4UF7C

Ghanaian henipavirus (gh-m74a) attachment glycoprotein in complex with human ephrinb2
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
142
structure length
138
Chain Sequence
SIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDGQYEYYKVYMVDKDQADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOPROTEIN
publication title Molecular Recognition of Human Ephrinb2 Cell Surface Receptor by an Emergent African Henipavirus.
pubmed doi rcsb
source organism Bat paramyxovirus eid_hel/gh-m74a/gha/2009
molecule tags Viral protein/immune system
total genus 30
structure length 138
sequence length 142
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00812 Ephrin Ephrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4uf7C00
1ILUA 1RZPA 2XXGA 3EH5B 4E9WA 4AKPA 3IEAA 4HIPA 2IDSA 1MZZA 1PLBA 2YAFA 3WG7B 4KOCA 2YAOA 2XX0A 2ZXWB 2DWTA 4JKNA 4PCYA 4F2FA 4HCGA 1BEXA 2TSBA 3H4FA 1IUZA 1W8EA 1A4CA 1R1CA 2B3IA 3UABA 3FU9A 3CDZA 1OCZB 1B3IA 2LLNA 2WSDA 3PCYA 4BWTA 2AANA 2QT6A 2YAEA 2MTAA 2VM3A 5EHFA 3KW7A 1RKRA 1OF0A 4A2FA 2AZUA 5B7FA 1DYZA 1EHKB 3ASOB 4YSDA 1BQ5A 1A3ZA 4YSEA 1J9RA 1PNCA 4GYBA 5D4JA 2ZOOA 4W9ZA 3NP4A 3D12B 1QLEB 5I26A 2PPDA 4E9TA 1JXDA 3OD3A 1IBYA 1AZRA 4HAKA 5B3SB 4GP8B 4YSPA 4DPCX 5D4IA 4YSTA 5F7AA 1ZIBA 3OM3B 1TKWA 5I6NA 4KNUA 5E9NA 5I6MA 1AANA 1NPJA 1ASPA 1M9WA 4GP5B 1OE1A 1PZCA 1KBWA 3SBRA 1JXGA 1ASQA 4GP4B 1CUOA 1SFHA 1MDAA 3NJGA 1GS7A 2MRYA 4G71B 1A4BA 1NTDA 2XXFA 1XMEB 4A2GA 2HX9A 3OQRA 2CJ3A 2DWSA 2FJSA 2HZHA 4DP5X 6PAZA 1GSKA 2J56A 3GDCA 1WA0X 1ETJA 4YVNA 1AS8A 4BDVA 1BAWA 2Y1AA 1NIFA 3NSFA 1AR1B 1T5KA 2EIMB 4KO6A 4YSRA 3CZUB 2BWDA 2VW4A 1DZ0A 2DYRB 2H47C 2HRHA 1L9RA 5B1JC 1PY0A 1OV8A 4AZUA 3S8GB 3L45A 3NJNA 1NINA 2CUAA 3AZUA 3T71A 2XUWA 3AG1B 5B1JA 4DP6X 2XX1A 1V10A 1YLBB 3ZDWA 1NWOA 2EIJB 1SDDA 1KYAA 1BQRA 4E9RA 1PAZA 1ZIAA 3AG3B 4KNTA 3ERXA 4AX3A 1AZBA 1I53A 4ZK8A 2YAMA 1FFTB 1HAUA 2PPEA 5AZUA 2CBPA 3QJRB 4G7QB 1ILSA 7PCYA 1J5CA 3CVCA 3FPYA 3IN2A 3ZBMA 4KO7A 3FU7B 1WS7A 2OCCB 4QLWA 2B08A 3UADA 4NERA 3HB3B 2W88A 3DIVA 3FYIB 1NIAA 1KBVA 3QQXA 1L9PA 2VSKB 1NIBA 2YARA 2BO0A 3NJLA 4G70B 1KCBA 4CSZA 3V9CA 4WKXA 2YAQA 1NIDA 2FQEA 1AOZA 4JHUA 2JFCA 3X2QB 2YQBA 4PAZA 1N70A 1WAEA 3UGEA 1AACA 2XV0A 2BZCA 1AG0A 4YL4A 2QPEB 1SJMA 5AFAA 1SDDB 2DV6A 1IC0A 1RCYA 2BW5A 2FT8A 2X87A 3NJKA 5D4HA 4HCIA 2H5UA 2BWIA 2XVBA 1PLAA 4WTQA 2HRGA 2GC4C 4Q89A 1BXAA 3AY2A 3FT0A 5ANHA 3AG4B 2UXGA 1IKOP 1L9TA 3NYKA 1E5ZA 5I28A 1E30A 4G72B 1NICA 2XV3A 2FQFA 3TBBA 4F7KA 3G5WA 1HAWA 4GXFA 1GS6X 2IWKA 4P5SA 5B1KA 3S3CB 4M3HA 4EF3A 2BW4A 2XV2A 3EF4A 1CURA 2VMJA 4A2HA 1FWXA 4BWWA 4YSAA 1J9SA 2GIMA 4E9YA 2P80D 3PAUA 2GC7C 2UX6A 3C75A 4BWUA 2AZAA 4BXVA 1PCSA 1ZV2A 3ABMB 4AKOA 3IE9A 1PZBA 3SQRA 3NJJA 3FS9A 2GI0A 3OMNB 3S8FB 4W1TA 2Y69B 2PP7A 4DP0X 4KO5A 1PF3A 2J5WA 1ZDQA 5TK4A 3PPSA 2P80A 1AZNA 4BK5C 2FT7A 2TSAA 2YAPA 1KDIA 3NJHA 2J57A 1ID2A 2QPDB 1KCWA 4QKTA 2PPCA 5B7MA 3H56A 1WS8A 2EINB 3T6ZA 3CG8A 2IH9A 1ZDSA 1OCCB 3IN0A 4HHWA 3PLYA 1BXUA 4N4YB 4DP8X 5I5MA 4NAJA 2XLLA 4AI7A 3ABLB 5IY5B 2VN3A 2PPAA 3FU7A 4GY4A 4FA7B 1N68A 4YSQA 4DP1X 2FWLB 1JOIA 2VSMB 3TBCA 3ZX1A 3FYEB 4A66A 2GB2A 4G7RB 2PCYA 2YXVA 1ASOA 1JVOA 1JZIA 2BZ7A 2BP8B 3OMAB 4MFHA 1PZAA 2IDUA 1WA2X 3EHBB 1AS6A 1GR7A 2PP9A 5I6OA 2IDTA 4JHVA 1OE2A 3U25A 3QJVB 4P5RA 4HZ1A 3BQVA 2FQGA 4L0PB 3NSCA 1KDJA 3X1GA 1PLCA 2AFNA 5B1AB 3MBWB 1X9RA 2QDVA 1BYOA 4A68A 1WA1X 1E67A 3SBQA 4TXVB 3N2JA 3T6WA 1NZRA 3FSZA 3JTBA 2FT6A 1W6LA 4DP9X 3QJUB 1XB3A 4F2EA 1W6WA 4AKQA 2IAAC 2FQDA 1NWPA 1KV7A 1BYPA 1OE3A 1RZQA 2CAKA 2Q5BA 3NSDA 3NSYA 1JZEA 2DY2A 3CVBA 2OV0A 2I7SA 1TEFA 1XB6A 5B7EA 2RACA 3PAZA 3T9WA 4G7SB 3RYMA 3GXUB 1E5YA 1NIEA 3TASA 1ADWA 2UXTA 3X1NA 3AG2B 1SHWA 3FQ2A 1CYXA 1HFUA 1JZJA 5A7EA 2GBAA 1ET5A 1JZFA 4HCFA 4E9QA 3QJSB 4E9XA 2YAHA 4YSSA 3ABGA 1SFDA 3UACA 1EZLA 4E9SA 1F56A 2XWZA 4KOBA 1QNIA 2PCFA 2DYSB 1JERA 1IBZA 2HLEB 2VM4A 3EH4B 4K9JA 4FAAB 1OCOB 3AW5A 3MX0B 2R7EB 3NJFA 3WI9A 1URIA 2EILB 5TK2A 3X1EA 3NJMA 1JZHA 2HXAA 1AS7A 1SF3A 3DKHA 2IH8A 2AVFA 3NP3A 1J9TA 3H4HA 2IWFA 1X9UA 9PCYA 1AQ8A 1M56B 3PXLA 5PCYA 4YSOA 3FQYA 3S3DB 1GY2A 3PAVA 3WIAA 3ABKB 3S3BB 1NPNA 1AZUA 1SF5A 1MG2C 3TA4D 3TU6A 5I5JA 2PP8A 4CSPA 2XYBA 1OOWA 1KGYE 2BP8A 2E86A 2QDWA 4A67A 1J5DA 7PAZA 1QHQA 1AIZA 3ZIYA 1CC3A 5I5IA 1XB8A 1BQKA 4DPBX 3N55A 4YSUA 2NRDA 2ZWNA 2GSMB 2J55A 3QPKA 1AAJA 1SHXA 1L9OA 1UATA 2OJ1A 1E65A 1GY1A 1V54B 4DP4X 3NT0A 2WO2B 2A3TA 3GYRA 3OMIB 1BXVA 3IBOA 1TU2A 2FTAA 3WNIA 1ET8A 4UF7C 5I6PA 5F7BA 2HX8A 2GHZA 3FSVA 5AKRA 3CDZB 1GS8A 4DPAX 2YXWA 4UANA 2VW7A 2I7OA 4KNSA 2WO3B 3QJTB 2BP0A 3V9EA 2XU9A 5FC9A 3QJQB 3HEIB 2I85A 3ASNB 5PAZA 1NDTA 4HALA 1PMYA 3FPXA 2Q9OA 3KW8A 4UAHA 5B1BB 2UXFA 4YVUA 3X1BA 1MG3C 3X1FA 2IDQA 4NB7A 1CYWA 4RH4A 3UAAA 3JT2A 1JVLA 3WNJA 1JXFA 1PNDA 1A4AA 4N8UA 4BXSV 4E9VA 4M4RB 2VW6A 3SBPA 4DP7X 1L9SA 2BHFA 6PCYA 4X4KA 2W8CA 4DP2X 2ZONA 4ENZA 1OCRB 1FA4A 5I6LA 2IWEA 1GYCA 3FSWA 2IDFA 2PLTA 2UXVA 4HHGA 2JXMA 2R7EA 1ZPUA 1L9QA 1AZCA 4Q8BA 1J9QA 3FSAA 1VLXA 2BP0B 2CALA 2H3XC 1TEGA 3BVDB 2JKWA 1ET7A 3FQ1A 2HX7A 1V55B 3CVDA 4YSCA 2X88A 3T6XA 3T6VA 1M57B 1SNRA 1A65A 3DTUB 3NJIA 8PAZA 2N0MA 1AG6A 1GW0A 1MZYA 2EIKB 4A2EA 5LDUA 1A8ZA 2PPFA 4KO9A 1JZGA 3WKQA 2CCWA 3UAEA 3EH3B 4A2DA 2FNWA 2UX7A 3FU8A 5I6KA 4BDVB 3WKPA
