1J9QA

Crystal structure of nitrite soaked oxidized d98n afnir
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
336
structure length
336
Chain Sequence
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNINFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
publication title Alternate substrate binding modes to two mutant (D98N and H255N) forms of nitrite reductase from Alcaligenes faecalis S-6: structural model of a transient catalytic intermediate
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
total genus 91
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2001-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1j9qA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1j9qA02
4AKQA 3FYIB 4KO6A 3UACA 3H4FA 1L9RA 1B3IA 1PZBA 1IKOP 4CSZA 2GI0A 2YAMA 1AS7A 3AG3B 3CVCA 3FSVA 3IEAA 3CVDA 5E9NA 4L0PB 1CYWA 3AY2A 1KCBA 2VW4A 1EHKB 2VM4A 1KDJA 1FA4A 1NDTA 3AG1B 1EZLA 2VMJA 1PZAA 3ABKB 3SBRA 2IWEA 1NWOA 3T6WA 1JZHA 4HHGA 1CURA 1J9TA 3DIVA 2Y1AA 2FQFA 4E9WA 1AG0A 1E5YA 4NB7A 4FAAB 2ZXWB 3NSDA 3WG7B 1ASOA 3UAEA 1GS6X 3X2QB 4YSOA 3NP3A 1GSKA 4DPCX 1PAZA 4UF7C 2AVFA 1ASQA 4GP5B 2HX7A 2XXGA 5I26A 3BVDB 3X1BA 3FSWA 3ZBMA 3TASA 3WNIA 1NTDA 4AKOA 4PAZA 2GIMA 2YAFA 1ZDSA 2FT8A 1IUZA 5I6KA 3EH3B 4DP5X 1AS6A 1XB6A 2BHFA 1X9UA 1A4BA 1NIFA 3FSZA 1KYAA 5I5JA 4PCYA 2PP9A 3IN2A 3GDCA 4G7QB 1WA2X 1NIDA 1AS8A 7PCYA 1PLCA 3SQRA 1N68A 2Q9OA 5EHFA 3D12B 1KV7A 2ZOOA 3X1GA 1BXAA 5B7MA 5B7EA 3WIAA 1UATA 5I6NA 1I53A 4BWTA 1ET8A 2PPAA 4G72B 4UAHA 3N55A 2XYBA 4NAJA 1PLBA 1YLBB 1AOZA 1AAJA 1AG6A 1W6WA 2JXMA 2XLLA 3PXLA 3QJQB 2IDQA 1SJMA 1JZEA 4JHVA 2TSBA 1XB3A 2DY2A 4BXSV 1E67A 3NJJA 1BQ5A 2BP0A 1KDIA 2H47C 4YSSA 2HRHA 5FC9A 4HZ1A 3N2JA 2FQGA 5F7AA 4YL4A 2P80D 1OCZB 1BXUA 3TU6A 3EH4B 1JVLA 2FQEA 4F2EA 2PP7A 2GBAA 1MG3C 2BW4A 3NJKA 4A66A 4UANA 5A7EA 1IBYA 3ABMB 1NIBA 3CVBA 3QJVB 4YSDA 1QNIA 1AR1B 4GY4A 2UX7A 2BW5A 1E65A 1TKWA 2BZCA 2I7OA 1JZIA 1W6LA 1FFTB 5B1AB 4YSQA 1SF5A 5I5IA 2OJ1A 3ASOB 1J9QA 3UABA 2HXAA 2BP0B 2IWFA 3H56A 1KCWA 2BP8B 1NICA 1A65A 3FT0A 3OQRA 4GP4B 2P80A 7PAZA 1JERA 1A3ZA 1CYXA 4AX3A 1WAEA 3FU9A 1W8EA 2YXVA 2PCFA 5IY5B 2I85A 1AZRA 4BWWA 1GY2A 3T9WA 4DP8X 4FA7B 2YAQA 2XUWA 3IN0A 1FWXA 1BQKA 2H3XC 1DZ0A 3AW5A 2AFNA 4RH4A 4HCIA 2CAKA 2EILB 3T6ZA 4YVUA 3GXUB 4W1TA 1KBWA 4G71B 1ASPA 3QJRB 2I7SA 2VSMB 2RACA 2BO0A 1JXFA 2N0MA 3PAUA 2TSAA 6PCYA 2PPCA 1J5CA 3H4HA 5LDUA 3OMIB 4BWUA 1ID2A 3OD3A 8PAZA 2UXVA 3NJFA 2IH8A 2AANA 3TA4D 3OM3B 3FSAA 4E9SA 1JZJA 4P5RA 1WA0X 1A4AA 1OCOB 1AIZA 1TU2A 4A2EA 4DP4X 2EINB 4EF3A 3OMNB 3X1EA 1JXGA 4GP8B 1ZDQA 2PPEA 5B3SB 3QQXA 3EF4A 2B08A 5I6MA 1BXVA 3NJGA 1HAWA 1R1CA 3ABGA 1JVOA 1GY1A 1AZBA 2PLTA 2CCWA 1HAUA 1XMEB 2CJ3A 5PAZA 1OE3A 3IE9A 1J9RA 4AZUA 4E9RA 1PMYA 4GXFA 4A68A 5B1JC 3MBWB 2FTAA 2W8CA 2XXFA 5ANHA 1MG2C 2IDUA 2YQBA 3EH5B 4YSCA 1F56A 2WSDA 3MX0B 2FWLB 4G70B 1OE2A 1L9TA 2YXWA 4A2HA 3WKQA 2VW7A 2MRYA 4HALA 1N70A 1PNDA 4Q89A 2PPDA 1AANA 3JT2A 2IDSA 2XVBA 3UADA 1A4CA 1M9WA 3AG4B 4KO9A 2J56A 5TK4A 4A2GA 4TXVB 2XX1A 1IC0A 4KO7A 3AG2B 5AZUA 2FT7A 1KGYE 2NRDA 2XWZA 3FU7A 2HX8A 5PCYA 3S3BB 1PLAA 3L45A 1ET7A 2YAEA 1ETJA 9PCYA 4WKXA 3NP4A 3TBCA 2XV0A 1GW0A 4E9YA 3PCYA 2GC7C 3NJNA 1NWPA 2HZHA 3WKPA 2B3IA 5D4IA 3V9EA 4E9XA 1SF3A 1X9RA 2GHZA 4JHUA 1E5ZA 1PY0A 2CUAA 4X4KA 3CZUB 2YAPA 4E9VA 3SBPA 1IBZA 1J5DA 3NJMA 3IBOA 1AZNA 2DYRB 1VLXA 2A3TA 2DV6A 1TEGA 2YAOA 3UGEA 1ZIBA 1WS8A 3NT0A 1AZCA 3CDZA 4KNTA 4G7RB 2PCYA 2DYSB 3BQVA 3DTUB 3S3DB 4GYBA 1NPJA 3FU7B 2AZAA 4KNSA 4DPAX 1ZV2A 4DP9X 1WS7A 4YSAA 4M4RB 6PAZA 1MZYA 2FQDA 2EIMB 1ET5A 4YSTA 5I6OA 1T5KA 1OOWA 2XU9A 3CG8A 1RCYA 4MFHA 4NERA 1XB8A 2IH9A 4HIPA 3NSFA 3ZIYA 1AZUA 5D4JA 4F2FA 4DPBX 3FQ1A 2YARA 3NJIA 3X1NA 1AACA 4AKPA 4YSRA 1BEXA 2QDWA 2X88A 1BYPA 3PLYA 2VW6A 3NJHA 1ILSA 4BK5C 2OCCB 3WNJA 2J5WA 2EIJB 3V9CA 5TK2A 1NINA 4A2FA 4HCFA 2QPEB 2DWTA 2R7EA 5B1BB 2E86A 1JZFA 3T6XA 1M56B 2BWDA 4CSPA 3DKHA 2GC4C 2WO3B 1ZIAA 1AQ8A 4DP1X 2QDVA 4A2DA 2MTAA 5B1JA 3KW7A 1SNRA 2UX6A 4M3HA 2WO2B 2IDFA 1SHWA 1URIA 1SFHA 2VN3A 4G7SB 4QLWA 2PP8A 3KW8A 1A8ZA 1GS8A 1NPNA 3PAZA 2AZUA 1OF0A 4F7KA 4YVNA 1V10A 1L9SA 1OV8A 1CUOA 4KNUA 4HHWA 1OCCB 2GSMB 4KOBA 2JKWA 4W9ZA 1L9QA 2IAAC 2R7EB 2FJSA 1MDAA 4YSPA 1JZGA 1NIAA 4Q8BA 4A67A 2BZ7A 1MZZA 3JTBA 3QJSB 4KO5A 1GYCA 3NSCA 4KOCA 2Q5BA 4YSEA 2QPDB 1NIEA 2XX0A 2W88A 3FQYA 1SHXA 3WI9A 3FYEB 1RZPA 4DP2X 4E9TA 1KBVA 5D4HA 4P5SA 3S8FB 2JFCA 2PPFA 2VM3A 1V55B 3X1FA 5B7FA 5AFAA 1ADWA 2XV3A 2DWSA 4DP7X 4DP0X 3FU8A 1SDDA 2ZWNA 5I28A 2LLNA 1HFUA 4BXVA 1RZQA 2Y69B 4WTQA 1WA1X 3NJLA 2CBPA 1L9PA 1QHQA 2GB2A 3G5WA 4E9QA 4K9JA 3FQ2A 4BDVA 4QKTA 3EHBB 4DP6X 2FT6A 2UXFA 2UXGA 1L9OA 2XV2A 1TEFA 3ZX1A 1ZPUA 3TBBA 3GYRA 4HCGA 2J57A 1CC3A 1OCRB 3T71A 2BWIA 3QJUB 3UAAA 1SFDA 1J9SA 3U25A 3T6VA 2CALA 2HLEB 1NZRA 2BP8A 3QJTB 4ZK8A 1E30A 2HRGA 2J55A 3NSYA 3FPYA 3S3CB 1ILUA 1GR7A 2FNWA 1DYZA 2UXTA 1V54B 1OE1A 1SDDB 3NYKA 1PNCA 3ZDWA 1BQRA 2EIKB 2IWKA 1JOIA 5F7BA 2IDTA 5I5MA 1BAWA 4N4YB 2YAHA 3FS9A 3OMAB 4N8UA 3PAVA 4BDVB 5AKRA 3ASNB 2H5UA 4JKNA 1BYOA 2ZONA 1QLEB 4AI7A 3PPSA 3QPKA 1RKRA 3AZUA 1GS7A 4ENZA 3S8GB 2X87A 3C75A 1PF3A 2HX9A 3ABLB 1PCSA 3RYMA 3HEIB 4YSUA 3SBQA 1M57B 5I6PA 4HAKA 2QT6A 3ERXA 5I6LA 1PZCA 5B1KA 3CDZB 2VSKB 2OV0A 3HB3B 1JXDA 3FPXA
