1J9QA

Crystal structure of nitrite soaked oxidized d98n afnir
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
336
structure length
336
Chain Sequence
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNINFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Alternate substrate binding modes to two mutant (D98N and H255N) forms of nitrite reductase from Alcaligenes faecalis S-6: structural model of a transient catalytic intermediate
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
total genus 91
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2001-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1j9qA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1j9qA02
1OV8A 2N0MA 3NJLA 2DY2A 4DP8X 1NIFA 2XWZA 9PCYA 1FA4A 4MFHA 2OCCB 3D12B 5B1JA 1CURA 2XLLA 1JZIA 2ZONA 2BWDA 2YAHA 3CDZB 3TBCA 1L9SA 1KDIA 2CBPA 1BQRA 2Y69B 4KNSA 2I85A 2PCYA 4BDVA 3RYMA 1KYAA 2BW4A 3EF4A 1IBZA 4CSPA 1CYXA 2CAKA 1XMEB 1AS8A 1KBWA 1NIEA 2Q5BA 1SNRA 3CG8A 2NRDA 1JXGA 3CVDA 1M9WA 3GYRA 2AANA 5B7MA 2QDVA 3CZUB 3NSCA 3NSYA 1ILSA 2J56A 4A2EA 1AQ8A 4HALA 4KO6A 1GSKA 2EIJB 5D4HA 2VW7A 4YVNA 1W6WA 2VW4A 4YSAA 1HFUA 3OMIB 1OCOB 3ABGA 1ET5A 3T6VA 4E9YA 2QPDB 1J9RA 2BP8A 2XU9A 2H5UA 2XYBA 3FU7A 5I5JA 4F2EA 3TBBA 1HAWA 1NPJA 1PF3A 3X1NA 1A8ZA 1OCZB 1OE2A 3N55A 1ASPA 3S3CB 4YL4A 2WO3B 3CDZA 1ZIBA 3QJTB 1QNIA 3KW8A 2PCFA 1OCRB 1XB6A 1WA1X 3NJNA 4AX3A 1PNDA 1A65A 1TU2A 3MX0B 4JHVA 1GW0A 3ZDWA 4BXSV 1PCSA 1WAEA 3FPXA 3N2JA 2PPFA 2ZXWB 3NJFA 2X88A 1EHKB 3QJSB 1J5DA 1NIAA 2ZWNA 3ZBMA 2LLNA 2W8CA 1JXFA 3GXUB 2R7EA 1N70A 2FWLB 2WO2B 1GS8A 3OMAB 3U25A 2IH9A 3AZUA 2VM3A 3G5WA 1L9PA 3S3DB 1AZNA 2HXAA 1NINA 5F7AA 3OQRA 2DYSB 4GP4B 3FSAA 5B7FA 2OJ1A 3TU6A 3V9CA 3FU9A 4A68A 2DYRB 4RH4A 1AS7A 2XVBA 3UGEA 1SDDA 1PY0A 2HX7A 1JERA 3NT0A 4QLWA 1AZUA 4YVUA 2QPEB 3WIAA 1A4CA 2XV3A 1IBYA 1BXUA 1AOZA 1ZDQA 3DKHA 4PCYA 4BK5C 1URIA 3EH4B 1QLEB 3UABA 3UADA 5ANHA 3FQYA 1A4AA 2YAFA 2GI0A 1WA0X 2XX1A 4BWUA 1AR1B 1A3ZA 1MG2C 1RCYA 3EH5B 4F7KA 2AFNA 2A3TA 5EHFA 3C75A 4BXVA 2YARA 4GP5B 4M3HA 4YSOA 2B3IA 2P80D 1AG6A 4G7QB 1NICA 1XB3A 1PLCA 3NJKA 4G72B 4KO5A 7PCYA 1T5KA 2E86A 3CVBA 3IBOA 2MRYA 