chains in the Genus database with same CATH superfamily
3V0EA 3AY4A 1WUNT 1GGCH 1ZHBB 2YOCA 1ZWIB 3D69A 4M93B 2DWEB 4GAGL 4EKJA 3P30L 3PWLB 1KT2A 3OKEA 1DBBL 1AGEB 1E8ZA 1UWGL 3NRQA 3DGGB 2LFGA 3IU3B 1WFIA 3WUWB 3UABA 1A14H 2KPNA 5DHMC 4YC2B 4RFNB 4K71B 4PD4K 5J12B 4HQQH 3R8BB 4IRSB 4NJAH 2QFPA 4FI6A 4NZRL 4JFWA 3T4AA 3AB0B 1Y0LB 4NDMA 4G5ZL 1AXSB 1XCQA 5I1EL 2QMJA 1U8HB 2BSRA 3EZJB 4IRJC 4KZ0A 5I1AB 1X5FA 2FHFA 1QFWM 3HRZB 3QAZC 2YK1L 2VC2L 3ATEA 4ONFH 5AAMC 1XGTB 2DQFA 3SKJL 3CFKA 1CFQB 3QRBA 1S7QB 3ZE1E 3HBZA 3QO0A 5A2JH 2NTSP 3ZE0E 1JXDA 1DVZA 4MVBD 4RDQF 3R0MA 3JWNH 5CZXD 5JW5B 4RMSA 5E2WL 2KERA 3B83A 5A7BA 4YSTA 3FFDB 3QIBA 1XZ0A 4BYHA 2CRZA 4F15C 1L7IH 2COQA 2X6BA 4LEXL 5K93A 2G5BB 2UZYB 2OR9H 2UZPA 3FB6B 3RWDA 4F5CA 1LP9E 4OM0H 3BWUC 2NY2D 4H0LC 1OO2A 4LIQL 5JYMA 3MA9H 3DNKA 5D7IF 3P11L 3DROB 2MRYA 3MRQA 1IGTB 1G7PB 4IKIA 2Z7UA 5D1XD 4M7ZC 2O1AA 3SDXF 1BIIA 1RUPH 3OQRA 2NX5B 2HFEB 2OJEB 2V2WB 2Q0ZX 3AU0A 3FK3A 1WFMA 5LGYA 3DSFH 2WHVA 4FFZH 6PAZA 3EDEA 1IAIL 4WQOA 2N7AA 4XP5L 2YUWA 1UD6A 2CO4A 1CICC 3V10A 4F8LA 3T1FA 5BUAA 1TTRA 4UAOC 1NLDL 3UYPB 3V0AC 1FH2A 5SX5K 5CSZA 5F3BA 3WJJC 2HTLC 4KY1H 4L2LA 4W9IC 2LR4A 2ROXA 1KJMB 4S1DD 3AS1A 5F6IB 1INDL 3LQAC 3D3VA 1TR7A 3Q06A 4KRNA 2V9RA 2RIKA 2XCMC 5T1LA 1XGQB 3EKCA 3O2WL 3AG1B 5E2UL 1CLCA 4JN1H 3WIIH 5B8CA 2PTUA 4EMZA 5DJ6A 1FN4A 1MAML 3AG3B 2AK4B 2C1PA 4GKSB 4PRPB 4DVRH 5BPPA 4OCSH 1NEPA 3EFFB 1BAFH 1E2ZA 1T3FA 3B2MA 3VUAA 2YAMA 5KVDE 3FN9A 4HOMA 4NFDA 1IJNA 4HWNA 1R6VA 4NCC2 4WCYH 5ICYB 5J6GA 4PJBB 4J4PC 3FONB 4MA7L 2DM3A 1A66A 1VFAA 4PJHE 1DJIA 4HLJA 3NZSA 5EBMA 4JPWL 2XPYA 4JDZA 2UVFA 3HR6A 2LGNA 2MFNA 4HFWA 2FSEB 4M1GL 2HMIC 3QQXA 2L8AA 1EEUA 3MROB 4I3RH 1DBJL 3ECUA 3HVNA 2ZKHL 4KBPA 1RUKH 2LFEA 1LM8V 1NIDA 2R23A 3U9PH 4N0FB 3X2QB 3GUTB 3SDDA 1EDYA 3E3QE 1WEJL 2IGTA 4HUKB 4I0PA 1KLGB 1AQKH 2CDGB 2R27A 3AXHA 4FQXC 4E41E 3GLAA 4FP8H 2COVD 3M17B 1SJMA 4R0LA 1NL0H 1EVUA 3ZL2A 2FO4B 5I1IH 4UV4L 4U6TA 5TGBA 2VMFA 4OCWL 4OCMC 2MCAA 2P5PA 4OF6A 4OLUL 3Q01A 3VXQB 4C57C 1AY1H 1FBIL 1ZXQA 4I9WE 5DJ2B 3EYFA 5C0AB 3LKOB 2OMXA 3DXAB 4KKAD 1UACL 4HWEL 4YGAB 1G4RA 1P9MC 5E9DA 2HFGL 3BSZH 3NFPA 3V0DA 5DRNA 3INUL 5I74C 3A24A 4Y1TA 2H1XA 1N59A 4WIQA 1E30A 1DANT 3FUMA 4O2CB 1V7MH 3IETA 5C0BD 2VLRA 1S78C 4MXWL 3TLRA 2X4OB 4HZLA 2IAMD 3HOGA 1XAUA 4U7KA 1AR1C 3FCUB 4WO4B 3SE8L 2GYSA 3DECA 2FWUA 2WN2A 4HCRA 3ZDYF 3IWUA 2X4SA 3N9GL 4JMNA 4R96B 3TA3C 4G7VH 4J3SA 3IT8D 2CR0A 3UZEC 4A55A 2N7SA 4N5UA 5IEHA 2GC7C 4KMTH 4QWWC 4JFED 3KLAA 4M02A 2DWDB 3TX4A 4PHZA 1OGAD 3DC0A 4HOWA 4Z3IA 5C2UB 4M1DL 1Y07A 5JDSA 4Y4FC 2PP7A 2DYPA 2PNDA 1JF5A 1P53A 4GMTL 1ZDQA 3LZNA 4EZKA 1KJ3L 3HZKA 4FFYL 4PI2A 3QQ9C 2AKRA 2YBGA 4IIQB 4NRXA 3SZKC 4EDXA 4Q6KA 4RWHA 3BYYA 5EIIA 3MOQA 1KGCD 4BK8A 4RISL 3C2AH 1SUJA 2DICA 4YEFA 4S0HA 4Q9QL 1NUFA 4KH9A 3CZFB 2YD8A 3ZT5A 1R3JB 5K9OA 4L0YA 5I23A 1KG0B 2Y4SA 4ZFGL 5AVVB 1DQMH 1N4XH 2DTSA 3HA0A 3Q13A 4A66A 1WAAE 3BLPX 3L4CA 2V4LA 4UQ2B 2H32A 3QUZC 4U05A 1JVOA 5C3TA 5HI5C 3FCGA 2YD9A 3U0TA 4B9IA 3R0NA 1SBSL 3L5XH 4Z1PA 2PP9A 5I6OA 3DBXB 5DJ0A 3KWWB 3REVA 1W72B 1KY6A 4LKCA 5E99L 1QWUA 4RRPM 3P2TA 1IZKA 4FLSA 1MFAL 3QUYA 2APTA 2FYVA 4HJSA 1TTFA 3NSCA 4X0KB 3FT3B 1I3RB 3PRZA 4ETQB 3MLUH 3ORJA 5E2TL 5D7LE 3TONA 4BFFA 5I1CL 2EO9A 4PJ9A 4NRYB 3N40F 3ILDA 1NFDB 4Y0GA 2A9DA 1E5BA 1OQOA 4DESA 1MELA 4DO5A 3FF8A 4JJHA 2P42B 1NZRA 2R9HD 5E94A 1J05B 2QHLA 2HJKA 4Y16A 3MV8A 3CPUA 4P3DB 2BK8A 4N1HB 4RBPK 1KLFB 2P26A 3FUKA 1WBYB 3CFIC 4GRLC 1CVSC 5L6YH 4U3HA 1T2XA 3BEVB 3BSGA 3HBGA 4B53A 2JKNA 4RWYH 4ELMB 1X7QA 1TCMA 1J1XH 2CJSA 5CBEB 4Z3FA 2AJSH 3MRBB 2OZ4H 2CIKB 3VQ1C 4JFZH 4WHTB 4WO0A 5D2LF 2VR3A 2VL5B 3KWXA 5E7BA 5B7EA 3BWSA 3DO4A 1V7NL 1HQRA 3TZVA 3GWJA 4L1DA 4A37A 1SEQL 2GK2A 3NQIA 3IF1B 5C0DA 2UXTA 5D7SL 4C4KO 1QHPA 2PR4L 3NFSH 4E9QA 3R8QA 4DKEL 3QJSB 4X5XA 4E68A 3LS4H 1HINH 4JAMA 1GAFL 1J8HE 4R4ND 1G6RH 5D7IA 4NHCH 2JK5A 2VXQA 4OIBA 1C9SA 1BZDA 1EZLA 4FI7A 4KJWD 1PKQB 1F56A 1IB5A 3CVIH 3SDXA 3UTTD 1IBZA 4MMZC 4O4YL 4BFOA 4R4FL 2YUZA 3VFNA 1U4EA 4MAYD 3UXFA 2JQMA 4PWJA 1LEKA 3AWGA 4MJJA 1FVEA 4UBDC 4ZPTB 2O5NA 3DX1A 4JY4B 5E1IA 2VB5A 3VXMB 3STZB 1SF3A 3DVNB 2AVFA 3RWJB 3TIDB 1KY7A 3T8MA 1J9TA 4PJAE 5AZ2H 1MRCH 2WQXA 4LVNC 4XWGH 4WU5A 1R3IH 3UC0L 1LQSR 3O3DB 1U41A 3H54A 3CFBA 2D4DA 1KC5H 3O11B 1B0GA 3OJVC 3S3BB 2FK9A 2DQDH 1CF8L 4WKZA 1ZGLP 2C3VB 3LNHA 4PJ6A 5E8EB 1J5DA 4PJGE 2HRPL 3IK2A 1SOQA 3S4SA 1T1YA 2MPAL 3QUXA 4D2NA 3WYRA 3ROOB 5I5IA 3M1CA 5BO1H 3B8YA 3WKNA 5AOJA 5C3LD 5I71C 1N3NA 2FLMA 2YN5A 1WHPA 3WXWL 1PX3A 4GQRA 1EXUB 3PGDA 4KVCL 1QO3A 4M3KB 1T83A 4R8WL 4YO0B 5MEPB 3T77A 5KYXA 3CCHA 1LD9B 4GBXA 3VE0B 1PDKA 3GBLA 4V2CB 5GGTA 2IFFH 2WB1A 1BX2B 3NT0A 3RU8L 5E1AB 4KUZL 3RVTC 1X5AA 3SYAA 1F1AA 1L0QA 1FYTB 3QS3A 4UQBA 3TS8A 1FL6B 2ARJQ 3QEHB 5AVQB 3KYMA 2XG4A 3SO3C 4U1JB 3MLWL 1QYGL 4PVMA 4YK4C 3GSOA 4GSUA 4JFQB 