chains in the Genus database with same CATH superfamily
4MXQD 1NGQL 2Q3AA 3DETD 7FABH 3WTUA 4IRZL 2BX5A 3QRFM 3FL7A 5LAXB 1IAIL 2F7OA 3MBEB 3X12A 4ABUA 2NY1D 1KPRA 4NENA 3DOSB 4IYKA 3OAWA 2EYTB 1ML0A 1HHHA 2B4CC 4FDWA 4CNIB 1N5AA 4JRWA 2BY0A 1ZXKA 3BIKB 1G9MC 1QI5A 1KCBA 3AY2A 4OJYA 5EWIH 3QFGA 4I1PA 3STBA 1DQKA 4ZTPL 3VE0B 1KIUA 1FA4A 1F4WL 3KLKA 3EDFA 2GSIA 5EUKA 1HIML 1T3FA 4FADA 2R2BB 2J4WL 4J12A 4IBYA 3VXRB 3CMOL 2HN7B 3MKKA 3CMGA 1XT5A 3T6WA 4BYHA 2PR9A 4UQ2B 4E41D 3LRSA 3D1MC 5D70H 4G8EA 4UQ3B 5KJRL 4KI5C 3VI3A 3EO9H 2ZXCA 5LGJA 2ZOKB 1AMYA 4Q6IC 4JDZB 3MLTA 4M8UA 4QTIH 4X6FA 2IG2H 2FEEI 1FH5L 4MYPA 1OAUH 4FTDA 4OLUL 4LCYA 3N1QC 3UBXI 5IB5A 4QTHA 4FEMA 1AR1D 5IMOB 5I6KA 4X7EC 1UXWB 1CTOA 3O9WB 4J6RH 4NQED 4YUEL 1XB6A 2R0WH 1IC7L 5I19L 1E6OL 1PZ5B 2VYRE 4ONGH 2AJZB 3V4PA 5IGXL 4LIQL 4WW1A 5DK0A 3SQRA 4E42A 3S9DB 3EO1B 4XC3L 4MNGE 4F7CA 3A4DA 3LV3A 3CX2A 1A1OA 1IAMA 1G1CA 3NEXA 3VGEA 3WFBH 3GZKA 3BUYB 5E56A 2HKHL 3KPNB 4N0CC 4N90D 3ILEA 4XCCL 2Y06L 3IXAA 1W6WA 1BVLB 1EUUA 3ARGB 3BLPX 1E4WL 3IBEA 1GRWA 5GJSH 4LCUB 1BPVA 4OLXH 4U1LB 2AQ1A 3KVDD 5G4NA 4LPCA 3GSWB 3QK0A 3AUWB 2RB8A 1HINH 5L7XL 5H2BA 1O7VA 5FLVA 2BP0A 1EIBA 2BVUA 2VDMB 3SO5A 4LCCB 1TEYA 1OP3H 2X1QA 4X6CA 4G9FE 1EANA 3HE7B 5BS0D 4MJ5A 3HIZA 1QKZH 4QJ3B 4PJ5B 1BVNT 1IIIA 2CGZA 2JNZA 1TZOA 1AKPA 3W57A 2YKKA 5DQDH 4AQEA 1DVTA 4KTEH 3UTPD 4JKMA 3M45A 3HZKA 3UMTA 4K7PY 3WD5L 2G2PA 1MCKA 2R69L 3MRDA 5E6IA 5CBEB 2P24B 4APQD 4X6BB 2ITCA 5KSBB 2CE6A 2DQCH 2X4SB 1CLYL 2E4TA 3D50A 5HGBB 4XNDA 3AUVA 1HE8A 3HZMA 4PJCF 2C3XA 3BWAB 2R1WA 3RY5A 4DETA 1XEUA 4JZOB 5DVKA 4MAYC 4NC1E 4L5FL 1F4AA 1KB5A 1WYJA 1XAKA 1B2WH 2AMUA 2GIXA 3AWFA 3CC5B 4H2AA 1KC5L 4NWUH 4XAWL 2XQYA 3QPQD 1DLFL 1T66C 2BM3A 3WE1A 4JY5L 1E7VA 1OM9A 4NZTH 5FA4A 5HJGA 1E0OB 4FEIA 3B43A 4O00A 4OFKA 3HB3C 1PY4A 3FUHA 2AXGA 3TTYA 1MRFH 4R84A 5FYLL 4H1LG 5ERWB 2AJYL 2VDML 5EFIB 3ZUCA 4ZDHA 5B39A 4Z0XA 3CC1A 2VSCA 1I3RB 1HTYA 4QWWD 1OARH 4RWHA 4U4BA 6PCYA 1BDYA 4E41E 2HTKC 4XZ4A 3GM0A 1S46A 3CXDH 4GIAA 1LE5A 3OF6A 3GRBA 1A4KB 1E9PB 1DFXA 3MYJB 4QT5B 4TLKA 3TA4D 4BFGA 3MRLA 1PX4A 2PCFB 4PBWD 3VWKC 4F8NA 4Y88A 4N1CA 3M17A 2K4AA 2J25A 2FO8A 2P28B 1KG0A 5KS9B 2O1AA 4P4KD 1BFOB 2ENSA 2I9TB 4PRHD 2WGNB 3MRBA 3QUXD 5MI0B 3BVTA 4M1CD 1CFNA 1BXVA 2F19H 1OIOA 3RWDB 1PY9A 4NFDA 4JFEB 4PM1A 2ARJQ 2FBOJ 3SSGA 4PG9A 1XMEB 1KCKA 3UXFA 4UOW1 4KTDH 3T0EA 4NQCA 5HJ3B 3NCBB 5I1AA 3GIZH 4Q14A 5TE7L 1CICC 4OLWL 1NC2B 1KTCA 4GXFA 1TG8A 3C6SA 4JANB 1YN6A 2BVQA 2Z91A 5EU7E 1FO0A 4O9HH 4PIRF 4GO9A 3BKCH 4NFCA 5ITBH 1CD1A 2WQSA 4FNQA 1CF1A 2J6EH 4WIQA 5KW9H 3CFBA 2W59A 2LQRA 2ICEB 3UEZA 3QDJE 4ELME 3GMMA 1MFBL 5F9DC 2P48B 1A4CA 1M9WA 3U0WL 4NRXA 4P2OB 3KPPB 3TURA 2PABA 5DK2A 4DO4A 4TXVB 1BA9A 2VSDA 4F8PA 1FCGA 4N0YL 4BCXA 2K3TA 4BH7B 4LEXL 3OAUL 2DJSA 3DRTB 1OD7A 5D7LB 4PJ9C 5K9JH 4P4RA 3QG6A 3TEYA 4Z9KB 3U82B 1LNUB 1S7TA 1Z1WA 2ZAHA 1MEXH 4H4NA 4WUUB 2CR6A 1MIMH 5TQ2L 3RL1A 3UTPE 1DBJL 4X7CC 4YR6A 1N8ZA 4LPXA 3OAZK 4GRLD 5G5DA 4BRVA 4HF5H 4HV8A 3WNKA 2Y1YA 2PW2B 2AABH 2B3IA 3V9EA 2XRAL 1R0AH 4K3JH 1MLBB 1T83C 4RAUB 2HLFC 1G7HB 4EUPA 1C5DB 4OCXL 1NLDL 2ZX5A 1BIIB 5HI4C 4L1TA 1B0IA 1KJVA 5IBLD 3ARUA 2BIOA 1AZNA 5E2VL 1YEJH 3CFMA 1TEGA 3WFEH 1SYSA 1R3LB 4P2RB 3VWJD 1JCVA 2VDRL 4OTXH 4Y2DA 2X05A 2CO6B 1WFTA 1PJWA 2L0DA 3HZYB 3I6GA 4TNWF 4PP1C 1WIOA 3UZQB 3CFUA 4GMTH 4OBSA 3ROOA 1ZV2A 2JB6A 2JIXB 1UM4H 1I7RA 5FHBL 1SJHA 3NRPA 1WS7A 5BPPA 2GY5A 2IAMC 4ZOBA 2Q86B 3CFJA 2A0LD 3GWJA 2PW1A 1KN4L 4JRXE 1RZ8B 3C09C 2MPAH 3RVTD 3VRIA 4PJHB 3L3GB 3C12A 3NIFF 4NERA 5DR5H 1GGIL 2IH9A 2NT0A 2ZAIA 3BSZH 3F5WB 4YGAB 3ZMNA 3RFZC 1IFGA 1KLUB 1QLRB 1T0NA 2H0EA 5AVSB 3RVWC 43CAA 1CO1A 4JM2F 3RP1A 3P3UA 4LZKA 3MV7A 1EAPA 1O6TA 3ZL4H 1B6UA 1Y6NR 4G9DB 1T7YA 3LS5L 4AV5A 1HC1A 4UT6A 3DUHA 3LEXB 2UZXB 2UZIH 2A6KA 3NPZB 3QC6X 2WK2A 2F53B 2MQGA 3BPNB 3GBNL 4LL4A 4OKVB 4PRHE 3WNJA 3OKYA 5BRQA 5TK2A 4YFEA 3CCHA 5AB2A 2C1PB 3QHFL 1TZGH 5IVOA 1ULVA 4U6TA 4RBPK 1ZLUK 1ACYL 2Y4SA 2E86A 3F85A 1H15A 2JQMA 3AS2A 4LRNL 1G6RB 2NQDA 3T6XA 5TDPA 4CSPA 2BHUA 1X9QA 3WJJA 1DJYA 4KBPA 4A2DA 4HUWB 5D71H 3C5ZD 4G7SB 1Q9OB 3WELA 3FFDA 1KENH 4BFBD 3MRFB 1I85A 5DFVD 5A2FA 5DI8B 2AV1B 1RMFH 2QZ5A 3PAZA 5IJKC 3T2OA 3B9DA 5L8LB 3PWPA 1YYLH 4UINH 5EOCH 4FNUA 3SODB 1DEDA 3QI9D 2ZKHL 1DJHA 2HH0H 1ACCA 2CKBH 3BC9A 2PF6A 2G2RB 4Y5YC 2QQLL 3MPCA 4XP4L 5SWSE 3ZXAC 1TZHA 3E6FB 3L4UA 3QB7C 1RJLB 4P9HC 4A67A 3O0RL 3HZVB 5LBSA 2VXQA 5D1QB 2QPDB 1NIEA 1A3RL 4OLEA 4ZXBC 1CPUA 1GTFA 1NCOA 3VXPA 3ZZSA 3QXWA 4XBGA 3PWJB 3HCVA 4M7LT 1WTGT 2RFXB 4HMEA 5D8JL 3HPLA 3QQDB 1FNFA 4MHHG 4LPVA 4KXZI 5D72L 4AW7A 1ADWA 1G6RL 3LEYL 5D7SH 2MCMA 4AG4L 3FH5A 5I15H 2P5EB 3IPBA 3MFFB 4ODUB 5F9JA 3GRWH 3D9AH 1YYCA 3ISYA 3V4VB 3PGFH 3NJLA 2ZAGA 1RVFH 4MCNA 1ZV5A 3ES6A 4X42A 3ECBB 3IU3B 5L6YL 4URKA 2NX5D 3OXRA 1M2VB 4Y9CA 1NGZB 4URTB 1YUKB 1OY3B 3WDIA 5FYJD 1UKSA 5GZOA 