4ISVB

Crystal structure of the fab fragment of 1c2, a monoclonal antibody specific for poly-glutamine
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
221
structure length
212
Chain Sequence
SIQLVQSGPELKKPGETVRISCKASGYSFTTYGMNWVKQAPGKGLKWMGWINTYSGVPTYADDFKGRFAFSLETSASTAYLQINILKNEDTATYFCARRRSYSNYFDYWGQGSTLTVSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1C2 FAB LIGHT CHAIN
publication title Linear and extended: a common polyglutamine conformation recognized by the three antibodies MW1, 1C2 and 3B5H10.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 47
structure length 212
sequence length 221
ec nomenclature
pdb deposition date 2013-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4isvB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4isvB02
2EKSB 3NFSH 2GAZA 1N3NB 4M1CD 1YEGL 4JEGB 4F15C 4Z7NF 2VXSL 2WLZA 4IJ3C 3RGVD 4KV5E 4FRWA 3G04A 4PB0H 3VD7A 2W92A 4HBCH 4R4BB 3K2MC 2ZG2A 1FNLA 5TPWH 3NZHL 1J5OL 1T0NA 1H3PL 2IPUG 4HWBH 5H35A 2MFNA 3LIZH 1S7QB 4OT1H 3Q6FB 3FB7A 3FO2A 3B9VA 1S5HA 1BBJB 3BMVA 1RZFH 3TBWB 1IFHH 1DBJL 3V4PH 4BK4A 5LQBH 3GMPB 2IH1B 5D7JD 4Q9CA 3STBA 5IFHH 5HPOA 3DXAD 1G7MB 4TNVK 4N0RA 2VDRL 5TDPB 4IOIA 5EN2A 1QRNA 4ZUWB 3VXSD 4MA8L 3L3GA 1NGXB 4K8RC 1KN2H 1UQSA 2BRRH 4L4JA 4RBPK 5FOJA 1JGEB 3SDAA 3IFPB 5HYQA 7FABH 3VMPA 2E27L 3BD5A 1CR9H 1MFDL 4Y4KC 2AJYL 2DIJA 4KAQL 2XACC 2O5ZH 3MRHB 5L8KB 4W81A 3I3EA 5D72H 1S8DB 5E5UB 3UTSD 5BO1H 3V6ZB 5DMIL 3ZT7A 2UV3A 2VXUH 3QWRD 4K7FA 4NWUH 4GRWF 3G6JA 4PR5B 2RCSL 3X3GH 4OZHE 2J6EL 2F58H 3VXPA 3CXDL 3HPJA 2VAJA 1IQDA 3KGRA 1L4IA 5F89B 4YZFF 5AZ2L 1ZSDA 2VQTA 4N0UA 3W0WB 1TTGA 2DQIL 3T0BA 3PNWA 4P2QB 3RVTC 3S8WA 2PO6B 1XGPA 2V2WA 4FQXD 3X13A 3H42L 2FYYA 3T09A 4RMRA 3NCYS 4JPIB 2QTEA 5EUOA 3B3IB 1OCWL 1HHJB 4C83A 1CICA 3JUZA 1D9KA 1FL6A 5DURB 4GG8A 5D93B 3PL6C 4MDJA 3V6OA 3BH9B 1GC1C 1T04B 2F5AH 2IALB 3QI9A 5DEZA 4OD1L 4UTBL 5DJXA 5FO9B 3QEQB 2MNUA 3N50A 2W9LA 4BH8A 3RDTB 4YHNB 3F7YB 3AM8C 2X70A 5L8LB 3EYUL 3WKML 3MOAH 3QJHB 2Q6WB 1F6LL 3PP4L 3QP3A 3MACL 2IFGA 3HE7B 2Z31B 4P5KB 3H7LA 5EBMA 5JOPD 3G5YB 1CDYA 5IR1B 4PJGB 2LVCA 2B5IB 1BD2E 4DFIA 1S7SB 5DJCB 3B9KB 4HAFA 5E8NA 2COQA 2WSKA 3SDXA 5K9KB 1YNKH 2DQCH 4LCYA 3C8HA 5IHUH 3UJJL 3DVGB 4AG4H 1AI1H 1UM5L 2VZOA 5GZOD 4RRPA 5HHMB 4L8SA 1A6VH 2DJUA 3A67H 2LFGA 5FB8B 3WSQL 1R0AL 3KYNA 5T1DH 3RVVD 3DX9B 3D39A 4JKLA 4D9RE 3PHQA 2VDPH 4ODHH 1A3RH 1YEDA 1OTUD 3WIFA 3LMJH 5FM8A 2DM4A 3PJSB 5L88L 1XCTB 3QO1B 1UYWH 2DL9A 2Z35A 2FHFA 4YEEA 4YFLI 3AU1B 1DBAL 1UKSA 3CH1A 3D18B 1QRND 3ZSTA 4NWTH 3KXFE 3WEXA 3EOTL 1T66D 5KOVC 4YBLC 4CMMA 3OJDA 3RZCC 3SDAD 1G0YR 3VFNB 3QZWA 5KAQG 1F3JA 4NUJA 2XQYG 1YN6A 4QT5B 1U8QA 3FOLB 5I6XB 3P2TA 1O7VA 4FQLL 3UAJD 3I85A 4PV9A 5DQ9A 2EECA 3DECA 3NIGF 2HJFA 2VN4A 4H8WH 4JAMB 1S3KH 1NDMB 2P7TA 4KQ3H 1EO5A 4DVBA 5GGQL 5AWNL 1J10A 4JN2B 5GHWL 4Z7VF 4RDQF 2GITA 4HIJB 1INDL 2HT2D 1JFQH 3BO8A 3QUKA 5DZNA 4YWGH 4DQOH 1RULH 2EYRA 2ZUYA 2J8UB 5I75B 3OGCB 3IF1A 5F21B 3IDGB 5AEAA 2XWJA 4HWZB 2XWTB 3S5LA 3VI3F 1EHXA 1UXSA 1J05B 4V1DA 3O3UN 5GGVY 4ELME 2FX7L 1ETZA 3LDBB 5GGUA 4C56A 4I5BA 5HHVH 3ZDYE 4DGVH 2VDKH 3VFMB 3VH8G 5J6HA 5C0JB 2UWEF 2X4NB 4F8QA 5IMOA 4M7ZC 4TYUA 1CICD 5EUKA 1D9KD 3QQ4A 3H9YA 3MRRA 1F97A 3OV6A 3VE0B 3BPLB 5FKAB 3TYGH 1HH9A 2CLRA 5E56A 3DV4B 3QI9D 1I1FB 2Y07L 1DN2A 4P23C 4FQ1L 4PRHE 4NNXA 4WV1C 5CEZH 3SBWA 3QIWA 3QUXB 4XPFH 4Y7MA 1LO3L 2JE8A 3E0GA 2AJZA 3AAZB 3WFZA 2D4DA 5KVDL 2BSRA 4LNVA 4LSVL 3RVWC 3NIFE 5JA9A 2YA2A 2PYFA 2ICCA 1MCPH 3SY0A 2Y6SC 3WJJA 2AS5M 5BXFA 1DN0B 1LO2H 2ZJSL 3FO0H 2BSSB 1YYLL 1KT2B 3NAAL 1CU4H 1VEPA 4Y88A 3MREA 1FG9C 2R1WA 4F15B 5TDNB 1U0QA 4NHUB 1RVFH 5GS1A 2VC2L 4PLKD 4LLMA 4OQTA 4JKPL 3D39D 2EDQA 5K59F 1CGWA 4LHUG 1E27B 3VGAB 1N4XL 4OI8A 3OKEB 2B2XL 2ERJC 1V7NH 3U9UA 3ZKMC 3LKNA 4WW2C 1FIEA 1CLOL 1M7DA 1WUNT 3OKOB 4XPGH 4M8QA 1N5AB 4PJXB 5MERA 3O11A 3BDYH 4DAGL 3RNQB 3P11L 1BOGB 4MQTB 1NAKL 5DZLA 3QAZB 1IM3A 1AE6L 3RWGB 1BVLB 3DBXA 1NMAL 3P4NB 3EYOA 5IESL 3DTXA 3LQAH 4X80L 3VCLA 1ZA3B 4NRZA 1OP3K 5IV2A 1FFNB 4XZUA 4YGAB 2NW2A 3H3PL 5FGRA 4TNVF 3BDBA 1CDJA 1G7HA 1MJJA 4OZHA 1KXVC 5JXEA 4IRJB 3OB0H 3L3DB 2W0PA 3QEUB 4KRLB 3GHEH 1TZHA 3CH8A 4F7PA 1K4DB 3MV7E 1E28A 1H3XA 2QQLL 3FQWB 3KVQA 1A2YA 1XH3A 2H2PC 4HWBA 1Q9WA 3C6LA 4U1LA 5GSVA 1JUFB 2AK4E 1YZZA 2NYYD 1UH3A 5DFVD 4RSVA 4U1NA 4HMDA 1RIUL 2G2RB 1OGAB 3STZB 5CILL 5EU5B 2EDEA 2NY0C 2V2TB 3HAEB 2BOBB 1UCBL 3PGCA 4V1DD 4Q9QH 4LCWE 5FYLL 4NQSA 4C56D 4LOUC 4M6NL 1E4XH 1JF1B 2ATPB 4HLJA 3HR6A 1MRFL 2PKDA 3KDMB 3KYMA 1DJSA 2JB6A 5D2LB 3HUJF 2VXVH 3DYOA 3B2UD 3MYJB 1Q38A 4UMGA 2XYCA 4X7TA 2XN9B 1MHPL 3QXAB 3RL1B 5KJRL 3QNYA 4RGNE 1QNZH 4YXKL 4ZOCA 4JDVB 5JW4R 1EAJA 1JF5A 4LCUB 3UTOA 3P9MB 3WDJA 2A6KB 3FQNA 1Q94A 3R0MA 3QIWD 4G6MH 5E94A 4DN4L 3LN5B 4OUUB 3OKDB 5I19H 2P5EB 3CIQA 1T0MB 1SY6H 5DJ6A 1UM4H 3UCRA 2HT3C 2YMXL 1Q72L 3CD4A 2EIZA 1MI5B 3OKYA 4J6RL 4MXQD 1EFQA 4HKJB 3K74B 4BH7B 3NCEB 3F8UB 4CVXA 1LE9B 4X9IA 1HKFA 5I73B 2W60B 4UV7L 3KPQA 4XP6H 4P2RE 5IKCA 4OCRH 1EA9C 5KG9A 2VERN 5L9DH 3MNZA 3ZTJG 3GI8L 3H6JA 4KI5E 1YPZF 3HRZA 