3UBGA 5I1KL 3TO4A 2IANE 2VERA 3T0AA 3ARZA 2PCXA 1P84K 3KYNB 3OBAA 1K3ZA 3RGVD 4BGLA 3AMLA 2W65B 3VQLA 5IVXB 1GJWA 4NM8H 5JIPA 4D7PA 3DSNA 2Q9OA 2CO1A 1KXQE 3T0EA 1HSAB 1Y1DA 4S2SB 1JHTB 2IDQA 3GJFA 2VH5H 4IRJB 5DRWB 1ZLUH 3ARVA 1A7QL 4ZMVA 4R7XA 5C0CB 1CE6B 3NZHL 4NAQA 4GG6E 3QAZB 5I0ZA 3MRIB 3BVXA 2ATKB 4U31A 4FA8A 2XV6B 1YO4A 3KNBB 4DP7X 1ZCRA 5EZLB 3W0WE 3N85H 1U8QB 1TU2B 1ACYL 1I7ZB 1LO2L 4NEHB 4ENZA 1IGCL 8FABA 1ZJBA 1FQ9C 2YGPA 2UZIH 2Z4QA 3MLVL 3UAFA 4I85A 1GGBL 3VFPB 3TFKC 3FO2B 4HHGA 1JGVL 4HQQL 2VZUA 3BVVA 3C6EA 1S7RA 3AREA 3F04A 4NJAL 1BG1A 2NNAA 1S9WA 4MJ5B 3FF7A 3PJNA 1DN2A 4F15B 4N8CL 3AAZB 3HJEA 4R7LA 3DOIA 3BN9C 1DP0A 5F1IA 1NC2D 1OOAA 4JFHD 2OMTA 1F4WH 5SWSE 3WD5H 3FQXB 1NCDL 1M6OA 2VDRB 3BQUC 1ET7A 5JA8B 1BZ9A 4NNYB 4WFGE 1HDMA 1CFBA 2X9YA 3KEHA 4ONFL 1OPGH 5D5ME 4M7ZB 2HT4C 3BKMH 2XWJA 4MMXA 3V6FA 4LT7A 1UXWA 2A9CA 5JDJA 1WISA 2N3JA 2EIKB 2F58H 4K55A 5IG7B 3C60C 1QBMH 1S9VB 3OJDA 3UAEA 1ZK5A 5KWYC 1IT9H 4X8XA 4QTHB 4XC1H 4BDVB 2EE3A 1NJ9A 3QRFM 1CICB 2OL3H 5ACLA 1L7IL 4UAOB 2N1KA 4AUYA 5JIIA 5AKSA 4GW1B 5T5NG 5FYLD 5KSAC 4IS6B 2XX0A 2K7PA 3TBVA 4F2FA 1IAKA 5F88A 1P0SE 1XCTB 4NO0A 2IH3B 3O8XA 3T2NL 3CMOH 2ZXCA 4MA1C 4TSAH 1TDQA 3FU9A 1OK0A 2ITCA 1JF1B 1OCZB 2FL5A 4KY2A 4XZ4A 3T4AC 3U0PA 3H42H 1NBVL 2PWEA 1I9JL 3CIAA 4RMWA 2XTLA 4W9EC 1AP2B 4L48A 1F4YH 4I18A 4U1SA 3X11B 3L5JA 4L23A 4O02B 2OTUA 1AHMA 5DT1H 5I24A 5FW7A 3HAEH 4M6OL 3VFSB 1H8SA 1XTMA 2MEJB 3ASOB 3T0XA 4KY1L 2BY3A 4TTDC 3T0DA 1N2RA 1T0OA 2WJ7A 4Y7OC 2VQUA 5EOTB 5BNXD 1Q0XL 2DQHH 4U3XA 5AYTA 1MRFL 3HPJB 4AK1A 5DS8B 1EZUA 1UJTA 4LOFA 1S4IA 1JMXA 3MO1A 5JZ7C 4TLUA 2IWGA 2B77A 3OD3A 3QIBC 4P07A 2ICEA 1DBKH 3LKSA 1J9CT 3L3DA 4DPCX 4AYMC 2XQYG 2B1HH 5I73C 1BAFL 1BFOA 4NC1E 1KIRB 4FQXB 3OKLA 5CCKH 3F58H 4OAWA 4NHUB 5I1GH 1KTDA 4NQTA 3DPBA 2K45A 4BHUI 2DOCA 4YEEA 5CJXC 5D2LA 1JK9A 3NCYS 4ANUA 4AG4L 4PP2A 2X4UA 2LTQC 4X9HA 2X2YA 1X7SA 2G3ZA 4QHUA 4I3RL 2DWSA 2HZHA 1OY3B 1OSZA 4MD0A 5I74B 2EVIA 3U9PL 5IQ9A 3WDHA 3RX8A 1UTDA 3FOMB 1HE8A 1O7DC 1KCKA 3GBMH 1AR1B 4PCSA 1NCWH 4OJFL 1WBZB 1I1AA 1T80A 1EDHA 3ILEA 1NGPH 5I1IL 3TA3B 1P4LB 2FATH 3D39B 1IBHA 5LBSL 1R5WB 3NJNA 1EPFA 1JSYA 1MHCA 2HWZH 3SOBL 1T7WA 3QJFB 5F89B 3NIFB 5C0AD 3SE9H 2ZWLT 1PG7L 3KPSA 4KJPD 3K91A 4Y4FB 3N6YA 5FOBB 3Q3GB 4FKKA 4JDEB 1FZOB 2VN7A 3BSZL 2H7WA 4KI5F 5TF1L 3S3JA 2HFFB 2E76C 1UH2A 2WTRB 1KFGA 3BP5A 1H19A 3INOA 3ELAT 4X4XB 1FORH 5GGSA 1HI6B 5BOZG 5EU6A 2F9BT 2F53A 2Z0BA 4Q52A 5F7EL 2CRYA 2OLDA 4ALAL 1NANH 1CGSH 1HILB 4L5FH 4UMGA 4QRRA 3LN4B 4PJ8A 2VSKB 1KPVA 2FIRT 2HJFB 4Y5YA 5KYUA 2QVKA 5FECB 4PRIB 1OTUC 3GMMB 3SDDC 4N9GB 3R18A 2VDLB 4HHAA 5I6XC 1M4KA 3QUZB 3RIAK 4JHAL 3S4SG 3EDDA 3NUKA 1N70A 2BHZA 1D5BB 1WAEA 3DRQB 4PP1D 3RZCA 1HWHB 5BW7A 3HUJE 1MWAB 4H0HB 3V4PH 5F72S 3N43F 3T65B 5GGVH 1UA6L 4YGVB 1G4MA 4TQEL 3II1A 4C54A 3QDJB 3BWZA 5H35B 1HL5A 4WTQA 2HRGA 5I0YA 1X6LA 4P5TD 4DJMA 5DWUL 2XYCA 2AJXH 4QRFA 5F2FA 4J5VA 1MXGA 2QELA 4BSWA 4ANVA 3QNFA 1CD9B 1U8CA 3ARYA 1RPKA 1TPXC 5I28A 4OF7A 1LE5A 3L5XL 1TMCB 1NICA 1R17A 2GI7A 1A5FH 2Q6WB 1HAWA 5HDQH 4D9QE 1XIWD 1SXAA 2HG5A 4PV9A 5JHDE 4I9WD 3W39A 5L2JB 3WTUA 2OYPA 2OTWB 4NUGH 4JKPH 3P54A 3EF4A 4Z7NB 2Z92B 3B5TA 3QXAA 3TBTB 1JWUB 5EZJA 12E8H 3WNKA 1F2XK 2VDNH 1FZKB 2D9QB 4UQEA 1ZAGA 3VVVA 4OY9A 1B0RB 4FNUA 2QPFA 1QZNA 2JCCE 4LBEA 5ALCL 2GTZA 3N0AA 5FX3A 2Z0UA 4ZUTA 2HKHL 3RWCB 1N0LA 1MNUH 1OP4A 3AXLB 4RAUB 3F62A 2UY7B 3I6GA 5I0XA 1WQVT 4JNXA 3FFCD 5IESL 3QWRD 1FAKT 2Z6FA 5CCHE 4MS8C 1KJ2H 4PJDF 1XF3A 4YNYA 3R1GH 2B7DT 3FCSB 5L6YL 2BY2A 4NO3B 4MMZB 5HBBA 2IH9A 4NO5B 2R2CA 2AJSL 1R19A 4H8HA 1YJDH 3QP3A 3F85A 4U1KB 3NA9H 2WTPA 2DMKA 4NYLA 5HI4D 4OI9A 1MPAH 2YD3A 3P4MB 1BVKA 1SJEA 3RTQA 4KJQD 2F7IA 4LVNB 3MRJB 4AQAA 4MFHA 3HE6A 2IEPA 4J6RH 5IBTL 3NFSL 4UNVA 4ZXBA 3FB8A 3CVHB 3QUYC 2PABA 2IIJA 3V4VB 1G6RL 3D06A 4HPYH 3ZMRA 2B8OT 3L4UA 1Y18B 3BAKA 5DYOB 5TTRA 3I75A 5GGUB 3SDCA 5AYUL 1RULL 2R4RL 3L1EA 3CVIL 1R3KA 5HD8D 5I71B 4RQQB 4KK5C 3KPMB 4QXGH 3O0RL 5FO8A 4QLRA 1PY4A 5FYLH 2XKUA 1R3LB 4H0GA 4HC1A 4YDKH 5I9QC 3SEPA 2XC8A 1F4AA 5IHLB 2EEAA 5FF6A 2GQHA 4B9KC 1MJ8L 1AD9B 1KC5L 5I1JH 2ETWA 5DVKA 3US9A 1HCYA 3SO3B 2IAAC 4YHOH 1KXHA 4I2XE 1E27B 3NSDA 3NIGF 3BVWA 1XZWA 2A38A 1O6SA 5DJCB 5BO1L 3TZVC 3MGAA 4UTAH 5IF0A 5SV3A 4Z18A 1H15B 3CXDH 3JTTA 1IKFH 3I50L 2R2EA 2Y1VA 2E7MA 2AP2A 4L1SA 3CFJA 3ETBJ 5E00A 1XCWA 3BKJH 3Q1SH 4LVEA 3H9SA 2IFFL 2IPTH 3U83A 4ZNEA 2P5EA 1I8MB 2BSSB 4ODVH 5C07B 3IJYA 3TJHC 3ARFA 3QNZB 5FWRA 4ACTA 5GS0H 2BS71 1TTAA 3KBFA 2A6IA 2C9RA 4MSWA 4UDTB 2AXWA 3LMJH 4W81A 4D0CB 4GEIA 3CDFA 3RGBA 4UM9B 4U1NA 5C0FA 4OBRA 3BEWA 5CFHA 2DYSB 3QEGH 2EXSA 4P3CL 3VI3E 4B60A 1B88A 2LE9A 1NA8A 5E5MB 3PIQA 4CW1B 5L4FA 4DKFL 2CBOA 5MENA 4IMLB 1J8HD 2HXAA 4DVBA 4NM8L 1INEH 5FK9A 3WLWD 1G7MA 2AJYL 1T2JA 4IEFB 3U4EB 1AMYA 1CTNA 1RP8A 4KQ4L 9PCYA 1JNJA 3WL9B 2P48B 1RIHH 3PXLA 2ENPA 4IRJD 1AKJB 4LCIH 1XEDA 4Y4HA 3U9WA 5IMLA 3HG1E 2FBRA 2R1WB 4FQQB 4EO5A 1D7CA 5C0CD 4P9HL 1IQWH 2UVEA 3BQUB 3N5AA 3QUXC 1KB3A 1OM9A 3V0WL 4L4TE 5HGAB 3VW3H 3IMWA 4N8PA 3D0VB 3LHPL 4HUMB 3VXRE 1H3XA 