4ISVB

Crystal structure of the fab fragment of 1c2, a monoclonal antibody specific for poly-glutamine
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
221
structure length
212
Chain Sequence
b'SIQLVQSGPELKKPGETVRISCKASGYSFTTYGMNWVKQAPGKGLKWMGWINTYSGVPTYADDFKGRFAFSLETSASTAYLQINILKNEDTATYFCARRRSYSNYFDYWGQGSTLTVSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1C2 FAB LIGHT CHAIN
publication title Linear and extended: a common polyglutamine conformation recognized by the three antibodies MW1, 1C2 and 3B5H10.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 47
structure length 212
sequence length 221
ec nomenclature
pdb deposition date 2013-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4isvB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4isvB02
4WJ5B 1FV1B 4MDJA 4RFEB 2EDFA 5FK9B 5C0BB 4NUGL 4WTWA 3OHXB 4YC2B 2EDRA 2EYRB 2WWKT 2APVA 4R4ND 3VFWB 4WIQA 2NX5B 2NY1C 3TVMB 3IYLW 1EZVY 3M45A 4WO4D 1AQKH 4CVUA 5D2LB 2ARWA 5J9PB 4RWYH 2V9QA 1AGCB 2H1PL 3BYYA 1FVCB 4P5MA 2B8OT 4L8CA 2W0LA 5FUOH 3HUJF 2NY6B 4EXPX 2AEWA 1I3GL 4JKPL 5EWIL 4LFHG 3UTZB 2YPLA 1RJZA 4LPTA 4Z8FH 1Z9OA 3EDKA 4U0RB 1S7VA 1U3ZA 2YZ1A 1TLKA 3GSXB 1F02I 3E3QE 2GEEA 3WKML 3WO4B 4CVZB 1FFPB 2DD8H 4O2FB 1EH9A 3VE0B 2VXUL 4XVSH 2HLFC 4HKJA 1LD9B 2J88H 1KCUH 1T80A 5F93C 1RIUH 4ONHB 3ARQA 1TVDA 5MHSE 5GXBB 4B7LA 4UT7L 1OAXH 1SYSB 4M5ZH 1T83C 3QFJB 3QEGL 5IMLB 5CJOL 2GSIB 4NPYA 1PDKA 3CAFA 5TE6L 3MA9H 4M00A 4TRPH 4N0UB 2J8UA 2YWZA 1E4XL 4PJ8B 5C0GB 4FQ2H 3BAEL 2BJMH 3QUYD 1QPXA 4AT6B 1Q0XL 1OGAE 1DDHB 2XICA 1VKXB 1W8NA 3NBNA 4X6EB 3GGWB 1G9EA 4XC3H 3IJSA 5IBLD 1NEUA 5J11C 4JFHD 1T7XA 4JZOA 1TJHL 5FM5M 5E2TL 3RVVD 2DTML 2R2BA 4LKCA 2UZIL 1S7SB 3D3VA 1D5MA 3FQRA 1OM3H 3T1FA 3BPCA 3LHPH 3STLB 4JHWH 3QJHB 4ODSL 3VGDA 3LS4H 1MF2L 1EHLH 1ZA3B 1TQBB 5TGBA 4HIIA 4MHHI 4AEHL 3V5KA 2XZZA 2MPAL 5A3IC 4P0DA 3U48A 4I77H 1MFBH 1X5ZA 3VWJD 4LIQL 3LAFA 3KDMB 1A21A 1CG9B 4S1DC 5IW6A 5J6HA 5GHWL 4NFCA 5CCKL 4NQEB 1IM3B 3I6LD 5ESVB 1NEZA 1P7HL 4PJAE 4DW2L 4M1CD 2EYTA 2XT1B 4N9OB 1A1OA 1BD2B 1ZT4B 4QNPF 5CEYA 1XGPA 5GS0D 2AEIT 5BRZE 3LV3B 3D85B 3DNKA 2P1YA 5E94B 2UVFA 4G6KH 4Y4HD 1NC2D 5EOCL 1NDMA 4L8SB 4YHIA 3VRJA 5BMFL 1EEUA 2DAVA 1LO4L 3QULA 1Z6JT 2CRYA 2A6JA 2IC2A 3GBNH 3O3AB 2BSRA 1IQWL 4M7KL 2IQAB 3CX5J 1M71B 3I6GA 4B50A 4LLYA 3DX6A 2FH6A 1JTTA 4ODWA 5JIKA 1RHHB 1JGDB 3H3BC 4NQVB 1A7RL 2X7LB 1BM3L 1JL8A 4DOHB 2P5WB 5CGYC 5FUCC 1HHKA 1CICB 1IGIL 4JFFD 1B0GB 2CDFA 1WFTA 3MV8D 4Z7WA 3OKNB 5KJRH 1KCRH 4MJ5A 5HGHA 1JZ4A 2FD6L 5D7IA 2R9HD 2X70A 3MXWL 4R4BA 4YHOL 5E6IB 3VXTB 1FN4A 4YBQD 5HHQA 4JDTL 3CLEH 4I0PD 5T5NF 3UZEA 3QCVH 2A9NH 4QGYA 3MJ7A 1J0HA 1QRND 1HXMA 4NN6C 1XIWA 1K8DB 1U6AH 4JO3H 1I7TB 1JNNL 3RUGE 3LQZA 1XIWC 3MGOB 5FFLA 3ZYJA 3QZWA 2NLJB 4WFFD 1HOCA 2Y72A 2H2SC 4DVRH 5J3HC 12E8L 4YBLB 1XEDA 2G5BB 5TF1H 5KVEH 5B3JE 4ZQKA 5HGDB 5JPNA 4OLVL 1Z3GH 1ZANL 4K3DL 5KSBA 1JMZA 4MGXA 3ZKSD 1MUJB 3HAEA 1OSPL 1EXUB 1REIA 1A7BA 1YUHA 1HQRB 3KPRA 1OHQA 3GSVB 3X17A 2NW2A 1K6QH 3SGDI 4WFHD 2APWA 2DI9A 4TUJB 5FGCB 4D0BA 4NDMB 4M8QA 4NGHH 3F62A 4H1LB 1CI5A 2GHWB 4TPRL 3ZE2F 1TNNA 2FWOB 1EUUA 3CSGA 1CZ8H 4GMTH 1DLFH 4I9WE 2VXTL 3F7RA 4BM7A 4NWTL 5FYJE 5JOEA 4MQ7B 4DGIL 3VFUA 3HC3L 2ATPB 4JR9H 3AMLA 1AXSA 4RZCA 3PHQA 3BEWA 2VDML 1DQMH 2YRPA 3FN0L 4NKDA 4R96A 4HK3J 2EKSB 4YNYA 4Z77B 1I1FB 3FRUB 3HE6B 4PYHA 1MAMH 1E6JL 4C83A 4KVCL 5D4QA 3D9AL 5ADOL 2X40A 5E9DB 5IVXF 1KG0B 4RMVA 3IS1X 1AP2A 2XWBB 3I2CL 4GG6B 5GGUB 3CXHJ 3L9RB 2VLJA 1HYSC 1XR9A 1Z0NA 3PGDA 2IF7A 3LQAL 1CD0A 1NFDB 4PJFB 1WC7A 5DC9B 3JWDH 1RZGB 2PKDA 4KQ3L 3CDGA 4NBXB 4QY8B 2R1XA 5E08L 3BVNB 3FRPA 1MJ8H 1JUFA 4JQVA 3FOLB 3H2WA 2W59A 4JQVC 1E27A 3BQUB 4TUKL 3S88L 4ELMF 3E1F1 3P4NB 2YN3A 1MCQA 3B6SA 3V5DB 4EJ1C 3AS1A 1NC4A 3EW3B 4MLIA 1DBKH 2V2WB 1NGZB 1Y0LB 2VOTA 3H7BA 2EDYA 1KB9J 2Y5EA 2PXYB 5HYJE 2A77L 4QXGH 2BMKA 43C9A 3LRSB 5MENE 1IRAY 2ATKA 3TT1L 4Y1AD 5CD3B 1S7WB 3QIBB 4KI5F 3BYTA 2E6QA 1BVLA 2Z31B 3N1GC 1BF2A 4PGCA 3QWQB 2ZSVA 1GGIH 1TQCB 4K07A 1JP5A 3GUTA 2DWEA 3TN0B 1N3NB 3OV6A 1C5BL 3NOIA 4FG6D 4PJ9A 3MGTB 5C86A 1GGBH 3DYMA 4RIRB 4PJ9C 4D0CA 2Z8WC 1SBSH 25C8H 1YYLH 4IRJD 3BSZH 1JGEA 2DL9A 2EICA 4Z7VB 3DV6A 1K4CB 4HS3B 1WTGT 4E42A 3BH8A 2I60H 4L4VE 4DKFL 2VSCA 4BH7B 4WFED 2Q86A 4GQPH 2RBLA 1C5CH 3PWVA 4ODUA 5EOCJ 3JTTA 3RIFF 2FX9L 4F7EB 1MIEL 1HCFX 5D2LE 1U36A 5DJCB 5J1AA 3N06B 1Z9MA 1RZ7H 2NY5H 3SKMB 4XGZA 5BZDB 1EAPB 4XVJL 2DQFB 4N1HB 4YQXH 4GRWH 1JI1A 5DRWB 3T08A 3LEVH 1X44A 2A38A 2G60L 2AK4A 3R06A 4X5WB 4LSUL 2XNAA 4FQXD 3T4YA 3UTPD 4UNVA 5ID1B 2EC9T 2K3TA 4F58H 4PJDE 1T03L 4OFVA 3WFEH 5E8PB 4KY1L 2V2XA 2XTJB 5ALCH 2AQ3A 3BKYL 3BP6A 4HUUA 4JHAL 3QFJE 3TBVB 1A7PL 5E1AA 1UGNA 5C09B 3L95B 1MWAB 3CFDB 4N0UE 3QNYA 5BQ7B 5ADPH 2F53A 3LKSA 4YFLI 1BZ9A 5ITBL 1Q9KA 5KAQG 1CL7L 4DVBA 5D5MA 1D6VL 2XN9D 3RPIB 1RD6A 4OQTA 3OKKB 5HYSG 4ENEC 2QHRH 4ZSOE 1KACB 3TC9A 3KAAA 4QRRE 1LE9B 3U7YL 3IB4A 1AO7D 2APTA 3SQOL 1HIML 4P46A 1I3RB 3EYQD 4P46C 4XMKL 3HMXH 4CGTA 3DUHA 2IAMC 4WO4B 3RWCB 3REWB 2E9BA 1N2RB 1MHEB 5CJQL 4RISL 3OPZL 2YUZA 3MGAA 3NAAH 5FV1L 