YY9D 5HHOE 1V8HA 3IDXL 1Q9WA 4JFDD 4ZO9A 1T5WA 5FEBA 5EU4A 4ZD3L 5I71B 1D5BA 4F9LC 5D1XC 1UACL 3JTSA 2PO6C 5GGQH 4I77H 2EIZB 1PVHA 1J1PL 4MXVE 2IC2A 2ZUSA 1T66C 3TO4B 1MAKA 5E0QA 4XAKD 3I50H 1BHGA 3WLWD 3QHFH 2V2TA 1P6AB 4HWZB 4P3WA 5I1HL 4QHUA 3WLBB 4PJAF 1PG7L 3DI3B 4IIQB 4HHAB 2CRIA 1YQVL 5GISH 3CVHL 3T0DA 4Z7VE 4UDUB 5T1LA 2IAND 2XWTA 4NOFA 4FXLA 4QRTA 1P7QD 4LCUB 1PGRB 4MWFA 3GGWB 2Y36H 3CFJB 1LVEA 4NZRL 1PZ5B 1T4KB 4TNWK 2FZ3A 4PIRF 4I8DA 5C07B 1CLZH 5CILH 5IEKA 1MI5A 1IM9B 3MLRH 1BVZA 3CVHA 3P77A 5GSVB 4Z8FL 4OT1H 2APWA 5IQ7L 3ZDZF 5DFTA 3ARGC 4LFHG 4OUOA 4OB5L 1WBZA 4R0LB 1HHHB 5JHLL 3V0AC 4PG9A 3RA7L 1BZ9B 3RWEA 3W82A 1ZS8B 1ZK9A 4LSQL 4TUJA 4KRLB 4M9PA 4MJ5B 1T6VN 5C0BB 1IARB 1XGUB 2DMCA 1ZE3C 4YBLB 2CKBL 4BELD 3IB4A 3UBXI 4Y5YA 2W0FA 3P0YH 3TCLB 4BQCA 3WNLA 3U46B 2QR0A 2VLRE 2EECA 4PTUA 4X8JB 1A7PL 1N6UA 5F7WC 4AH2B 1UWEL 1IL1B 1H15B 1KCRH 1YDPA 4ZUSA 3U4EB 4EVNA 3VXUB 3WL9B 4UB0L 4WEBH 5B22A 1N6QH 1IGCH 5ANMA 5IF0B 5J12C 1S7RB 3PV7A 5D8JH 2P49B 2JJUA 5C0IA 1DQMH 2FJGB 1X5JA 1MJ7H 1F3JA 4QRSB 1L6ZA 5MEQB 4G7VL 5ACZB 3BEWB 3CUPA 5HGHA 3HZVB 4NSKB 1T03L 3VXSA 1JZ3A 4LU5L 3V5KB 2ZG2A 4PRPE 4I0KA 4GKNB 1T0NA 2DDQL 4R90L 3WXWL 4Q2ZA 4D8PB 2WMPA 1TQBB 4FNLL 2OTWA 1LO3L 1PKQB 1A6WL 3O3AB 1RQ5A 3N1QC 5KSBE 2ORBL 5D7SL 3GZKA 3V4UL 2HT3C 3WD5H 2ED7A 2VIRB 2OZ4L 4YHKH 1WWCA 2HTKD 1GZPA 1U3HC 3C08H 2GY5A 4F8QA 1AXTH 4GBXB 3EZJB 3UZEA 1DBJH 4RA0C 4XBGB 4WHYG 1A64A 1J87A 4LLQA 4X5WB 1F6LL 2C4FU 3WHE0 1YNLL 4PJDA 5IBTH 3DMMB 3FT2B 4X98B 2V9RA 4JQVA 5FM8A 3NIDF 2R0KH 1KIPA 1JGDB 3WIIH 3B4NA 4P0DA 4OTXH 5FUZL 2ZSWA 1T0PB 1J1XL 4AEIH 1T83C 3H9SA 4KRNA 2E8YA 2GT9B 1P2CA 1T21B 3HUJA 3P73A 3QDJB 4PJAB 5J9PB 5MEOA 5H2BA 3ULSA 3I3BA 4YBQD 4WHDA 1IKFL 2B0SL 3IJHB 4LKXA 2JF1A 3F58L 4H5SA 1J5OH 4UIKL 3KLDA 4HK0B 4N1EA 3UJTL 1B0RA 3MXVL 1H5BA 3VXUE 3MV8B 4I9WE 