4RIRB 4QGTA 2E27H 4JFXA 1T83C 3GHEH 4NC2B 4L1LA 5EU4A 1MHPL 4JO3H 3C60B 1JV2A 4GBXC 2UZIL 4KK8C 5DMJB 2R0KH 3WAKA 4H8QA 3D69B 2IOOA 1KT2B 1AGCA 1FAIL 2WO2B 3B34A 3OKEB 4HIJA 4X5PA 1X44A 4I3SH 5KSAB 5FUZH 3WD5L 2DI8A 1RFDH 2IFGA 3TO4C 5DK3A 1LNUA 5HYJA 2Y1YA 3A67L 2FO8A 5FB8A 3JWOC 5HHPA 1Z3GH 4MA1B 5CLYA 2DQMA 1EGJH 4F7PB 4H7VA 1BQUA 4AL8C 3T4AB 1BQLH 2VC2B 3GIZL 3TVMC 3AFLA 3J2PA 1XCQB 2F58L 3HEIB 4UT9L 4N2AA 2BSRB 4RZCA 4HALA 4L8BA 3WUZA 3FPXA 4ZUUA 2AQ1A 3X1FA 1RIUL 2IAND 3K46A 5HI3C 1EJ6A 4R90L 4A38A 4OCLC 3US0A 1RZFL 3WNJA 2DQFB 1TQWA 1Q9OA 1ZEAH 3N04A 4PS7A 3CFKB 3CLFH 2GG1A 2CA4A 5HHNA 3TNMA 4E9VA 1J5IA 3QO0B 3TJPA 2FB4L 2K4AA 4FFWC 2CGRH 4TSAL 3ET9F 1U4FA 3QIBB 1FA4A 4J3OF 1XZ0B 1U21A 3O6LH 4JB9L 3BISA 3U1QA 4OZIE 3HMXH 3CZKA 4XPFL 3RWDB 5I73B 1MVUA 4JFFE 1KLUA 5GJTH 5IMOA 3IDYC 4K94L 4L3EE 4N26A 3W0WD 1ZGLA 2EVFA 2I9TA 1DQLH 1P69B 1ZY9A 5FOJA 4LNRA 2QL1A 3MRQB 5H4YA 1EO8H 2YBRB 3B1TA 4MMXC 3O3AA 1BIIB 3UTQA 3IGAA 3T6XA 3NCFB 2LTQB 2HMID 1IO4C 3CK0L 4ZQTA 3CN3A 5GISH 2FWOA 4XC3L 3GIVA 1I3VA 3WN5A 1JZGA 1M3JA 5SWSD 1HWGB 3G6JE 4IJ3C 3T1FB 4K2UH 3VDAA 5CSZB 3OVUB 4WFGD 5D72L 4PRHA 3SE3A 2JELH 4JE4B 3WJLA 2HT3D 5HHVH 4HD5A 1DVYA 4PJDA 3H6AA 1J1PH 3D3VB 1VEPA 5T1DH 3DIDA 1TFPA 3O8XC 4JKNA 4N68A 4PCYA 4Z7VF 1K2DA 3OLIA 4NKDB 4R5VA 5T1LB 4O58L 5HPMA 3OC5A 5B8CB 3CSTA 2DM7A 1R24A 3EYQD 3F84A 4TULL 5DJ6B 4ZAKD 4XGZA 4QJ4B 1FN4B 2FX7H 4CA4A 3Q2NA 2Y5EA 1P4BL 2C1PB 1YEGH 3POCA 3ZUCA 3G5VA 1BZ7B 3ZHDA 3ZO9A 3EJCA 4ELDA 4I18C 1T3FB 4YDIH 5A2LH 2K4WA 2G2PA 2RHEA 4AQEA 1TVHA 5BRQA 4LSVH 4X42A 1S5IH 1TJMA 5J6GB 2XFXA 4ZMTA 3U30C 1S78D 1TUPA 4XB7A 1EHKB 1QZ1A 1VFAB 3GBML 3N50A 4IIZA 4Q6IC 4JDZB 1XL6A 3PV6A 3QHTC 4HFWB 4AYSA 5AALA 4HS6A 2J72A 2PWGA 3MLRL 3OSVA 5I8KH 3VA6A 5C8JA 5E2JA 2NY7H 1WZAA 4AIOA 1ZHLA 2ICCA 5C08A 3EGXA 2R23B 3V6ZA 2PYEA 2R4SH 3BUBA 5IQ7H 3L7FA 3SDDB 5I15L 5I6XB 1XH3A 2Y7SA 3KBPA 3PP3H 4I0PB 4PBXA 1W0WA 1IZJA 5KANG 3VXPA 5ID0A 1QI3A 5FUCC 1ESOA 1F8TH 3FH7A 3QK0A 4JFDD 2X6UA 1WD8A 3RNKB 3SZ6A 3L2MA 1EV2E 5TGBB 4FXLA 5HVWA 2FBJH 1SJHA 2WUBH 4L8DB 2ZKYA 4F2ME 1MCHA 3SYPA 1C8QA 5T8IA 1YECH 3WEBA 1CGSL 3EYFB 2OMXB 4OSUL 3ZE2E 1ZTXE 5CR8A 1HT6A 5E9DB 4BQBA 3NFPB 1AI1H 2KUTA 3MUZ1 3L4XA 3MRPA 4AC2A 1N59B 3CQPA 5AW3B 3QUZD 1GSKA 1TSHA 5HI5D 4ANWA 3UO8B 1TPXB 1F0LA 3J8F7 3NFNA 3RRQA 1I1AC 2VZSA 2X4SB 3GB7B 3RWGA 2WQRA 4R4BA 2Y1AA 2JJTA 3IDXL 4K23H 3PP4H 2ICES 1L4IA 3QJHB 2GFBA 4WTXA 3HLAA 3KLAB 3VGEA 5BS0E 3ZMEA 2WLIA 3KCPA 3JXAA 2XBTA 3VXSA 4NWUL 1XGZA 1OD7A 2FH8A 2FIKA 2NOYA 2CUAA 4YDJA 5JDSB 4M5ZH 4XMKH 4ZFOL 5IW1A 3QZBA 2DYPB 2BINA 3ATBA 1IBBA 5EEWA 1SDDA 3T2LA 1KYAA 4Y2OA 3HZKB 1R47A 4ZO6A 2AKRB 4NRXB 2A74C 2VLJA 2Q3AA 5EIIB 1ZANH 3CBRA 3JWDH 3FH8A 1S7WA 4I1RA 2EKSA 4C47A 4XWOC 4XAWL 3V4UH 4GRLD 5HDQL 2M83A 2YEZB 5G2NA 4XPHH 3GSWA 5EZIL 5DEFA 4PJ8C 2AI0H 3RVXD 1NOAA 5K9OB 1WS7A 4JKPL 2WXMA 1ZSDB 3DX9B 3Q1EA 1KBGH 4OIIL 1U93A 4GKNA 4Y5YC 1DUYA 2VDNL 2AV7A 3APCA 4WEBL 5CUSH 2K9FB 2H32B 2OP4L 2DLTA 5DVPA 1TSRA 1IE5A 1ZLUK 1NH6A 3TGXA 3U0TB 3ECBA 4PGJA 3REVB 2FQEA 1A1NA 4LKCB 4JHUA 1ZS8A 2XTJC 5L8LB 1ZPLA 2A9ML 2BIOA 1IGJA 4ONHA 3NPSC 3QUYB 4UIMA 5IZ7A 1QTSA 2X4NB 4ZOEA 2DQGH 4MQXC 3NIDE 4HLEA 2V33A 1GC1C 3ZTJH 3AU1A 3WCYA 4GXVH 2FT8A 1P6AB 3NJKA 4LBAA 5KVFE 2NY6C 1YJDL 2VO5A 3O2DL 5HP5A 4UQDA 4LMQI 3C9NA 4PJIB 2J8UF 4NBYB 5E94B 2WK2A 2HJKB 5I9QB 3MV8B 3P0YH 5AOLA 1F02I 5B22A 4DT2A 4MNQE 1U91A 4QHKJ 1OANA 1CE1L 3GI9H 3FN0H 4PLNC 5ITFA 2XWXA 3OAUL 4X7DC 3B2UC 1PQZA 4F9LA 4I1PA 1HQRB 3TZVB 1MVFA 5J3HC 2QQLH 5D6DA 5C0DB 4ICWA 1PCSA 3ABMB 1HEJC 5CWSA 4D9QD 3PE9A 4X5XB 1B90A 3W9DB 2GI0A 4JAMB 3IAQA 1AZVA 4W1TA 5D7IB 4PJCF 2JK5B 1ZS2A 3KXFA 2VAJA 1OD9A 4EKXA 2FEJA 3WY3A 3KYKH 4DERA 1O7SA 3SDXB 3VXUE 4GRWE 5I1JL 4EI6A 3VFNB 4WI9A 4YHOL 2RCSH 1LEKB 2A6JA 3JVFC 2EINB 1FVEB 3DUUA 3OZKA 5DZLA 3U4BL 5JW4R 2E7LA 4K3EL 1OCCB 1MFMA 3QXTA 4TNEA 1F3JA 4MA3A 1M1SA 5DVOA 3X3FL 4HKXA 2PPAA 3BZDA 3CXDL 3FU7A 1IKFL 4WU5B 3RI5F 4RFOH 3CFBB 3HE6C 3KR3H 4DGIH 3MYZA 1WD9A 4WKZB 3KYAA 1UFUA 3BI9X 1CBVL 4HV8B 5C07D 4ODVL 1D6VL 3QEQE 4YPJA 4FXKC 3EOYG 3LIZH 3SHSA 3S4SB 1BD2D 5GS0L 2AF2A 4WJ5B 1T1YB 2ZG3A 3QUXB 3CHQA 5C0NC 5I0VA 2GTWA 1XTLA 1KCVL 4LCCA 2YSSA 4EI5A 2BNQE 4HJIA 1ONQA 2EJ1A 3PGDB 1QO3B 3T77B 5LG1A 4EN3A 3CCHB 2EXWD 4PS3A 3VRLF 4GBXB 4G9FA 4QHPA 4XE0A 5EBLA 1ZTMA 1NBYA 1INEL 4I9XA 3I02A 3F64A 2AQNA 3ARSA 1E67A 2WLJA 3UPAA 3U2SB 3NEXA 4J1UA 1HQ4A 2P44B 2WOBA 3KYMB 1OAJA 4YHKL 1AKJD 2XG4B 1SYVA 5DFTA 3T4YA 3GSOB 1L7TL 1E28A 2XN9E 3TO4B 5TF0A 1W6WA 2QLVB 3VW3L 4JPKH 1E8XA 2E5EA 5J0BA 2EYRA 1BYPA 2VRAA 2Q7NA 4HJGA 3HN8A 3CVBA 3GHEL 5DUBA 3A6BH 3DSNB 1IM3D 4JO3L 1RZKH 2R0KL 4FMFA 3GJFB 4IKJA 4K3DH 3EO9H 3ARFC 4GIOA 3B9EA 2W0LA 5AWNH 1CLOH 1VACA 3VMPA 2H2SC 1NOFA 5KSAD 5FUZL 3S96A 8FABB 5CF3A 1SBBA 2YD2A 2KH2B 2Z4QB 3LDBC 2VM4A 5B3NA 3EF7A 1WFJA 1S7RB 3AREB 1FZJA 2NNAB 2A1WH 1BQLL 4YS4A 1J0ZA 4P2YA 2K78A 4QKXB 2WVSA 4M6MH 4Y4HC 3L9BA 3TESA 4WF7A 1WWBX 2I27N 2OMTB 3IDYB 1M6OB 4GAJH 3Q2CA 2VDOB 4DK3A 1BZ9B 3PAVA 1U95B 1HDMB 1V8HA 3I84A 2YZ1A 1BJ8A 1ZEAL 4MMXB 1KGYE 2XWJB 