4UF7C

Ghanaian henipavirus (gh-m74a) attachment glycoprotein in complex with human ephrinb2
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
142
structure length
138
Chain Sequence
SIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDGQYEYYKVYMVDKDQADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords GLYCOPROTEIN
publication title Molecular Recognition of Human Ephrinb2 Cell Surface Receptor by an Emergent African Henipavirus.
pubmed doi rcsb
source organism Bat paramyxovirus eid_hel/gh-m74a/gha/2009
total genus 30
structure length 138
sequence length 142
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00812 Ephrin Ephrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4uf7C00
1ZPUA 1BAWA 3NSYA 4HHGA 2FNWA 1AZRA 1NTDA 1FA4A 1SDDA 3T6XA 3KW8A 4PAZA 4ZK8A 1TEGA 3QJTB 3V9CA 1WS8A 1OCRB 2FJSA 1B3IA 4G70B 2XU9A 2YQBA 1BXUA 1NZRA 5E9NA 1JXDA 5F7AA 2VW6A 5I6NA 1A8ZA 1M56B 1ET5A 2YAQA 1AIZA 3ERXA 7PAZA 2PPCA 2TSBA 1IC0A 3WI9A 1CC3A 5FC9A 2YAEA 1N70A 2YAHA 2VMJA 4W9ZA 2UX6A 3X2QB 2AZUA 1SF3A 5B3SB 3CDZB 1MZYA 2EILB 1GY1A 3AZUA 3ZIYA 1KBVA 1NPJA 3PAUA 1MZZA 4DP4X 1E5YA 1PF3A 4KO7A 2IH8A 3NT0A 1NIEA 5ANHA 4CSZA 5B7MA 4GXFA 2NRDA 4QKTA 4G71B 4Q8BA 4HCFA 5F7BA 2CCWA 1A65A 3FSWA 1OE3A 3TU6A 3NYKA 1DZ0A 1HAUA 3IN2A 2OCCB 3QJUB 3S3BB 4A2HA 5I28A 3CVCA 5I6KA 1M57B 3UGEA 3AW5A 2FWLB 2H3XC 3X1GA 2BW5A 2UXGA 4E9WA 3X1NA 1V55B 3OQRA 3IN0A 5AKRA 2QPEB 4E9TA 3QJQB 3S8GB 1NICA 1AZCA 3FQ1A 4A2GA 4A2EA 2VW7A 3X1BA 1PZBA 1BYOA 2Y69B 4NERA 4KNSA 1RZQA 1WS7A 8PAZA 3SBPA 4RH4A 3UADA 3PXLA 1NIAA 5B1JA 1EHKB 4PCYA 3ABGA 2IDTA 1L9TA 2BZ7A 1BYPA 3N2JA 4G7SB 3CG8A 1L9OA 1WAEA 3FQ2A 4JKNA 1TKWA 1SJMA 1ID2A 3FU9A 1OE2A 4DP5X 2PCFA 1AQ8A 2IDFA 2Y1AA 2QPDB 2QT6A 2CBPA 4BWUA 2X88A 2IDQA 2AVFA 3NJMA 2RACA 3D12B 2LLNA 2JXMA 1SHWA 1E30A 3NJJA 7PCYA 4EF3A 1PLAA 4HALA 1JXFA 1M9WA 1CUOA 4NB7A 1AG0A 1NPNA 2W88A 3UAAA 4QLWA 4GP5B 1MG3C 1WA0X 3AG2B 1NINA 4YSEA 3NJFA 2I7OA 5A7EA 4G7RB 2I85A 2BWIA 1PAZA 2CAKA 2P80D 3ABMB 4N8UA 4X4KA 1HFUA 2FT6A 1A4AA 5B7FA 1A4CA 2XXFA 3CZUB 3OM3B 2DV6A 2VM4A 1AG6A 3TA4D 1XB8A 3CDZA 4HIPA 1TEFA 2PP7A 1YLBB 2BP0B 4DPCX 3IEAA 2XX0A 4GP4B 3NJKA 3MBWB 2J5WA 3HB3B 1JVLA 1GSKA 1V54B 3FT0A 2IH9A 2W8CA 2FQDA 3S3DB 3TBBA 3WIAA 3X1FA 1SFHA 1TU2A 1OCCB 2JKWA 3FYIB 1OV8A 2GIMA 2QDVA 5PCYA 1UATA 4JHVA 5I6LA 2X87A 2YXWA 3FSZA 4E9YA 2EIMB 4DP6X 1F56A 2PPAA 2PPDA 3WKQA 1IBYA 1ILUA 2PPFA 2FTAA 1XB3A 4KO5A 3CVBA 1QNIA 1RKRA 2HRGA 3T6ZA 4YVNA 1CYWA 3T6WA 5I6PA 3IE9A 2GC4C 1VLXA 3L45A 2UXVA 4W1TA 1BXVA 3AG1B 5B7EA 3EH4B 4L0PB 3OMNB 4FAAB 1PZAA 3DTUB 3BVDB 1ASQA 4E9XA 1L9RA 4KOBA 2ZOOA 4MFHA 1ET7A 1OE1A 1JZFA 4KNTA 4TXVB 5TK4A 3RYMA 3GYRA 2GI0A 4DPBX 1NIDA 1SHXA 2J55A 1WA2X 4GY4A 3G5WA 4HAKA 2I7SA 1IBZA 2GBAA 2VN3A 4YSPA 1BEXA 3FSVA 4BXSV 2A3TA 2HLEB 1E67A 1JZJA 2IDUA 1PMYA 4WTQA 1BQ5A 1AAJA 5I5JA 2HRHA 3HEIB 3SBQA 1A4BA 4BWWA 1ETJA 5B1AB 2ZXWB 2CJ3A 1GR7A 2IDSA 4AKPA 1I53A 3GXUB 2YAMA 5I5MA 2PP8A 4KNUA 1AZUA 1QHQA 4YSCA 4HHWA 1RZPA 1AS7A 4P5RA 4N4YB 3ZBMA 4A68A 4M3HA 3ABLB 3OD3A 1QLEB 1XMEB 5D4HA 5I6MA 2EIJB 1ET8A 4BDVB 4FA7B 2HX7A 1OCZB 5I5IA 1KGYE 1NWOA 5D4IA 3T71A 4A2FA 1IUZA 2MRYA 3FPXA 2OV0A 3H4HA 3TBCA 2B08A 2P80A 4AI7A 3C75A 2BP0A 3UAEA 1GW0A 4K9JA 2DWTA 3NJLA 1CURA 1KV7A 3QJRB 1JZHA 3MX0B 1ZV2A 4DP2X 4UANA 1X9UA 4A67A 3NSDA 2BWDA 2VW4A 4YSQA 4P5SA 1GS7A 1PNCA 1GS6X 2BZCA 2IWFA 3OMIB 4A2DA 1JZEA 3TASA 2VSMB 3H56A 2ZWNA 1W6LA 1EZLA 2UXTA 2BP8B 3S8FB 1L9SA 2XUWA 1L9PA 3FQYA 1GY2A 4WKXA 1MDAA 4KO6A 1J5CA 2ZONA 4E9QA 4YSSA 3ZX1A 4UF7C 1KCBA 3GDCA 1HAWA 4AKQA 1SFDA 3FU7A 1PNDA 1SF5A 1NDTA 2DYRB 3JT2A 2YARA 1J5DA 4A66A 4DP9X 3S3CB 3BQVA 4AKOA 1ZDQA 2XV0A 2BO0A 1L9QA 4YL4A 1BQRA 1AR1B 5PAZA 2H5UA 1PLCA 3JTBA 3QPKA 2HX8A 2FQFA 2Q9OA 2GC7C 5I6OA 1T5KA 2YAPA 3NP3A 4JHUA 2FT8A 1ZIBA 1OF0A 2BHFA 2BW4A 1JOIA 2J56A 3FYEB 3PLYA 3NJHA 4DPAX 1BQKA 1W6WA 5B1JC 5LDUA 2XWZA 1ASOA 1X9RA 5EHFA 5TK2A 4HZ1A 2WSDA 2XLLA 2IWKA 1J9RA 1AS8A 3FU7B 1NWPA 3ABKB 4ENZA 2WO2B 4KO9A 3FSAA 1ILSA 1AOZA 2UX7A 2EINB 2CALA 1JXGA 1FFTB 3FU8A 4BDVA 1KBWA 3V9EA 4YSTA 2QDWA 5AZUA 1AS6A 4BWTA 3QQXA 2IAAC 2R7EB 3DKHA 3T6VA 3NJGA 2MTAA 4NAJA 5B1BB 3PPSA 2PP9A 2YAFA 2E86A 1WA1X 4DP7X 4DP8X 2DY2A 3U25A 3WKPA 2B3IA 3KW7A 2VM3A 2HZHA 2FT7A 1R1CA 2FQEA 1URIA 2AANA 2YXVA 4AZUA 3PCYA 4YSOA 4F2EA 1JVOA 1V10A 4YSDA 1AANA 4YVUA 3PAZA 2OJ1A 2BP8A 3IBOA 1FWXA 1SDDB 3AG3B 3ZDWA 1JZIA 1OCOB 1XB6A 4UAHA 4F7KA 3QJSB 3EH3B 2J57A 4E9VA 2EIKB 1J9QA 2HXAA 3SBRA 3T9WA 1J9TA 2GHZA 4E9SA 2UXFA 1IKOP 3N55A 1PZCA 4YSUA 2XV2A 4DP0X 3QJVB 2JFCA 1SNRA 2IWEA 3OMAB 1ZDSA 1GS8A 3FPYA 3NP4A 3PAVA 1KDIA 2CUAA 3WNJA 2FQGA 2VSKB 2TSAA 2YAOA 4GYBA 4KOCA 1MG2C 1AZNA 1W8EA 4M4RB 4HCIA 2XX1A 4YSAA 1CYXA 1OOWA 4HCGA 2XV3A 4G7QB 3FS9A 3CVDA 2XXGA 3UABA 4BK5C 2PLTA 3SQRA 4E9RA 1E65A 3ASOB 1RCYA 1PY0A 2DYSB 2N0MA 3WG7B 2Q5BA 1AACA 1KYAA 2H47C 3WNIA 5B1KA 3AY2A 4BXVA 4GP8B 2WO3B 4F2FA 3AG4B 5D4JA 2DWSA 2AFNA 1DYZA 1AZBA 3UACA 1KDJA 1NIFA 3EF4A 3DIVA 5AFAA 1BXAA 3NJIA 4AX3A 4CSPA 9PCYA 4DP1X 1JERA 1PLBA 3X1EA 4Q89A 1NIBA 1A3ZA 2R7EA 1ASPA 1J9SA 1JZGA 1ZIAA 3NSCA 3EH5B 3H4FA 2AZAA 2HX9A 1N68A 4G72B 3ASNB 2PCYA 2PPEA 1GYCA 5IY5B 4YSRA 2XVBA 6PCYA 1E5ZA 2XYBA 1PCSA 3NSFA 3EHBB 2GSMB 6PAZA 3NJNA 2GB2A 5I26A 1ADWA 1KCWA
