4ISVB

Crystal structure of the fab fragment of 1c2, a monoclonal antibody specific for poly-glutamine
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
221
structure length
212
Chain Sequence
SIQLVQSGPELKKPGETVRISCKASGYSFTTYGMNWVKQAPGKGLKWMGWINTYSGVPTYADDFKGRFAFSLETSASTAYLQINILKNEDTATYFCARRRSYSNYFDYWGQGSTLTVSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 1C2 FAB LIGHT CHAIN
publication title Linear and extended: a common polyglutamine conformation recognized by the three antibodies MW1, 1C2 and 3B5H10.
pubmed doi rcsb
source organism Mus musculus
total genus 47
structure length 212
sequence length 221
ec nomenclature
pdb deposition date 2013-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4isvB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4isvB02
2VDQL 1CTOA 2Y5EA 4G6AD 1RFDH 1S7RB 3FO0L 4LNVA 3GSWA 2XPGB 3O8XB 1S8DA 1UJ3A 1OM3L 4K8RD 2E8ZA 4PLKD 2OR9L 3RUGB 2GJ6A 4P59L 1KPUB 4OSUH 5DD6B 5DGQA 3VFNA 1DBJH 2CH8A 3N85H 4XP1H 2DM3A 3KYOB 1FLRH 1OB1B 1A8JH 5FKPA 5C08E 2W0FB 5L8KB 2ZNWA 3OXSB 4I9WE 3SPVB 3QDJD 4X6FB 2LVCA 1ORSA 1W2KT 3X14B 5KSUB 1VPOL 3G5XB 2HTLC 5IBUG 4JDZA 4JPIB 1W0WA 2EIBA 2P1YA 3GJFB 1HYSD 5MEQA 5AD0B 3T0WA 4QRUB 5JHLL 1MVUA 2YZ8A 3Q3GB 3PQYA 3C60C 1CD0A 3RVTD 2XWTB 5FV2A 3VJ6A 3S97C 4MNGE 5MI0B 1FDLH 5IK3A 1PZ5B 4I18B 4KKLC 1T1ZB 3PDGA 4S1RH 5EC1B 2VITA 5EU3B 1ITCA 1ZT7B 4U7MA 3FHAA 4WO4D 5T1LD 5A3ID 1FIEA 2IH3B 4F57L 2VLJB 3LN4A 4ZPVB 3QUXC 4RIRB 3NZHL 3EUUA 3AY4C 2P8PB 4F80A 4ODSL 1FBIH 1FORL 15C8L 2A83A 3WL9A 1OCWL 4NPYB 4QHNA 3HTLX 1A7OL 5D7LD 5CBAB 3O4LB 2W59A 4GRMA 3QFJB 4LFHD 3FFDA 5D2LA 4LLUB 1CD9B 4I18C 1MRCH 3CX2A 1HNFA 5JHDA 1XCTB 2BSTB 4KK5D 1CFTB 4MNQB 4UUJB 5EA0L 3ARFC 1MWAA 5B8CA 5BCAA 5J1AB 3UZVB 2EYRA 5D7IE 5BXFB 2O5ZL 3KPMB 1RUQH 4LPCA 1CL7I 1CIDA 2P24A 5GRVK 4PPTA 2EYTB 2DI9A 4E41D 1T1XA 3F12B 4H5SA 3TVMB 3SJVA 5A2FA 5ABDE 3DBXB 5D1XB 3SDXE 3QDJA 3RWEB 2VLRA 1MJ7H 1BD2D 4FG6C 1K4CB 3T0ED 4QRPE 1JCKA 2R0WL 4LVNC 2C3WA 2B1HH 1F8TL 2FWOB 1UKTA 4NP4H 3PP4H 3B9AA 4LLDB 4NO3A 4WY7H 1FC1A 1FL3B 3CLFL 4YIQB 5DD1L 4NQVA 3FQTB 5DS8A 5EU4B 2AGJH 4XMLL 3NZ8A 1MFEL 4GLRH 5DSCA 3PP3K 3KR3H 4EI6A 4D9QE 2A9ML 1BF2A 2BXZA 5KAQF 3KYKH 4JCLA 4WHYG 1XF5A 3BAEH 4Y5VA 1T20A 4QXGH 1FZKB 2KQMA 4P9MH 4ONFL 3RUGF 2QKIB 5I66B 2VDPH 1C5CH 2OXGA 4WO4A 5T1LA 1OAZL 5BZWB 5LQBL 1U3YA 4P57A 1AI1H 1CS6A 2CLVB 4FFZL 5TDPA 3WNKA 3LH2L 1RZ7H 5HI3C 2J88H 3K1KC 4JPKL 2NY5C 2Z8SA 3KPRA 4Z0XA 1I85C 1KV3A 3JTTB 4IRJD 1KB9K 4GAJH 1E28B 5E6IC 5C08A 5D7LA 3M45A 5I8CA 2AI0L 4JGUA 3G5YA 3L3KA 4RGNC 1ITBB 1WFTA 4HUUB 4TYUA 3UTTE 1Y6KR 1X5IA 5KZCD 4JDVB 2IJ0C 4X6CA 4XPFH 4JO1H 4NWTL 1SYVB 3IETA 1KIRA 1U92A 4R4FL 4Z7QF 2E7BA 2EE3A 4RGMC 4NQDB 3X11A 4EDXB 2J4WH 2R2EA 5HHVH 3C5ZA 3CX5K 1S7TA 4H0HB 4G9FD 5J89A 1S9YB 4OKVB 3WKML 1NCDH 2EKSB 2COQA 1I7UA 5F9OH 4AJ0A 4E41A 2P5EB 3KG5A 3Q2CA 2ATKB 4HFWB 1K5NA 4JFEE 3FKUS 2QL1A 3AXLB 2ICCA 5KVEL 5DEFB 3KJ4B 4JZJA 5CIPA 1DQQA 1HI6B 4DTGL 5T5FL 1BD2A 5FYKD 3SQOH 1U36A 3ZL4H 1P6AB 3VRIA 2QADC 3DPBA 5F9WB 1YQVH 4NRYB 4OFYD 4MNHA 3T4AB 3CIQA 5F6IB 2H8PB 1CFVH 3EOBA 1GGCL 1YNTB 2AV1A 1EPFA 3HUJB 4U1MA 5IB5B 1MCWW 2XQBH 3V52L 4IDLA 5DC9B 3X3FH 3FHQA 1WWAX 4WWKC 5IMKA 1ND0A 3IVKB 4QRSB 1M7XA 2JJSC 4LEOB 3EIFA 3KPPB 2OQJB 5DFTA 3DO7B 3T1FA 4ESKA 1AD9A 1WAAA 3BH8A 3MLVH 5C07D 2WBJD 3KJ4C 1YN6B 3ZKMD 3GRWA 4XBGB 3VXPA 5TDNB 1NCAH 3NTCL 4WEBH 5BVJB 5C09D 2CJUH 3DV4A 3FT3A 1I8IA 5D7IA 4TSCH 4MX7B 4DEPB 2R29H 3P4MA 1CU4H 4LP4A 2Y06L 2FZ3B 4YX2H 3RHWK 1Z5LB 1UT9A 1YJDH 3QB7C 4YHML 2H6PB 2GAZA 3UROR 3I02A 3CSGA 3SDXA 4LF3B 1NAML 2YUZA 3DROA 3QQ3B 4EUPA 4QRPA 1ADQH 5GGVY 2X7LA 3E3QC 3OKMA 4BQ6A 1T21A 1YEDA 4GRLB 4YH6A 4XP4H 4GG6E 3T0AA 1R3KB 3FO2A 2AEWA 1IT9L 1HHGB 1CWVA 5IR1B 1P5UA 4X4XB 5GGSB 2DWEB 3LKRB 1U6AL 4JRXD 1QP1A 1PGRB 3RZCB 1QFUH 4P4KA 1QBMH 1ORQA 3B5HA 4X5XA 2R0ZL 2HKFH 5E2JA 3NCFB 3P9MA 3GMNB 2FBJH 3OJDA 4J8RA 2QR0B 1FFNB 4JQVC 1YEGL 4QXUL 4YHYC 2QQQA 4FQPA 4MSWB 3LKOA 3MLTA 3VFGL 5JR1L 2KBGA 2FX7L 3CFBB 4KU1A 5CD5C 1LK2A 1LEKA 1CCZA 1F5WA 2APWA 2DL2A 4AL8L 1GYAA 2BCKB 3VGGA 1QA9B 1C7SA 4P5KB 5IHZB 2YC1A 4HFUL 1VB9A 5C9JA 3PV7A 2BSSB 3C5SA 1IKNC 1Z0NA 4H20H 3MFFA 3L5IA 2HRPH 2DD8L 1NFIB 1M71B 4I0KA 1A6UL 3WUWB 2YRPA 1ZLUK 5IVOA 5CHNB 5C07A 4HKZA 1C1EH 3PABB 3QI9B 1BQHA 3UTTA 1KB5B 3L7EB 4XPTL 4EOWH 1TETL 2DBLH 3EYFA 5ICYB 3HE7D 3WXVL 3RTQB 3IDYC 1IGTA 4TVPH 1WWWX 4RWYL 4JFDD 1V7NH 5IHLB 3ULVH 1MWAL 5HDQH 3KLDA 3D6GA 5E8PA 1F4YL 3BN9D 1HDMB 4P2OB 1K6QH 3ZKXC 4GW4A 5CJXA 3VFRA 1X6NA 1YEJL 2HH0L 4LHJB 3K8MA 1U8MB 2CRMA 3TCLA 3GMPA 2FSEA 3VWJC 1BFVH 1A6AB 1CFSA 1MF2H 1FYTB 3QEQD 5C7XH 1FAKT 1B0RB 1UGNA 4A2MA 1OTSC 4C83A 3RNQA 4NCDA 3THMH 2NY2B 4NQEB 5JIIA 2P7TA 1H3PL 4WJ5A 5F7LB 4BQ8A 4PJDE 1DQML 3PWJA 3VG9B 1OAXL 4DFIA 3RX5A 5E95B 1R3HA 4MQ7B 1GL4B 3RPIB 4X5WA 4TOYL 5EOCJ 4K23H 3U36A 1H5BC 2FX8L 2GY7B 4IDJH 2FATH 5TDOA 3VWKC 5MENE 3MLPA 5IT2L 3BISA 4N9OB 2PYEA 5DK3A 1ROWA 3ARED 3OHXA 2RAMA 1SVZA 1Q0XH 4J3UA 3U79A 4JANB 3RUGE 5FYJE 3WNLA 4HSQA 2RR3A 3HFML 2GT9A 3QNYA 2NY2C 2Q86A 5F71A 1HSBA 2YD5A 3O2VL 3VRJA 