4UF7C

Ghanaian henipavirus (gh-m74a) attachment glycoprotein in complex with human ephrinb2
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
142
structure length
138
Chain Sequence
SIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDGQYEYYKVYMVDKDQADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Recognition of Human Ephrinb2 Cell Surface Receptor by an Emergent African Henipavirus.
pubmed doi rcsb
source organism Bat paramyxovirus eid_hel/gh-m74a/gha/2009
molecule tags Viral protein/immune system
molecule keywords GLYCOPROTEIN
total genus 30
structure length 138
sequence length 142
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00812 Ephrin Ephrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4uf7C00
1QLEB 1JERA 1FWXA 2WO2B 2IWFA 1GYCA 2GSMB 2W8CA 4HCGA 4HIPA 4AKPA 2HRGA 1RZPA 4CSPA 3GXUB 3WKQA 1WAEA 1AIZA 2IDFA 3ZBMA 2PLTA 3CDZB 1QNIA 5I6OA 1L9SA 4DP5X 1GW0A 1L9QA 2CAKA 3NJKA 3UABA 4E9RA 3FYIB 3NJLA 2GC7C 2IWKA 2P80D 2PPEA 4G7SB 2YARA 4WTQA 2ZOOA 3H4HA 4AZUA 1W8EA 3X1FA 1PZBA 1AR1B 2JKWA 3FPXA 4A2FA 3FT0A 5I28A 4K9JA 1OOWA 1PNCA 1SFDA 3NT0A 4HALA 1N70A 1EHKB 2VW7A 2R7EA 2XLLA 4KO7A 3ABMB 2Q5BA 4A66A 1GSKA 1NWPA 2FWLB 3FYEB 5B1BB 2HX8A 2PPCA 2HLEB 4DP6X 2DWSA 3IN2A 3T6XA 2MRYA 5TK4A 2BP0B 3ABKB 4N8UA 4BWWA 1PMYA 1IBZA 1AZCA 2VN3A 2VSMB 3FPYA 2XV2A 4HZ1A 1GY2A 2JXMA 2YQBA 3X1EA 5LDUA 1J5CA 1MG2C 2EIJB 2Y1AA 1ZPUA 3NJIA 2QDVA 2VW6A 1SNRA 3ASNB 5I6NA 1BYOA 2XU9A 1JZGA 1ET7A 2GIMA 2YXVA 1KCWA 1A4BA 4KO6A 3X1NA 4GP4B 3H56A 1AS7A 1AS6A 3KW7A 1WS7A 1B3IA 2BWDA 4BDVA 1L9OA 4E9YA 1GS8A 4KNUA 3NJHA 1KDIA 3FU7A 3S8GB 2YAPA 1ZDQA 2CUAA 1BQKA 2BP8A 3T71A 4JHVA 2IDUA 2BZCA 2XXGA 3CVDA 4DP1X 1WA1X 2BP8B 1SFHA 2I85A 1FA4A 2VMJA 3AG3B 3IEAA 3WKPA 2BO0A 1KGYE 2N0MA 1OV8A 2PP7A 1ZIBA 3ZX1A 4HAKA 2TSAA 2P80A 1V10A 3CG8A 3ZIYA 2J56A 2XUWA 3FQ1A 4KOBA 4YSUA 3NSCA 3ABGA 2VW4A 5I5MA 4EF3A 1N68A 1V55B 1AG0A 1AZUA 1IUZA 2EIMB 4BDVB 1TKWA 3PXLA 3ASOB 3DKHA 3NSFA 1ILSA 1YLBB 2QPEB 3HB3B 2HXAA 3WNIA 1NIEA 1ZDSA 1PLCA 3N2JA 4KO5A 2NRDA 2EINB 2OCCB 4A2HA 1SDDA 1PF3A 3OM3B 1KBWA 5AKRA 3T6VA 4A68A 2AANA 1ZV2A 2FT6A 3MBWB 4YL4A 1ID2A 1BAWA 1NWOA 5B1JA 1HFUA 4A2GA 1HAUA 3GDCA 2BP0A 4F2EA 2LLNA 1OCCB 4KNSA 2X88A 9PCYA 1NIBA 4HCIA 2OV0A 4AI7A 3OQRA 5EHFA 3BVDB 2XYBA 1OCRB 4E9XA 1F56A 1JOIA 3S3DB 4ENZA 2OJ1A 1KYAA 3QJSB 4HHGA 5B3SB 1IC0A 1JZEA 3EHBB 1PLBA 5AFAA 5AZUA 3JT2A 2CCWA 8PAZA 1PCSA 4W9ZA 5B7FA 1FFTB 3SBRA 2H5UA 4N4YB 1JZIA 4NERA 1AZNA 2XVBA 3GYRA 4QKTA 3NP4A 3S3BB 2I7SA 2PPAA 3NP3A 2PCFA 5B1KA 4TXVB 3T6ZA 1W6WA 3AZUA 3NJJA 1NIFA 4JKNA 5IY5B 2EILB 5TK2A 6PCYA 5I6KA 2YXWA 4YSOA 4AKQA 1CYXA 4DPAX 4AKOA 3CDZA 2W88A 2XX1A 4YSCA 2RACA 4E9WA 2AZUA 4G7RB 2TSBA 5PAZA 1BYPA 2PCYA 3UGEA 3V9CA 1A8ZA 3QJQB 1AG6A 1ASPA 4YVUA 3FSVA 1JZJA 4E9QA 5D4IA 3SQRA 1DZ0A 4E9TA 4DP8X 2CJ3A 4G7QB 2PP8A 1ASQA 1BQRA 1EZLA 1A3ZA 1J5DA 1TU2A 3NJMA 1KDJA 4DP9X 2IWEA 1RCYA 5B7EA 4YSDA 1J9RA 1CURA 1QHQA 2JFCA 3WNJA 1J9TA 3FSWA 3CZUB 3G5WA 1KCBA 1M9WA 1OF0A 2BZ7A 3ABLB 1SHWA 1AANA 4P5SA 4A2DA 1KBVA 1ETJA 1WA2X 5E9NA 1V54B 2B3IA 2PP9A 1NINA 1ET5A 1XMEB 2AVFA 2FT7A 1BXAA 3QPKA 2FJSA 2AFNA 2IDTA 2XV3A 2DY2A 1TEGA 1RZQA 3OMIB 5B1JC 4Q8BA 4BXVA 2ZXWB 3WG7B 1GR7A 1AZRA 2FTAA 4KO9A 3EH5B 3QQXA 4BXSV 2UXTA 1L9PA 1L9TA 1OCOB 4X4KA 3TU6A 4A2EA 2FQDA 4G71B 5I26A 2HX9A 5I6MA 1NTDA 3IN0A 5D4JA 2MTAA 3ERXA 1JVOA 1PZAA 4A67A 3WIAA 3QJRB 3X1BA 3AG1B 3BQVA 3RYMA 2B08A 4DP2X 1ZIAA 3D12B 3FQYA 2YAEA 1GS6X 1PNDA 4QLWA 3NJGA 1MDAA 4BK5C 1NPNA 3X2QB 5I6PA 2FT8A 1AAJA 3DTUB 1M56B 4RH4A 3T6WA 1SDDB 1GS7A 2WSDA 4G70B 1J9QA 4GXFA 3PCYA 2XXFA 1SJMA 2DV6A 1NIDA 1A4CA 4BWUA 1PY0A 3CVBA 3TA4D 2VSKB 3PAVA 3SBPA 2GBAA 1DYZA 1CUOA 4F2FA 3FSZA 3N55A 1JXDA 2ZWNA 2CALA 1CC3A 3NYKA 4YSPA 1PAZA 2DYSB 3AG4B 2DWTA 4CSZA 4M3HA 2UXFA 1MG3C 2UXVA 1AACA 3DIVA 2FNWA 4FAAB 3NJNA 2YAHA 1SHXA 2E86A 3CVCA 3QJTB 4E9VA 2UX6A 3IE9A 2BW5A 1CYWA 4FA7B 3PAUA 4G72B 6PAZA 1X9RA 4M4RB 4GY4A 2GHZA 3FU7B 2ZONA 2FQGA 3NSDA 3FQ2A 2DYRB 1E5ZA 1URIA 5PCYA 3FU8A 3UAAA 4MFHA 4HHWA 1T5KA 1JZHA 1WA0X 2IDQA 2UX7A 2XWZA 3U25A 4DP7X 1L9RA 3PLYA 1WS8A 3NJFA 1MZZA 1KV7A 1J9SA 1NZRA 2BW4A 1OE3A 1BQ5A 2VM4A 3S8FB 2IH8A 3AG2B 3L45A 3T9WA 3PAZA 3UAEA 2YAOA 1PZCA 1NICA 3OD3A 3SBQA 1BXUA 4PCYA 1XB8A 3TBBA 3TBCA 3EH4B 1XB3A 4HCFA 1A65A 1ET8A 3FS9A 4UAHA 1OE1A 2IH9A 5FC9A 4UF7C 1VLXA 2FQEA 3UADA 4DP0X 3EF4A 1AOZA 4YSRA 2BWIA 1NIAA 4GP8B 4W1TA 1E67A 3WI9A 5F7AA 4YSQA 2PPDA 2UXGA 1XB6A 3X1GA 2GI0A 4L0PB 3JTBA 1ADWA 1W6LA 3IBOA 2HRHA 2R7EB 4BWTA 4AX3A 1RKRA 1OCZB 3C75A 2HX7A 1TEFA 1SF5A 1UATA 2YAQA 3AY2A 1JVLA 4DPBX 2BHFA 3TASA 1M57B 2J5WA 2QT6A 3QJVB 5I5JA 3AW5A 2H3XC 4YSEA 1NPJA 5D4HA 2I7OA 2H47C 4KOCA 4WKXA 5ANHA 4GP5B 4NB7A 1IKOP 1ASOA 4NAJA 5I6LA 4E9SA 1AZBA 1JZFA 4JHUA 5B7MA 1BEXA 1R1CA 2AZAA 1ILUA 1PLAA 2VM3A 2YAMA 1MZYA 3EH3B 1JXFA 3QJUB 1E5YA 2EIKB 1AQ8A 3MX0B 3V9EA 1SF3A 2WO3B 2GB2A 3KW8A 2XV0A 4YSSA 2FQFA 3HEIB 2QDWA 2CBPA 2QPDB 4YVNA 1E30A 1NDTA 4F7KA 7PCYA 2A3TA 2Q9OA 3H4FA 3FSAA 4P5RA 2J57A 7PAZA 2HZHA 4DPCX 5A7EA 1X9UA 2IAAC 4UANA 1E65A 1A4AA 1HAWA 4PAZA 2IDSA 2X87A 4DP4X 3ZDWA 3S3CB 1JXGA 2Y69B 4ZK8A 2GC4C 3OMAB 3NSYA 3FU9A 5B1AB 4YSTA 2J55A 1GY1A 4GYBA 3PPSA 1AS8A 4YSAA 2PPFA 4KNTA 5I5IA 1OE2A 5F7BA 3OMNB 1I53A 1BXVA 2YAFA 1IBYA 4Q89A 3UACA 2XX0A