4W1TA 4KOBA 6PAZA 1PLAA 3FYEB 2QT6A 1ADWA 1OCCB 1KCBA 2PPDA 3WKQA 4A66A 3IE9A 4YSQA 2BP0B 1NZRA 1FFTB 2IDUA 4G70B 4HCFA 5B1BB 3FS9A 2W88A 2XUWA 1AACA 1SF3A 1IKOP 3ZIYA 7PAZA 3IN2A 1SFHA 2YAOA 4NERA 1B3IA 1BXAA 2CJ3A 4A67A 1JZEA 2FQEA 4YSTA 3JT2A 4JKNA 3UACA 1WA2X 4FAAB 3S3BB 1PZBA 2PPCA 3FQ2A 1DYZA 3X2QB 1NDTA 5I6NA 4AI7A 2IWEA 1OF0A 2PPAA 1JVLA 2TSAA 5I28A 1ZV2A 3QJVB 4HCIA 3WG7B 1AZBA 4AZUA 1FWXA 3TA4D 4WTQA 2PP9A 5I26A 5LDUA 1AS6A 1BYOA 1ETJA 5PCYA 1W6LA 2BZCA 5AZUA 2TSBA 2UX7A 5D4IA 1ASOA 2HRGA 2XV2A 2HRHA 1E67A 3NP4A 4YSPA 2BZ7A 4G7RB 4CSZA 4YSUA 3QPKA 2UXVA 3H4FA 5TK4A 2GBAA 3FSZA 1BXVA 1F56A 4DP6X 4W9ZA 2BWIA 1IUZA 2I7OA 1JZHA 2X87A 3PAZA 4KO7A 1J9QA 2JFCA 4JHUA 4HCGA 2I7SA 1JXDA 1NPNA 3IEAA 1M57B 4DP2X 3PAUA 4P5RA 3WI9A 1NIBA 3NJHA 4KO9A 5B1AB 3SBRA 1ID2A 3FPYA 1ZPUA 2DWTA 2WSDA 3PPSA 1OOWA 3NJGA 3SQRA 1BQKA 1PLBA 4HZ1A 2B08A 1RZQA 3NSDA 2GB2A 5I6LA 2XV0A 1A4BA 1ET8A 4DPAX 5I5IA 2PP7A 4GP8B 3WKPA 4PAZA 3T71A 4FA7B 2Y1AA 1L9QA 2YAPA 3FYIB 3DIVA 2XXFA 1NWOA 1AANA 3T9WA 1AIZA 1HAUA 3TASA 2FNWA 1E30A 2FT8A 3QQXA 3NJIA 4WKXA 1NIDA 3NJJA 3NYKA 4UAHA 2UX6A 1BAWA 4DP0X 6PCYA 2JXMA 1I53A 2FT6A 4M4RB 2YQBA 4BWWA 4ZK8A 1TKWA 4F2FA 2FQDA 4DP7X 3KW7A 1AZRA 1V54B 4DP5X 1WS7A 2AZAA 4HAKA 1MZYA 1PZAA 2GIMA 1SHXA 4E9VA 2EIKB 1DZ0A 1E5ZA 1CC3A 1KBVA 4G7SB 2UXTA 2IDTA 4EF3A 3QJQB 2IDSA 4DPCX 1GY1A 1NTDA 2YXVA 4E9SA 5IY5B 1PNCA 2BO0A 1R1CA 3ZX1A 2PP8A 4Q8BA 4N4YB 1V10A 4BDVB 3UAEA 5I6MA 1J9TA 4GY4A 1MDAA 2AZUA 3T6WA 1UATA 3NP3A 2MTAA 5B3SB 4DP4X 3S8FB 2UXFA 3IN0A 4X4KA 4E9XA 4N8UA 3PLYA 3DTUB 3WNIA 5I6OA 5I6KA 2IWFA 2XXGA 3SBQA 2HZHA 1JZJA 4GYBA 2EIMB 4L0PB 1J9SA 2H47C 1OE3A 2BHFA 5PAZA 2CCWA 4E9RA 2J55A 2XX0A 8PAZA 3GDCA 2VSKB 1JVOA 5B1JC 2R7EB 4A2DA 4AKPA 1AZCA 3PXLA 1M56B 1JZGA 1J5CA 2YXWA 3PAVA 1KGYE 2PLTA 2VN3A 1RZPA 1EZLA 1ASQA 3ERXA 2DV6A 2BP0A 2HLEB 1SF5A 1SHWA 2YAMA 3MBWB 2GHZA 1BQ5A 1PAZA 4AKOA 3QJUB 1GS6X 3X1GA 4YSRA 1IC0A 3NJMA 4E9WA 1BEXA 1GYCA 4E9TA 1MG3C 3OM3B 1YLBB 3NSFA 1SJMA 4HHWA 3H4HA 1XB8A 3SBPA 2GC4C 1GY2A 1OE1A 3QJRB 1X9UA 2UXGA 3PCYA 2VW6A 3AG4B 4GXFA 4QKTA 1PZCA 4HIPA 4DP1X 1E65A 3FSVA 3T6XA 2VSMB 1ZIAA 2IH8A 2P80A 5B7EA 1KV7A 