4JREB 5DJAB 5EDSA 3NIDF 3NZ8A 4QHNB 2BC4A 1Z5LA 3DV4B 1RK0A 3BZFB 4GQ9H 1GR7A 5F0PB 1I7ZB 2DQFA 3ZDWA 4G8GA 2GABA 3ZW3A 1XD0A 3KYOB 4WI7A 3ECVA 4IHOB 5JOPE 2CR0A 2YAHA 4GKSA 2NCMA 4LLDA 3NCEB 1INEH 3PHQB 4JFSA 3GTNA 4ZO6A 3APFA 1GSMA 3B37A 4G6JH 1A5FL 3QDGD 4Z3EA 3ARBB 1F1AA 2A9MH 4KRLB 2ZCLH 4DGVH 5I30H 1CR9H 3B2VH 3MXVL 3QDHA 4IBQA 4YPGA 5HVHC 1CK0L 4IEFA 2L7UA 4D7BA 1SEQL 1MWAB 3MFGB 1KYDA 2N56A 3WTVA 4M5TA 3O45B 2HLAA 2UZPA 3KPOB 4NKMA 3RYMA 3SBQA 1M57B 4KROD 4WO4B 3Q9QA 5TDNB 1QLFA 4XMVA 3VFWA 2VSKB 1LEGA 3PUCA 1Q72L 3LZRA 3Q6FA 4PJDB 2NXZB 3F12B 1QOKA 2R83A 4W9DC 4WEBH 3G6JB 5IHUL 5FS5A 1QBML 5CSZA 3SDYH 1UWEL 3IETA 4QO1A 3CZLA 4OD3L 4MNGB 2NMSA 1RLBA 3B56A 3DGGB 4FXGA 1T20B 4NRYA 4DTGH 1L0XA 4AGLA 4NQSB 3V6ZA 1J86A 4X7SL 4N86A 2BS9A 5EZJB 1G1KA 2J8UA 3RU8L 4I87A 2XG4B 1ECYA 1ZK9A 3DVNA 3VXMD 1K4CB 3MGOA 3PHOA 1F02I 1UC6A 4YO0A 2UV3A 4JO2L 1JZHA 4ANWA 1BVOA 1AJ7H 2E56A 4BZ2A 4TQPA 3MJWA 5ACZA 5CJQL 1CIUA 2DAVA 3B2UC 3ZQXA 1HHJA 3BE1H 5DRZB 4N0FB 5J12B 1K6QL 2AVFA 1ASQA 3MLWL 3PV6B 3P30H 1AE6H 4FI8A 5GHWL 4RGNC 2HFGH 5C7ZA 3EGXA 3NFPB 4LMQI 1XMWA 1WAPA 2WXNA 1HEHC 2GIMA 2E7DA 2JQZA 3ML9A 4R6UA 4Y5VB 3PWLA 1B4JL 4DP5X 2PR4H 1A7QL 2WKLA 4OCSL 4DK6A 3FSZA 4MD4B 2F8VA 2Q7AA 4MTMA 2P49B 1N2RB 4J1UA 4XTRC 4U7KA 3EYUL 2Q9OA 2JCCE 5CN1A 5DQJB 2WQAA 5C0AA 3VI4F 5B7EA 1X9LA 2ED9A 1I1AD 1I53A 2NY1B 2CG9X 1G87A 3DX4A 3HW7A 1R3IL 1KZYA 2J5LB 2NX5E 2XBTA 4ZS7H 4GG6B 5E1QA 1PLBA 2YMXL 5CZVH 4F58H 1MW3A 4UT7L 4K7FB 3U46B 3FQXB 1AD0A 4G1MB 2ETWA 1RUKH 3EOBA 3KPRD 1TJGL 1LDPH 1ZLSL 1HU8A 1GHFL 5HYQA 1SN5A 4UIMB 5IIEB 4GO6B 3TJHD 5JW5B 5JORB 4BXSV 3UPRA 4TN9A 1JHTB 2H47C 4V33A 2DQIL 5JZ7D 4ACPA 2WOBA 4GI6A 4N85A 1S9YA 2H3KA 2XI9A 5FR3A 5HHVH 1LO0L 1OP5H 4NT6A 5F0JB 3HMWL 3BN9C 3LD8B 3ZDXB 1BXUA 3AMLA 3EH4B 3B2DC 3LHAA 3ULAB 3PY9A 1SLWA 1DANT 4R90L 3BZEB 3HR5A 2CIIB 4G6KL 4FXTA 4Z7QF 1WF5A 1AR1B 2XC8A 4PVMA 5JHDB 5F1NB 1D7CA 1E65A 4NQEB 5GS2D 3TWYA 5KVFH 1JZIA 1ADQL 2VDQB 3SPVA 4YSQA 1O7DE 3KYKL 4OZGA 5T3XE 2VIRA 2Z34A 1BGXH 1S7VB 3J8F7 3QUZC 4XBEH 5BV7H 5E8DL 4AUUA 5FYKE 3OGCA 1KCWA 1MCWM 3FXIC 1WE5A 4TQHA 1T5XA 1P6WA 1BZOA 2P47B 1FNSH 1UZ6F 2Z31D 3L7FB 1EO8H 3UYPB 3FMGL 3QCVH 2PN5A 3BX7C 3FU9A 4PVLA 3MREB 3REVA 1GCFA 1SXBA 3H0TA 2FATH 3Q5YA 1E4XI 2HFEB 4H8WH 3S96A 3ZN6A 5FPIA 1HWGB 2XUWA 3IN0A 4QOKE 1OT2A 4TQEL 5LHDA 5CSBA 2Q2EB 1E5UI 6FABL 1TJXA 3D3VD 3DUSA 5GPRA 1UTDA 3JUYA 3QPXL 1T21A 2PO6C 3LRLA 2ZQKA 5BVJB 5IR1A 2GT9A 4L9LC 2WTRB 4FQ1L 2AI0H 3VGBA 2JTYA 1ID2A 1CDCA 3N85H 1XXDC 4NO0A 5HI5C 4A7GF 3FN3A 4NM4L 4IRJC 2F5AL 4MMYB 5BS0B 4X8JA 3RX9A 1BQSA 2GITB 5JA8B 5J89A 1U8OA 2X2HA 5HBBA 2OQJB 3GK8L 1N6QH 4GRMB 4XPFL 1TXKA 2MTPA 5FKPA 3KHOA 3VH8G 3GJFB 2XBZA 3ALXA 3KYMB 5A1AA 3L5WA 3DHMA 5D7IA 1ZSDB 4EBQH 1A9EB 1IVLA 4HGMA 2YFNA 1CLOL 2WXPA 2YK1H 1OSZA 5INDB 1NGYB 3SBWC 4UV4L 4C59B 3VCLB 2C1OB 5B21A 4ALAL 4HOXA 1QQDA 3NCJL 4YXKH 1J5OH 35C8L 3UP6A 4AQ1A 2Y23A 4NP9A 1A6PA 1VADB 2ZE0A 3BAYA 4MMXA 5AWNL 3UG5A 4PU2A 4FJ6A 3TVMA 5IZ7A 4L37B 3L3HA 4LLYA 4BSVA 3KPRE 1CGVA 3MODH 3V0WH 1LWRA 3MX0B 4U1HB 1A3QA 3FCTA 3FU0A 4A6YB 1M71A 4J39A 4GQZA 4JS7A 2A73A 4TVUA 3H2PA 3H42L 3AQDA 3D25A 3JT2A 3QS3A 5E0QA 2JK5B 4Z7UE 3MLRL 4BUQA 2JI3A 4LESA 3AG4B 1MOEA 4MJ6B 1PZUB 2FJHB 2XX1A 2QR0B 5GGVY 5IT2H 4DH2A 4PRDB 1E2VA 3BH9A 2VRQA 3N3EA 3VJ6A 1NCBH 1AQHA 4P2AA 2YD7A 4I2XA 5SWZA 3HE6D 1U58A 3GI9L 3NTCH 2WVTA 4FI7A 3IDGB 4OVUA 1OTSD 2RIKA 5DMKB 1CS6A 4HEPA 4FERA 4PRHB 3QUXB 2XV0A 3HJ0A 3MLUH 4LVOB 4Z6AT 4M4PA 3I50L 5CLYA 3RZCA 2FYYA 5CN2A 2FJFA 4NQDD 1P84J 1S7SB 2XFXB 4KKRA 1ONQB 2W81C 2F5BH 1UVQB 2VDKB 3PIQB 4UV7L 3BSGA 3P3SA 1Z9PA 1IBZA 1J5DA 2IPTH 3LKNA 3E6HB 4KRNA 2UWEA 4TRPL 4JFOA 5GGTL 1F41A 1M3JA 4KI5D 2AAAA 3LKOA 1LLAA 1P4UA 3CLFL 4A6YL 4WI5A 2ICES 3FB8A 1INQB 2ZCKL 2A4CA 3D18B 4R26L 4ES9A 3HAEB 3QISA 1V05A 2A74B 4L4VB 4YSAA 4Q74A 4IRSD 3D3VE 1JDAA 5C7XL 1H3VA 5E23A 1OOWA 4EN3D 3KXFD 5CSGA 5F71A 1RCYA 3I6KB 3V5KB 1ZTXH 2V37A 3V52L 4OM1H 3PE9A 4JO5A 1JGVL 3V6BR 4BHUA 3FF7A 3UERA 3RKPA 1UD5A 5C0EB 2GBTA 2BNUA 4LL1A 1QEWA 1J0HA 1IC5L 3EJZC 4ZX6A 1E6JL 2DI9A 5AW5B 1HDMB 1G94A 3ULSA 5IW6B 3K2UH 1UXLA 4L1LA 4K3GA 4CVUA 1NC4B 3IPFA 2ZUYA 5ANME 1BREA 2XNAA 5DRNA 1JWMA 1QW9A 4HT1H 3L1OL 4P5TC 1URLA 2VDKL 3JTTB 3C60A 3FTSA 2WIMA 4RNRA 2VJ0A 4A2FA 2HFFB 2X89D 2DWTA 3LH2L 3S4SG 4F2ME 5EF3A 1Z32X 2OYPA 3D69B 1C7TA 1FCCA 1KGIA 4HD5A 4OH2A 1GH7A 5CLWA 4ERSH 2QHRH 3KEHA 4N6RA 2QADD 5EN2A 5ICYB 5HXMA 1D9KA 5C3LD 3L5HA 4BZ1H 2VC2H 3OWEA 2VL4A 4HBCH 4I0CC 1AFVL 3X3FL 1DDHB 3JV0A 1CYGA 2VR4A 4NCC2 4MNQB 1ZT1A 2BRRL 3VFOA 3KWWB 3QFJD 3L13A 3TP4A 1HN1A 5DS2A 5I1HH 4G82A 5IMLA 1MFCL 3IVKB 3B3BA 4POZD 5I16A 1OB1A 4JDTH 4N2GA 5KVDH 4AEFA 3KPLB 1AO7E 2BNQD 1LP9A 3PWUB 1WWCA 4MJID 3MRCA 4APXB 2BZ7A 2N0KA 5A2AA 4K3DL 2V3DA 1HEZB 4Y5XB 4AM0B 4MS6A 3STZA 5J6HB 3BYYA 5HJBA 4IRZA 2O61A 1SHXA 3TYGL 4F5CA 3X14B 1N59A 4Y1AD 3SPHA 4Q7DA 1N3NB 4UNTA 5D4HA 1X4ZA 1TNNA 2FX9H 4HJJH 3C08H 1QSZA 3PDOA 4YHYC 5MEQA 4J5VA 2PPFA 2ZKWA 3F7YA 4J28A 1T66D 3FT1A 1UURA 5LG1A 2V9UA 1OAKL 5IW3A 3D4ZA 1YHPA 4QD2E 1Z5YD 