2WBKA 1FCCA 5JLZA 5FM4A 4NRXB 1R3LB 3QXTA 2EXWD 2VC2H 4NO5B 3RWJB 5C0JA 4X7EC 2XZCL 1LGVA 5ILTH 3FQUB 4FQJL 5EU4A 1NUFA 4CMMA 3CMGA 3R8QA 4JCMA 5ITFA 1MWAH 3PUCA 2D9QB 2VLLB 1B4JL 2W9EH 4PY8J 3ZYZA 4JDZA 5C0EB 1OAZL 2R0WL 1CE1H 2WQ8A 1JK8A 3OKOA 5D6DA 5DUPH 3RL2B 5D6DC 3PIQA 4X6BB 1VERA 5HDBF 2CIIA 2D7PA 3T0BA 3W39A 2ADFH 1A6AA 1N4XL 5F6HI 2ZUWA 3UO1L 3HZMB 4XWOD 1YNLH 4G6ML 2LU3A 3QUYB 4GUPA 4MX7A 1LO3H 3ET9F 5IHZB 5BOPA 3B3IB 2Z35A 5M94B 3WIFA 4I3SH 5TDOA 1C7SA 4QT5A 1ONQA 1RPQA 5I19L 4L3AA 4DOHE 2P5WE 4X6DF 5ERWA 5SV4A 3OKYA 3FCTA 5GGRB 4C58B 1FIGH 1DJSA 2YC1B 3IFLL 3MUGB 1TZHA 3ZHDA 5D96B 5B8CA 1NL0H 1KB5B 3FB8B 4WUUA 5B8CC 1ITBB 2WP3T 3DX9B 4NC1C 3A6OA 4M6AA 5DGQA 1S8DB 4R0LB 3L5WA 3VWJB 3FB6A 3IDXL 5HSFA 3K2UH 1E4XI 5DJXA 4LRNL 4EOWL 3ZKMC 1Y6KR 3MLVL 4NFDA 3O8XD 2P44B 4KJWC 2YUXA 4W68A 5B4MC 2W0KA 3SKUD 1NLDH 1T2JA 3DRTA 2R0LL 4HS6A 3D25B 4C4KO 3JV4A 2G2RB 4JG1L 5GISL 5I1KL 1TNMA 4F15B 5E2WH 3OR6A 4OLZL 2NY0C 1E28A 4U1GB 2UZYB 3ROOB 3WIHL 4HULB 4Y4HB 1NC2B 2BNUA 4HUWA 4BKLB 4ZFOL 1FYTD 3HI6H 1O7VA 1JPFB 3V4PL 1MREH 3FB7A 4MJ6A 1VEMA 4FFYL 4HLZG 1YEJL 4YFEA 4XPTL 3DVGB 4PG9A 5HJ3B 1CFTB 3CNKA 4DGYH 2F54D 2O5XL 1FL5A 5E8DH 5IR1B 1ES0B 1KN4L 2EZ0C 5FO9A 1LE5B 3TPUA 1KB5H 4P57B 2GJ6D 1X5FA 1A6ZB 2AAVA 5CJBA 2EYSA 5CZVH 1CGWA 2Y07L 5CJ5A 2HMID 1A1MB 3UCRA 5HBBA 4P2QA 4JFFB 2DQJH 4KDVA 1WZ1L 4X6CA 2A0LC 3C9NB 3MV8B 3JWNC 4WU5A 3PV6A 3ILPB 3U7WL 3QBTB 5CGTA 4JRYD 4G8FA 3BKML 1G7HA 1W72A 5DFVD 4I0PB 4OTXH 1F6AA 2BDNH 4QTIH 5T33L 3E0GA 1QD0A 3QDGB 5TQ2L 3T3PE 4XP1H 4K3GA 4WW1B 1FQ9C 4XPHH 3S3PA 4WCYH 4PJFE 4LNVA 1JHLL 1QNZH 4FTVE 1BFVL 3HB3D 2EE2A 3C8KA 4ZPTA 4HIXL 3MNWB 1I9JH 4P2RA 3UJTH 5F7EL 1CFQB 2OI9B 1LO2L 5C71A 2A6KB 1QPPA 2JB5L 2D7OA 4KFZC 3RJQB 4M62L 2AJYH 1MEXH 3EGSB 1KTKE 4OD3L 4DTGH 1PQZB 2Q3ZA 2R23B 3X3FH 3VRIB 5D93C 5GGSY 2F5BH 4JY4A 4O9HH 1IQDB 1KCSH 5INDA 3M8OH 4RNRA 5DD5L 3BP5B 5FB8A 5H94A 4V1DB 3OF6D 2YD3A 1CWVA 4GLRH 1YEKH 4K9EL 3T0XA 4WY7L 2ZUVA 5GRVL 2AGJH 4LVOC 4E0RB 1OP3H 3S5LG 1CIUA 1G7MB 4NKMB 3V5HB 1J1OL 3KXFD 1KFAL 5H2BA 1A0QL 3LRHA 1CFNA 4P2CG 5C2BH 2XA3A 1HH6A 1XF4B 4LARH 5F7YC 1K5NB 2D7MA 1QR1B 4P2YA 4JAMA 4JN1L 3L7FB 4F33A 1CU4L 2DJ4A 4AG4L 2BCKB 3O4LD 4XP6L 2W0FB 3TNMA 4GJTB 5KW9L 4FFZH 2PO6A 5L2KA 2PO6C 4Q9QH 3RQ3A 4HUKB 2J12B 5HY9A 1AD0B 5H8DA 1WBXB 5IB4A 1I7ZB 4NRZA 2Y36H 5DSCA 5FHBL 3UTSA 4JDVB 4S1QL 1NAMA 3UBXA 5CP7B 1UWEL 5DVNA 5CEXA 5BVJA 4IHOB 1FAIH 3S96A 3P30L 2QQLL 4JPWH 4XVUC 4OF8A 1RMFL 3ARDC 4ISVA 3KPPB 2HKHL 1XGUB 2AJVL 4XNZB 3T0AA 1INDL 2L7UA 3ZE1F 3P0YL 4CUCA 5F6IC 1VFMA 5FA3A 4AM0A 1LP9B 1ZOXA 4WENB 1BQHG 2R1YA 5ICZA 3IJHB 5DYOA 2DJUA 5DUBA 4HWBH 1YY8B 3RY4A 1LEIB 4GRWF 4OBSA 5K33A 5ACLA 1IAOA 4Y1AB 5LGJA 3OJ2C 1MAJA 2BOBA 3TCLB 4U6HA 2NY2C 4PRPD 3VFTA 1QLEL 4ZS7H 3SKJL 1FAKT 4GXVH 3PWPA 3IDMA 4OF0A 1UB5B 4WGVB 5L7XL 3MOAL 2NY1D 3MLXH 1TPXC 2A83A 1IM9A 4Z7VF 5DZNA 4IRJB 3QUMH 3C09C 4Y0GA 5JPMA 4JG0L 4JRWA 5IT2L 1DL7L 4QXTB 2OZ4A 2D7TL 35C8H 4QHNA 4ZFZB 1FZJB 3L3HA 1AFVL 1CYGA 4LHQB 4KXZH 3V6ZB 2X1WL 1OP3K 1F2XK 5KS9A 3SKOB 2YPLD 4PRIA 1YPZB 1JNLL 3Q5OA 4CU7A 2APXA 3CCHB 3RGVA 1SVCP 1QO3B 2H1PH 3KWWB 4RMQA 2HLFD 1EO5A 4S1SH 3TBWA 1EDQA 5CILH 1UVQB 1WBZB 1I3GH 3JWOH 4Y8DC 32C2B 1U8QA 3GM0A 3SE8H 1DEEB 4HK0A 4QLRA 1ED3B 2OL3B 3LKQA 1JIBA 4N8CH 3WFBH 3CSPA 5I15L 3D18A 3L6FA 4X4XB 1UH4A 1G7IB 2YUWA 2YA1A 4PJBA 2PW1B 1DE4B 2SEBA 4XH2B 2N7BA 5EBLB 2HVKA 4PB0L 3CLFL 4UT7H 1JGVH 4U1MB 3L3DB 3IDJB 2H8PA 4ZYKB 1SMOA 2X4SB 5C0CA 3K80A 5TE6H 3DX7A 3H42L 4MJIA 4P4RA 3W5NA 1RJCA 1P4IL 2PYFA 4FNLL 5F89B 1E4XH 3BAEH 2VTFA 3LN4A 2GJJA 3PWLB 4BZ1H 2XQBL 3D3VD 1Q0XH 3KPNB 1F97A 2IGFL 2MCG1 4PRNB 2Z91A 2BVYA 1WFUA 3I9GH 1IAKA 4L9LA 5E4EB 4RMRA 3T0VA 1I75A 4LCWA 5E2TH 4BFBD 1LEKB 4JFHE 5A3ID 4KGJA 4YLQT 4F2MA 1N59B 4HPYL 5I1LA 3IDNB 4S1DD 4ODSH 4PJ7E 3DURA 3ZO0A 4KKBC 1MF2H 2OL3H 3U83A 3HCVB 1KT2B 4I0KA 1X5LA 3KYKL 4MWFB 2MPAH 4P5KB 2QJDA 5LQBL 4OF5A 5BW7C 3HZYA 5DGRA 1CLCA 5E5MB 5L0QB 2BP3A 2OJEB 1BOGA 1PFCA 4LIQH 2OSLB 3QQNA 3MLRL 1FNSH 4GMSL 4HJJH 4LCIL 3VCLB 4LPXA 4NBZB 4NO2A 1MCWM 3P11L 4J8RB 4D9LL 5CIPH 4RGMB 4K71B 4GW5B 4DW2H 1CL7I 2EKJA 4HJGB 1OTTC 3LKOA 5F72S 3MMEB 1OP5H 4XP4L 2JB6B 4WFGD 4OKVB 1FC1A 5IMKB 5EZLA 2IMNA 3P9MB 3WV0A 3QPQC 4NQUA 2DRUA 3WKNA 1QHPA 1PLGL 1NCWL 3KPLB 4MJ4A 4Z5RB 5CGYD 3QR2A 4XCCL 2KH2B 3SPVB 4LVHB 4PGZA 2AKRA 3IFPB 1YEDB 3QDHA 4M7KH 4G43A 5DJ8B 3DETC 3DSFL 4QYOA 1GCFA 5DQDL 5GJSL 4GKSB 4OLWL 1T1ZA 2ZP0T 2VDNH 2VSDA 1A7RH 4WVRA 2QKIA 1KLGB 1HDMA 4OLXL 3MNZA 2XWJA 3RVXC 4DN3L 4FQ1L 3CXHK 43CAA 4W70A 1IGIH 2VXVL 1NMBL 3RTQA 1XIWD 1UENA 5EUOF 4JFFE 3RTQC 1K3ZA 4F8QA 1BJ8A 2Y25A 1QQDA 3MRQA 4OLYL 4MD5A 5ESAA 1A1NA 2H2SD 4DUWA 5B38A 1H3WM 5DEFA 5J3HD 1FZOB 4LCCA 4LBEB 4BH8A 2F58L 2W0PA 5FGBA 1CGTA 2DF3A 1KENH 3DSNA 3PDGA 2LU4A 4LCCC 2D31B 1UJ3B 2RB8A 3CH1A 4IMLA 4RX4A 3LDBB 4NSKB 2LAAA 3QDGE 5IFHL 2DL2A 2XG5A 3VFVB 3KPRD 3O8XB 1R3HA 12E8H 2VAAB 4WU7A 4WFFE 5J12C 5FA4B 1ZANH 4NKQB 1FO0L 3JV6B 4K23L 3K4DA 5I73C 4OGYL 1IVLA 5EUKB 3WBDA 3K74B 3GIVB 5I75B 1WK0A 2X4TA 3MFGB 3BPLB 4I0CC 3NPZB 3OAUH 1UM5L 