4TTDD 3V6FB 2IXQA 2QDWA 3CLFL 1UXWB 2LABA 1QHQA 2B20A 3KHOA 2ZOLA 5GZOA 4XO5A 4R84A 1UWEL 3QIUA 3OJDB 5DD0H 1QKZH 1SN0A 1UA3A 4YHPA 3VH8G 2A9NH 4GI8A 2WQ8A 5HDOA 4IJ3B 4GQ9H 5C0JB 1UATA 2HT2D 1WUZA 4L4TD 1HXYA 1RI8A 3VTMA 4HPOL 4DP4X 3VXRD 1OF2A 2BS8A 3TBVB 1AOHA 1IAKB 5BJTA 2UYLB 1AE6H 4HISA 1E3FA 1DQLL 4NO0B 3I2CH 1K5NB 1U8PA 3O8XB 5ETUA 5I6PA 5A6IA 3S3SA 1QR4A 5KS9A 3MJ9L 2DJ4A 2ITCB 4E5XG 2HN7A 2FL5B 2K6ZA 4QI3A 3RIAF 2I25N 3U0PB 3K2MC 3WDJA 2YJQA 3IDUA 4FQPA 4GQZA 2XRAL 1OALA 1Z9LA 2BP0A 4I18B 3C5ZA 2R15A 1KEMH 1UT9A 3KD4A 4K7PY 4U1SB 4ZO7A 3MREA 1XF5A 2OTUB 1OGSA 4NQSA 3L1OH 5LUMA 4PW3A 4K2UL 5JLZA 3QYNA 2CDFA 4LL9A 3QFDA 4LLVA 4MTMA 3WFCH 3N3EA 1U0QA 4LU5L 3U30B 5L9DL 3RY6A 1X5KA 1DR9A 3P73A 4LRIA 4N2FA 3PABB 1N2RB 4RH4A 4IRZH 1J1PL 3KLSA 1CDUA 2NTFA 4P99A 1X9LA 2Y7LA 4JN2A 5I2IA 2E9WA 3OGCA 5IKCA 2C7FA 2J8UA 5JHLA 5T1JA 1LE9A 2FX7L 3L54A 3MOBH 3U0WL 1F4HA 1GOHA 1BFOB 3UO1H 5CR1A 2PLTA 4GINA 4YDIL 4JPIA 3RVWC 2DW5A 1P7QA 2JXMA 3L9EA 3FXIC 2OR7A 1UADC 4MAUL 4OAWB 3T08A 1URZA 4AEEA 1KTDB 3FBKA 1O5DT 3DPBB 2LU4A 2XBZA 1NCCH 4X8JA 2V5TA 5J4MA 5D2LB 1JK9B 2CALA 1YQVH 1AGBA 4PP2B 2VLME 1Y6KR 1XSIA 2X4UB 3LH2L 3R4RA 3AROA 3MUGA 5D2NC 5TDNA 2WWMC 4LSRH 4QHUB 4NBXB 1NCIA 4GT0A 2APFA 3WN5C 1ZA3A 4JFFD 3ETTA 3KJ4B 4L3ED 1OSZB 1UD3A 5DHYA 4MD0B 4X9BA 5JQHC 2G3NA 1YEFL 1OTUD 1FNAA 2FJFA 5ALBH 4FZ8H 3SE3C 1AO7E 1F3RB 5IQ7L 3TF4A 4AY0A 3FT4A 5DD5L 4S1SH 1BW8A 1BF2A 2OSXA 4G6AC 5KSVA 8CGTA 1F8TL 1I1AB 2EDTA 3B7RL 3IEAA 4K15A 4HIPA 2Q8BH 4FQLH 4L3FA 4B0MM 2Y22A 3IFOA 3FZUD 4G6FD 4PGEB 3WG7B 3MNWA 2FBJL 1NGQL 1ZHKA 4HJEA 3F7VA 1VZHA 3M86A 1MHCB 3T1WA 1LO3L 1W8EA 4TUOA 1A4CA 2ZIDA 3D7PA 3KPSB 3HNSL 4WUKL 3DI3B 3KPOB 4L9DA 3ZYZA 3MLYL 1SVCP 1AI1L 2IGFL 5E4EC 2ZPKH 2BIMA 2PR9A 2JKTM 3K8LA 3BP5B 3PQYD 2A74B 3QCUH 1E5UI 1I8IA 1ZJAA 5GGSB 2WBJA 1KENL 5EU6B 3FB5A 1CD1A 1QFUH 3VA2C 3ARTA 4I88A 4S0SD 3B9KA 3QXDA 1MCKA 4PJ8B 4YSEA 3WY2A 4IK6A 2M1KA 3BFQG 3HNVH 3GMNA 4OCYL 5F6HJ 4QHKI 4OT1L 1PG7W 5KYUB 4Y5YB 2A99A 1FFOA 3MCLH 3D12B 4G8GA 4HWZA 3LB6D 4HHAB 4M4RA 2EYTA 1FO0A 2D3LA 4I0CC 2BVPA 4GP8B 1CZ8H 1JHKH 3RZCB 3PS6A 2LVEA 1E4KA 1TZ8A 4DGYH 4NN7C 5FHAH 4QRAA 2XTJB 4YPGA 2ZUYA 2NY5H 2XWBA 3O6FC 5A2KH 3NPSB 2GJJA 3QNYA 2CMRH 2XDHA 4MCZA 4B9PA 1J12A 3OR7A 1I1FA 3CQQA 4YHML 3JV4B 3V4UL 4GP4B 4LPUA 3G6DH 4CC1A 1S7XA 2NY6B 1U92A 3IPBA 3LZQA 3PY9A 4F3FA 3Q2WA 4XNQA 5C0RH 4R2GC 3LZFH 4BSWB 1KPUA 2CJ3A 3EYSH 2K9UA 1U8CB 2VXUL 3A4AA 3SGJC 2WXNA 4RGOL 4TOYL 4PH8A 4UNTA 1J10A 5LCVA 1LE5B 4G6KH 2ZSVB 3GDBA 3LNDA 3GRBA 2HG5B 4L8SA 4F37K 2JJTC 3W39B 3GZKA 3X3GL 1CXHA 1AMXA 2DZEA 3N1PC 3B2XA 4AIZA 1BAWA 1UB5A 2J71A 3EGSA 3QXAB 5EZJB 4QOKE 4WLCA 2YIHA 2FYYA 5SWZB 3L95A 5DD6A 2HRHA 2ZUTA 1L9RA 2GTZB 3FTVA 1IX2A 4Y19A 4KKLC 4RZKA 4KK5D 4OJEH 3X14A 4ZUTB 3HE7D 4PWIA 1N0LB 2QPSA 1YEHH 3ARDD 4KXZH 6FABH 3U7WH 3L17A 3S0PA 2H6PA 5F71A 4HIEA 5IHUH 1INQA 2Q2LA 3I85A 3LNFA 3Q6GL 1M6UA 2X53A 3P0YL 4BFBD 5KYWA 4N0UA 4AX3A 4GOSA 4JRYE 3NAAH 3TYFB 1WFUA 3QDGD 1XF3B 4Y5XA 2PPEA 5DK2A 2HVJA 4MD4A 1BV8A 2GJZA 3T0BA 7PCYA 1UM5H 3D50A 2EEFA 2G2NA 3QCVL 1OZTG 4FNSA 3D08A 3GSNL 3ESMA 5TPWH 2F08A 3ZT7A 4A2MA 3IGFA 4NYLB 2B08A 4LFHG 1BVKB 1D7FA 3FTWA 1SJEB 2Q8AL 2ZKWA 4XVUD 1J1OL 3MJWA 5ICUA 2VMDA 5IVXE 4PGDA 4AQAB 3O9WA 3GF8A 3NOIA 3HE6B 2N1TE 5DMKA 3MUUA 2BO0A 4Z8FH 4ZXBB 3FB8B 4YE4H 1BQHA 2E56A 2L7JA 4W9LC 4YUEH 2JFCA 2ZX6A 4HUNB 5A3ID 4KV5E 4PAZA 2CPCA 4FXKB 3ISRA 2E47A 1I8UA 1VHPA 1MEXH 3I75B 1TO4A 3G04A 4EOWL 4KKQA 4BD4A 1QBLH 1UC6A 1TIUA 4WGKA 1E7VA 4OJYA 4XN8A 5FO8B 2F19H 5DA4A 2Z8VC 4WI6A 5GGRA 3KHQA 3QCTL 1ETB1 1MJUL 4U7MA 3WNNA 2OZNA 3L3IA 2CE6A 3ULUL 4U1IA 4XB8A 4Q89A 4RFOL 5FF6B 1BJ1H 4Z7WF 1F1GA 1I3GH 1UD8A 3CBKB 4YQXL 2EVGA 5J1TC 2R0ZL 4XNAA 5CD5D 2WLLA 1BJ1J 1T03H 1LXMA 2FNBA 3BP7A 1E9OA 1IC7H 2GEEA 4FCHA 3LIZL 1TNMA 2XV3A 4JZNA 3ALPA 5JYLA 1O6SB 3B2VL 4F9LC 4J3OC 3VFWA 3FSOA 2RQEA 3B7TA 1DVSA 2CUMA 2FUTA 5D6DC 1QPPA 3JTTB 3QFJE 4ICXA 2VMJA 2R2EB 3IYLW 4WWKD 2GIMA 4CU6A 1IC5L 3CFJB 5T3XE 2UX6A 3ZSSA 4WDIA 1OM3H 4KK8D 1K8IB 4OJCA 2P5EB 2QEJA 2BNUA 1QSFD 3IJYB 3ZDZF 3ARFB 2WQAA 2DMBA 4IJTA 2I24N 3MV7A 2A6IB 2NZ1A 4MSWB 1OP5K 3VXTA 4Z7OF 2Y69B 4ZX6A 2E7DA 4YL9A 1UT2A 2J5WA 5TE4L 1E50A 1YMME 2AQPA 4NZJA 4U1NB 1ID2A 3EGDA 3WGUB 5C0FB 4HXBL 5IGXH 1SXZA 3A6CL 4XCFL 4HSCX 1IGIH 3LDBB 3FBQA 3PIQB 5MENB 2GJPA 1O7VA 1LO4L 1JNLH 2W9EL 1TFHA 3PL6C 3PLYA 4OGXH 4UILL 4WWNA 5FK9B 3X13A 1G7MB 3TVMD 1I85A 3PHOA 4BRVA 1WO2A 3CX5J 3GINA 4IOIA 3HCVA 3WO4C 3VXUD 1RVFL 4FA7B 2AQ3A 5IOKA 4Y4HB 1OW0A 5TE7L 4YSQA 5IMLB 3MZTA 2VSMB 4X0NA 3EO9L 5FW8A 2XY2A 4WUUA 1KTKE 3DX3A 1YYML 1QQDA 4MA8L 4PS4L 3ULVC 5AWNL 2EABA 3OMAB 1U42A 2JV6A 2VITA 2D3NA 3FULA 3QW9A 1GR7A 4EI5C 3OC8A 5L2KD 4JFXB 2EKJA 3J27A 1UYWL 4WHYG 3QR1A 3S2CA 4P2QD 5ABAA 3DK0A 4EN3C 4P5RA 4CVUA 5EU4B 2Y36L 2D3VA 4F8TA 1JV2B 4N85A 2FQGA 4FFWD 5KOMC 1E2VA 4IM8A 3PP3K 4OCNC 4AYID 1B6DA 1A1OA 1Q9KA 3QEQD 1QP1A 4RMUA 1KYOJ 3RX5A 1ORSA 1AGCB 4HIJB 5CKAA 1GCFA 3HZVA 5TQ0H 3K8MA 2BNQD 2BERA 3PHQA 1UUSA 1CFVL 3EW3B 3IU4L 1LNUB 1IAOA 1P4IL 2X2HA 1VGKA 2XJKA 2D03H 3NK3A 1QLFB 