5CP7A 4AIOA 15C8L 5ALCL 3QWQB 4XI5C 3CMOH 4YC2B 3BUYB 1NFDE 4YHIB 2YXFA 3BSZH 3DX8A 4KKLD 3SKNA 4HC1H 1NC2A 5EBGA 2QSVA 4YBHA 5K9OB 2CLZA 3GIVB 4Y1AB 3HCVB 1I8MB 3IDNB 2JF1A 1YEKL 5IBLC 3K80A 1RIHH 3TJHC 4NNPL 1MF2H 3HMXA 3I75B 4YDVA 3CGTA 1XR9A 1OSZB 4I3SL 4JDTH 4LSRH 5I1KH 3KS0J 4H26B 2JJTA 1JNNH 2ICWJ 5JXED 2DQHL 5F8RC 5DD6A 3S7GA 3ZDXE 3FB6A 4PJIE 2VABB 3B9AA 1U3YA 1AGDA 2C7UB 3NCFB 1TDQA 5KSBB 5I66A 4OIBA 3OJMB 5E4EB 1BVKA 1KF9B 3IDXH 3REVA 5D7IE 1M4KA 4ELMA 5H2BA 3GDBA 5D71L 1NQBA 3C6LD 1BQUA 2K7QA 2KBGA 1EERB 2IBGA 2WUBH 5MI0C 1CLCA 3T1WA 4GKNB 1MEXL 4DKAA 4CVUA 3G6DH 4GXVL 1BIHA 3UX9B 3KPTA 3F58H 1U93A 5FAAA 4JPWH 3ZKSD 4H1LB 5B39G 3QXVA 2PW2B 4JO3L 3G6JF 5C6TL 2V5YA 3QB7C 3CUPB 3SKMB 3HZMB 4RQQA 1AXTH 3X12B 25C8L 2WINA 4KUZH 4YHYC 1I8IB 1KJ3H 1T89C 3IJSB 3NTCL 3QH3A 3ARQA 4FMFA 3EYVB 1OARH 3GKZA 5HHPB 2EXYC 3ZLQC 1CXEA 2CGRH 4YBQD 4Y4FC 4CDGC 3QFDB 1F4HA 3GM8A 3WCYA 5L6YH 1CFQB 5HPMB 1OPGL 5ETUA 4KJQC 4CU7A 2VB5A 3PWNA 4IRZH 1IGTA 5IVXE 3QDAA 1VSCA 3LZFH 5IWLC 3NOIA 1L6ZA 2YSSB 1DEDA 4KHTL 4P23B 1M7IA 4D9RD 3QHFL 3O3DA 3STLB 4DEPB 1D6EA 3HRPA 2ZSVA 2NXZB 4NQTA 2ZP0T 4IIQC 4XNQA 1JWSA 3MXVH 5GQBA 4QXGL 3UZVB 1P9MA 3JUYA 5J1TC 3S36X 5AZEL 5CZVL 2VLJA 3CFJB 3B83A 1ZTXL 3BHBA 4NQEE 4X4XB 4HV8B 1I9JH 3OZ9H 4IHOA 5F6IC 3FO1A 1F13A 1NC2D 2CXGA 4L8BB 4LKCB 4DVRL 3O2VH 1CXLA 4JRXA 4R3SA 1HI6B 1JNLL 3TPKA 1BFSA 2N4IA 1AR1C 3D3VB 5F6HI 4WTWA 1AQKL 3CFDA 4MA3B 4QRRE 2AXGB 2VR9A 4WW2B 2YK1H 3MRMB 4M4RA 3HZYB 4JKWA 4UV4H 5T33H 4OKDA 2UZIL 3WD5H 5DQDH 1T1XA 2PYEA 1P4BL 3FFCB 4PS4H 5ADPH 3RY6C 4DKEH 1YY8A 3BESR 3O6ML 4I77L 1TTUA 2CR3A 4DCQB 2OZ4L 4ZUUB 4PRAA 1C7TA 4EI6B 3VG0H 4L9LC 1D5MB 1A6WL 3UJIL 2DI7A 3IDYB 3H7BB 4KRPD 4LPVA 4HIEA 3EZ8A 3L7FA 4W4OC 2OCFD 4X5WB 5HHXL 1VADA 1JF6A 4F7EA 4JFOB 2CK0H 1IRAY 1XGYH 1T5XA 2QBWA 2J4WL 2OMNA 2YUVA 2CIIA 3AB0C 1IVLA 4EXPX 3CFBA 1WLHA 1MJ7L 4NM8H 4Y5YB 3GBNH 3ARSA 4F7MB 3O2DL 1TJIL 3IKKA 4LPYA 4PUBL 1WZ1H 5CS7A 3F65A 4WFGD 2NY0B 3TC9A 1KYOK 5DVKA 5DJ2B 2X09A 3WV0A 2GJ6E 4ZO8A 4O2EA 4HJJL 2L4OA 4YDKH 1MCSA 3JWDL 4OSUH 3NZ8A 3ES6A 5B3JE 5ICYA 1BFOB 3T2OA 1RFDH 3TGXA 3SE8H 1MAMH 3T8XB 2ZG1A 3MLWL 4JO2L 4P59H 5IBTH 5DJAA 1CXKA 1IAOB 3JWOL 4J4PA 4MNGE 4E9LA 4KTEL 1MRDH 3FZUC 2A1WH 1DFBH 5IFJA 1MH5A 4LARL 2YUZA 1PG7W 3MRDB 5D1XB 1BQHG 3DVFA 5F9OH 4XGZA 2NY4C 4FQJH 4OFIA 4X98B 2R9HD 4KV5F 1ZHBB 4OCSL 1J1OH 1V8HA 1MOEA 1UB6A 4HS6B 4Z7WA 5HYJA 3PWLA 4POUB 2DS4A 1ZT4A 1QR1B 1OAUL 1KCSH 3RWJA 3O3AA 3RPIB 3AS1A 3VD3A 1J0JA 1KB5H 4I48A 3RU8L 1WZMA 4OM0L 1LO0H 1HE7A 1QHOA 3C6SB 3S96B 4QYOB 5DD3L 4G6KH 1U2HA 5HYSA 2VLJD 5FV2A 4EOWH 1I1AB 4Z95H 1EEZA 1IKFH 2ZNWA 3TA3C 1AC6A 4ZAKC 3PQYA 1MFAL 4S1RH 3D69B 5GGVL 3OGOE 4HMEA 4JRXD 4QOKB 1AGCB 1W0VB 2BNQE 4PP2A 1WV7T 4R8WH 3QQ9C 3EO1B 4TPRL 4DN3H 4G80A 5I1HL 3KJ4C 5CEZD 1G7JA 2CIKA 3OXRB 3EYFB 5D7IA 5T1LA 4GXUM 5EORH 2XRAH 3S37H 4QEGA 1ZK9A 2H3NB 4YHOH 2PYED 1FZOB 5JDSB 1CGTA 4NQDE 5CSBA 5EWIL 5DK2B 2I9TB 3KYKL 1C08B 2Q86B 1JGDB 5C09E 5F7NC 2OXHA 3ULUL 1T03H 3G5VA 2Y5TA 3LS4H 2IQ9H 4PRNB 1ZLUH 1MVUA 1EJOH 3JTTB 4Y8DC 1ES0A 1R3LB 1YEHH 4WFHD 1OOAA 3BEVB 1YMMA 4YXLH 1T1YB 1AKJA 1T5WA 2HFTA 1JHLL 3BWAA 4PFEA 1A47A 4WWKA 5DUPH 4LQFH 3GSVA 3FCTA 4HC1A 5DI8B 3OPZH 5F1IA 1CFNB 4K94H 4A6YH 5MP6L 3WXVH 2X4OB 5J13C 3W9DB 1ZGLM 3OX8B 3U4EA 3WNOA 5I1IH 1MCWM 4ZG1A 2P5WE 5IHZB 2FWOA 2QL1A 4J1UA 4MB4A 1OW0C 3QXDA 4Y16A 3KWWA 4R4NC 1CE6A 2X6MA 3EOBA 1ZWIB 5ITBH 4BK5A 1IAIM 1L0YA 5D5MA 3T0DA 4PP1C 3DMMC 3MGOB 5F88A 2VITA 4Q2ZB 1GL4B 2OR9L 4LSTL 3MRFB 5F96L 4J4PD 6FABL 1LK3L 3K2UH 5J3HC 3U6RB 4F2MA 2X5PA 4QF1B 4KI5D 5TGBB 4DGYH 2F53B 5E0QA 3QWOA 4E41A 1SVCP 2PXYB 2A6JB 2ICES 4OD2B 4D0CA 2RIKA 2Z4QB 1DQDL 2Q1EA 3JVGC 4WI6A 3QXTA 5HYJD 3FT4A 2GK2A 4NKDB 1NCAL 4JJ5B 1UWEH 5ID1A 1BM3H 4F58H 5IK3B 5F9AC 1NGPH 4UT6H 5GGTH 4AENB 3O45B 3IFLL 1CLYH 4UTAL 2BY2A 4QRRA 3F62A 2E7CA 3JV4A 1RSFA 1PZ5A 3GO1L 3QPXH 4EUPH 3I84A 4NZDA 4XVJL 3NPSC 5DXWA 5M7QA 1T7VA 3PQYD 4WTZA 1EEYA 1YNLL 3AMLA 1H3UA 4NJAL 4ZS7L 5LBSH 1AO7E 2YD1A 2EICA 5HJ3A 2PTTA 1N0XH 4WDIA 1FFOB 2HFEA 1MFBH 5INCA 4OLUL 1NL0H 5CMAB 3MRGB 4ZXBA 5JHDE 5T1LD 4MCYA 2WBJC 1ZHKA 3MODL 5E4IA 1EGJL 4L3CA 2HKFH 1DQQA 3L9RB 3MNWA 4ZSOB 5KSAB 3D25B 1JTPA 3U2SA 3RL2A 4JPVL 4OIIL 2OI9B 3BZFB 4PJAF 5HHQA 2AP2A 3VFRB 5HD8C 3BZEB 5DD5H 5GSRB 4DW2L 1F00I 1DANT 2VDQH 2VLRA 3B5HA 1L7IH 5CINH 3GK8H 1LO5B 4LAQL 3MRBA 4UQ3A 4BELD 4XMLL 5IW3A 2BDNH 1G7IA 5CGYC 1JWUA 1OAZL 3SDCA 1KCRH 1R5VA 3OAUH 4M7KL 4MNQE 1YMMD 4XCFL 5FA3B 4XNMB 1AKJD 4OGXH 4X4ME 4PGZA 1S7UB 2GSGB 3X17A 4WWKD 4NYLB 4B7IA 1MHCA 3PGDA 3X11A 4L1DA 3H0TB 2PR4H 4NN7C 2D4FA 3N85H 3TT3H 3CX5K 1YJDC 1VFAA 4JFFE 1G9NH 4MNGA 1JWMA 1K8DA 3ZDYF 4HZAA 4Y16D 3O6KL 5I1EL 3CMGA 2YD8A 2HN7A 4HUUA 2R4SH 4MD5B 3CCHB 2Q76A 4OZFG 4Y8AA 5KVFL 4PJ9C 4U1IB 1YNTB 2P43B 4PGBB 3Q6GL 3O0RL 5T1MA 1CFSB 3QIUA 3EHBC 1T1WB 4GRLC 1K6QH 1WJ3A 4JVUA 1F4YL 2D03H 3LKRB 4K55A 1BREA 2I07A 1F4WH 4OLEA 5DGRA 4IOFC 4ENED 1YN7B 2HKHH 4IM8A 4HBQA 3NIFF 5B4MD 4Z5RB 1ZHLB 2ZCKH 3ULSB 3AROA 4QO1A 1U8PA 2UY7A 5FUCE 2QQQA 4E41D 4M7JL 3HB3D 3FKUS 1U8LB 5GRUL 