3MLZL 1IEAB 2E6JA 4TUOA 1FYTB 2W65A 3LSOB 1A2YA 4KAQH 4V1DE 1U58A 4HWUA 2FO4A 3CPLB 4EUPG 1J8HB 4UOW0 4TPRH 3HNVL 3SDAD 3ZSTA 2X10A 2VUYA 2F74A 1RAMA 4OZ4B 4J7RA 2ESVE 3S4SB 2RGSA 2R0ZL 5TDPA 3HC3H 2BSSA 1H5BB 1OP5K 1EA9C 1IZKA 3FN0H 5LWYH 2GJ6B 3QHTC 1QEWB 2FL5A 1HYSD 1HSBA 3KPSB 3O6KH 4H0HB 3DUSB 2VLJD 3NFSL 3L3OA 3QXWA 1PG7W 1XF2A 3NIGF 4KVCH 4AENA 3GMLB 3I3BA 3QO1B 1BBJA 3EZJB 4LSRL 1R5IB 5C0AA 3X12B 1R3IH 2A6DA 4MCZB 2NW3B 3GMOA 4JRYB 3WNNA 1BF8A 5FM8A 5KSVB 2ICEB 5IKCA 1XGTB 2JJWA 4G8GA 2CH8A 4JRXA 4RWHA 3SE4A 1P1ZB 3MRMB 2HT2C 5H35A 1KIPA 5JOFA 5CBEA 3LQAH 3SE4C 4RGNB 3LKPB 1BIIA 1NC4D 4KRPC 4YHNB 3ZE0F 4KQ3H 1K2DB 3OKDB 1J05A 1XCTA 4YXHL 2AABL 4WHCA 2FJHA 3BD4A 4N8VB 1S5HA 1JZ2A 4LMQE 5FYJU 1AGEA 1YEFL 3ZDXF 1AXTL 5JORB 1D5BB 4YFLF 5J8OA 1L9MA 3RFZC 2EDEA 2ILLA 1UACH 1UM4L 2VIRB 5BCAA 5E99L 3O9WA 4KVNL 2ZG3A 3C60A 3OXSB 3O9WC 3UTTB 4HMEA 3C60C 4Y7MA 4EDXA 1LP9E 2I07B 4PJ9D 5HHME 3OX8B 3TT1H 4LEOB 3FT2A 3MRCA 3RVTC 1OF2A 4HZLA 4R7NB 2AK1L 1PG7L 4Y1AE 5C07E 1ZWIA 2Z92B 1E6OL 3AROA 3S8WA 4YJZL 4MB4A 4PV9B 5AWNL 2ICWB 3S35L 4M1DL 3QDJA 4R8WL 3NGBC 3O3DB 2NXYD 4QOKA 3CFBB 4Z7UB 5FV2A 4Q97A 1MLCB 5EU7C 2AEPL 3EUUA 1HHGB 4GBXD 4WUKH 1R5VA 5JUEL 5I1HL 2VISB 2G75A 1PVHA 1CGYA 4OAWA 4OI9A 4RMTA 4Y5VB 1QKZL 4NYLA 4XP9L 3ULUC 1NH6A 4QXUH 1QLRB 1SQ2N 3O4LB 3NZHL 5ENWB 3CZFB 3OKEB 4JKKA 1PW3A 3CFIC 3GMQA 4GO6B 3AS3A 5IWLA 3MRJB 2FX9H 3H3PL 3BP4B 2ZSWA 4H1LG 5IWLC 4TVPL 2ID5A 2X09A 2AK4D 4R4FL 1R3KB 2DQIL 2Z8VC 4PP1D 1G9NC 3AAZB 4WHYG 1WAAF 4PP2B 3I3DA 4XVJH 4Y2OA 1F4XH 5CSZB 1P9MA 4PGDA 3GMNA 4NM4L 4LLDB 2G60H 5GGTA 1EAJA 2BXYA 4LSUH 3NABH 2J5LB 1T03H 4KY1H 3SDXA 3S37L 5IHUL 2C9AA 3UTPE 1ZHNA 2F53D 3BKYH 3QP3A 4GAYA 1D5XA 2X4UA 4LSDA 4CBPA 3BP7B 2IH3B 4XBGA 5K9KA 4ENED 1EPFA 1JPGA 4LU5H 3QXDB 4LEXH 1AGFB 4NZTH 4AQOA 1MELA 1E0OB 1T20A 3MRBA 2QSQA 4PRPB 4EVNA 5ITBH 4MDJB 4Q6IA 1F4WH 1CL7H 1WT5A 3T0WA 4JO4L 4Q6IC 2Y23A 1R5WA 1WT5C 4UV7H 4K8RC 1QFHA 1CS6A 2NY1B 5M7QA 3QXVA 4OCXH 3TIEA 5BV7C 1CFSA 1WIOA 1JPTL 2AQ1A 4CU8A 1ZLWH 3LB6C 2FX7L 3BZ4A 3U7YH 1A6WL 4Y8AA 5MEQA 4P5MB 3VXMA 1MFCL 4L8CB 3REVA 4P23A 3SHSA 1HIMH 2F8OA 4XXCA 3V4VL 4Y16A 1YPZF 4ZD3H 4P23C 2R0KL 4XXCC 3G9AB 7FABH 4Y16C 5B39A 1RJZB 1NANI 3ARFA 1G7PA 1S7VB 4G6AC 2CMRL 5DDHA 3VW3L 3ARFC 3VXQA 4PJHA 2P5EE 3C5JA 5CJQH 3OKLA 2DLIA 4RISH 5D7JA 1XCQA 1UG9A 4HKJB 2GW5A 3P73A 5D7JC 5IQ9A 4KZDH 4EIGB 5MEPA 2YPKA 4C56A 5I1EL 4FQJH 4UI2A 4PB9L 4WI5A 5J7CC 4M8VA 4XCEA 4YHML 5DQ9A 2FBOJ 3VA2C 1QP1A 3SN6N 4NPYB 2VDOH 1UXSA 1NGPL 1B4JH 4PRBA 4NC0B 1Q9LA 2J8UB 4ZO8A 2WK2A 4E41B 4OCYH 2BNRE 5EU3A 2I25N 5J11B 3IJSB 2ADIA 3Q6FA 4JZOB 1F4YH 1CDCA 4P3WA 4OQ1A 4S1RL 2OLDA 1IGYA 2KQNA 1J8KA 3WDIA 2R2BB 5F70A 4LKCB 1IC4L 1L4IA 4MCYA 3D3VB 1DN2A 2BNQE 1D5MB 4LHJB 3FQRB 3T1FB 3BPCB 3QUXC 1NKRA 5A2KH 1IT9L 1M4KA 3WIIH 5SWZA 5TGBB 3GM8A 5GRXG 1VFAA 4YHKH 1OY3B 5I19H 3MODL 3V5KB 3CD4A 4WUUD 2FX8H 3BDBA 5KSUA 2XG4A 1FGNL 4LSSH 4DAGH 4JJ5A 3ZKMD 1T1YA 1Z2KA 1TTGA 4JLRA 1NSNL 5ACMA 5IW6B 4PRHB 2BHYA 5J6HB 4QRTA 4KJWD 5DD0L 5B4MD 1GHFL 1OD9A 1B6DA 3T0DA 1NEZB 2H2PC 4OCSL 2X1XR 3UXFA 1G1CA 1NKOA 2R8SL 2EYTB 3C8DA 1A1OB 1MIML 1OAKL 3IDXH 1XGPB 5CEYB 3HLAA 4LRNH 3PL6D 3MLVH 3M07A 5CSBA 1ZLWK 1OAUL 2DLEA 3RUGF 4YFDB 5EU6E 1NDMB 4YHIB 1VEPA 3KR3H 3VRJB 2DQTL 3DJ9A 4JG1H 4LSPL 4XWGL 3VJ6A 3W81A 1WSST 3QULB 2VDRL 3F7PC 5KVGL 2A6JB 5I1KH 3MR9B 5ANMA 3T2PA 1T7ZA 3G5ZA 3H3KA 3WNMA 2EZ0D 5IP4A 3O11A 4LLYB 3IKKA 1N6UA 2Z4QA 4ODWB 2X4RA 2C1OA 1HWGB 5IW1A 1FYTE 3MLWH 1J8HE 1HHKB 4XPTH 2O5ZH 3DVFA 4P2QD 4PJCF 3TBYA 2O5XH 2CDFB 4GOSA 1QFUH 1T7WA 2EEAA 5EFIA 4Z7WB 1X5HA 3Q5YA 5HGHB 4BQBA 5D7IB 2X70B 4R4BB 1RZKL 4R3SA 1CTNA 4NQCA 1FN4B 2AERT 1WIPA 2Y07H 3QEHA 4P3CL 4KI5C 5HHQB 3H9YA 3MJ7B 5BVPL 4NN6B 3KPSE 1WZ1H 2CK0H 1HEZA 2WUBH 3MNVB 1EFXA 1XIWB 3KPMA 4TTDD 3LRGA 5DD1L 5JIPA 3IT8D 2H32A 2VL5A 4PD4K 3BKMH 3QZWB 2FR4A 3L5IA 1HOCB 3B9AA 3HI1A 1WFOA 3DI2B 3QDAA 5E2UH 5T33H 4U7KA 4ZQKB 2DBJA 5JPNB 2YK1H 4RGNE 5KSBB 2P8PA 5GGQH 3HAEB 4HIXH 3MLPA 1BEYL 1YUHB 5F7EH 3LOWA 1LO2H 3KPRB 4QEGA 4KJQC 4H5SA 2JB5H 2NW2B 4XB8A 2AJUL 1MRFL 4HQQH 3MZTA 3VMOA 4M62H 4D0BB 3DI3B 4TVPD 5C0RL 1RIHL 4NHUA 4M8QB 5DJ2A 1I8LA 2H9GA 1QBMH 4Q58C 5TQ0L 3CXDH 5DD5H 3IFOA 1I8LC 1E4WH 4C57C 2DMBA 3G6JF 3UROR 5HGAA 3UTTE 4K9EH 1L0YA 3BWUC 1ZT7B 2OR8A 2J8OA 3BEWB 3PHQB 4NKDB 4R96B 1ZVSA 4YNYB 5C92A 2KKQA 4HIEA 2BHZA 2VLME 2ZJSL 4ZOEA 4AMKL 5K9QG 3TT3L 1A0QH 4NC2B 4C83B 3KHOA 3G6DH 2PO6D 4GXUM 5L2KD 4KZEL 2Z8SA 1UZ8A 5IJKA 1AP2B 4JQIL 4O58H 3IGAA 5IJKC 2VLJB 2DQDL 2NZIA 1XR9B 2YN5A 1T5WB 1S7TA 3U6RA 4DZBA 1CU4H 3PGDB 3HAEH 4EN3A 2A74A 1EMTL 4F37F 5KW9H 3UTSD 4EN3C 5DD3H 2EC8A 4LSQL 3BD3A 5I66A 3CDGB 3O4LE 4JFQA 2R1XB 8FABA 1HSAA 1JUFB 3BKJL 2ARJQ 3QH3A 2QQKL 3KYMA 1E27B 3I75A 3SDCA 3B6SB 3QISA 2CLRA 5C0FA 1NC4B 4UQ3A 5FGSA 3SDCC 3WJLA 4AJ0A 1R3JA 3GK8L 1UWEH 4IS6A 3WJLC 2EH8H 4CMHC 4Q9RL 3H7BB 3P30H 4JFZL 4KUCF 2BMKB 43C9B 2HKHH 2AJVH 2HJLA 4OGXL 1INDH 4PJGF 2ATKB 3P0YH 5C0NC 3INUL 3PXJA 3TEUA 1N5YH 5HDQL 1BVLB 5DC0A 1JWMA 4PGCB 2ZSVB 4KRNA 4WTZA 3GUTB 2DWEB 3PWPD 4ZNEA 4PJ9B 1GGUA 4D0CB 