chains in the Genus database with same CATH superfamily
1FL3A 1QWHA 5BJTA 3QIUB 2DWEB 4QF1A 2F53A 3DROA 1MCLA 3FOLB 4R96A 4E5XB 1YECL 1S78D 4X2UA 4AC4A 2YWYA 4XGZA 1LP9F 3IVKA 4NLAA 5FKAA 4L8SA 1Z9NA 1P2CB 5FO7B 3C5XA 3PGDB 1OCWL 1VCBC 4KK8D 1P7QB 3KLSA 4GLRI 1QSEB 5ICUA 4ZUSB 1ET5A 3KPRE 5HYJD 1AIZA 4HG4J 2Y07H 5E23A 3ZE1E 1O75A 2PW1A 5EU4B 5HHXH 5EU6A 2IADB 3FFCB 3LKPB 1FE8L 4FQXD 1H0DB 2GW5A 3FO9A 3X2QB 4OZHA 3GT6A 4AXWA 2F2HA 5CCJA 1UEYA 1Z0MA 5L8KB 2KI6A 4G11A 1JJUA 1QR1B 2YC1A 1V3LA 1QFUH 3IFPA 5BQ7B 4CDGC 2DQGL 4NUGH 1MFDL 2Y2TA 3QNZB 3V6OA 4GXFA 2NRDA 1MF2L 4PIBA 4UB0H 4YDKL 1BAGA 1UGKA 2F5BH 3QNXA 1EFXA 2WPGA 3V4VL 1PD0A 4FG2A 4TSAL 1PKQB 1JWSA 4Z7VA 2NQCA 4RMQA 2X6VA 3K1KC 4KV5F 4OCNC 2BXYA 1CLVA 1DZ0A 4X5WA 1QTPA 3T0XA 5D71H 2NY7H 2BZDA 2R15A 2X7LB 1KY6A 2DJSA 1CMOA 4CGTA 2BMKB 5C7XL 1A7BA 3QQ9C 1DQML 3SCMB 3Q05A 3IN0A 1MCWM 3B9KC 5F72S 4Y5YC 5I82A 4W6WB 5DVLA 4UYPA 4QYOB 1VFMA 5DC9B 3RDTA 4BZ1L 1BMWA 1IGTA 2YD9A 1NBVH 2PTTA 4HZAA 4WGWB 1GW6A 3C08L 3EJTA 2J21A 3K2KA 1Q9KB 1LE5A 3V4VB 2XHNA 3MUUA 2CLZB 2NCMA 4L8DB 3SHSA 2AJZB 5F3BB 4YUEH 4IRSC 3SDCC 1MAKA 5GGRB 4NKOA 2VDQL 4CL7A 2PWHA 5T3ZD 1QI4A 3OKEB 4NPYB 5BRZA 1UHVA 3UBXB 1I4FA 4FNRA 3ULUE 5DQDH 3W1ZA 2ATAA 5ID0A 5I1KH 4JPQA 1R3KB 4M56A 1NEZG 4APQC 1ADQL 1WLHA 1BWWA 4IU2B 5D2LE 1FFPB 1EXUA 4P2QA 2VJ8A 4L4TD 5HHOD 2BVPB 2PCFA 3L9RA 3UYRL 3ZL4H 3O4OC 3TF4A 4N9GA 2HVBA 1WFTA 2IDQA 3IPEA 5DO2C 3H9SD 4L5FL 5HHNB 1M2VA 1CGVA 2RALA 1F3JB 3K8MA 2YUZA 4UYQA 3TA3C 4OQTH 2HT4D 3PUCA 3WFDL 1TTBA 4HK3J 2VDQB 3QAQA 2ZD0A 3JVFC 4NB7A 2FO1A 3DLQR 1NCWL 3CFUA 3TBYA 5J6GB 4XCFL 2AJSL 4JG5A 1GRWA 4LCWE 3V4PL 1FSKC 5CR1A 3EZJB 4MQXD 5IW1B 5ESVA 3NGBC 4KZDH 3ARWA 4NUMA 3PQYE 4GXUN 1A4CA 2XXFA 3O4LA 2YGVA 3OM3B 4HXAH 4F8OA 4F7EB 1FORH 2OL3H 5KUMA 3V8CA 5KVDE 1JYWA 3M1OA 3ESPA 5EC2B 1TEFA 5J4MA 1CDYA 4JY4B 2W0FA 4W93A 5KN5A 1JVLA 1I8LA 2HFFB 4Z18A 1P5UA 2WN2A 4QRRB 1ODUA 1H8OA 2VSCA 1J0IA 5DEGA 4XI5C 5DHMC 3CZGA 4WCYL 4CVWA 4MNHB 1PGRB 1MCHA 5DJDA 2V5MA 1MELA 4ACPA 3V4PB 1OV8A 1TZAA 2Y07L 4CUCA 3PHSA 3FH8A 1DQQB 5HHXL 1CFSB 2A2QT 2FGZA 3GSUB 3QK0A 2AEQH 1HCFX 5JHBA 2V33A 3QEQE 1IBYA 2DPKA 3ZK0A 2EEBA 4LIQE 2HRGA 3FCTA 3QIBD 1QFUL 4XNBA 4NHUB 1AIFB 3DURB 2IH3B 2GJZB 1CF1A 2YA1A 5IQNA 4NUGL 1V8HA 2R2EB 5E99H 5BUPA 2C8NA 3REVA 5H4ZA 4UB0L 3MV9D 4X9YA 4PS8A 3B5GA 2F5BL 3OTTA 4MFHA 4KNTA 2CSPA 1RJYA 5ANMB 5FOBA 4X0KA 3ROOA 2ZUUA 3GYRA 3G6DH 4N2BA 1DFBH 4HAKA 2OQJA 4JEGB 5TGBA 2DQEL 2GYSA 5D71L 4UM9B 2AF2A 2NY7L 4D3CH 5LAXB 2YGQA 5HSFA 4C4KT 2OI9C 4MASA 2EE2A 4ODTH 1J8KA 2QGCA 2MNJB 5INCA 1FV1B 4LNRB 4QRSA 4X8JB 2QFRA 1AMXA 4H0HB 2BNRD 4IHOB 3HMXH 3HEIB 1A4BA 2YRZA 5SV4A 2ZSWA 3HZMB 5B8CA 1HZHL 2IMNA 5MEND 1VSCA 5DURD 2IANE 4M48H 3UL4A 4NHCL 4HLZH 3RJOA 3RWHA 4A7UA 4AVHA 1BZOA 4IRSD 2XPYA 1MUJB 3SDCD 1LXMA 2Q76B 2AJUH 2Y7NA 3IWUA 3GRWA 5DQDL 2EEXA 2J8UA 5D2LA 3TEXA 5CZXC 4L8SC 3F65A 4R7LA 1AP2B 4G5ZH 3UXFA 3V8OA 5I1KL 1OPOA 5I0XA 4JY6B 4N8VG 5JXEA 1AD9A 3T0WA 2MRYA 3L5XH 4WEEA 3C5JB 5AUMB 2VL4A 3ZL4L 4F3FA 5A6MA 3BFQG 1NGZB 1S5HB 1UXWB 1XF5A 3U36A 4W9LC 3QDMB 4JGUA 2BCKA 3RWJA 4B96A 4OQTL 3B2XA 1FIEA 2BWDA 1PNCA 3HZYB 1FO0H 4QYAA 2LHAA 3IGAB 2AXFA 1T22B 4ZW6A 1GGBL 4A2DA 5J89A 1MW3A 2B4CL 2OXGA 3H56A 4TNGA 1BFVH 2UZYB 3O9WD 3MYZA 3V6OC 3DX1A 1IQDB 3RB7A 3FQYA 4JREC 4JRXB 4J3TA 4PTTB 4HGMA 1NJ9A 4KZDL 3VCLA 4AVIA 2ENJA 4RGOL 1P53A 4HXAL 3ZN6A 1FORL 2OL3L 2Z8WC 2WUCH 5DJ0A 3UX9B 5JPNA 3CSYA 1REIA 2NX5B 2AXHA 1U3ZA 4UNVA 1B6UA 5T3XD 5E2WL 1A1OA 4X7TB 4MJ5B 2RCSH 2DQDH 4CAGA 3ALPA 3GFUA 2KERA 1LEKA 3GXIA 1BQRA 4YL4A 3RDTC 4XI5D 1AGEA 1NGWA 4G8FA 1E3FA 3HG5A 4LHUG 4PP2A 5MEOA 1MJUH 5E4EC 3W38A 3ARPA 2AEQL 3T65B 2ALWA 1YMHB 2YAPA 3NP3A 2V3DA 2OL3B 3VFPA 1Z5LA 4CMHC 3U79A 3A4FA 5J5EA 4DPAX 2FO4A 3GIVA 3BJ91 5E8NA 3NUKA 4IHBA 4PS7A 1YG9A 2CRIA 4QRTA 1CDIA 2J72A 5E99L 1AXSB 1ZE3H 1H6UA 4U0QB 1RH8A 2X9XA 4YHPA 3D08A 2WWMC 1IM3D 2C9XA 1AGDB 3Q8CA 3CV5A 3ARGA 3MRIB 1XF2A 1ILSA 3C2AH 3G6DL 1TPXB 5DJ6B 4IRJB 2D4FA 3K7UA 1DFBL 4KJYB 3BAIA 1J8RA 1RUQH 2VUYA 4PJEB 2XKNA 1DQIA 1I7UB 2AV7A 1G87A 4FNSA 4I3GA 4NXKA 4ZTEA 3VNYA 3FTZA 5A7BA 3GMPB 4JJHA 4P23B 1JHTA 2IEPA 4ZUWA 5A2BA 4JUSA 3LYRA 3QQXA 5HJBA 5GSVA 3RWFB 2VLRD 1IAOA 4BKSC 1UVQA 1RLWA 1UUSA 3BXNB 3HC0B 1CFQB 2IANA 3HMXL 5CKAA 5IHBA 2K6ZA 2UYLA 4WDIA 5EU5A 2Y23A 1X9LA 4M48L 2EIZA 3BOVA 3T8XB 4LFHD 2YPKA 2YXVA 1J10A 4ZUVB 3ARRA 4BIKA 2PYFB 1I8LC 1E6OH 4K7FA 4PJ9A 2AJUL 1P5UC 4YVUA 1LO5B 1B6DA 3VJ6B 5TQ2L 2PWFA 3IBOA 4NOBA 1PZDA 4G5ZL 1NCHA 4JKLA 3PP4L 1TJHH 3MJ9A 5DUJA 1JHLH 1Q94A 4HPOL 4OD3H 1LD9B 4NZ8A 5C0AE 3B3IA 1S8DB 2C9AA 4L1TA 1MLCA 2YUXA 2JI1A 1WFUA 5FM8A 5FA3B 2B1AH 3GLDA 3S5ZA 2GHZA 5LQBH 1A1NB 3GKWH 1DFXA 4JG9A 3D3VE 1BQLL 2GTZA 5FHBH 2H41A 3BUPA 5B4MC 2ED8A 2ZYSA 4R4BB 2EH7H 5DUMH 5EU6D 2L0DA 2WBWB 3PWVB 4NQCB 4MKMA 2JFCA 2E6PA 4UQIM 4OZFG 3SE9H 4IBYA 1A7OH 4OGXH 5HYSG 1FO0L 2NY3B 3EFOA 4OFYD 