chains in the Genus database with same CATH superfamily
5C0GB 2PTVA 4UM9D 2WXLA 1O5DT 5F1NB 2Y5TB 4GW4A 1KTLA 3FO2A 3UTTB 2OTUA 5CM1A 5FWQA 4TNVF 2WKLA 2QGEA 2P8PB 1JYNA 2GJ6D 5EC2A 5T1KD 4NQVA 2EDEA 1ZHNA 1S8DA 1U8IA 3WUWB 4E9RA 1U2YA 1JI2A 3NCXA 3DURB 4KHTL 4XGZA 5HDBE 4YWGL 5D96C 1BOGB 4EN3B 5JIKA 4D7BA 1HYSC 4KZ0A 1R3IL 3CZFB 4RDBA 2ITDA 2DZEA 2QVTA 3QZWB 4R0LC 4GG6E 1S7VB 1D7BA 3U0WL 1AMXA 1KYOJ 4JB9L 4KXDA 1F45A 3MC0A 5T1KA 3M86A 3MHZA 1YJDL 1ZK5A 5C0FA 1PNCA 5I1HH 3ZKXC 2J8HA 2V2WA 4R7VA 4OTXH 5TH2B 1XGRA 2HRPH 1U8LA 3ES6B 4Z7VA 2VMDA 5BZDA 1DBBH 3SDXE 2AF2A 5HXMA 1CZ8H 2NUPB 1IC5H 3QJHB 3GI9L 2H4EA 5E1AA 3HMWH 4OUUB 1ORSB 3HG4A 5GGVY 4GKSA 3UOAB 3GSRB 4AQ1C 1KY6A 3LD8B 5F0JB 1MFAH 3S35L 5A3IC 5G5DB 3MRMA 1CB4A 1V7MH 4X4ZA 4HJ1A 5F1OB 4HEPG 3IMBA 1OT4A 4QF1A 1ZWIA 5IESL 5C2BH 3D33A 3NAAH 2F6AA 4Q14A 5D7IF 2W60B 5F7KC 4ONGL 1T5WB 3BWAA 3C5ZD 4OU3A 1IC5L 3QXUA 4KI5E 1QHOA 1KCSL 3VD4A 1KGIA 1E4XI 4WO4C 3EJJX 3KW7A 3BI9X 5FWRA 4BDVA 1XZWA 1OQXA 4DW2L 3C6LD 1A6ZB 1J1OL 1L9OA 3G6JF 5E8DH 2KHAA 5HI4C 1LNUA 3ZL1A 3RTQA 4FHBD 1FO0B 2DBLL 4ALAC 5L7XL 3ARYA 4FMVA 3VXPA 4WWKB 3FTGA 4Y19D 3F12A 3T2NH 3HTLX 1NLBL 5KN5B 1YHPA 4O51B 3RWFB 2RAMA 4F57H 1HT6A 4LCWA 1G6RH 3VSTA 4ZO8A 1ZIBA 1SVBA 1UB5A 1FYTB 3TVMB 4D9LL 4QAWA 1GGYA 5E4EB 4AEHL 1R3HA 5FDYA 3BP6B 5ABAA 4F8OA 3NZHL 3FO0L 4JO3L 1BVNT 3HI1B 4DZ8B 3WNIA 2JKNA 1FNEA 4M9PA 2I27N 4WRLA 3SGDI 4TV3A 1D2PA 1KGXA 3VFVB 1WIUA 5DZLA 3KVDD 2ZT9C 4N3UA 4KX8A 1T6BX 2NR6D 4OJCA 2P5PA 1GJWA 1U8MA 3T6VA 4MD0B 1HX0A 1PGRB 3ULVD 5ALCL 4JFOB 2XIIA 1NC4A 3E6FB 2NLJB 5HYEA 3D06A 3V0DA 2C7FA 4ZMVA 1KCRL 3UROR 1YVLA 5I8EA 4MMZC 1EGJA 4F2EA 2J88L 2LLGA 4LPVA 1HESA 3CN0A 3HMWL 3KBFA 1RP9A 2JI1A 2WMPA 4WLCA 1JHLL 5TDNA 1YYCA 5F9OL 4XN9A 4AJWA 5GZND 2GG1A 3OXSA 1DTUA 3P4NA 3LZRA 3ZRFC 3AGVA 3QUXD 1RIHH 3MGTA 3LZPA 3BAEL 1G84A 5AZUA 1EX0A 1CU4L 4KDTA 2WO4A 4FJZA 3LKSB 4ZMOA 4E0RA 4QYOB 1VF5C 4MA8L 5B38B 5H37H 3WDHA 3D05A 2XTJD 1UC6A 2MOQA 5DLLA 5H4ZA 2X4OA 2J1XA 3EFDL 4FCHA 5CXPA 1OP5K 3BP5A 4POZC 1ZLWK 1RULH 3IJYB 3ENEA 3FQNB 3O3EA 3RFZC 4YSOA 1FF5A 5DYOA 3QI9B 2OMZA 4JY6A 2IH1A 3O9WC 3D2UA 1CCZA 4BUHA 1M4KA 2RACA 1CFTB 3F6IA 4FG6D 4UT9L 5MENA 2P52A 2JQZA 4QY8B 4BZ1L 3C2AH 2PCYA 1QFWM 2N01B 3FW6A 5TFSH 1SJHA 4FQLL 5HJDA 5J3HC 4HG4K 1ORQB 4RZKA 2W07B 1BWWA 3GIVA 2ODHA 4LCUB 3BDBA 4MD4A 1XDTT 2H6UA 4U6XA 3Q2VA 1J5DA 4M6OH 3NJMA 4U49A 5LXGH 2YMTA 5JPNB 3BDXA 5FFGA 2VOTA 3UTSB 4H40A 3GEFA 2D0HA 2RTTA 1DO5A 3U0PB 1QFHA 1OSZB 3FH8A 1WBXA 2KC0A 3D8MA 3Q48A 4MJHA 2P46B 3BZFA 3IJSB 4JG0L 4FFTA 1FZMA 1TFPA 5E03A 4EUPH 2WIMA 5E0FA 3M7FB 5JPMA 1N8OE 4RMRA 3BP7A 2VJ8A 2QLVB 3BDYL 2XV3A 5KAQG 1MWAL 1QFUL 3IKKA 2JQAA 3L81A 3TF7C 3DNKA 4YGVB 3PDOB 2X4NB 4DZBA 3D1MC 5FYJD 5HI3D 2VIRA 3MRDA 3V2AR 2VDLB 2VXQL 3QQXA 5C6WH 2RJMA 1INQA 3BUPA 1XSJA 4IGBC 5AOJA 2X2YA 5EBWB 3ROLA 5IVXB 1OAYH 4LU5H 4NC0B 2OL3B 4MJ6A 4FFWD 4PLKC 4X5PA 2CR0A 2P5ED 5JZ7D 2AC0A 4JJOA 1Q9KA 3W0WE 5IUCA 2AMGA 1U91A 4TQPA 4WNQA 3X1BA 4B9IA 3P3UA 1TQCB 3FUMA 2YAEA 1GS6X 2YD8A 5H35B 1NPNA 2ZJSH 1AGDB 3JWNE 3K4AA 1R0AL 2F7OA 4MA8H 5DJYA 1YN7B 3DTUB 4B95C 1DJGA 4KTEH 3WEXA 2I69A 2JJSA 1MAML 1W0WB 1G6RL 1OAQH 1EJOH 4MDJB 4NRXB 2N7SA 4LOVA 4Q2ZB 3H9HA 1IVTA 3N9GL 4OV5A 5DD6B 3SE9L 5CR1A 3I84A 3PV7A 2D8KA 2OYKA 4WEUD 3NYKA 4CSZA 4Q4EA 3CSPA 3FUIA 4ERSH 4W68A 3TOPA 2DAVA 2JQMA 1SVCP 1CK0H 4MJ2A 2QHRH 3IGAA 4X7FC 1ES0A 1TTUA 1ZGLM 3VXOA 2FNWA 5FYJE 1B0RA 1CGTA 3TPKA 4UU9B 1CBVH 4LPXA 5JW5A 3IGKA 3VWKC 4QRRA 3T4AB 4RA3A 4EN2A 1YNTB 2ADFL 4CU8A 5I15H 2OMTB 3KWXA 2VXUL 4PJ8B 1G9EA 1KPUA 1W2KT 5MEPA 3RTLA 1ZTMA 2R0WH 3QZOA 4OCYH 2ADYA 3CFDA 4PJ5A 5L2JA 2YA2A 2X9YA 3FCTA 3QG7H 1XCWA 1JGDA 1I3RA 5DS1A 1H15A 1KCVL 1E3ZA 1V7ML 3AY4A 5FA4A 3TZVB 4NO5A 1JYVA 3WY1A 3NJFA 4JM4L 3MV8A 4KZDH 5D72H 3O8XD 2J8UF 4ZRGA 4LRIA 3GXFA 4TL4A 5EOTA 5HDQH 4Z7AA 3BAKA 2X10A 5KZCB 5DFTA 3TL5A 1K8DA 4J27A 3G6DH 5AW5B 3TBBA 4HMEA 5E1GA 1CGXA 4PFEA 3FO9B 4PREB 1U36A 4XHJC 1INEL 5JQHC 1GTFA 4BZYA 1MW1A 2GT9A 1O7SA 1P4LB 3MRCB 1Z0NA 3LZFL 5GRYA 1PKQB 5CU5A 3VXSB 1ZGLP 2FLBT 3STBA 2DMHA 5E8PA 3HZYB 4UTBA 5ESAB 2O6DA 2F5BL 1LK3L 1OTTC 2A7BA 4IQHA 3PWJA 3PF2A 4L0PB 5H94B 4KVNH 1KGUA 4LSPH 3TT1H 4IBVA 2CZNA 2QBWA 4XPGL 1DQTA 3OF6A 1MRDL 4KKNA 5DGRA 4TPRH 2H6OA 3EKCA 4I9WE 1KB9K 1MRCL 2BNRD 3M1CA 5HGGS 3AY2A 1U92A 1VIWA 5C0BD 4O2EB 3VD0A 4DPRA 1NCBL 1RZIB 3WLBB 2NTFA 3CLEL 1SDAB 2CHNA 5DQ9B 1NSNH 1Z1WA 3VFPA 3GKWH 4I7ZC 3WSQL 2DQHH 1RFDH 3SE9H 2H3XC 4XO3A 1CFVL 3A47A 1AHWC 4PLKD 4JL2A 3DJRA 3QS3A 4PWHA 4R7NA 3HG0A 4WJ5B 5I6LA 2VLKA 1YUHB 4OLVH 4YAQA 3TVMC 2HUEA 4FQ2L 1TJIH 3LTVA 2W0FB 1NGPH 4NNXB 4JPQA 4JUTA 1TUPA 5I23A 4LCYA 2ZCHH 5DURD 2NNFA 1BM3H 2D0FA 1BF2A 2P4AB 1P7KA 3HC4L 3ARUA 3DHUA 1L5GB 1CIUA 5IB4A 4G7VH 3UTOA 3WFCL 3CN3A 1DVFD 2A6JB 3QH3A 4NKDA 3V4PH 1TFHA 1OAUH 2D7TH 4FXTA 1M7IA 1GOFA 4U1LA 3MA9H 2CA3A 4FQ2H 2C7UB 3CH1A 