5C0DA 3Q3GB 4HSQA 2OX5A 3K8KA 1YYML 3D9AH 4U6XA 2OJZH 5C07A 5T3XE 4HXAH 3ARGC 5DMGC 4PJCA 4OJFH 4QRRD 2KUTA 4OV5B 5CLTA 4G8FA 4LIQH 1DCLA 3DSNA 3T3ME 2JKXA 5IW1A 1CG9A 3H3BC 4K3HA 4RFNC 3UO1L 4NM4L 5DK0A 4PRIB 4LF3B 5GZNC 4TVPL 1S9VA 2MKWA 5E6IA 3NBNA 1HXMA 5GIRB 2J7LA 5D2NB 1S9WB 4QXUH 4ZUSA 4ORGB 1WQVT 5EA0L 5C09A 2ADFL 4XVTL 2EC9T 4ZXBD 1XIWB 4U7SA 2DL2A 2NY1D 4G8EB 1NMBL 1X44A 4LHJB 3UBXA 4FQQB 1FIGH 2E7MA 4I9WE 2CRYA 4B50A 4RZCB 4R7NA 2BOCA 1CGUA 3ARZA 1CD0A 3GSQA 4K23L 3I3BA 3QIBA 3FAWA 3BOVA 2PCPA 4X9FA 1JPFB 2R1XB 5IM7B 3IDIA 3FJTA 2YPVL 1RUPH 4HUNB 5BMFH 2VLRD 2BX5A 1P7HL 1KN4L 5EBLB 3MRJB 3PIQA 4ODSL 1KB5A 4EI5B 2HG5A 5ENWA 3SDCD 2P5WA 1ONQA 2DLFL 1SHMA 2J5LB 32C2A 5DC4B 4M61B 5FECA 2CDGB 4M1DH 3P73A 4QRQA 2E9WA 1FV1A 2R2BA 4E5XA 1TJGL 3MV8A 4QXTB 4WJ5B 4KTDH 2X1WL 3WJLC 1BBDL 5E2WL 5FHAL 4XRCB 3TVMA 4ODVL 1OAQH 4ZQKB 4K2UH 4M6OL 4R4FH 1I3UA 2AXFB 4U3CA 1S9KC 3CK0H 5ANMB 3ZYOA 4F8TA 4JPKL 4XVSL 1V3JA 3BIAX 2IPUK 3NCJH 3L3KA 5CUSL 4F7CB 2A9NH 5BRZE 1SJVA 2Z91B 4OAWA 3PABA 3QIUD 4X6EA 1NSNL 4NGHH 1K3IA 1AD0A 3D2UA 1AFVH 1JHTA 2FJGB 1I1YA 2VQUA 3GJFK 4PLNC 4OZIA 4GLRH 1RZKL 2ATKA 3FO9A 2XIDA 3JWNC 4HWNA 5HHOE 5D4QA 2FIKA 2GUOA 1V3MA 5FO8B 5I1CH 3DMMB 3MLZL 2R1YA 1FFPA 1N59A 2CRMA 1JZ4A 2R2EB 2ADGA 2BERA 4LBEA 4MSWB 3QHZL 1OF2B 2VWEC 1DQLL 5I1JH 2JB5H 2DQDL 4KVCL 4A6YA 5C07D 3IVKA 2YEZB 3MRCA 5JOFB 2IFFH 4GSDL 1DVFA 1UWXH 4PJ5A 5E2UL 1VEOA 1A6PA 1JBJA 3VRIA 3VI4F 1AGFA 1NFDF 2BVOA 2DICA 3UEZA 1BEYH 1GGCH 4GAJL 1U91B 1KCUL 4JZJA 4RFOH 5FUOH 2KQMA 1W8NA 3LQZA 3PWPE 5E6ID 3DRTB 4P46C 4J3SA 4GRWB 5C09D 3BW9A 4YO0B 4P5MB 4HDIA 5C0CB 1EH9A 3NPSB 4WFEE 4D3CL 3PDDA 3OBAA 5B8CC 5F9WC 4G6AC 4EXKA 3WS6A 1FL3B 1YY9D 2EKSA 1N3NA 2BVEA 2WZPD 3PWVB 5EOTB 1Z2KA 2MWCA 1FLTX 2X1QA 1RUMH 5F3BB 1KV3A 2GTWB 4KJYA 3ZDXF 4X6BB 2UZYB 3QIBD 3SE4C 3BD3A 3WFHB 4PJIF 4YFLF 2P24B 3TBSB 3WNKA 2WNGA 1KOAA 4R4BA 2VXQL 5T3ZE 3P30H 5CSGA 3T2NL 3BVNB 3CSYB 5GGTA 1MY7A 4K8RH 5D7IF 4Y2DC 1PYWA 1GGIH 2F54E 1J7VR 1KACB 1I7UA 2IAMB 5SV4A 4PG2A 2QSCL 2P5WD 4NHCL 3O3EA 4I4WB 3LAFA 3BD4A 3GBLA 1ZMYA 3Q6FA 4EUPA 4TRPH 1QO3B 3BN9D 3SJVE 3LB6D 4OLVL 2X9YA 4PREA 3MBEB 5KVGL 3QRFM 3MV8D 2Y72A 2IH1A 2A6IB 4U0RB 1SMOA 3IDMA 3N1FC 3C5JB 4KROD 3HAEH 5HGBB 4GS7C 4R0LB 4U7MA 2F8OA 3TVMD 1AGEB 1G7MA 2DQJH 4JHWH 4J3OC 3V6FA 2NXYC 2W0LA 2VDLH 5K93A 2VAAA 2FO1A 2H6PB 4ZD3H 1V5JA 1BZQK 1MREH 4GAGH 3K8MA 4P5TC 2FO4B 3L5XH 3H9HA 4JFQB 1B6DA 5EZIL 4NQCB 1UZ8A 3IFPA 4Y2OA 3DSFL 1KELH 3ZTNL 3RWHA 1QFWL 3L6FA 1ERNA 1GGBL 2EYTB 3NA9H 4MA1C 3UMTA 3FRUB 1NGYB 3OTTA 1IZKA 1Z0MA 4B0MM 2ED8A 4XP1H 3AY4A 2RHEA 3D2UD 1AP2B 5EBWB 3VFWB 1NGQH 4IMLB 4Z77A 2VMFA 5F1NB 1S8DA 1OP9A 4LQ1A 4WO4C 5DWUL 3RUGB 1NLDL 4POZD 3VXQB 4CNIB 3PGFL 4KQ4H 5I8OL 5IVXF 3BGAA 3ARBB 2EH7L 1KC5H 1PG7L 4DZ8B 5HVFB 4KXZI 3L1OH 1GC1H 2YRPA 3NH7L 3MR9B 3EYSL 2VKXA 4FQCH 5F1SA 5AYQA 5DJ8A 2P44B 3EJYC 5F89A 4XVUC 4JFDE 4LASL 4WEBH 1TVHB 1IC7L 4Z76A 3IU4L 1PY4A 3ALPA 3EJZD 1DVFD 2XQYK 3LEVL 2NY2B 4PJ5D 4P2QA 4U3XA 1IEAB 2LAAA 3FQUA 4JPIA 3S34L 1YEGH 3B3IA 3HE6A 1QBLL 2VTFA 3BH9A 2OS7A 3PHSA 1T04A 2B1HH 5FK9B 5FO9A 3O6FB 3QEQA 1WISA 2HVJB 3RVXC 1H8NA 3F7YA 1F45A 2DJ4A 1WVZA 5EOQL 3NZHH 4TUJB 1J5OH 1NH6A 3SDYH 4PD4K 3GSRA 4M62H 3TLRA 3NMEA 3HE7A 2RGSA 2Z31A 4P5KA 2WMPA 2X4QB 3I6KB 1DSFH 1QFUL 3I2CL 4Y5VC 3IJHA 1TJHL 4FZEL 1E4WH 1DBJH 5FA4B 5BW7A 5IR1A 4PJGA 1ACZA 1BX2B 4XX1G 4U1KB 1S7SA 5DJCA 1MQKL 5K9KA 1U8NA 4ELKB 1OGTB 4MVBD 1WK0A 2G75A 5D7KD 2AJUL 2NY5L 4MMZC 1TXKA 4LAJH 4OFYA 3O2WL 5JIKA 1HINL 1WC7B 2VISB 3D87B 3M1BB 4L4VB 5I76A 2FGWL 1ZE3C 4MA8H 4E0RA 3LD8B 3AREB 2J88L 3ULVE 1MWAL 1MFDH 4YFEA 5EU4A 5ILTL 2AJYH 4KAQH 5CKGA 2FBJH 1WEJL 3PJSA 5I74C 2EXWD 1S78C 1XCTA 5ITFA 3QO1A 3RTQC 5KW9H 2KQNA 4OQ1A 5KSUB 2VR4A 5DMIH 4LNRB 4X83A 1ZLVH 3VFTA 3AU1A 4MDIB 1LGVA 5F8QC 4XWOC 1MNUH 1NPUA 3IB4A 1RUAH 1OWWA 3VFNA 2FECI 3CXDH 4RFEB 3NFNB 3W5NA 4NN6B 1QPXA 2EDNA 1UJ3C 4OQTL 5AZ2H 4QT5A 3S3PA 3TN0C 5KSVA 2ZKHL 5C2BL 5FGCE 2Z8WC 2GKIA 5EC2A 5T3XD 1K2DB 3ECBB 3UYRL 1DLHB 2HH0L 1GIGH 3H9ZA 2HTKC 2H32H 1KB9J 2VQ1B 4HIJA 1KFAL 5GS3A 2X4RB 3BE1H 5DMKA 3U0TB 4NFDA 4P2OA 1S5IL 4NZTH 2X4TB 4L4TE 3V95A 1JYXA 4IOSD 3MTRA 3NFSL 1BP3B 2EEAA 2B4CC 4OD1H 4UTBH 1J05A 4APQA 3RNKB 1HQRB 4OBSA 4P2QD 1R3JA 3HZVB 3EYUH 3VFMA 4LSUH 4PLJD 5E2TH 5C0JA 4I9WD 2BFVH 1FNEB 3ZHDA 3HE6D 2EZ0C 3DXAB 3QDGE 3OAYK 5TPWL 3MNVA 1N6UA 4FOMA 1KTDB 3GMOB 3WFEH 4HWBL 2CKNA 3L3IB 1NCWL 4UT9H 1TENA 5MEQB 1WIOA 3LIZL 3DV4A 4O5LL 3KJ6H 3ROLA 2NY3C 3QEQD 4RA3A 3QEGL 1NBYB 1RZFL 3UJJH 2F54A 1IFHL 3V4PL 35C8L 4PD4J 5LQBL 4WNQA 1M71A 3V5DB 4OCMC 1MLBB 1P4LB 2NTFB 4HJ0C 5AAMA 5IFHL 3HE7D 2Z31D 4OF6A 3BQUC 1KJMA 1DN0A 3SJVA 2DWEB 3GSNB 3EKCA 2OTPA 4HIIB 1X9QA 5ABDE 4GQPH 3TCXA 1I9EA 4CMHC 1WT5C 1T3FB 5L88H 1KN2L 2BRRL 5D6DC 4I18C 1C5BH 4NHUA 3P0YL 5C0EA 1CR9L 3HUJB 3L7EB 4FQIH 1DBAH 4OFYD 1G6RB 3M45A 4JQVC 5DRWB 3VFSB 5F9JA 5ESAB 3T77B 5BO1L 3OKEA 2VXUL 4Y2DB 1XMWA 3KLAB 4PJ8C 4MJ5A 4NWUL 2G60H 2AEWA 3T4YA 4GRMB 2FHBA 1HSBB 3S98A 3ROOA 2ZUQC 4EN3C 3RNQA 1BOGA 2IH3A 3RWGA 5GGQH 5AWNH 3ZMRA 2X2YA 4MJIE 5KVEL 2R69H 