1MH5A 1CDUA 4G80A 1IM9D 1KTDA 2EIDA 1JGEB 3FO1A 2W1NA 3DO7A 2OBGA 4F3FA 2MNUA 1QLEH 3DV6B 5KTEL 5JXAH 2BFVL 3P3YA 1U41A 1UCBL 1QYGH 4E42B 1X3DA 3BH8B 4NCC2 5L7XH 3U1SL 4Z7UF 2Q86B 4ODBD 1JHKL 4PRID 1RVFL 4I1NB 4IBLT 3GSRA 3RGVD 4JG0H 4ODUB 3JTTB 1DL7H 3DYOA 3UEZA 1DANU 4QRPA 5GRVK 3RWIA 4NP4L 1XH3A 1KCVL 4ONOA 5J1AB 1T21A 4ELKB 3NA9L 4P4KA 1ZLSL 1JNLH 1NCCL 5DK3A 4XGZB 1CFVH 4M02A 4P4KC 4KKAC 1VPOH 4X6DA 4FXLA 1PYWA 3UYRL 1PGRB 2BX5A 4QRSA 2FZ3B 4LAQL 2JELL 2VZ1A 2E7BA 3R06B 2XNAB 4AEFA 2YD4A 3T4YB 5IOPA 1FFOB 1KPRA 2WMPA 2V2XB 5I15H 1N5AA 3BP6B 3BW9B 4HUUB 4PRAA 1U8JA 1MCJA 5C0CD 3OAYH 5HYEA 2LVCA 3ULUL 5E1AB 1CIDA 4PB0H 1KULA 5E24E 1CF8L 1JF6A 1YEIH 3CFCL 1HINH 1CVSC 4E41E 1KELL 2ZCKH 5IBTL 2YD2A 2F53B 1MFDH 1BZ9B 1Q9KB 4DVBB 5D5MB 3H42H 4LCWD 1P4IH 1FLRL 4RMSA 2XY1A 3MOQA 2B4CC 3V9FA 3VI4E 1N0XL 4XPGH 4N0CD 4Z9KB 4MA8H 3MUJA 4EEEA 2DQCH 2IMMA 3GI9L 3D3VE 3V6FA 4J3OC 1DR9A 3DROA 5C6TH 3T4AA 1VB9A 4P46B 4I13B 5GGTL 2IAMB 4I4WA 1F13A 1WJ3A 4HPYH 3O3EA 3GJFA 2V5MA 2GJZA 4YHYC 4JFOA 2FO1A 1TCRA 1KJ2A 4O5LH 3X11A 1AKJA 1GRWA 5SWQA 5JLZB 5I17A 5C0JB 1JI2A 1YC7A 3QIUA 4PRHE 2KPNA 3L1OL 2XZQL 1MCPL 3VA6A 3QIUC 5EU4B 4HDIA 4UDTA 5ITFB 4BQCA 1OTTD 4QHUA 3MLRH 4M1GH 4XBEL 4UOJA 2ICWJ 4LCIH 2NY4C 2V7NA 2W07A 3E2HC 5IHBA 4JDZB 4D9LH 1JK8B 3OKOB 3MRPA 4K8RL 3B9KA 3PIQB 5BV7L 2CIIB 4PPTA 2JK5A 3B9KC 1DFBL 4OQTH 3W39B 1A6AB 3CDFA 4G5ZL 4M03A 1N7ML 2CO6B 5L88L 4PGJA 2X4NA 5JW3L 4J3XA 3DETD 4JFDD 3ZSSA 1INQB 4XP4H 1ZAGA 1ZT1A 3L5XL 4GUPB 4MX7B 5EZOH 5GJTH 4YZFE 1D9KA 4OD2B 1PLGH 1D9KC 4WFGE 5F9OL 2YA0A 5TDOB 3NZ8A 4XCCH 4R26L 3RVXD 4S2SA 5C3LD 1IKNA 2Z0BA 1VFBB 4QT5B 1IKNC 2BSED 1ONQB 1CXLA 1WFNA 5FUCE 3OAYK 5ERWB 4D94A 5C70A 3RTQD 3FCTB 4HIJA 4W6XB 3QDMA 3T77B 1FNEA 4OLXH 3PQYE 3Q0HA 2FEEL 2OJZH 1F90H 1TZHB 1UZ6E 3IDUA 4J3SA 1PJ9A 1QLFA 3RI5F 5B8CB 3FN9A 1B90A 2VXVH 3RWEA 4WUUB 2EDDA 3D1MC 2WUCH 4RX4D 1NMCC 4LHUG 2IH1A 2VITA 3L5WB 5IB1B 4NQXA 3GRWA 3FB6B 3RZCA 3BUYA 4I48A 5DJXB 4MAUL 4MXVF 5EOTA 4PJXE 2DQHH 2AV7A 4MVBC 3RZCC 3B5GA 3N50A 4MS8C 1Y6NR 1ZS8A 4EBQL 4X80L 4Y5YA 4HS6B 3JV4B 4Y5YC 2Q8AH 4LNRA 5IFHH 4NJ9L 1JFQL 4HXAL 3VD4A 2NY0B 2HRLA 4FN0A 1WWWX 3OR6B 4OFKA 2YHGA 2K7PA 2CRMA 2PR4H 4ODVL 2MCPH 2BNUB 4HUWB 1GIGL 4HAFA 4OGYH 4EDWL 4QHMA 5D7KE 2BVPA 5D2NE 3BGFC 4MJ6B 2VXQL 5CD5C 3ARZA 3VWKD 2HT3C 1ORQA 3QQ4A 3IS0X 1VHPA 4ZTOL 4CN4A 5C0IA 3B83A 4PG9B 3MLZH 4K7PY 1FL5B 1WZLA 5FO9B 1EO7A 3CDYA 3TPUB 4JPIA 3IXAA 3HNVH 2X42A 1OARL 4XHJD 3WSQL 2EYSB 3DWTA 9CGTA 4X9IA 4RRPA 1A6UL 2CUIA 4Z7WF 4P2QB 2R0ZH 2BC4A 5TF0A 1MJ7L 4X6CB 5C0AD 2NY5C 2J6EA 4D2NA 4WU5B 2HJFA 3PV6B 3LS5L 4OB5L 4ZMAT 3JUYA 3ESUF 4GG8A 4PJIA 1UB6A 4G8FB 1J87A 3TYFA 1AR1D 1QBLL 3QIWA 3WNKA 1G7HB 4FQQA 4G8GD 3NFSH 4NCC1 4IOFC 1W72B 4BJLA 2F5AL 5HPMA 3QIWC 4NKOA 4P2OD 3T04D 4KRPD 3ME0A 4LSRH 1F6AB 1KPVA 2IALA 4J3TA 3H6JA 3QCUH 3R4DA 3TV3L 2Q1EA 2CLZA 5IVZA 3P77A 3C8KB 4ZPTB 1H3GA 5JHDA 1ZE3C 4P2RB 3PWNA 3FL7A 4OLUL 5K9OA 1P53A 1OLZA 3K1DA 2HWZL 4XT1C 1NCDH 5KSBF 5D1XA 3N1FC 3MJ8A 5D93B 4W4NA 2IFFH 3P9LA 1MPAL 3O9WD 4GT7A 3C60D 4JY4B 5T3XD 5INDB 4R97C 3MFFA 4RNRB 2EECA 3VXNA 3RVTD 5H94B 3VI3F 5FM5O 3KVQA 3PP3H 1DUZA 3QAZC 1A02N 4KUZH 4LVOB 5DFWH 5FKAA 1EVTC 3WUWA 1UM4H 3B9EA 1AY1L 1ZA6A 4KVNH 3AXLA 4UINH 3KG5A 3BRDA 3VGFA 3VXSA 3G9VA 2AJ3A 3QDJD 5SWSA 3R1GL 2R29H 3HNTL 1W72H 1CFNB 1HI6A 1UC6A 5JHLL 1HH6B 5J13C 1CD8A 1PG7H 4J6RL 3ULUD 4JAMB 2EDLA 1E6OH 3S3JA 2XTJC 1ETZA 5DURD 3S35H 1KC5L 4F33B 4UZGA 1A9EA 3TIDB 2DQEH 5K9JL 4PFEA 1H3PL 1KJ3H 2PO6B 1YEHH 5L2KB 4JFYA 5DMKA 2A1WL 5AZEH 4ERSL 2CLVA 1LEGA 4KTYA 5I1HH 3FHQA 5JUEH 1U8IA 2VR4A 4DFIA 5HY9B 3GSNL 4XP9H 5IB4B 4P5TD 2HKFL 4NRZB 5HHXH 3RPKA 5DSCB 2GCYA 2IQ9L 1KLFA 4PJ5E 3UTSB 2VH5L 1NAMB 3IU4H 4XMLL 3UBXB 1H3XA 2Z9TA 4CAGA 5CEXB 5E8EA 1TJGL 4O02L 1CBVL 4BQ8A 5BVJB 4X99A 4BQ6A 3ARDB 3S96B 4TVPH 4QTHA 4YHLL 1U0QA 2JJUA 2ADGA 1IGFH 1PKQA 4R4FH 2O5YL 2DQIH 4ISVB 5F6IB 4QCIA 5F1IA 3ARVA 1U8KA 2D4FA 3CU1A 1JCKA 5FA3B 5IJVA 4AM0B 2R1YB 5ICZB 1G6RL 5DUBB 3ULSA 3O0RH 4WI2A 1TJIL 2CPCA 5GS1A 1FNGA 1IAOB 5LGJB 3Q1SL 5GS1C 4OFPA 4U3XA 2H3NA 3DV4A 4HCRA 2BOBB 5IHUH 1LK3L 1RURL 4U6HB 3WFHA 4K8RD 5DUML 3PWPB 3IDMB 4WTXA 1TPXB 2W9DH 1EJ6A 1L9NA 1KLUA 2IANA 4U1HA 3C09B 2A83B 3BGAA 3LB6D 1IM9B 1H15A 2BY2A 5JPMB 3ZYIA 2HTLC 1NAMH 5HHVH 4QHNB 1O7SA 3L3HB 3PP3K 3MLYH 3VXMD 1DQLH 1L7TH 3D87B 4P23D 3MREA 3V0WL 4N8VG 5DJYA 1NBVH 4Y16D 4GRMA 4AY0A 4G6AD 5KS9B 2Q6WA 1OCWH 4PRIB 4M9PA 3Q2CA 4CJ1A 3ARFD 4Y4KD 1YJDL 1EEZA 1RUKH 1U9KA 2FX7H 1TTUA 1A8JH 1MFCH 4LVEA 4M5YL 3TBWB 5D7JD 5IBLC 3V4VH 4HUVA 2R0KH 1U8QB 5IFAH 1KJMA 3T3MF 1MCKA 4C56D 3LKQB 4HC1A 1BZ7A 3D18B 5DR5H 3BKCH 3L6FB 1RZJL 4PJBB 1DBJL 2Q7YA 1ORSA 2SEBB 5FOJA 3B2VL 1FPTL 1P6FA 1IMHC 1LNUA 1J18A 5IB5B 6FABL 3L3JA 2HVKB 4ESKA 2ED9A 5I1EH 2EDJA 3U9UA 4YHMH 3U7AA 2H8PB 4JFPA 1EK3A 5CSGA 3KYAA 3BIAX 2RQ8A 5C0CB 3DX7B 4M6ML 1NBZA 4MJIB 4P4RB 2OZ4H 2PYFB 1J0IA 5EBGA 4H25A 3VXPA 3LN4B 5DC4B 1W0VA 2NR6D 5MP6L 4OLEA 5AG9A 2FNBA 2FHBA 1A7OH 1JPST 4ALAL 2Z91B 3ZKNC 5D5MF 1IAKB 3P0GB 2VLRE 5SWZD 4LCWB 4M1CC 3EDJA 3HN3A 1IC4H 2OM5A 