4G42A 4L3EE 1ZLUK 1JV2B 5HJBA 1UFGA 4EN3C 4HSQA 4A2LA 4IRJA 2P5EE 4OZGE 4PWFA 3DJZA 4AC4A 4W9LC 5IVXF 1L4IA 1HCYA 2YOCA 4QLRA 2WLHA 1JN6A 3B9AA 3N85H 5SWZD 3VRIA 4JFWA 2HLFC 2WNKA 2J6EL 3UZVA 3ULUH 3C9NB 3WTXA 3CC1A 3O3DA 4ELME 3ALPA 1YNLL 3ZTEA 2NW2A 1KNOA 2BIIA 1XGTA 3FHEA 4L4VD 2HVKA 3DJTA 5E1QA 3QIWB 5DZAA 1FZKA 3BP4B 2VXTH 1U6AL 2P44B 3OR6A 5C2BL 4KNTA 1DCEA 4HCRA 3FT2B 4LP5A 3ARTA 5DA0B 5IG7A 2A74B 3OMNB 3KMDA 3WU1A 2VN4A 2WVVB 3O3UN 1JERA 4QNPE 2J6EH 2B15A 3T0VA 4A6YH 4C55A 1DLHA 4XN7A 4XNXH 1ZK9A 3EJPA 4QOKA 4Y16D 5F88B 5I1LB 4KY1H 5K39B 3VXRE 1P7BA 4IOSA 4ZPTB 3MCYA 4RLDA 2VZVA 3DJSA 4OZFG 4DP5X 4IOFC 3QDJD 4LCCC 4RX4D 1IEHA 1HYRC 1UB6A 2CAKA 2B1AL 1V05A 4PY8J 3NJKA 4AC2A 3U4EB 2A9NL 5GHWH 4LLQB 5KSAB 5F89B 4Z7OE 5FUOL 4WFGD 4JAMA 2IPTH 2W9LA 3U0WH 4WTQA 1PZ5A 2HTLC 2MMXA 3CGTA 4A37A 2CCLA 4AZUA 2I9TA 5BZZA 4DAGH 3TA3D 1YAZA 1HHGA 4GMSH 3QCTH 2PYFA 3DO3A 1QHPA 3T3PE 2FO4B 3TV3L 1I8UA 2WAQA 3QB7C 2WOYA 4FQIL 2VW7A 1B6DA 2Y1ZA 1JDCA 1Q4NX 2JELL 4L8BA 1KJ2H 2PPCA 2HLEB 1HOEA 1Q0XH 1U3YA 2FWUA 4MZIA 3VXRD 3D09A 4GJTB 1D9KC 1Z9PA 3FCGA 5TK4A 3SCMD 4WFHE 4JFPA 4OIIH 3FPYA 2VDPH 3JWOL 4M7JL 1JZ4A 5LGJB 3BT0A 3I2CH 3O9WD 4MD5A 3X1EA 2Y7OA 3VTTA 5E7FA 2X0WA 3ZKNC 1U0QA 4PV8A 4NQCA 4PJIF 3BPCA 4FQHA 4ZUWB 1INDH 3JYBA 3NK3A 3INUL 5EZJB 4ZMQA 2EIDA 1GPOL 4PJDA 5BV7B 3BPLB 1NAKL 3S98A 4IBSA 5HGBA 2EDLA 2P9RA 4MYPA 5E2WL 1LWJA 5E00A 1U95B 4O02B 3K5RA 2EABA 3BN9D 1D2OA 5ADOH 2VN7A 1FAIL 1DJWA 4YPJA 1DJIA 2UVFA 3EAKA 3QJXA 3NJHA 1HEJC 4HUVB 3HRPA 4KROB 1JNHA 4P23C 1IGCL 5FLUA 1EHLL 4GMTH 4U0QB 1T1ZB 1J86A 3MRQB 2FR4A 3ECWA 3F5WB 2IXQA 5DD3H 4Q9RH 2IC2A 3EXLA 4ZUVA 4LSRL 3RUGB 2CBTA 2BP8B 2Z31A 4PB9L 3WIFA 1FA4A 5GSVA 4OLUL 2GQHA 3ARGA 4RFEA 2NY7L 4ZAKC 5JPMC 2MHAB 2CG9X 4HJJH 4I3RH 3GUTA 5BO1L 4NZDA 1LILA 2IJ0C 2J56A 4N6RB 4YHYC 3G3LA 1J0IA 2DWEB 5INCB 3QG7L 1S6NA 1N68A 2AABH 3QUML 3ASOB 1OGTB 4Z0BH 3VQ2C 1XMWA 2EEDA 2O61A 1OSPH 3O3AB 2BS8A 4G7VL 5GZOC 3PJLA 2APTA 4J4PA 3INOA 2JV6A 4NUGL 1G9NL 3TFBA 1J05A 3RWHA 4KITB 3WCYA 1EEYA 3L16A 3PHSA 1OAXL 1V3KA 4LDCA 5DDHA 1AP2A 3LVTA 4WNJA 3TNMA 2IAMB 4NYLA 5AW3B 2JXMB 4PCTA 3U4KA 4JG5A 2J71A 3L8QA 4NQEB 4JCMA 2FL5B 4KUZL 2VLJD 4NZTL 4B9FA 3A22A 1DVSA 4XR8C 3GDCA 3NIDF 5F93C 1XXDC 3V4PA 1AD9A 1MJ7L 1K5WA 2OTPA 1OTUC 3ZHFA 3I9PA 4X8XA 3EUUA 3VGDA 3WFEL 2GI7A 4F1SA 3FU5A 2EUWA 4W93A 2QKSA 5J11C 2Y36L 3QEHA 3BFQG 3FQRB 7CGTA 1MLCB 3VSUA 2E59A 2DWDB 1F1GA 1E4KA 4KQ4L 4CADA 5GGSA 1RZGB 3JT2A 4AUYA 4W9ZA 4XCEB 4XNYL 2E7LA 5CSZB 2MH4A 3HMXL 2Q3AA 1KXQE 3NH7L 4PBVC 4ZXBD 3BZEB 3VFNA 4EXPX 1FL6B 3NJJA 4XCCL 4N1HB 2OR8A 2Y2TA 3QDMA 3K74B 4C4KO 2EIEA 5AVRB 1M1XA 1RULL 2KQMA 4KNQA 4QRQA 4ESKA 3WKML 3L17A 4G8GB 2DJSA 4Z5RB 2DI9A 4JPKL 4G7RB 2R0LL 3AY4C 3PP4H 3O6MH 3NIFB 3UGEA 3OKOB 1ASPA 1J8HE 2XCMC 4KXBA 1JZJA 1OARL 2FWOA 1UGNA 2EYTA 4DP8X 1HSBA 3X11A 3N41F 4N2KA 5EN2B 3RKDC 5JDJA 4Y2OB 4ZNEE 1X9QA 1QNZL 1URLA 4P5MB 4AIZB 2DL9A 2EKJA 3G6JA 2FX9L 5I16A 3ABZA 5CGTA 2TRHA 1NFAA 2B4CH 5H4YA 1J9RA 2AMUA 4FQIH 4P46D 4X6CF 2UYLB 3JWNC 2PMZA 3ULAB 2CA4A 1XF5A 3NEXA 3QNXA 3ABLB 5HJGA 4J3OH 3QHFL 5I1KH 5BCAA 1JPTH 1N3NB 4OD3H 5FW6A 4OI8A 4ZX6A 1RJZA 4MJ5A 4NN6C 4PW3A 4AL8L 4N2HA 4PJAB 2Z64C 5KVEL 1CICC 4L29B 1ZJBA 1TEGA 3OMIB 1E4XH 4AYFB 1F02I 1DLFL 4P2QE 5AENA 1UOLA 3ME0A 3WNLA 2FTAA 4OM1L 1NAMB 3MV9D 2OZ4A 5C8JA 5ESVA 5E6RB 3EDEA 2AJ3B 1D5ZB 4LASH 1P9MC 2VAJA 4N0YL 1EAOA 5CIPA 5CZXC 2I25N 3PGDA 3SGKC 4ZDHB 5T3XE 4OCWL 3V5DB 2PCXA 1HE8A 1E4JA 3QJRB 3S4SB 4GRMA 4BFKA 3VFUA 1A9VA 1E4XL 2HFEB 4IKNA 1J5HA 4AVJA 2GK2A 2Y06H 4OZHA 3D12B 4LAQH 1QEWB 4HA1A 4LIQE 1MDAA 4X7TA 5I1CL 3ARDD 2D03L 4P04A 5CP7B 2WQVA 5ECGA 3PNWB 3TT3L 1EXUB 5E94A 5B4MD 3B9KC 3UTTD 5KYNA 3ULSA 4ODSL 4KVCL 1KCSH 2AW2A 1G5AA 4JQVA 3BC9A 1DSFL 3KDMB 5I18H 4BBWA 1CUOA 1G7LB 4F2FA 1RIVH 2JNZA 5JR1L 3RURA 4HAGA 5GQBA 5D1XC 4U1KA 2ZOUA 3AG4B 4JMXA 4L37A 4BH8B 1AIFA 3EADA 1BJ8A 4U05A 3PIQB 4PSPA 2V2XB 4JFHD 4P5TC 4H8WH 3DIVA 3RWGB 4MLSA 3V5HB 5JUEH 5CZVH 1J48A 3QYNA 3O6FC 4AGOA 3CVCA 5IJVB 1JF1B 4XP4L 4IOFD 1WFUA 2VL4A 5HDWA 2W9EH 1QYGL 2F74B 3T65B 1I8KB 1PZDA 3PAUA 1JCKA 4G72B 4D2NA 4LKXA 2OFQA 3N06B 2UY7B 5ISZA 3JZYA 2X2IA 3UC2A 5IHZA 1E5ZA 1P2CA 4Y5XB 1N5YL 3RWEA 4MWFA 3N91A 3UEZA 1YJDH 1UZ8A 4NRYA 4LEOA 2J2ZA 4DP7X 4L4VA 1V27A 2LV4A 2IWGA 3UL4A 3IKCA 3EZJB 3WD5H 1FSKB 3OPZL 4M61A 4S0SD 4U1SB 1KTRL 1HCZA 4JM2A 4I2XB 5DRZB 3PAZA 4EAEA 3T8VA 1XZ0B 3VMNA 1H5BB 3CBKB 4XE0A 1U8JB 3E80A 3FUKA 5E23A 3QVAA 1UD5A 3AWEA 1OE1A 3APNA 3Q8AA 1T03L 5DC9B 1ZHBA 1YJDC 3F7VA 5FC9A 2K70A 1VLXA 3AABA 3HBPA 7FABL 3WEOA 4B9PA 4YSRA 2CKBA 3HUJB 3KNBB 3W0WB 1RUQH 5T3ZH 5CGBA 2PPDA 1DDHB 3LKNB 3MBEB 3P9LA 1H8LA 1RKRA 2L8AA 2CLVA 3BIKA 4H1LG 3OL2A 1G7MA 2RCSH 3ATEA 1J1OH 2YPKA 4FL4B 2FSEA 3MREB 4NM8H 4LIQH 5DO2C 3JSSA 4LNVA 1EMTH 4WUUB 5AZ2L 3UTZB 1F0LA 4XMVA 3LQAH 1BFVH 1U8CA 1SJEA 1WITA 2H41A 3TIEB 5ICZB 1KXQA 3T4YA 3L5WB 5L2KA 5LBSH 2WP3O 4PYGA 4TUUA 4PJ5E 4PS4H 3CWGA 3L7EB 3EJRA 3TV8A 1D6EB 2GY5A 3SE4C 1AMYA 2UY6B 1BM3L 2WYIA 2YD7A 3IDNA 4Y4FA 4FXGC 4YIQA 1IKFH 3DTDA 2C1PB 4PY7A 3HI6L 2VC2L 4F5CA 