2LV4A 4AM0B 1INDH 4X9GA 4G8IB 4HCRA 3L3DA 5CD3A 2MMXA 3JV5A 4LMQE 5A2IH 2GAZB 1YPZB 4P5TB 3MBXH 5GRVK 3TBVB 1K4DA 4U4BA 5IROA 3NIDE 1T22A 3FQWA 1AXSB 3G04B 1JTOA 4OZGA 4Y4KA 1DBMH 2F5AL 3DYPA 4JZNB 3MSPA 2VZ3A 5F7EH 4HZLB 3OKKB 1INQA 4LFHD 3HMXL 4P2OD 3ZKXB 1HYRC 1WCBA 3MOAL 1T0NB 1OGAA 2G2RA 5E1AA 3D6GA 2W1NA 1SJXA 1EAPA 3HAEA 3C5SB 2BOBA 1JNJA 2Y07H 4APQD 1I3VA 3FO2B 1S5HB 1FRGH 1BJ1J 3QR2A 4M1GH 4WFED 4M4PA 1OVZA 4R6UA 5KAQF 3KDMA 1JRHL 1YNKL 2DDQH 5IHUL 3QDME 4AG4L 1AI1L 3QXAA 1A6VL 3A67L 2VYRE 3HFML 4U1JB 4IOIB 2P42B 4JDVA 5EN2B 1YYLH 1QRNB 1BJ8A 3NAAH 4LCUA 1M6OB 1MCFA 4CW1A 2A6KA 2Z0BA 3L3GB 5T3ZD 1I7TB 3KPRE 2HWZH 3SDAB 4V2BA 4OUUA 2F54D 3OKDA 3MRLA 3PL6A 3LMJL 2VC2H 1T0MA 4R90H 3LRGA 3MROB 1OTTC 4JANB 4JKPH 3R1GL 3S9DB 2K1MA 1YECH 3SJVD 1AHWC 1MI5A 3BPNC 5CJQH 4YNYA 4BH7A 5KS9F 1CLOH 4NWTL 3G6JB 2XKSA 2W60A 4ODTH 3BKJL 4X6CF 5EIVA 3MLPA 5C92A 4DAGH 3ALWA 3CFEB 1NUGA 5TF0A 1NAKH 4LLQB 4LU5L 3C2AH 1AE6H 1JPST 5IESH 1NMAH 4X80H 3V9FA 3BUYA 3MJ8B 4N0UB 4EQ3A 2EDFA 4PJEE 1WZLA 4XHJD 4KQ3L 2C3VB 3X14B 2MOVA 3ESVF 4J23A 2IBZX 2CDEB 1XGPB 2V2WB 3S37X 4LCIL 3GIVA 4DQOL 4C83B 1KGCD 1CICB 3C09B 3ARDC 1OSZA 4GG8B 4MDJB 3VU2A 3QI9B 1KEGL 1XF4B 5DJXB 4H26A 4WUUA 5TH2A 4MZ3A 5HYFA 5IB5A 1B4JH 2Y23A 1URLA 3R4DA 5HHVL 3VXME 2AVGA 1RIUH 5HVHB 1H0DB 4KH2A 4K8RD 4TTDC 4WHTB 1IC5H 3RZCA 4CN4A 4UILH 3SGKC 3LPFA 1AQDA 4CJ1A 5EBMB 4Y4KD 4LHQB 4M6NH 3ARYA 1RJLB 2BVTA 3TN0B 1AR2A 3SDXB 5E8NB 5CEZL 1JI1A 4GKNA 1LK2A 4XPFL 3F12A 5DFWH 1RV6X 4L8SB 1I3GH 1OGAD 2EE3A 1MCPL 4KJPC 1PEWA 3D39B 4BSJA 2PW2A 1LO2L 4FFYL 3PHQB 3FO0L 3CUPA 3VFOA 1I1RA 3SKMA 5LG1A 5DO2C 4JHBA 3T3MF 3JTSB 3T65A 4LSPL 1CU4L 3K1DA 3U4AA 1DQTA 4FTVB 2YMXH 1Q72H 1F90L 1EO7A 1A1MA 1RVFL 2VLKE 1CIUA 2ED7A 5EOCH 1SM3L 3RVTD 3RWDA 3CH1B 3QFDA 5C9JA 2M1KA 4TSCL 4UV7H 4CMMB 4OI7A 3OJDB 1AC0A 1V7NL 3IRZA 1KLGB 3BJLA 4ONFL 4M5ZL 4WGVB 4NNYA 4XPGL 3PL6D 1F3JB 4NUJB 3T0VA 1TVBA 2K7PA 3BDYL 1SQ2N 1YN6B 1X6LA 1U8QB 2H32A 5E8DL 4P23A 1I9RH 5DQ9B 4O4YH 4X6DE 1MI5D 4PRDB 4WV1A 1JZ3A 5GJTH 2HJFB 5TFSL 2DM3A 3LQAL 1EO8H 4Z7QE 2LTQC 1RZGB 2GITB 4GQ9H 2I5YH 3BO8B 3QUKB 3RBGA 3S4SA 1EX0A 3BQUB 5SWZB 2EYRB 4NNPH 4B41A 3SO3B 3IF1B 4I3SH 3BGFB 2XWJB 3NCMA 4MJIA 3S5LB 4MWFA 1UXSB 4X4XA 2GY5A 4M8VA 4HV8A 1NCBL 3N0PB 3REWA 2RJMA 2XNAA 4XNZC 2DQHH 5AAWA 5GGUB 3MO1A 4C56B 4I5BB 1DQMH 1HI6A 2DKSA 3RVUC 5J6HB 3BP5B 1GOFA 4MA3A 2NR6C 3K81A 2AXGA 5EUKB 1ITBB 3QQ4B 2XG4A 3MRRB 2V7NB 3QULA 4LLDB 4WW2A 3HZYA 5D71H 2CMRH 1HH9B 4XBEL 3FFCA 4WUUD 1IAII 4AEEA 4NNXB 4EN3B 4Q9QL 1A6ZB 1KIQB 4JDZA 3MZTA 1MEXH 1E4XL 2AJZB 3TO2B 2V5MA 2BSRB 4FQPA 2NLJA 1MWAB 2PYFB 4EBQH 2VXVL 3SY0B 3RRQA 1FNHA 3RZCD 4JO3H 4PGCB 3H7BA 3E6HB 25C8H 1FNSL 3CVHB 3MREB 2WP3O 4X5WA 1MQ8A 1WAAE 4G6ML 3QDMA 3ZE2E 5C0FB 1OD9A 4QKXB 3MJ7A 1BZ9B 1P5VA 1D7FA 1UM4L 1DDHA 4LLMB 5FYJE 3N9GH 3DO3A 4PRPA 2ORBH 4H1LG 3U9UB 1OPGH 3ILPB 3V4VL 4XP6L 4FABH 2CLVB 5MERB 2EDDA 4OCRL 2DWDA 5L9DL 3CFKA 5AD0A 1MRCH 1P4IH 3DBXB 4PGEB 4PJHE 3DTXB 1K9TA 5I15H 3CMOL 4KRNA 4NRZB 3T8XA 5IV2B 4BQCA 3U7WL 4UZGA 4XZUB 4WHYH 1HNGA 1IAOA 4AMKL 1G7HB 3E2HC 4OZHB 1BECA 2DI9A 4NKOA 1M05B 4FN0A 3VXNB 4QXGH 5D1XA 5J6GB 4FFVC 1OB1A 1TZHB 2XTJC 5AZEH 4S2SB 4X98A 4P23D 4F7PB 1ZTXH 1ZHBA 1A6UL 1MF2L 4XAWH 1JIBA 3GRWA 1E28B 5IT2L 4RGNC 1A2YB 4JDTL 4DVRH 4YHPA 1QR1A 3RVWD 1JNLH 5GSVB 2ESVE 5I1KL 2Y6SD 3RPIA 3BRGC 4U6VH 1AQKH 3KPMB 4BFEA 5DTFB 4U1NB 1A1NA 1I3RB 3C6SA 2EIEA 4QYOA 2UUDK 1JJUA 5I0ZA 1T6WA 3BP4B 4MJID 3DNKA 3F7VB 2P8PB 3NCBB 3PGCB 5DYOA 3IDXL 4MQ7B 4ETQA 5FDWA 1JZ8A 3D69A 1G9MC 4LSSH 4NQSB 2C5DC 1AGCA 1W0VA 5BVJB 4I1NB 3EO1A 1N2RA 1EZVX 2JB6B 2WUBL 3LS5H 4XHQA 4OLXH 2LE9A 4X7TB 1LEGB 3TIDB 3MXWL 3OXRA 3EYFA 3G6DL 1JMZA 3QNYB 4I2XE 2QADC 5D7LA 5F97E 5FGBA 3F58L 2H3NA 4YXHL 4JPWL 1FZOA 3FFCD 4NFBA 1BD2B 4OZ4B 3FQNB 4UQ2A 2PUQT 5JDSA 1Q94B 2EE6A 1I75A 1AXTL 2CKBA 5E5MB 2VLME 3GMMB 2J4WH 2I9TA 2Q86A 1KJ3L 4WCYH 4GG6E 2FNBA 4O02H 1MJ7H 1OARL 2EIZB 4PRNA 1T1ZB 2AGJH 2CGRL 5D1QB 1NCNA 1BVZA 1D5XA 5EO0B 4CVXB 1TZGH 4QRPA 1BFVL 2ZNXA 5L6YL 5KG9B 3QDMD 3PE9A 3MNZB 1A1OA 1A5FL 4IRZL 1CFNA 2YOCA 3JWDH 2VOTA 1XGUA 3HRZB 5ESVA 1L6XA 1LDPH 2MHAA 1RJYA 1T7XA 3K7UA 2VL4A 3OX8A 3FAXA 4C59B 3MLWH 4PRPD 3JWOH 1SYVA 1FVDB 5C0AE 3DX8B 5B38G 4Z0XA 1NC2B 5DHYB 3D0VA 5E2VH 3MUY1 3TZVB 2NY0D 4FZ8H 3C87A 3ULUC 4OCYH 4JGMA 4P4RB 5KBNC 4NT6B 4OCSH 4KKBD 3KYAA 3MXVL 3MLTA 4YDVB 5EH1A 4Q2ZA 3TBTB 4MZ2A 1F02I 3BP7B 1IGFL 4NO5A 1OAUH 4GRWH 3MRFA 4D94A 5AUMA 1I9JL 1T89A 3OZ9L 4JVPA 3U6RA 1JI2A 5SX4H 5DD6B 4R7DA 3SGJC 4YE4H 5D1XD 2F53A 2BVUA 1LE5B 3CPLB 3C5ZC 1T83C 2PXYA 2DTSA 1AGDB 2IWGA 4OF5A 2XTLA 1R24A 2GFBA 1BVKB 2NZIA 3REVB 4DOHE 5ADOH 3BRDA 2YK1L 2AERT 4ACPA 4ELMB 1CTOA 5GGVH 5H2BB 2P4AB 1FGVL 5T33L 5F7DA 3GGWB 3UJTH 5IK3A 5DQDL 5IWLA 2HT3D 2EO9A 4PS4L 4NZUH 3MRPA 4TPRH 3TH4T 5ADPL 4RAUA 2AEQL 3X3FH 4DKEL 2QJDA 2D9QB 1JCKA 1U93B 4RGMC 2BNUA 2VDNL 4PRHB 3RX5A 4EVNA 3QQNA 3BH8A 3ULVF 3F7PC 2HMIC 1UZ6E 1OT1A 4IIQA 2I26N 4GW5A 4XB7A 5TF1H 4RQQB 5EWIH 4MAYC 2WINB 1E6OH 3HKFA 4XI5D 4M7LT 4KKNA 4YIQB 3OHXB 1XGYL 3I6LD 3QH3B 5CMAA 4N1CA 