3A6CL 1AO7E 5JW3H 3LRHA 3QNYA 3IDYC 3KWWA 4GQ9L 4Z7WF 1HXMA 3EGSA 3L5XH 4LPVA 4Y1AB 4ZFGL 4XAWL 1MFAL 4XB8A 1PY9A 3DO7A 3HG1A 4JN2A 2RFXA 2YUXA 4HV8B 3MRLB 2MCG1 2XZCH 4FS0A 2GSIB 3UBXG 4MCYA 1UKQA 4PD4J 5TFSL 3DTXB 1RV6X 3WKMH 2NY7H 4JHWL 5B38B 1NLBL 2R69L 4MVBC 4AENB 2RGSA 4X5LA 3RI5F 2R0LL 5CJXA 4LGSB 5SWZE 1HHKA 4G3YL 3QCUH 5I17B 5IB5A 3TP4A 2XG4A 5E2TL 1RHHB 3QUML 5DR5H 2E7LA 4YWGH 3PQYD 4FMFA 1TCRA 4P2CG 4ZODA 3MNWA 4KROB 3T0EA 3DV4B 3IJYB 3SDXA 4EBQH 2ICES 4GRWF 4XNUH 1DQDH 1BJ1H 4CW1A 1ZSDA 2V9TA 3UC0L 1KCVH 4NN6C 3RZCC 1NCDH 2A73B 4OCRH 1PEZA 2P46B 5LXGL 5JO5B 4OFYD 1EV2E 2J3SA 1CDIA 3MLTA 5HYEA 3LHPL 4LSUL 2G75B 3ALWA 3QUMA 1T2XA 4PS4L 3BEVA 5EO0A 3W0WA 5IMKA 4GJTB 4JR9H 3U4BH 3V0WL 5BOPA 4ODTL 4LMQI 3QDJE 4F7CB 1A7OL 4PJAE 2BNQA 2E7HA 1F5WA 2XYCA 4WI9A 1KACB 1J10A 4HIJA 3AC0A 3FB7B 2HWZL 3O4OC 3ARUA 3H0TB 2IG2H 4ODHH 4K9EL 1KIUA 3VXRA 5EU3B 3I3DA 3MV8E 3VFPA 3OGOE 5D1QD 4Y2DC 1U3ZA 4LL9A 3QXDB 4PJ8A 4LVHC 4HGMA 3L6FB 2ARJQ 3H9HA 1IQDA 4FQ2L 3MR9A 4DKEL 2V5SA 1JFQL 5GJSH 3ARDC 4K07A 5CUSH 3T77A 1MRCH 1MCPL 3GSVB 5DA4A 5HYQA 1X7QB 2YPLE 2SEBB 3MA9H 1AGFA 3TBYA 3O2VH 3ZDZE 5FDYA 3MUGA 2GKIA 1E6OL 2VERN 3DIFB 3OWEA 1EA9C 1VFAA 5GGQL 1DBBH 4XC1L 5CJ8A 5KN5B 1E4WH 2QL1A 3GMLB 5E8DH 5FM4A 4OM0L 3I50L 2W65A 2EC8A 1HINH 3BKJL 4JY4B 5ESAB 4H25B 3BP7A 5CJQL 4ZFZB 1ZTXH 4X80L 4QHNA 3VWKD 4MDIB 5GISL 4AM0B 5DTFB 4BZ1H 1F90H 3N06B 4RMWA 4JFDA 2VXVH 3NVQA 4OUUB 4YH6A 3FQTA 4MA3A 4TSAL 4UOJA 2Y36L 4Z7WB 3RU8L 2AJVH 5GGVY 4Y5VC 2NW2A 1RIUL 5EU5B 4HH9A 2BY0A 4MX7B 1A4KA 4JO3L 5DD3H 1K4DB 4DUWA 5FO8B 5FOBB 3VFTA 3INUL 4UT9H 5GRVK 1HXYA 2YBRA 2G2RB 4RAHA 4WHCA 4OT1L 4KI1A 4JFEE 1VKXA 1FVCB 2OSLB 2FYYA 4JJHA 5DZNA 5DJ2B 1QBMH 4U1GB 1FQ9C 4LSPH 4ZXBD 3ISWA 2WBJB 2JB5H 4Z76A 5C2BH 1AQKL 1AR2A 3IKKA 1IEHA 3HAEH 1VB9A 3BX7C 4U0RB 5T1KB 2DL9A 3J7HA 4MAYC 3TYFA 2IANA 