4ELDA 1TJGH 4UOW0 3F7YB 1YY9D 5I19L 1O75A 4M7LT 3N40P 2HJLA 1E9QA 1ED3A 5HI4D 2BHZA 3RX7A 1L9NA 2X0UA 1HEZA 4M5YH 1Z9SA 5D9SB 5HVFB 3HS9A 1HHKB 5LQBH 4P5RA 3BVXA 1N12A 2W38A 4GSDL 1NMCC 4TKWA 5J1SC 3EOBB 1F3JA 1YQVL 2J20A 5A7EA 1RUML 2ARJQ 2J72A 4HSCX 5AYUH 4KMTL 4WNSA 2R83A 3T0AA 4PRHE 2DKUA 1YRKA 3C2SA 4ODHL 2IDSA 4FQXD 4LARL 4WFFE 3W82A 1FVEA 3LIZL 4MXQD 2KQNA 3FBQA 4UT6L 4ZK8A 4IU2A 1BEYH 1E4WH 2CBQA 2A6DA 3QNZB 4ZAKA 1CFMA 5FHBL 4NEHB 4N2AA 2F5BH 1Y6KR 2YS4A 3DV4B 3JV4B 1SHSA 4JDEB 3U6XS 4FABL 1D5RA 2F58H 2ATPA 3MCG1 2APBA 1UASA 1ZHKB 3T2LA 4PJ5D 5DK0B 4G8IB 5TJWK 2Q7YB 4X9IA 1ZA3A 4ZOEA 1FSKC 2ORBH 4LOEA 2YN3A 4NBXB 2YK1L 3MUGB 1LE9A 3CFBA 5IOKA 2DQIH 5H2BB 4W9GC 2BY3A 1CS6A 3E1ZA 3K2IA 1CN4A 1J1XL 1OSYA 1VZIA 3PAYA 1WCBA 4NWTH 1AQMA 1WUZA 2J5LB 1XCQB 3QRGH 1AOHA 1K9TA 1QNIA 4YX2H 1F4WH 5C0IB 2IALA 4HOXA 2VO8A 1IM3A 1JZ2A 2PR4H 5TE6L 4X6BB 4HT1L 2APVA 3ZYJA 4EXKA 5D2LB 3OAZH 5IW1A 1LEKB 1NGWB 4Z8FL 5FDWB 3PGCA 1XR9A 2DIEA 4LRNL 3VSQA 1QVOB 2VJXA 1NAMH 5EU5B 5D7IE 3UTQB 1Q9WA 1A3QA 3UTSD 4I0PB 4ZOCA 5ID0A 5JHAA 1U3NA 5KAQF 4Y8AA 5DXWA 2ZCKL 1LYQA 1YMME 4G8GE 5KSBA 1M3JA 1XCTA 3QA3A 4UDTA 3N44B 1WVZA 3B9KB 1GKOA 3SY0A 4L8SC 5FKAA 3VRLF 1WWAX 3DX7A 3LEXB 3P0GB 4DP6X 3ARBB 4H88H 4C47A 5HD8C 2P7TB 3HE6B 3MV9E 5EZIH 2DQFA 4IIQA 3DSFH 1GYWA 1QO3A 3BCFA 2ODIA 2WP3T 3HLAA 2FDBP 2R2BA 4OCXL 2ZKYA 4F8PA 3BRFA 3WNKA 1XQ4A 2OYMA 1CLVA 4WI7A 4QPEA 1NCOA 3WJMB 4R4BA 1G4RA 1Q94B 5MEQB 1XAKA 2L04A 3DMMB 4OJEH 4KAQL 2CJUH 5T33L 1LEIB 1R46A 1RUQL 5T3ZL 1JZGA 2FK9A 5D1ZI 3NQIA 2VNCA 3STLA 4A7TA 3MV7A 5A2CA 2JCWA 5CU9A 2AQ3A 3S48A 3DWTA 1Z5HA 3SCMA 4AIEA 4XNDA 1ZLEA 1J5OL 1FVCA 4LGRB 1I3UA 2GW5A 1D5MA 1X5AA 3LEYL 3T04D 4AENB 4N9GB 5TFSL 1GS8A 3RU8L 5E6YA 4Y1AE 5IVNA 4N25A 5ICUA 3ZTJH 4K8RD 4F7TA 3KPSD 4YHLH 3K8MA 5HGAB 5IIEA 3EYUH 2VN6A 2WXHA 1ZT7B 4JHVA 1O7VA 1Q0YL 2EUZA 1TOXA 2ZWZA 4YXLH 3DX6B 3S36H 2ZXQA 5SWQB 1T0NB 3HC0A 2OS7A 4AGLA 1UM5L 3MCKA 2GJRA 4OCSH 3KWVA 2F8OA 1JS4A 5IF0B 3IEAA 4R9HA 5CBAB 1B0GA 4I48B 4MBRA 4K7FB 5BNXD 3APFA 1IAMA 3G5VA 4HJUA 4Z7WE 1IAIH 1FFNB 1RURH 1IKFL 1CDHA 4J3XA 4BFGA 5L6YL 4MNHB 2V7NA 2WB7A 2FIKA 1TKWA 2D3VA 4Z3TA 1F4WL 2OYLA 3WOVA 5HHOB 4NO0A 2BVOA 1VDGA 4HUXB 3X3FL 5C9JB 4ANWA 3QEQD 2OMNA 3SDDB 1WFNA 2A4CA 2ICEA 4PV9A 2SEBA 4JPWL 2X6CA 4AG4L 4BK4A 4ODXA 4P2QB 3T3PF 5HPMA 4C4BA 3CFIC 2NW3B 4NPYA 3F04A 5F3BB 2FT6A 1N5AA 1JPST 3MOQA 3QIBD 4N5ED 5B1JA 2GJJA 2JIXA 5HHVL 1MREL 2P8LB 4J23A 2VLKE 2LLNA 4M93C 5E5UB 3VVWA 4QO1B 5KG9A 2EKSA 3NFPA 2BVYA 3MCLH 3D69A 4PRHB 1RZFL 3AXHA 4WV1C 5DK2B 3U36A 4LDEB 1H6FA 4WFFD 3UZEC 3ZHDA 3QNYB 5ID1B 2YEZA 3UMNA 1HIMH 3PE9A 3WIIL 4P99A 4AZ8A 3V0EA 1BV8A 5C0AD 2WM0A 2CCWA 2FEEI 2X44D 2LE9A 2YUWA 3UGUA 1NEZG 5CWSA 2J8UA 4GSXA 3O0RL 3EFOB 1ZSHA 1FFRA 2ICES 4JFZH 4XP1H 4CMMB 3FDWA 1XH2A 3CX2A 3TH2T 4Z3HA 2RFXB 4MCMA 1SN5A 5FO7B 2PPAA 2LOEA 1WPCA 1S9XA 4QRFA 1W6WA 2BNQB 5I8OL 4JKNA 4F9PA 1FPTH 1HU8A 1TLKA 1LO3H 4DPAX 3MRGB 5LGHL 4L9LA 3PWPA 4YSCA 5FECA 1TU2B 4G59C 2QGCA 4DKFH 2UVEA 1MFBL 3PABA 3NFNA 2V0AA 2HVJA 3VM7A 4AEIH 4S1DD 1BD2B 4FA8A 4HT1H 4FD0A 1JPSL 4RGOH 4RGNC 2DQHL 2BSBA 1S7QA 2MPAH 2W59A 1T5XA 3A4AA 2GYSA 1KBGH 1RMFL 2R4SL 3B43A 4E9TA 1U21A 1XIWC 2W1NA 3RHWK 1W80A 1IEAB 2NDFA 2CHZA 2WK2A 2O93L 2WTOA 4B9JA 1EZLA 4A7QA 2MQ3A 3B6SA 5SWSB 3RTQD 3NA4A 4OCMC 1KDJA 1UWFA 2IWEA 1RCYA 1I85C 4JQXA 1SDYA 5D2NA 4I8DA 5M7QA 1TTFA 4JFDA 4FJYA 3T2OA 4UDUA 3KPRB 4MA1C 2NX5E 1ML0A 3AITA 4N2MA 1U3HB 2CBOA 2R1YB 1VFBB 3BHBB 4LL1A 4OLYL 5F44A 4UQ2A 3LS5L 3SDCA 1XMEB 1BQLL 3T09A 2G75B 3QGVA 1WC7B 1PLGH 1GCYA 3NIDB 1JHKL 1QFOA 4QAMB 4CW1B 3PHOB 2NY4C 1MNNA 4OFVA 5L0QC 4BXVA 1K4CA 2ESVA 2OPCA 1M71B 4P57B 3BPLC 3POCA 1J8HB 5HGDA 3UAJA 4PI0A 1DDTA 3JUYA 4NSKB 3RKDD 1E8WA 2MNJB 1KTKE 4R26L 3HG1B 2Y6SD 1L9PA 2WQ8A 3J8F7 3N04A 4IHOB 3SDXA 4IMLA 2XIDA 4IOIB 3BVNA 3MUY1 4NC1E 3T1FB 3UIZA 1QRND 3HMXH 4U1NA 1IGFH 1TXKA 2BERA 3HZ3A 5E8DL 2AV7A 3VB8A 4WI6A 1KIQA 2GSIA 4PJHE 5KYUB 1M3IA 4Y1AD 3QSKB 4XN4A 2H2SC 2BMKB 1ZIAA 1GRWA 4QRTA 1FZJB 4BHUI 1ZANL 1VACB 2CH8A 1UURA 3N1QC 4NKIH 1IQWL 2AKRA 4ODTL 1QTYT 5DD0H 4PEEA 1Z9MA 5F3HB 3VXQA 3K71B 1GJIA 3SE8H 1NKGA 3HCVB 4PJCA 2AVGA 4YXKL 4LRIC 1XR8B 3B8SA 3HE6C 4HZLA 4KVPA 4Y16B 1MCNA 5J6GB 2ZOLA 1EANA 4BFIA 1PY0A 5MEOB 3GRWA 4P4KD 1TQSA 3PAVA 4B9ZA 1GKEA 3QDJB 3J27A 1ZCRA 2WWNA 3H42L 4NUMA 5D7KE 3KGSA 3KVQA 2BVUA 1CC3A 1PAZA 1UUNA 3SD5A 2E7DA 2GJ6A 4LSDA 3A23A 5I1AB 2BHUA 3DVGA 4PIBA 4Y2DA 2LVEA 5JO5B 3OAUH 1S7UA 2WBJA 5BRZB 1A02N 2H26A 5BJTB 3BGAA 4WKZB 2E86A 1MCSA 3IDXH 3KL3A 3KS0H 2B8OT 2NY3D 4F3FB 2N7BA 5E8OA 1EJOL 2F1EA 4JFUA 4OUOA 4PG2A 3WJJA 4LCCB 4EO5A 4IU3B 3HA0A 1MWAA 5K1NA 4GKZA 1HI6B 2FUQA 2YGQA 4I77H 4PU2A 1K3ZA 2FQGA 1Z9OA 1AGFA 4PJIB 1JWUB 4ZW6A 1RP8A 5G4OA 1NC2B 4KRPC 4L1SA 4NWUL 4I1NB 1HC1A 2CPUA 1U58B 3FUJA 3VXRB 5BS0D 1J1PH 2XQYA 5IMKB 2WCGA 1S9KC 4QCIA 1GMIA 4IS6B 3MRNA 4J3WA 3MRNB 1OE3A 2JJTC 4PRPD 3S8FB 4OCRH 5ALBH 3T9WA 3BXNB 4EZKA 1W0YT 1H6UA 1JZ6A 4FNUA 2D73A 1MW3A 1O7DE 4GQQA 1JWUA 4RAUB 5IT2H 1AGFB 2VDRH 1F4AA 2V5TA 1ZEAL 4GKZB 1KPVB 2MPVA 3WFDH 2VWEE 3WUZA 