1T6VN 2TSAA 3AGVA 5DS8A 2OPCA 4KOCA 1BFVL 1MG2C 2FYYB 3ECWA 3MUZ1 3Q7JA 3ET9F 4JZJA 4NQEE 5AKTA 5E1QA 2WZ6A 3BW9B 3VI3B 3TYFB 3S37L 1EK3A 3V10A 3K81A 3MGOB 4JCWA 5GRZA 4GW5B 2QADB 2XV3A 4Z7NE 4WI0B 3GS4A 4AQ8A 2Y0SA 3IJEB 3KPNB 3Q2NA 4NO3A 1K3ZA 1FC1A 2WUCL 1CICB 2XTSA 3LRGA 1ID5I 2I5YH 4NBXB 5J7CC 4UT6A 1M42A 2Z31A 3GK8H 3F7VB 1D5MB 1KPRA 3RI5K 1U8IA 2RCSL 1FO0B 2DQDL 2WO3B 3FF8A 5D4JA 4LSQL 4YDNA 1PZ2A 1A64A 3H42L 3RDTD 4GJTB 3NPSC 3RIAK 5B8CC 1MJUL 3OKMB 4F2ME 2X4PB 5I8EB 3QP3A 1EBAA 5EIIG 3RQ3A 4A6YL 3OJMB 3QB7C 1F18A 4OLUH 1FL5A 4QNPF 3ATFA 3AMKA 2A74A 3A4AA 3EJPA 3T0EE 4DO6A 4K5LA 1S2EA 3S5LB 4PV9A 2HSIA 1YPZF 1XD0A 2AXJA 1JZGA 5EA0L 5B22A 4UOW0 3MRCB 3ATDA 3EH5B 4MJIB 1XGTB 3L3DB 2AXGB 5JXEC 4IK7A 1BZ7A 2EIDA 3BQUB 3NBNA 1DEEB 1GYCA 1E5UI 4NKMA 15C8H 4YSRA 4MSWB 2WWMD 6PCYA 3C2AL 4X50A 4QRUB 1IGCL 3O6KH 4A7GF 1RUQL 3LQMA 3PUUA 2ITFA 4TLSA 1AQHA 3TF7C 4J3UA 5E2VH 1VF5C 2EC8A 4XNXH 4DN4H 2V6HA 1R3HB 4XNQA 5CU9A 3JTTB 3FB5A 4W4OA 3QJTB 4YFLI 1IM9D 3FO1B 1RHHB 2X4OB 1KV3A 3WY1A 1OCRB 3GKZA 4AYID 5IOKA 2JXMB 3HZKB 2XU9A 4JM4H 1U58B 4QHMA 2XWRA 1BJMA 3FO0H 1FNAA 3II1A 2V9QA 5DRZB 2VW6A 1ZD6A 5KSVA 4RSVA 4PLKD 1GXEA 4OLYH 2PKDA 1TG8A 2EQDA 5JPNC 2DLFH 1NBQA 4YDLC 2VUKA 3BZ4B 3NCMA 2XPGB 4I9WD 5BVJA 5KYXB 5AW6B 5E1AA 1X4YA 2CHXA 1ZLDA 3ZZLA 1KBPA 2ADJA 4QT5B 2WLLB 1JHLL 1NPJA 4IU3B 1HC1A 4QMEA 5FECA 3KPRD 4NQUA 4KRPB 5EZIH 4EJ1C 32C2B 3HG1B 4GG6E 1TFPA 4NO5B 1GZHA 2G3MA 4RAUA 2L7JA 1JFHA 3QE5A 1J87A 2XZAH 3NACH 5LQBL 3GKWL 2A83B 5FHBL 3EYUL 2OZNA 5I0DA 5DUML 2EH7L 1UH2A 2C9UA 4Z7QF 2BVEA 2CA4A 4PV8A 4P57B 5E6ZA 3A0OA 3SE9L 1WWCA 1WUZA 3VFRB 4NQEA 4OGXL 3CZSA 4NENA 3TH3T 2GKIA 1RI8A 4CVZA 4J8QA 3D4ZA 3L1EA 2YGOA 3DMMB 4UQ2B 4L8CA 3QJXA 2YFOA 3X1NA 1V55B 3QUZA 1WAAE 1UM5L 3B1UA 3WFEH 4NEHB 4XN7A 2YSSB 2OYKA 4LPCA 4ZFZB 3ARGC 2YEQA 1AGBB 4UNUA 4KVCH 3PE9A 3ROLA 3FQ1A 4M7LH 5K33A 1OAJA 3BGAA 3KPSA 4P4KB 2ROXA 4R2GB 3SQOH 5A6IA 1D5RA 3GC3A 3DJZA 4PRAA 8PAZA 2A6JA 2HH0H 3V0IA 1QI3A 4W68A 3T2OA 4R8WH 4DPRA 5KS9E 5I2IB 1V05A 2BNQB 3LDBB 1PZ3A 4PCYA 1TT6A 3REWA 2RJMA 1SXNA 1UKTA 4HHAB 3CG8A 3UTZA 5C0IA 2G0KA 3KR3L 5FWRA 2VDNH 1DSYA 1WAEA 1YY8B 3BH9A 4XZ4A 3QUKB 1KIQB 4IRZA 4AVJA 1GYWA 5F7DB 3AREB 3F2LA 5HI3D 4ADGA 4OLUL 3T0EA 4PJDE 2A6IB 1Z9SB 3MV11 4KY1L 3DHJA 1MHCA 3D06A 3MNWA 2PCXA 4PJ9C 3GPEA 4Q74A 3ULUD 1BSIA 1BD2E 1TQTA 2NYYC 1WFOA 3TBSA 4OTXH 4EF3A 1HOEA 2AI0H 4JFFE 3FULA 2XVKA 3PDGA 1IKFL 4ODBD 5C07A 3L6FA 3AG2B 4HT1L 3WIHH 1UXSB 5JXED 15C8L 3RNKA 1MJ7H 4UM8B 2LVCA 3NJFA 5CP7A 5CSGA 4PTUB 3UC2A 1HFUA 4FQHB 1CQYA 1H3WM 5E2VL 5ELIA 2XG4A 4G43B 3WNKA 2EE6A 3NFNA 4PPTA 3NIDB 1ZLVK 3IS0X 3ME0A 3GLZA 2AQTA 4DPCX 3NJKA 2ITCA 2O5YH 3SDAB 5SWSE 1U8JB 4LCWD 3LNDA 4JZJC 4LCVA 4RVBA 1QW8A 3MJ7A 4JM4L 1V54B 1UB5A 2XACC 3FRUB 4W9HC 2KT6A 3P3SA 2XQBL 4Z9KB 3UPRA 2W8CA 4R97B 4RDQG 4JFHE 2FQDA 3FO0L 3V52H 3TBBA 3PWPE 5CILH 3ZRCC 3PQYD 2XYCA 1ZHNB 4AQ8C 3AXHA 1OALA 4Z7UA 1YEGL 3GXMA 4OLYL 4WKZA 2EUWA 2ICWA 5ISZE 4UTAA 1ZK5A 2DLFL 5PCYA 1Q9OA 2ARJA 2Q7YA 2P5PA 4ELMA 2Z31C 5HHMB 3CHRA 1MQ8A 2D73A 2AABL 3CVBA 1N5AA 2BDNL 3EGDB 4LLQB 3B7RL 1S7XA 4IS6A 4O2EA 4U0RB 2MOVA 1A7RL 4J6RH 5A2FA 5DMGC 4KROC 4YVNA 4GG6A 5C0FA 4JM0A 5FR3A 4ZFGL 4I2XA 3WXWH 3L45A 4W1TA 1BXVA 5EZIL 3MRLB 4TTGA 3UZVA 1HDMA 3SKJL 5FEBA 3MMEB 1TTRA 3I9AA 1M53A 2XZAL 3NACL 3SB3A 3JV4B 4E9XA 3QEQD 2X70B 4J3SA 2WNGA 3ES6B 3GB7B 5IKCB 2A74C 2EUVA 3DO4A 2UZPA 4GY4A 1T21B 3L81A 1ZLUH 1WAAA 1DQTA 4KH2A 1IVLA 4ORGA 4KTEH 4WWPA 1E43A 1KNOA 1YN7A 1E2WA 1QABA 1BREA 2BSTB 4FERA 5GGQL 3WFEL 3VD2A 3QAZB 3IDUA 4IBZA 4WTQA 2I25N 2F7QA 2DKSA 4DF9A 5CBAA 1MH5A 4KVCL 4EPSA 4OAWB 4M7LL 1CD1A 1I3RB 3ARGD 3MRQA 3NA9L 1S7SB 2FE0A 2P8PA 3RGVA 5KS9A 1MEXH 2D7TH 5AKVA 3T0VA 2YAMA 3HE7D 5BOJA 5IIEA 2PP8A 8FABB 2WVSA 3O8XB 4W4OC 5BS0A 2HH0L 3BAEH 2ICES 2P5WB 5C3IA 3GSXA 3P4NB 4N4YB 4Y16B 3OD3A 2OXHB 4JRLA 3ZHNA 4MAYD 1CD0A 2ICWI 4ZG1A 2VXQH 4TS6A 4WO4A 3MBXH 4PN6A 5FB8A 4AG4L 1MFBH 2BOCB 2IAND 4AYFB 2G60H 1WZMA 3FPXA 3MRDB 3ZE1F 3P9LA 1MFVA 3BPCB 4Z7WE 4ELKA 3LN4B 4E42B 1BD2A 4ZO6A 2D3NA 3QWOA 4ZO7A 3RIAF 4JFFA 3FQNB 5D2NB 5T33H 4PJ9D 5GZOA 2JQMA 3U1PA 3RAJH 4LCYB 2NYYD 3P11H 4UTBH 2DWYA 2VJXA 5EF0A 3WIHL 1MJ7L 3GI9H 3OMZA 4PB0L 2BNUA 1GZHC 1JPFA 2VDNB 3L3JA 4H2AA 5HD8C 3NIGF 1A6WH 1YUHA 4P46A 4BFRA 3Q1SH 4KFZC 4OCWH 3ZTNH 1XGQB 3QRFM 3O2WH 3GSNH 2DYPA 4L8BA 1KCBA 3L13A 2R2BA 2QGEA 4MCZA 5DUBA 2NUTB 1FI8C 3FU7A 1WWAX 3M7OA 1AD0A 3HI5L 1D7DA 2VERN 3VXQA 3PWPA 2WLYA 1FN4B 3QUZC 3MC0A 3FT1A 1UZ8A 4EN3B 3FTYA 5ABDE 3V52L 3MRBA 1QTYT 5CILL 4TNFA 2D7MA 1G9NH 3U0PA 1QRNA 2XA3A 4Y5VB 5T5FH 1RZIA 1L3NA 3I9IA 5GGUB 1USZA 1S9XB 4PW4A 5JYLA 3I50H 3RKPA 2VDPH 1VKXA 2X9WA 2DQUL 3L8QA 3BVTA 1U93A 2Q9OA 3DBXA 4E0RA 5K39A 1K5WA 1GZQB 2Q20A 2C26A 3QZWG 1NUGA 1NKGA 2GIYA 3RWIB 1KJ2A 3VAEA 1KYDA 3OX8A 3HG3A 4TTDD 4M1GH 2Z31D 2DMGA 3LS5H 5ESAB 3RTQA 4OZGB 4PJBB 2NY6C 3ULUF 3NJHA 2KZKA 3SJVE 1CDBA 4PGBA 2AQ2A 3WXWL 2Y1ZA 1JZDC 1N19A 4X6FA 4ZQKA 4C4BA 5FGCE 5IREA 5TH2B 4DKAA 3L7FA 5AYUH 2XLLA 3ZR6A 5DVMA 5IQ9A 3SKOB 2DB8A 4LPVA 3T0EC 1G1YA 2EACA 5FKPB 3N1FC 