4LGRB 2VZUA 5D7LD 4K71C 3SKUD 4RMSA 3D25A 4NM8L 2PETA 1K8IA 3GBNL 1MHHA 1F4AA 1WAAA 4JFPB 1H8SA 5ETUB 2BY1A 3TJHD 4WFFD 1P7KB 3BZEA 3PWNB 1WZ1L 3DVIA 1IGTB 1U8KA 2DLHA 4P4KC 5MP6H 3DUUA 5BV7C 4PBVC 1VFOA 2WLYA 4TVSa 1M7IB 2YD5A 1KXTB 1YC8A 4OSUL 1JGUL 2HFFA 4TUOB 3RY6A 3O3DB 2EDYA 1J86A 1MFCH 1RFDL 2GQHA 1MAML 1ZANL 1D6EB 4QRPD 4P59L 1W2KT 4XNMA 2ZSVB 3NABL 3TFKD 1MRDL 3EYQC 1S7UA 2GSGA 2A1WL 3A0OA 1QSEE 1DFBL 3HG1E 4XNQB 1JWSB 4DJMA 3SOBH 3T0EE 3H0TA 4NQUA 4GW4B 5F9OL 3W39B 4MD0A 3BHBB 4W4OA 1XGRB 1UEMA 4HWUA 4F80A 3FO1B 4N90E 3TNMB 4JRXB 4R3SB 2X41A 5L0QC 1KB5L 3CFDB 1ZGLP 4JQXC 1LO0L 2PTVA 5HTSA 1CFSA 4DWHA 3JV0A 3MV7B 4PY8J 4V2CB 3LKRA 1QLRA 3FHQA 5IF0A 1C16A 4EOWL 4Z95L 4JO1H 1T1XB 1IKFL 2PYEB 3R8QA 2QSQA 2AK4B 3WUWG 5I9QB 2R2HB 1CT8A 1ZHLA 2SEBA 1RMFL 2RAMA 4UNTA 2F53D 4R8WL 4ZPVB 2X1OA 2V9RA 4DN3L 1JGVL 2PXYD 5HGHA 4X99A 5J12C 4XCEB 4XVJH 1QUNA 2Z8VC 1U8LA 1O7SA 1DZBA 3Q3GA 5EORL 2DIBA 1YNLH 4LCWB 2H9GA 1GVIA 4U6TA 3VXRE 4NJAH 2XRAL 4ZS7H 3GBMH 1CDBA 1F2XK 2D0GA 3EDDA 4HIEB 4YHOL 2A0LD 1G9EA 3RX7A 4YEFA 5I1DB 4RCAA 1TQBB 5JDJA 3HI6L 2OYPA 4F7EB 2V5RA 3DHJA 4OLUH 1FG2A 1T5XB 4OV5A 1WBYA 4U2ZA 1J8HE 2CIIB 3DWTA 3MODH 5JQHC 1RJCA 3CFBB 1PKQA 3P4MB 4P9HC 3LS4L 4JPVH 4LF3A 3U36A 4FXGA 1MJ8L 1EJOL 4KMLB 4ZUVB 3UTZA 5GIRA 5D7JC 1BQLH 1DEEA 5D2NA 1S9WA 1OL0A 4ORGA 4N8VG 4DW2H 5D1ZB 4GG6A 2V9TA 1CQYA 5D8JH 4LAQH 3TA3A 4ZAKA 1XIWA 4XMLH 4HXBH 3J7HA 1RZJH 3OPZL 4G8EA 4K94L 4A6YL 3TM6A 2EDJA 3NZ8B 4FQQA 3SDDB 3WXVL 2WW8A 5ICYB 1UEYA 4LGPB 3BXNB 4N5EC 4RZCA 5DJAB 4P2RB 1CLZL 1DANU 3QFJA 1AR1D 1FC1A 3E3QE 1NAMH 4GT7A 1MH5B 5IM7A 1IEHA 4CGTA 4Z7VE 4XGZB 4MQXD 1V3LA 1WFUA 5ITBL 5A16A 5IMMB 1WICA 3U82B 1NFDB 3KG5A 5C0AA 4EI5A 5JW4M 5CIPA 1J1XH 1UB6B 4Z7WB 4C4KT 3PWLB 4IEFB 5I1EH 4M61A 4YAQA 4X6FA 3K2UL 3RWJB 1EEQA 3O3AB 1CN4A 2OQJB 3O0RH 4D0BA 4DGYL 3F6LA 1QRKA 2VSCA 5EU3A 5HYSB 1EEZB 4ZQKA 2W07A 1QSFE 4KDVA 3EFDH 1NEZB 4M5YL 5AG9A 1JZ2A 4OGZA 5ANMA 3E1F1 3MGTB 1UWEL 4OLZL 1NGPL 4UT6L 5GGTL 1MUJA 4WRLA 3TT1H 4M7JH 1CLYL 4TSBL 4F7CA 4RBPH 4PJDF 2W38A 2Z91A 5BZDA 5DHVH 5T1LB 5D7IB 1W0WB 2V7HA 2E8ZA 4KKAD 1YYMH 4N5UA 1OW0A 5JW3L 3QPXL 3U9PH 5DRZB 1XF5B 4MJ4A 3WE6B 1I9IH 3BIBX 5JQ6H 4ZFOL 1KIPA 5LBSL 3DMMA 5DHXB 5SX5K 1N0XL 3KPSE 5FYKE 1RIVL 1UH2A 5BVPH 3P77A 4MXVE 4LEXH 4N9OB 4MSWA 3G5VB 1OF2A 3GSNH 2Y5TB 4N1EA 3FZUD 1XF2A 2NPLX 1MVUB 1X5JA 4TVPH 2F74A 2C4XA 1Z9OA 3ET9F 3AS2A 3MC0A 2NY4D 5EA0H 1AKJB 1T5WB 2ADFH 3PP3K 5K59E 1RUKL 4XVTH 3L3HB 4NUGH 4HKZB 3JVGA 3FCTB 5DD5L 1NMBH 2WUCL 1G6RH 5HDLA 4X8XA 3ZHLA 2VDQL 4X8JA 5JIHA 5T3XL 4CKVX 4PJEF 4CVZB 3GK8L 3VD4A 3U4EB 1D3CA 1ZGLA 1SVZA 4QCIA 5FM5O 1OTUC 1X5IA 2EC9U 4KZEH 3C60C 2FWOB 3QXDB 3KWWB 3AGVA 2YPVH 1C8PA 3EOBB 2ICWI 4OGXL 4P5MA 5CBEA 1NLBH 4RGMB 4WHYG 3TA3D 2VWEE 3DO7B 4ZAKD 1XIWD 3I6GA 2O26U 1FL3A 2HT4D 2VITB 1QKZH 2IG2L 2DLFH 3N85L 4JG1L 3TT3L 4K9EC 3PWVA 5DFTA 4YGVA 1U8MA 5F3BA 3QFJD 4X6BA 2B0SH 5EIQA 4ZPTA 3WFHA 3HG1A 1TJGH 2P24A 4MJ6A 3WDHA 1MY5A 5CAYB 5J11C 1A7RL 1YQVH 4KGLA 5H37H 4K71B 4ALAH 2R4SL 3CSYA 1BBDH 4HG4K 5FHAH 1QP1A 3CNKA 4D0CB 2F9BT 5AYUH 2RQ8A 5C0AD 4EI5D 1K6QL 3CDYA 1JZ7A 1X5GA 2D03L 2H8PA 4U1HA 5D2LE 3WFCH 4CL7A 4XCCH 3UYPA 3WNNA 2LU3A 1QO3A 4JFHD 4PJ7E 2HKHL 3HR5A 4QRRB 2ZCKL 3OXSB 5I18H 3QQ3A 3VD9A 1X6NA 1HIMH 1PZ5B 2ILLA 2B7DT 2MQ3A 1AGEA 4XBGB 4PJBF 1ORQB 5B21A 3UP1A 2KKQA 4BQBA 3LSOA 2IGFH 2OJZL 3MLZH 4HXAL 5HJ3B 4WDIB 1HCVA 3SGDI 4NQCA 2VE6B 4MB5A 5IJKC 1D9KC 1RD6A 3QUYC 2EYTA 1F6AB 4NIKB 4ZXBB 1NGYA 1HEZB 3IGAB 1ZHKB 2DQDH 5EBWA 4R4ND 4IMLA 3A6BL 3MV9A 3U2SB 3O4LE 4LP5A 3ARBA 4UAOC 4HFWA 4PP1D 5HHQB 3DMMD 4B7LA 4NC2B 3LEYL 4JB9L 1J8HA 4QXUL 5ACMA 4X6DF 1U41A 2VLRB 1PSKH 5LWYL 1RHFA 3G9AB 1CXFA 5J3HD 1KCUH 4Z7QF 4O2CA 4S1QH 2Q8AH 3BUTA 1G7IB 2IC2A 1A9BB 1KBGH 3SDCB 1FIGL 1NCCH 1R3IH 4Q6IC 2QLVB 3FFDA 1WCQA 4GAYB 2GJ6B 2EDBA 4G7YL 1MHCB 3PGDB 4QNPE 3FT3A 5JTWA 4M93B 3SE3C 1IM9B 1RUPL 4NOBA 4LLVA 5BMFL 5J1SC 5C0BE 8FABA 2EEBA 4UOW0 5K33A 1VFAB 4MNGB 1K8DB 4XMPL 3VGBA 4HD9A 1E0OB 3BX7C 1E4KC 2XY1A 2VXQH 4HUUB 4M1DL 3T2NH 4Z7VA 2HVJA 1LNUA 3QUZC 4JHAL 3GJFB 4TUJA 1N64H 1WFNA 1U6AL 5T1MB 1BWMA 3QIUB 4JY6B 3THMH 1MCKA 4AL8H 1J87A 2I07B 1N8ZB 2BY3A 3HPLA 1OAQL 2X4QA 3OAZK 4UBDC 4YFDB 1MAKA 5FA4A 3HG1D 3QHTC 4NCDA 4U1KA 4ELKA 1U8PB 1OGTA 3HNVH 3KLDA 1H15A 3NCJL 2F8XC 2FH6A 4RX4A 4KK9D 4R2GB 2UWEA 3VDBA 1QSFA 4LPXA 4H0HB 4NGHL 3U30C 2AW2A 5HD8D 2FJFA 4U6XB 1KJ2A 3M1BA 1WAAF 5T3ZL 5L2JA 5EZIH 3ZE2F 1PDKA 1JGLH 1NMCC 4MGXA 3MBED 1NFIB 1UXWA 4PJCB 1EHLL 5I1CL 1TQCB 2IEPA 4AH2A 5CGYD 4G8FB 4ISVA 4H0IA 5E70A 1KCKA 4FXKA 4ZFFA 5CZXC 3CLEH 1CG9B 1GGTA 1FORL 3KR3L 5DEFA 1MCHA 5DK0B 4LNRA 3PGFH 3ZHKA 4MDIA 5I1JL 1S9VB 5I8OH 1A8JH 2EH7H 4NQDB 5LGHL 5CEXB 1HXMB 4N8CH 4WI2A 1OP3H 3WJLA 3NH7H 4NQCD 4G8GA 2P46B 2IFFL 1A22B 2B4CH 5C09B 2OSLA 1HXYA 3UTTA 4BQ6A 3CVIH 1INEL 1P6AB 2ID5A 4PJHF 1NAMA 5IIEA 1L9NA 2HFGH 1OT2A 2WANA 2XFXA 5JZ7C 4FFZH 1BEYL 1IC7H 3MV9D 3IU4H 4R26L 1A21A 1K2DA 5IP4A 5FUOL 1DLHA 4M43L 3GSQB 2E5EA 2D7TH 3ARBD 3QIBB 4XBPA 2PCPB 1NGZA 3UTPE 2G5BA 1J8HD 3VRJA 3IDIB 1C5DA 2VQ1A 1BPVA 4TSAH 2FZ3A 