5DMJB 3VXNB 3H3KA 2VO5A 3OKNA 4KHTL 2DQJH 5IB3B 5FYLD 1YYMH 3IDIA 4NGHL 3S3PA 4JFFB 4FQXB 4ZFFB 1L7IH 1X5YA 4WUKL 3MGAA 3QXDB 2FHBA 3QPXL 1NCUA 1GZPB 4GG6A 4N9GA 4Y7MA 1NMAL 2ZCLL 3QO0B 1UM6L 1WITA 4Z7QE 1H9VA 4BSJA 3O4OB 2JCCB 4N0RA 2HVKB 3E6HA 2DQGL 5ANMB 5I0DA 1QVOA 4YHOH 1JPSH 4HZAA 5IB2A 1A6ZB 3TF7C 5I9QB 2GSGA 2FD6H 1MLCA 1AGBB 1RJYB 2VLJE 4DK3A 1DN0A 3X17A 1IGCH 3GJEA 3I6KA 5I1JH 3T09A 4FQXC 1P7KB 3C60D 3QHFH 1MUJA 5AUMB 2JELH 2XWBB 5FF6A 1MCOL 4KKLD 5GIRA 4MHHG 2OK0H 3O4LE 4JPWL 3TP4A 3QFJE 4LARL 3U4BL 3QIBD 3Q0HA 5GRJL 4MNQE 1MQ8A 3DTXB 3EOYG 5GZND 4NCC2 3QUXD 5EBMA 1XGRA 4KMLB 3IAGC 5F7EH 3CH8A 3ARPA 1PBYA 3CVHH 3MRDA 4FZ8H 1I8MB 2CPCA 1LO2L 2I27N 3BKYL 3Q6GL 4FQQA 1T5WA 2OZ4H 3DI3B 4Y8DC 1YEHH 4HDIA 2X09A 1SY6A 4GKNB 3GRWL 5IBUB 5HYSG 5I8OL 3ARFD 5H37G 1HNGA 1TCRB 1KB5H 4HAGA 4ZFGL 2NY0D 3KYAA 5TPWL 3F58L 1A6VL 2HLAB 1GPOL 3JV0A 2G9HB 1YUHB 3DUUA 4DN4H 3GK8L 4TUJA 3BIKA 1MNUH 3F5WA 4PY7B 1AHWB 4JM2B 3GZKA 1FNEB 3LZFL 1IAOB 4PJDA 5I17A 1PY9A 2DQFA 4M3KB 2XY2A 2BY0A 5DJCA 1X4YA 1UFUA 2V2XA 1XZ0A 4EDWL 4OBSA 4I77H 2YD2A 3MRPA 3FZUC 3S98A 4QYOB 4HMDA 1S7RA 4M7KH 5ILTL 4F7PA 3O8XA 5BV7L 3SGJC 3TT1L 3O2WH 2CDFB 4JFXB 1KCVL 1X5KA 4OTXL 3QUMH 1M05B 3L7FB 2P43B 1L0QA 3KYOA 3LSOB 1OB1A 2QSCH 4ISVB 1F90H 2W0FA 5LXGL 2EDRA 1NLBL 1TZHB 3ARDD 1MVFA 5IESH 2VDLH 3SPVA 1ES0B 4N5EC 4X6FA 5JW3H 4N1HB 4NQCD 5KSUA 2CRYA 4M6OH 3UZQA 3QUXA 1FN4B 4LHUG 4ETQB 5IFAH 1HOCB 2BK8A 3AY4A 4NQDE 1J9CT 3GJFA 5AD0A 3GHEL 3QQ9C 4X4ME 2JCCF 4LSQH 3MLXL 3BX7C 4BYHA 4F37F 4ODVH 4HIXL 3EOAA 2XWTA 2A9NL 4I3GA 5E6ID 3UYPA 3MREA 1MFBH 2E9WA 2P5EE 4I18A 4NBXB 1T1ZA 4RGND 4JCMA 3D85B 5EU3A 3WKNA 3ARFA 2KL6A 4NM4L 2X1QA 1WZ1L 5E8DL 3INUL 1LEGA 2IH3A 5GS2D 2AJSL 4XVJH 4CVUA 1E4KC 5T3ZH 4RIRA 5D9SB 4WGVB 3T77B 5JPNB 5MEOB 1KC5L 4LRIC 3HUJE 2XZAL 5I2IB 3ARBB 4RFOH 2B2XL 4G43A 5J12B 5D1QC 1NL0H 2XRAH 3Q6FB 4UMGA 4YE4L 1KLUB 3WSQH 1LO0H 4NPYA 3LPGA 3O4LA 2IWGA 3TC9A 2PTVA 5HJ3B 4KZEL 3IS1X 3C9NA 2CK2A 4J23A 4LLUA 3T65A 1UACL 4XAWH 2C4FU 5F1SA 3VH8G 2BSTA 5J56B 1CFTA 2QADD 5TQ2H 3TO4B 4GBXB 3C2AH 2XTJD 4YO0B 1V7MH 4Z7OE 4ODHH 5HDOA 2AJYL 1ZAGA 2XA8L 4G7YH 3KPMA 4WWKD 1XCQA 1JPFB 4M1GH 3QULB 1N4XH 4AIZB 2CRZA 5DRNA 1WF5A 1DQTA 2EO9A 2EYTA 2V7NB 4MA1B 4RAHA 3BZ4B 3A6BL 3T4YA 3F12A 1UKSA 1JGVH 1BMGA 3DBXA 1LNUA 3TYFB 2QSQA 4Z18A 1JFQL 1FV1B 3P77B 3G6JB 5DK2B 5ITBL 5FHAH 1K4CA 3E2HB 4KK9D 4YHLL 5ACLA 2NXYD 4LSTH 4JM2F 3TO4C 1VADA 3WYRA 4GBXC 4E5XA 1IMHC 4DKFH 1FFQA 2FWOA 3QWOA 4RNRA 5LGJA 4U1LB 4Y5XC 4LLDA 3DUSB 1I85A 3WV0A 1FL5B 1NLDL 1K8IA 4S1RL 3HE6C 1T2QL 1S7XB 5DMGD 5E6IA 2NR6C 2MNUA 2WINB 5FB8B 5E03A 3MMEB 2AKRB 5IF0B 1N0XH 1I7RB 1BJMA 3SO3C 1IM3B 5JO5A 1FZKA 1GGYA 3TPKA 5JQ6H 3N1GC 2IFGA 4LGSB 1IGMH 2CLVA 1UKQA 1I1AB 1I8KB 3PIQA 3QDGB 4LU5H 1ZS8A 1RIVH 4JDTH 5DYOB 3JTTA 4PJGB 2HT3C 2D9QB 1NKRA 3JUZA 3IRZA 1P7HL 1YY8A 2QQLL 2UZXB 3QWRA 3SN6N 5GJSL 4HUUA 5DA0B 4CN6A 4QGYA 5IHBA 4JDVA 4HZLB 1B9ZA 5KS9B 5CD5D 5DZLA 1INDL 3ES6A 4PUBL 1OAQH 2ARWA 4EDXA 4YLQT 1S3KH 4X4MA 1I1FB 4WWKA 5F96L 4OKVA 4Q6IB 4X7DC 2BNUB 4Y89A 2DN7A 3MUGA 3PL6C 2ADGB 4KMTH 2EDLA 2JJSA 1E6JH 2P5EA 3ALPA 12E8L 3V6ZB 2NNAA 1F58H 5DEFA 3UJIH 1LQSR 4BELD 1VFAB 4OGYL 1HI6A 3I50H 2B1HL 1C08B 1SY6L 4M6ML 4WY7L 2VUOA 5AYUH 4ENEC 1A47A 2Q8BL 4KZDL 4OCSH 3KR3L 4JRYB 3B9VA 5LAXB 4NQEE 3HUJA 5IB5A 4P2YA 4ZUVB 5GS0L 4TUOB 4K8RH 5FUOL 4Q6IC 2YKLL 1CDBA 4U1NB 1FHGA 4G9DB 5HXMA 1IBGL 1BFTA 4LEOA 2VLMD 2X4SA 2GTZB 3VWJD 1V3MA 3U6RB 2A6JB 2X4QB 2OQJA 5ECJE 1RZIB 1F4WH 2KZWA 3UDWC 3ZKND 1EZVX 1QLEH 1WZKA 1NFKA 1OTSD 1NC4D 3S37H 4WHYH 3SGEH 5BVJA 1XAUA 2F19H 3ZO0A 2H1PH 3V9FA 2M1KA 2RHEA 2W60A 4G8GB 1O7VA 5B39B 1VFOA 2AXHA 5KVFH 3RI5K 3G6JF 4QHMA 4WFHE 1ED3B 5EU7C 2YZ1A 5AZ2H 4V1DB 3QUYB 1Z5LA 3WE6B 4XP9L 2A77L 4RAVB 3VWKD 5I1CH 1UVQB 5B38G 4JQVA 1HHIB 2NY1D 2W65B 2XXCB 5FDYA 5FYJL 4LF3A 1QD0A 4JFFE 1T66C 5F1OB 3C87A 1TPXB 3FN3A 2BDNL 3M17A 3QQ3A 1NKOA 4JY5H 4YGVB 1R3KA 1DL7L 5D72L 5CGYC 4KVNL 1HHGA 1QRNB 5A2IH 5IR1A 5GGSY 4X4XA 5GGSA 2DWEA 4EQ3A 1ZHKA 1LO5A 1IKNA 3CMOH 4M1DL 3UPAA 1YNKL 3U7YH 3RFZC 2EDTA 2JCCE 2D7OA 4M9OA 3MLUL 3BPCB 3PUCA 5ANME 1EUTA 1U3JA 2QR0A 4YDIH 3V6OC 3AMLA 5EBGA 5C6WH 1DBBL 3P11H 5F3BA 2F8XC 1N0LA 5EO1A 1RK1B 3RAJH 3OKDB 1OHQA 3GSQB 1TPXC 2VXUH 1BGXL 5A16A 1A2YB 35C8L 4JQIH 4O2CB 2HVJB 4FTVD 4KJPD 2WW8A 2BCKA 4U6HB 4ZS7H 1A14H 4PRPB 4HD9A 4P5KA 3L5WB 1DSFH 4S2SA 5KS9F 5DI8A 3BPNB 1VENA 4NKIH 3ARGB 1UQSA 1NFIA 2K7PA 1MAJA 2WQRA 1M71A 2ZUQB 3VWJA 5I71C 1GAFL 1N3NB 2Z31B 3CSYB 1CL7L 3HI6L 4XZUB 3WUWA 3LKNB 4M93B 4WW1B 5DJ0B 1RVFL 1DE4B 4X9GA 5CS7A 3L7EA 3HC4H 2CR3A 1G0XA 3W9EB 1AGEA 1M7DB 3VFMB 3DMMB 4PBVC 1DEEB 3QIUB 5I1KL 1BHGA 5TQ0H 2VZSA 4MA3B 3WN5B 3RKPA 4X7TB 1HDMA 2IFFL 3LKQA 3TBYA 2OL3A 4KPHH 1ZTXH 2P8MB 3S35L 2Z91B 1H5BA 2K7QA 4LOUC 3RL2B 3WO3B 4C56B 4DWHA 3ARGC 3VWKA 4J7RA 3RIAF 5L2KB 1KCUH 1N7MH 4XP4L 1NC2B 1FYTA 1AXTH 3GBML 3V2AR 1HINL 4YXKL 8CGTA 5IMOB 3CFCH 4PY8I 1GH7A 3V6FB 1J0KA 5M7QA 3DMMC 3MX0A 1ZT1B 4L3AA 3S3JA 3IDJA 4RQQB 3QIUC 1AQKL 3WN5C 4ELMB 1ZEAL 2Q6WB 4FRWA 4M8QA 3H2WA 3V0VB 3MV7B 1PG7X 4NOFA 3BKJH 