4XB7A 5DS1A 4O00A 5JORB 4KO9A 3KXFB 1R24A 1I3UA 5HHPB 4G6MH 3PL6A 3CLEH 4X4YB 5K9QI 5KTEH 3IDJB 5F89B 1QSFA 4JFDB 4XP5H 3GMQB 4J4PD 2CO1A 4NO0A 4AQOA 1PS3A 2EKSA 3BIAX 1FH2A 1XF3A 1WFJA 5AKSA 2BY3A 1A4KB 3FNKA 3VFTB 1URLA 2WXNA 1BQHA 4HDIA 5JHLL 3BVNB 4GQ9H 1FFNA 1FNSH 2IGFL 4OCMC 3ZPDA 5CM1A 3I6GB 4DEPB 3CC5A 2D7TL 3INUH 1EEUA 3ZUNC 1G1OA 3BAEL 4WV1A 1MCNA 1GIGH 4JRYE 3ILPA 4JFEE 1MJJB 1JVOA 3DYOA 2VQTA 2Z92B 1AANA 1OF2A 4LP5A 4JN1H 5SWZB 3IPBA 2Z8VC 3AG3B 2Q2EB 3MBXL 1FF5A 1OGTA 3IT8D 2G60L 2K7QA 4JR9H 4IIQB 4UAHA 2A9DA 2XN9A 1DANU 3CFKB 3QNFA 3I9GH 5F0PB 1SXCA 4QTHB 1DVFA 2ESVB 1Q72H 2HUHA 4BA0A 5JTWA 3PJSA 5DHYB 1ZT7A 2JVUA 4TQIA 2I9LB 3VO0A 5BUGA 1FFRA 4Y4FB 3FB6B 5ICZA 5FW7A 2N7BA 1F3DJ 3MROA 4UI2A 2NYKA 3RAJL 2YMXH 1R47A 2CUAA 5C0AD 3V4UH 1BPVA 3P11L 3DECA 4UTBL 4X42A 1W8EA 3GI9L 5KAQG 2IIJA 2YKLH 1LO2H 3L3GA 3FRPB 3CQFA 3OHMB 4LCCB 1UJ3A 3D3VD 1NLBH 3BYYA 5IUCA 1HEJC 3ARYA 3HAEH 3Q1SL 2SEBA 4G7QB 4OCWL 3DA0A 5HD8D 1WISA 3N42F 4QHNA 3FUEA 4ODWB 3O2WL 3PDOB 3QCUH 5I76B 4EE2A 1EV2E 1KMGA 5CEYA 4L3EE 4KI1A 4CKVX 4NQED 4NQQA 4NNYA 4MQ7B 3MRNB 3AY4A 1QZ1A 2O6CA 4X6CB 5DFWH 2KLRA 4L4VE 3GJFK 3QUZD 1QRKA 5ADOH 3ECUA 1SYSA 2H0PA 3U0TB 5C9JB 1D5BA 3KLLA 3CUPA 1I1AD 2DWEA 2WLHA 3I50L 4B6ZA 2VDPL 2ZQKA 4XRCB 4MVBC 1QACA 1BHGA 2CR3A 4N90E 4WW1A 3NZHL 3C60B 3N1PC 5AVWB 3RGVC 1MCOH 4M8QA 3SKMA 1J8HE 1KPUA 2HT3C 3ARSA 3GSNB 3KJ6H 3AS0A 1UCBH 4M1GL 3LS5L 1ZLWK 4X9GA 1T7XA 1PLBA 3RX5A 2WC7A 1NIBA 2V2XA 1A3ZA 2P8LB 3QEGH 2NY6D 2WJ7A 3WLBA 5FK9A 3GJEA 3NSCA 2EC9T 2RR3A 4WO4C 5EO9A 1UCTA 2NY5L 2LVEA 1YEHH 3NDYE 3MUHL 4PREB 1WBXA 4IDJH 2WKOA 1U8NA 5JHDB 3CBKB 1SXBA 3RHWK 3RWCB 1G1KA 2WINA 2VDPB 3DETC 2EZ0C 2XYBA 1PCSA 3SDYH 5BQ7A 4OCLC 3DXAE 1KLUB 4FQPA 3MYJA 3KCWA 4G6ML 4RESB 4U2YA 4XMPH 3CLEL 3DX8A 2F61A 1AKJD 5GZOC 4XP5L 4X9FA 3KW8A 3WFBL 2CHNA 5F9JA 1N8OE 3A21A 3BJLA 2X4TA 4N20A 3II2A 1XCQA 2FECI 2GEEA 1NCIA 5AW9B 3TWYA 1BXUA 4Z0XB 5HI5C 4N86A 4P46C 3EO1B 3K0WA 1FNSL 3B6SB 1JXDA 4P5MA 5C6PB 1INQA 2BMKA 5I6NA 3FT4B 2B77A 4JRYA 3INUL 4JFYA 1FL6A 4G1MA 3VTAA 2X0VA 4L1BA 4GG8A 5D7IB 5DJZA 1N70A 4XN1A 4JVWA 3VRJB 3D18A 4JN1L 2PWGA 4PBWD 3ULSB 4EOWL 4IBLT 4MCYA 3CDZB 4ES8A 4CADA 1S7WB 1C12A 1JGUH 3IMRA 4JQXC 1YNKH 3OL2A 2XTJE 4U1NB 4F24A 4AVKA 1O7DC 4JR9L 3RVXC 1BECA 4AGPA 5BVPL 3I9GL 5ANHA 2EDKA 5B7MA 1IKNA 4PJ8A 3PWLB 4KGLA 3TXAA 3U6RA 4R5XA 1JCKA 3SN6N 4UQEA 4GFTB 4N6RB 3RTQC 3BWSA 2LQRA 2YMXL 1FNFA 4YWGH 3V4UL 3CVCA 3D1MC 3IFNH 1KCKA 1DN0A 2YKLL 1LO2L 3DI2B 2JCCE 4MMYA 5H35B 1NLBL 5AKRA 3KL3A 3WNNA 5GS0L 3P77A 2H0FA 4RETB 1HH9A 3DDGA 5MP6L 2NY4D 2QKSA 2ZUQB 1VFAB 4MD4A 4NQSB 2NSMA 1BJ1J 1IVTA 4QCIB 4AGMA 3PL6C 4JZNB 5JPMA 4NERA 1WZKA 4GINA 5FDYA 3RJQB 2YKKA 4L4VA 1ADQA 1HH6A 4M8UA 4HKZB 3VUAA 3BO8A 3ZHDA 3VDAA 1YC8A 5CJXA 1J1OH 1UFUA 3ZE2F 5ADOL 1IT9L 4WI8A 3LZFH 1P1ZB 1L9TA 1NLDL 3LQZB 5ES4B 2DDQL 1T0MA 1HHGB 1J8HA 3N0AA 1N2RA 2HFFA 3HAEB 1TKWA 1SJMA 1MCOL 4J8RB 4MVBD 2Y2WA 1E2ZA 2FR4B 1LWHA 3KJ6L 3D07A 1UCBL 2RIKA 4WV1C 2DN7A 4UZUA 3TJHC 4M6MH 2P28B 2HT3D 4MB4A 5FCUH 3PG2A 5AWNL 4N3TA 1OM9A 3QEGL 5GGVH 4DCQB 4LSUH 4ZDHB 3ILQC 2ZUVA 1QFWM 1I7RB 2A9NL 1M9WA 4Y9FA 4PJGB 1YEHL 1U92B 4IDJL 4LP4A 3DXAA 1T4KA 2Z7YA 3EFDH 1PZUB 1DVFC 3DVGA 3GZOA 2CAKA 1PAZA 4N8UA 4QD2E 3SDYL 1RIHL 4NHUA 4JO4H 4NBZB 5C08B 1BD2D 1L0XA 1P6FA 3U48A 1NBYA 4Q6KA 2VM4A 2N56A 1SLXA 1U3HD 2V5RA 2FH8A 2X42A 3ZT5A 4JFFD 2YD4A 1NC2A 4GP4B 3N04A 2FUQA 1AGCB 3VGBA 5EFIB 2GVYA 4NWUH 4OV5B 4Z7NF 4QEGA 1UJ3C 2N3JA 3DOHA 4TUOB 2H45A 3D4GA 1IX2A 3IU3B 1XH2A 3BUTA 2WTRA 2YUWA 5HI5D 4P46D 2VITA 1JYXA 5E8EB 2VOTA 3BGFB 1AXIB 2OW7A 3RVVD 4X7EC 1JK9B 2DYPD 5SWSD 1PG7W 1KC5H 4IJ3B 1U8OA 2FTAA 3AY4C 5DZAA 1Z32X 1OOAA 3MFFB 4JFHD 4Z7AA 4YE4H 3F58H 3PWPD 3K2IA 1CU4H 1YNKL 4XCEA 2VIRA 3IE9A 3P4OB 4Z77A 1NEUA 3G6JE 3G5ZB 3WGUB 4A7QA 3D52A 2CO6B 2EXYC 2OZ4H 4KK9D 5JIIA 5ISZD 3RVXD 5DJ2A 3CDCA 3QXAA 4X5RA 3RU8H 1OGAE 4IKKA 1H9DA 1HILB 3LZPA 5IUSA 2OMNA 1MRFH 4WI4A 3RYMA 3W0WA 2H1XA 1SHXA 3W39B 5LXGH 2YEZA 1A9VA 5I9QB 2HJKB 4YWGL 1JVKA 2BC4B 1Y18A 2E46A 2JCCA 4PJAF 5F1KC 1HL9A 4RAHA 4Q2ZB 3RKDD 1UXWA 2R51A 3ECQA 1W0YT 4JFXA 4PY7B 1HIMH 1QBLH 5DD1L 2HJLA 4OZFA 2FIRT 1JTPA 1NBCA 5HYSA 4Z76B 1UEMA 4JHWH 4WGKA 1NBZB 3FZUC 2A99A 4BZYA 4GAJH 2VQUA 5IB2B 2RB8A 4N8CH 5LNDA 4JM2A 4RGNE 1RZPA 2XN0A 3QQ3B 5EC1B 1J1OL 3S97C 4NO0D 3UCRA 1EAJA 4PJXE 2ATKA 4LNVA 4AQEB 4KMQA 2Y2YA 1Z5HA 4L1LA 4NAMA 5JNYB 1P5VB 3L5JA 1FYTE 4LSPH 2AK1H 3DUSB 3GMNB 4L29B 4LU5H 4OQTA 3PV6A 4PRBA 5IVXE 4NRZB 1QPXA 2OX5B 1FBIH 1FZJA 2O6DA 3V0JA 4M6ML 4QHKJ 1JGEA 1SJHB 3NJLA 1ZLVH 5FCUL 1EO5A 4U1GB 1CURA 3DHMA 3MR9A 4NCC2 3B2UD 3F3HA 4LSUL 2E7DA 4FFTA 3G9AB 2QR0A 2UY6A 4XN4A 3AM8A 5EIIA 4R3SB 3ILQD 2CZNA 3WU1A 4J1UB 1K85A 5E9DB 3VVWA 5ABAA 3BUBA 2VSMB 3ORJA 1DSFH 3PRZA 2AQPA 3CDGB 4HGWB 4PJ8C 1GJWA 3KM1A 2EE0A 3NDZE 2DD8H 2FIKA 2EUXA 4KH9A 3SSGA 3ZZQA 2CO2A 3CN0A 1TTAA 4HEME 3JV5A 4NJ9H 4CN1A 3BIKA 5D5MF 4QWWC 4GIOA 1XEUA 3O6FB 1UA6H 4HF5H 3HB3D 4QRAA 5EDSA 1JRHI 1IEBA 3HHRB 1ZDQA 2P48B 1QMUA 3IJHA 5IBUG 5JIPA 2F8VA 3FUMA 4C56E 1LEIA 3ZGIA 3OPZH 4D0CB 