2XBZA 1MCWW 3GJFA 5E8OB 1NBCA 4F3FA 1JK8A 4LBAA 3F65A 2HT2C 1NBVL 3VI3E 4UTAH 3HS0B 5D71L 2P5WA 1S7UB 2WBJB 3OKKB 4LLYB 3INUH 4QGTA 3L5XL 3DVGB 5DT1H 1EPFA 2F1AA 2LVCA 2NZIA 5AVQB 2AJVH 5I1AA 2WLLB 4GW5A 1UZ6F 2R7EB 1QRKA 3BGFC 1YPZE 5I1DB 3EGSB 3UTPD 2EDFA 4XC3L 2XWCA 2OSLA 1E5AA 3D52A 1DANU 5MEOA 1C08A 1WV7T 3KHOA 4A7VA 3CZKA 5DS2A 4IOSD 2EDRA 3LPGA 2AJZB 4HZLB 4Y16A 2P47B 4PJCB 3U82B 3HC4H 1HCVA 5DZ9A 4XH2A 3VXQB 5DMJB 4JFTA 5F3HA 1VACA 5LXGL 1FZJA 1L7IL 4QRTB 4WKXA 3K4DA 4HKJA 1QZ1A 1IKOP 4OZHF 1ASOA 3TJEH 2GSIB 5SWSE 2ZX6A 3MOBH 4FNLL 4LE8A 4Z77B 4WI3A 2Q7AA 3FT9A 3EH3B 4JFFD 4F37F 1E5YA 3BVNB 4XOBA 4IMLB 4IOIA 3SDXB 4IHOA 3T1FA 2BIQA 4HETA 3HG1A 4B0MB 2GB2A 4P9HH 2KL6A 4TTGA 4NSKA 3OTTA 4L3FA 1J8HA 5HGDB 3WMPA 3IWVA 4P57A 2QPDB 4U7KA 1M71A 4PGJA 2ESVB 1K4CB 1NDTA 5I73B 1JK9B 3PHOA 4CW1A 1IC7H 4XMPL 7PAZA 2PXYC 4UYQA 4FNLH 1NJ9A 3SDCB 4AK2A 3QYMA 3TA3C 1UADC 2NY0C 3LIZH 1IGIL 4IBUA 3BHBA 2V17L 4LHUG 3LB6C 4K73A 3QWOA 4LVNC 4XXWA 3KPRA 2FBOJ 4UDUB 1JXGA 4JFDB 1OQOA 3THML 3T1WA 1G6VK 1IX2A 3SGEI 1CXLA 2C4XA 4OV6F 1QA9B 1QBLH 3CPLA 5JHMA 1AS8A 3B6SB 1WCQA 4JVPA 3BJLA 2WUCL 4D9RE 1IEAA 4DQOL 4FXGB 5F97E 3QXWA 5EOCH 1S7QB 3SE3A 1F6AA 1KZYA 4OGXH 3S97C 1QLEB 1U41A 2VL5B 2DH3A 1DEEA 5E6IC 1BD2A 1JD9A 1CFBA 1V3MA 4S0TD 2DQEH 3V6BR 3NFNB 3PABB 4ORZC 2OP4H 3CFKA 2Q3ZA 4AKPA 3WXWH 1F86A 4KK9D 5T5FA 5I0VA 2WXMA 1G0XA 1R47A 5FECB 3PWPB 3UH8A 3MRGA 3TYGL 4AXWB 3VYOA 3WIHL 2WB1A 1F1AA 1TQUA 3ZQ9A 2D2CC 3M1BB 2BNQA 4Y4KC 4QHKI 4NAQA 1B0WA 3FYIB 1CDYA 4JPKH 4G7SB 2WUBL 4L18A 4WV1A 4WWOA 5CWSB 5DGQA 3LS5H 5CN3A 4FZ8H 2FHFA 4ZW3A 3KLHD 3CAFA 2UZYA 1EZVY 3F7KA 3HG5A 2YEZB 3V4VA 5ID1A 4CU6A 4DGIH 1EHKB 3QNYA 4LPTA 4TRPH 3MLYL 2XLLA 4KMQA 4TSBL 1XD0A 2ZICA 3BSGA 4OGYH 4OD2B 3I6KA 3ZKMD 4FQ1L 2HX8A 2DW5A 3D69B 4PRHA 4KJWC 5FLVA 1FRGL 3NFPB 4CVWA 2HT4D 4GEIA 4QXGL 3HPLA 2Q8BH 4C56D 4UINH 4XXCC 4YHZH 3LZOA 4AVKA 1QUNA 3VRJB 4KQ4H 2FJFA 4BFFA 3D25A 3ABKB 5GRZA 1JUFB 1PD0A 3APCA 1IBZA 2FB4H 4GPVA 2P8LA 1F6LL 4DIXA 4TF4A 5E0QA 1N19A 5GGQH 1PVHA 1N5AB 1Y6MR 1MREH 4FI8A 5G4MA 4PJGF 5F3BA 3O6KH 4FFVD 4NPYB 3E1F1 2NW3A 5GZOA 5HPMB 2QDVA 1UD4A 5IBTH 1P0SE 3LXAA 4FQ1H 1KJ2L 4KXCA 1CD9B 3DX8A 1U42A 2VDOH 3EUDA 4HUXA 2BVOB 3GXPA 2G3NA 2YXVA 4NO0B 3KCPB 3V4VH 1A4BA 3BPNB 1TLMA 5GS2H 1GA2A 1BQUA 5TPWL 2FD6H 2FIKB 1XIWA 2V7NB 4MGXA 4MNHA 2CRMA 4XI5D 3WKMH 5JDSB 2ZKWA 1MUJA 4FFVC 2G5BB 1XCXA 4FERA 2YWZA 4UOZA 4NOFA 4KMLB 3G5VB 1PTZA 2X89A 4K7FA 1B0GB 4I48A 1KELL 5L8LB 1R75A 4KTYA 1A9EA 5IF0A 5EEVA 1B3JA 2W65A 2Z34A 3K80A 3MCKB 1ZDQA 4N5UA 4NKOB 1CTMA 1T0NA 1BQKA 3DX6A 5SWQA 5LG6A 4AMWA 1IGYB 4J2QA 4JVWA 4DP1X 1FYHB 4NJ9H 4OGAD 5I30L 3EYSH 1ADQA 4OIBA 3U9PH 5IIEB 5HGAA 4A6YA 1CFSB 2R69L 3D30A 4F7TB 2BVQA 4MQTB 4P3WA 2I5YL 4RMQA 1V10A 4N9GA 2BVPA 1BAFH 3PUCA 3MOAL 1AZUA 2A9MH 2DQCH 4GMTL 5AKSA 3SDAC 1ILSA 1JRHL 3B9DA 1D5BB 1E90A 3H6AA 4LKCA 3UAJC 4AY0A 1BFVL 4CNIA 4HD5A 5DWUL 2DTSA 4LLVA 1OPOA 3DMMA 4AGNA 3HVNA 3OAYK 4UT9A 3GLEA 3OZKA 4XI5C 5H37G 5MEQA 4OBSA 2C9AA 5E51A 4KH2A 3WJMA 1JNLL 4QRPE 2F2HA 1ZHLA 4IBYA 4Z7OB 1GZQA 1NWOA 1HN1A 4R83A 4G3YL 2R2BB 2F53B 3HLAB 4KKPA 3UBXB 2WQUA 1QO3B 3GSNL 2A6KB 2P7TA 3HE6A 4HH9A 1EO7A 3DX7B 1T2JA 3LEXA 1OCRB 4LASL 5FKAB 3I74A 5EULV 4OF3A 3SY0B 5E56A 5HHQA 4U6TA 2PWHA 4UDTB 3S3DB 1OPGL 1YC7A 3QA3B 3DPBA 1EHAA 1NPUA 2M8XA 5SWZE 3WY2A 5KSBB 3MUUA 3K6SB 3KXFE 5EB9A 1ACYL 2BZDA 1DL7H 2F5AH 3F3HA 1IC0A 3BEVA 2BWQA 3CK0H 3O6FD 4I0PA 5DMIH 1TYEB 1Q9WB 1S3KL 3UTQA 4OY9A 4NN5B 3VQMA 3MODL 5CILL 3SBRA 4CL7A 3D39E 3QZPA 4L0ZA 1QVOA 1KC5L 2K7QA 3LMJL 5K9JH 2OMUB 3KG5A 1YO4A 1PEZA 2C9QA 1LEKA 1YEGH 5FPIA 1TYRA 1K6QH 5B1KA 5JIMA 4BELD 4X6BA 4PJFB 1IM3B 4NNPL 2IALB 3B1TA 1CFVH 2R0KH 4EOWL 1EZUA 2W5PA 3RX5A 4AKOA 1XCQA 4XP9L 4NC1C 3NCBB 2QVIA 5GPRA 4E9WA 3D51A 1A3LL 1CR9H 5H2BA 5PAZA 3V0JA 2RH0A 2WLMA 4HK3N 3CFBB 1D6VH 1A8ZA 4HXBL 1WD8A 1J88A 3L5HA 3HC2A 4H8QA 5JUEL 4WHTA 5JOPD 1EK3A 2FGWH 2EYRA 2CJ3A 2YHGA 2Q7YA 3WS6A 5DK0A 3LY6A 2CK2A 1ZHKA 3A3YB 1OCWL 2ATPB 3IDJA 3CU7A 5J5EA 2R4RL 1HNFA 4I4WB 2Y3AA 4M7LH 4FMFA 1EO5A 3L4CA 5E08H 5EU4A 3QNZA 2A6DB 4ZAKB 3ZR5A 4R90L 5HHVH 3GTVA 4PJ7A 4YHZL 1FVEB 4LFHG 1OF0A 1Z32X 3QR2A 5GRUL 1KBVA 2NSXA 5E9NA 4TQ8A 4GRLD 5D1XA 5AW4B 3QORD 5CEZL 1RY7B 1VERA 3K81A 1Q9LB 2P5WD 2FJSA 3L9RB 4GRWE 4M02A 4NLHA 2AFNA 4QNPF 1YQVH 1HHKA 2ZE0A 4MAZA 2JJUA 5IBUG 3F84A 1Z9SB 5D9SA 3V52L 2FUTA 1HEZB 4KKZA 3MJ9H 4WO4B 1UD6A 1IARB 1GR7A 4TSAH 4KO9A 1LE5A 4P46C 2LU7A 4J5VA 1ED3B 1E9QB 3F7YA 4OM0H 1N4XL 1MFVA 2HT2D 2EH7L 4GQPH 3WTSA 3KE0A 3IN0A 2UY6A 1CE1L 4WJG3 2OCJA 3FQ4A 4RGNB 2NZ9D 3BQVA 1U8PB 3JTTA 5AUMB 3Q7JA 3TIDB 5M95B 1YEFH 3EBHA 4JGMA 1UOVA 1AJ7L 4PH8A 1QI4A 2Y22A 4QHUB 2CJUL 3T4YB 5I75B 4P59L 4KK5C 3ARFD 3TIEA 5ICZA 3KPPB 1FCCA 1SJEB 3BVTA 5I66A 1GYAA 1NFIA 4WUUA 2R56L 3GJFK 1O0VA 1A4CA 2FSEB 2BM3A 2HCZX 2DJ4A 1G7MB 2VSKB 1Y0LA 3MRIB 4F33B 5C0CA 2CLVB 2NY4B 3P9LB 4HYTB 3BQUC 4HJJL 4I3RL 4LSUL 4X98B 1NCWH 1V5JA 3IMUA 1AACA 1I1FB 1LO2H 1GMEA 1PU0A 4MB4A 5C6PB 1T4KA 3HUJA 1EDHA 1RK0B 3NJNA 5EBMA 3MLVH 3UG4A 1FAKT 1PBYA 1SXAA 2ENQA 2XQYK 4XNAA 3BUYA 