4GG8B 4XPAH 2ZSWA 2NUPA 4AUYA 5EZPA 1SDDA 1YEWA 3HB3D 3ZDYF 2IGFL 3QR0A 5D6CA 4NQDE 3JTSA 5F6IC 5ICZA 2GUOA 4FS0A 3DIFB 1QBBA 4FCAA 2B1AH 2PYFA 2CJSA 5D6DA 1FYTA 2OTUB 4Y19A 3INOA 3LQZA 4KDWA 2HMID 5I1IL 1GGBH 3F3HA 4KI5E 1QFWM 1YAIA 3K72A 4XNUL 1TCRA 1MFDH 4O4YH 3D4YA 3FQWA 2W60B 2AK1L 5EB9A 3N1GC 3OKLB 3COOA 2EDLA 4U0RC 2R1XA 2VGLM 2ED7A 4FULA 3ATEA 4J2QA 3QI9B 4NZFA 2GJZB 2X0UA 2VLLB 1DYZA 1MCLA 3M1BB 1FFQA 4XP5H 1JGEA 4DQAA 3ZKNC 5E6YA 2YLHA 4Z95L 3KXFE 2B8OT 1DEEB 4N4YB 5LAXA 3U7WH 1E3FA 3MBEA 5AKRA 2D2CC 5CNHA 3PNRB 4GAJH 1VSCA 3DX9B 3V6OC 1PD0A 2EE9A 2WQVA 4CNIA 1G7QB 3BIKA 1CICD 4JVUA 5FECB 2Y7QA 1G7LB 2V7HB 4LSDA 4PJGF 4PQXA 4TVPD 3VE0A 1TETH 4M62H 1N7MH 3P02A 4XCYB 2R2BA 3OJ2C 1M6OA 1WZMA 2A77L 5B1KA 3VXRA 2HN7A 1X5FA 4YDLC 1W72L 2DM2A 4GW4B 4H8PA 1A25A 5E0FA 4UQ2A 4M1DH 4F8TA 3O6KL 4PUBL 4UQ3A 2XKNB 4CSZA 1ETZB 1TZ8A 2ZOKA 4IOSA 3DJZA 4U1IA 3E3QC 4JDZA 4XN7A 3UO8B 3CVCA 3K6SB 2VL5B 2OMZB 4X5XB 2NX5B 1ZD6A 2QV2A 4H1LB 4Q0XH 5GS1B 3L3KA 4QRRE 2D7NA 3QFJE 5IMOA 3QXAA 3ILQC 2V5TA 3F7LA 1UXWA 3U4BH 5B38G 3A6OA 4L3CB 4OLVL 2VB5A 4YIQB 1KIQB 3OL2A 2R69A 3VFPB 2L7JA 3DIVA 1AGCB 4RDQF 4Z7WB 1ZVSA 1TQCB 3G3LA 2QMKA 1BZ7B 2AJZA 4U6XB 4XGZB 4XMKL 5C3TA 2K4WA 1UOWA 4MJIE 3EO1A 5JIIA 3HG0A 1JSYA 5JHLL 3K91A 2CLRA 2HLFD 3TEWA 2D4FA 3QDGB 3DBXB 5I8KH 4GP5B 1UUSA 3NESA 3BUYA 1KY7A 1A7PL 1R5VB 4TUOB 5IVNA 3KPNA 1DBKL 1EDHA 1QR4A 4P59H 3IWUA 2J44A 3EJCA 1L0PA 4WW2B 3WNIA 4C8XA 3TL5A 1U8QB 4N8CL 4LCUA 4PP1D 4U1LA 2ADJB 2X40A 2H7WA 1AS6A 4KKCD 1Y7VA 1FVDA 3GSWA 3LHPH 5D5ME 3LNEA 2OZNA 4GS7B 4Z7NF 2KQNA 1PEWA 2BP5M 4PWFA 3VDBA 3HJEA 5JTWA 1EQWA 4HIIB 1UJ3B 3OAYH 7PCYA 4N0RA 4LCCA 1PS3A 5AG8A 2ATPB 3MCLL 4J4PC 5LQBL 3W2DL 4U3SB 4U6HB 3U36B 5FYJL 1IM3D 1UATA 4NZUL 5JMOC 1JGUL 4X6DB 4JFWA 2ZJSL 3P9LA 1AQKH 3IJYB 4AGOA 4X4YB 4EZLA 1OCWL 5AOKA 5D1ZI 3OPZH 2GTZB 1X7SA 3GNMH 3GBEA 1NMBL 4RA0C 4G7VL 5CBEA 4AK1A 4IM8A 4YHPB 2XA3A 2IDQA 4QUOA 4ZX4A 4UM8B 4X6BA 1P4LB 3VXMB 5GS0C 1IT9H 2X4SA 1ZHLB 4IHBA 4QRRA 5HGBA 4TNVK 2BS71 1PPIA 1TF4A 3A4AA 3BWAA 4FYQA 4C58B 2TSBA 5KVEE 5DC9B 3QNZB 2E6JA 4JZOA 4U2ZA 3Q2NA 3HI6L 4JO1L 1EEYB 4GJTB 3UCQA 5F7AA 3LIZL 4A2MA 2G75B 5DJDA 1KPUB 4MAYA 4LVNB 2B1OA 2ENYA 3VXUD 1RLWA 4JDVA 4TVPE 1OAJA 2RBLA 5D7KD 4LHUG 2Z64C 1U3HD 5EFIA 2I7OA 2BCKB 3S37H 1F3DJ 4JRYD 3WKMH 1FFTB 2AC0A 1FV1B 5I76A 1I3RA 2YD0A 1AXSB 2H0FA 2HG0A 4I18B 4E9LA 5T3ZH 3GSOB 4WTZA 5KG9B 4KQ3L 2BP8B 1NGWB 3D8MA 4F93B 4JY6B 2FB4L 3FT0A 1E9PA 1FL5A 1WT5C 3FRPG 3GIVB 3OZKA 4QT5A 4AGPA 1R5WA 2P80A 4EIGB 3O8XC 4F33B 2H6UA 1UADC 1RP9A 2PCFA 2E9JA 5IY5B 1RZGA 5AYUH 2NY6C 3O6LL 3IGFA 1I1FA 2HRLA 3UO1L 4DW2H 5EO9B 3RKDC 1A7OL 1PU0A 1ZHNB 4P5KB 4EPSA 1ZS2A 3KPRB 2VZ3A 3WXVL 1F6LL 5EORL 3VWKA 5C6PB 4JFEA 1SDAB 1U2CA 3NN8B 3OQ3B 2IO5A 5I1DA 3HNSL 1TLKA 4M48H 3WUZA 1RUAH 4LDLB 3RX5A 8CGTA 5HJ3A 3C8HA 5JDJA 4DVRL 3Q2LA 1V8HA 1NC2A 2AANA 3I3BA 4S1RL 5KEZA 1QFWL 3BDXA 2WVSA 4OZFG 5CGBA 2YPVL 2FX7H 3KCPB 2B2XL 4FQCH 2YIHA 2KDYA 4DP4X 4IU3A 1ZT7B 4N8VG 1ZXQA 1E5CA 4LSVL 4LRIC 4JG1H 3QJHB 4X8CA 3KLDA 3CXHK 4MQ7B 1DVYA 1MJ8L 2WIIB 4TNGA 3TNMB 2WQUA 4IJ3B 2CHNA 5F6HI 1C7SA 1MIEL 4JQXC 3VYOA 5ID0B 1PG7L 4P2OA 3RI5K 1J9RA 1RPKA 2AQQA 2D03L 3DVFA 2GJ6A 4TULL 5L2JA 2Z31B 2ZOLB 2WWKO 3SQOL 3DRTA 4Y4KA 3P54A 3DBSA 2H26A 4LNVA 4TL4A 5DD0L 5M7QA 4Y9FA 5F9AC 1T4KB 4WUUA 4NI6A 3FC8A 4MA1B 2ZUQC 4XO8A 1NUNB 3RA7L 3LZPA 5IQLA 2ZWSA 1KEGH 3MACH 4OFPA 5DC2A 3GI8L 4PJ9A 2NTFB 2OR8A 2PW2A 4Q89A 3G6DH 1CZ8H 1MLBA 3UADA 5B8CC 1G7HA 4LCVA 2E7HA 5GRUL 4LLQB 3BPOC 1JZ8A 3FZUC 4JFDD 4NXSA 3AQZA 3CVHH 5GIRB 3FQ4A 4X0KB 4P2RA 4WI4A 2CKNA 5TGBB 3QZBA 1JNHA 2CJUH 2VUOA 5E5MB 2A9DA 2CO6A 3BUPA 1OSPH 2XWZA 4PS3A 4WAFA 4ZD3H 3Q2WA 3UZQA 1NAMB 3LJ3A 1XGZA 4QXVA 3A4EA 2JIXA 5BO0D 4F20A 2W0KA 4M43L 4RLDA 3DJTA 4PRID 1JV5A 1EHXA 4I0PD 2Q86A 4PJAF 1I3VA 4BQ8A 3CHQA 5F1OB 1RZ8A 4JRYE 1AVAA 3WFZA 1JYWA 3NBNA 4FGMA 2R4SH 4F2MB 2FD6L 4JFVA 4XPTL 4YDJB 3U0PB 3L3GA 4C56A 2JELL 1OD9A 3FCGA 1U8IB 3F5WA 2CD0A 4FA8A 2ADFL 4N2LA 3HBGA 2ADGB 1EVTC 1KLUA 1QLRA 3A6CL 3L81A 5ICXB 2YRLA 3MMEB 3VFMB 2P43B 3UC0H 1F2XK 4KHTH 1NFIB 4G7RB 3BQVA 5MEOB 3GSXB 1J0KA 1V3LA 4ZMXA 3EKCA 3LEXA 2UZXA 3RGVB 3IDIA 1UYWH 3EJYC 4KNSA 4LK4A 5IHBA 3RFZA 5C0IB 4HWEL 4OKVA 4HD9A 4RGND 2CBOA 2C1PA 5I1JH 2CGYA 5IUCA 3MGTA 4N9OB 4X9BA 4MB5A 4Z78B 1DQJA 1SUHA 4FNLH 5F97E 5KSAC 2V9QA 2KZKA 5IWLA 1PKQA 3ROLB 4AJWA 5E99H 4MFHA 4R96B 4AQOA 3JWNC 3KPSD 1E2WA 3OG6B 5C3IA 4HUWA 4HJTA 4XTRD 5IB1A 4GXVH 3DXAA 4PS4H 2OX5B 1FIGL 1Q9OA 2H1PH 1EBAA 3RWFB 1R24B 1THCA 2R8SL 1HT6A 4PTUA 4YSRA 4U1GC 3K8MA 3D30A 3HE6B 1IEBB 3P4MB 4BK5C 1KCLA 5T5FL 1ODAA 1OPGL 2L3BA 3HC0B 1IQWH 4ZOAA 1QPPA 5KTEH 2JJTA 4E5XB 2G2RA 4BBWA 3MO1B 3E6FA 5DQ9B 4YE4H 4PBDA 4NN5C 1CVRA 3HZVA 4D0DB 3VM7A 4JM2D 5T1KD 1R3JA 5D1QA 1RJYB 5CCHE 2IDFA 4LOUC 4HJEA 1VGKA 3S35L 4OCWH 4WI3A 5DMJB 3DHJA 5DMGC 1LK3H 1QUNB 4XNAA 3KS0H 1BQUA 3PWJA 4PB0H 4F7KA 2XY2A 3HG3A 1CLZL 2L7QA 4KK6C 1FZJB 5IBTH 2AEOA 4ZXBA 4L8SB 4HS3A 2P5EA 3MFFA 4IRSB 4FLQA 4WSJA 4N0UB 3IDMB 4IDJH 4EN3B 3KXFB 4M7JH 1XX9C 4HU8A 1CFSB 5K59E 2PNDA 3E1F1 