5C6PB 2MSPA 2BSRA 3NA9L 4PJXB 1W0YT 2X10A 3B2UC 4Y88A 4JQXC 4WI3A 4EUPH 2ADIB 1HCFX 4FTVA 3RY5A 2YA0A 4ZUTA 1QTYT 1T1WB 4WI6A 2R0KH 4XPBL 1WJ3A 1RZJC 4YFDB 4XVTL 5EZLB 5D2NB 3O9WB 4NJAL 1RUML 5E5UB 3VMNA 5J6HB 1PEZA 4ONGL 4JFQB 3C6LD 4ACPA 2HWZL 4HXAL 5ICZB 1X7QB 1YDPA 4KUZH 3VXNA 1NGYB 3FZUD 3WCYA 3V79C 1T6WA 2MQ3A 3K4AA 5EOTB 3UZEA 4O5LH 5T3XE 4W4OC 3LKSB 4FQXA 4ZFFA 1H3GA 4MGXA 1YEEL 5ISZB 1GGUA 3CJJA 5CD3B 3FQUA 3QXDA 2X4OA 4MHHI 3O0RL 1IEBB 4KTYA 3OKEB 4LSSH 5FYKH 4AEFA 4CAGA 4QTHB 5HYSB 2EIDA 5E99H 2ZSVA 4PGZA 5E2VH 3GO1H 1CIUA 5T1KB 2Z8RA 2YUVA 1AGDB 4EI5D 3MJ9A 3TNMB 5I1IH 2O5YL 4N5ED 3GSNA 2HVKA 3PHQA 5E8NA 2D7TH 4WW2B 3RL1A 2B0SH 2XG5A 4FP8L 4Z95H 4PTUA 3KPTA 4L4JA 1E6OL 4PGJA 1AGBA 1FIGH 4QEGA 3U46B 4NKDB 5IVNA 1P7KA 1I7TA 3SDAC 1RZKH 5J1SC 3JV6A 3LV3B 5AUMA 5I1AA 2JB6B 3HPJB 2IADA 1MJUH 3BI9X 1OAUH 3SKNA 2YD8A 2A6IA 2R4RH 2O93L 1CLZL 1OL0A 4ZOBA 3TPUA 1TITA 5JUEH 5EORL 4YZFE 5HD8C 4HS8H 3UJJH 4OD1L 3WHE0 5DR5L 3U9UA 2UYLB 5HGGS 2ATPB 2X41A 2FJGB 5EZIH 5I76A 1NAKL 5D1QD 2FRGP 2R2HA 3R1GL 43CAB 4KXZH 5CGTA 1MIEL 3BPOC 2UVFA 3MXVH 3V8OA 5BMFL 1NJ9A 1PLGH 1EH9A 4JKMA 3G5VB 4GKNA 4Q7DA 2VJXA 4OD2B 1UA6L 1MCHA 1REIA 1BVLB 4LHUB 1KBGH 2HFEB 2DDQL 5LGHH 3G6JE 1JNNL 4Z7UB 5DUPH 2VLLB 3SGJA 1IQWH 3CFEB 1VFBB 1R24B 1R3LB 2HLAA 2G9HA 4OCXL 1LP9B 4ELMF 5IJVA 1DBKH 2IPTH 3UBXA 1IILE 4KDTC 3HI5L 4PRBB 4PS4H 3GNML 1NMBH 3IKCA 1FNEA 3W9DB 1U8KB 1SBBA 5INCA 2F54B 4FZEH 5HHNA 2DRUA 5FM5M 5C0JA 2BVPB 2ZUSA 4CVXA 2WLZA 2G5BB 2R69H 4JKKA 4R7NB 3TJEL 4QRTA 2CDFA 4JO3H 1LDPH 4LCWB 2QSVA 5SWZD 5IQ7L 2HJFB 2PO6C 4MA8L 3QDGE 3HE6D 4OGXL 3QA3A 5F7FA 2NR6D 4DKEL 4A6YH 3L7FA 3VH8B 2ICEB 3STLB 3S34H 1DDHB 4L8CB 5IW3A 4PGBA 4LEXH 4MD4A 1DFBL 1J1PH 2AJUL 2E6PA 4TQEH 2AP2A 5SWSD 1OP5K 4MB3A 3PGDA 1ES0A 1BVKA 4NO5B 1XGUB 1U58B 4F15B 3JV4B 1HN1A 1E4KA 5KS9E 5IW6B 4XH2B 1FN4A 4N8CL 4LRIA 4ETQA 3VGAC 1HOCA 4FFWD 5DO2C 5D1QA 4NDMA 1VCAA 4AEIL 5FOBB 4WW2F 2F5BL 3H9ZA 5D7JB 4RMTA 4JM4H 3IFLH 2HT3D 3ARRA 4RISH 1MRFL 5T1MB 1TVBB 1BF8A 2DMBA 3PXHA 2Z92B 4KI5E 1CBVL 3CU7A 5E5MB 3FOMB 4Q9CA 4F15C 3D5OF 4W6YB 2OL3L 4WV1B 5H37H 4CJ1A 3M07A 5D9SA 5MEOA 2ADFH 4F2MB 4YXLH 5I2IA 3PL6D 3BMVA 2ZCHL 1QLRA 4XNXL 5EU7E 4XCNB 4ZXBB 5I1LA 2VQ1A 2UY6A 5D7JC 2UZIL 2X70B 4QLRA 3U0PB 3V95A 1XR8A 3SEPA 5I6XB 2G60H 1FSKC 5HJ3A 4E42A 1SJHA 3B9EA 1RURL 4Y4KD 2H9GB 2IANA 4G9FE 1P4LB 2MOVA 3ARQA 3TO4A 2I07A 3QSKB 4GBXA 1TZIB 4ENED 1Q9LB 1QR1B 5I1GH 3R4DA 2NMSA 4YO0A 3N1PC 3GBNL 5FYLH 4Y5XA 5L9DL 5D96B 1TZGH 2V2TB 4H0IA 4NN6C 4G8GE 5SWZA 1LMKA 3HE6A 4JE4B 1JPFA 5I15L 3QULA 2P45B 3MV9D 3P40A 4GW5A 2V7NA 2VC2L 4Z7UF 4Z7VA 3C5JB 1A7QL 1UEYA 4V1DE 4QXTB 5JW3L 3D0VA 5K33A 3V6OE 5SWSA 5CCKH 1LP9F 3HPLB 4HIEB 1BQSA 1ZVHA 1L9NA 5KANG 3P77A 2Y36H 3HNTH 4KWUA 5IV2B 5DK2A 4D8PB 5DVKA 4FXKA 4TSAL 1FFOB 4N0YL 1IM9D 3QDHA 5C70A 4CVWA 5IGXH 2AK1L 4CW1B 3BT2L 1BQUA 2OI9C 1F13A 1QRNE 2GTWB 5D96C 2HFGH 1MJJA 4N5UA 4EXKA 3QDMB 2NTFA 3FOLB 4KC3B 4CN4A 5HPMB 4MQSB 3ZT7A 5FB8A 5C09E 4HF5H 2J8UB 2AKRA 3O6KL 3RWDB 5IF0A 3RVWC 4JVPA 1I7RA 1YMMB 1IM3A 4OZIA 3MLRL 1T66D 3O3AA 4HXBL 1QYGH 1UH3A 5IMMB 4YUEH 3IKKA 3OWEA 3HZKB 5DJ2B 3MRHB 4ZUUB 4P46B 2V5YA 3VFSB 4J6RH 4LQFL 2B8OT 3L9RA 4MD0B 5CGYD 4LNRA 5KBNC 5KVDH 1JMZA 4HV8B 1D3CA 1CFQB 1I8KA 3QDGA 3PL6A 4PRPE 1L0XA 3VXSB 1YEIH 1JF1B 3X13A 4LLAA 4PJGA 4UQ3B 4I0CC 5ITFB 5KJRH 1XH3B 2YPLB 1AO7D 3NCEB 3C2AL 1N5YH 2MFNA 2VXVH 2VZOA 3IDGB 4LGRB 1RUAH 4IJ3B 5TH2B 4HZLA 4JRXE 1EEQA 1JGUH 1NBZB 5E9DB 1U41A 4PJIF 4MAYC 2BY3A 5C0AB 1H8NA 3QXTA 4NQSA 1E27B 4PJ8B 3QUKB 5HGHA 4OZHB 1F4HA 2D7MA 4Q6IA 1U8IA 2BNUA 3MV9A 4IRZL 5B38B 3LEVH 1GC1C 4MAUL 3H7BA 7CGTA 1JZ2A 2AV7B 4HUXA 1G1CA 2MMXA 3I9GL 4JG0L 1U91B 3I3BA 3MJ8B 3BP7A 4FA8A 2LFGA 1FNFA 4C56E 1A0QH 4DFHA 1JV5A 4O58L 4NZUL 3UDWA 2OLDA 1DLHA 1QRKA 5L2KE 1QKZH 5K9JL 1NDMB 1C08A 3UMTA 1IM9A 4XC1L 1I1YB 5JMOC 2BRQA 4N0CC 3QUZC 3UTSB 4UOW0 3TIDA 5IIEA 3RKDD 3BHBA 3JXAA 4JRYA 3FQRB 2B1AH 3FO9B 1KJVB 4XPGL 2F74B 1ZMYA 1J0YA 4XCFH 3VA2C 4ELME 2MHAA 4ODXB 4LOUD 4U1NA 4NZRH 4ZO6A 4Q9RL 1CE6B 3GSUB 3CFKA 4G8FB 3MV7E 2A6JA 4NHUB 1AFVL 4I3SL 4JFDE 4UILL 1MELA 4W4NA 3WFEL 2ERJB 3MODH 1BM3L 1C16A 4PJXE 2FL5B 1ZANL 4I48B 2XV6B 4JDTL 3FJTA 1RPQA 3AB0B 5B39A 4YHKH 4DVBB 5JA9A 1G0YR 4LSVH 5GRWA 3K8KA 3BVNA 4WI8A 3QEQE 5D2NE 2NY5H 4V1DA 3ZYJA 1BJ1H 4JLRA 3FMGL 5FGBA 5I1HH 4Q0XH 4ZFZA 1Z0MA 3V6OA 4NZJA 5IW1A 1AO7A 3MLWL 3U0TB 2W65A 5DZOA 3OTTA 5HDBE 1UZ6F 4R8WL 3CK0H 4X9BA 1CICB 4FQ1H 3V4PH 1Q9WB 4YNYB 3B2UD 5ISZE 5DURB 3VCLB 3GGWA 5E08L 4EBQL 3F7VA 4HKBB 4ODTL 1ZLWK 1F4AA 3QCTH 4RMSA 4QGTA 4OCYL 5T3XL 5C0RH 1DTUA 1AY1L 2VQTA 1WUNT 3X12B 1DVFB 1PJ9A 3K2UH 4EKXA 3V0AC 2AJ3B 5F89A 1ACYL 4JFYA 3SE8L 4LLWB 1H3WM 4OF5A 4AT6B 1UWXK 5JPMB 4RCAA 3H42L 4L8DB 3KPNA 1U8HB 2FDBP 4XPHH 3N1FC 4ODBD 3OQ3B 4FQJH 4O2CA 2HVJA 3U2SA 2Y25A 3ALWA 3VXRD 1TFHA 3QXWA 4OLZL 4PRPA 1J0IA 3BRFA 2VDOH 2DLHA 2BOCB 5H35B 3ARGA 4XVSL 4F7MA 4IOFC 1N3NA 4ERSH 4PG9B 4PRHD 3MGOA 3LKNA 3K4DA 2BNRD 2X1OA 4OZHF 5DJ0A 1DE4A 4CUCA 2IH1A 1J88A 2VRAA 3MLZH 4PR5B 1EEZB 2BVQB 3SDAD 3S36H 4Y2OA 5J9PA 4YHPB 2E7HA 