1MCBA 1EVTC 1Y18A 4J3XA 1NMCB 4YDVB 5A2IH 1P7QA 1OF2B 1B0GB 1FG2A 2DI7A 3MLWH 1OWRM 4GRWB 3S88L 1KCRL 1FAIH 3FQWA 2Z4QA 4WEBL 3F7YB 6FABH 3NIDE 4XI5D 4WFFD 5HD8D 5IJVA 4M5YL 1YN6A 4OF8A 4S0SD 4PJ7B 2H2SD 5JIPA 4NO3A 4PRBB 1RIVH 3QDGB 1NFKA 3G5VB 3U0WH 3HMWH 5SX4H 5EO1B 3WHE1 4DUXA 2P43B 2B4CH 1BAFH 4WUUD 4PB0H 4H0GA 4NZTH 2EH7L 4LEXH 5CHNB 4AQOA 4JFZL 3NZ8B 4QHLA 3RDTB 4C58B 1II4E 1DBMH 4HXAL 4X7CC 4XNZC 4JFFD 2X44D 2NLJB 1NMBH 2F15A 3VGGA 3WD5L 5C0DB 4ODVH 5HGBB 25C8H 3QEGL 4Z7WE 4GAGL 5F89B 3T2PA 3C08L 4GSDL 1I1RA 3DSNA 3EDKA 3VG9C 1DBJL 4X7EC 4M61A 4RMTA 4XP6H 1NC4B 35C8L 5IBTL 3O8XB 4LGRB 1OP3H 3CSGA 1XGQA 1DLFH 2Y6SC 1AP2A 3QJHB 4F15B 3WIIL 2NXZB 4OTXL 2DMBA 4Y5YC 2VYRE 5IB3B 1EEQA 3B43A 4XPAH 3GSUB 4KZDH 4PYHA 3KDMA 3U0PB 1YEEH 4MNHB 2BVUA 3L3GB 3DYMA 5ERWA 2NTSP 5L88H 1A6AA 3RVWD 3STLA 4GRWE 3QBTB 5CEXA 3LKRA 3QQ4B 3RVUD 1G7QA 5F8QC 3RWDB 1GJIA 4AG4H 4K7FB 3U2SA 1D5XB 2CLRB 4LP5A 5JW3L 4RMVA 2V2WA 3G6DL 3M07A 3LN5A 2H8PB 5HI4C 4D9QD 4IOFC 3QUKB 1G6RL 3P11H 4GW1A 4KMQA 5KZCB 3QNXA 1T6WA 2V2XA 2A6KB 4EOWH 3QG7L 4LSVH 1CI5A 1UQSB 2H6PB 3HR6A 3IU4L 4L3AA 1JWUA 3MV9B 1TTUA 4ONHA 3TT1L 1JF1A 3PHQB 2F74A 4YK4B 5E6YA 2NY7L 1NCAH 1SYSB 4MQ7A 4XCNB 5D1ZA 3QCUL 3V5HA 2ZPKL 2CKNA 1VHPA 3X13B 2VDKL 4YWGL 1FNHA 1U8OB 3GSWA 1U8MA 3GMMB 4NO5A 1TPXC 1DUZA 3MRDA 1F4YL 4TRPL 1I1CA 1F02I 4WV1C 1KCVL 3PGCB 4HD9A 3N1GC 3S36H 4TVPD 2D0FA 2QLVB 4MA8H 4OCRL 3DRQB 3QO1A 4EIGB 1IEAB 2EDQA 4OKVA 3Q5OA 5HHNA 4ZO6A 3LKSA 5J7CC 3BW9A 5LGKA 4R2GD 4P59H 4NIKB 3DSFH 4PGCB 4TVPH 3F6IA 2AXGB 3PJSA 1JMZA 2HFTA 3IDGB 3M8OH 5BS0B 1F8TL 5DJZA 1S9XA 3VD7A 1S7TA 4NNYA 5D7LB 4RFNB 5DMKB 3FQXA 1CBVL 2VC2L 3PQYA 5E8PB 4U1JB 2IG2L 3MUJA 4ODHL 4V2BA 2V5MA 3FONB 4UDTB 5D7JD 2WNGA 1YA5A 2JTDA 1MCNA 4PY8I 4KK9C 4RGND 4I18B 2D7OA 2G60H 1BBJB 1JF5A 4UINH 3FB8A 1EERB 1KBGH 3ZKXB 3OF6D 2XTJD 