4Z3FA 3ZRCC 3PF2A 3P2TA 4JFDE 4F27A 4OZIE 4JQIL 2C3WA 4N9GB 5AB1A 3HS0C 1ZVYA 2OULB 3NK3A 4L3AA 3TJEL 2VE6B 5IVXA 1M2VA 5I1CL 1MHEB 1CFQB 3IDUA 4OGXH 3GTVA 4LHUD 1H5BC 2DQHL 2FBJH 1MNNA 2CBTA 4QHNA 1KXHA 2XZAL 5DJZB 4ONOA 1O9ZA 3WAKA 5B7FA 3O6FC 2ZCHL 3DHPA 3BZFA 1A3LH 3U2IA 3JWOC 1L4IA 3QQ3B 3VB9A 1J8HA 3KYOA 5D2LE 1MF2L 1P5VB 2AJUH 2GB2A 2L4OA 5IEKB 2ZXBA 2PO6D 3HS8A 3PHQA 3SCMC 4TSAH 2Y36H 4KAQL 2QADB 1L0QA 4K8RD 4OD1L 4K94L 4CGTA 5LJYH 2Y2TA 3VU1A 1QA9B 2X0WA 4CDGC 3C5SB 2CUMA 2J57A 5JW3L 1JWUB 3KGRA 4X50A 5KUMA 3O45A 3BJ91 4OGAC 4UILH 3KPOA 2VLRB 3QFJB 1LGVA 3LZNA 3QIBD 5TDNA 4RGNE 4PY7B 5G2NA 4OF0A 1OE1A 2O6FA 4AMWA 5C0RL 3Q7JA 5DJ2A 5C09D 1PLGL 2G5BB 3F12A 1KNOB 1I8LC 3L3DA 3BAXA 4PJDA 5TJWK 2BNQB 1TLMA 4MJIB 3DMMC 1HL5A 3PAVA 3KPSE 4LGPB 1FYHB 3WFDH 3IDYC 4J6IA 3VO0A 1W16A 3C6EA 2FEDD 1E3ZA 3CHPA 4KRMB 2X4QA 3QXUA 1GGCL 4XXWC 4Y1AB 4ZSOE 5KZCD 2O6EA 2YEVB 3RDTC 3T3ME 3SE8H 4K3HA 4RGMB 3ATBA 1GS7A 5EZJA 4PJ7A 3SGEH 2HX9A 2XG4A 3LNHA 3HMXL 2CK0H 3N1PC 4MNHA 5D5MB 4QF1B 1OM3H 3RHWK 3ZE1F 1I82A 1JWSB 3HB3B 3WNMA 1C5CL 2DIJA 4O5LH 3NIFE 4ZNCD 2V3EA 1JYXA 3X13A 1MJ7H 1F18A 1N64H 4PGCA 3JWOL 4UDTB 3WDHA 1B0GB 2BFVH 2MCAA 2Z4TA 4JRLA 1PZBA 3U48A 3D39D 1PIGA 3JWDH 1Z3RA 1NA8A 4KJWC 4N0FA 4XPGH 2YD3A 1I3UA 5CCKH 2CGRH 2R29H 3OWRA 1UOLA 4H40A 3X3GL 3I9GL 1SXZA 4A55A 4O02H 1XGUB 4KKNA 3NFPA 4K5OA 4MAUL 5DO2C 4HIJA 5IVZB 3K1DA 3AMKA 2VW4A 2VM4A 3ESVF 1X6NA 3QP3A 1DO5A 1RUMH 3RNQA 4ZFGH 1EZLA 3MXWH 2VMJA 1NWOA 5I2IB 5CHNB 5K39A 4Q9RH 2MHAB 3FT2A 3VXQB 4AGMA 5C07B 2DTMH 3BD4A 5DHVH 1QFHA 3FNKA 5EWIL 1TCMA 5AYTA 1AC0A 1ADQA 1TUPA 4HWBH 4N1EA 1GS6X 1P69B 2Z1PA 3FONB 2VUKA 1D5BB 3BIBX 4B9GA 2HX7A 3QG7H 3QDME 5FM8A 4GG6A 3V6FB 3BVNA 3VH8B 3QXVA 1BFVH 3ZBMA 3U46A 4E0RB 4ZSOA 4KK9C 1N4XH 4MMZC 5D70L 3BWUC 2EDMA 2GKIA 3EO9L 5B3NA 1VCBC 1P6FA 4RRPM 4HJ0C 4UIMA 1NIFA 3THMH 5I5JA 2FVNA 4PCYA 3WJMB 5JW5A 4QTIL 2IG2L 5JORA 5CEYB 1AQMA 1JHTA 5HDBF 1OAUL 3WTYA 1LO2H 5AKTA 5MP6H 5J1SC 3V5HA 3QWOB 4HPOH 3T0AA 1J5HA 1HS6A 4ZMNA 5JPNC 3T4AB 2FZ3B 3MUGB 1Q4NX 1BVKA 4JEGB 4XN2A 2M8XA 4J6RL 2R0WL 1KGXA 3PXJA 5EO0A 5E08H 2DQUH 2ZUWA 3BZEA 4TPRL 2YGOA 4ONGL 1ZT4B 3ZRSA 2AV7A 4EI5B 2W0PA 3N40F 4P07A 5JHDA 4FI6A 2KPNA 2X0VA 4NQEA 3FN0H 3G08B 3S5LG 5EIIG 1XB3A 1Z0MA 4K5NA 5C09E 5E2WH 3WFBL 3GKWH 4U7MA 2CO4A 2FAUA 2Z8SA 3UZVA 2Q87A 4BE5A 2EDXA 4ZODA 2WW8A 3T8XB 4JUSA 2OBGA 5I8OH 4M6OH 3QEQD 3L7FA 5DUPH 3UYPA 3ZDZF 4P99A 3G9VA 3MREA 2CK2A 4OLXL 2WBKA 1HINL 4S1SH 5HGDA 3U1PA 4AE0A 1OAXH 4ICWA 4HUVA 3UBXG 1MCIA 2E27H 4YSDA 3ABMB 5KJ4A 4YDKH 3LEVH 1QSFD 5E70A 4GNKB 3FO9A 1QKZL 2IADB 4N26A 5B1AB 5L88H 3H3PH 2CPUA 2WTRA 3IMTA 5DQDL 1AQDB 4KY2A 3HG1A 4KTEL 1XSIA 4PP2B 4DKDC 4LSSH 4ZNEE 2QLYA 1DJZA 1E8WA 2IPUG 3TCLB 1U4FA 1JIBA 3OQRA 5IOKA 4MMYA 4OF5A 5BS0A 1IM3B 2DQCL 4N3TA 5I73C 2OQJA 1GY2A 1X5HA 3K2KA 1EJ6A 1RK7A 3P4LA 4NDMA 1MDTA 3UTZB 2V8LA 4IKLA 4YFLF 5E8NA 1BQKA 4RH4A 3HKFA 1EEQA 3D85D 5J13C 4YHLH 3BH4A 3OV6A 3PRZA 4IRJA 4BRJA 1LE9B 3IJ7A 4LKXB 1DANU 1OLZA 3FN9A 3SYQA 1B4RA 4NWUL 4I7ZC 1A9EA 3ZGHA 1FLTX 3BUIA 1DBAH 4ZBJA 4NZTL 1GZQB 4BWUA 3UDWA 3L9EA 3B2XA 4UAOB 4OVVA 2IH8A 1WD8A 4PJ6A 1MRFL 4GKZA 4P5RA 4OCMC 2MKWA 2K6ZA 3DVGB 5CEZD 3ZKQD 3HI5H 2Z1KA 3TBVA 2XTSA 3SBWA 3VXUB 3X1EA 1OARL 3LPGA 4L37A 2H2PD 1B0RB 1ZDQA 3B1UA 3L4WA 3D09A 2AKRA 2D0GA 3WUWG 3C9NA 4U1HA 3MX0A 3CXDL 2BERA 3D5OF 4A6YA 1U3HB 1AXIB 2CM6A 3DLQR 2JWYA 5HY9B 1IV8A 1CCZA 4UNUA 3WEXB 4MJ6A 2AGJH 3CPLB 5AQ0A 1IGIH 1S5HB 4E68A 1CI3M 2Y6SC 3ZHDA 3ARRA 2P9RA 43C9A 4CU8A 2F19L 4JFPA 3VACA 5CP7B 3BW9B 5F7FA 3EDEA 3QO0A 1U6AH 2G9KA 1QYGH 4XOBA 1F11B 2LT9A 2QVKA 5DMKA 2NXYC 2RCSH 1VFMA 3QUXA 4KTDL 2I69A 1CD8A 4PJCB 3GIZL 3VTTA 1KXTB 2EQDA 4JFYB 4BGLA 4HG4J 2NLJB 1ICTA 3O2VH 4HZLB 3UGXA 1N70A 1S7SA 1JK9A 2XFXA 4CVZB 1B4LA 4O9HL 2H2SC 1UVQA 3BKCL 4HAGA 4ACTA 2HVJB 5ITBL 4TUKH 1RULH 1F5WA 4W9GC 4ZMAT 3QEQE 3U30C 3WJLA 2J6EL 3UX9B 1AKJB 1HQRB 4K71C 5T1MB 1WC7B 5KW9L 1FPTH 3CZGA 2NRDA 4RMSA 2P26A 3HG2A 1W8OA 2B1HH 3A47A 2F9BT 2I5YH 1FZMA 4YEEA 4N68A 5AW0B 1NMCB 3L45A 4LF3A 4RVBA 1TQBB 4OU3A 3HAEA 1UJTA 3NP4A 1EAOA 1CGSH 2B20A 3BEVA 3LXAA 1NJ9A 4KJQC 4L4VA 3KLHC 1QSFE 5F9OH 3R1GH 1MFAL 3LPWA 4N3UA 3RJQB 5KWYC 2OLDA 4HA1A 3ILQD 4JHUA 2R15A 2ENPA 5K9JL 1PY0A 3M7OA 1MW0A 3I6KA 3V5KA 5A2KH 3L2NA 1MEXL 1XR9A 1MIML 5ITFB 3IMVA 3JVGC 2CPCA 4RMBA 5C0EA 3BZDA 1YAZA 3NT0A 1PL3A 4HF5L 1HDMA 4GYBA 4AENA 2AABL 5IW6A 2NW3B 2CO7A 1NBYB 1NC4A 1R0AL 4K3JL 4IBWA 3JWNG 5DU7A 3EF7A 1MCWW 3OG4B 4EXKA 4WNQB 1SBSH 4PBVC 4XCNB 3WHXB 3DURA 3JTTA 2FQDA 3HI1B 1VACB 1YEJL 3WFEL 2JJSC 3S97C 4EEEA 4OTXL 2XU9A 4KKLC 3N40P 3D69A 3QZOA 1M7XA 4KVNH 3CN0A 4OV6F 5ICYA 3IM1A 4LGRB 4GMTL 1UM4L 5I8EA 2G3ZA 4JFDB 4QJ4B 5D96C 2WQWA 1DDHA 3UFIA 3IRPX 5I0XA 4NQXB 4WI0A 2QSVA 4YC2B 5CEZE 1FRGH 5EOCJ 4EIZC 2OI9B 2Q7NA 4MNQA 2MPAL 3JV4A 5E5LA 5AVRB 1K72A 1NAKH 1THAA 4OIIL 1QASA 3TEZA 3UBHA 5DR5L 3BSZL 3TIDA 1W91A 1YNTA 4PRIB 4I0PB 5L9DH 3FSOA 5KYXA 1ZTXE 2CUIA 4QHLB 4B7LA 2MH4A 2OZ4H 2NY5H 3ZL4L 4NCDA 4PJXA 2B77A 3KGSA 3LDBC 2F54B 4AM0A 4Y5XA 1G0XA 1C8QA 2UZIL 5FHAH 