3KYOB 1BYNA 5KSBE 3MLZH 1A4JA 2WXQA 3RBSA 5BXFB 1R3JA 5JPMC 3L3IA 5I6OA 1M1XB 1KC5L 2JELL 4YC2C 5EU7E 1OLZA 5I8OH 1T1XA 2VSDA 3G6JA 2FJGB 5CJXC 1BDYA 1I7TA 3F58L 4YE4L 2X4QB 2XVGA 5JXAH 1CU4L 2P5EE 3WY4A 1CR9H 4OFDA 4OZIA 1IL1A 5IWLA 3FAXA 2OZ4L 3FCSB 1B88A 2ADIB 4HFWB 5EHFA 3CZFB 4DKEH 5KSBF 2HAZA 4Z5RB 3VD1A 1RAMA 1NCAH 1MCFA 1QNZH 2A73B 2EXYD 1YY9C 4N68A 3QWNA 4H20H 3IJ7A 2F58H 1JZ8A 5EZOH 2AJYH 5IW6A 4W9CC 1AOZA 4AYBA 5GGRY 5LXGL 3SJVD 4DTGH 3KPQA 1DJWA 2Z8RA 1IQWH 4D7PA 4ABVA 4GQPH 1EO8H 3ZDXB 1E5CA 3MBED 1DQVA 5D7JA 3JV6B 3V5HB 4PJHB 3IKCB 3GHPA 4J3OG 2O26U 1HIML 3UTTA 2DEXX 2DM7A 1SYVA 5ACZA 1DJYA 1L4IA 2B9BA 3LEXA 4PRPE 3GTNA 1R19A 2PP9A 4JHWL 3HNSH 2G5BA 1QYGL 2DY2A 5KVFE 2H8PA 1QFWL 3W5NA 2EH8H 4GAJL 4FNUA 2HZHA 4HUXA 1LYQA 2A9MH 3FZUD 4PJXA 1K4DA 4OY9A 3ZUCA 1WV7T 3PCYA 1MVYA 4YBLC 4M6AA 5ICXB 4U3SA 2WTPA 1QWUA 3CN2A 4PVMA 5I75C 4ONGH 1SDDB 2XV6B 5F9WB 1XDTT 4P5TB 2X0UA 4LSPL 4U1LA 5HJ3A 2YD5A 3L7EB 4LU5L 1YEDA 1PFCA 1TLKA 1MIMH 3H7BB 1J9QA 3W81A 5E4AA 1FBIL 1YQ2A 2WQVA 1HZLA 3M46A 4E9SA 4JFED 4G7YH 1YMME 4OFIA 5EEUA 2BY1A 2XTJC 2XV2A 2Y06L 1U3YA 4RAVA 3QBTB 2EKJA 1PTZA 1XO8A 2AXWA 3OMAB 1R5WB 3HTLX 1NMBH 4HK3N 3UTSB 3VXSE 3IE4A 5DSCB 1CFVH 1DSFL 4FOMA 3WUWB 1AQDA 5GRJH 1M7DA 2VTFA 2MMXA 5F7NC 3WELA 5JIMA 4U6YA 4PJ8D 1Q38A 2DD8L 3K8KA 3O2DH 4HEMA 4R9HA 3FS9A 2YQ3A 3VXNA 1XGTA 3RDJA 2AEOA 1RIVH 3VH8G 5I1LA 3SGJA 5FWQA 4WFFD 2CKBH 5T1LB 1CB4A 2N0MA 4U7MA 3NZ8B 4PUBH 1EZVX 4IBTA 1JV5B 2J71A 4HF5L 4X8XA 1UA6L 4YHOH 2B5IC 4NAQA 4BH8B 2ZUYA 5AYTA 4A6YA 4BSVA 4WY7H 4P4RA 1TQBC 2IV9A 1NOFA 5FOJA 3IGFA 1L0YA 3OPZL 1TNNA 5D1QA 2AFNA 1KB5H 4FLQA 3FO1A 4L3ED 5GISH 3UIZA 3UACA 1CE1L 1K5NB 3MV8E 5FYJU 4KVNL 3LTVA 4FEMA 2W9DH 2WV3A 4P9HH 2G9HA 2AVGA 4E5XG 4N0FA 1QZNA 1HHJA 3FUHA 2P5EA 4JM2C 4NI6A 1IAIM 2CDGA 4D9QE 1AVAA 3M45A 4L4VD 2GUOB 2XQYA 4Z1PA 9PCYA 5JXAL 3EOAA 3QXVA 3X1EA 1YO4A 3O6LH 3FQUA 4GUOA 3LAFA 3C5ZA 4ODSH 5AVSB 3FT9A 1W15A 4DKEL 2E7LA 1SVCP 4N90D 2DQFA 2HX9A 3NCFB 2OULB 1NCAL 4YHIA 1QNZL 3ZMEA 1IARB 3BWAA 4Z7WF 1PLGH 1J8HD 2WVVA 3NRPA 1S7VB 4Q7DA 4H20L 2F58L 2P42B 4ZODA 5IB3A 1G5AA 4RNRA 1OAXH 3FOMB 1PY4A 1YY9D 3PWUA 5EZOL 1E5ZA 2Q8AH 1OB0A 5IK3B 3S4SA 4JPWH 1DP0A 2AP2A 2GB2A 4FNLL 1IQWL 5EBMA 2WXHA 2ZE0A 2D2CC 1EO8L 4BD4A 5DJXB 2P7TB 3DSFH 5CP3A 4LHUD 3AM8C 2B0SL 3J8F7 1ZV5A 4PRPA 3MRMA 4QY8B 4W81A 1WD9A 5G4NA 2KQMA 1D7BA 3KPPA 3RWGB 5D8JH 3BWUC 3VSVA 3OB8A 1E28B 3OGCA 1QBBA 1QA9B 2BXZA 1KXTB 3CE1A 4FTVA 3S9DB 2EH8L 2VISB 3I6KB 2I60H 2YAQA 4QXUH 4PRHB 2VLLB 2A9ML 4P05A 1DBBH 4F8QA 1QQDB 3TNNB 1H3PH 1F8TH 1KUMA 1RERA 2YD7A 4OGZA 3RL1A 4OW6A 1MXDA 4UOJA 4ONGL 4AEFA 3UO8B 3B7SA 3ZIYA 3IDGA 4LVEA 1R0AH 4ZMVA 4AM0B 5H8DA 3GO1H 2E7HA 3IMVA 3LH8A 3PAUA 4UDTB 4XCNA 4XC1H 3VXPB 5L4FA 1YMMA 4I5BA 5E5RB 1EGJH 3VA6A 4PGZA 4ZMPA 2BNQA 3H1ZA 4G7YL 5E7BA 4YEFA 3EO0A 1DHKA 3CXHK 7CGTA 1B4RA 3MRFB 4RIRB 3SYQA 4G8GE 3UBXG 4P07A 3DGDA 3VXSA 3F6JA 1BCIA 2XTJD 4A55A 4F9LA 4PV1C 1JTOA 3UOAB 1NMBL 2CCVA 1OSEA 3GJFH 1CFVL 5IWLC 1E27B 3ARQA 5E5MA 4JDZB 4LEEA 2V9RA 4C54A 4E9WA 3RWEB 4IDLA 4G2AA 3PAYA 4NDMA 4JQIA 4MNQB 4G8AC 4PJ5A 2Q86A 5E4OA 5EOQL 3O2DL 2CE6A 2YBRB 1ZK9A 4IMLB 5J1AB 1AZCA 4HC1L 4PG9B 4EZJA 4ADIA 2W65B 4U6XA 2FEEL 1RIVL 1DBKH 2JB6B 3ULVE 4R7NA 4IGBD 5E03A 1ZLWH 2OMXA 3QORA 1RSFA 1ZJBA 4PUBL 4TM9A 3I74A 4EBQL 5I19H 1U8QB 4HJGA 4DOHB 3QQNA 4GMTH 4KQ3H 5DJAA 5D7JC 5F1OB 5F96H 4WY7L 2BOBB 1KTLA 3ZQWA 1XH3A 4AM0Q 1QEWA 2IDTA 3Q5TA 1BYPA 3MV8A 4HEPG 1KB5L 1CK0H 5LXVA 4OZ4B 1ZCRA 1G7HB 2BIOA 4JJOA 1F6AB 5GISL 1BJ1H 4P9HL 1QFHA 2PO6B 2W9DL 3MRHB 3R06A 4RGNC 3T0BA 1L6ZA 3VFWB 4C83B 3VFUB 4DP5X 4QOKE 3D85A 3WV0A 1KTCA 4Y4HD 4MS8C 3SDXE 1BVKA 1Y6MR 4RZCB 4OI9A 3TPUA 2CKBB 3CFTA 3O6LL 1J86A 2Z7UA 1LO0H 5CN2A 4EDWH 4ODSL 4XCCL 2B2XH 3DOSB 5C9KA 1EZVY 4LSTH 3W9DA 2F0CA 3CBJB 4EUPH 4KDTA 3E6HB 1PLGL 1SQ2N 1OAXL 1KB5B 1YNLH 2QPSA 3LD8C 5F7MC 2Q8AL 3HUJE 1CL7I 4JPWL 3ALWA 3KLAA 2CRZA 3CXHJ 4FDWA 3DYPA 4M5ZL 3ETSA 4C4KO 5CCGE 4B3EA 5L2KD 3DSFL 5HGGS 1E9OB 3AU1B 3MBWB 5JOFB 5D7LE 4OFPA 4KZ0A 5EOCJ 1G1CA 2E9IA 5C0BE 4I85A 2E74C 4N2CA 3JWNH 3U0WH 3K5SA 1LJMA 1OAZH 4PQXA 5DMKA 1UOWA 1NANH 5C0GB 1TFHA 1TVBB 2I60L 2L7EA 4KZCA 1DBBL 1NGYA 3SGJC 1E4KA 1ZWIA 2G5UA 2FX8H 2ICCA 3FSZA 3PP3K 4TN9A 4XBMA 2X28A 4KUZH 1H3PL 3CHOA 3ZTJH 1F8TL 4BCZA 3KMDA 5MHSE 4GW4A 1QNIA 2ADGB 5AAWA 5KANI 5I74B 4GSQA 2WB1A 5IFJA 1AC0A 5CHNB 5CEZH 1R0AL 3A6CH 3GO1L 2WBXA 1KY7A 1Q0YH 5D1QC 4AH2A 3ZHKA 5CFHA 4JKMA 1EGJL 3G9VA 3P4NA 3OMNB 1Z3GH 1TQCB 3QDJA 4G8GA 1PZAA 2G30A 2TAAA 2N4IA 5E8OB 1NAKL 2ZOOA 1T1WB 3PWNA 4WK2B 1JD9A 4JFVA 1WGVA 2H9GA 2M83A 3FC8A 3SDDA 4FA6A 5FO8B 3K5RA 3QS2A 5I66A 3DX6A 3C5ZC 3BP6A 4EI6B 4GRWE 4WWNA 2E7LC 5CGMA 3EUDA 1UG9A 4MJ4A 1OGAD 4GUPA 5KYWA 4BELD 4KAQH 1JZJA 1AMYA 3D2UA 1F58H 3OR6A 4WWKB 4HK0B 5ACLA 2WIIB 2ZKYA 3QC6X 3EJRA 5H94A 4Y2OB 3VFMB 1BZDA 4FGMA 1DBKL 1RK7A 3K71A 3BAWA 2R0LH 4GKOA 5I19L 3OKDB 2H4EA 4GMTL 4KQ3L 1AZUA 5J11B 4U1KA 3QH3A 4HHWA 3U2IA 1SGKA 1B9ZA 2DQCH 4YHNA 2QSQA 1ACXA 2JK5A 5D7JD 3GJFB 1NCBH 5D4HA 2LGNA 3GTTA 3N43B 3TVMD 2NSXA 1KGYE 3L5HA 3NEXA 4FHJA 