1IGJB 3DMMA 4YBLB 1NGQL 2YA2A 1DEEA 4QTIH 4C4KT 3QIUA 2VDKH 1T03L 3H3PH 1KJ3L 3WN5A 1MLBB 4XXDA 4X7TA 4I0PB 5DLMH 4X6DB 1WLHA 2H32B 2P8MA 1MJ8L 5FYJU 2Z91A 2QTEA 4P9HL 3RL2A 5HHQB 4Z7UE 1UCBL 5L2KA 1FRGL 2EICA 4XWGL 4DAGL 1NC2A 1FZMA 4JQXA 4UTAL 5IMOA 1LP9E 1L7TH 2OJEB 2I25N 4P5MB 4U6VL 3V6FA 4RFEA 4PIRF 4U1KA 5ERWB 2NW3B 3ELAT 3MBEB 3LQZA 2F54E 1YPZB 1R3IL 3JWOL 2O61A 2CD0A 1MPAL 1DP0A 1J7VR 4M61A 3VD7A 3EO1A 3NPSC 4JHWL 3JV5A 3CVIH 4U1JA 5FO9B 4P49A 2C4FT 4TVSa 4W4OA 3ZE2F 5FFLA 1KFAL 1HHJB 3DRTB 1KN2H 1SBSH 1D5XB 1YY9D 1IGIH 5DEGB 1JHKH 4LCWE 4GKZB 5J0BA 4XNQB 3MLYL 4CGTA 4YAQA 1X5XA 3DSFL 1S9WB 4XPAH 3FB6B 2XICA 3ALXA 1T1WA 2P4AB 1FP5A 5D1ZC 5EZLA 4YPGB 1VFUA 2BJML 4ZAKD 5J6HA 4JFQA 2Y7QA 3UO1H 2HJLB 3HG1B 4M43H 3WS3B 2E27H 3NCCB 4YDVB 2IALA 2OR8A 2XQYG 5IMLB 3PWPD 5DD0L 4HUKB 4ALAH 2DF3A 3SDAA 3T2QA 3NCYP 1T2XA 1QACA 2PO6D 2ZSWA 3BSZL 5CD3A 2DLEA 4XBEH 1LO4L 2BSED 3OKEA 4QTHA 4XMPH 4ZQKB 1F6AB 5DUBA 1IAMA 3MGTB 4FQCH 4N8VB 1K85A 2XZQH 3BEWA 1AGDA 4PJIE 5E2TH 4OD3L 5DJYA 1QFOA 3TNMA 3V4UL 2LABA 2ZUYA 3C09B 5HYJD 1AKJB 1WK0A 2AEQH 5D93C 3MRCB 1ZLVK 3P4OA 1IGFL 3K46A 1DQDH 4KDVA 5DO2D 4KI1A 3WMSA 4M5ZH 2EXWD 1OY3B 3CUPA 1Y18B 3ZKQD 3FQXB 3RY6C 4MJ6B 3W39B 3QG6B 2X5PA 1AP2B 5E2UL 4WFEE 3VI3E 4N0UB 3EYUL 4UT6L 4LCUB 4GSDL 3HPJA 4U1IA 5EWIH 1X5HA 3VD4A 5MP6H 2B4CL 2AJZB 3NFPA 1JNHA 2PTTA 1EXUA 1NCWH 3CXHJ 2P5WD 1AGFA 1U8JB 4BZ1L 4O51A 4RAUB 3PGFH 3EFFB 1P6FA 2UYLA 4ZSOA 1HEZB 4CJ0A 4X6DF 4KDTA 43CAA 3L3GB 1JZ3A 2KZ1B 1CXEA 3HR5A 5J11B 4O02H 9CGTA 2AEPL 2QQNL 3AS3A 1UWEL 3PHOA 3SO5A 1NBQA 3NOIA 5HGDA 4LBEB 4XAKD 2E9IA 5CBEB 2E9BA 3FQWB 5F8RC 2VLLA 5C3LD 2BX5A 4U3CA 1VFBA 1R24A 4UB0H 1RK0B 4L4VD 3UC0H 1Z9LA 3EOTL 3STZB 1YPZF 5A43C 5F6HI 3OKOA 4IEFB 4UNTA 4R96B 1UZ6E 5I75B 2DKSA 1GIGL 3PF2A 5DJZB 2BHZA 4F7TA 3QDME 2R1XB 1JYVA 4JZNB 2CK0H 2Z4QA 1RHHA 3W9DA 5EO9A 4Z95L 2J8UE 1U8KA 5D70H 5KVMC 2F54A 5ID1B 4JFHD 2BVPA 1YMME 3SE4C 2DM2A 3UPCA 2V5SA 3GI9H 1I8LA 3PWLB 2G5BA 2C1PA 4R7NA 1A6TA 1BZ9B 1MJUL 4H8WL 5ADPH 1EO8H 3QFDA 1IFHL 2MJWA 2HJFA 4LLYA 4WUUB 5GRXG 4OLVL 2Z35A 5FKAA 4LAJH 2I60H 3VXSE 2W0PA 2EEAA 3G9VA 3FQNB 5ICXB 3B4NA 1KXTB 2ICEA 25C8L 1WEJL 2D2OA 5JTWA 4L8CA 2DJ4A 1CLYH 4PJCB 3PWNB 4ZDHA 3RVWD 4G6JH 3BGAA 4G8EA 2VN4A 2KH2B 2YPLE 3BZFB 2IEPA 3PP3H 4U1HA 4HW6A 1HH6B 2P5WA 3W0WB 4L5FL 5INDA 1XGUA 3BUYB 3MJ9H 3MRJA 1P4BL 3QZWA 5EBWB 3BW9B 4BFGA 3GSNH 5E9DE 2ITDB 1A3LH 3ULSB 1EGJL 5MEPB 4M7JL 5L7XL 4OZHE 4X6BA 3DX6A 5D7JA 5I1EH 2EDHA 4KRNA 4G3YH 4PB0H 2V17H 2VXQL 4MWFB 2KKQA 3DVGB 3VFVA 3KS0H 5T1MA 3ROOB 4ZNEE 3KWWB 3F62A 1E4XI 5KSAD 3K0WA 1S7UB 4L4TB 4MAYD 4F7CB 2GW5A 1C5DB 1IC1A 2AXGB 3UTSE 4RRPA 4POZC 3KXFB 3N9GL 3G5ZB 3G6AB 5IG7A 3CMGA 5JXAL 2GJZB 4RGOL 1HZHL 1X5AA 4XCNA 4ZXBA 4OF8A 2X70A 3GKWL 5KANI 3U0PA 4HKXA 3TN0C 5DWUL 5F1IB 4ZTPL 4TRPL 3VG0H 2H9GA 3K8LA 4POYA 1WSST 4UV7H 4N0CD 3QUZD 1BEYH 1TQBB 1TZIA 4OM1L 1Q9LA 1LK3H 4Q9QL 1PW3A 4FFVC 4LPYA 4OLYL 5I74C 4KTDL 4OFDA 2V2TA 2X1XR 3AMKA 3ZE2E 2MPAL 3MRQA 4M00A 4POUB 3ESVF 4F7EA 4Y8AA 2Y6SD 3O6MH 5FDWB 4WWID 5ENWB 3TIEB 1N64H 5CP3H 1J8HD 3RHWF 4HIIB 1FZOB 3HPLA 4HIEA 2E7MA 1LDSA 5JDSA 3VDAA 1OLZA 2D7PA 3LD8B 4ZFOA 5IV2A 3MBXL 5CSZB 5HGAA 3RJDA 1HHHB 2UZYB 3TNNB 4Y4FB 4Z76B 2CDGA 3HMWL 2CGRL 3SKUD 4X0KB 3CDYA 3L1OH 4LVHB 2OTUB 4NC1C 2GTWA 5E8EA 2IBBA 1MQKH 1IZKA 4YWGL 4GMTH 5K9KB 3WUZA 1YYLH 2VERN 1G6VK 3QDMA 3W11C 4RMVA 2J8UA 3FT2A 5BS0D 1YMMA 1CR9L 2GFBB 3F7PC 2H3NB 4DUVA 3BDYH 5CZVH 5IMMA 5C6TL 3HZKA 3RY4A 5DJ2A 3LD8C 1U3HB 4MAYA 5F7UA 5IEKA 3VDBA 2MKLC 3ZLQC 1C7TA 3DX8B 4BK5A 5IFJA 3QPQD 1G9NL 5GSVB 4LVHC 3VXSA 1CXLA 4Q74A 4PRNB 3MOAH 1FC2D 1FFPA 2I26N 3MCLL 5H2BA 1XH3A 2YPLA 5EH1A 2JIXB 3KLAB 3QXAB 4KUCF 3IDGA 1BZ7B 2V6HA 4Y19D 1FNSH 5BO1H 5DJAB 4PJ7A 3QUZA 4Z78B 2RCSH 2R2BB 2X4NB 5E9DA 4P99A 1DEDA 3CFDB 1I3RB 5C0BB 1D6EA 1KTDA 5C0AA 1SEQH 3QUKA 5C0CB 1JGDA 4PJ5D 2AV7A 5TE4L 4X6DE 4OJFH 4Y5YB 4OB5H 4XVUC 4MMZC 3RDTC 4ZNEA 5HSFA 2VSCA 5GS1C 1OSZB 2YK1H 3HMXL 3IDMA 5DQJB 4F33A 3QJFB 3ZYOA 1NDMA 2XZCL 3HN3A 2V5RA 5E2WH 1RIUL 3U4EA 1HCVA 4D3CL 4L3ED 4YPJA 1G7JB 3FO9A 4XCEB 4XI5C 3WLBB 2F74A 3L5JA 4M8VA 5EN2B 2NZIA 1JGEB 5HGBA 4GAYA 3RA7L 3S5LG 1YPZE 1MREL 2YEZB 4NOBA 5JW5B 3CC5A 4HWEL 3GSUA 4Y5YC 5BS0A 3BIBX 4NHUA 3I84A 4WIQA 2XNAA 4K7FB 1UWGL 4PP2B 2FL5A 4LIQL 4EIZC 4I48A 4QHLA 4OIIH 2VXTL 2D03L 4G6ML 1I9RH 1U2HA 4DVBA 4MJ5A 4LKXA 5GGQH 5F93C 2APFA 4XGZB 4YBQC 4JAMB 3MRNB 5CEYB 1J05B 3BWAA 4HLZG 4AG4H 1EA9C 3R8BB 1EK3A 3HG1E 4KTEL 1MOEA 3F6LA 1YMHB 3E8UL 3TBWB 3KAAA 2NW2B 1ONQA 1YEFL 1A6WH 4DN3L 4YNYA 4HCRH 4PB9H 1GZQB 5K9QI 4HWZA 2G2RA 3D3VB 3LEVL 1I9JL 1PDKA 1W72A 5FUZH 3TH4T 3ZDZF 1VESA 5D1ZD 4PJ5A 2V5TA 5EC2A 5C2BL 3MJGX 5ETUB 3X12A 1DVFA 2FO4B 5CKGA 3IFOB 1S5IL 4KQ4L 3L95A 1QSFD 4MS8D 4M02A 3BDXA 2AJ3A 5FECB 2Z93A 4M4RA 1CDIA 4AMKL 5DMYA 2BOBA 2N7BA 2VN7A 1SEBB 3GMOA 5JPMA 5GJTL 2NX5D 2F53D 1CG9B 1U8HA 1T0MB 3WEXB 4N0UE 5JZ7C 4L3EA 2YWZA 4HIJA 4MLSA 5CINL 1C12B 1K4DB 2VKWA 3EO9L 4F58H 1KELL 5DT1L 4G5ZH 2VDMH 1QSVA 5CEZE 1G9ML 5H35A 5KTEL 2R56H 4XC3L 1MCKA 3P9WB 4Y2DB 5I19H 5GRUL 5ESVA 4LRNL 2PW2B 