2YZ8A 4KY1H 5J6HA 1AQ8A 3HHMA 1KCVH 3MJ7B 5EUOE 5KVMC 1DN2A 4IGBC 4ZMQA 4L0ZA 1ZANH 2PP8A 1JK8B 4F8QA 1N3NA 4FF9A 2XFGB 2D8KA 1HYSC 1TZGL 3H85A 4DCQB 4OD2B 5HVGB 3RUGE 5B38B 2P4AB 4FFYH 4K9EH 1S9XB 3AGWA 1S9WB 3V6OE 5E1AB 4LDEB 5KBKA 4GG8A 5AYQA 2D7OA 4CJ0A 1KENL 3MN8A 4OJFH 3CBJB 4YSPA 1U2HA 3GKZA 3DIFA 3L9RB 2VOTA 1RMFL 3FUEA 1I8MB 2EVIA 4GMSH 1KB9J 1W72A 4LAJH 5CCGE 1YYLL 4UINL 2OTUA 2QPUA 1UH2A 4W81A 5EOCL 4MJ2A 1IKNA 1O6VA 3NEOA 2LLLA 1Y07A 2HWZH 2R2CA 3S35X 1TO5A 3ZT7A 4EQ3A 5ABDE 1A64A 2G3XA 4P2YA 2HH0L 4PHXA 4F8LA 2CKBL 1FI8C 1Q0YH 4M7ZB 5DHDA 2W60A 3X1FA 4WWKD 5D7HA 2DQMA 5LGYA 4POUB 2Y0SA 3QIWC 3T5WA 5KVDE 3Q2VA 2EYSB 4E36A 2ZP8A 2VLLA 1X5MA 3MOBH 5J8OA 2X70B 3M1BA 1KUMA 1P9MC 3K6DA 5ALCH 3NIFB 3ZHNA 1NMAH 1DEEA 2IJ0C 2XQYK 1J88A 3FQ2A 3QQ9D 2QKIC 4JM2B 5KS9F 3LZFH 2UXGA 2K8MA 1U93B 2XV2A 1T1WA 3DX9A 4B95C 4JFXB 1G7QA 3S98A 5I15L 1GJWA 2EKJA 4HCGA 4PJ8D 3GRWL 5JHLA 3D9AL 4HKBB 1JNLH 2X2JA 2V7HA 3PGFL 2IQAB 1I9RL 1E5AA 1USZA 1C8PA 1XD1A 4NPJA 4DF9A 4QXUH 4I48B 1RVFL 4KTYA 2WLIB 1XZWA 2D0FA 3ZL1A 1JZ4A 3N9GH 2UXTA 3BH8B 2QFPA 4UQIM 4P46D 4PHZA 1YEIH 1AP2B 2FDBP 4PWIA 4MCYB 3EAKA 5E95B 1L3WA 1IRAY 3FRUB 1UCBH 3P0YH 4TS6A 3F7PC 4N8UA 2WUBH 1ETZA 3ASNB 3HN3A 2KDGA 5KJ7E 4XPHH 1BYOA 5DVNA 4OJDH 5DHYB 2VL5A 2OMZA 4GQ9L 3QPKA 5ESAB 5EBMB 1HWWA 5GS1A 3IJ8A 4LHUB 2P8MB 5BO1H 1MW1A 1KTJA 1V7MH 1KGWA 1XZ0B 3DX8A 1INEL 3K71A 3MJ9L 3MGAA 4L3CA 4JFQA 4HLZG 2X4UB 1KIQA 2A9ML 4I1NB 4MD0B 5CMAA 2F8OA 2ZCLL 3VFPA 4DGVL 3B2VL 5I30L 4Z7WA 5F3HB 1QBLH 3CNKA 2CRYA 1BZ7A 4JFFB 3FRPB 4XGZA 1UEYA 2MNUA 2GJRA 2GVYA 3EW3B 4WU5B 4FL4C 4ODWB 3I2CH 3NAAH 3QDGA 3AG3B 1Z9SB 3DBXA 3IEAA 1WICA 1AGDB 3Q5OA 5E9NA 5A2CA 2NY4C 3LIZA 4NBYB 2VITB 3NDYE 4WEBL 3H55A 3EYVB 3VFGH 5ESVB 5H35A 3SDYL 4QEGA 2YXMA 4RQQB 1S78C 3NEEA 3QIBB 3GHPA 4M02A 3OR7B 2NNCA 2JKXA 2FWUA 3EJQA 4N5EC 3DJRA 4DTGL 5C09B 3D05A 4WCYH 2BVTA 1KJMB 2VABB 2W92A 4IOIA 4ESKA 3FQNB 3NSDA 4U3SA 2NY7H 4OZFB 3D33A 3UAEA 4U6HA 3W11C 2E7BA 3HUJA 2WGXA 1ZS8B 4M7LH 4GBXD 4N8VB 4X6DA 3L16A 3BSHA 2FCBA 4Q6KA 4X4YA 3VD1A 2V7NA 4FG6C 3FT3B 4OM0H 3NIDB 1AJ7L 1Y0LA 5A2JH 4J4PA 1T7ZA 5J1TC 2PYEA 4IMLB 4XODA 2GK0A 4CU6A 4YHPA 4UZSA 4UM8A 3VXMA 1P4LA 3BE1L 1ZHLA 5AUMB 1A14H 3EJRA 1N26A 5KBPA 4OFVA 2NY2B 4XPBH 3P30L 3QNZA 1AE6L 4JY4B 4ZPVB 1NIDA 1XH0A 5H37H 3S36H 2HFGL 4YAQB 2WJ7A 4WJG3 2ZOOA 4HUXB 1EEYA 3X1GA 5F3BB 1DJGA 3D39B 1ZLWK 1L7IH 3HZ3A 4NS0A 3S5YA 2PR4L 4G72B 4JJOA 2XYBA 4XXCC 2G75A 5BV7C 3HKZA 3PFUA 4K07A 1X7TA 5EN2B 2AXFB 3K1KC 4WO0A 2VDLH 2YPVA 4JPWH 4PJIE 1UKQA 2ERJC 4YBHA 5GGRY 4BHUI 2N1TE 1IGCH 4BKLB 1TT6A 3V95A 5GQBA 5IQ9A 3OPUA 1FV1A 4GSRA 4JAMA 4Q9BA 3HLAB 2R1YB 3UJTH 4ZS7L 1MAMH 2VJ8A 1MH5B 4F58L 5CZVL 5I75C 3ULUF 3FHAA 2BSDA 1NGWA 1KGCE 2FQGA 2A83A 1RUKL 3G5XB 4JY6A 1CQKA 1N0LB 4R4FH 4Q6YA 3ZLQC 1HL4A 1HSAB 2XN1A 1LDPL 5JIDA 4O58H 2BSSA 1JVLA 4X99B 1JPGB 4YHIB 3MVSA 5GRYA 2B3RA 4U6YB 2D7TL 4P3CH 4AYID 2CHXA 4Y0GA 5LNDA 2O5ZH 5EO9A 1G5GA 1ZHNA 3II2A 3QW9A 1FGVH 4R0LB 5DD3H 2VKXA 3CLEH 4CUCA 3BGMB 2YKLL 4MJJA 1Z0NA 2VDPH 3P40A 5FM5M 4WNJA 5HHVL 3EXLA 1RAMA 1QO3B 1YVLA 1V3MA 2M26A 3NN8A 3RWJA 3WCYA 2QLVB 1KACB 3MJGX 4JO3H 4LCWD 4QAMB 3ASOB 4YX2H 1JF1B 2QPSA 4FKKA 1PZSA 1Z9OA 4LE8A 5DVPA 4KV5F 1QVOB 1R3HB 2VZUA 1GZHC 4JQVC 1HHGB 1Z9LA 1Q9KA 3PV7A 1W8EA 1OTTD 1BYNA 2VRKA 5KVFL 2DPKA 3CV5A 3KCPA 2BHYA 1MAJA 2LAAA 5GGRA 3L4VA 1BGXL 1FFNB 4XBEL 4GLRH 2D31B 1J18A 1QTSA 4JMXA 4BQ9A 4C47A 3QJHA 2K6YA 3C6LD 3MV11 3GLDA 1FNSL 5DZLA 4W70A 5FKAB 1VZHA 3VD9A 1EO8L 2XN9D 3QCVL 2QQNH 4KITB 3WN5C 1PZ2A 4H8WL 2FATL 1Q94B 2OMTB 1IAII 4Y4HC 3AWGA 2WM0A 4LRIA 5D1ZC 5HDLA 3VI4B 1S3KH 1T7XA 2WAQA 1PYWB 4LCIH 4UNIA 5JUEH 3O3BB 1LO5A 3MRQA 1XL4A 2JKRM 4EIBA 2ZOLA 4E9SA 5F89A 2V5SA 4X9IA 1GJUA 4XB7A 1CGWA 2RALA 1XR8B 1A6UH 2VDOH 4KXDA 1AR2A 2EINB 2WLYA 2K7QA 4Z23A 5DUMH 1T0OA 3LPPA 2AI0L 5DJCB 3RVXC 2ZT9C 4X6CF 3GUFA 3N85L 3BQUD 1QSFB 2A7BA 3AITA 3BI9X 3P4OB 4Z3IA 5L8JB 4OGAD 2CDEB 2CR3A 4L4TA 1XH1A 1UXSB 2DEWX 5LXGH 2GBVA 2WKOA 1N6QL 1L3NA 1RZKH 4LLQA 1VIWA 3T65B 4AZUA 4M1GH 4E9RA 5AW2B 5KOVC 4M61A 4X0KA 5TGBA 4NQUA 3LYRA 3JWNE 2E74C 3VQMA 5B8CA 4EBQL 5FK9B 4NWTH 5EIQA 5GGQH 1KXQA 2YK1L 1CBVL 5DUBB 1IJ9A 5GSVB 4TQ8A 4HHAB 4OF7A 3D85B 3SDXA 4ZFOL 4KQ0A 3V8OA 3RDTD 3W9DB 2FWLB 2KLRA 1L9TA 3I84A 1L9NA 4AM0Q 2NDFA 4YXKL 5ABAA 4YHYB 1X3DA 1J5OL 1FFOA 3TTSA 3F84A 4QRTB 2VISB 3QAZB 1AANA 4GO8A 3OKDB 2PWGA 1C1EH 1NCHA 1ANUA 3O11B 5CWSA 1IILE 3ULUH 4PGBB 4F9PC 5T1LD 2ADGA 3I75A 4KK5D 2JKLA 3V0JA 3WEBA 1F4XH 1UEMA 3MODL 4YBLC 3MMEA 1EXUB 4KO7A 2DQGH 3V0WL 1CE6A 3WTXA 2ZX9A 3ZO9A 4L2YA 5CLXA 5MEOA 1P5UC 3VD3A 4DOHE 3GSXA 4KKBD 3KLAB 3CSBA 4KU1A 3RGVA 5EO1B 1ET7A 5LKNA 1A1MB 4GSQA 3NDZE 2A6JB 4C4BA 4LHJB 4OGQC 3TBCA 1ZLVK 1SLUA 4A37A 1FL3A 5E00A 2R51A 1HYRC 5IT2L 4NNYB 2VMFA 2AQPA 1U4EA 2C3HA 5CM1A 3ROLA 4LCWE 2CUAA 4JZJA 1NCBL 4R96A 2WZ5A 2JXMB 4FLSA 3DX3A 3ZU8A 1XF1A 4F15B 3FHQA 2VXUH 4E9VA 5HHQA 3NTCL 2XETA 3U79A 3FUNA 4WK2B 3US9A 4P49A 5E4EC 2P5PA 1S5IH 2OX5A 1NBCA 1SDYA 3B2MA 3MRJB 1WDAA 2Q20A 4JLRA 3CDZA 4PJFA 1R24A 3MLUL 3RWFA 5BRZA 