4ZOCA 5HHPB 3MQIA 5ECJE 3LNEA 3BGFC 1X5IA 3GSXA 4R7NA 3D85D 1RZQA 2FWSA 4MBRA 2CBQA 2P28B 1CFTA 3NSYA 4TNVF 3GQFA 4RZCB 5DD0L 3MVSA 4L8BB 4ZUUB 4H8WC 2XN9D 2K1MA 1EFXA 2GBUA 3GXUB 4P46A 1MCCA 1U6AH 3MNZB 4FFZA 4L4VA 4QR7A 5DUJA 5B4MC 2OSWA 4OFVA 1Q9OB 3FQ2A 3FRPA 4XPGL 5DHEA 3ZDXF 3TNMB 1W0VA 4OZGB 4X4ME 3W11D 1BGXH 4AV4A 4MJ4A 4CL7A 2OM5A 5I0DA 1AD0A 1XO8A 3BIBX 3EIFA 4AYGA 3D48R 3JYBA 1HEZA 2PO6A 3ECQA 2ICWJ 2AAVA 1OCOB 4AEFA 1JMZA 4U4BA 2ZSWA 3QDME 4TYUA 4FJ6A 4Y5VA 1MVUB 1ITCA 5EEVA 2ZCKL 3VYPA 2DL2A 1KLUB 2GITA 5IMOB 1ZGLB 1AS7A 1HZHH 2VDMB 2RALA 4BZ1L 4JG0L 2I9TB 1CVRA 1T1XA 5F3HA 4LNRB 1QRNE 2CQVA 4YLBA 1GYUA 3EJYC 3UTQB 4M8UA 5GZOC 2X3AA 4IRZL 3QIUC 4JCLA 1RK7A 3APDA 3MLZH 1SJXA 4RGNC 4HKBA 4PJ5E 2FWOB 4NUQA 2Q10A 1E3ZA 3GIVB 3IDGA 4HFUH 3WN5B 4QPEA 5IQMA 3DJRA 4H88H 4M7LL 3N55A 4FX5A 1ZTXH 4PRHB 4V1DB 3SE6A 1H8LA 3CIQA 4JL1A 3APMA 1OQXA 4PJDB 4NM4H 1WJ3A 2AITA 5J56B 1QUNA 3CZEA 2DEXX 3A6OA 1UWXH 4FXGA 4WWOA 4OGAC 5TH2A 5BVPL 1K2DB 4NKOA 2CGYA 4KRPC 5HPMB 3GXFA 5FM8A 1R24B 4KWUA 3MLTA 1E4XH 2WSKA 4GKLA 3G5VB 1MCNA 3WENA 2CPUA 3C5ZC 3P9WB 1NC4A 3DURA 4Q9CA 4AQEB 1TVHB 1C12A 2Y06H 3NRPA 4PSPA 5E4EB 3QJQB 5BRPA 1JZ7A 5ALBL 1MFUA 4NQDE 2XFXB 4FZ8L 2FD6L 3BGMA 5I30H 2IPUK 4LRIC 3ZTNL 2CHDA 4YVUA 5H8DA 1TZIB 1SOXA 2RR3A 4NB7A 1DBMH 2JKIS 2Q8BL 4HKJA 4HS6B 1QACA 5MEQA 1UEYA 3SQBA 2P8LA 4APQD 5C8JB 3KYOB 2HTKC 2ADYA 2YPVH 4BXSV 5IHZA 1ZHLB 5C08B 43CAA 3EGXB 2BOBA 3U6RA 3V6ZB 3CZGA 2PYEB 5ISZE 4GT7A 3AMKA 3UEQA 2J1XA 2LU3A 4CNIA 1XH3B 3WFHA 1W0WB 3Q8EA 3VXPB 5ID0B 4PV8A 4BFRA 2TRYA 5IV2A 1P5UA 1FIGH 2ZPKL 3BFOA 1FNGA 4NN7B 3SCMA 4WSKA 1S7SA 3PWPD 3QCUL 3O6FB 1F4XH 3D07A 4LEEA 1MCLA 4LARH 3RPKA 1A4KA 3B56A 3FT2A 3FL7A 4PVBA 2F7QA 2MOQA 4KXZI 4Y9GA 1HZLA 4ZTEA 5KEZA 4ZS7H 1A2YB 3G7TA 5CD3A 3HNVL 4N1CA 3DTXA 3ZL4L 1E6JL 3K2KA 3SD5A 1J0HA 3MRPB 1ZE3H 5KVFH 1Z66A 4R2GB 4DUXA 1P5VB 3CZSA 5CFAA 3BUIA 3IVKA 3DBSA 3GMRA 3NFNB 5I16A 15C8H 4AGNA 3CHPA 1CZ8L 3RWGB 5I6KA 4R4BB 2XXCB 1QWHA 1RZPA 2LU7A 2NR6C 4HG4J 2GFBB 3HBPA 3HLAB 4LGSB 3KJ6L 2WLIB 1WCQA 3KCPB 3HG4A 2YAOA 3VXSB 4YDJB 2FIKB 1AO7D 5FYKD 3TP4A 2QADC 4AITA 3RUGF 3QWQB 4HS3A 1OLZA 3UJTH 4Y2OB 5ESVB 4ADIA 1VADA 4FXTA 5C0RL 3HHRB 1JFQL 4PVLA 1K9TA 3K71A 2VLJB 1YG9A 1NAMH 5IT2L 1QFHA 2WBJC 1S7WB 4LHUG 3F05A 4HOZA 4TL5A 5CBAA 1DVTA 2XHNA 3W3BA 3D51A 3Q2VA 3RNQA 3GSWB 3UDWA 1NLBL 3B9KC 5DEFB 3V95A 3VFTA 4CKQA 3IJEA 3R06A 5B7FA 1C16A 3RGHA 4B7LA 2EICA 3VM7A 3ATDA 5SWZD 1U93B 3MV9E 4GKNB 1DUYB 4AH2A 4LPVA 2CCVA 4XBEL 3GXPA 3K2IA 3AT9A 1BEYH 1O75A 1TJIL 3EYUL 1U8MA 4JO2L 2OZ4A 2R83A 1A7OH 4WHDA 1A1NB 2EC9U 1E4KC 5DMGC 1F45A 3OPUA 1ZS8B 3OJMB 4JREC 1RK1A 4DUVA 2KMWA 1IGJB 4ONHB 4UIMB 1RHFA 4EBQH 4ZMQA 1Q38A 3VYOA 3AUWB 3LNGA 2X2IA 1IKNC 3FTXA 3S37H 1NPJA 3AU1B 3ESOA 4ONGL 4JY6A 4GP5B 1UM5L 4OLXH 1RUQL 3DMMD 2W1NA 3SBRA 3OKOA 3JWNG 3C9NB 4XMZA 1A3LL 1F00I 2XZCH 4JM4H 3LEVH 3QH3B 2QR0A 2CLVA 2X1OA 5KTEH 5L88H 1A22B 1MY5A 3GK8H 2ZWKA 2FJSA 1U91B 4U2ZA 4L8SC 4X6EA 3HZ3A 3QQDA 3SY0A 3RWIA 3FUHA 5E03A 5BV7C 1HTYA 1L9MA 1T21A 1MEXL 4AEIH 5D1XA 1U2CA 5C0ND 1PQZB 2CH8A 4BE6A 1RZIA 5IHWA 3P3YA 2F18A 2EIMB 4HMDA 3P4LA 4YSRA 2APSA 1UA7A 5MI0C 2CO6A 2R29H 5ACZB 2E74C 1SGKA 1I8LA 2F19L 1Z3RA 1OV8A 5CWSB 4J6IA 3QRGH 5CGBA 4M6NH 4DKTA 3TJEL 3VI4B 4GEJA 4LNVA 2XX1A 4KPHH 2WZ5A 1YEKH 3KXFB 2X6VA 4QOKD 5LXGH 3U1PA 3ATAA 4BSVA 2DJUA 4PWHA 2BM3A 4AJYV 5T5FH 4EI6B 3RDTD 4YHLL 2YC1B 4ENED 4FQCL 5AZUA 3B7SA 1RERA 2OMNA 3O4LB 4G7QB 1BZQK 1XF4A 3DUUB 4QGYA 4AGLA 3MRGA 1D5XA 1F3JB 3F12A 4MA3B 4UQAA 3WO3B 2J1KA 4N90E 4HKXB 2WXOA 2FH6A 4OV6F 3PL6B 3FU7B 5KJ7E 1L9NA 3O9WC 1H5BA 1FJ1A 3AACA 4JRYD 2F7OA 3C6LD 3HIZA 4MZRA 3M7OA 3BIKA 4D9RE 1KBVA 1OM3L 1GTNA 2EIEA 5JMRA 2BLFA 3FN3A 3JUYA 4BSJA 2YPLE 2C3XA 3EUUA 4GUQA 1TTCA 1HJBC 1KMGA 2GTWB 2H1LM 5DJAA 1DTUA 4ES9A 2YSSB 3LH8A 4EI5B 3UGEA 1AACA 3HPLB 4MJ2A 5IW3A 1ONQB 1GA2A 3RKDD 2QPEB 1RZJC 4EN3B 1EEZA 4G9FB 1RHHB 1IGIL 1WIUA 3GPSA 5EBLB 4DSYA 1A7NH 4EIZC 1C5BH 2YMOA 4ZW6A 1NBYB 1L5GA 4LIQE 4OGXL 4PLKC 3N0PB 2Z7YA 4JGJA 1I3UA 4J1UB 2ARJA 1HQ4B 1LWHA 5FHBH 2OSYA 4Y4HD 1H8OA 4WVRA 1SYVB 2E8YA 4A6YH 4XMTA 3T4YB 1E28B 2JJSA 2ICWI 1A9EB 4G6JH 5IUSA 1M7UA 4QRUA 2DLEA 2OAAA 1E5ZA 2NYYC 1A6WH 2OULB 2EYRB 1VFMA 3BUPA 4G72B 3RAJH 4QTIH 4OD3H 1J88A 4HJGB 4K9EH 1UASA 2WZPD 3BGFB 1PVHA 2IWKA 5DUBB 3MCG1 3OKKB 4IU3A 5IEKA 4YSAA 5D1ZI 1J9SA 3RY5A 1YN7A 5CLTA 1OB0A 3TN0C 3UP1A 1PY9A 3KGTA 4F7MA 2XTSA 3DJ9A 5C0BA 1MCBA 4M7KH 1VACB 2IAMA 2FVNA 4Y8DC 3GM8A 1F11A 5TQ0L 1QLRA 2VLLA 5JXED 5ENWA 1FNSL 3S8FB 4KQ3L 4PG9A 1RL1A 4NNPL 2OL3A 3S96B 4NSKA 3BVUA 2FT7A 4S0TD 4JFEA 4HF5H 2W80C 2WINA 3D05A 3FUDA 1DLHA 3IFPA 1OGAA 4A39A 4G82A 4XMLL 4HBCH 1OAZL 5AENA 1CPUA 3T6ZA 1I85C 3CG8A 4OUUA 3WSQH 4DP8X 3D1MC 2WMPB 3FMGH 1OW0C 3HB3C 1YMMD 2VN3A 1MFBL 3U9UB 3UTZA 4M1CC 1YYLL 5LNDA 5BXFA 3ZX1A 1U6AL 2ZXGA 1D7BA 3S2AA 1E4XI 1JP5A 5I75C 1JZIA 4L37A 3L4WA 2IXQB 5C6PB 1JN6A 4JHWL 4M48H 1ADQL 2HG0A 1C8PA 3QIUB 3TEWA 3QJVB 4OCXL 3RUGA 3O3BA 2F6AA 4RGNB 4BUGA 1IAIM 5AZEL 2DD8L 4XPTH 3P3RA 1A6ZA 3MU3A 1MCWM 2WYIA 3CH1B 4WW1A 3DJSA 5DFAA 