2X4RA 1FJ1A 4IOFD 3U0TA 3PIQB 3U4BH 5DRNA 4HMCA 4L8DA 2X44D 2R39A 4BA8A 2HG5B 2Y7QB 4L8CA 2P5WB 4W70A 1ONQB 4M6AA 32C2B 5FECB 4KUCF 1RUML 3RNKA 4HCRL 4QRQB 4E5XB 3HZVA 5EOQH 4OIAA 4YDLC 1TIUA 2O61A 2IANA 9CGTA 4K8RL 4OCWH 5E2JA 1JYWA 3GMOA 3I2CH 1QFUH 5DHVA 5I71B 3CC5B 4FQ2L 3ARVA 4C4KO 2OTWA 4TRPL 5EU6E 3EBAA 1NBYA 2AJUH 3JZ7A 2XOTA 1MCJA 5FF6A 4M3KB 1FZKA 4X6EB 3LHPL 2ZOKA 3O2WH 1AD0B 1JHTB 1I1YB 2VIRA 2GT9A 4Y4HB 1CDGA 2DQJL 4X0KA 3PG2A 2ENYA 4JHWL 1T7WA 2ATKB 3FO9B 4NOFA 1E4JA 1MCNA 4PJ7A 4I0PC 3GSNA 2VDLL 4HIIA 4OUOA 2FIKB 2GUOB 4ZD3L 2J88H 1MREL 1D5IL 1MWAH 1ED3B 1T3FA 3L5XL 4PB9L 1KELL 4LBEB 4LKXA 1TTFA 4RX4D 2Y4SA 3NA9L 5EFIA 3HUJA 3L7EA 1QSFD 1ZLSH 4JLRA 3C6LC 4Y0GA 1KXQE 3WXWH 1G6RA 3CVHH 1AO7B 1ZVSA 3B9DA 3DJ9A 3MJGX 3MRCB 4KQ4L 4Y2DA 1REIA 1DVFB 4PJ5B 2CUHA 1MPAH 1P5UA 4KPHL 3VRIB 5JHDB 1TNMA 4QLRA 3L1OL 1HKLH 2FIRT 4IRSB 1GC1L 5I30L 2ZKHH 5C2BH 3V7AE 1II4E 3OKLA 1YA5A 1RK1B 4JZJB 1UA6H 3DPBA 1FSKB 4JM2F 2HH0H 3B8SA 3O4LA 1FYTE 1QLEH 4WEBL 5EC1B 2HRPH 2YD3A 3A6OA 1HH6A 4Y19E 1BGXL 1X4ZA 3EUUA 4G8GD 1KFAH 5IBUB 1MIEL 3UTTD 1OP5K 4YBQC 4LSDA 5TDOB 5C3TA 1EHNA 1YPZA 4IS6B 4P5TA 3SCMC 3TBVA 5IB4B 4BZ2L 1AXSA 4KJYB 3QUYB 3BPOC 2ZUVA 1Q9OA 2BXZA 4C58B 2B1HL 4JZNA 4RA0C 4JM4L 5C0BA 4HZLA 1N5YH 3OKKA 1C7SA 1PYWB 2CJUH 1I7UB 1SEBA 4JFFB 5JNYA 3OJVC 3SDYL 4QOKE 2UYLA 1GOHA 1KIUA 1NCWH 2VZSA 3O3EB 4M62L 4O5LH 3C5SA 5C0NC 2D0HA 4EUPB 3QEGH 4MQSB 3VG9C 1DSFL 4PREB 5MHSE 4GMSH 1E4WL 4ZFOB 35C8H 1CZ8L 1BWWA 3IDMB 2IAND 5HI5D 2BCKA 1UZ6F 2IADA 1OAKH 3V6FB 4U1JA 2R0ZH 2NQCA 2VAAB 4CU8A 1D5ZA 1EMTH 1M6OA 4HPYL 4LHUB 1KCLA 1NANI 5CFHA 3VJ6B 1I7TA 5HHNB 3H9HB 1UZ8B 3RWHB 3L6FB 3IJYB 1C12B 1BLNB 3P0YH 2X42A 1N26A 4HS3B 2FBJL 3MROA 3M17A 4JANA 4Z77B 2IMMA 5KW9L 4CBPA 5A2FA 5IJVA 5J56B 3W5MA 1IC4H 1JYVA 4OB5L 4TVPD 1RURH 1MNUL 4Q7DA 4G6AD 1B4RA 2WWKO 5A43C 1RUAL 1V05A 5FUZL 3WKNA 3CFEA 4XNYH 4K3DH 5BS0E 4LLQA 5DJ8B 1WITA 4JZOB 4KRPC 3BYYA 4Y5VA 3RJQB 5SWSE 3MJ8A 5DEGB 5KVEH 4Z76B 1JNHA 3I50H 1NKOA 3U79A 1X4YA 4Y2DD 2C3VA 1U9KA 2F5BH 3X14A 4BFIA 1GIGL 3Q5OA 4ZS6C 2OK0L 2CDEA 3ZYIA 3S3SA 5CKAA 3V0AC 2X4PB 3FQUB 3MA7A 5FHBH 2GK0B 2H26A 3BE1L 3HE6B 4NZTL 5AG8A 4H20H 1JPTL 2FD6H 3O4LD 2R29H 4G43B 4MD4A 2QEJA 4BQ8A 1XF4A 4HF5H 4KKCC 3O4OC 3RTQA 3TWCH 4HGKC 4NRXA 4UINH 3W11C 3HMXH 2NXYD 4BKLA 2DLTA 3ULVC 1H0DA 4LSUL 3GSRB 5E2TL 2BFVL 4G9FA 4P5TD 1QACA 4WHTA 1EBPA 5GS0C 4H8WC 4KGJA 3WFEL 3HNTL 3RQ3A 2FGZA 3IJHB 3ARXA 4UT9L 1JPGB 1MCWW 1RJLA 5IUSA 3KJ6L 1KG0B 2O93L 1LEIA 3GI9L 1Z0NA 3MCLL 3TN0A 1JRHH 4TOYH 5C0BD 1U8NB 1Z6JT 3T4AB 4DKFL 2G75B 2ZUTA 3HFMH 4JY4B 4GJTB 2QKIA 4KMTL 3FMGH 5I76B 1ADQH 1WTLA 4E0RB 4XXDA 1Q1JL 3QDJA 2KZWA 3EJYD 1X3DA 3JTSA 1P9MC 3FRPA 4XVUD 4ZSOE 5EU4B 4FG6C 3OQ3B 4D8PB 4Z7UE 5ITFB 4FTVA 1X5LA 5H94A 5IVOA 1C5BL 2EEDA 3R1GH 5J06A 3EDKA 3VFTB 4UIMA 4FQIL 2ICWA 3MOQA 3BKJH 5HSFA 5DJYA 1IGIL 1CVSC 2AAVA 4PRBA 1KLGA 2G60L 1PVHA 4LU5H 1HHGB 1KPRB 3CFCH 1PAMA 3KAAA 4ODUB 4PJAE 2AABH 3BZ4B 5GJSH 5KSVB 5C0RL 5LJYH 4NC1C 2J8UF 5EC2B 4JHZA 4PRDA 4LVNB 1ZLVK 3RVXD 2A77L 1BZ7B 5JOEA 1R5WA 4NO2A 4H88H 1RZGA 1MCOH 2R69L 1ZLWK 3WBDA 1J8KA 4LCIH 1MFEL 4UDTA 1T4KA 3RZWA 2VNCA 2J8HA 3BQUA 3RIAK 5DMKB 5SWZA 2DN7A 4P2OB 1U3JA 5E9DE 1FYTA 3PWPB 4B53A 4O2FB 4P3DB 3VFUB 3MBXL 1KEGH 4Y19A 5JR1H 1HN1A 5D6DA 5EU7C 4APQB 2DQTL 4I18A 1ZA6A 1B0GB 1R3JB 1DBML 1EK3A 5DF0A 5F7EL 3BP5A 4DUXA 2Y06H 3GRWL 3MNVB 2V7NA 4LLDA 4PJ8A 4ZDHB 1VESA 4Q0XH 2N56A 1LO4H 5TQ2H 2NTSP 1UFUA 1L7TH 2DRUA 2YHGA 4N1HB 1S78D 3ROLB 5B39B 1IAMA 3UPRA 3RTQD 4BYHA 4EN3A 4MJ2A 2AV1A 3IETB 1A6ZA 1KIQA 1B90A 1FRGL 4PLOB 4M1GL 2F54B 4RISH 3TO2A 5DD1H 4WNQB 4XWOD 1MWAA 1M71B 5T5NG 2DTML 2DDQL 4G9FD 1XGTA 2EDTA 4ZNEE 1KJMB 3SJVB 4FFYH 4PGCA 1T2JA 2AKRA 3E6HA 1CDHA 3O9WB 4PJFE 4LSPH 4X5XA 4EIGB 4MXVF 1Q9LB 3CVHA 1MCEA 4O00A 3TN0D 4LVHC 3B6SB 2HWZL 1BQSA 1F90H 5C0FA 2A9MH 5C0EB 4IJ3B 3DIFA 1F3DH 3QEHB 4HKXB 1QBMH 1BZ9A 4RRPG 1SM3H 4R90L 2FECL 1I1CA 2BVQA 4U3HA 4TSCH 2HTKD 3FHAA 1YECL 4UOW1 4U31A 4JY5H 5F9JB 1U8HB 2J2ZA 5CJQL 3QDJD 2B1AL 2CKBL 2J3SA 3ILPA 4MJ5B 4RWYH 4ONFH 1EZVY 3T4YB 4M5ZH 3NVQA 4ODTL 3ROOB 2R23B 1TCRA 4NQXA 2CLVA 2NY7H 4FTVD 4WEMB 5E8DH 1FO0A 4ZYKB 3C2AL 2IH3B 1PX4A 4WI7A 3CSBA 5C0IB 5TFSH 4PGEA 3VDAA 1TLKA 5HVGB 4XPHL 5F7LB 4AT6B 2X10A 2YXMA 2IF7A 5BS0A 1M05A 1IGCL 5CD3B 3VXNA 3H9SE 5J6GA 3QZWG 4OKVB 4JFDB 5J89A 3WLWC 4S2SA 4QXWA 1NCBH 1UACL 2BVPB 3QCTH 1JHKL 1T22B 4XP5H 3KPNA 1U8IB 4OZGB 1AGBA 2V9QA 4Y4KB 4CAGA 3D1MC 1DL7H 4FQHB 3VWJC 4HJ0D 3IRPX 3CDGB 2D31B 3BQUD 3FN9A 1INQB 1B4JL 3KPMA 1AHWA 5SWZD 3VWKC 4N0CD 5DTFA 2BHYA 1I3RA 5D2LF 3MGAA 1VCAA 1WCBB 5E1AB 1FYTD 4DUVA 1G0XA 4PJ7F 3BP4A 1EAPB 3F7VA 4X4ZA 5E03A 2P8PA 4XBEH 4Y19D 4HUVB 1IC5L 4D9LL 4UILL 4MQ7A 1XR8B 4WWKC 2ICEB 3BGMA 4K7PY 3MLRL 5BVJA 4N68A 1F58L 4EKXA 2XTJE 1TPXC 1S7WB 4LLAA 4FMKA 1LEGA 3SN6N 3TIDA 1J18A 4PJ8D 1I3GL 1PGRB 4GO6B 4O9HL 2CD0A 2YD7A 2IMNA 5DQJA 1TZIA 4CW1B 3T04D 1BD2A 4OZ4A 1FNSH 4EN3D 5DMJB 5K9QG 2OL3H 5E5MA 3ARDA 3GMMA 3MRLB 1WZKA 3PL6B 4OLWL 2VDOH 3NGBC 1OY3B 4ENEC 2IPKB 1T1ZA 5B4MC 3L5IA 5EOCL 5D1QA 2H45A 4YNYB 