5D4IA 4AV0A 2COQA 3B9DA 1JDDA 4FFWC 3CFQA 4KXZH 4UOW1 5C09B 1KG0B 1JN6B 2ZWLT 1A1MB 5FV2A 5LN8A 3HS9A 5HI4C 3DI3B 2CGRL 2X2UA 4M43H 2QKIB 2DMBA 3D9AH 3OHXA 2C1OA 1LO0L 1F41A 1W16A 3DX4A 4XCYB 2P9RA 4LLMB 2KH2B 4D9RE 1UQSB 4HZLA 4I0CC 2B2XL 1FYTD 5JW5B 4LSTL 5HGAA 5F88A 2WYIA 4NUJA 1GS6X 4PJCB 4YHMH 1M6OB 3LCYA 1JZEA 2X05A 2WZ5A 3WN5A 2BK8A 5EZLA 3RNQB 1YNLL 4KDWA 3WMSA 3CFDB 3CX2A 1P4UA 5LBSH 1KIPA 4R84A 4OKVB 1IAKA 3D69A 3WEBA 5D7LA 3AT9A 3S98A 1N3NB 3GDCA 4F9LC 5DZPA 1SFDA 5DRXB 1PIFA 5C0BA 3NK4A 3EXLA 4XOCA 3SO5A 1UOLA 1P7KB 4N0CC 3JT2A 1U95A 2ATPB 4YX2H 3FTGB 4DP9X 2HTKC 43C9B 2WSPA 3AC0A 1KGCE 3VW3H 3IPFA 1E4XL 4MNGE 1A6VH 4H8UA 3U0WL 5JIQA 1S6NA 4EUPB 3S3SA 1OAZL 3DO7B 4PWIA 2BO0A 1GJUA 1AR1B 4DZBB 4H25A 4PHZA 2BINA 2H5UA 1PLCA 4HIEB 5FFGA 1OSPH 3LKRB 4OF7A 1BMGA 3CFJB 3QPKA 5F93C 4DZ8B 5IV2A 5L2JA 1LWRA 3DJRA 3LZNA 3TIDB 2FX8L 5CN3A 4KUZL 4NO2A 1RJLB 3CDYA 2QZQA 3CHQA 3PNWB 4A04A 1S9YB 8CGTA 4G6FD 4XP6H 4C56D 5CEZL 2WHVA 2DRUA 2IMMA 3A6CL 2CIIB 4G5AA 1Q0YL 2Q7NA 3HMWH 3QG6B 1ZS2A 3LXBA 4P2CG 4MWFA 3SQBA 4QRPE 4UMGA 2WSDA 4OD2B 1D3CA 5J12C 1JPEA 4H8VA 4LXFA 4TLKA 3FB7B 4HP5A 4A38A 4DWHA 1PBYA 3NIFB 1XTLA 3GUTB 3GLAA 3GI8L 4WJG3 4FNTA 2E0PA 2P5ED 1XBDA 3NZUA 4H40A 2JMRA 4K71B 4LLUA 5JHLA 3PHQA 5CU5A 3PWJB 5EUKB 1M05B 3LV3B 4L9LB 4KAQL 1J1PH 4KDTC 1F58L 4UCFA 4BWTA 1ZA3B 4M7KH 3TONA 4OJYA 2H26A 3DKHA 1Z9PA 4KHXH 2E86A 4JO2H 1ES0B 2R0LL 1YN6B 4HLZG 4K2UH 2GFBA 4HWUA 2LE9A 4LCCA 3TNMB 1FNHA 1G0DA 2MTPA 3UAJA 4AZUA 5DRWB 3AT8A 1UWXH 1U8MA 4X8CA 2DQCL 3LPGA 4KX8A 3SGDH 1S7UA 4ODWA 1NCBL 3PDOA 4YSDA 4PRPD 1N9PA 1LL1A 1FWXA 3K72A 3FW6A 1D2PA 4MDRA 2ZZUT 3ATBA 1N6VA 5IG7B 2Q6WA 3QUMA 4LARH 3RWDB 4KTGA 1GH7A 1BM7A 3EH3B 2AK4B 2Q3ZA 4TNVF 2CLVA 4LEOA 1B0GB 4UAOC 1RVFL 3MDJA 1E4KC 2F7OA 3PS6A 1OM3H 3V5KB 3U0TA 1FZKB 1SJXA 4YXHH 3TO4B 3ALXA 2X4SA 4IOSD 1CT8B 3F7PC 5AAWC 1JPGB 1DE4A 2VLKE 3KPOA 3ZE0B 2ZOWA 5B21A 3ZKSD 4YHML 2UVEA 3QFDA 2CXGA 3E7JA 1ITCA 1AZNA 2NY2B 5EUOB 2YFNA 2VE6A 3KGRA 3T3PB 2WQWA 5JDSB 2O61A 1L6XA 1YNTB 3FUNA 4HCGA 5LBSL 4HU8A 3HS0A 4XVUD 4YHYB 2B1HH 4QRBA 1Q8MA 3OJDB 3C6LB 4R4NC 5ALCH 5GSRB 4YZFE 4JQVC 3S5LG 5J9PA 4BSWA 3SDDC 1E65A 1RFDH 4R7DA 4OZHF 1PY0A 3MRPA 3VXSD 5JHDA 4MNGA 3ZZSA 4XOEA 5EU3A 4ZUTA 5EN2B 5CEXA 5FFLA 4YX2L 3VW3L 1Y0LB 2ICEA 4N0CD 5J57B 1KTBA 1A6VL 5F6IC 3ARBB 3BVWA 2HTKD 2YN5A 4H1LA 4J3VA 5GGSY 2C7FA 1PFOA 3ULVC 4BUGA 5HDBE 3RGBA 1OSPL 4F1ZA 3UPCA 2GT9A 4XOAA 1ZSHA 3F64A 4MA3B 3HZ3A 1BBDH 3F00A 5ESQA 3MLSH 3EF4A 1EEZA 3LKOA 4RGMC 2WXGA 3RX8A 3FHAA 2RBLA 4DGIH 2PXYA 4XP6L 1K8DB 4QRPA 5L0QC 2OSLA 4O2FB 1T66C 4MD0B 4X4MA 1UB6A 4JDEB 2FGWH 1CE6A 5IVXF 3MV8D 5HDQH 2YOCA 3ISWA 3NCXA 3EYOB 3EGXA 5DCCA 2MCAA 1DN2A 2QFPA 4D9QD 5KVEE 3NSFA 1NGPH 5EEYA 3OHXC 2WBJC 2AQSA 2XNAA 4F7CB 2CRYA 2O5XH 5I26A 2WGXA 1NFIA 2APWA 2XT1B 2P52A 2IGTA 2OBGA 3EFFB 5IB1B 4P5KB 2NXYB 4ZK8A 1MW2A 3ZRFC 5IR1B 1WS8A 1J1PL 5IB4B 4M7KL 3WN5C 3QULA 4HCRH 1I3VA 3WXVL 4WLCA 1IGML 2CWRA 4KHXL 1FNGB 3QQDB 1MVUB 4MTMA 4JO2L 3BAKA 4PLOB 5EG6C 1EDQA 5F7AA 3MLXH 4K2UL 3F5WB 3BKMH 3VG0H 3MUY1 3O3AB 5ITFA 1O6VA 2TSBA 2ZXCA 3KCPB 1DZBA 3HBGA 1BX2B 4HISA 4K0OA 4PP1D 2YHGA 4Z78B 2YAHA 2CO7B 4LDCA 3OKOA 3CZJA 4AEIL 5E8DH 4B97A 1OQXA 1TITA 3BDYH 4FQXB 2WWNA 3T0AA 1RUAH 2V5YA 3V0AC 1I9IH 4I0KA 2XIBA 2Y3AA 3EDJA 3KWWA 4G42A 1T1ZB 3OLEA 1E5YA 4JGMA 2OTWA 3QIWD 1FVEB 4KO7A 3RPIA 4C8XA 4CSZA 1GYAA 2R2HB 3OAWA 1HL5A 4ETQB 4OCXL 4PGEA 4YXHL 2WN3A 4Y19B 1DQJA 5I1GL 4Z3GA 4CU6A 1XIWD 4OIIH 3IDYC 5BO1H 4PJ6A 4RDQF 4QRFA 2E7MA 3S36X 3FT2B 4JN2A 3S3BB 1WIPA 2H32A 4KJWD 4MDJA 2GSIA 4X4XA 1SM3H 1QLEH 1WZAA 5E8PB 3MGAA 2PYEA 2FWLB 3JSSA 4HIJA 3X1GA 4H8QA 4LOEA 1NSNH 5IQ7H 4NN5C 1BFOB 4ORZC 5T3ZL 5MEPA 1HYRC 5L7XH 1NDGB 3PFQA 2WMPA 3KNBB 4G8GD 4LCIH 3BI9X 2X6UA 5ALCL 2CBTA 4LPUA 4Q6IB 5BZZA 1S9WA 1AO7E 5KYUB 5D96C 1RFDL 4ZXBA 1SEQH 3HHSA 5HVHC 5EEVA 4S11A 3SDDD 1QFOA 2CK2A 5DYOA 5TFSH 5HBBA 5DZLA 3LKQA 1WCBB 1ZT4B 3M1BB 4P2RB 3S4SB 1RK0A 5DZJA 1V7MH 4U7SA 3V0VB 1NIAA 1NCGA 5E1HB 3QT2A 3KBEA 1JGDB 1OGSA 3OKNB 3V79C 1MCRA 2HLAA 1JV2A 5FAAA 1PCXA 3CDFA 4EVNB 1NOLA 3ULVD 4JVPA 1CLOL 3D25B 1BBDL 3K2MC 2R1WA 4Y2NA 2VXSH 4YGAB 1W8NA 3UAJC 3VACA 3G04A 4TVPH 5FCSH 4DGIL 1T5WA 3MLUH 4L4TB 1BAFL 3AADB 1I7ZA 2DH2A 3FO2B 4FABH 3CFEB 1RUKH 3J07A 3K4DA 2FGWL 1QLRB 2UVFA 1CLYL 5HDQL 3GD1C 1X5GA 3HG0A 1CLZH 1WA0X 4QOKD 4F15B 3J7HA 4WK4B 1TSHA 3TN0A 1F02I 1MXGA 1UT1A 4FFZL 1NGPL 4LGSB 1OP9A 1ORSB 4NZJA 4DETA 1FYHB 5CJBA 4ZJ9A 5KYYA 2QV4A 2HA1A 2P49B 2NY1B 3TA4D 2WBJD 1P4LA 5L9DH 4L0ZA 1ZSDB 1A5FH 1BOYA 5EBLB 3RL2A 1QSEE 2V9TA 3IEAA 2GTWB 3VE0A 1GJIA 3GQFA 4NNXB 4LLWA 4OUUA 1HEHC 4HCRL 2OAAA 4GLRH 5F97E 3KG5A 4LCUA 3FFCE 5CCKH 4BZ2H 2ZX8A 3HS0C 4JAMA 2NXZB 4WHTB 2J44A 3MLXL 4JMXA 3MRRB 5CBEB 3BKML 5K1VA 2CK0H 1NUFA 3TOPA 5IFHL 3X3FL 5JOEA 4HUVA 4C55A 4EDXB 1UATA 2C3VA 2K6YA 4E9YA 4X6DF 2EIMB 3P4MB 3UBHA 1KSRA 3GBML 2WLZA 2PPFA 4JDVA 1XB3A 1IEAB 3TBVA 5E8DL 1RKRA 1XZ0B 2ICEC 3HPJA 5IJCC 3T6ZA 1RUAL 1QBMH 3Q13A 4XP9H 1VLXA 3BZEB 4PBVC 3C6SA 4X99A 4TQHA 5IMLA 1ZTXE 5JR1L 3MLYH 3IF1B 4L0PB 2EDMA 2EO7A 