1PLCA 1NBQA 2R2HA 1HXYB 1JV5A 4YFEA 3DO7B 2WAQA 3JWNC 2XA3A 4NQEE 1OF2B 2WYZA 3MBWB 3RVWD 4N2IA 3LRLA 3HMWH 5DLMH 5BJTB 1TT6A 3ETBF 1FE8L 5GQBA 2A6DA 1GGYA 5ETUB 1U8PB 3MPCA 3VM5A 1FPTH 5KS9B 1ZT7A 2HN7B 1KGUA 5C7ZA 1W72H 4DGUA 2WWMD 1YC8A 5DHXB 4MNGE 2VWEC 3C5ZB 5T1KD 5F9JA 1U2HA 3MREB 2DY2A 5FDYA 3VMNA 4H88L 5JLZB 3U48A 4P46C 2Z7ZA 4QXTB 4X4YA 5EF3A 4WY7L 2CDFB 3QFDB 4LLVB 4V1DD 1PPIA 2R39A 2NY3C 5K1JA 1E90A 4X6CA 4DGVH 4AYBA 1ACXA 2VLRE 4NWTL 5EO0A 4QXUL 3ZE1F 1ODAA 3WIHL 2NTFB 1G9NL 4ERSH 3ZE0F 1SHSA 1EJ8A 4JN2B 4W6YB 5I2IB 3E1ZA 2WQVA 3OGCB 4NQXA 1SMAA 5IKCB 3MJ8A 3HS9A 1E6OL 3ABGA 2J8UB 2F1AA 2PO6C 3OHXA 1LE9B 4BKSC 1ACZA 1E4XL 3EJSA 1CLVA 5CGMA 4N25A 1TCRB 3QDAA 4Y5VC 1EAOA 3DHMA 4QYAA 1DBAL 1LP9F 3WFZA 4JPIB 3MX0B 1P7QB 2JXMB 3N41B 4NIYE 4CDGC 3QQ4A 2I5YH 2XPGA 3HNTL 5AW6B 1FFNA 1UWFA 2YSTA 5LN4A 3VFMA 4FQHA 4X8JB 1EAJA 5IVZB 4BBWA 1NM9A 3ARGD 5EO1A 1CG9B 5EEYA 1AGBB 2J6EH 3S5YA 3UTTA 3KMDA 1BJMA 3MUGB 5TDNB 1DBML 1CGVA 4LF3A 2MSPA 4MAYA 3QDMD 2BSCA 3TU6A 5DQJA 2DI9A 1ZA3B 1XSKA 2FRGP 4K8RD 4UQ3A 4V2BA 3CFNA 2YPVL 3C08H 5DHYB 5AVUB 3JZ7A 1M2OA 2FJFB 3TCLA 2APXA 2JKJA 2VZVA 1JPTL 1BQKA 1IRAY 5GS2H 3FT4B 2NQCA 2WNGA 5KSVB 3QPKA 4LSQH 5E4OA 2OJ1A 3P0VL 4OTXH 1UQSB 4IMKC 3IFOB 2WNWA 3O6FD 5ACMA 3MNWB 4IBZA 4PJ5D 1DJSA 2H2PD 5B3JF 1ZHKB 3F7VB 3IBOA 2WXIA 2MTPA 3MXWH 1DQJA 1ET8A 3EH2A 4TUOB 2BVQA 43C9A 1H6FA 3FSVA 2C9UA 4TVPD 1PIFA 2QADB 3V4PA 5IMKA 5C09B 4CVZA 1M2VA 3QQNA 2YXWA 4UANA 1IBGL 3DDGA 5KYNA 3GI8H 2NZ9C 2IJ0C 4LAJH 3V9EA 3S5LG 1I8IB 1KB5A 4S1RH 1E0OB 2I85A 4PJHF 1HN1A 3L81A 2WBJB 1XGRA 4IBYA 4ZMYA 1BFSA 1CD1B 5EU3A 3O4OB 5D8JH 4JS7A 3B9KB 3QXDB 1MG3C 5I8CA 4PVNA 4LLYA 4PJEF 3MGTB 3EO1A 3GMNB 2F8XC 3IMRA 2R8SL 3RGVA 1FFOB 4HWZB 4G8GB 3WFEL 4N8UA 4LLUA 4NQDD 1USZA 3MN8A 4M4RB 2VW6A 1NKGA 2E0PA 2EYTB 1FO0B 4KKLD 1PJ9A 3A4FA 1AQMA 1ZA6A 1U8KA 2BVPB 4JUTA 1P5UC 3RQ3A 3UJTL 4AVHA 2RGSA 3K6NA 2MMXA 4JREB 4YPGB 3PWLA 2XWBB 2ZX5A 3U1SH 2EXYD 1IGFL 1MW2A 3QNYB 3OR7B 1X4XA 4Y4KC 3JUZA 3QC5X 3UYRH 1AGEA 3DGGA 1B4RA 3WMSA 2MKWA 1BSIA 3DARA 1ZLVK 5G4OA 35C8H 4HETA 2DJSA 3CX5K 1S7XB 1U92B 1JPSL 1XFPA 3UH8A 2JB6A 3R7QA 1KJ2A 4XNQB 4I77H 1KCSL 1MREL 4XVJH 3PDOA 4LQFL 1KPUB 1Y0LA 3KPLA 3N1QC 2UV3A 1NFDF 5KJRL 1MI5E 1NC2A 4L8SB 1WSST 3R4DA 3BP6A 4LP8A 2DWYA 1CDCA 2EDKA 4AIZB 3L5HA 4WHCA 5BV7B 5AVXB 1UB5B 3EGSB 2O6FA 1KPRA 2FYYB 4A7GF 4AKPA 1JXKA 2VQ1A 3IDMA 4BZ2H 1MZZA 5DD6B 4JFTA 4ELMF 1S7QA 2EEXA 2QSTA 5D9SA 1FH5H 3ZR6A 4Y19B 3KGSA 1JRHI 3X14B 5MI0B 3AQYA 5JW5A 1KCUL 4BJLA 2H6PB 2H1PL 1FNEB 3Q8BA 1INQB 4UWQB 1Q9LA 1BHGA 5DXWA 2G5BA 4XVSH 5T3XH 4N0UB 5J1AA 5KYWB 4ZMOA 1TYJA 2WQSA 1KWKA 1EZVX 1IBDA 5DK2B 2HVJB 4MD4B 2GJZB 4M9PA 2Y07L 1J5OH 2DRUA 4F8NA 3KPPA 4IKNA 5L0QC 2G60H 3KW7A 4J3BA 4QIRA 1BQSA 4ZMPA 1G9MH 1WAAF 1E4HA 2PWHA 5AW2B 2VDKB 3T2PA 3QE5A 2P5WE 4LXFA 3QB7C 2F61A 5AW8B 2H0FA 4GSDH 3O9WB 4GYBA 2Z31D 4JFUA 4OLWH 4TS6A 3MBXL 5DMKB 1D5ZA 3NP4A 2NXZC 3T0EE 5ADOL 3NCJL 4F57H 1BQHB 1DJZA 3NDYE 1WH0A 3HAEG 1OIOA 1RLWA 1SLVA 2F1EA 1XGUA 3Q5YA 4HIXH 4ZUVB 4F8QA 1ECZA 3KEDA 5D4IA 3MV9D 1KYFA 3G04B 5GGQH 3SGKA 1HCZA 1H6UA 3GHBL 3BCDA 5I6MA 4IHOA 3HC3H 1RUMH 2V37A 1PLGL 3O4LD 2R69L 1LDPH 4LSPL 1LTXA 2ED8A 3UTSD 5GGRB 5GS3A 2N01B 5T33L 5JQ6H 3L3IB 4CBPA 4MHHI 3PL6D 4U1IB 3CFDA 2XXFA 3H3PH 1XMEB 4RDBA 4LCUA 1JRHL 2NY2C 1NGXA 1Q1JH 3D4CA 3DVGB 2WLLB 4JGMA 4TSCH 1E9OB 3F7YA 1ICTA 4JL2A 1I9IH 3ZDYE 3ULVD 1WZLA 2QFRA 5D1XC 4JZNB 4Z9KB 4GRMB 3MODH 3VFWB 3PYCA 3CE1A 1S5HA 1IC1A 4OGYL 5ITBH 1I8LC 4DZ8A 1T5KA 3EXJA 3E7JA 3S36H 3ZZQA 2WLNA 1LP9A 3BH8A 4B3VA 2P45B 2XQYK 4WDIB 1KBKA 1X5XA 1GJUA 5HHOE 4M7JH 1C5BL 3TN0B 4H20L 5I8OH 1EO7A 2XUWA 5DLLA 3VNYA 3VXTB 1T1WB 1UWXK 2DIAA 3GRWA 2ZNXA 3M17A 1V05A 4QNPE 1WP6A 2FO4A 1RZ7L 3EGDB 2YPKA 4HEPA 3FCTB 3L8QA 5C97A 3VYNA 1HAUA 4LHUB 1CI3M 1A6WL 3LVEA 5LHDA 4FOMA 3FQWA 2UZXA 4OD3L 5DJ8B 3B37A 2AVGA 4Q56A 5F0MB 1F42A 1WTGT 3FPYA 5DJ2A 5C0AA 1H5BC 2WNXA 4PBDA 4ZFQA 3PHOB 4ADJA 4IOIB 3HCVB 3BAEH 4QLWA 1FL3B 3FTGA 3NG5A 2X12A 3KDMA 3RBGA 3HB3B 3GKWH 1EGJA 5HHQA 4O9HH 4PJGF 1CL7H 4WUUB 4X5WA 1NCJA 4ZRGA 1QQDB 4X7SL 3VFGL 4K8RH 3WEAA 1BVZA 2VITB 5DEGB 5CEZE 2G3MA 4WKXA 4N90D 2WGNB 2Y0SA 4RAVA 5I75B 3BWUF 4LLDA 1XGYH 2IH1A 3OAYH 1UZ8A 1RK0A 4D9RD 1ZMYA 1G1CA 1XH0A 3TBWA 3CFCH 4HF5L 3M1BA 2E9GA 1EERB 4FNQA 3L3JA 1G7LA 1Q9KB 1A1OB 4LL1A 1QBAA 1ORSB 1HL9A 2BIHA 2YPLD 2B9AA 3HZVB 3WXVL 4RMRA 1IFHH 4PJHA 3FMGL 2IG2L 3PHQB 4LFHD 2JJSC 1EMTH 3UTPE 1EHLH 1IAOB 1VGKB 1BXAA 3ZKSD 2VDLH 3HMXA 4PJEA 4A7UA 3NBNA 3A23A 3WS6A 4AVKA 3EJYD 3GZQA 1PW3A 2QMKA 3EJQA 1N5YH 2Q76A 3GSXB 1YZZA 3POHA 1KEGH 2A0LD 2X09A 4M3JA 2YKLL 4LL4A 1CFTB 5EUOE 4P5TA 2NYKA 2DKMA 4YZFF 3II3A 2BW4A 5HYSG 2XV2A 1EFXB 4UQ2A 4XNUH 2VO8A 4P46B 4HG4K 4GG6F 2D31A 2IAMC 4Z23A 4L4VB 1G7HA 3BDYL 3BESR 2NT1A 3HTLX 3KWWA 4B9YA 4WWID 3FTYA 5DA0B 1MW0A 1XIWA 4W70A 5DLML 1SLUA 4NN5C 4OCRL 2A73A 3MUY1 2IC2A 4DP0X 4KRPD 4JG5A 1AD0B 1KB9J 1FPTL 2TSAA 3BUDA 2P49B 4RRPA 4JQIH 5F96L 1W72L 2FECL 5D6CB 2PO6B 3VO0A 5DUPH 3OPZL 4JLRA 2PPCA 3ZL1A 1KFAL 2ZSWB 1UG9A 2BRRL 1NFDA 4FHJA 4Y5VB 4ZSOE 2CRMA 