3EGDA 3F7RA 4QTIL 2F54D 4GY4A 5GISH 6FABH 43CAB 3NGBC 3FQ2A 1IAIM 3FU8A 4ZFZA 3W5MA 2EEBA 2XFXA 5IFAH 3LHPH 1XZ0A 3D18B 4H26A 1HTYA 4JM2B 1J18A 3LSOA 4U1SA 1MHCA 1KV7A 3LCYA 4Z9KB 4Y19E 1GIGH 2J2ZB 2EADA 2NUTB 1UZ8B 4NRYB 1RK1B 3ZDXB 3KPSE 2WLIA 4MWFB 5IMOA 5KSBF 4Y5XA 3SBQA 4CSSA 5IHZB 2HT4C 4DVBA 3FOLA 3Q3GA 2VDLH 4WW1A 3TBTB 2GABA 4CC4C 5ISZB 4LKXB 2NT0A 2HKFL 2YK1H 5EORH 1LQSR 2Z9TA 2XRAH 1I8KA 2VZTA 5C08B 5A6LA 3T65A 1JPEA 4PD4K 3EF4A 3X12A 4DP0X 5IJVA 3PS6A 3S34L 1T3FB 4JO8A 1UT9A 1E67A 3K2UL 4MB3A 3IJHB 1TVBB 1W0VB 4XXDB 2LFGA 3GMRB 3KYAA 1TQBC 4GI9A 4LHUD 1AIFB 4L37B 1AGBB 3IBOA 1KLFB 1KJVB 3HKZA 1TQTA 1G7LA 3CSBA 1NCCL 2NNAA 2IANB 4NN7B 3KDMA 5KSAC 4Y4KD 1KGJA 2Z1KA 4W9JC 1PIFA 4AV0A 1P4BL 4MMYB 5ESQA 4Z1PA 2F7QA 1MJJB 4OKVB 3RVTC 3CVHH 5E94B 1EXUA 1ETZA 3S5YA 3LXCA 3PNWA 5CP7A 3U83A 4HLEA 2YPVH 4PJEE 3HRZC 5DHVH 1FPTL 3D39D 1R3IH 1NUDA 1QEWA 2I7OA 3OLEA 1CPUA 4OZHB 4GP5B 2VCOA 3FKUS 2HFEA 4LEXL 4HK0B 2WLJA 1JRHI 4GRMB 4M5SA 2XWTA 1AZBA 4XBGB 3V5DA 1ETA1 1RVFL 3IJ8A 1QW9A 3MFFB 3U2IA 2FO1A 2HWZH 4ZFOA 2E6JA 4H13C 3WHE1 1TIUA 5GZOD 3KPOB 3IJEB 5KANI 2QTEA 3FOMA 1X5YA 2AQ2A 3ESVF 3TEXA 5IW6A 1NAMA 1CMOA 3ATDA 2E27H 3B2MA 5IJBC 3BAXA 1H3PL 4FEMA 3SN6N 1PG7H 4NNYB 4ZS6D 4WGKA 4P2RD 3UZQA 1X5HA 1RJZB 2A4EA 4MJ5B 3SD2A 3B56A 3ULUL 4JG1L 1A4AA 5CSGA 4LO9A 1R3KB 3IJ9A 4QHKJ 5AW8B 3VO0A 5IHHA 1XF5B 2B14A 3L13A 3QNXB 2FHBA 5DYFA 1R3KA 3MYZA 2XQBL 3E2HC 3K3QA 1SUJA 4ATTA 3QDME 2VLRD 4FNPA 1N64H 3UZQB 3WJLC 3FUDA 1T2QL 5I16B 1CYGA 4AIZA 4JO2L 4B60A 4A39A 1I8AA 4NNYA 5EN3A 5BRQA 2RQ8A 2OI9C 5GS0L 3X11B 3FUNA 5CJBA 2FWOB 5J13C 2ESVE 3MUJA 4EPSA 5JQ6L 5IW6B 3MACH 2XX0A 1DN2A 5DR5L 3MLPA 5FUZH 3FOMB 3HNSH 3MV11 4OFYD 5DUJA 5FXCH 3U9WA 3IJEA 3O0RH 4XP1L 2ZPKH 2ZKMX 3KPOA 1XO8A 3CH8A 5DVPA 3WNOA 3DMMC 4Q9BA 2OM5A 1NKOA 5E6SB 4ZFOB 3LJ3A 3UGXA 4G8GA 3MFFA 4QRQB 4GSRA 1FE8L 5FV2A 2PLTA 2XWTB 4OQTH 4WHCA 4XBGA 4AYGA 4KK8D 3QDMB 4HK0A 3LRGA 4PJIE 2W95A 1L9QA 5KBMA 3CXFA 3VFNB 2JVUA 4W9KC 1KN4H 1KBBA 3EH1A 4M9OA 3U7YL 2GC7C 3BJ91 4S10A 4K94L 4Z7QF 3PL6D 5CSZA 1ETZB 1KYOK 1PG7X 1PPIA 2EJ1A 4XCEA 1MJJA 4OKVA 5IBLD 3FU6A 4MMYA 5ESQB 4AYEC 3X1FA 2WXFA 1GVIA 5JW4N 1OALA 5EDXA 4MNQE 3NCJL 4OQTL 4GI6A 4CADB 3RIFF 2IANA 1OOWA 4F15B 2NNAB 1SFDA 4XWOD 1KJVA 3GZPA 1KLFA 1MCIA 1OD7A 5C3TA 1AGBA 1P69B 1CDIA 1NWPA 1G87A 1MFEH 1N5YH 5T3ZD 4L1BA 3L5IA 3GMRA 5DZJA 3QS2A 5EH1A 3O6LL 1TVBA 1W0VA 3IJHA 4XXDA 4ZD3H 1MF2H 3TEZA 2BOLA 5IBLC 1F4XL 1JMZA 1T80A 3K1DA 1T3FA 1AD9B 2VWEC 5KVDH 1Q0XL 2DLIA 3X12B 4EMZA 4RGMB 1SRDA 5C08A 2FL5A 1F6FB 3FN9A 4HZ1A 4RSVA 4OZHE 2KPNA 2JXMA 4NYLB 3TBTA 4ZO9A 1ID5I 1AP2B 3FOLB 3Q3GB 4WW1B 5AOZA 4DN3L 4DVBB 2QTVA 2CRZA 1EEYB 4TYUA 2F7IA 5IMOB 1SNRA 4Z7VF 4CRPA 1T7VA 4FFZH 5GGVH 2WLIB 4DJMA 1QASA 1FC2D 1T7YA 1RK1A 4YXHL 4GXUM 2NUTA 4KZDL 1Q0YH 5FEBA 2FNBA 4RMVA 4Y4HD 3ARED 3HIZA 1J8RA 1TPXB 1MHCB 4HS8L 3WAKA 4FQJL 3LSOB 1B3IA 4YEEA 3WS6C 4H26B 1O7DC 3HUJF 5INCA 3D18A 2E56A 1P6WA 2DWEA 2XC8A 2OBGA 1MW2A 2XFXB 4ZFZB 3VX1A 1P1VA 2AK1L 1PSKL 3GUTB 2MHAA 43CAA 4RFEB 3L5JA 4UOJA 1P5UC 3QR1A 2Z31B 2BP8A 3ZKSD 3RUGA 3BUYB 3EGDB 2BVTA 3K8KA 3MJ6A 2OJZH 4RAHA 2FR4B 1T1ZA 4JO4H 5KJ4A 2VMJA 5EBMB 1RK0A 2WJ5A 3CHQA 2JMRA 1HS6A 1T4KB 4HUVA 1KGYE 4L0YA 1OV8A 3QFGA 5EA0L 1I1FA 5D7JD 2TSAA 4PCKA 3SBWC 4X98A 2GY7B 3FTSA 1U95A 3OAUL 2VW4A 4O02A 5E00B 3HB3C 5C0CB 4HU8A 5I73C 1JNNH 1Y0LB 2H3KA 3MRIA 4MJJA 4F33A 4PJDB 5AL0A 3QDAA 1XTMA 5EZJA 1NFIB 2DM7A 4FQHB 3CSTA 3H2PA 3NK4A 3KPPA 4A2HA 5I66B 2OK0H 4NQCB 4PV8B 5AVTB 2M83A 1TPXC 4QHUA 4MD5B 5LGJA 4GBXD 4ZXBC 3TIDA 3I2CL 2PN5A 5AUMA 4JFPB 1PG7L 1U8PA 3JTTB 3NTCL 3WO4C 1LO4H 3FF7A 3QUZC 4KUZH 1D7DA 5BS0E 2IV8A 3TO4D 1OT1A 3VGFA 1ZD6A 4L8BB 1ECZA 2ZAIA 1ZLDA 4GXVL 2OAAA 2VQUA 1EBPA 4X6CE 3IWUA 4KI5F 5DD0L 2FO4A 1LE5B 4HHGA 2I60H 2PYFB 2V3EA 4WO4A 2DWXA 2V5MA 5AFAA 4P2AA 4KKBD 3WXVH 2I9TB 1B2YA 1Q9LA 3L9RA 5B7FA 2H5UA 5D1XB 4F8QA 1M7XA 4JAMB 3HS0C 3PP3H 3H54A 1QABA 2DTML 4NBZB 3NP3A 3II1A 1DVYA 2F7RA 1WHPA 4KDVA 4YFDB 5FYKU 2Y07L 3NH7H 4PJ7B 3V9FA 2X1PA 1IJ9A 2IOOA 5EU4B 5FR3A 3OSKA 4ZPTA 4I4WA 5K39A 4YZFE 1SM3L 2YUZA 4KK6C 1QUPA 1USZA 3IDJB 3MLSL 5IZ7A 1CTOA 1IB5A 2X41A 2DQCL 1BCIA 2EYRB 2H2SD 4E9QA 5HYIA 4WHTB 4A6YL 3C60C 4S11A 4GIOA 4HZAA 5IG7B 3FT2A 4GG6F 2B7DT 1KFAH 2BRRH 4PVNA 5E2TH 1YYLH 3OR6B 3SYCA 1JZ7A 4Y5XC 1OAXH 1A3ZA 2EXYD 3BP4A 5DK3A 3LXBA 4H0LC 2VDKB 2VDQB 5E24E 2HVKB 1XGTB 2NW2B 1MFBH 4XPTL 4NZTH 4NXKA 3DSFL 4PJFA 5HI3C 3UZVB 3D9AL 3VRIB 3LX9A 5GRJL 1THAA 4ANVA 4JX0A 2ZUVA 4KHXH 3Q44A 1GYVA 1TT6A 2OMUA 4OGQC 4JPSA 5JTWA 3PRZA 4IRJB 1G9NC 3L4WA 1N6VA 1CGWA 3CH1B 4G42B 4WK0B 5E9DD 4U1LB 4OJDH 4NKDB 2EVHA 2A6JA 3BWUC 3BEVB 5MP6H 4IKIA 4FQXC 1LO4L 4DKAA 3V4PL 2VDNL 3K6SA 3KLDA 1CJYA 5IB4B 3PDDA 3SYAA 3DPBB 1F4YH 4LB8A 1L5GA 4HS8H 4R4NC 5HBBA 2KLTA 5HHQB 5CGMA 4OZIF 5C3IA 1XSKA 4KQ3L 5HVGB 5I26A 2Z65C 4HH9B 2VDKH 2A6KA 3I50L 2W0FA 4K71B 3UBXA 2V9QA 2F53A 2VLKB 3EJZC 2Y5QA 4YAQB 5F72S 4R7NB 1WWWX 5A40E 5A7BA 2V3FA 2K6WA 3ESOA 1GZQB 4I3GA 3VD7A 1ZHLB 5DZOA 4MVBD 3UP1A 4TPRL 3VFPB 2NTFB 3PP4L 1RZIA 3WGUB 5GXBB 2BIMA 4MZRA 