2IGTA 2Y25A 3OKKB 1NPJA 5ILTH 2R0LH 2YA0A 1ITCA 2ZZUT 3NZHH 4HGWB 4JQIA 1MHCA 2F5BL 3P4MA 5F7MC 3HRZB 3OLGA 3V4PH 3IFLH 5T5NF 2WYTA 3V4VH 4M4RB 2IPTL 5EZLB 4KX9A 1DN0A 1M05B 1BZDA 3HC0A 4MQSB 4KI1A 4KK9D 5FYJU 4KZCA 2XN9E 4E5XA 1RIVH 3LKSA 1ZGLM 3WNOA 4HJ0D 1DTUA 5DQ9A 3NK4A 3PQYD 4MXWL 2VC2B 4D0DA 4UTAH 5F2FA 3S3SA 4PR5B 4PW3A 2ZWLT 3MNWB 4DERA 2P8LA 1AH1A 5ALBH 2BP3A 3U2SB 4FQHA 2ZXQA 2W9EH 2YA1A 4JM4H 4OAWA 4UWQB 2C4FT 1ZTXL 2EZ0C 5B3JE 2J5WA 1FZJA 1UXMA 2EIJB 2DWEB 2OMVA 4OM1L 1A6WH 1DJWA 2XVKA 4L8SA 4IRSA 3TN0D 1MCPH 5DRXB 4FMFA 4N0UA 4LOVA 3IDMA 3SPJA 2VXVH 5HPMB 4EN3A 3DDGA 4WKZA 2FK9A 4JFHD 4RFNC 3K2UL 3SGDH 2X3CA 1I4FB 3J7HA 3EHBD 3KPQA 4CGUB 1WAAA 4HK3J 4M3HA 3K8KA 1MWAH 4V1DA 3T0XA 3OC8A 4HT1L 3TA3D 1X5XA 4FQLH 5KOMC 2G4GA 4PLKC 1MHEA 1CFQA 4X7FC 3VYPA 1WIPA 5EH1A 2ZYSA 3DGDA 1MCOH 4JKKA 3CSPA 5I18H 4HIQA 5DJZA 4CBZA 1FIEA 3W82A 4ERSL 2IMNA 1UWXH 2QHRL 2XQBH 4KOBA 5HYJD 3C2AH 1R5IA 4F7MB 4BZ1L 3M46A 2VC2L 3QQ3A 4HBCL 2R7EB 2X89A 3HMXA 3BHBB 3P73B 1EEZB 1P5VA 2FJSA 2K70A 5IEKA 4M6AA 1KJ3H 4YDZA 1MZZA 2HJLB 3O6FA 4Y4FD 1TFPA 3NPSC 4LPUA 5EBGA 2BIIA 2Q5BA 4PCKA 5I1HL 4H0HB 4PWJA 3UC2A 3SO3C 1QA9A 4JDTL 3UAJC 5TH2A 2V33A 2ZXEB 1GYAA 4MD5B 2P5WD 5IG7B 5F7NC 4ELMF 4G6FD 2YQ2A 3SCMA 5HDOA 1MVUB 2VLRA 1IM9D 3VG0H 2LABA 4C55A 2ILLA 3V0DA 3QULA 4PY7A 1TZIB 5HGHB 4QRQB 5DHXB 1D5MB 4Z8FH 1KNOA 3VSUA 1RZQA 2BNQA 4K7PH 4ONHA 4B9IA 1DUYB 4HJJL 3C08L 5D1XC 1OF2A 3FU3A 2VQ1B 3RNKB 4JFZH 3WL9B 5DTFB 5C0JA 3VMOA 1GZPA 4I4WB 2HKAA 3ZZQA 4XPAL 4Y1AA 1ZGLP 1U8LB 3GUTB 3QA3B 3O3DB 1YMHB 3DMMA 5DEJA 2N4IA 5AOLA 4G43B 3O2WH 1YYML 2ZYHA 4OCLC 3T6VA 2CALA 4PJAE 2HLEB 3EYFB 2B1AL 3QJTB 3S5LB 1E30A 1EV2E 1J05B 1JPST 1ILUA 2DL9A 3C8KB 5E2TH 4K5LA 1E50A 4XXWA 1LDSA 1TFHA 1KBGH 3S88H 5AEAA 1VPOH 3O3EB 3QYMA 1MJUH 1ZHBB 1T22A 2G4EA 1AGFB 1CN4A 3P9MB 1MFDL 4HH8A 4O4YL 3PQYE 2YS4A 2AK4A 4HJIA 4S2SB 3DV6B 1J8KA 3GMOB 4Q9QH 4ZW3A 2WINB 2D3NA 3U0TB 1QSEB 2V0AA 2X3BA 2IALA 3MI6A 3GHEH 1XGUA 1G9NC 3PPSA 4XP5L 3PABB 5IVZA 3K6NA 4PV9B 3ABLB 3IKCA 4WWKB 3U7WL 4NIYE 1XSOA 3F65A 3DJ9A 5E6IC 2UZYB 4AJYV 4GAJL 3ARZA 5CHNA 4R7NB 4A7TA 2MHAA 2IQ9H 2NXYD 5F70A 5C08D 3VXQA 4WNSA 5C07A 2BVOB 4LQFH 2EIZB 3D7PA 3W38A 3DPBB 4JPSA 2DH2A 4QNPE 4W68A 4RMUA 1TETL 1EO5A 4M62L 1N7ML 1JNJA 3FONA 3CE1A 1D5BA 1G6VK 1FE8H 1R6VA 5HP5A 5EZIH 4QAWA 3L5JA 4UU9B 5KYUA 1SN0A 3VFSB 1RZJC 4M56A 4PJ8B 4E0RA 2VDQH 4M1DL 1BF2A 2ZX7A 4I5BA 1LO3H 4HK0B 5FFLA 1PZAA 2BVYA 4MZRA 3TFBA 4HOWA 2AQ2A 4Q9CA 1QWUA 3WJMA 1TQUA 1KBKA 1QW8A 5CEYA 4DFIA 2IMMA 5CGYC 4P46B 3EJPA 3I85A 5F7UA 2QGBA 4KJQD 1AG0A 1SUJA 3EO0B 5DFWH 1CFTA 3KYAA 4NSKA 4CU7A 4Q0XL 1EHNA 3T4AA 3R7RA 3MUGA 1F8TL 9CGTA 1J48A 1FNAA 4FZEH 4UF7C 3U4BL 4LMQE 3O3AA 3WUWB 5EF2A 3VG9B 3NVQA 3L4XA 3SKMB 1C5BH 4L8BA 1ZT4A 1EK3A 2YAFA 4GI8A 5JPNA 3S2CA 1YSOA 3RWIA 4DKAA 4EI5A 1IUZA 3EH3B 2VCOA 1NKRA 3I3DA 4G7YH 1I1CA 1XEDA 4GOSA 2PP9A 1XCQA 1MRCH 4FQQA 4W9HC 5I8KL 2WQXA 4L8DB 3IN2A 3ZKXB 2ICWJ 1M7DB 4P59L 3TWCH 2ICWB 1UD4A 3M86A 4UT6H 3T8XA 4BFOA 3NMEA 1UASA 2XY1A 3RVUD 3DO7B 4GKNB 1IGYB 1FG9C 1MHHB 5GRZA 3VFRB 3T0EC 1WFJA 5EEWA 2FSEA 3GLAA 3BGFB 4G1EB 1HZHH 1NM4A 2IF7A 2NOYA 2J72A 2R9HC 3LHPL 2Q8BH 3TFKD 4PJGB 1U8HA 1UD3A 5D2NE 4ZYKA 2XLLA 5A6MA 5E24E 4MSWA 1CDYA 5AW7B 4CMHB 1D2PA 3Q01A 3QAQA 3MV8E 4PJBA 3LVEA 3L95B 1JN6B 3JT0A 2EDBA 4AH2B 3H9SB 3L48A 4A04A 1AQKL 4FQXD 3TV3H 1AQDA 1D3CA 3EYOB 4M8RA 1KDIA 2E46A 3OPZL 4HZ1A 3GNML 1VESA 4W4NA 5D4QA 4KXBA 4YL4A 1CGXA 3GD1C 2VLKD 4X80H 2WBWB 3ARYA 4GBXB 1IT9L 3SYPA 1KN2H 2CMRH 4PBXA 4EDWH 4PD4K 2Z35B 3UTZA 2E59A 2NUTB 2WXGA 1HWHB 2ZSVA 3EYSL 3JBG7 1EMTL 2WP3T 1LE9A 1HYSD 3P2BA 2CH8A 3RPKA 4WFHD 4LKXA 3O6MH 1F2QA 4P23C 1YMMB 1Q38A 2EEFA 5D7JD 1W6LA 1OGAD 2V17H 1ZJBA 4I85A 5C08E 5IJVA 2Z7ZA 1XH2A 1KB3A 2DYPA 4I3SH 1OGSA 5LDSA 3ZHKA 5AAMC 2AITA 4AX3A 4WI2A 4K73A 2X28A 2YXVA 4LSQH 5F0LB 3DVGA 5J6SA 2Q2LA 5E4IA 3S37L 5CN3A 3WKML 1CGTA 3VXUA 5BUGA 1FWXA 5IV2B 5BZDA 1B0RA 4D8PB 2J6EA 5CZRA 2GG1A 5T3ZL 1T1ZB 1MRDH 5JIKA 3B5HA 4XMPH 2JB5H 5EOQH 1CL7H 4U1GB 4Z7NB 1JPFB 1U3HA 32C2B 2KH2B 4HUUA 2G3MA 1T1XB 3QIWD 5AYUL 5HY9A 3H7BA 3O4LE 3PAUA 4WGVB 4PGDB 2GYSA 3WEXA 3H4HA 1XF2B 4DW2L 1A6VL 2BK8A 2W1NA 3OMIB 1XTLA 3CPLA 2CBMA 3VXNB 1S5HA 5DJYA 3W0WD 5I6XC 3NJFA 4FC3E 3AS1A 3N06B 4ORGB 1K3ZA 5EU6E 1JZJA 3EOYG 3TIEB 3OHXB 4F91B 5CP7A 5IF0B 5LUMA 1XVSA 4MVBC 1AIZA 3FCSB 4DOHB 2E8YA 1DVXA 1UZ8B 4M48L 4GP8B 1KTDB 3D0LB 2PPEA 4DNLA 1RUAL 2MNJB 4KUZH 3LXUX 4PJCA 3LSOB 3VA6A 1KXTA 4JFYA 4LNRB 2DQ6A 3LRGA 4NQVB 5A43C 4NCC1 4G8AC 3VDCA 1JVOA 4CVZA 4RRPA 1L6XA 4HUCA 5IM7A 3NQIA 5FF6B 2FX7L 4ADIA 4BUGA 4FQCL 3P11H 4UOZA 1Z9NA 1QR1A 3BPCB 4JG1L 1E43A 5SX5H 3WJJC 4F92B 1OQXA 1AKJA 1HQRA 2QQQA 4O2FB 3MBWB 1UH3A 1H9VA 1TU2B 1S7UB 1H8SA 3EH5B 2WTPA 2ZYRA 1WWBX 5HGAB 1FVCB 1Q8MA 3C6LB 4XRCB 2CWRA 2JCCF 4HX1B 2W38A 2Z0UA 1BLNB 1PNDA 2XN9B 8FABA 3BSZA 1AXTH 5I9QC 2BVPA 2LAGB 5LO7A 1FG2B 1DCLA 1QRKA 5ITFA 2IBZY 2OMYB 4UZGA 2ESVA 1KYUA 2EH7H 1I9IL 2VLKE 4AZ8B 4LBEA 2ICCA 1XCTB 4GQRA 1KEGL 2RQ8A 3DNKA 1DHKA 3MACL 1KGYE 3SD2A 3PWVB 1RJCA 4JG9A 5PCYA 3G6DL 