2H2SC 1H3GA 5EO0A 2FCBA 3V4VH 1A9EB 1CFBA 1ZT1A 3HS0A 3SO5A 3SGKA 3MLXL 1NBZB 3TPUB 4XAKE 3DV6B 3KXFA 3O6LH 3VI4E 4WENB 1I9RL 3U7WH 3EIFA 5FM4A 5ALBH 4O4YL 1FVDA 5GJTL 4AMKH 1JTTA 4QNPF 3OR7A 1EO8L 3HA0A 5DHYA 4NZRL 4BQ9A 4J3WA 2EIBA 4PJAA 4C54A 3TZVA 1WSST 4GQ9L 1NKRA 3I02A 2I5YL 4WU5B 5GRXG 2XA8H 4P4RA 2FBOJ 1A6UH 3KPOA 4NT6A 1OLZA 4FXLA 1D5BA 5IT2H 3RHWK 3TBTA 3BP7A 43CAA 4O58H 2WWMC 1BAFH 3CLFH 4P49A 4U2YA 1VFMA 4WUUB 2APFA 3L95A 5TH2B 1CBVL 4LP4A 5BS0D 4XPAH 5IB5B 2NY1C 5I2IA 1DQML 1LE5A 3CPLA 4L4TB 5E9DA 3IKCA 2Q7YB 3UZEA 2OLDA 4YBLB 3PDGA 3RZCB 3BRFA 4KMQA 3P3YA 1QYGL 1AQDB 2CMRL 1L0QA 3GGWA 4NPYA 4ONGL 4D9QE 3KNBA 1OTTD 3ULUE 2B39A 1ADQA 1T2QH 1F5WA 1ORSA 1LK2B 3F12B 3QDGB 3MXWH 1IMHC 5HDBE 5LGKA 2KZ1B 4EBQL 4YXHH 4PRHA 3RIAF 2ADIB 4WU7B 3K1KC 1CDIA 3ME0A 3VFOB 3QISA 3HMWL 2JJSC 1QOKA 1HHIB 2YKLL 3T65B 2Q3AA 3RUGE 3WHE1 4YIQA 5A2KH 3OHXA 2DMBA 2FJHB 4ZNEA 1R5IA 1A1MB 5FYJU 4F7TB 3MJ9H 4XMKH 1AXIB 2OR8A 2DQUL 3TNNA 3RWDB 5C9JB 3N9GL 4MA7H 1DUYA 4PJFA 1BD2D 1ZHNA 1FYHB 3LRSB 3S35L 1BFVH 2ORBL 1I7RA 4JFPA 3ZDZE 4M7ZB 5CD5D 3OKMB 1J0IA 3ARDD 1P7KA 1A5FH 4NNYB 2QQKH 5I8EA 1TVBB 2NW3A 4FABL 1P1ZA 2H32B 2W9EL 1MRCL 4WV1B 4CN6A 1P4IL 4NRYA 4TUOA 2APBA 5D1QD 4TN9A 5I15L 4JQIH 5EZLA 5ICZB 5FM5M 4P9MH 2YPKB 1NDGA 3DX6A 3S4SB 4OI9A 4QWWC 4ODBD 1CS6A 1OHQA 4GW4A 1UM6H 3MRNA 1WBXB 3KXFD 3IYLW 3W39A 1VENA 1IGFH 4MJIB 1NCDL 2OM5A 4MWFB 3ZZ1A 1XGRA 1B3JA 4XAWL 4UIKH 5T1KB 3REWB 2W65A 3TNMA 2XNAB 3BT2H 3EZJB 2NCMA 3MO1B 3H9SA 3TZVD 2RFXB 4DGIH 3BYTA 1P69B 4NJ9L 2BVYA 4HJGA 3VFGL 4U6VL 4JRYE 4X4YA 2ERJB 5E6IC 3MV7A 2EDLA 3QULB 5DO2D 5L2KE 3WS3B 2VXTH 1FGVH 4NC0B 2RR3A 2G5RA 4PBXA 3WLBB 2OJEB 3QA3A 1G1YA 2BXYA 3J8F7 4ODXA 3GJFH 3O81A 3RKDD 3FB5A 2AK4A 5D6CB 3WO4C 4JDZB 2R2HA 2AEQH 4LSSL 2E7LC 3KHOA 3N06B 4L4VE 2NLJB 5E9DD 4ZPVA 4LVOC 3LS5L 4J3UA 4XCEA 2VDNH 3NCYP 4OLXL 3HC3H 5CJ8A 5ACZB 3WN5C 4Y5XC 1MCBA 4LCWA 4AEFA 1RAMA 4OLYL 4HK3J 1CGSH 2GEEA 5I1DA 2FR4B 4GUPB 4YK4C 4G42B 5ISZE 2BC4A 5C7XL 1FLRH 3QDMB 1A3LL 4Q74A 3MJ7B 2G9HA 1PQZB 4WCYL 5C8JA 1DDHB 3BN9C 4O02L 4GOSA 3P4MA 4PRHD 4PRPB 5A2JH 2L0DA 2AGJL 2H1PH 4MHHG 4ZUVA 1NFKA 4GW1A 4KHXL 4I0CC 1TZGL 1A64A 1QFWI 1VEMA 3KPLB 4NO0A 2DI8A 3RY4A 3RPKA 1G6VK 5D1ZA 3TVMC 5EPMB 4NO3A 2DWDB 2XZQL 3CFKB 5AD0B 1CGXA 4EDWH 2YZ1A 1JGUH 3SDDA 5JXAL 3WUZA 3O8XC 1LDPL 5EG6C 4GBXC 2XXMB 1ZANH 3BXNA 4L3EE 3RVUD 4P2RA 1P7QA 3NABH 4M00A 2NR6D 4NKOB 2KPNA 5E2VL 4KK8C 5J1AA 4OZFB 4FZ8L 1OB1B 1K5NB 1UH4A 3CX2A 5IMMA 4POZC 4OCYL 1NFDA 1U36A 4GH7B 5EOCJ 3DARA 4PJEB 3HC4H 3PXHA 4YHPB 3MFFA 5JMOC 1PLGH 4DK6A 4A2MA 3DXAE 3NGBB 2D3VA 2CDFA 5A3IC 5CBAB 4AJ0A 2QR0B 2OQJA 1HQ4A 4U49A 2QV2A 4KDTA 1IAIL 4YE4L 3FB8B 1A1NB 1F8TL 1PG7X 4HGWA 3VXSE 2BZDA 3NACH 2KL6A 5DYOB 4LCCC 4JKMA 5ADOL 1FC2D 3FL7A 4OV6F 4NN5C 1NEZA 4ETQB 5FDWB 4PV8B 2Q8BH 2A6DB 3DHMA 3MGTA 1RMFH 1I7ZA 3UJTL 3H9SD 4PJIA 3DVNA 3UTSE 1N2RB 1JGVH 4NZUL 5E08H 1ND0A 3X3FL 1KCVL 2OL3A 3MV7D 1OM3H 3FQTA 1W0WA 5D7LB 4U1SA 3HN3A 3WIIL 5DRZA 1XF5A 3TBYB 1G0DA 4G6FB 3WE6A 5JMRA 4UQ2B 2AK4D 3HI6H 1GOGA 3KLSA 4HHAA 5TF1L 4Z7OF 3QBTB 3WS6C 2CKBB 1X7QA 4JM2C 3MUJA 4WI9A 4YLQT 1PFCA 2Y36H 3MLVH 1E6OL 3S36H 2KDGA 2D7OA 2P8LB 2OMBA 5GISL 4OF7A 1MJ8H 4LCWD 3ESUF 3MLUH 5TE7L 3SGJA 1CD1A 1D5XB 1XF3B 4FFVD 4QRPB 1T83A 2V6HA 1YJDL 3GSOA 3L3HA 2X4SB 1TVDA 1M7XA 4HKZA 3GUTA 1A1OB 2X1PA 2W91A 3TF7C 2AEIT 2VLKB 4RGND 5BJTA 5ESVB 1XGUB 2MHAB 5E99H 1J11A 1RJYB 3VD5A 4CVZA 4N8PA 2BJML 1B88A 2WV3A 3IDJB 1HDMA 5MI0B 1CLZH 1SYVB 4RWHA 2AEPH 3BAEL 5M95B 5EZOH 1RZIA 1MFCL 3ETBF 4YR6B 4Z0XB 3KLHD 3D0VB 5EO1A 5IVXA 4NO0D 2FL5B 5D1ZD 1CK0H 3DO7A 4AYFA 4HLZH 1ROWA 1IKNC 4S1SL 3SOBL 1N6QL 3MLTB 3SDDD 3LPGA 1S7RA 2DLIA 3QDHA 4X9BA 4YHYB 4NO5B 4P2RD 5ICXA 1P7QD 5AUMB 2YUXA 5F71A 4IDLA 3VW3H 3FONB 3NA4A 4R7DB 3HHRB 2QADD 4W6WB 4BSWA 4Y4FB 1NUNB 4ESKA 2D7QA 4ZMAT 3Q1SH 2E9IA 4NQEA 2GSIB 3UPCA 1R24B 5MENE 2GFBB 5IHBA 3P9WB 4JFYB 1GZPA 3G08B 4M5YH 1JMXA 5F7DB 4P4KA 4OLZH 1YEFH 1A7BA 4JO1L 3L5WA 3CJJA 3MRPB 1QA9B 4TSBH 1RZ8B 2Y5EA 4RAUB 3Q5TA 3OXSA 1QSVA 1QRNE 1T20A 2GTZB 5JW3H 4XBGA 3RKPA 1GPOL 2BNUB 4S0SD 5HYSG 1ORQA 1G9NC 4EVNB 1S7TA 1VKXA 3BH8B 3MJ9A 2PO6C 1B0WA 4IIQB 4GW5B 5H8DA 4Z7UF 3GBML 4CADB 1OAYL 4PLJC 3PWUB 2QHRL 4K7PL 5HYIA 4R9HA 3HNSH 1RIVH 2VE6A 1UVQB 3HLAB 4ZOBA 3V52L 5D93C 1F6AA 2WBWB 1HEZA 3IGAA 3TV3L 5F6IB 1UENA 2ITCA 3T0EC 1KJ2L 1JZ5A 4IBLT 2EE9A 5DVLA 3ZT5A 2LU4A 2AXHA 5K9JL 1K8IB 3RDTC 3MLYH 1MHHB 4U1MB 1RUKH 3BKYL 4JQXA 2BK8A 2DYPA 2Z8RA 1BQLL 5CGMA 1A4KB 1U8KB 5JUEL 5KS9E 3QJFA 2WUCH 1FVCA 3DUUB 2OBGA 5T3XH 2XXCB 2Z31C 4X6CE 5F70A 5EZJA 1WBZA 4KVNL 4XC1L 5D8JL 2XI9A 4HXBL 1RZJL 2XKNA 5BW7C 1MAJA 1A9BA 2HFFB 4MNHB 1QR4A 4UU9B 2B5IC 3B9KC 3F5WA 5EUOE 4LVOB 4Q9RH 1C1EH 1OD7A 3O3BB 4GAYA 2GJ6A 1FH5H 3P0VH 4L9LB 3V6OE 5SWQB 1NAML 2VKWA 5IW6B 4YX2H 1IJ9A 1IM9A 1HSAA 3WHXA 4U6YB 4PJHB 5IVZA 2IG2H 4JG1H 2RB8A 2JLLA 3L5HA 4L3EA 4MD0B 1FGNH 3CXHJ 4CN1A 3TIEB 1KLUA 3OAYH 1J1XL 3MUZ1 4WWID 5L7XH 1A7QL 1A7RH 4M6MH 3AB0B 1I8KA 1MCRA 3K4DA 3GJFA 4AK1A 3TYFB 2R4RL 1QQDA 2NNAA 2HMID 4JY6A 2Z92A 1QLRB 1N8ZA 1ZVYA 1C16B 