3MV7B 3SCMA 1X4ZA 1SJXA 2C1PB 4NFBA 4F2MB 2X89A 5DRNA 2GSGA 4LGPB 3SCMC 2VZOA 1IT9H 3MUY1 1V3LA 2V5YA 5HYSA 3DURB 2C5DC 1B9ZA 5E0QA 3RWFA 3ARWA 3K0WA 2Z8RA 3MODH 4UNUA 5D71H 2H2PD 2R15A 4ODHH 1I9IH 3VFRA 1A5FH 4N0YL 4F7CA 3HZYB 1FGNH 3EYVA 2FECL 3RX5A 3IDYC 4WUUE 4NC1E 1BOGB 3GEWB 4G7YH 4HT1H 1R0AL 4F7MA 1NSNH 4L3EA 4TQEH 3ARGA 4NO2B 4WWKA 1WGOA 1GHFH 4Q74A 1NDGB 3L7EA 3ARGC 4X4ME 4WWKC 3HR6A 1JBJA 4DN4L 2BOCA 1ND0A 5LCVH 3HI5L 2PF6A 4R7DA 1MIMH 5D8JL 3EHBD 1U8HA 4M3KB 3LKOB 4L29A 3NCEB 4XNYH 3MRNA 5HYIA 4ZAKA 1OAUH 3WE6A 4KJYA 4WWID 4ZAKC 5EZLB 3U4AA 4HPOH 1C1EH 1VENA 2DI8A 1GC1C 1QUNA 4G6JH 2DQTH 3DXAA 3F7YA 4N68A 5EDXA 4LDLB 1TIUA 3UZVB 3ZT7A 4L1DA 2YKLH 4JGJA 4FXKA 2AKRB 4TVSa 1DANT 4OJFL 1J1XH 1KJ2L 4QYOB 4U1SA 1KCLA 1MCIA 1T1XA 3E6HA 1AGDA 1T1ZB 1TVBA 1A6VH 1CDGA 1FSKC 2QKIB 1HDMB 1QSEA 4NQCD 4G8IA 3K4ZA 3MNZB 1UEYA 2XWJB 2H6PA 5EIQA 43CAB 3QHFL 3WEXA 3ZDZE 3ZTNL 3MV11 4N5UA 1NAKL 3ARUA 1EFXD 3RTQB 2DJSA 1QQDB 3MRQB 4Y19A 2XFXA 1MCDA 4MD5B 3FB5A 5ESAB 1A1NB 1MQKL 3K8KA 5DA0B 1RZFL 5DEFB 3RP1A 5B38B 3DVNB 3BT2L 3N85H 5JIIA 4LCCB 1QG3A 4OZHA 4HJ0C 4QRQA 4G42A 3CH1B 1WF5A 4IMLB 4KV5E 1T2XA 1EV2E 4U2YA 4H88L 1MFEL 3B9DA 4WI4A 2FHFA 4AK1A 4XB7A 3NH7L 4KJQD 4TYUA 1F8TH 2IBZY 1R3HB 4L4TE 5J12B 5D7LA 4WU7B 4DKAA 4P2RE 3CMOL 5I73B 1EO8L 3HC0A 4X0KA 1LDSA 3BJ91 1BEYH 3C08L 4FXGA 5A1AA 3EO1A 5H37G 2X4TB 2AJUH 3DVIA 2Q8BL 3MACL 3QUMA 4FP8L 4TUOB 4G6FD 2W65B 1A2YB 2EDOA 1U58B 4UTAL 1RIHH 2FO4B 5HI5C 5I1DA 2F74B 3TJHC 1TVHA 4I18A 3ULVL 4PBVC 3GRWL 1I7UA 4I18C 5TDPB 2ZUXA 2BSSB 2P8MB 4RFNC 3V6BR 4XNZC 3KS0H 5GRYA 4DWHA 3O4OC 3GIZH 2FL5B 2I27N 1HSBB 2ZJSH 3E3QC 3L3OB 3TT3H 2VZVA 3AUVA 1W2KT 4X6CF 1XF2B 5LBSL 4M3JA 4EN3D 1BBJB 5C0AB 4KZEH 3QQ9D 2A6DB 3GMOB 3TNNA 3QPXL 5D72H 1L0XA 5IKCB 5L2KE 3HMWH 2DQDH 4G8GB 4JRXB 5H35B 5DMIH 5ICYB 1KIPB 3RA7L 5CBEB 5JOFB 4XPBH 1DCLA 4KRPB 3SDCD 4XTRC 1UM6L 1BIIB 1NMAL 2ORBL 3EBAA 1OGAA 1WWAX 1J05B 1XCTB 3HZVA 4FFVC 4CN6A 3BKJH 2FJHB 4PUBL 4NO0A 3FFCE 1S5HB 2WQRA 3A67H 3AC0A 5C0ND 1P5VA 1AGEB 3PXHA 4YWGL 2WZPD 5C0DA 3IFNH 1IGCH 2QQNL 3GK8H 4Q9CA 4Q9RH 3ETBF 5IM7A 1ACYH 2YR3A 3O9WB 3QG6A 4HV8B 2J6EL 3DIFA 1P84J 3C60B 4JFZH 4HFUH 2K7QA 1RFDL 4EDXB 3FAXA 4NM8L 4JE4B 4OGXH 4U1NA 3L3IA 1N64H 3FT2B 4OM0L 2X1PA 3MRCB 5EH1A 3LIZL 1OF2B 3ALPA 4K55A 4HZLB 1IFHL 2ITDA 2BVTA 1ZEAL 5K59E 4OSUH 1V7ML 1ZWIB 2OXHA 2JJTC 2CKBL 1HHIA 2W60A 3QZWG 1A3LH 3NGBB 3QDJB 5HHPA 1UH2A 4KKLC 4X7DC 4QOKB 3PWPE 4XNUH 2HFEA 4FQXC 3VGGA 5I76A 3O2VH 1R5VB 4NQSA 2G75B 4XAKE 4HX1A 2W91A 4OAWB 1S7XA 2BFVH 2AI0L 3HAEG 1FVEA 4NYLB 3V52L 2GY7B 5DURB 3K4AA 4JANB 5C9JA 3CFEA 4PGBA 5CIPA 1JHKH 4P4KD 2Q20A 4ZUVA 4KKAD 4RMUA 5IFJA 2J4WL 4OZIE 3GMQB 5KS9E 2ZSWB 4MQTB 3DBXA 4YPGA 4NP4H 4KROC 4LASL 4A2MA 1KCVH 3NVQA 4KK9C 4YDKL 3NA9H 1ZLSH 3PWUA 1OQXA 4RDQF 1DZBA 1CGSL 1NCCH 5FOBA 3DX8A 2D0GA 1KN2L 3EO0A 1F00I 2WBJA 3GMNB 1DQQB 4PGDB 3DMMA 2NTFA 1T2QL 4LAQH 2JELH 2VERN 2WBJC 5T5FL 4Z7OF 3DMMC 4S10A 4OF7A 4YH6A 4WI9A 1OP9A 2CSPA 1FJ1A 5FAAA 1S7RA 4AIXA 4I2XE 2BRRL 4QXWA 1ZHNB 4GAYB 1FYHB 4XNMA 1D5XB 1D5ZA 4QWWC 2A9ML 3ULUH 1BQHA 2W9LA 5I2IA 4XBGB 1JE6A 1JNJA 1JPGB 1I9RH 1FG2A 5I1JL 1I8MA 4MJIE 1S9XA 2R2EA 4KMTL 1PX3A 1T20B 3MRBB 2EDQA 3GKWL 3RUGA 4EVNB 4W81A 4Q6IB 3IRPX 4ZDHA 3FRPG 1OAYH 1FLRH 3NMEA 4K2UH 3U36B 2P7TB 5BV7B 1J0YA 4XPAH 3V7AE 3O6ML 3RKPA 1G9NH 3TIEB 4LCWE 3MV9A 1J9CT 1YQ2A 3GI9H 1RJYA 2B1HH 4P99A 2R4RH 3BZ4B 3MV7E 1BWMA 5MEQB 2ZPKH 3VXMB 4HK3N 3C2AL 3REVB 4P23B 4HEPG 3QI9A 3X13A 2WIIA 1AKJD 5I8CA 4Y16B 5EA0L 3QI9C 1MFAL 4HSQA 2A6IA 5GGTH 4XWOC 5B39B 1YZZA 3ARFB 1G7PB 3HZKA 4LFHD 3LZFH 3Q3GA 5DDHB 3HE7A 4HFWA 3VXQB 4AEEA 4PJHB 3C5JB 3OKLB 3RU8L 2MSPA 3HE7C 3IDGA 5D7JB 1XCQB 4WV1C 2FBJH 4ODTL 3P73B 5IQ9B 1DN0A 3EO9L 4I3RH 5MEPB 4AYFA 2YPKB 3B9KD 4AL8L 2XZQH 4C56B 3T0EA 1MCPH 4BFIA 3T0EC 5ETUA 5DQ9B 4IM8A 1UXSB 3KGRA 1GOGA 5FCUL 2FHCA 3HR5A 4PRBB 5BS0E 3OKMA 1J1PL 4K8RH 2I26N 4MDIA 3LKRA 5BV7H 1ODAA 3UMTA 1D9KD 3HPJA 5EU3B 5I8OL 1DFBH 4UIKH 4G5ZH 4G7VL 3Q6FB 5L88H 1CK0L 2GKIA 5LGHL 1IGYB 4CVXA 1XF5A 5HGGS 3KLHD 4MCYB 3OR7A 3QUXB 1AJ7L 3HNSL 4ODXA 2D0FA 4HWZA 3QDMD 2WWMC 3UAJC 1YEEH 5CEZL 2DKSA 5SWZB 2LABA 5TDNA 4HGKC 4NUJA 1VFAB 4R2GC 2XPGA 4NNPL 5DVLA 4BFEA 3EYOA 3H9SA 3NIFF 4DEPC 5KSUB 1CVRA 5INCA 5CEZE 3G6JA 3F58L 1J12A 5TFSL 4JJ5B 3MRFA 3ULVD 2NY3C 1T1YB 1PD6A 1YN6A 3RZCD 1MCEA 3TJEH 4MS8D 4JLRB 1A7NL 5C08E 3HC4L 5HYJA 4QRTB 1YNKH 4UUJA 2FDBP 5FYKE 5MENA 4EI6A 4RA0C 4P59L 5IVXB 5TH2A 1WEJL 3HLAB 4MAUH 1UKTA 4LQ1A 4Z0BH 2CGRL 1MVUA 3W0WE 5A16A 2NY7H 4EBQH 4LL9A 4IMKA 4X80H 3CJJA 4XMPL 5EC2A 2FEDC 4XRCB 2BVQA 1M7XA 5CD5D 3FO0L 3VJ6B 1GH7A 4HXAH 1J7VR 2X1QA 5ANMB 5D9SA 4L4VA 1AGBA 5EOQH 3G5ZB 2OCFD 4MA7H 4JFXA 3MRHA 4N9GA 5DT1L 1TENA 4Z95L 3O11B 4JO2L 3L5JA 1KV3A 3RWDA 2Z4QB 4D3CH 3LCYA 2X4RB 4JGMA 5FYLL 2C1OB 4PTTA 2VXQH 5IW1B 4OF3A 5JR1L 4ZTOH 1N0LA 2UY6A 4KC3B 1AGCA 5DK2A 1B2WH 3TZVA 3TBYB 2FECI 3TZVC 5EFIB 3ARXA 1TXKA 5D1QA 5GZNC 1F45A 4YHZH 4PJGA 5D1QC 4IOFD 4LSVL 4R3SB 4DGVL 4NQCB 3WSQH 3QIWD 2P47B 4MB5A 1BREA 2XWTA 1BJ1J 3EOBA 1HEZB 2ZKHL 4LCUA 5CKGA 1ZLVH 3EYFA 