1M42A 1SRDA 3KPSE 2GITB 2XLLA 5FGSA 5FIEA 3FFCA 1EK3A 3ZQXA 1T1XB 5F3HB 4M5YH 2HCZX 3QWRA 1KLFA 1MHHA 1S7VA 4HWBH 3LEYL 1PX4A 2FWLB 4A7GA 2Q1EA 4ZTOH 1I9RH 1DQQA 4NFBA 1KIQA 2BZ7A 2F53E 4G5AA 4QRRE 4HKBB 4UQ9A 5TE6L 1CR9L 2HTKD 3IDGB 4FQIH 3TWYA 1HSBB 4Q9RL 4JRXE 1OWWA 5EOCH 2ZYSA 2H0PA 3OSKA 4YFLF 5EOCJ 5L4JA 4N0RA 3W1ZA 1QUNB 4JQXA 1G0XA 1MFEL 5B1AB 2I5YL 4OZHE 1BAGA 4BK4A 5AB1A 4N2LA 5TH2B 1OP3H 4H1LH 1B2WH 2OMUA 3UCQA 3N06B 1KXTA 3MV11 2X4PA 4JDTH 4TXVB 2XG5A 1RPUA 1WAAA 2WYTA 3MLTB 4M62H 3O2VH 2D7PA 3G5YA 2WZ6A 4MB1A 3QUMH 3V4VH 4DN4H 1EQWA 2FUQA 3K4ZA 4NQED 4GXUM 4MZ2A 4JY4A 5KSUA 1TJHL 2VLKB 1NC4B 3DURB 2DH2A 1N64L 2CKNA 4ZNCD 2R9HC 5D71L 1C12B 5AEAA 1OWRM 4L2YA 5MP6L 4M5SA 1RQ5A 3BGMB 2VXVH 5K1NA 3HG2A 2ESVB 2C3VA 4W93A 3BPCB 1MY7A 2I60H 4HKJB 2BX5A 3OKNA 5MEQB 3SQBB 4OJDH 2J3SA 4KMLB 2BRQA 2NR6D 4EQ3A 1OT1A 1CIUA 1ZVYA 1Q0EA 2V3FA 4P8QA 3OHXC 5IHZB 3H2PA 4K3JH 2BOBB 3BX7C 1U8OB 2KS0A 3QA3B 4HT1H 5C0IB 3MRNA 4AQ8A 4CNIB 3ISWA 4K5OA 2QADD 4EAEA 5BRZD 3EJUA 1BWWA 5C09D 4PV8B 5IV2B 4KOBA 5KBKA 1FRGH 1P5UB 1BX2A 4K9JA 2WOYA 1P7KB 4OR1A 4R4NC 4Z3GA 2O5YH 4HXAH 3KPNA 3M8OH 4X6DB 1S7SB 3SCMB 5DO2D 3DETC 1P4UA 4X80L 1A4KB 2OXHA 4G59C 3DKHA 5J7CC 3IMUA 4KKBC 4Y4KB 5EG6C 3BZ5A 1LK3L 3FT2B 4N2HA 1SM3L 5D8JL 4JFQA 4K7FA 3QZNA 2YKKA 4EE2A 5JW3H 3JBG7 4MRBA 2EE0A 5CD3B 3KYNA 3DTXB 1AZUA 2GUOA 3CHXA 4Z7QB 2W65A 5AAWA 1J8HA 3FU0A 4ODUA 3ZDZB 5E6YA 1YN6A 4ZMWA 3D52A 1HSAA 4QRPE 3IVKB 3ZYIA 3GMRB 3OXRA 3BIAX 1TTUA 1VJSA 4IRJA 2OK0L 2JVUA 4JANA 5GZND 2HH0H 2HLFD 5C0CA 2X9XA 4NOBA 1TLMA 4OM1H 1KV3A 1SHXA 2DQIH 3HI5H 2P24A 1O9ZA 2IO5A 1V5JA 3UYRL 5EC2A 3PREA 4F80A 1GSMA 1XSOA 3APFA 5INDA 1TU2A 1UD5A 1I7ZA 1IEBB 4HS3B 4PN6A 3MRHA 4UF7C 1C5CH 2DJMA 4WEMB 2CLZA 1VADB 4GAGH 3RVVD 1ZSHA 4I77L 4XVJL 4PJGA 3K71B 4RGMB 1DBBH 2CK2A 3W37A 3WLBA 4KVNL 1UWGH 4DW2L 5CBAB 4AZ8A 3LZRA 3Q8FA 2OXGA 5DFVC 3VFTB 3IJEB 2H6OA 3R06B 1DJHA 5L0QB 1C16B 4EI0A 2C26A 4IBVA 1G6VK 4TPRH 4AH2B 4NI6A 3P3SA 4NZRH 5JQIB 5KBLA 2VDRL 1U8MB 4K5PA 4LASL 1KWGA 5F97E 3HKFA 4PREB 4Q9BA 2E9BA 3HUJF 1RK1B 3MLXL 4LEBA 1L9SA 4FQ2L 5HDBB 5JPNC 3UIZA 2IANA 3H9SE 2ZONA 4ZNEE 2YK1H 2VC2H 2ZG1A 3H9YA 4XVSL 1GYCA 5CAYB 1QOKA 3QZWA 1J5OL 1ZPUA 4JY6B 3MLSL 2IH3A 4XP9L 4BUHA 3OKOB 5E2WH 5F9OL 2Q20A 3DHUA 4YXHL 4YH6A 3DV6A 2VSCA 2WWKO 3UROR 2QR0B 1A25A 2CLVB 4JY5H 5MENE 2JJVA 4GG6A 4LHJB 3EUDA 2WP3O 4DUWA 1WIOA 3X11A 1X5HA 4X6EB 3W0WA 1NMCC 4LIQH 3ZDXB 2NY2B 3QQDB 1X7TA 3SY0B 3RWIB 4A2EA 3P11H 1PZ5A 3DIFB 1G84A 4HIXL 3EH3B 3WY4A 1T21B 1CDHA 5D1XB 3IJSA 2Z91B 1RZIB 1I8AA 2JIXD 5F7UA 4O02L 3EH5B 3ESUF 1JYNA 2CO6B 1BBJA 2YHGA 3T8XB 2X41A 1DEEA 1PLBA 3U6XA 1IAIH 1MI5D 1FLTX 4XP5H 1YNLH 2GAZA 5SWSA 1U8IA 1T89A 1OHQA 3FTZA 4KI5E 4PLKD 3K6FA 5CU9A 5D5MA 4BSVB 1INDH 3CDZA 4O51A 4EUPG 3OJ2C 1XD0A 4BWTA 4HOXA 4HJTA 1XF4B 2FCBA 2YGNA 1I9IL 2QT6A 4YDMA 5E2UH 3S5LB 3MRGB 5HYJE 1D5XB 2NYYD 3F12B 3MODL 2RA1A 4ZAKA 1E9QA 4LLWB 3QPXL 2EVHA 5ITBL 5J57B 1H5BB 1KIUA 5AVYB 4Z76A 4JFPA 3WKYA 3S36L 1H3PH 3DGCR 3BIKB 3GKZA 3P4OA 4TRPH 3TN0D 2ZOOA 2DQEL 4GNKB 3STLB 1DQDH 3RILA 2XY1A 5FLVA 5DQ9A 4AYEC 3H9HA 5CJQL 2ITFA 4MA7H 1XXDC 5DJAB 4HAKA 4L4JA 4JPWH 1COBA 1DCLA 2WXHA 2P5WD 3K72A 5IFAL 1HU8A 1DBJH 1ZIBA 3VWJD 5GS0C 5JIMA 5C3IA 1P4LA 4WW2F 3O41B 2ZYRA 4A2LA 1XH2A 1EEZB 3QHFH 4LHUD 4WI2A 1OE1A 4TUKL 4Z3HA 1L5GB 1KBWA 3JV0A 4X98A 4JGUA 1TZAA 1WEJH 5FOBA 2ARJB 3QISA 1NTDA 3FQTB 3QRLA 2ZUUA 1CCZA 4PM1A 4JFDA 3A5VA 4O9HL 2ZXAA 4NENA 4UV4H 2WTRA 2DB8A 2XXMB 4PRNA 4QRUB 4GG8A 1H3VA 4JCWA 4X4XA 1SOSA 2CM6A 3ULAB 1FBIH 2AGJL 2Z35A 4QD2E 4B27A 3I3DA 1GVIA 4C8XA 1XGYL 4OKVA 1UACH 4HWEH 4FLQA 4IU3B 5IEKB 2HFGH 1UGNA 1NIFA 3INUH 2ENYA 3A21A 4KO6A 3GXDA 3VG9C 3RL1B 4N9GA 1DZ0A 2J12B 4F7MB 2QKIA 1A0QL 3P3UA 1PY0A 3QUZA 4MXWH 2IAMB 1F11B 2H45A 1IFHL 1QLRB 2EIZB 2VLLB 3T71A 5ENWB 1DVUA 2DBJA 3N9GH 2X28A 4PJDE 1NWOA 3BYTA 2OL3B 4NN5B 4NSKB 3LRHA 2VDLL 3LQMA 1NCUA 2W81C 1SZNA 4JFEB 5HHOD 1DLHB 5F3FA 3FCBA 2XSKA 1B4JH 3EYOB 4HCRH 4KJPC 2QGEA 4OUUB 2CU9A 1X4YA 4GMTH 1MWAL 3TOPA 1JXJA 1M7DA 2J4WL 4NI3A 1BCIA 4X9YA 1KBPA 3UTZB 4U6VL 5BXFB 2NLJA 3LTVA 1NIAA 3OMZA 4Y9CA 1KELL 2NY3D 2NPLX 2DTML 3U2IA 4Q9QH 2ORBH 4L37B 1FVCA 3T3PB 2D3JA 3EJRA 4GRLA 1JN6B 1PGRB 1JPFA 3RLSA 2YAQA 4XCNA 3BKCL 3RUGB 3O3BB 4ZFGH 4U0RC 3EG9A 2F68X 2OW6A 5JOPD 3JTSA 3EJTA 3T2OA 1A6ZB 4UQIM 5C08E 1JV5B 5CEYA 1K72A 1SBSH 2PYEE 1RMFL 4PP1C 4YZFE 1YY9C 2WXGA 4ZJ9A 1A3RL 6CGTA 5ANME 4Q4EA 3BVTA 1MFAH 2DEWX 1Y7VA 4EXPX 2H32H 3WS6C 5KVGL 1DSWA 3L3OA 3AY2A 1QSEB 2W92A 1ZT7B 1V3JA 4JMXA 1FLRL 5E2TH 1TVDA 2KL6A 3UIYA 1I9RL 3NIGE 2Y6SD 3RVUC 3ZTJG 5I1CH 3E3QC 3RL2A 1JPEA 4ODWA 4MD5A 4UU9A 3CC1A 3QUGA 4P5TC 1RIVL 1BPVA 3I9GH 5F9JB 3VG0L 1J0IA 2DLGA 4E9LA 3HUJA 3UTPD 2VDPB 2NDGA 4X4YB 4AMXA 5JNYA 1VA9A 4FNLL 4JDVA 1DEDA 4X6CB 4F7CA 5EO0B 1XIWC 2Q87A 4AEHH 4GMSH 4KTGA 5EEZA 3AABA 3GS0A 1ZV2A 4AKOA 1MIMH 1AXIB 1D7DA 4MDIA 3LXBA 1B2WL 3FS9A 4NQXB 3OMNB 3MJ8B 4IBWA 4PQXA 1V7NH 3OHXB 4M8VA 3O0LA 1IIKA 4BH8B 1HNFA 1KDIA 1SEQH 3CVHL 1NCTA 3KH4A 3KPMA 5D96C 3V4VL 2GHWB 5D7SH 4QKTA 2VLKD 1T7XA 3H1ZA 5DJXA 2PR4H