3A6CL 3FRUB 2BVQA 4AENB 4K94L 1HXMB 2AJVL 4WU5B 4PGCB 4YHPA 1IGJA 5T33L 2BZDA 4UIKL 5BOZG 1ZV5A 3AS1A 5IM7A 3LEYH 4GXVH 1MHCB 1MLBA 4Z7NF 5L88H 1U8OA 2H32A 1N6UA 3QO1B 4GAFB 1UM5L 1KENL 4EZMA 4PTTB 4MJID 5HHQA 1NEZA 5HHPB 4UNVA 3OAUL 3ZHKA 4Y2DC 4ELKA 4MMXC 4U6YB 2ITCB 3ISWA 1JNLH 1K2DB 3QAZC 4FQ2H 1JZ8A 4NFCA 4OLWL 1ZHNB 4UDUB 5ADOL 3TWCL 1GSMA 4NBYB 2OJEA 4EXPX 3MR9B 4H26B 1B2WL 2VABB 4CU7A 2JJVA 4DZ8B 4QKXB 4APQD 3VD5A 3ESUF 3SOBH 5T1DH 5ERWA 1PG7H 3TA3B 5D1ZA 3MCG1 1Q94B 2QHLA 5DC0A 1D5IH 1XF4A 1QSFA 5FO9A 1T3FA 1JJUA 4HJJH 1NSNH 5ESAB 3DRTA 1CVRA 3H9HA 3FN0H 4PGDB 1NGPH 1UB5A 1MFAH 2NX5A 3SDDD 2C3VB 3IXTB 4XNQA 3DV6B 4WUUE 3MCKA 3O6FC 4R26H 5I1DB 4WEMB 3FB6A 1KCSL 3BEVB 4R4BA 1YEKL 4FQHB 4PJCE 1ZVSB 4NKMB 43C9A 1J1OH 3PNWA 2CUHA 4CMMA 4KROB 5DJDB 4QRRB 3HG1A 3W0WE 3VI4F 4HQQH 1FNLA 2FH8A 2DQTL 4BUGA 3P0YH 1KT2A 5IMLA 4LVEA 3BXNB 3LIZL 4OFIA 2BY1A 3RY6A 1EBPA 3PHSA 4M6NH 3NFSH 5IB1A 3S88L 4L1DA 4WCYH 2AXFB 5KW9L 1F6AA 4PLJC 1JHTB 5J8OA 4PV9A 1KTKE 4N8VA 3RVUC 3WDHA 3ME0A 4KKCD 3TLRA 3C08L 1GOFA 1I4FB 3GSXB 1BJ1J 4JO4H 3AM8C 1AKJA 4PJEA 2W9DL 4KROC 4OCLC 4FQLH 1UH4A 3MRCA 1AH1A 1JZ5A 2CKBA 2E6QA 2XN9D 3PWUB 4L4TE 3VFWB 2LTQB 3JWNC 2P47B 1FL6A 5SX5K 4JKLA 1NCBH 5BVPL 4AEHH 3U48A 4OLXL 1UYWL 3KXFE 1Y18A 4S1SL 3FQXA 1ZT4A 4MA7H 4O9HL 3W39A 2NY6B 3QG6A 5L6YL 3TH2T 3WIIL 1B0GA 1HWGB 1LGVA 5I30H 2Z8WC 3D39D 4CMHB 4ZG1A 1MFCL 2XTLA 2AJZA 4NYLA 4EJ1C 3SE9L 4NRXB 3U0WL 1DBAH 3SCMB 1U8JA 1IAIH 1MAML 3L3JB 3RBGA 4M6AA 1P4IH 3QQ4B 4FMKA 4UOJA 2HKHL 4BH7A 2NZ9C 1KPVA 3H0TB 3TV3L 2MCG1 4LKCB 3MRBB 3L3GA 5DJ8A 2EH7L 4PRAB 3ZYIA 1AJ7H 1IC7L 4TSBH 4PD4K 3TN0D 1GGBH 2VZ1A 1KJ2A 3SE4A 1RZJH 4Y0GA 1QLFB 4ZD3H 3WLWC 4OZ4B 1F11A 2BMKB 1BFSA 1P84K 2WNGA 4U49A 1FAIL 5ALCL 2ZUTA 4LBEA 2RJMA 4FFVD 2LAAA 4HWBH 1FNHA 4YEFA 3OJVC 1H15B 1RK0A 3LQMA 4OV5A 3STZA 1D9KB 3IJSB 1F97A 5E2TL 3GSVA 3LB6C 3AGVA 2EEBA 4HT1L 5DJZA 2BNQB 3ZTNL 1A1MB 3QQNA 4JZNA 4Y4HB 1NBVH 4JFZL 1CGSH 3BGFC 1KTRL 4UU9A 5DFVC 3LHPL 1X4ZA 5ID1A 1RHFA 3MNWB 3S4SG 1W72L 3ZZ1A 2XN9A 3W2DL 2Z9TA 4KY1H 2Q8AH 1J11A 1NGXB 2ICWI 1MCIA 2KUTA 2UUDK 4DGYL 1JYWA 3H9SD 4HMCA 3DHJA 4WHDA 4RZCB 2V9QA 3IDXL 5DMIL 3MOBL 1BZ9A 1E4WH 3WIHL 1IC5H 1QR4A 3EFDH 4OFKA 1G7MA 1D6VH 1ZXQA 3RU8H 3MLSH 1EJOL 4PP1D 2LQRA 5ICXA 3W11D 3P4NA 5HHMD 3TZVC 3MRKB 2X4PB 3D39A 4PJCA 5CWSB 2CKNA 4JHZA 3D9AL 3M8OL 3BZFA 1EBAA 1MI5D 3FT4A 5D6DC 3R0NA 1HH6A 1OAYH 4MXWH 3BUYA 4NZTL 5E00B 3VD3A 2EH8L 5TFSL 1CK0L 1GGIL 2QHRL 3CXDH 5C0BE 1BBJA 1G7PA 2ITDA 4XNUL 4OZFA 3D69B 3ULSA 2G75B 3X3GL 2E8YA 1RAMA 5C0CE 1RU9H 4HWNA 1F4XL 3TBSA 3TT3H 5DRWB 2ESVD 3JWDC 4LVOC 3ROLA 4JN1H 3DVGA 4UV4H 3DLQR 2VLKB 4H25B 2AJXL 1MCDA 5D7SL 4LCCB 3SDCC 4E0RA 4L4TA 1YECH 4OCRL 2I24N 3DETC 4KMQA 1P7QB 3FB7B 5E1AB 5FIEA 1C5DA 4HG4K 3EHBC 3VW3H 3SGDH 1JL8A 1B3JA 1Q1JL 2R0LL 3G5ZA 1JRHI 4XMKH 4RBPK 1HH9B 3DX9B 3GB7B 2BVOB 5EU6D 1MH5B 1FO0B 4NN7C 3FONB 4MZ2A 3R06B 3DGCR 3RDTD 2WP3T 4DVRL 1PSKH 4NM8L 5GRZA 1FZJB 3O2DH 3KPQA 4G6KH 2C7UB 2H2SC 3KHQA 1WTLA 1X3DA 5D4QA 4XTRD 3G08B 5F3HA 3UPRB 4RFNC 2OTWB 2WUBH 4U6XB 1I1CA 3H9SA 5A40E 4KHXL 5KVGL 4XI5D 4GUPB 4OF3A 2VNCA 3ZHLA 3QNXA 3PJSB 2AK4D 5D7KD 3IDUA 1XGQB 2Y07H 4K07A 3RI5F 3BD4A 2R9HC 5I8KH 2PXYC 3GBLA 4M7LL 3ULUF 1QFPA 4PJHB 3SY0B 3QNZB 4X80L 4U1SB 3O3EB 1D5MA 1QO3B 3KJ6L 5HHOD 4HBCH 4Z76A 1JPGB 3C8KA 2XIDA 3D3VE 2OYPA 3LDBC 4LCYB 3L6FB 1A7RL 1R6VA 2OTUA 1QSEB 3MRGB 3EYVB 4M5YL 5K9KA 1G7QB 1NDGB 1FNGB 5AWNH 4OCNC 3DWTA 4ZNCD 5FCUL 3P30H 5HHXH 2NY7L 1U95B 5J6GB 3KYMB 5E94B 2GFBA 3ULUH 2H3NA 2LU4A 4GT7A 2C5DC 4OIAA 4U33A 2ZUVA 1VGEH 5E24E 2FGWL 5CEXA 4P2RD 1DQLL 3DX8A 1UXWB 5ACZA 3S5LB 1LD9B 4X8JA 3GUTA 2A0LC 5D5MF 1DLFL 1DQJA 5EU6A 1AGCB 1U3ZA 5FK9B 4K71B 5C8JB 4GAGL 1O0VA 3EGSA 2VWEC 3RDTA 1AC6A 5IROC 5GS1A 4DCQB 4K3DL 4RX4D 2FR4A 5DJAA 3QRGL 1EDQA 3HCVB 3SDYH 1RJLB 5JZ7D 2R2BA 3S37X 4Y16C 3T1WA 4Y1AB 4XBPB 1CFNB 3EO0B 4O2FB 5CEZL 2AK4A 5C0CA 4LAQL 1A7PL 3WNPA 4P23D 2WUCL 2YSSA 2A73B 2JB5H 4BQ9A 1JPTH 5GZOC 4O4YH 5SX4H 4Y5YA 1S9XA 4YHZL 4JZOA 2DWDB 3LS4L 5EZJA 3GJFK 1W8NA 3O3DA 3MNZB 4YQXL 3KPSB 5DQJA 5HHOA 1G7HA 3QJFA 1XGPB 1HIMH 1KJ2L 1ZK9A 1G6RB 2YUWA 3PDOA 3NACL 3MPCA 3VE0B 3CLEL 1TDQA 3GSRA 4DZBB 4JG1H 3FFCB 5BJTA 4KJYB 1G7JA 3I3EA 1QZ1A 1V3KA 3OR6B 4X4ZA 4XCEA 5E5RB 1CF8H 1JK8A 3L5XL 5C0FA 2HT4D 2ARJA 2CLRB 3U30C 5EN2A 3LS5H 4RA0C 3I3DA 1N6QH 3BJLA 5D71L 2YEZA 5JW5A 3KS0J 4JN2B 2V7HA 1CZ8L 3LQAL 4LSUL 1KB9J 4WNQA 1FJ1B 4YDKL 5JOPD 4OCMC 1T7XA 4JJ5A 3QYCA 2PR4H 4HPOL 3JSSA 1MHEA 2J5LB 3WFCL 3AU1A 2JKXA 1FO0H 4P2RA 1K8DA 5IFHL 1MFDH 4PJHF 3MACH 4DQOL 3QG7L 4X99A 5DD5L 1V3JA 1MCPL 4NJ9H 3EYOA 3GMRA 1C5BH 3CX5J 2ZP0T 1X44A 2WWKT 5BQ7B 4QRRE 1YZZA 3D2UD 2EIEA 5E8OA 2FO1A 3TBWA 1JWSA 4RX4A 3U9PL 4XNMB 3VMOA 4K7PY 4W6XB 3L3HB 3KHOA 4K2UL 3RNKB 1G7LA 5AAWA 1D5BB 2VAAA 5CUSH 3O6FD 4AIOA 3IGAA 4XWOC 3OX8B 4Q6YA 2WK2A 2OMBA 5LWYH 3KNBB 4CDGC 4JFEB 1S9KC 1E4XL 4U1GB 2PKDA 2R2CA 1NFDB 2FO4A 4UT9H 5JLZB 3IFOA 3NCJL 1H0DB 2D31B 4ODUA 4J3WA 4DUXA 1O7SA 2X2YA 1CE1L 2FIRT 1KEMH 2A6DB 4A2LA 5FHBL 4WFFD 3WBDA 1GCFA 1JHLH 1SEBA 1QEWB 3MO1A 3UTPE 