4XZ4A 4LLVB 4PI2A 2D9QB 1U92B 1NCBH 2XPYA 3MV7E 4N24A 3LQMA 1D5BA 4LKCB 4YHOL 4CNIB 1ESOA 4JKWA 4OT1H 1A66A 1XF1A 5E7BA 1JXDA 4PLJD 3WIHA 3PWJB 2RALA 2ZCKH 2BVPB 3N50A 3VQLA 3ML8A 5GJSH 1MIEH 1T0PB 3HZYA 2MJWA 3DYPA 1IBBA 4HEME 2MOGA 4BINA 2BVQB 4CMHC 1CFSA 4A6YB 3FMGL 4YFLI 5F0LB 3VXSA 3MRCA 1XWVA 1P4LA 3U7AA 5CD5C 1J12A 3MKKA 4A7GA 1IGYA 4WFEE 3VGGA 3FTZA 4NKOA 1YUKB 2B1OA 3SHSA 3FO9A 2W65B 4PREA 4R8WL 1A9EB 1K8DB 4JREC 5IWLC 2G5BA 1MUJB 2CR3A 2D2OA 4ZTPH 2IDQA 1N67A 5EOTB 2JCCE 5JDSA 5J56B 3LYRA 3TV3H 4Y16C 1XIWB 2H32H 2X6MA 3FMGH 3V0AC 4JHAL 3MV8B 3GXMA 2EVFA 1OGAE 2CSPA 3KCPA 1GXEA 4NO5B 1TYJA 5FA4B 3TN0D 4TLUA 2NTSP 3DX8B 1JGDB 5CCGE 5L2JB 4YDIH 1H3XA 2L0DA 3S8WA 3M6DA 2X2UA 5LB1A 1KPUB 1HEHC 3A6BL 4PJ8A 3CIAA 1VFUA 2OMTA 4ATWA 1KUMA 1OTSC 2LU4A 5IFHH 1UA6H 1YNTA 2C9UA 1JUFA 3ZTJG 4DQOH 3D25B 2FJFB 1QUNB 3VRJA 4A38A 5JW5B 4KY1L 4UT6H 4I87A 5CN2A 3HPLB 5FYLL 3WI9A 3HMXA 1JDAA 2QMKA 1QSVA 1S2EA 2JJSC 3GKWL 5DO8A 3I6KB 5A2KH 1TJXA 4E9LA 3VQ1C 3SJVD 3FTXA 1DSFH 3QZNA 3JTBA 4OD2A 1KN2H 4NAMA 2FECI 5MHSE 2L3BA 3T0WA 2CJTA 3V4VB 4PJBE 5DD6A 2HPTA 4KROC 4Q2ZA 2UZYB 2WOBA 4HJ0D 4NQUA 1YNTF 5CNHA 4MDJA 3WKNA 1AI1H 4P2RE 5C0BE 4DPBX 4IK7A 1GGBL 1W0WA 1TF4A 1BPLB 4WV1B 2BX5A 2Q20A 2DMCA 5FYKL 1FYTD 2QT6A 3TVMD 5CZKA 5DJYB 5I5JA 5H35A 1YPZF 3GRWL 3GWJA 1P6FA 3HN3A 5DC0A 1JD7A 1WIOA 2YXFA 3U4AA 3M1BA 3QP3A 4MQXC 2PABA 3P4LA 1U91B 4AXWA 2JTYA 1UENA 4Q56A 3OBAA 1ILUA 3A0OA 1MJUH 5JW4Q 2A4ZA 3CFKB 3K46A 5D1ZD 5AKVA 2VZ3A 5CCJA 2EIKB 2KH2B 4MJ6B 3SDDC 5SX5H 1DEEB 3ROLB 5EBWA 2VL5A 5IVXA 3SE4A 1F6AB 3POHA 1C1EL 2X4NA 3GEWB 3PDOA 5LO7A 3U48A 4YGVA 4DZBB 4FXGA 4F7KA 2A3TA 1IVLA 2IANE 1LWHA 5FM5O 3HW7A 2X28A 2B9AA 3AQZA 1QFUH 2J1KA 3BP7B 3CPLB 3MLRH 1QA9A 3NGBB 4QXVA 4JJHA 4K07A 3GO1L 4DPCX 4DTGL 2JKRM 3DLQR 3IJSA 1LLAA 4B5ZA 4GAFB 3S3CB 3QWOB 4OCXH 4MA7H 1ZVHA 3OMAB 3NSYA 2QFRA 5GJTL 3UTSA 2FJUB 2XVGA 4UQCA 1A7RL 3LXUX 1I9JL 1NJ9B 4HLZH 2H1XA 2VZ1A 4W9DC 3HNTH 4MD4B 5C0RH 4LCUA 1JK9A 2WYTA 5I5IA 4U3CA 2ZG1A 3CNKA 2W07A 3CHXA 3C08L 3HHRB 3TO4C 3R7QA 4XVUD 3CMOL 1QSED 4XNYH 3E9UA 2NY1D 4NJ9L 1C7TA 5AG9A 4Q52A 1EFXD 5I0ZA 4Z77A 1ICTA 2AEWA 3D2UB 4XMUA 2VUKA 2OMZB 4JY6B 3QI9A 4PJFE 1KN4L 2WQWA 3HNTL 5DYOB 3RVWC 2HKHH 4HKJB 3IJYA 1CXIA 2RD0A 2LTQB 2JB5L 2X4OB 4XNZB 2L7UA 1H3GA 4XH2B 2PPEA 4Y7MA 3IT8D 3N1MC 4HC1H 4XBMA 2YARA 2EDKA 5K9QI 4QYOA 2AJZA 1KXVC 2ZOOA 3LKSA 3DGDA 1W8EA 4AV4A 5JA8B 1ZTXL 4P06A 1C08B 4IIZA 4ZAKD 2OSLB 3MGTB 3TYGH 3FPXA 3EGSA 1Z2KA 4UTBH 5I1DA 3OXSB 4B3VA 2Q0ZX 2R7EA 5TDNB 1GSKA 2WLLA 4GW5B 1RUKH 4WAFA 2WMPB 4S1SH 4YLCA 3GXNA 1QFWH 3OKKA 4LLYA 2P5WB 3HS0A 4PN6A 4NHCL 5HSFA 2JJVA 4FKHA 1JK8B 5I8EB 1DCLA 3V8OA 3GJFB 2OW7A 4NC2B 2NLJA 1KPVA 3ZQXA 1NC4B 3E6FA 1YMMD 4TRPL 4TVSa 5IGXL 1J5CA 1IIIA 3DOHA 1AE6H 4RAUA 5AVUB 2J5LC 3T3ME 2HMID 2WWKT 4YK4B 3BXNA 3HS8A 4PRIE 4JCLA 1TNMA 1KCWA 2VR3A 1FNEB 4RGND 1CGYA 4DZ8A 5AL8A 3QAZB 4Z7NF 1AS7A 2K45A 4IS6A 4QCIB 5IMKA 4UQ9A 2NY7H 1U58A 3GFUA 4LT7A 4FYRA 4UILL 5TTRA 3VXRA 3EOTL 4PLNC 2OZ4H 1NC2A 4Q0XH 4E9YA 1UB5B 4PJIA 5CEZD 1B88A 4GFXA 4LCWB 2BVEA 2XN2A 4P5TD 3K6IA 3TN0C 5LAPA 2XHNA 1HI6A 2COVD 5FYKH 1MWAB 4O51A 4IU3A 4LCCA 3F12B 1MRCH 4WWKA 5FYLD 3CD4A 3FH5A 2K1MA 4JFFE 5KVEE 2XZZA 4JBSA 4NGHL 4WKZA 4Q97A 2H26B 5BJTA 4GS7C 3CHPA 4K8RH 5BRZA 5JO5A 1BYNA 3S35X 3KBEA 4CUCA 1LNUB 4Y2DB 4NN5C 5K1VA 1BXXA 3S36X 3ZIYA 4XNXL 2GJ6B 2Q8AH 1A6ZA 4ONOA 3O0LA 4M56A 4BDVB 1XTLA 1IUZA 5ECJE 4PVLA 1EJ8A 4YFEA 2B1HH 5AOMA 4WJKB 3QDJA 4RX4A 4HJ0C 4K3JH 4RCAA 2WWKO 3UJIH 1E6OL 5F8QC 4F1ZA 4ZJ9A 3BWAB 4BFIB 1T5WA 1A5FL 4TNWF 1PLCA 2W60A 3CQFA 2ZOLB 5J6GA 3RVVC 1ZTXH 1XR8A 3Q2CA 4QF1B 3HCVA 2VO5A 1PF3A 3K71A 4GO6B 3FHQA 3MRMB 4HC1L 4DGWC 2AKRB 1R4XA 4XN5A 1U2CA 1WT5A 3CBJB 5F96L 1OAKL 4H1LH 3IU4L 3ZKND 4EI0A 3S35H 2BMKA 4BRJA 1RH8A 2CM6A 2FLMA 4GNKB 4OUUA 5KYUA 1KIQB 3QJHA 2NUPA 2AV7B 3CLFH 4HBQA 1DQVA 4U1NB 3ARZA 3ULVL 4E9XA 4Z7VB 2N59A 1U8LB 3GQFA 5TH2A 2XA8L 4N68A 1PG7W 1HIML 4BQCA 1H3PH 4ZQTA 4XB7A 4M7ZC 5A6IA 1CICD 2FBRA 3RJQB 5C0FB 5GGSY 2G5RA 1PLBA 3EHBB 12E8H 1E6JL 1UJ3C 4J12A 1J8SA 4XAKE 3QXVA 3QZWA 4S1RH 1WC7A 5EZOH 1MRFL 3CZFA 4JO1H 2G75A 4N4YB 2B39A 2IFFL 4HCRH 1QX1A 2AEIT 1SMOA 4UQ2B 2VKWA 1AE6L 1VFBA 4RGNE 1U3HA 2R1YA 3RILA 4E36A 5GS0D 3WUWA 1SXZA 1ZHNB 3KL5A 5EWIL 1A7QH 4NZRH 2ZUTA 4NQVB 2AJXH 4TNFA 5TK2A 2YXWA 5D2NB 1S78C 5D55A 4E41E 1QLEH 3F83A 1UZGA 3MPCA 3V6OA 5SWSA 3ZL2A 3FO2B 3VB9A 1IFRA 2Y5TA 2TSBA 4GLRH 4JHZA 4LSUH 2Z7WA 5F1NA 3UJTL 4F58L 4EQ3A 1T5XB 4ETQA 4Y5YB 1QG3A 1BP3B 1AXSA 4FHJA 3BX7C 5KUKA 1KGCD 2JJWA 2BPBA 1RPUA 1TVHA 2HVJB 4XBPB 3ZKQD 1DBJL 4JKLA 4Z3JA 2R4SH 1XGYL 1FLRH 4NCDA 4DETA 1TU2A 1K8IA 2ZF8A 3L54A 4JMNA 4L9LB 5DURB 2R0LH 1T6WA 2I5YH 1A9BA 2GPZA 4AMXA 1QBAA 1T1WA 1S9XB 4N2IA 3D87B 1IZKA 3RZWA 4A2DA 3PREA 2JELH 5AOIA 5FO7A 2RFXA 1OM3H 3WGVB 3RDJA 2KDGA 4CMMA 2NYYC 3IRCA 3EFOA 4AYMC 2J8UB 4H8UA 3BSZA 4M62H 1GTNA 4WDIA 4GINA 3D0LB 3MJ8B 2ERJB 4AZ8B 4P4KC 2E5EA 4H0IA 2K7PA 3GGWB 3FK3A 3SDCC 3GMOA 1PJ9A 1XGPB 3JV5A 1TDQA 3Q6GL 2R8SL 4UB0L 3U36B 3R06B 5DK2A 2VMEA 4XHJD 4BGLA 2M1KA 1X6NA 2E9GA 3DI3B 