3VE0A 1EFXB 4X98A 4OB5H 1XAUA 3KPMB 1L6XA 2XOTA 4PJDA 1C7TA 2QHLA 1CLYL 1GC1L 2H32B 2VL5B 3FTGA 2FR4B 1WWCA 5JHDD 1MCNA 4RAHA 4LF3A 1MHCA 3HI1B 3KXFA 2GSIA 2HLAA 2Y7QA 4G8GE 4JRXE 5CUSH 5D1XD 3WS6A 1RUQL 1G0YR 4N0UA 3WS6C 2P8PB 4FZEL 3ECBA 1S3KL 3TA3A 1JZ8A 3TA3C 3Q48A 4H5SB 3VFPA 2EXYC 3U4BL 2OQJA 1IARB 3UDWA 4KDTA 3BMWA 4M43L 4MXWH 1W0WA 4ZSOA 3UDWC 4KDTC 4NHUB 4QHKJ 3H9HA 5DJ2B 4QRRA 2OS7A 3HUJE 2WSKA 2H9GB 2PYEE 1G7LA 1AXIB 1YY9C 3VXSD 3IFOB 3W2DL 4WHDA 1J5OL 3QEQE 5SWSD 3GMPA 2E6PA 3GBMH 5T3XE 2F19H 5HGAB 1NBQA 3RNKA 1SBBA 1ZVSB 2B1AL 1T1WA 4HIEB 1UA6L 4R90L 5TPWL 4RAVA 4MLSA 4EUPA 2H32H 1BBDL 3ZL4H 5T1MB 3KDMA 3HG1E 1C5DA 5GQBA 2F8XC 5JHLH 1KNOA 5HD8D 3NCJH 1UZ8B 4QOKE 4O4YL 4K7PL 3IGAB 4FMFA 3KNBA 5GGRY 3P4OA 1WBYA 2W38A 2XZAL 1KC5H 1S7TB 4DZBB 3U6RB 1YNTA 3GO1L 4EN3B 2A74B 5K9JH 1H3PH 4YE4H 1X5AA 4ERSH 5I66B 3LPFA 4JFQB 2DYPA 8FABB 5E94A 1GZPA 3CDCA 1F3JA 1DQDH 4HKXA 1HSAB 4MA3A 2HKFH 3QH3B 3KYMB 3I75B 4NN5C 2IQ9H 3SDCB 1KCKA 4NQDA 2CLRB 3GNMH 2XRAL 4NNYA 5C0FB 2VH5H 2XACC 4CMHB 1IKFL 1IGTA 4XMLH 1R3JB 4BFGA 4IS6B 1QFWH 4O02H 1CBVH 4JO1L 1OTUC 3PHOA 3CVIL 3P9WB 1ZLVK 4YHLH 1FGVL 2WBWB 2NNAA 4YXKH 2ZCLL 4ETQA 3WFDL 2HJLB 2KZ1B 2P5WA 5I8EA 3RGHA 2LFGA 1JWMB 4GKZA 1G6RH 3NACH 1YMHA 1DBBL 4POUB 4W6YB 4LKXA 2FB4L 5BO1L 2E5EA 1JZ3A 1ADQL 2FJFA 3VXTA 2D7NA 4YXLH 2ADJA 2IAND 1J0KA 1MH5B 4G80B 4JEGB 2JLLA 1MHPH 1KTDB 4M48L 2HTLD 4HF5H 3BDXA 1LK3H 3FO1B 3DO7B 3C2SA 4F3FB 4FABH 1FRGH 4UNTA 3O2WL 1IEBA 2FIRT 3DLQR 2N4IA 5KSAA 4D8PA 3ULUF 3GSRB 5KSAC 5FF6A 3BO8A 5DZLA 2X6MA 1JWSA 3V0WH 5I9QC 4OIIH 2HP4A 4QRPB 1PY4A 1XH3B 4HAGA 5D7SL 3VXME 1X5XA 1T21B 4YEFA 4PG2A 4P4KB 4PG2C 4POYA 1G0DA 3A6CH 3T8XA 4X6DB 1AH1A 1PYWB 4M5YH 3LH2L 2QADC 4QRSB 1INEH 4PTUA 3KJ4C 1D6EA 1JRHL 3WIHA 1VADA 3S34L 4UTBL 4ZFOA 5IOPB 2FRGP 4OCWL 3BN9C 1KPRB 5MI0C 1FBIL 1BQLH 2DQGL 4K3EL 4ZTPL 3RIFK 1RZJH 4PRAB 3ZTJH 4UAOC 1DBJH 1FC2D 4B7IA 3B2VH 4F7TA 1UWGL 2B7DT 4JZJA 3QB7C 3SDXF 5KANG 4JZJC 3ZKND 5GGVY 4APQA 1TITA 2N56A 5HYFA 4APQC 2KBGA 4DCQA 2X4OA 3VGAC 4QHLA 3S97C 4Z18A 4FMKA 3WXWL 3D39A 5DLML 3SCMD 5MP6H 4NO3A 3MYZA 2X89D 4ALAH 2A73A 1Q0YH 3UBXG 1T7VA 3NPSC 3KLAA 4FTVA 1RU9L 3V6FB 4WEBL 4F57L 2VZTA 3DROB 3T4AB 4J23A 5EBWA 4U1KA 4YZFF 2PN5A 5L9DL 2AJXH 2RIKA 3RVWD 3VDAA 5SWZE 1LDPL 3BIBX 3N1MC 4PR5A 5FYLD 2XIDA 4I4WB 3VXRA 3ROLB 3O3EB 1EUTA 2VR9A 3V5DA 3TYGH 3GJFB 2EE6A 4YHYB 2ENSA 2VAJA 5LG1A 4JFOB 3TWCL 4L3ED 1TCRB 1KJ2B 3X11B 1AKJB 3ARGD 5SWQB 2K9UA 2P45B 4WWKD 4CJ0A 5I17B 1E4JA 2AXFA 4O51A 3QIUB 4CDGC 3VXUA 2VDKL 2VQ1A 4PJHF 3LRSA 1C16A 4JM4L 4L8BA 4R9HA 4HDIB 1UZ6F 4TOYL 4QHUB 2NY4B 4U6YA 3E2HB 5DHYA 1R0AH 3LN5B 4XVTL 2V7NB 3W11C 3NCFB 4M61A 1QFWM 2MQ3A 5IVXE 4ZAKD 5IQ7L 3NTCH 2B4CH 3MRPB 4OI8A 3B9KB 4K9EC 1SEQH 1IZJA 2JK5B 4P3DB 3HI5H 3DXAD 3N9GH 4PJXF 5ISZA 4WNQA 4GKNA 1FE8L 4OM1L 4N90D 2X4NB 1SY6L 4M6OH 3RY5A 1ZT1B 5ANME 2HH0L 4K94L 3VG0H 1AE6H 4GXUN 2MWCA 4FQIL 1D9KB 2IJ0C 1K3IA 5I1GH 1GPOL 2DIAA 3RWHA 1V3KA 1P7KA 2YRLA 1J86A 3NZ8B 1QSED 1I7RA 3I3EA 1BOYA 4S2SB 4EQ2A 4ELME 3MRLA 3GJFH 4J1UA 2OK0L 3SJVD 5A2LH 4U1JA 1F4AA 1X5JA 1AC6A 4OJFH 1KJ2H 4RFOH 1EGJL 1XFPA 4HIJB 4FFWC 1WQVT 4BSWA 1X6NA 3QDMB 5EZJA 1FNEB 5FYJL 4Y19D 4C54A 3RAJH 3MRDA 1T6VN 3SKMA 3PWJA 4NZRL 2GI7A 5T3ZL 4BUGA 3EJYC 1QLFB 4HJ0D 2R1WA 2V7HA 4KI5E 3THML 5C6PB 5DVOA 3RWEB 5IF0A 3ZTNH 4DKEH 2NYYC 1NMCB 3QT2A 1JMXA 4K7FA 3UJJH 4GQ9L 2QSCL 3BWAA 5T3ZE 2IH1B 2VITB 3MSPA 1VFOA 4UILH 5ID1A 4NQXB 1MQKH 3MPCA 3RZCB 2VN4A 2GY5A 3BUYB 4I48B 4XPFL 3SDAA 3MCLL 4EIZC 5EOTB 2YEZA 3CGTA 2AV7B 2CR3A 3SDAC 1ZS8B 2DOCA 4NWUL 5D7LD 5F96L 4P9ML 3MBXL 3T65A 1NGQL 4Y5YB 4H88H 1MFEH 4CVWA 1MHHA 3RVUC 4LNRB 1SJVA 5BJTA 5TE7H 3V7AG 2DM7A 2IEPA 3QA3A 4JPKH 1QSFE 2HRPL 3CVHL 4H20L 4EXKA 3WLBA 5HGBA 3CMOH 1EO8H 3RPIA 5D6CB 4XCFH 3BGFB 4Z7NF 4QHMB 5HI5D 2HVJA 3C08H 2BVPB 3TJHD 5CLWA 3FQTA 1IL1A 4A6YL 1ORQB 3QQ4B 4RWYL 5C0IB 4C4KT 1F3DJ 4XBPA 3FQXB 5JW4Q 3WFCL 3R0NA 5L8LB 2I5YL 4HH9A 4UTAH 4JPIB 3KPTA 3ARSA 3IXAB 1F2QA 4Z8FL 1ZGLP 2VO5A 3HPLA 4OBRA 3ULVH 3RWCA 3GRWH 2GITA 1IILE 1T66C 1F58H 4GRWB 5MHSD 2HJFB 1JGUH 4XVSL 1AI1H 3IETA 1UB6B 3TYFB 3RWJA 3QIWB 5A2JH 4FQQB 5E2VL 5HDOA 5HPMB 4XTRD 4NKOB 3GJEA 5LBSH 3KPQA 1KPVB 2IALB 3GJFK 4PS4L 4XI5D 1OGAD 3MA9L 5KG9A 4FFVD 2CLZB 2IPUG 5IVZB 2FH8A 3P77B 4FQ2L 2BJML 2YD9A 3ZYOA 5JHDB 4NO0D 3PWNB 1HZHL 4MXQC 5K9OB 1N6VA 2EDBA 1UM6H 1NMAH 5D1XB 2P24A 5C0BE 5DHVH 3MJ8B 2NZ9C 2NXYC 3P9LB 4R97B 4GBXA 4YR6A 1CQKA 5J4MA 4PUBH 2ZCHH 3F6IA 2NX5E 3MFFB 4GBXC 4LP5A 1OM3L 1X9QA 2Z93B 3VXNB 4N1CA 3QAZB 4JHWL 2QQNH 4LLUB 1DUZB 3WDJA 1EHLL 5FKAB 3WUWB 3ARPA 2MFNA 1WIUA 1ZA6B 1LK2A 3G6AA 2J6EH 3AXLB 4PJ7A 1L0QA 2FJGA 2X4QA 1PZ5A 4KKLD 3JXAA 5B38G 3VXSB 4OUOA 5FUZL 2AJ3B 4H0GA 2YC1A 5SWSB 1MFBL 3BJLA 1FORH 5J13B 1HI6B 3LIZH 4MZ2A 4PP1C 5B3NA 1IFHH 1HNFA 3QUZA 4D9RE 1CD1A 1OAQH 5KVDH 2HG5A 3QUZC 2CKBH 4YUEH 2XV6B 1ETZB 1A64A 4KMLB 5FDWA 1A9EB 1S8DA 4UT6H 4FQCH 5HDBE 4DUVA 2JTDA 2MHAB 4O2EA 2W92A 4JFYB 5DMKB 3O3BA 2CLVB 5E56A 1LEGB 1U8IB 1AD9A 2AI0H 4KROD 5J6GA 3IDIA 4PLOB 4KK9D 3EDDA 3S36H 3D25A 2GCYB 1MJJA 4QRPE 