4GO6B 4PJBA 4U2YA 1L0YA 1CG9A 4PLJD 4XCCH 2DTMH 2EDKA 1T5XA 3RVUD 5J06A 5I18H 5DD3L 5DHVB 1MHHB 2C9AA 2FJHB 3MC0A 4U1GC 3ZT6A 2WANA 3HC3H 4MYWB 4Y2DA 5EDXA 2DKMA 3QT2A 4OLUH 1LEIB 4X7SL 2PETA 1LVEA 1RMFH 4HGWA 5IBTH 1HKLH 3MYJA 5I8EB 3S96B 4M3JA 2ED7A 2EE6A 1AXSB 3WHXB 4WU5A 4TPRH 1JWUA 5B3JF 5GGTH 1UZ8B 1Q9KA 1QHPA 4LPXA 1Q0YL 4XRCB 2YOCA 1U8LB 1M7IA 5EB9A 4LHQB 2UWEB 1INEH 4JY6A 4QY8B 1KLGA 3D2UA 4FABL 4HS3B 5F44A 1HKFA 5HHPA 3V0WH 1S7VB 3PV6B 4NNPH 2ZOLA 3C6SB 4U6YA 2ITCA 2GITB 2NZ9D 4HLZH 3ULUE 1UENA 1W0VB 4UDUA 1EHLH 3O6FA 3QJHB 3RGVB 2GK0B 2VXSH 4KRLB 1J0HA 2A6KA 4DZ8A 5JOFA 1HSAA 5DUML 2BP3A 2ARJQ 3FRPA 4X9IA 3VXOB 3U7WL 1A4KB 4NHCH 1Y0LB 3VXTB 4Z8FL 4LLMA 3WFDL 1RZGA 1T7YA 1G6RH 1IC4H 5DJXA 1T6VN 2ADJB 2GJ6D 4PJFF 4XCYB 3KGRA 3VXUB 1UM4L 1JUFA 2V9TA 5ESAA 3GIZL 1Q72L 1G7IB 5IKCB 4XP6H 1Z3GH 4Q97A 3BP4A 5I1DA 2DLFH 3V5HB 3OSKA 3GI8L 4D9LH 3MV8B 4KRPB 5DFVD 4NKMA 4I5BB 3AM8A 2QBWA 2NY4C 4L4VE 5LG1A 4OZGA 3BOVA 5IP4A 3REWA 1A3QA 4H1LG 4GMSL 4JHAL 4FNLL 3PQYD 4FXGB 1T4KB 4JFHE 1OT2A 4D9RE 1KJMB 3QCVH 4R0LB 3TZVD 5I16A 3ILPA 1KN4L 3G6DH 5BRZD 1AE6H 4GW1A 4OM0H 2VLKE 4UIMA 5FGCE 3TYGL 1I4FA 4S1QH 1CT8B 4HJGA 1VDGA 1LE5B 1Z2KA 3VGEA 3OXRA 3PWUA 4RDQG 1OP5H 4L9LC 3B9KB 3BO8B 1Z6JT 4FS0A 1FGNL 3CU1A 4GKSB 2RFXA 1INQB 2FX9H 4R3SB 2B5IB 5JW4N 4B53A 4X9FA 5DK0B 3S4SB 2I5YH 1J10A 4GLRI 4MVBC 4R0LC 3AAZB 5TE7H 3RWFB 4JO2H 3T2NL 4HH9B 5MENB 3V6BR 2X4UB 3SDCD 5GS0C 3BKCL 3BQUB 3DETD 2GCYB 3SCMA 1QBAA 3EHBD 3L3JA 4KRMB 2IGFH 3QQ4A 5J4MA 1NAMA 4WDIB 2UWEF 5DHVH 1SVCP 1PYWA 4OFVA 4LKCA 3BP5B 3SJVD 2NY3B 1RULL 2B5IC 4PRAA 2XFXB 4YXHL 1I7ZB 1WGOA 2E5EA 2VLRD 1YNLL 1OT1A 1B6DA 2VISB 4PJHE 4G6FB 3QEUB 4S0SD 2FNBA 3B5TA 1QLFA 1KLFA 3P0YL 5JNYA 3RQ3A 3BQUC 2QJDA 3O8XC 3PE9A 2DQCH 3QIWB 4UTBH 2ICWA 5FA3B 3HC0B 1MCSA 4HPYL 3I75B 1EV2E 5GISH 1BQLL 3VXMD 1D9KA 3IJSA 1QSEE 1RJZB 2R9HD 3TZVA 2VZ3A 2VWEE 1SYSB 2PXYD 2BNQA 2NY3C 4K7PL 5IBLC 4ZYKA 5KG9B 5BRZA 3SKMB 1A1MA 4K9EL 2EDXA 1CGXA 4FQIH 1BAFH 5D6DA 1NCCL 1MEXH 2EYSB 3BKML 3MNWA 1BFOB 2FB4L 4CVZB 5DQ9B 4HUWA 1BP3B 4PJAA 4IRSB 2ZPKH 1NGXA 5IQ9B 2WWMD 1SM3L 2FCBA 3KPRD 3V4VH 1J8HE 4JJHA 1TJHL 1JTPA 3DXAB 5C08D 1QBBA 4IOIB 4PV8B 5MI0C 1XT5A 1WWBX 3IU4L 1CDYA 3ORJA 4N1EA 4I9WD 1AQDB 3IAPA 3WXWH 3MRKA 2X4PA 5CWSA 1V05A 1JGLL 3ILQC 4URTB 3VFPA 1II4E 4IS6B 5JIPA 3SDCA 4I4WA 2ZJSH 4IMLB 2OX5A 5TE6L 3MNVB 2P48B 8FABA 5CILL 3C5ZD 3QCUH 4KVCL 5F7WC 1N5AB 3HNSH 1ZGLB 2ZCKH 1QFWH 2A0LD 4Y1AE 5EU5A 2CKBH 4G7VH 1PQZA 3LPFA 3BGMA 3D69A 1P1ZB 5AZEL 2QQKH 3RWJB 4X4YA 1TNNA 3BE1H 1KULA 3UYRL 4JB9L 5DRWA 4HC1A 1NGZB 1OGTB 3IJHB 1QOKA 2E7CA 5B3JE 1MRDH 2MCPL 1J12A 5EBLA 3OPZL 3I6GA 1YJDC 4H25A 1EEYB 4KGLA 4NUGH 1Z9OA 2H2PC 3KPSE 5E6YA 1HILA 3O6LH 3CFJB 1CD8A 2BRRL 4Y16D 3FB7A 3IB4A 4OQTA 4B7IA 4NWUH 2EZ0C 5GHWL 5CJQL 3FFCE 1J5OH 4BH8A 3JUYA 4P2QB 3KLHD 3VXMA 2BVOA 3TVMC 5GZOD 4Y19E 2PXYA 3UJTH 4F37K 4YHNB 3R06A 5D1XC 1BBDH 1CTNA 3IFNL 3A67L 3B6SB 4XNYH 2AABL 2R1WA 3HZYB 1ZLSH 3CCHA 3DRQB 2C7UA 2RIKA 4Q2ZB 4OT1H 4G8IA 3UPRA 3F65A 1DBML 3GHBH 4UT7L 2F5AL 4P3CL 5A2KH 2O5XL 3QXUA 2VL5B 4UAOB 5FM8A 2ZKHH 5F8QC 4DGVH 1R5VA 3PJSA 3MA7A 2VH5L 2HN7B 2VDNH 3OB0H 3NAAL 4QRPD 4U1SA 2NXZD 3EYQC 1QNZL 2R1YA 2YMXL 2DQUH 3RWIA 4MB5A 4J12A 2ORBL 3TT3L 4MNGA 1WBYB 3CFIC 4EVNB 4GXUM 4LFHG 4LCYA 4D9QD 4NIKB 3L6FA 4NKQB 1RIHL 2YN3A 4P4KD 1G84A 1YN7B 2IQ9L 3EYVA 5IROA 1OPGH 4NO2A 1NDGA 2A1WL 4WFGE 7FABL 1NFDE 3RVVD 2Y23A 2YBRB 3LN5A 3P0VH 2J6EA 1AR1C 3MZTA 4BZ2H 5J6GA 2KPNA 5E94A 4BFEA 4LCIL 1A7NH 4LSPH 5DHYB 1KYOK 2XWJB 4I3RH 4TN9A 2PCPA 5ALBH 4DW2L 4Y16A 1DUYB 1JN6B 1N8ZA 2D7NA 4F8QA 4L29B 1EFXB 3DYOA 4TULH 3F7YB 2H26A 4NC2B 1A9BA 1U8QB 4OZFH 3GMLA 2R23B 4BSWB 3MSPA 4P5TB 3UTTD 4JKPL 1I9IH 1ZLWH 3EZ8A 4UINL 1IQDB 5F9WC 2M8XA 6FABL 5F6IC 5DTFB 2R15A 5LCVL 1TJGL 1RJLA 4NSKB 3CSPA 3EO0A 1BX2B 4O2FA 5I8KL 1LE9B 2GUOB 3B3IB 5D8JL 2UWEE 1KF9B 3PDDA 1NQBA 3T8XA 5E56A 2F53E 5EZOH 1X6LA 4KV5F 4ZTOL 3BP6B 3WD5H 5EUOF 3GSOA 3KPSA 1N59B 1XGPA 2P46B 2XXMB 1J8KA 1RUPH 3VE0A 4DEPC 5EOCL 2HTKC 4DZBA 3FFCA 4KJYA 3OR7B 2VDRL 5K59F 3OR6A 1OGAB 2F58H 4EUPG 1VKXA 3MRLA 2PYED 5TF1H 1FE8H 3MROA 4JN2A 2GYSA 4F8TA 2APVA 4MXQC 1A02N 4NQXA 3VXUE 3ULVF 1EMTL 1S7QA 1FJ1A 3QHZL 4GRLC 4KJWD 3CVHB 3HI1B 5F88B 1VGKB 4KQ3L 1RQ5A 4ORZC 2EDYA 3LPWA 1B4JL 4NT6B 1A5FL 5MHSE 4WTWA 4MJIE 4JPVL 5HI5C 1XFPA 1NCTA 3RZCC 1FG9C 2HT2C 3MV8E 3LMJL 4KKAD 4LK4A 3E6FB 1MHPL 5BQ7A 5L0QB 3BYYA 3FCTB 4LASH 2A74A 4TTGA 3MRIB 1M6OB 1FG2B 2XKUA 3NH7H 3JWDL 5CP7A 2FIKB 3ABZA 4QT5A 3DURB 1EAPB 1URLA 5JDJA 3MJ6A 4UQ2B 1XGYH 1D5BA 3S36X 4D0DA 4PRDA 3OKLB 1RZFL 4XX1G 3KNBA 2W9EH 2OJZH 4JFEA 1OW0C 4U3XA 4Z0BL 1J1XL 1XIWB 2NY4D 3MXWH 1BQHG 1K9TA 4X98B 4M48H 2R8SH 1JRHL 4WHTB 3QI9C 5L0QC 4QRQB 1TVHA 2DQDH 2YPVH 1GHFL 5JQHC 2A6DA 2APBA 2CMRH 4HC1L 5C0IA 1A3RH 5KSBB 3A0OA 2RQ8A 1MIMH 2ZOKB 3RTQC 4OIBA 4YGAB 5EOQH 3IFPB 3QUMB 3IS0X 4NC0B 3TEUA 4P2OC 3DUHA 3OGCA 2J8HA 1P69B 5GGRY 5FO7A 5GGRA 1MHHA 1KPRA 4GRWF 4OQTL 5DQDL 3QEGL 1KCKA 4MDIB 2EC9U 3DJ9A 3EYSH 5KSVB 1LEIA 5I73B 4JGMA 2P44B 3ZSSA 1FO0L 4NNXB 4R2GB 4GQ9L 5EFIB 1UG9A 1KIPB 