5IF0B 3W2DH 3VGEA 1NGWA 4XP9H 1KEML 2ESVB 3U7YL 1LVEA 2L7JA 5C6PB 3CDCA 3EFDL 1CT8B 2SEBB 5I6XC 2CO7B 2AJXH 2I9LA 4GBXB 1BF8A 3TT1L 3SPVB 5HGHB 4X99B 4NQED 3I9GH 1VACA 3R0NA 4MMXC 3GB7A 3L3OA 4PJFF 2H9GB 2VH5L 4LPWA 2YUWA 3U9PL 4P4KD 2BNQA 1SEQH 4HFUL 4F9LA 2NY4B 1I9IL 1NFIA 5JQ6L 5I75C 5FYKU 5BOPA 1FG2B 3E3QC 4QTHA 1WBYB 4I2XB 1DR9A 5IQ7H 3MPCA 4HWEL 4HULB 5BVPL 3F6IA 3A6BH 4LEXL 5I1GL 1PKQB 3MCKA 3GSNL 3BPCA 3EYQD 3U36B 4FXGB 4WTZG 3UTZB 2FEDC 4NQDA 5CEXA 3LEYH 4JB9H 1DEEB 3GIZH 1MSPA 1U95B 3ZTJH 4GG6B 5LWYH 2FX9L 2APXA 1NUFA 1U2CA 3BPLC 4NUGL 4RAVB 3TA3B 4ZAKB 4HK3N 4A2LA 3HI5H 2GW5A 4LRIA 4NN5B 1WTGT 1FE8L 4F9PC 1G6RL 3M07A 3QUXC 2DB8A 1EVUA 4WUKL 3QFJB 3KJ4B 3BZDA 4KZEL 2DYPD 2EDWA 5FCUH 4G7YH 4BFBD 4BZYA 1CL7I 4V1DE 3RGHA 1NLBL 4NP4L 5A16B 3BISA 4C56E 1A0QH 2C1PB 5C0AB 1FFQA 4F37K 4XMPH 2Y7QA 5CIPB 4F33B 1X5XA 1IAKB 1QKZL 4JM2B 1K3ZA 4G5ZH 4YAQB 1UWGH 4BSVB 4X6FB 4HIHB 5E1HB 2B0SL 1AY1H 1NCTA 2GJ6D 4JHAH 3UZQA 4XXCA 1HYSC 1G84A 1P84J 4JN1L 1U6AH 1YQVL 4D0BB 1IM9D 3AUVA 4ALAL 2J8OA 1N0LA 5EU3B 4NQVA 3VGAC 1K4CA 4L3ED 3VXUE 3I3DA 3SE9H 4XHJC 5AYUL 5F72S 3EAKA 2AJVH 2N1KA 3CC5A 1E6JL 3WFCL 1NBQA 4XCCL 2HVKB 5MEOB 4JJHA 5J13B 2DQGH 1MUJB 3QAZC 5GRYA 4J8RB 1CE1L 2F19H 5MENA 5BZDB 5I18L 4DOHB 2V7HB 3C60A 1HIML 3GNMH 2VDML 1TMCB 4Y4HA 1YEEH 3VXTB 5T3ZH 3HZKB 3IS1X 3SQBA 6CGTA 4IRJC 5CP3A 3T2PA 2IGFL 1EHLH 1KIPB 3LKOB 1ED3A 3BKMH 4KJWC 1GSMA 1YEIL 4PTTB 3RJDA 3OKNB 4N5ED 3WNPA 3P77B 3BMWA 1FORH 5IROC 3KR3H 2C3HA 3QG7L 4R2GD 5DUML 3VGHA 3V79C 1JN6B 1XF2B 2F74B 4P99A 5LGHH 4ZODA 1AO7A 2BNQD 4N9GA 3RA7L 1INEH 5JHDA 1Q0XH 4IRSA 4X8JB 1PSKL 3MA9H 1HCFX 2AI0L 1RK1A 4R26H 2APWA 4S1QL 2Q8AL 1A6AB 1ZGLB 3FN0L 4M43H 4QCIB 8CGTA 1A7PL 3GMLB 1KBGL 4NQDD 1G7LA 1NCCL 5EC1A 2CK2A 1DLFH 4HK0B 1R3IL 5KS9A 5C08E 3ELAT 5CBEB 4X6CA 1JYNA 4O51B 1U8OB 5F7MC 3I6GB 1CCZA 3VH8A 1QTYT 1W72H 4EDXB 5TDOA 1QPPA 1A02N 5IEHB 3UBXG 4IS6A 4MNQA 5IB4A 2ED9A 4YGVB 1U8MB 3SQOH 5IJKA 1X5ZA 1YQ2A 4HCRH 4X4MA 3QG6B 3QUYA 4ZPTB 1QSEB 3HG1B 1QZ1A 2XG5A 4MJ6B 2WBJB 2CO6B 1JV5B 2DIAA 5HI4D 3T0EB 1UCTA 2A83A 1CGVA 1EVTC 1GZQB 2P8MB 3LKPA 3EDEA 1FZMA 5F7FA 4JFFA 1N64L 3WYRA 5GGRY 5I73C 2GJZA 4FQ2H 3THML 3ULUF 4AL8L 2H8PB 4U1HB 2APTA 4XC3H 5HDBF 3HR5B 3VFPA 3DGGB 4ZFOA 4NBYB 4JFXA 3QQ3B 4YC2C 3LHPH 3R8BB 3RWEB 3HNVL 3IXAA 5L8JB 4Q6IA 1VFUA 12E8H 1EBAA 4LMQI 3WFBH 4DK3A 1IQWH 3LSOB 3TJEH 4AEHH 3L5JA 5CCKH 1D5IH 5KZCD 3Q48A 1EIBA 3RUGF 4LHUA 3SE3A 2BNRE 1HOCA 4NN7B 1MHEA 2M2DA 5HHNA 3VJ6A 2OR7A 4RMUA 2WAHA 5JO5A 1XCQA 1JGLL 1E4XI 4PB9H 2C3GA 3IJYA 1C12A 1BLNA 5MEND 4HS3A 2JJWA 1J0KA 3NCCB 4MLIA 3INUH 1CD9B 3C60D 3VXRB 2OP4L 2P48B 4Y4HD 1E4KA 3CLEL 3MV9B 3ZDZF 3V8OA 3LH2H 3OJ2C 3MLSL 4PJ9B 3DROB 3QUZA 2XQBH 4HFWB 4NZJA 4KPHH 4GRLB 4N8CL 4OCLC 1J8HB 3MOBH 5DRXA 1VPOH 2B4CL 4OD3L 1KB9K 5I30H 5E4EC 1R3HA 3CVIL 1QFPA 3LN9A 4W68A 4G3YL 4JZOA 1CL7H 4L3AA 4O2CB 4KWUA 3IXTA 2HFGL 4N0YH 2Z93A 4S11A 3QCVH 3ULVH 4PYHA 4FFZL 5DEGA 5IFAH 1AO7D 3F7RA 4QHKI 3MRIB 1BGXH 3FFDB 4YHML 1MIEH 5GS0H 2D7TL 1XAUA 5JHDD 5LCVL 4JVWA 1UC6A 4IRSD 3FT3B 2X4PA 2VL5B 4OGYH 4LLVB 4P2CG 4TSAL 4ZO9A 8FABB 5LAXB 2GK0A 4U6HA 3U4BL 4BZ2H 4AIXA 1A6TA 2DQFA 3ARGB 4PY8I 4HGMA 4G43A 3GFUA 2GCYA 4HLZG 3IU3A 2W9DH 4JM4H 4Z7VB 1AD9A 4DUWA 1LNUB 4RFNB 1X5HA 3G5XB 5GRJL 5IBUG 4P2YA 3TCLB 3MYZA 4QRUA 1IEBB 3U7AA 3UYOD 1ZOXA 1R6VA 4OCWL 4MNQD 2FATL 3HPLB 5JW5B 4HS8H 1B2WL 4GXUN 3QUYD 5KN5B 1QHPA 1JPGA 1Z5LA 4Z18A 3U46A 3TESA 1KG0A 1CZ8H 2BMKB 1Q0YH 2R0LL 3GJEA 3UDWC 3T4AA 1H15B 3VXUA 2MTPA 2YPLE 1F4XL 4DEPC 4RIRA 4JFFD 2UWEB 4KDWA 1QSFB 4JY4A 5CJ5A 3GEWB 5D9SA 4JRWA 2FJFB 4WFGE 4YJZL 4HPYH 2MKLC 1KJ2B 2NXZC 5JPNA 5L2JB 4EUPG 1QFOA 1UXWB 4F37F 4K3JH 1OAXH 5BRZA 4AH2B 4XTRC 4D8PA 4ISVB 4MXWH 1KPVA 2CSPA 5GGSY 4FXKB 4MX7B 4ZFFB 1SJEB 1UGNA 4HX1A 5DEFB 3B5GA 4L29A 1ZLSL 5HHOA 5HXMA 1CYGA 4OB5H 1JL8A 5HGAA 3WXWL 4I8DA 2XA3A 1XZ0A 3CVHL 3KPPB 4LHUD 1I4FA 3B4NA 3KPSB 5FUZH 4G8GB 4KZDH 2OSLB 1HXYB 3UTTB 5I16B 3ILQC 1HHGA 1KPRA 1U58B 1MPAL 3IFOB 4ODUA 1NAMB 5IIEB 1HKLL 2N7BA 5IMKB 1JP5A 3BZ4A 3GSXA 2XFXB 3LN4A 4EEEA 1CIDA 1UA6L 3RWIB 3QUZD 5CJOH 1BZ7A 1QLEL 2OK0H 4XBPB 4YHZH 2WIMA 1GCFA 1NGZB 2HRPL 1U8JA 2G5BB 2VLJE 3VRJB 1C5DB 1TETL 1FO0L 1VA9A 2FZ3B 1FJ1B 4YDJB 4UBDD 5DRNB 4L8DB 3IDYC 4I0PA 1JPTH 2O5XH 4JRXE 4UUJA 43C9A 5IB2A 3U0WH 3PWPA 4O2FA 4L8CB 2NMSA 3LKQB 4P3DA 3VFUA 1KTKE 2UUDH 5GRZA 5C08A 5CEZE 1NCUA 3B2VH 1JK8B 4OCXH 2AK1H 1I8LA 1B0GA 1HNFA 1S7XA 1NC4B 3ZE1F 1VGEH 4G7VH 2O61B 2IANB 2PYEE 4NC1E 4Y5YC 1N5YL 4XP4L 2CJUL 1X5KA 1RQ5A 5MEPB 3ABZA 3QUML 1QG3A 3HNTH 4ZDHA 1JPSH 5DHVB 1CQKA 4XNXH 2OTWB 1KTRL 5B39A 3GI9H 3MCLH 2WP3T 3QNXA 4DKFH 1RU9H 3OMZA 5CZXD 3IETA 4D0DB 4GMSL 4KKBC 3VDCA 2PN5A 5FF6B 4WFHE 1FZKB 2NY6C 5CEYA 2ZOKB 2VIRB 2GT9B 4KMTH 4P46B 5EU7E 4H0GA 1RZ7H 4X0KB 1QLFA 4HAGA 1OAKL 4PJ7B 1Q1JH 2R0ZL 1ZS8A 5D1XC 5B8CB 5F9WB 3UROR 1EMTL 3O9WA 3GMNA 4NBXB 1Q9LA 3E8UH 4IDJL 5JZ7D 1QBAA 2V17H 3B6SA 4NKMA 3SCMA 4LKXB 3VXUD 4KXZH 5EFIB 4S1DC 3QEHA 4HKXA 1FN4A 4JLRB 4ONHB 5DGQA 5F1OB 1GHFH 4H5SA 1ZVSB 1IGIH 2BNRA 5DS8A 1U8HA 4XNUH 2AJSL 4ODWB 1IC4L 4TTGA