1R3LB 3U46A 2EKSB 5KG9B 4QO1A 2R27A 5AW6B 2FO8A 1PEWA 1WRFA 1XBDA 2CUIA 3DUUA 3WIAA 3GMLB 2XJKA 3AG1B 2FEEL 4DP2X 2JIXB 3NJVA 1MIML 2QZ5A 4UYPA 5IFHL 3X2QB 1ECYA 3FB8A 1F1DA 3HNSL 1E9PB 1EVTC 4ODXB 3C2AL 4P2QA 4G70B 2WAHA 1QEXA 2SEBB 2ICEB 4PV9B 1OOAA 4IMKA 2AJUL 2G60L 3SDDA 5C9JA 1E5CA 5I1EL 4KJQD 5HHOA 3NSJA 1TKWB 5J13B 1R34A 3MLUL 2ZCLL 3N41B 5L88H 2ED8A 1FFNA 3PXHA 1EA9C 2C1OA 4ZOBA 5K59F 2DLTA 4GW1A 3PDGA 1MHHB 4KDWA 1GGCL 4ZUUB 5L8JB 1FIEA 5CBAA 1CLYH 2DYPB 3MDJA 3O45B 1U8QA 2YAHA 4OFPA 4FAAB 5ABDE 1IE4A 3BN9C 3HC0B 4XPHH 4BEIA 5I0WA 4E9VA 1Y07A 4M43H 2BW5A 3HB3D 4LVNB 4UCFA 1CYWA 1ZT7A 3DETD 4R7XA 1P4IL 5CJ5A 1G5GA 2L7JA 4F15C 1SBBA 1SXSA 3F6JA 1X4XA 4S1QL 4TM9A 5CBEA 4HJEA 3IDYB 1URIA 1I7ZB 3MLWH 4C57C 4N2NA 1KCKA 4MFHA 4MS6A 2E6PA 4AENA 4BQ6A 5I71B 1D5MB 1G1OA 4LFHD 1FVCB 3VD3A 2UX7A 5F70A 4KKBC 3KLHC 2FZ3A 2JKXA 1MZZA 3SCMB 1J9SA 3MV7B 2O6EA 3Q6FB 3STLB 2Q10A 1RHHA 3LN5B 3LN9A 4RFOL 1LEIA 1HXKA 1P9MA 1GC1C 2P24A 5BXFB 4JO5A 3LOWA 1E4WL 3CDGA 4N85A 1Q94A 2MKLC 2BSDA 4R4BB 3KLKA 2ZZUT 3EG9B 4NQXA 4UTAA 2Y6SC 2ZXGA 3H0TA 4WTXA 1ZKAA 4FFWC 4J4PD 4JZJC 1QBBA 5CZRA 1FORL 3OB8A 1QFWI 4PRBA 2BWIA 5FF6A 4ADJA 1MFNA 2DQFB 4IIQB 2ZF9A 3ARBA 4L4VE 3Q5TA 5KBLA 2IMMA 2DKMA 3B9KA 3WHXA 2HJKA 4WSJA 2VMFA 3ZU8A 5EWIH 1XCTB 1K5NB 4XN8A 1HKFA 2BSSA 4N0UB 4OF8A 2FEDD 3KLLA 3TBSA 4GUQA 5ID0B 1IL1B 1OGSA 1WAAE 2F61A 2BSTA 5FIEA 3RHWF 1S5IH 3QIUB 1A3LH 2NZ1A 3BKML 1A6TA 5EU5A 3RTQC 4Z23A 3M46A 4BIKA 1XR9B 2IMNA 2VDMB 3K91A 3PGCB 4OB5H 5FDWA 2WCSA 2ROXA 1NGWA 2NY0D 5D93C 5IW1B 1RURL 4EUPG 5D2LA 2OMWA 3LS4H 3QIBC 3SOBL 1KACB 2OXGB 3I3DA 2A9CA 1NGPL 1H9VA 2LHAA 4HIHB 5C0IA 4OQ1A 1DBJH 1H8OA 4Y4HA 1A1OA 2WC7A 4O02L 5MEND 3KJ6L 3AQDA 5CZVL 1WCBB 1OM3L 4LIQL 2DH2A 4DHLA 5KOMC 1MAJA 3F58H 4NQCD 3KPMB 4U3HA 1LE9B 1EAPB 2FH6A 3MUGA 2QR0A 1JTTA 3FCBA 4AE0A 2V8MA 1KFAL 5JZ7C 3CVHB 1CD0A 1KJMA 4Z7WF 1ZA3B 5C6TH 3R7RA 4E68A 1SJXA 4G8IA 1JZDC 3KPTA 3H4FA 3HBGA 4ZUSB 3AT9A 3WO3B 4DKEL 5HDLA 3N6YA 2ZKXA 3DV4A 3JV4A 4JDEA 2CDGA 2WKOF 3EJYC 1TCMA 2Y0SA 4IU2B 4MAYC 2WCPA 3LKRA 3O8XB 3BWUF 4D0DB 4Z7NE 4RFNB 3EO1B 2E74C 2FEDC 1MXDA 2XXCB 3BPOC 3RIAK 2YOAA 4W81A 1MY5A 4TUJB 3RJDA 3KL0A 5LQBL 1F3JB 3EOBA 4P3DA 2VERN 2HG0A 5HHNB 2KZKA 4RWYL 4K5MA 2EZ0C 5E1IA 3OVUB 3MRPA 2VQ1A 3FTYA 4HX1A 2HJLB 4FDWA 1IO4C 3V5KA 1T03H 4LLDA 4EIZC 2H2PD 3IF1A 2YRLA 4PY7B 1HOCB 2C1PA 1KLGA 5ANMA 2NY6C 2FH8A 1RI8A 3CN2A 3VMOA 1G4MA 4Y4FB 3IDNB 4YIQB 4G8GD 4LLMA 2JKIS 3GI8H 2EDXA 2KZBA 4LLAA 2DS4A 4X6DA 4YGAB 3VSVA 3ZBMA 1D6EA 3RWDA 3L7EA 2EIBA 1I7TA 2A9NH 1GW0A 1N18A 4O2FB 2E75C 3TURA 4J8RA 1G9MC 1TJIL 2XT1B 2Z35B 2BP3A 3DHJA 4EZLA 1HJCA 5L2KB 1IAII 2AEQH 4U3SA 3L5WA 4TL5A 1TQWA 3CFCH 2QQQA 1U8CB 1X44A 3AQYA 4MNGE 2YMXH 3MREA 3UTZA 1GSMA 4BRVA 1XSIA 2YPKB 2OXHA 3OG4B 2DQMA 3D5OF 4PS8A 3FT0A 3VGBA 3GM0A 3VDAA 3BIKB 4HALA 3ULUE 4HHAA 3MBEA 4GAJL 3ZVVA 3LKNA 5FGCB 3FYEB 1DDHA 1NANH 1VESA 5EU6E 3W0WA 3KNBA 3KS0J 1LL1A 2CKBB 1X4ZA 4HJTA 2FGZA 3BMWA 4PJEF 5CUSL 4QHNA 5ERWA 2W0LA 5T5FH 1DVFA 5JMRA 4BWWA 4L1DA 1KWKA 5EUOB 3F7VB 1ZHBB 3DXAA 3LNGA 3HNVH 3PJNA 4LVOC 4N2FA 2NOYA 2AS5M 5G4NA 3Q2WA 2E27L 3GHEL 2ZWLT 4FG0A 1U8JA 4PHZA 1MQ8A 1H5BA 3II2A 1U8OA 5T3ZE 5DLMH 4PJXF 5LAXB 5DRZA 3EYOA 4I2XA 3RX8A 2QQKH 3LIZA 3TBVA 3NBNA 4KKLD 4AYBA 5A3ID 3D3VE 3X1NA 4M61B 4DGVH 3IKCB 4DEPC 1AS6A 1VCAA 2DBJA 4A04A 1OAYL 3KGUA 4L4VB 1I1AC 4LEOB 5F7DA 2V7HA 3DUHA 2QVKA 5A6MA 4TUKH 5I1JH 4MSWB 5DHYA 3WXWL 1ZLSL 5EO0A 1B4RA 3RWEB 1DQMH 1P2CB 3DDFA 2X40A 3SYOA 1UXWA 5LLIC 3APMA 2JWYA 2UY7A 3S8GB 4EBQH 4IRSD 3RIAF 3DV6A 3T71A 3CLWA 2F74A 4KJPC 2X1QA 3T3MF 4RWYH 2ZUWA 1P4BH 1JF1A 1FC1A 3OKEA 1O9WA 3D48R 2E7CA 2BHYA 4NP9A 4HP5A 1S7SB 3V5HA 3RWGA 2BO0A 5BRPA 3GMPB 4X9HA 5CD3A 2V2XA 4OD1L 3AAZB 3ARRA 2BRRL 1TNNA 3PIQA 4HAKA 1OLLA 3CG8A 5F7WC 5KS9E 1PY9A 3ZR6A 4BH8A 2WNWA 5I6XB 4U1KB 4URTB 4JR9L 5DJ8A 1V55B 4ABWA 1JG9A 3JV0A 3DKHA 5KSAD 4YQXL 3B2UD 3G04A 3KD4A 3QEQE 4PPTA 2FSDA 3ULSB 2D31A 2MCPL 2F68X 5E1HB 3O11B 5EA0H 1T20A 3B8YA 3CFCL 3ALWA 3OM3B 4I0CC 2XN1A 4IIQC 4X7TB 4ICWA 5I1HL 3T0EE 1HK6A 3NA9L 1ID2A 4PJBF 4RRPA 4EKXA 1SY6L 3AREC 3DRTA 2LR4A 5AAWC 3MV8D 2UZIL 3VFUB 5EZPA 1QTSA 3S4SA 1S7TB 3WMSA 3M8OH 5LN8A 1A14H 3PQYD 3KLSA 4Z95H 3JUZA 2ICWB 9CGTA 7FABH 4NWUH 4ZDHA 3U1SH 3PGDB 4EKJA 4XMTA 5CIPB 1YZZA 1D5ZA 1UM4H 2AJ3A 2DM4A 3HNVL 1IFHL 3AS2A 5ESVB 5C8JB 1A7NL 2VLLA 2Z0UA 3QWNA 1NFKA 3ME0B 2V9RA 5B3SB 2UZPA 1FJ1A 5CINL 2XQYG 2PYED 4AYFA 2BSEA 3GSUA 1Q0EA 2NDGA 4HGMA 4L29A 4ODVL 4PJAA 2Z8SA 3QDGE 3B34A 1UCBH 1N3NA 1F18A 2YRBA 4ZNCD 1U93A 2WXPA 4HPOL 1W15A 3DOIA 2UYLA 1FLTX 2GBVA 3UDWA 3DGCR 1Z6JT 4XPAL 2C8NA 6PCYA 5I6KA 4JRXE 4Z3EA 5TF1H 3RBSA 4AT6B 5D7JA 2W88A 3QO0A 3QDHA 3RGBA 4NP4H 4WUUD 1OGPA 3NMEA 3QRGL 2XG4A 3G6JB 1E40A 4P5MA 5GGTH 1NH6A 4Y2OA 4G9FB 5EN2A 4I5BA 3QUMH 2QVFB 1HSBB 2EYTB 3IU3A 4Q7DA 3FT3A 4LLWA 1NBYA 1DZ0A 3QFJD 4Y9FA 4PP2A 4YDLC 3U0TB 2BIHA 2BS71 1PL3A 2WYZA 4OD1H 4R5XA 3OKOA 5D7SL 5HHOE 3FC8A 2XN0A 3MGAA 5JHDD 2CGYA 4RISH 3AT8A 4Z5RA 1M1XB 3FUHA 2QL1A 2W9DH 3GRWH 4KI1A 4L4TD 4R97B 2CR6A 1KJ3L 1CURA 1QHQA 1N6QH 2AXWA