1OAKH 1ZLVH 4UDTB 3L3IA 4HKJB 1AXSA 3MA9L 4MD5B 5DGRA 1AD0B 4MVBD 4NKOB 2VDQH 3VG9C 2C1OA 3HNVL 3FO0H 1U8LA 1OM3H 5GS0D 2Q1EA 5F9JA 2OR9H 5HY9A 4P59H 3OKYA 3NA4A 3LEXB 3TBTA 3ZE1F 3Q1SL 2R4SL 4GRWH 4HS3A 4PRIB 4NBZB 4LMQI 3IF1A 4FFYL 3N1MC 4NO0B 3MTRA 1W0VA 3RGVA 2X4TB 5ESQB 1BIIB 2ZG3A 2FJFB 3UTQB 1S7SB 1VPOH 2E3VA 4JKWA 2XT1B 3RPKA 3GMQB 3K4ZA 2HTLD 4LDEB 5KN5B 1NBYB 3PGCA 3DVIA 1A4KA 3M1BB 1Y0LA 5JHLH 2FYYB 2ID5A 3O45A 3O8XD 4KAQL 3HAEA 5LVEA 1UEMA 1I3GL 1KIUA 2VL4A 4XCYA 3VXUA 2WV3A 1WT5C 1R0AL 5FYJD 1ERNA 2BHUA 4MJ4A 3RIAK 3QISA 2DQIL 3DXAE 2J6EL 3VFUB 2DQHL 3B2VL 5IBLD 3V5HA 3TCXA 2X1WL 3GIVB 4C58B 3O4OC 4EN3B 2IAMB 4F57H 3DGGA 5ELIA 2FECI 2DM4A 4HUVA 4CADB 2PF6A 3NZHH 5CJOL 4CRPA 3EJZC 3PXJA 5C0GB 5I9QC 4ODWA 3GEWB 1D7FA 2AW2A 4ODSH 4LSRL 1FORH 15C8H 2DYPB 1JYNA 4XP5L 1CLOL 4L9LA 4QOKB 1OCWH 1A7OH 5F7NC 1ZA3B 4AH2B 2C4XA 1KEGL 3OZ9H 5DDHB 1T4KA 3O41A 3GSWB 4M62L 5EA0H 4W70A 1QBLH 4R0LA 1OWWA 4OKDA 2DLGA 5CSBA 1VA9A 2NPLX 1R3JA 3ILQD 5KSBF 2OP4L 5LBSL 3H6JA 2VLJD 2J1KA 5FKPB 1FGVL 1CT8A 5DMKA 4ORGA 1LE5A 2BFVL 4U4BA 5F7DA 4R90L 5GRYA 4PG2C 3NBNA 3NABH 1BWMA 1UXSA 4LPVA 5IHUL 5EUOE 4JDZB 4P2QE 1W0WB 3O4LD 3VFOA 5GGVL 4L8SB 3QFJD 2P42B 3BDBA 4FG6D 1MVUB 2R0WH 2X40A 4MNQD 4N0FB 3RWFA 2H45A 2HP4A 4HH9A 1F8TH 5MENA 2H2PD 2ZUUA 1MCWM 2X4UA 5K59E 2ZUWA 2XPGA 3BQUA 3CLFH 3VD9A 5DD1H 4QNPF 2I9TB 2GCYA 4XMLH 1MFEH 1OF2B 3U1SL 2VITB 3RUGA 1KPUA 5DD6A 2EZ0D 2ICES 1LO3L 3HHRB 5SWQB 4WDIA 4TVPE 4Z7WF 3EDKA 1AHWC 4ONFH 2AQ2A 3TVMD 3ULVE 3BP5A 4JM2C 3FAWA 3LN4B 4OGAC 1E0OB 5D1XD 1OAZH 3OXSA 4L8SC 5LQBH 2XFXA 1T04B 2D4DA 3EBAA 3FAXA 1T7VA 4TUKL 3X14A 4FFZH 4JR9L 3WL9B 3G5XA 1OSPL 4QHNB 3QEUA 4KH2A 4JPIA 3LH2H 1ACZA 1KCRL 4OQ1A 4OZGF 4GRMB 4PJ9B 4JPKH 3FFDB 5D2LB 4QRUA 2IG2L 3AUVA 1FH5L 1F00I 5HI3D 3Q3GA 5JHDB 2C3HA 3U82B 2YHGA 4RDQF 5B8CB 2AI0H 4S10A 3SKJL 1IKFL 2EYRB 4H1LH 1PZ5A 2DS4A 4W6WB 5F7KC 5FUCE 5HVFB 5EC1A 1ZKAA 1SYSA 4K3JL 4NWTH 1ZT7A 4R4FH 2P24B 5HVHB 3EYQD 2VLJA 3BN3B 1T1XB 5IVXF 1TTGA 3RZWA 3WKMH 4ZPVA 4CVZA 5DQ9A 4R97B 2IBZY 2P8PA 4PJ9C 1TCMA 1JE6A 4IRSA 2JF1A 3QDJB 3RWGB 1OARL 4ZUSB 4P3WA 5B21A 1MAKA 5KVEH 2EEDA 4DJMA 2HAZA 4PV8A 5CBAA 3QFJA 4DTGH 5T5FH 1RFDL 1GGTA 1AQDA 1XCTA 4UUJA 3QWRD 4MNQA 2J2ZA 4PLKC 5DS8B 4NQVB 3ZTJH 1CVSC 1GGCH 3NZ8B 5J1AA 5DSCB 4EI6B 1CGVA 4IS6A 4OSUL 2JLLA 4IMLA 3V52H 1DBJL 4NQDD 2BC4B 3N85L 4XP1L 5BXFA 1MCCA 5TF0A 4Y5VB 1FLRL 1T20B 1ADQA 1N5AA 2EDEA 4NQTA 3SGEI 3ARBC 4WO4B 5T1LB 5J12C 2EXYC 4P57B 1OLLA 1TTUA 1KTLB 2P5ED 3TVMA 1P1ZA 3RWJA 4J3VA 5D1XA 1HYSC 3IJHA 4QWWC 3NTCH 3RWEA 5JW4Q 2UY7A 3KPRB 4OGZA 4LSDA 1EEYA 1F3DH 1I3UA 2VSDA 5D7LB 5GSRB 1JBJA 5I8CB 2Y06H 1CDCA 3CFJA 1FDLL 3L3KB 4P9HC 1FL3A 4YIQA 4NZDA 3FQTA 5EU4A 4YHMH 5E7FA 2IF7A 4B50A 1KUMA 4X6CB 2YN5A 4HGKC 3IETB 4AK1A 1KIRB 1U92B 4MA1C 2D0HA 3X11B 2MKWA 1NAMH 1OGAE 3IYLW 2R2EB 1S7TB 2QKIA 5I66A 3B6SA 5BZWA 5F97E 1U8PB 1A4JB 2DTSA 4OAWB 3HZYA 1IT9H 4E41B 3E2HC 2YD1A 1FBIL 4RMUA 2Q87A 4EEEA 4OUOA 5HI4C 4BFIB 3JWOC 1U6AH 1I9EA 4JZJB 1DQQB 1BD2B 3NN8B 1YC8A 1PZUB 2R0ZH 3ARVA 3T0EB 3VRIB 1MRCL 1E28A 1FVCB 1L4IA 3EOBB 3EAKA 1YEGH 4QXUH 5D2LF 4DK6A 3OAYK 4BM7A 4W68A 5L2JB 3VFGH 5JR1H 2FX7H 5IEHB 4MXQD 3P3YA 5IMKB 1RUQL 4AL8H 1SYVA 3LAFA 4NQDA 4GRLD 4HFUH 1I1AC 1AD9B 1S9YA 3CZFB 2DD8H 1X5FA 3P2TA 2EKSA 1FNAA 1A6UH 4EVNA 3RZCD 5JIKA 3T0EC 2ATKA 4HFWA 1MJ7L 3AXLA 4N1CA 4XPTH 1TETH 4NUGL 1UADC 2YBRA 4NP4L 3WXVH 3PP4L 4IRJB 4NRYA 4RWHA 2EO1A 4WTZA 3T4AA 4RWYH 2H8PA 3T3PF 1MWAH 2AGJL 1YNTA 5KSBE 1F4YH 3I02B 4M4PA 1YEJH 2HH0H 3KYKL 5GPRA 2R39A 2PW1B 3BAEL 3DROB 4EUPB 4QXGL 5KZCB 3IVKA 2CUMA 4P9ML 4QRSA 2VDPL 4L29A 1C5CL 2X7LB 3RIFK 1T21B 2NXZB 1YEDB 3KPPA 1I75A 3T08A 1AI1L 3FO2B 3DO7A 3VGFA 4G9FB 3OGOE 3NIDF 3QI9D 4BSWA 1WWCA 4I13B 4PYGA 1YN6A 4KI5C 4XBGA 5TDNA 1RZ7L 1ULVA 1H3PH 2J88L 3OL2A 4LMQE 3MJ7B 1ORQB 2B4CC 4IRJC 4X5XB 1BOYA 3UTOA 1DQMH 4MX7A 3RTQD 3T0XA 5DTFA 1OAXH 3OJDB 4GAJL 4J8RB 3IJYB 3WNOA 4BA8A 4NSKA 4P2OD 2FZ3A 1BX2A 3LKOB 2ZG2A 4TOYH 3MLTB 3CDFA 2FX8H 4ZODA 2H6PA 5IT2H 2EE2A 3B3IA 1LEKB 4XPFL 4JO1L 1TXKA 4OUUB 2YC1B 1FYTD 3DYMA 2J4WL 5HHVL 3C5SB 4X6CF 2A38A 3BP6A 4PRIE 1NCDL 3HFMH 3UXFA 4GRLA 1ZVYA 3BMWA 4YEEA 5F9OL 2NY2D 4NQED 3O2VH 5T3ZE 3HB3C 5C07B 3LKRA 2WBJB 3QDAA 2APTA 3MUHL 4KHTH 3QR2A 2J12B 3RZCA 2A2QT 3EYFB 3OR7A 5C09B 4NGHH 3SQOL 3AFLA 3ZL4L 3QUYC 1OGAA 5FGBC 4WUKH 3GMNA 1YQVL 1EFQA 1CFVL 3H7LA 4QCIB 1FFNA 1HK6A 3QPXH 3N50A 5CLWA 4MSWA 2XQBL 4GW4B 3X3FL 2YRLA 4L9DA 1NMAH 2ZCLH 3CFBA 1UM6H 3JVGC 5CGMA 3GMPB 1QA9A 3HI1A 3FN9A 1CFSB 5IHZA 2DQGH 4WFHD 2ZWLT 2BSSA 1OW0A 3MLVL 2OZ4A 3MOQA 5CJ8A 2G5RA 4LGPB 5DA4A 4GOSA 3RNQB 3QH3B 4H8WC 1NCAL 3E6FA 4WEBL 1X5JA 5CHNA 2CQVA 3PABA 1WAAF 2CJUL 3QI9A 4JFFD 3ZE0F 4FQXD 4TSCL 1KB5A 3PWJB 4JRXB 3MRIA 5CIPH 2R29L 1R3HB 1CU4L 4QOKE 5ICYA 1TNMA 2BY2A 1MCOH 2FIKA 3RTQA 5D7IF 4JPWH 4X5WB 4YX2L 1PKOA 4LARH 3U36B 4TNWK 1YJDL 5TDOB 3DARA 2K3TA 3U4BH 5KOMC 4P2OA 3OKLA 5GRJH 4KXZI 3OHXB 3WUWG 4I2XB 2GJ6E 3BPNC 1U8MA 1ADQL 4KK6C 4X98A 2ZUQC 1A6AA 2Z31C 3QNYB 3SDXF 3AC0A 2C3GA 3KYNB 5J13B 2Q86B 4M93C 1LO2H 1CQKA 3BKYH 4WHTA 