3L3KA 3STBA 4NNPH 1X9QA 4Y88A 4HIXH 2D0HA 5MHSD 1P9MA 2NY5C 3OAUH 5CD3A 4ZZFA 3MV9B 4OIIL 5BO1L 5DT1H 1RZKC 4WJ5B 3G5XA 4G59C 4CU7A 1JFQL 3VI4F 1QLEL 4F7TA 4FG4A 1K4CB 2VZSA 2CLRA 5IQ7L 1NSNL 4MDIB 4NRYA 4M5SA 4HWZA 2CBMA 2FH6A 3HLAA 5FM5O 5J3HD 1NCJA 2WAHA 2Q0ZX 5L7XL 1AO7A 1EZUA 1UTDA 3EYSH 1AAJA 2VH5H 3KVQA 1U36A 1T7ZA 4PWFA 2OCJA 4S2SA 3BUIA 1SEQL 4LLDB 4OB5H 2IDSA 3B9KB 2FJFA 1T7WA 2Y7SA 3DIFA 4Y5YB 3QUXD 5TFSL 3CDGA 2R56L 1E5AA 3LN9A 4NP4H 2LFGA 5IVNA 3A5VA 1XGYH 5EO1A 1BVLA 3WHXB 5DURB 1A21A 1AS7A 3F6LA 3MFGB 4M3HA 2VLME 4MQSB 1QLEB 1XMEB 2NNAA 3MLVH 4FXKA 5I6MA 4NJAH 1TJGH 1ET8A 4E2OA 3EJSA 5C0JA 1IGYA 4HPYH 1FG9C 1OCZB 4UU9B 3SDCB 1OSYA 2ENQA 1DDTA 1KBGH 4ZD3L 3VXUB 3A6BH 5HHVH 3NN8B 1TQVA 1I1FA 3QUGA 2M8XA 1HI6A 3CC1A 2VXSL 2WZAA 3PABB 4N2DA 4DESA 1JWUA 2DQJL 4WHYH 5DEFA 4AK1A 1FUNA 1HKLL 4X6EB 3S5YA 1P4BL 3MLUL 4APQB 4XVTL 2ZXGA 3KYOA 3QJRB 4HQQH 4POUB 4FABL 5E2TH 1CO1A 1GCYA 2PW2B 2CM5A 1CN4A 4DGYH 1JXJA 1RUKL 1HCYA 3NSDA 3MOBH 1JP5A 2OMUA 3BAYA 3O4OB 1OARH 3SE8H 3T8VA 1XAUA 4M3JA 5IESH 1O9ZA 3WS3B 4PGCA 4NRXA 4ZUUB 5IW3A 2FJHB 2FEDC 3VFSB 3TA3B 4HUUA 4MX7B 2J43A 4GRMA 4NQDA 5D1XA 1FG2A 2V7NB 4U1IA 1BLNB 3SD5A 4HIQA 3PP3H 3FQWB 4D9RD 2ADIA 2GI7A 2NZ9C 3ZX1A 5F3HA 3KGSA 1A5FL 1FSKB 2YBGA 1DUYB 2WZPD 3UZQA 5F1NA 4OT1L 1G94A 3NGBB 4R5TA 4Y5XA 2YD3A 4BUQA 4K15A 2DBJA 1VHPA 4AKOA 4ZMNA 3CK0H 4LT7A 3CH8A 4RWHA 5CCKL 2EE9A 2F18A 2IAMA 2XV0A 5FDWB 3PJNA 1NCDH 1AZVA 2CK0L 4ZXBC 3VFNB 3U83A 1UA3A 1TJIH 3TO2B 4WAFA 3DO3A 3NCBB 3WL9B 1L9NA 5ITBH 1OTTD 1KGCD 1KJ3L 3N44B 3VRLE 1ZIBA 5KAQF 1NFDB 2BHFA 2BW4A 2CG9X 2WY3B 3PLYA 4BFIB 3N06B 1QBML 4KKAD 3AB0C 4WU5B 1KGUA 3UC0H 4XP9L 3H55A 2ETWA 1HEZA 4MLIA 3MLYL 3RVTC 3MNZA 2FSDA 4HZ1A 3VQ2C 3WIIH 5D9SA 5I17A 4TSCH 5FGBA 2NY0C 1UZ6F 4AIOA 1OTUC 1A47A 2QHRL 2NW2B 3SDXF 2CXKA 4YDJB 5DT1L 3L2NA 5CINH 1UD5A 1AR2A 3KYNA 2W0KA 2X10A 4ZFFB 1N5YH 1RZFH 3TCLB 1G9ML 3TM6A 4LOVA 3PNRB 5E9AA 1TVHB 5LCVL 2KHAA 1KBWA 1KENH 1SLVA 2ICWJ 2NT0A 2Z93A 4QRPD 2WXJA 4QXGH 1IJ9A 4ISVB 1JNHA 2AQ3A 3ILEA 4TLTA 3WTXA 4POZC 1I8UA 5AZUA 4YZWA 3E1ZA 4NQVA 5D7SL 2I9TB 3FTUA 3HUJF 5FA4B 2K0RA 1XSIA 4ZAKD 1W0WA 2VH5L 4O2CA 2X2IA 1E42A 3DGGB 4GOSA 4UIMA 3TN0C 5B1BB 3VWJA 4A39A 5D7EA 4N0RA 4ZNCD 2OI9B 1FAKT 1QBAA 1TO4A 2JQZA 3BD5A 5DSCA 3PGCA 1SMAA 1VACB 1LK3H 1OB1B 3X13B 1BZQK 3IETB 4NP4L 3CPLB 3MVSA 3ESNA 1XGYL 5AW4B 3OKYA 1KLGB 4LDEB 5A3IC 5KOVC 2CBOA 2EDQA 2XFGB 3FRPG 3MLVL 3WO4C 1K9TA 4NJAL 1ODAA 1TJGL 3F85A 1JZ6A 1FL3B 5BJTB 4DH2A 5CXPA 5T1JA 3HBPA 4QF1B 3CMGA 1KBGL 2F53B 1HOCA 3DROB 4R96B 4HOMA 1M6UA 2YWZA 1KT2A 2KUTA 3A6BL 5HHVL 2DLIA 1JZ3A 4XGZB 3IVKB 5FKAB 5JLZA 1DBJH 4L8SB 4K8RC 3P02A 3E8VA 4M6OH 1RZ7L 4HQQL 5E2TL 1JHKH 3ARDD 4JRXE 4DGYL 4DP0X 3MOBL 2PW1B 1ZDSA 3KL5A 3SE8L 1OARL 5EU6B 5IESL 4C47A 1JBJA 4QXTA 3FO9B 2A6DA 4JJ5A 1YRKA 4FLSA 2GUOA 1KGJA 2NX5E 4AXWB 3VD9A 1QPPA 2FEDD 1QASA 1NL0H 2YC1B 3BKYH 3IFPB 1P9MC 1VEMA 1ZTMA 4MRBA 2VLKD 4YHZL 4Y1TA 1W9XA 4JREB 1BXXA 2NZ9D 4GRWF 4LBAA 2AJXH 3QNXB 1EFXB 2BLFA 3WG7B 4KNQA 2Q5BA 4HWEH 1JWSB 4KRLB 4Z7VB 2OMYA 3EZ8A 1KYAA 4YJZL 5CUSH 3CK0L 1SBBA 4N26A 1RQ5A 4X5WB 1CFTA 1NCDL 2DQMA 1HQ4A 2D7OA 5ADPH 4KWUA 4FQJH 4PBDA 4L0YA 1TZIA 1U91A 1CFMA 1WTGT 3GRWH 4EIZC 1LM8V 1A9BA 3IMUA 3P73A 4QY8A 3TGXA 1TJIL 5AVZB 2QSCL 5ITBL 1EXGA 4HS6A 2X2YA 3RDTB 3DIVA 1IGTB 2OMVA 2ZWKA 3P69A 1KCSH 4J23A 5ACMA 3G6AA 2PTTB 3IMTA 1S7RA 5AOMA 4HUNB 3ASWA 5E4EB 1T0OA 1LE5B 2O5ZH 4FXKC 5AAPA 4CBPA 2CH8A 3WIIL 4NKOB 4PSPA 4CMHB 4TSCL 1O9WA 3BT0A 5BRZB 3M8OH 3RVTD 5F9OL 1OSZA 3CTTA 2HPTA 1T7VA 5CJ5A 1JGVH 1I4FB 4LRIA 4LOUD 2NY0D 2PF6A 4AQAA 2VZOA 5ID0B 1RUPH 1OTUD 1PG7L 1BQSA 1TDQA 2IH1A 4AM0A 3EJUA 3RUGA 1N5YL 1RZFL 4OF5A 4XPBH 2CO3A 5KVDH 1EXUB 4P2QB 4AGQA 1JAEA 2PCFB 3L9RB 1KENL 5KWYC 2N1TE 4N9GB 4PJIE 1D9KD 1WGOA 4FMKA 1MCSA 5GRUH 3PDDA 1M2VB 2ZCLL 4POZD 4GS7C 4LHQB 5LBGA 5LDSA 4PM1A 5D1XC 3WMQA 5E6YA 2GTQA 4PI0A 3TN0D 2P8MA 3TBYB 4S1DD 2HLFC 4NZRH 5HDLA 7PAZA 2PPCA 4P2OA 5GZNA 5ESVB 1KGXA 4WFEE 2ZP0T 4Y5XC 3O4LB 5G5DA 2CIKA 5LGKA 2UZXA 2IAMC 4M5YH 3RZCD 1WIOA 2W0FB 1U8QA 5KN5B 2DEWX 4FF9A 4NQCE 4DP4X 1UM6H 1P5UB 1ZVSA 2J20A 5DEGB 3IJYA 4NC2B 3ATAA 3DRQA 4V1DD 4F8PA 5C2UB 1JK8A 1H3TA 4HMDA 4J3OD 4Q8BA 3KPTA 2E6QA 4M6OL 4BINA 5GGVY 5DJDB 4LSVH 5E6IA 2ORBH 4L48A 1FH5H 3VSQA 3RE0A 3WTVA 4GI9A 3D39A 3FUKA 4HC1A 1VERA 2H3XC 3HAEG 3TV3H 4CC0A 3H2QA 2X44D 3MREA 3QO0A 3VD4A 1OP3H 4XTRC 5GJTH 3FCTB 3SCMC 5J6SA 3DJ9A 4ZX3A 2GY5A 5T5NG 5INDA 1E4JA 1HS6A 3HE6A 2EEAA 4LEBA 2VB5A 5HY9A 3REVB 5KBLA 4L3CA 5AD0A 4WW2A 3O6MH 4JE4B 4NQXA 4R26H 2W59A 5LG1A 4CN6A 1RJYB 2R0KH 1ACCA 4X0KB 3ROOB 5FOBB 4GO9A 3SBPA 5CUSL 1UURA 2ZAHA 4UILL 4N0UE 4WSGA 4M7JL 2OQJB 1HL4A 5TGBB 3UTQA 2DIJA 4K5MA 1U8PA 3MUGA 4FQJL 1AO7D 5ADPL 2BZ7A 3VWJC 5C92A 2ITDA 4QUOA 1LK2A 3MJ9H 2EDBA 1KCVH 1KTKE 5INCB 1ID2A 4PJFA 4QRSB 1O0VA 5DA0B 4N3UA 2RGSA 5AEAA 4MJIE 2Y1AA 2VC2H 1KCSL 2QPDB 2EAEA 4XE0A 3NPSB 2ZSWB 5B8CB 4S10A 4B9GA 4PJ7A 2P24A 2PUQT 4BFGA 1FIGL 2O5ZL 5TE7L 1RJZA 5TDPA 3T77A 3T1WA 2LLNA 3X11A 4OCSH 1E30A 4MJ6A 4HALA 1BJ8A 1LP9E 1IE5A 3GEFA 1AG0A 4I3SL 