1CZ8L 5EC1A 3RIAK 3L6FB 3S8WA 4GUPA 4WEMB 1NGXB 3A0OA 4WNQA 3RFRA 4XCNA 2COVD 3WHXA 2NY4D 3HI1A 3BQUB 1VACA 3CVHL 4KJYB 4X5QA 4L9DA 5C0NC 1OGAE 1X9RA 2C3VA 2CJUL 1ACXA 1GW6A 1OSPL 4WTXA 4H8VA 2WVVB 4X4KA 5HDQH 4XO3A 1EHAA 1KZQA 4N5ED 5CEXB 3EOAB 4AL8H 2W9DH 2A3TA 2G3NA 3MCKA 1CGUA 1Y6MR 4HBQA 4WW2F 5HHOD 3SDAD 3I02B 3UJIH 4KNTA 1YY9D 1IKFH 2PCYA 2DYSB 3WTSA 3WBDA 1DBMH 5IW1B 2EVFA 3ME0B 3BJLA 2R4SL 1IEHA 5IMKB 1FJ1B 4HZAA 1MCEA 2F68X 1MFVA 3NCMA 3QNXB 4DP9X 2PXYD 3BVVA 5CR8A 2CKBA 5CUSH 4U1SB 4PRIA 4XC1H 5HD8D 3VNYA 5C70A 1MCRA 1A9BB 3R06B 1MKFA 1MVYA 3LZQA 4QHLA 4KHTL 4YSTA 2H41A 3UC0L 1H8NA 4EKXA 2LVEA 2F54A 1A7NH 3UZEC 2XPZA 1UYWL 2WD0A 5JLZB 1XF4A 3D2TA 5T1LB 1DJXA 3MJ7A 1NKGA 4ISVB 3W0WE 3I9PA 4PRBB 3FB6B 3OXSA 3Q5TA 5I1JL 3UL4A 1JK8A 2TAAA 2DMHA 1Z5HA 4DCQA 4FNLL 2IIJA 2KKQA 1S9XA 4WFED 1ILSA 5E99L 1S9WA 3U9PH 4BSWA 1T6WA 3GRWA 4IGBA 4MGXA 3QUMB 4QHKI 5EEUA 5I82A 1SXSA 4GXVL 1A6AB 3TBYA 2AJ3B 1NLBH 4G80B 4EZMA 3IMBA 5B1BB 5HHXH 2H1PL 4NUJB 1KV3A 5CKGA 3L9RA 2ED6A 3MUZ1 5TTRA 5J9PB 1I8MA 2QDVA 4PTTB 4MBOA 5CJ8A 5GRJH 1PD6A 4XMLH 2FGWH 1SFHA 3GZQA 2C5DC 4HWNA 4G42A 1KIPA 5KSUA 2EAEA 5F21B 4KPHL 5KTEL 1CD0A 2V5RA 2VNCA 4A2LA 1QAWA 4Z7VE 4PJEE 4YE4L 4HSAC 4PJAB 2X4NB 2BSED 2J1ZA 3FFCE 2BSRA 5C9KA 2QZQA 3L2MA 2IH3B 3E9TA 5JA9A 1NCWH 4LP8A 3ISRA 3UTTD 3NGBC 4OCWL 3ZIMA 3G9AB 1P7QD 1LK3L 3O2DH 5CD5D 3MJ9A 1EZVY 1NFDE 1U0QA 4Q8BA 3PQYB 4FTVD 4PB0L 2BH0A 4JM2A 4D9LH 4HSCX 2AP2A 1YC7A 2KL6A 1CD9B 3FQYA 3PDDA 1P9MA 5IBTL 1BLIA 2RGSA 3RB5A 5ECGA 4Z3TA 1CFBA 4QHUA 4IBZA 5F7DB 1HHIA 4HKBA 4IDJL 1GMEA 3TH4T 3ELAT 4MWFA 3QQ4B 4Z7UF 4I48A 3SE6A 5IJBC 2NY3C 2WLIA 2XV3A 3B9KC 3TPKA 1FNEB 3BH8A 4GAAA 2ZWNA 3TN0B 1AP2A 3QEGH 4WTQA 2C7FA 1XL6A 3KDMA 1QHQA 3FH7A 1YJDC 4OGXL 5ACLA 1EBPA 4J3OF 4L0YA 2XCMC 3EHBB 2FBJL 2NW2B 4DP6X 4R2GC 3GSRB 2NR6A 3KPMB 4AQ8A 2X4TA 4Y4HD 5D1ZD 4FYTA 2OCFD 3TA3B 2C9PA 2V3FA 1A3LL 3CN2A 3U4AA 1AZVA 1UB5B 3Q13A 4NO2B 1VKXB 2ENJA 3TBBA 3GZPA 2E76C 1ACZA 4EE2A 3BP6B 5I0VA 5EBMA 4LARH 4B9FA 2P8MA 4NFBA 5DMIH 2AJUL 4JG5A 2Y1VA 5T3XH 1XZ0A 3NQKA 4TKWA 2YBRB 4TSAL 2Y36L 1ES0B 5HYJB 5FYKH 1ZMYA 2QVTA 3WNLA 4ZAKD 4LGSB 3RVXD 1MNUH 2WNWA 4HXAH 4JFFA 4FFVC 5GGSB 3AT0A 1BD2D 3ZJAA 2ZTBA 4WU5A 1P0SE 4Y4FB 2DL2A 4UILL 4ODWA 4NN7C 3EFDH 4L3ED 3RY6A 4QRPA 4YLCA 1NBVH 3IFNH 1AGDA 1M1SA 1HESA 2H4EA 2ZD0A 2V2XB 1XWVA 2ADIB 2P5WB 2VITA 3H1ZA 5C6TH 3VVVA 2X87A 2BXZA 4G6FB 5B4MD 4WFEE 1H8LA 4Y7MA 1IM9B 3ERXA 3L4ZA 5BOPA 3WFDL 5MEPA 1OAYL 5DHVB 3PNWB 2XQYG 2I26N 2LVCA 1SOKA 4KO6A 2VABA 3SE8L 2HB0A 4YPJA 3RWEA 5E8EB 4EOWH 1ZCRA 4L4JA 2NQ3A 1ZS8A 4ETQA 3NABH 2CK0L 1AS7A 4NUGH 3E8UH 4R97C 1OM3L 1IE4A 4DEPC 5B39G 2CU9A 2MCG1 2XICA 3DWTA 4O5LL 5DSCA 3LQAC 4FFWD 1MJ7L 3PHAA 3WIFB 1JI1A 1N64L 4ANKA 4HUKB 5D2NB 1KDJA 1DSYA 2BFVL 4KJPD 2VXTH 4X4ME 1KJ2H 4IS6B 3TO2B 2Q3XA 3JWDL 2IWEA 4XPGL 3BO8A 5I71B 1CURA 3UTTE 2CGRL 2R29L 3KLQA 3QUKA 4ELKA 2LU3A 4O02L 4YAQA 1EFQA 2ZXWB 2N7AA 3PUUA 4HUXA 4X98B 2DH3A 3WNPA 3QS2A 4FTVE 5ES4B 5F3BA 3D39A 4NAQA 4HIHB 1RUML 3BP4B 3QUYD 4ZFGL 3WU1A 3MXWL 2OKMA 4IIQB 1J0JA 1P2CB 4L29B 1JUFB 2WC7A 2Y1ZA 2AXFA 3B5GA 2FNBA 4I9WD 4YZFE 4YOKA 4Q9RL 2H6PA 4JE0A 2DTML 5GGVH 2FUQA 2H32A 1E4KC 12E8H 2VDNH 4FFZH 4GI9A 4HWBL 1LTXA 5ADOH 1IBDA 4BKLA 2EDQA 4IMKA 3GEWB 4C54A 3ARED 4JZNB 2F1EA 1IQDB 2NXYB 3QG7L 1GPOH 5C0BA 4JX0A 5EBLB 1F6AB 1MH5A 4XN4A 5E9DB 3MUJA 1FN4B 1BFVL 2HVKB 5J11C 2LE9A 3G5XA 3SOBH 1BXAA 1N0LA 1N4XL 4J3OH 5ICUA 5B7MA 1HSAA 3ARFB 1QG3A 2DRUA 4HKZA 3RPIB 2J43A 4JK0D 4X99A 5KSVA 4YHIA 3OKMB 3N55A 3L5IA 3THML 4NAJA 4LKCB 1TNMA 1JP5A 1R47A 1CFMA 2DJUA 4N2BA 2UVEA 3LNDA 4RISH 4XI5C 5GS2H 1L7TH 4MBRA 1LO2L 5MP6L 3ZE1B 3QRGH 2KZBA 3BGMA 4HPOL 1SJMA 5EF1A 4CC0A 3QORD 1S8DB 1QO3A 2WLJA 3FUMA 4OIBA 5F0MB 3ZK0A 2GCYB 1I8UA 4PLJD 5DFTA 5E08L 2DQUL 2OPCA 4BM7A 1BAFL 4KI5F 1D7FA 5ETUA 4EJ1C 5I0DA 3VFVB 3TO4B 1QVOA 1R3HA 3S2AA 1HHGA 3EADA 1PFOA 4L3EE 3PL6C 3SDDD 3GSNH 3FN0L 4YK4C 4OY9A 4YHML 1E4HA 4XH2B 5E2WL 3GKWL 5E03A 1FFNA 1IGJA 3DK0A 4EUPG 4PLKD 1GZHA 3TF4A 2QHLA 5AG9A 3NOIA 5I8OL 4M6OL 2BW5A 3QEHB 5DUPL 4XOCA 5FKAA 3LY6A 4YS4A 1GAFH 1SF5A 1TO4A 1JZ2A 4ZFOA 1OO2A 3ZOAA 1Q94A 3RZCC 1UD6A 2FO4A 1FBIH 4F1ZA 1IEAB 3MUUA 2IPKA 3VI4A 4GSXA 4S1SL 5E2JA 3WYRA 1OAXL 2D7PA 2Z92A 2QVIA 4YQXH 4YXHH 4QCIB 3ULVC 2E27L 4QRFA 1NAMH 4YDKL 4Z76B 4WLCA 3LEVL 3IFOB 3ZMEA 1XR8A 3IMSA 5L88L 4UDUB 3H3PL 4HPHA 1FL6A 1MJJA 5D96B 1D5XB 3L5XH 5E8PA 2AFNA 3QFDB 2J4WH 2W65B 3B3IB 4LSSL 2EILB 1KULA 4X6EB 3AXLB 1HH6A 3MV9A 4BKSC 3FTYA 3P4OA 1TKWB 3PWNA 4XNZC 1ND0B 3X17A 2CDEA 5HDBB 2RACA 4GRWE 1JXFA 1A1NA 4FQXB 1J5CA 3DX2A 3T65A 4ATWA 2BNRB 2R56H 4FQIH 3RWHB 3U9WA 3MLVH 4DUXA 2Y2YA 4JJ5A 5AOZA 3G04A 4YHLL 1B9ZA 2ALWA 2VLKB 1X5JA 1U3JA 2DLTA 2N01B 3A3YB 3LDBB 3S37X 4O2EB 4TUUA 5FK9A 4Z77B 4I9WE 4KHXH 1KYOJ 3WKYA 1CXEA 1DBAL 2O93L 1Z6JT 3NCYP 1H3UA 4YUEH 5GSVA 4CILA 1XGPB 4HHAA 4KK8C 3V0AC 5DJXB 3IDJB 3KWUA 5AAWA 1YY8B 3FTVA 3W9DA 5DS8B 1U21A 1IVTA 1AIFA 2GIYA 1AHKA 1R1CA 1C12B 2X2IA 4Y2LA 5D7JB 1XH3A 3C60C 4U1NB 2VISA 5F9WB 3OKDA 4FJZA 2Y7MA 4R3SB 3HI5L 4JGUA 3RIFK