3JV6B 4OFYA 2PXYB 4BSJA 3P2TA 3BPOB 1IGFH 4CADB 3GUTB 4M43H 1S9WB 4WI3A 3MA9L 1U8PB 5HDQH 2ERJB 3BUTA 5CP7A 3O2VL 2EE2A 4MCZA 1OAUH 3QEHA 2F53A 2ADGB 4ZOAA 3OKLA 4XZUB 2F9BT 1DBBL 1E4WL 4KUCF 1OAKH 4Y7MA 2FWOB 4ZUUA 1I9JL 1YY8B 2J8UB 5D1QA 3W39B 3U9UB 2EXYC 1N3NB 4ZMAT 5DYOA 4FTVE 3CH1B 3X14B 1CVSC 2DLGA 1BQHB 1C08A 4UOW0 3PXJA 1MH5B 2XWBA 5BV7B 2BOCB 1M7DB 4QEGA 5TH2A 1F90L 2ZUQB 4G6JL 2VXVL 5ELIA 3L3HB 3LD8B 4QXTB 3L3KB 1YEIH 2Q6WA 4ENEC 2BJMH 4JQIH 4WENB 1J05B 5KG9B 1Z5LA 1ORQB 1ETZA 5BS0E 3DJ9A 3VXOB 3H8NA 4UT9L 4P2RD 4HKZB 2RBLA 1CVRA 5SV3A 5GZOD 5K9QI 4K8RH 5DZOA 2O5YL 1HH9A 3EZ8A 1MRFL 2YR3A 3EO0A 5IMOA 3C5ZD 3PL6B 4I3GA 3WFCH 5C2BL 3RIFK 3ARZA 5IVOA 3P30H 1F4WL 1BWWA 4WVRA 4NDMA 4KK8D 1PEWA 1WCBB 4J4PC 2AK4D 2PW2A 1J0HA 1J0JA 2XIDA 2BMKB 3HRZB 1TJHH 5B3JF 3JV4B 3RWIB 5DD6B 4TTGA 1FAIL 1AFVL 5IVZB 3CFIC 1RZ8B 2IFFL 1FYTE 3AS0A 3GMQA 1WAAA 4HUMB 4M3KB 3GKWH 3VDCA 4AMKH 4F37K 3HAEA 5KSVA 5DRXA 3NCJL 1RIVL 3VW3H 5I1IH 5EDXA 3OXRB 3DGGB 2GSGA 2J5LB 4ZXBA 4PB0L 1QVOA 1LEIB 3QULA 4IDJL 2F19H 1JWSB 4NZTL 5ID1B 5F88A 4LEXL 1GGIH 3CX5J 4HW6A 3SKOB 4ODWA 2IBZY 2X4OA 3GDBA 1G7LB 3GEWB 3G5YA 1X5ZA 5JIKA 1WFOA 1RSFA 2DQGH 1YNTB 4PRAB 1N59A 2CLVB 5D5MB 1VFUA 4ODUA 4NWUH 1KIQA 4ODVL 25C8L 5F1SA 1T1ZB 4UQ2A 3LB6D 1JL8A 3KYNB 4L4VE 1N7MH 1Z9OA 5CIPH 5DSCB 1XGTB 1V3LA 2X4NB 5CMAB 5DVNA 3A6OA 3WLWC 4LCWD 3PDGA 4XP6L 2JB6A 5DRWA 1XGRB 2IMMA 1S9VA 1A2YA 5I8KH 4Y4HC 1AHWB 4DW2H 5I6XC 4WUUA 3RTQB 3CDGA 1ZA6B 4NRYB 4P2QB 4YNYA 4V2CB 5HY9A 5M95B 2FR4B 1OD7A 2OL3B 5J8OA 3EIFA 1MOEA 4CDGC 2J1KA 4BK4A 5SX4I 4XPAL 4KZDL 2HKHH 4JFFA 1YEEL 1H0DB 1VGEH 3KXFB 3LOWA 2X4SA 2VR4A 4P3CH 2VXUH 1G7MB 5L88L 3O11A 3SGDI 1I8KB 4W6YB 4PUBH 4JLRB 3V0VA 2X4TA 3KNBA 3BPCB 1GYAA 4X6DF 2GW5A 4P2OD 4NJAL 1BQUA 1HHJB 5EU6B 3EYVB 3UYRH 3TO2A 1QFOA 2IH3A 4L29A 1CXLA 5MP6H 3O3BA 3NFNA 4R7DA<