3Q6GH 3VRJB 1B0RA 2XZZA 4RSVA 3I6LE 1KXVC 5F9DC 3OKNB 3MUJA 4NQEA 3GRWH 1QFUL 3IDIB 1QBML 1T0PB 5I8OH 2HKFL 2K1MA 2FBJL 3IFPA 4A6YB 4M7ZB 4MQ7A 4ZFGH 1NANH 3HE7B 3RPIA 5TPWH 3F58H 1A6VH 4N9GB 1GPOH 4JFDB 3GK8H 3RVXC 4BK4A 1MCFA 4MDIA 4UZGA 4RMRA 3H9YA 3E6HB 4JANA 1HE7A 5EFIA 1EERB 1QG3A 1EIBA 4H20L 1KIPA 2GSGB 2HRPL 1MLCB 2N56A 4UDTA 2DIAA 5SX5H 4EDWH 3QEQB 4M9PA 4XB8A 3I6KB 2YWYA 1C1EL 2IPUK 4UNUA 5ILTH 4EOWL 5BV7H 5FF6B 3HE7C 3TT1H 2DBLL 2F8VA 5IB3A 1JF6A 1GOHA 4JFFA 1BWWA 4TVPL 1KCVH 3LEXA 4RMQA 4OTXH 3VGHA 1C8PA 1V7NL 3CH1B 1WT5A 5D2LE 3ULVL 5HDQL 2X89D 1GZPA 5JHDE 1K6QL 4AQOA 5LXGH 1XGTB 4K3GA 1NLBH 3QO0A 1U93B 4JM2D 5EBMB 4OGAD 1XGRB 1SJEB 4LL9A 3AREB 3JZ7A 1S7SA 1BFVL 3LN9A 3MRDB 2JCCA 2WAHA 5D2NC 3O9WC 5ANMA 1MF2L 3GMQA 2DI7A 4FQQB 1A6ZA 5C7XL 1T5WB 3GM8A 3GHEH 1RJYA 4HDIB 3SGKC 2FYYA 2FBOJ 3VMPA 3MLXH 3QQ9D 3THML 4HIXH 4YK4B 3LY6A 3SJVE 2A9NH 3EDDA 3QEHB 2V2WB 4X9HA 3QDJE 1F42A 2XWBA 1WFOA 4NM4H 1A9EB 3T3PE 4K23L 1WZ1H 2FATL 3INUH 3DUUB 2KQNA 4IDJL 5E8DH 2OR7A 3AREC 3NVQA 2WIIB 2AJSH 3F5WB 1H8OA 4CADA 4WW2C 1G9NC 1Q0XL 3DTXA 1KC5H 2IMMA 3LRGA 2XZAH 5C0GA 2Y4SA 5T3XD 1GXEA 5I17B 2B2XH 1K3ZA 2DQFB 4YE4H 2DYPA 1T83C 3RJQB 4PG2A 4QOKA 1I8MA 3HZMB 1MCJA 2V2XB 2ZNXA 1ZA3A 4L3CB 4AH2A 4KZEH 1NGWB 1IGYB 3MRPB 5DDHA 1UACH 4HWUA 4F7PB 2DQJL 2UUDH 1YYML 3RWHB 3C60B 3D85D 2VTFA 2DMCA 1TCRA 1L7IL 5JW4R 2AJYH 2XA8H 3KPRE 1R5WB 4KKBC 5D7LE 4BQCA 1YUHA 1F3RB 3ARBD 2X89A 1IEHA 4BKLB 3QIBB 3A6BH 2EXYD 4GG6F 4PY7A 1AHWA 4ZMAT 4X6CE 4JM2A 1IAOA 1JFQH 2DKUA 1JPSL 3LRSB 3QUXB 4YHOL 4L8SA 4QWWD 5ITBH 2FD6L 4YHLH 1CDGA 2IAND 1IGCL 5CZXC 4XNZB 3EOAB 4N0FA 5I1JL 3TO4D 1PX4A 4GBXD 3MREB 3QHFL 4QYOA 4E41E 2JELL 2HJKB 1TTFA 1NLDH 4OBRA 3UBXG 2I9TA 1T2QH 4JFXA 1OF2A 3ARFB 2OK0L 4LPWA 1BD2E 3QIBC 1M05A 2FGZA 5SWQA 4NUJB 3T0EE 1LEGB 2NY0B 3LSOA 3OMZA 2N7AA 4Q9BA 4ISVA 3V8CA 5GZNC 1TZHA 3NCBB 1T04A 4G43B 2WQ8A 5F7EL 4RBPH 3CVHL 4M7LT 4DOHB 4FZ8L 4XNZC 4HAFA 4HBQA 1I8LC 5HI4D 5E6ZA 4PJ9A 2OZ4L 1YEHL 3C9NB 3OZ9L 3T65B 1WAAE 3MV01 3HAEH 5FGSA 3ZE0E 1QBLL 4N90D 2IQAB 4LVNB 1KB5L 4PJIB 1H3UA 4PFEA 2NY0C 3K80A 2QQLH 5GJSH 2AQ3A 2L4OA 3D85A 1WIUA 1XCQB 1INDH 4PUBH 5DRNB 4DN4L 4CU6A 1IAIM 1MNUL 4BUHA 4Q58C 3T4YB 5F96H 1XF1A 1I1AD 3NABL 3T77A 5JPNA 4HJ0C 3ARDB 1LNUB 3ARBA 2YD6A 3QDGD 2QV2A 2MWCA 3Q6FA 12E8H 5J57B 3RWGA 1KLUA 4ZUSA 4NQCB 1VADB 4PJDF 4I77L 4OGYH 4E5XB 1WBZB 4EIGB 4RNRB 3QWOB 4M7KL 2BVYA 5LGJB 1SY6H 1S9VB 4M6MH 4WENB 3O2WL 1K8IB 2K9UA 2Q8BH 5E6IB 4KZDH 2LE9A 5IUSA 3QUML 1ZE3C 2BC4A 3F7RA 5GS0H 5FUOH 4WV1C 4RGNB 1G9MC 5JO5B 2QSCL 2YKLH 1F90L 3ARDC 4AIZA 1V8HA 1IBGH 1JVKA 2J8OA 5FYKE 5IESL 1G9EA 1IL1B 2VDLL 4RGMB 4ZXBC 3BZ4A 1KTLA 1I1RA 5I6XC 4K94C 3BJ91 4M6OL 3TYFA 3PIQB 1FV1A 5IFAL 4KGJA 2W0KA 3G6JA 3HLAB 4KI5D 1ZS8B 4LSQL 4ODVL 5GSRA 2W38A 1EHNA 1N2RB 4ONHB 4XX1E 4JRYD 1MFBL 4U1LA 5C2UB 5C07E 3DUSA 2O26U 1YY8B 1FL5A 2CXKA 2DL9A 2QADB 4XP9H 2L0DA 1S7XA 4OI7A 2A77H 3B43A 5DXWA 2WINA 2XTJB 5FYJH 3TH3T 3ES6B 3MMEA 6CGTA 4CNIB 4BSVB 2BDNH 4IHOB 1KACB 4WWKB 4XVJL 3D25B 5T3ZL 3MUGB 4D0CB 1U8PA 1A4JA 1DL7H 4OAWA 3LKPB 4RFOL 5D72H 4KVNH 3T2PA 1NL0L 2XRAL 2NNAB 3WSQL 1I1AA 2EC9T 3HB3D 1LO0L 3ARZA 1B90A 4M1DH 1FVEB 4BFIA 1YNKH 2FECL 4G8GD 4S0TD 3GJFH 3MLUH 3NN8A 5ACMA 5DYOA 3T0EA 3DYPA 4V1DD 4XAWL 3QUYD 1FVCA 2NXYB 4F9LA 1DBBH 5TQ2L 2XTJC 3U7AA 1IEAB 1V7ML 2BVUA 5L2JA 4ODHL 4HK0B 1BGXH 4G7YL 5IEHA 1EAJA 35C8H 1F02I 3CAFA 5KS9A 4M1GL 1N4XL 4P46C 3CZJA 2X4SB 1I1FA 2W0LA 1QRND 2P8LB 2WM0A 1R5IB 5DRZB 3CZFA 1X9QA 1JGVL 2PYEE 2ADGA 4GG8B 1GAFH 2D9CA 1CL7H 3HI6H 4P3DB 1KIQB 4KK9C 2XOTA 1RVFH 3V6ZA 4I2XE 3N1QC 5FHAL 2NXYC 2W60B 4UI2A 4LSTL 2RB8A 3GM0A 1VFAA 4DKFL 4QHMB 4IRJA 1OD7A 5I1KH 5DMGC 5JOEA 4IJ3C 5LAXA 2IFFH 3T3MF 4PRPD 4YHYB 4PJ8C 3S35H 4ZUVA 4TUOA 1N0XL 1OP3K 2PW1A 3M17B 2ZZUT 3ARGD 4G9DA 4KK6D 5JQ6L 2GTZA 3U6RA 2Z31D 5K9OB 1GJIA 3GBMH 2X4QA 1HINH 5FM4A 4YXKH 1IGML 1T89C 4G9FA 1RZIA 1ZHKB 1LO5B 5DJ6B 3DI2B 1U2CA 3HS0B 4TNVF 4LU5L 4AIXA 4B41A 3UCRA 3DMMD 1RIVL 3MJ7A 1AQKH 4G8GA 3QIUD 3IJYA 1ZEAH 5F3BB 5EO1B 1ED3A 3QUYA 1ZA6B 4OFYA 4F9PC 3WE6A 2AEIT 2QLVB 3IDYB 5A16B 4C56D 4RAVA 5EUKB 1UVQA 2SEBB 1HHIA 2EDJA 3RVXD 5L2KD 3NA9H 1OAQL 4OUUA 3ZKXB 1S3KL 1NC2D 4WRLA 3WNNA 4ZOAA 5F1KC 4S2SB 3N06B 3JVGA 5DI8B 2ERJC 5F7YC 4KJQC 4ZPTB 1UQSB 4XPBH 5B39G 4KMTL 4YGVA 3VWJB 1IVLA 5GS2H 1H3TA 1E6JL 4XVTH 1QRNA 4NJAH 1RUMH 1F58L 3AB0C 4ONGH 2WBJA 2HWZH 4HXAH 2OBGA 3D18B 2M2DA 1JZ7A 3UJIL 1AGEB 1DJSA 3LRHA 1NC4B 1NPUA 5C09A 3BPCA 4HGMA 3I50L 3MV7D 2Q7NA 1YEEH 2WP3O 4TTDC 4XHJC 5AYUL 1M1SA 3O0RH 4QCIA 4OCSL 1RK1A 3VRLF 3LKQB 3OKDA 3TBYB 1CICC 2EE9A 2OL3B 4N68A 3GSQA 1F3DJ 2X9WA 3BZEB 4K8RL 1A2YA 1H5BB 3VWKB 1RSFA 3HUJF 4U6HA 2NY1B 5FYLE 2O5YH 5HDLA 2JK5B 1EO7A 1BJ8A 4FP8H 3L5WA 4OF0A 3O9WD 1GOGA 3W82A 3ZKNC 1F4WL 1E6OH 1EGJA 4MCZB 1QLEL 3CSYA 1DVFC 2Z31A 3G9AB 3QH3A 4XZUA 2D0FA 3S37L 4WW1A 2F19L 4CKVX 3IDJB 2H1PL 3EJJX 4WI2A 5ISZD 2XA3A 3W9EA 1A64A 4JRXA 1M7DA 2EDNA 3VFMA 5KVFL 1H8SA 4Z7OF 4M8QB 5F7MC 1CLZH 5AZ2L 5T1KD 1JTTA 2YUXA 4K55A 4MA3A 5EORH 2NY1C 5I1CL 1WZMA 1CDJA 2BSRB 2D4FA 3ZHDA 2ICWJ 4OD1H