3F7VB 4L5FH 5E8EB 4BZ2H 3RNQA 4X99B 2WBJD 3DMMD 1J0ZA 1I1RA 1DSFH 5JXEA 2R69H 1BJMA 2ADGB 1UFUA 1PKQB 4UMGA 5JMOC 5JXEC 3L3GA 2N1KA 1JPFA 3M17A 4IIQA 5I1CL 1IGMH 4IIQC 1X7QA 1EEYA 3LN9A 4QCIB 5F1IB 5D70H 3JSSA 1U8KB 1FZKB 1AIFA 3FT4A 5IJVB 4U33A 4G3YL 4QWWD 4NJAL 3MOBH 3ULSB 2DM3A 5T5FH 5KJRL 3BDYH 4LDOB 3DPBA 2R56L 4ZG1A 5GSVA 2VABA 3V6OE 1RIVL 5GS1B 5CINL 1FNGB 3HTLX 2HFTA 4XCNA 4HKZA 2H3NB 3DV4B 3CLEL 4TSBL 5F7HA 3QCVL 2A9NL 4JZNA 4NQEE 4RAUA 5GRZA 3WFHB 3O6LL 1KBGH 1P4BL 4V2BA 3VFGL 1U6AL 1ZTXH 5I1JH 1KLUB 2IANB 1BD2E 2PCPA 4U1HB 1JYNA 4G9FA 3MV9D 1H15B 4YDIH 4X9BA 1NCUA 4FZ8H 5TF1L 3FJTA 5KVEL 5J56B 3KJ6L 3EOTL 3X3GH 1Z3GL 2HN7A 3MREB 3QI9D 2HFGH 5DJYB 1EJOH 3LMJH 4GRMB 4NRYA 1T5XA 2OXGA 4KPHL 2Q6WB 3RHWF 1EEZB 3FFDA 3HE7D 1FHGA 1K6QL 3VH8G 3EGSA 1KJMB 1FO0A 3F5WA 3T0ED 5AZ2H 1CZ8L 4GMTL 4M7ZC 3SGDH 1DLFL 2JCCF 1CR9L 3LVEA 1BZ7B 4HCRH 4U6VL 4QO1A 5EUOB 3CZJA 2R2HA 3S98A 2Q7YB 1I8KA 1ORSB 1S7QA 4ODTH 1DQML 3DRQA 2VKXA 2ESVA 3EO9H 1LNUB 3A0OA 3L3JB 1HKLH 1MAML 2E3VA 4JFPB 4FQPA 1B4RA 1NBZB 4UDUA 5EIIA 4JCLA 1X5KA 3ZDYF 4H25B 1D5IH 3VXPB 1I4FA 4QF1A 1W0VB 4XX1G 2WWMD 3UAJD 5I8OH 1WICA 3P0VH 1U2HA 4GS7C 3VFOA 3JWDL 2OTWA 3ES6A 5F9AC 1CK0H 1UYWH 1H8SA 4R2GD 3PL6A 5CZXC 4HLJA 3H9SD 3PL6C 3SCMB 1I7ZA 2FATH 5DRNB 2GSGB 3DTXA 4CADB 4JN2A 5ID0A 3D48R 2NY3D 4GFTB 3MXVH 1JRHI 5FGCE 1DBKL 4HC1H 5IEHA 4OCRH 3RWFB 5HYJD 3RX7A 4JHZA 3HRPA 3T2NH 5MEND 3ZT6A 2F9BT 5DJAA 3KYOA 3IDYB 3VFRB 1I9EA 4F7CB 4QXGL 2AJZA 3EYVB 1EVUA 3F58H 5TFSH 5F97E 1IE5A 4LVNC 4F7MB 5E6ZA 4L3EB 3ZDZF 2Q3AA 3ARGB 4WWKB 1NFKA 3L7EB 1U3HA 2FEDD 1GAFH 1FDLH 1U3HC 2BOCB 1ND0B 5IHLB 4ZPVA 4OZGF 4P59H 4R7DB 1GGBL 1HWHB 5C07A 2HT4C 5E9DE 4NHCH 4JVUA 1U8HB 4L29B 3BSZL 5KOVC 4L4VD 3JTSB 3MRNB 4ZAKB 3WE6B 3H9ZA 4KJYB 2ZNWA 5IW3A 4GG6E 3EYUH 1QRNB 4XMPH 2I60L 1T22A 3QJFA 4X7FC 3DXAB 1NFDE 3F7YB 4O00A 1JPSL 1N8ZA 2VQTA 1R24A 5EO9A 1C5CL 4TTDC 3BPNC 3SDYL 4FXKB 1U8LA 3TZVD 1QR4A 5GZND 2APBA 3GMMA 4KUCD 4Z95H 1JF5A 5B39G 5HHOA 3MJ6A 1FSKB 5D1QD 5HVHC 1T1XB 3E6HB 1TVBB 3UJIL 2CD0A 5FYLH 3SKOA 1QSEB 1RZ7L 4G8IB 1UXWA 3S36X 5JQ6L 4ORGA 1QBBA 2H6PB 2GTWA 5FYKU 3WYRA 3ZE1E 3BH9A 2VKWA 3WEXB 3WN5A 1Q94A 3LEVL 2IBBA 5T5NG 3WN5C 3CSBA 5DD6A 3WD5L 4Y19B 4LSVH 1LQSR 2XFXB 4DGVH 4GRWE 1BLNA 5DO2C 2N7AA 4BK5A 3FB5B 3HFMH 3C5ZA 3WFEL 1BP3B 1DBMH 2YPVL 3C5ZC 5ALCL 4OZHB 3K8LA 2CXKA 2ZKHH 1CTOA 4MD4A 4G42B 3EKCA 4OT1L 3ULVF 4PJ8D 4X5XA 1YYMH 1GC1H 1IC5L 2I24N 1YECH 3TA3D 3CX2A 2HYMA 4LHUA 3GSWA 2EXYD 4Z7VE 3CFKA 5D7LB 2QSTA 1L6ZA 2ERJC 3HC0B 4X0KB 1BQUA 5DRXA 3T2QA 2J2ZA 2EIZA 4QRRD 1YY9D 1H8NA 2VYRE 4NZUH 4FXGB 5CJ8A 1BECA 3EO1B 2QHRL 4D9QE 2PUQT 3V2AR 3U4BH 3QUMB 3R0MA 4M43H 4PREA 5A2FA 3QFDB 3SGEI 4ZXBA 3KPOA 3BPOB 3BEVA 2GTZA 3QUML 4ZXBC 3M1BA 1B3JA 4NKIH 4DQOH 3AGVA 1N59A 3HMXL 4UBDD 5I1DB 1TVHB 4I18B 3MLSL 5B22A 1J5OH 5I71C 3P4LA 3I50L 1I7UB 3FHAA 4RFNB 1QBAA 5E8OA 5I1AA 3NAAL 3K8MA 1CDHA 1JWUA 3O4OB 2E27L 3IAPA 1A4KA 5C9KA 2B1AH 2VC2L 4PY8I 2P5EA 3IF1A 1UA6H 5DEZA 4R90H 4ZUUA 5TPWH 5ILTL 4XC1L 3VRLF 1ZLUH 5I30H 1U8NA 2XTJE 1FLTX 1MWAL 2OSLA 1FNHA 4PJIF 3D85D 1IC7H 2FLBT 2W9EL 2DYPD 3GDBA 4M9OA 5HDLA 3TNNB 4MQXD 1CE1L 1Q1JL 4K7PH 3D6GA 2D03H 4YDLC 2XZAH 5C09E 5DS8A 1T6WA 4NQDD 1CFBA 5I74C 4I3GA 1OTUD 1F11B 1OGAB 2DLFL 2BNRA 1YNLL 5KN5A 2MTPA 3HZVB 1T4KA 3QO0A 5DRZA 2C7UA 3VD7A 3P9MA 1LO3L 4UQ2A 4NO0B 4NUGH 3G5YA 5BZWA 4I3SL 2VL4A 5C0DB 1IKFH 2P5WD 1VEOA 2BNQA 2YUVA 4XHQA 3C6SA 2X9WA 4JO1H 2VN7A 3WO3B 4HLZH 1OT2A 3CVIH 3QG6B 2VDPL 3ESVF 1FGVH 3BX7C 3RGVC 1BWWA 3WFDH 1FIGL 4LDEB 3VD3A 3MRRA 3L3IB 4JKPH 4U1NB 5EWIH 4YGVB 5DK0A 5F3BA 2RHEA 2V5SA 2ITDB 1LILA 1DBBH 3WKMH 5HHNB 2FB4H 5F9WC 1HHIB 2W60B 2EE9A 4JQXA 4N0FA 2VXUH 1OGTA 5HHPB 4I5BA 5MEOA 4JQXC 1A7QL 2X4PA 4FQXB 5KSAD 3K2UL 4M48H 3CX5K 2HFEB 1VGKA 4CN1A 5I76B 4L8DA 2IANE 4NQSB 3QUKB 2UUDH 4HX1B 3QEGH 1S7XB 1A14L 1OVZA 5CJOH 1SYVA 4G9DA 4Q9BA 1NLDL 3O2WH 5C9JB 2GT9A 2IPKA 2M2DA 3CFEB 3OBAA 4PGBB 5CIPB 3HKFA 3C5SA 4ZUVB 4JJHA 3STZA 5IFJB 2EDHA 5E2WL 5EU6A 2AXJA 1BFTA 1NFIA 2QADD 4C59B 4KROB 2ZG1A 4YPGB 2OP4L 5D7SH 5CP3A 1TJHH 4HWEL 3HI6L 2CDEA 1FVDA 4L9LC 2XN9B 4JM2A 3RY6A 3BN9D 2DTMH 1MREL 3IJYA 4JM2C 3RY6C 3PWUB 3QHZL 4X4YA 2UZIH 5FOBB 3DX8B 1S9WA 1ZLUK 4CW1A 1RULL 4AZ8A 3QWRA 3EO0B 4N0CC 3SY0A 5C7XL 4DGYL 2WBJB 3DMMB 1BAFL 2NTFB 5E8DL 4BK4A 4M93C 1AO7B 4J4PA 1JRHH 1KB5L 1DLHA 1J8HA 2AVGA 3S34H 3QEUA 1UADC 4J4PC 4KWUA 5EUOE 4AEHH 1A22B 1FBIH 4K3EH 1FJ1B 4APQD 5HTSA 1S7RB 4ZTPH 1H8OA 1NUDA 1V7NL 5AEAA 1HKFA 2DQJL 4XNMB 2V2TA 5EG6C 1D5ZB 1UWGH 1PEWA 4KTEL 5I2IB 3D39D 5GHWH 3RWGB 5CCKH 4JPVL 1FG2B 1I8MB 1S9XB 1FL3A 3DECA 2R2EB 3BN3B 3BXNA 5GS0L 3RUGB 1RZKC 4FTVD 2BDNL 2HFFA 1XR8A 3I6LE 3K3QA 4MCZA 4XP1L 4PLJC 1QNZL 1S9YA 3PF2A 4Z7QF 5DLMH 1FNLA 1A3RL 3VXRD 3MV9B 2VQUA 5EOCH 3UJTL 1SJEA 1RJYB 5BMFH 4NZJA 1BIHA 5AYUL 1Q8MA 1RU9H 2BY3A 4WEBH 1FFRA 3MCKA 4F57H 1LO4H 2EDXA 2AJYL 1K2DA 3QI9B 3X13B 2WIIB 1MEXL 5I8CB 3HRZA 4DTGL 4E5XA 1IQWH 3TPKA 2A6IB 4JFDA 3UPAA 2F5BL 3F6LA 1KCSL 1QHOA 3M8OL 3VXUD 5EPMA 1TZIA 3HZKB 4PJCB 3Q3GB 3HE7B 2HTKC 4HFWB 3F12A 5F21B 2AJSL 3W11D 