5TDOA 2YN3A 3RWHB 1J5IA 3M8OL 2X1OA 4JANA 4LQFH 1RV6X 1TLMA 2ENYA 2R0ZL 3OZLA 4MXVF 2J8UB 5D2LB 1GTNA 4YSEA 5I0VA 1R34A 2G0LA 3QUYA 1VPOH 1FCCA 5AW8B 3TC9A 2YJQA 3VDCA 5AVRB 5IJKA 3F84A 5KVDL 1AD9B 5IQOA 1XT5A 3QFJD 4PJIA 5B7FA 1H15A 5M95B 4F3FB 4HIPA 4AIZA 1XF5B 5D72H 3U36B 1PU0A 4RFOH 5GRUL 2C7UA 4M93C 3VTTA 3QIUD 4XBGA 4UT6H 2BCKB 3RWJB 4G9FE 3FT0A 4PCSA 3RILA 3SPIA 1TYJA 1RXLA 1KIUB 4JO5A 4Q4EA 4YZFF 2AXFB 3HKZA 5C3TA 3UBGA 1OCCB 2OXGB 2JKWA 2MQCA 3BEVA 4NZRL 3FH5A 2MEJB 1IBHA 1QSED 4JGJA 5E2JA 1DANT 2HLFD 1NJ9B 3HG1E 3VCLB 5ETUA 4NZUH 2MCPL 4D8OA 1H3UA 3ZDYB 1P7HL 5FUCE 3FFCD 2CR6A 3SPGA 4DJMA 3K91A 5DJ0B 4M5YL 3T6WA 3CSYB 5JPNB 4G8EA 5HDBF 3EUUA 4YDLB 1UM6L 2IAMD 4PGDB 1A1OB 1LO3H 4ZBJA 2WLIA 1K8IA 3IDXH 1E2VA 5JO5A 2FZ3A 1F0LA 1QO3A 1LEKB 1HKFA 3CZNA 1FZOA 2ILLA 1ET7A 1AGEB 4KXDA 2C9PA 4LSVL 1NGWB 2JI3A 4G8FB 2PTVA 1FH5L 1WA2X 4PP2B 5MEOB 1ZOXA 1TXKA 5GHWH 5IBLC 1OT2A 1GGIH 4FMVA 2D7QA 1RLBA 1UGNA 2FAUA 3TV3L 3VFPB 3MA9H 2QKIA 4ODVL 1EHNA 2A9AA 4EI5A 2FO4B 3GIVB 5E8NB 1JMZA 4LRIC 2GK0A 4LVNC 3SCMD 1EAQA 3ZGHA 1WUNT 4PRIE 4QRTB 4N2IA 2Z0UA 2YD8A 3QDGE 4AE0A 4YDMA 1L0PA 4YHPB 1PL3A 3O6ML 1C9SA 4R26L 1CXIA 2XG5A 3ARGB 2A1WH 1XF2B 2NNRA 2J8HA 5FO9A 5KBNC 2WK2A 2JB5H 4MXQC 2OP4L 4AMKH 2XKNB 3ZXAC 2AV7B 4B9CA 3ZTCC 4FA7B 1ZHKB 2HX7A 3RJDA 4ATWA 5I5IA 3KDMB 1NWOA 2KZWA 1JHTB 3VWJD 3MJ9L 5D70H 1KCVL 3EOTL 3Q2WA 3OG6B 4ZUWB 3GM0A 43C9A 5GSVB 1OTSC 2VC2L 1UVQB 4P2OC 2IANB 5GZNC 3OWEA 4J3OF 3UYPA 25C8L 2VLMD 3EYVA 3WAJA 3QGVA 2UYLB 2VUOA 1LP9A 4WDIB 2UWEF 2V37A 5EU5B 2EIZB 2NZIA 4OCSL 4UANA 3S3JA 3MKGA 3HJ0A 2D31A 2YPKB 4OSUH 3N41F 3VB8A 4K7FB 3PNWA 4PJ9B 4RISH 5AVVB 2K45A 4P3WA 1IAII 2XUWA 3KH3A 4UQ3A 1VPOL 4JPKH 4XNMA 2F7PA 4RFNC 1Q94B 4PR5A 1W0VA 4OQ1A 2ZKMX 5LGHH 3B3IB 1MLCB 2VC2B 3P9WB 4H8WC 5E6IC 1D5IL 3BDXA 4UF7C 1XF4A 2OMTA 1HAWA 4G9FA 4HS3A 5D72L 2GTZB 1NDTA 1HNYA 2WKLA 3F12A 2PMZA 1QHOA 4GEIA 3QRLA 1YEFH 1KYFA 2Z7ZA 1PKOA 5HHME 3EFOB 1J05A 2WSKA 4J28A 5DS8B 3HE6C 3OR7A 4OU3A 3U30C 4JHBA 1WJ3A 4JZJB 1DJSA 1CS6A 5EMYA 4K3EH 4H44C 3AWGA 2VN5A 4WW2C 3VG9C 3X14A 4WFGE 1T20A 4YL9A 2XETA 4IRZH 2EDJA 4ICXA 1FGNH 4NO3B 4Y9BA 2M26A 4S0TD 4AT6A 4BHUA 1WAPA 4QO1A 4E68A 1HNFA 3BPLC 1FFQA 5LBVA 2O72A 2XWZA 2LU7A 2Z31B 3RPBA 3MLWH 3EHBC 3P9MA 5TK2A 1KPRB 3L16A 3V6FA 1U8IB 3IDXL 4BUHA 1V7NH 2IWKA 5KW9H 4KROB 1J9RA 3SKUD 4N1HB 3C9NA 5K59F 2HKHH 1WG3A 5T1KA 3D05A 1AFVH 5D6DA 4JPSA 4HETA 3HNVH 5GHWL 4JFSA 2E9BA 5LUMA 2AK4A 3IDNA 1GGIL 4QTIH 1EEYA 1FL5B 2JKRM 3MA9L 4UM9D 3OAYK 2A74B 1ZS8A 2BJMH 4PRIA 3IS1X 4PV9B 4ZX5A 4W6XB 1MFAH 3D0LA 3QDGA 3HI1A 4EIUA 3NPZB 2ZWZA 2FLMA 4N87A 4BE5A 2P5WE 3QUYC 1KBBA 1XEDA 4P3DA 1CG9A 3R1GH 1JPTH 4DO5A 5I1DA 1BZ7B 1QP1A 3QXWA 3ULAB 3NTCH 1BF8A 4NKMB 5T1MA 4V11A 2A1WL 2FT7A 3PJLA 3BAJA 1A02N 3KM2A 5F2FA 4UTAH 3OJDA 3WUWG 1JPSH 3LIZL 4KMTH 1CIUA 3PAZA 4MXQD 3WNLA 3VD3A 4XNQB 3BVUA 5I23A 3FB5B 4FP8H 3ARUA 3LXCA 2CPUA 1XCTA 1R5IB 1VAHA 3AUWB 1XSKA 2EIKB 3LKNA 2HXAA 4BHUI 4QHMB 2ZKHH 4XO3A 5DF0A 4EI0A 5C86A 1BIHA 2E9JA 1OTSD 1SN5A 5IJVA 2LV4A 5HPMA 5KSVB 4GEJA 4KXBA 5JIDA 4OSUL 3WN6A 3FPYA 1NFAA 4JG1L 2F8OA 4RISL 1DO6A 5BVJB 1CFNA 2I69A 1SEBA 2DIBA 5E1AB 3LHPL 2XX1A 2H3KA 2ADJB 4JPKL 4ZI8A 1JD7A 3QZMA 2HG0A 5EV7A 2X6BA 4JRXD 5A2KH 5LGHL 4FJZA 2O30A 3EYQC 4RAUB 5EULV 5E6ID 5DQ9A 2CGYA 3SIKA 3WLWC 5DFVC 4U6HB 3SODB 4H0IA 4E41E 2NX5D 2D03H 4PV8B 4EI5C 2XN1A 1YEFL 4F7CA 1CD9B 1A2YA 1RMFL 4NENB 4NQEB 4BXVA 2C4FU 3ZYOA 4F2FA 2X1XR 4CVZB 4ENED 2EXWD 5DJYA 3HN5A 4U1HA 4L8CB 2Y7LA 2ZX5A 3QUZB 1JF5A 4K3EL 4LLYA 5IROA 5IM7A 4YBQD 1AZBA 3QPQD 3ZSSA 5EIVA 5GGSA 1NIFA 2D9CA 4Z3FA 1FGNL 5FLUA 3ROLB 5LGJA 2MQ0A 2R23A 2YGPA 3KPSB 3UZEA 2FNBA 1TZOA 1ASPA 1UZGA 4H8PA 4NT6A 4B0MM 4PRAB 3MLWL 3V0FA 2A6JB 5HYJA 1EJ8A 2NY6B 3K6OA 3ASNB 2PCYA 3B2PA 4UT7H 4JK0D 3BQUC 1INEH 4BQ8A 1F4WL 3REWB 1BM3H 3T5WA 2K70A 1AFVL 1GOGA 3UTZB 4ZNEE 5C0IB 3HNVL 3CSPA 3NSJA 3BH9B 2WCGA 4QTIL 3T0EB 3L48A 1F1DA 4P8QA 3IMWA 1AZRA 3F04A 4JFUA 4C59B 2BJML 1LEGB 1MHEB 3MA7A 1MHCB 1UFGA 1AKJB 5GRVL 3SZ6A 4AZ8A 2OFQA 3PYCA 5AZEL 4FJ6A 3TBSB 5E8PA 3R1GL 1JPTL 3QUYD 5C07B 5SWZE 3LRSA 3L6FB 1J88A 4O5LH 3NTCL 4TKWA 4D0BA 4J39A 4NKDA 1BEYH 3RNKB 1WWWX 5HPOA 1X5YA 5CP7B 1IC0A 4UINH 4OJAA 3EF7A 5DMYA 1JPSL 2NDGA 4KMTL 4W9ZA 2UX6A 1WFNA 3U4KA 2XG4B 2ESVE 1KJ2H 1AXTH 4M4RA 4OCRH 4XPGH 4NFBA 3NFNB 1FNEA 1KXVC 3WE6A 1MJ8H 3ME0B 2ZF8A 3BFOA 2ITCB 1FHNA 1XQ4A 3CHPA 3WD5H 2BNRE 4K4KA 1WBZA 3MJ7B 1NIEA 1UB5B 4Z3TA 1RL1A 3UPRB 5FUCC 4WFED 1XXDC 3VRLF 4HCFA 3US9A 1CGTA 3OLIA 4HV8A 4HJ1A 2WBKA 4Z7UB 4O9HL 1OD9A 3Q6FA 4WKZB 2JTDA 2ICWB 1Q9OB 2ARJB 4EXPX 2Q7YB 4NQCD 5JIHA 3DX0A 4ELMB 5C97A 5I6KA 2GBTA 5CZVH 2AS5M 3HG4A 4BFJA 3C5SB 1L5GA 1N5AB 2A0LD 4JFWA 1S7XB 4IS6B 4O2EB 4DERA 5HHOA 4GG6B 3GDBA 5C0FB 4I2XB 5B38A 3CPUA 1NKOA 3S8GB 4FKHA 1AE6H 4I3RH 3UZVB 4I1NB 4H13C 3H9SA 5D6DC 1HDMB 3BD3A 2R0WH 4E41A 3K80A 3R0MA 2Y69B 4U6VH 4W9EC 4ANKA 4D2NA 1CICD 4KNSA 2D03L 5DFVD 4LVHC 3KBFA 3VFOA 1NMAH 3U46A 4OLVH 4EI5D 4MZ3A 1URZA 2JJTA 3V5DA 4ORGB 4Q14A 4RLDA 4DKDC 1KNOB 3FFDA 4ZX6A 1YN7B 3N1MC 4K7PX 1GTFA 4JO3L <