4KH2A 4WV1B 4H26A 4LLQA 3IDGB 3TWCH 1BM3H 1NCTA 3D2UA 3MTRA 4LRIA 5JMRA 2AGJL 3K1KC 2UUDK 1DN0B 3EJJX 4LRIC 4L3EE 2VDKH 2OMNA 3T0EB 4RGOL 4BFIB 5JW5A 5ETUB 4TOYH 2FD6H 3FQNB 3MXWH 4YHOH 5ISZD 3NIGE 5I0DA 5C8JB 5I16A 3MV8E 5C2BL 2VJXA 1P7QA 3HR5B 4JDTH 3OKMB 4EZMA 2VLKA 1WCBA 3OXRA 4WEUD 4R6UA 4MDIB 5DMYA 2DDQL 3PJSA 2A2QT 3LKRB 2B2XL 5FGBC 2C4XA 3MRIA 3HPJB 3GB7A 3WHXB 4PBWD 1JNNH 1QRNE 4FFZL 1DQJA 5JDSA 1MLCA 3VMNA 2V9TA 1HHGA 1KB9K 2X41A 4CVXB 3QNXB 5IV2A 5CHNA 1XF5B 4FFWD 3OR7B 4K94H 4YHPA 4FQIH 3RRQA 3U46A 2GK2A 1GPOH 1ZHBA 4ODXB 4OLVH 4HWZB 4K3DH 5DTFA 3EJYD 1OSPH 5GGVL 4R2GB 5TDNB 5KAQF 3ZDXE 5EBMA 3WS3A 1RUPL 4NUJB 4QGTA 2NYYD 1QSEE 2XPGB 5C6WH 4DEPB 3EYOB 3H9SB 1DBAL 4JPWL 5I18L 3UTQB 5INCB 3TBSA 1W0YT 3G6JB 5FYJH 2NY3B 3SGEH 1CGVA 3MRFB 4PP2A 4GAGL 4PRDA 3HS0A 4WFHE 3SOBL 1YN6B 4NZRH 5IMMA 3MJ9A 3VWKA 1BHGA 3THMH 4UUJB 2NPLX 3LEXA 2M8XA 2VXTH 4MNGA 5F7MC 3Q5TA 4NWTH 3VWKC 1UEMA 4FA8A 4IOIA 4EI6B 5MENB 4DGIH 4HWBL 4PJEF 2F54B 3RVUD 3E6FA 3QRGL 3ZKXB 2QSCH 2VDMH 4XNQA 3PDOA 2G9HA 1S9KC 5TH2B 4P9HL 1KIQA 4XPFH 3MCLH 4X7TA 4CRPA 4WW2F 4J3VA 4XHJC 1MVUB 1E6JH 5A16B 3D9AH 5JW4M 5ADOH 4XCYA 5T1LA 4OD1L 1X5GA 5EC2B 2EIBA 5DZOA 2BVQB 1NCAL 3MLXL 3EOAA 3AU1A 3I2CH 2B0SL 4LLAA 5GGSA 5IMOA 3PABA 1AR1C 4L4VB 5D9SB 1AGBB 2D3VA 5EZIL 4P2OA 4H20H 4JFXB 35C8L 3MRHB 4N9GB 4P2OC 1JZ6A 1HN1A 2Y5TA 3BZEA 4KQ4L 3RWDB 3QWOA 3ISWA 5E08H 4PTTB 4A6YH 3G5VA 1WAAE 4TUKH 1T66D 3UC0L 3S88H 5DK2B 3TZVB 3SQBA 5FO8A 4S1SL 3WFCH 4M7LL 2I5YH 5CILL 5D1QB 5IGXL 3EFFA 4PJGB 3JWOL 1TMCB 4NNXA 3QSKB 2MJWA 3BD5A 3SE8L 2XWTB 3NIDF 3EOBB 2XI9A 2A77H 4N8CL 3WFBL 1ZHLA 4NBYB 4LCUB 4JB9L 3EYFB 2KUTA 2NMSA 4X98B 1BPVA 2XXMB 4OZFA 4PJDB 1BZQK 1VDGA 4MXQD 1T83A 3FTGB 4Q2ZA 5E2VH 4OZHF 1JGVL 4UT9L 4LF3B 1MHCB 3KXFB 1C5BH 4WHTA 2HLAB 5F9JA 2Y7QB 1GOHA 4PS4H 2NZ9D 4H8WL 1BQSA 2KL6A 4EI5A 4JHBA 3ECBB 4E41A 2UWEF 4BZ1L 4EI5C 2B5IC 3IAGC 3TA3B 1HZHH 1WZMA 1NGYA 2XKUA 4GAJL 4DKFH 2LAGB 3I9GL 1KYOJ 3VFPB 1MY7A 2OQJB 2Q76A 1G7QA 1W0WB 4ZSOB 4WFEE 3W9DA 1X5YA 4JGUA 3H9HB 4QRRB 3MRKA 1U8PA 1YPZE 1B0WA 1MIEH 3ALXA 1PBYA 1G7LB 1MLBA 4P5TA 4I8DA 3GMPB 4P5TC 1NBYA 2OL3L 2QLVB 1GL4B 3QXAA 1HNGA 3RNKB 3SO3C 1JTPA 3QUZD 3SKNA 1MRDL 1T1WB 2E9JA 1AQDA 4Y4FA 2VMFA 4RAVB 4LLWA 5FUZH 3OL2A 5E1HB 4EUPB 1T3FA 1G0XA 1P9MC 4P48A 4Y4FC 2LQRA 4LPWA 1FH5L 1FNSL 5JIHA 1C5DB 4HJJL 1KEML 4PRHA 1KNOB 5GRJL 5DXWA 3DGGA 3KNBB 3P4OB 1WBYB 1I1YA 3FOMA 4LIQE 4JHAH 1YNTB 3CUPA 5TJWK 1X4XA 1A7PH 3VD9A 1T89A 3OB8A 1IAIL 1NPUA 1NCBL 1T89C 2DYPB 2X5PA 1GZPB 1F3JB 4HKXB 4OFDA 4MA3B 4NN5B 4GSDL 5JXED 1D6VH 4NQDB 1JZ7A 4NNYB 5KOMC 3MR9A 3H0TA 4TNWK 1IGTB 3KLDA 2BSTA 1MAKA 2XN9E 3SEPA 3VMPA 3PHOB 2EE3A 1T0PB 4MA1C 5I0ZA 2NNAB 4RRPG 4ETQB 3SQOH 5DEGA 2VDNL 5I1CH 5ACZA 1QFOA 3UPRA 1NCNA 4F37K 2GUOA 1AO7E 4EUPH 4XMKH 2YPLB 5CMAA 1B0RA 1HHHA 5I8EB 4Y4KA 4G3YH 4F80A 4GKZB 4NJAH 3BI9X 4Y4KC 1Z5LA 1YMHB 3PQYA 2C26A 4LKXB 3OPZH 2FJFB 2R56H 4MHHG 1RIVH 5CINH 2ADJB 1D7FA 3SE9L 4G9FD 5F3HA 2XZCH 1OSZA 4TSBH 1KENL 3BMVA 1XGRA 2FSEA 4HGWA 5DQJA 3MNVA 3O6LH 1Z9SA 2CDGA 1JZ5A 1P4BH 3QDGD 5IEKA 3VFGH 1OPGL 4PJXA 2VXSL 3AY4A 1IEBB 1OAZH 2R0WH 4ZO7A 5KSAB 3AY4C 4PJAF 4D8PB 2I9LA 5F88A 1MOEA 5FF6B 3BO8B 1MFNA 2ZUQC 3BUTA 5I9QB 1N4XH 3MV9E 3KJ6H 1JWSB 3EOTH 3UO1H 1UH3A 2BVOA 1PKOA 4NZDA 1J0JA 1U3YA 4G6MH 4KPHH 3WUWG 5F6HJ 2NR6C 4V1DD 3T8XB 2QADB 4N5EC 3WUZA 3OAUL 3KJ4B 3F65A 5D2NA 4PJCE 4X8JA 4PTUB 4KAQL 5D2NC 1D6EB 2ESVD 5MI0B 1VADB 4HIIB 1DP0A 4ZFOB 3ZZ1A 4YDVA 5F71A 1CR9H 4UAOB 1BVKA 4IRZL 4U6VH 4KK5D 3T0EE 3IFLH 2JJSA 2L0DA 1ZT7A 5LWYL 5F7FA 1S9VA 4F7TB 2JJSC 1ZSDA 4JZJB 2J1KA 3QG7L 1EIBA 3O6KL 1FL6A 3B5TA 5FIEA 4APQB 5GS3A 1JJUA 4OKDA 2VR5A 4DCQB 3MUZ1 4HBQA 3VGAB 4JY5L 2E7HA 3OZ9L 2X4OB 4QHLB 1R3IL 5CZXD 4EOWH 4F7PA 2WWKO 3D39B 1XT5A 4WEMB 4NO3B 1T5WA 2YA2A 3NPSB 2A73B 2R0LH 3KLAB 5L6YL 1OWRM 4FTVB 4DZ8A 3LD8C 5GISH 5EBWB 2BSRB 4U1KB 5B3JF 3EHBC 3W9EA 4OLZH 3WIHH 4PR5B 3I6GB 3VXRB 3D0LA 3GSOA 4H1LH 5E8NA 3DX6B 3H9SE 4WRLA 3JUZA 1YMMA 3V4PH 1MRCL 4Q0XL 1Q9WA 1JF1A 4WHYH 4FFYH 4CU6A 3G6JE 5ICXA 1UACL 4X6FA 1YEJH 4XNXL 1VESA 2P8LA 5HHMD 3QRFM 1U3HD 2AXFB 4O51B 3VXUB 2VQ1B 1K9TA 5K9QI 1KN4H 2HT4D 1C16B 4L8BB 4MJ5B 5DHYB 4U6YB 5C07D 1P4LA 4IDLA 2F54E 1HXYA 4M61B 5FO7A 2EDKA 2GJ6E 2IBZX 1R6VA 4U1LA 1IAMA 1HXMB 5CLTA 3SO5A 3U7WH 4EQ3A 1SVZA 1F5WA 3LQZB 5ISZB 4WNQB 4GKNB 4TNVK 4L1HA 4MZ3A 1Q38A 4JRYE 3ARRA 4WUKL 1S7UA 1M6OA 3IU3A 1XGQA 5HHOD 4QXUL 5TQ2H 3RWHB 2MKWA 1P7KB 1JPSH 1JHLH 1T04A 4XAWL 1BFVH 1I7RB 5EO1A 2V5RA 3MRLB 3SDYH 3GSUA 4J1UB 4WDIA 3AM8A 4U1JB 1M05A 4O2CA 1CLZL 3AM8C 3H7LA 4PJ5A 1DTUA 2VE6A 1IGJA 4BSWB 5DO2D 2WAHA 5EZJB 3GSNA 3UJIH 4GLRI 4ELKA 1UCTA 4OD3H 3MRDB 3N0PB 5JQ6H 3C5ZD 3BHBA 3PWJB 1RZIA 4PJGE 1F4XL 3MLUL 2KDGA 2R1WB 2V7HB 4Y2DA 5LJYH 1II4E 4Y88A 2C3VA 5IF0B 4Y2DC 2FZ3A 3VFUB 4K7FB 3KYNA 3WD5H 3VXOA 1AXSB 4RZCB 4WY7H 4FQLL 3BWAB 2I9TA 1FFOA 3IVKA 3NABL 5M95B 2WW8A 3SDAB 4GW4A 2YEZB 2YPVH 4LHUD 1J1OH 1KFAH 1CT8A 3BW9A 5D1ZA 4PV8A 3SDDA 5JA8B 2GAZA 5F9DC 1MI5A 3T65B 4TNWF 5D1ZC 1X6LA 4OT1H 3KXFE 3SDDC 1G6RA 1MHHB 4LU5L 1IC5H 4JN1H 4LEXL 5BJTB