4ENZA 1X9RA 2YAQA 5A7EA 5AFAA 1L9TA 1ILUA 1GR7A 1TEFA 1E5YA 3ASNB 1V55B 4KNTA 1JOIA 2IDFA 3ABMB 4YSEA 4NB7A 1QHQA 1AAJA 4P5SA 4UF7C 4AKQA 3OMNB 4YSCA 3AG2B 3V9EA 1SFDA 3FSWA 1L9OA 5AKRA 3JTBA 2J57A 1SDDB 1JZFA 1BYPA 3BVDB 2JKWA 2OV0A 2J5WA 2IAAC 3X1EA 3EH3B 4BWTA 1MZZA 2BW5A 4KNUA 1TEGA 3ABKB 2HX8A 2EINB 2VMJA 4UANA 3UAAA 1CYWA 5FC9A 4YSDA 3EHBB 3T6ZA 1RKRA 4TXVB 3S8GB 1CUOA 1KDJA 2CUAA 2FT7A 3ASOB 5E9NA 1ZDSA 2EILB 2CALA 1N68A 1AG0A 1PMYA 3FQ1A 2IWKA 2RACA 1NWPA 4E9QA 2DWSA 1KCWA 1L9RA 3OD3A 2HX9A 3X1BA 1GS7A 4HHGA 4YSSA 4K9JA 2FJSA 4G71B 3L45A 3AG1B 1VLXA 3H56A 4NAJA 3AG3B 5D4JA 4A2GA 4DPBX 1W8EA 2Q9OA 4KOCA 1ET7A 3FT0A 3BQVA 2ZOOA 4DP9X 3FU8A 4A2HA 3AW5A 3ABLB 2QDWA 5F7BA 3HB3B 2AVFA 4A2FA 5I5MA 3AY2A 2IDQA 2BP8B 3FU7B 5B1KA 2YAEA 5I6PA 2GC7C 5TK2A 2GSMB 1WS8A 2FQFA 3CVCA 3WNJA 3X1FA 4Q89A 2H3XC 2FQGA 2PPEA 2FTAA 3HEIB 2VM4A
chains in the Genus database with same CATH superfamily
3NG5A 1U93B 5CJOL 1I3RB 1WD9A 4DP8X 3BZ4B 4BH8B 4PRAA 4HJEA 2VLKB 2JIXD 3RDTA 2FEJA 2MPAL 4FD0A 4JN2A 1L9SA 3BC9A 2FYVA 1J18A 2R51A 4IDJH 4LCIL 4XI5C 3WY4A 1U8CA 4H5SB 3D09A 1BQRA 5E0QA 2O5ZL 5D6CB 5JZ7D 4G6FB 2KZWA 3I02B 3HZKB 1RVFH 1QSEE 2NSQA 3AJ7A 4NC1C 4D7BA 3IAPA 2OSLB 4ZMYA 4X8CA 1WZ1H 1MVFA 5D5MA 3C5SB 4LFHG 4ZG1A 4HH8A 5E6ZA 3D05A 3NFSH 1TPXB 4FXTA 2VE6A 5JR1L 2H32H 4W9LC 2YRPA 2AANA 4P2QD 3GSRA 4C56B 5IV2B 4ZS6D 3VW3H 2EIJB 1CFNA 1KC5H 4PD4J 3QJFA 4PGBB 5ADOH 1FGNL 1NUNB 3QI9B 4WK2B 4UINL 3BGAA 4YHYB 2ZXQA 3WMSA 4ZMAT 4ZDHA 1SEBB 3RL2A 3OV6A 2LW3A 1ASPA 3Q06A 4XH2A 1RHFA 4L8DA 4NZUH 1F3RB 4WDIA 1U4EA 1B0IA 2EC9T 4BFEA 2VL5B 5DSCA 5CSZB 1RIHL 5D7JA 3L13A 4PLNC 4XWGH 5GGQH 1KJVB 4YFLF 5BUGA 4XCNB 2ED8A 4J1UA 1J05A 1CU4L 3KVDD 3Q2LA 4EBQL 1SEBA 3O2WH 4HHAA 1CICB 1F1GA 1EHKB 5LN8A 3X3GL 1CF8H 1J5DA 4FXGA 5EFIB 4Q58C 3DVFA 4PP2B 4NYLB 3VGFA 3DX9A 2ED6A 5DR5L 1J5HA 5K59F 3GXUB 5FGBA 3U4BH 4ZFZA 1G4MA 2Y06L 3IJHA 5HY9A 3U25A 1IKFL 3EOTH 3AZUA 5JHAA 4B5ZA 3G5WA 1KLFB 3WFEL 2FJHB 4PY7B 3QIUC 5E2UH 2DYSB 4HUXB 3B3BA 4Y5XC 5TGBA 5CEXB 3SGJA 4ESKA 2ETWA 1CGWA 1GHFL 4ZOAA 4AQ1A 1NGWA 2NYYD 3Q9PA 3SOBH 3LIZA 1RK1B 1PY0A 3ARBB 5HBBA 1Z2KA 1D6EA 3IFNL 3G04B 5EORH 2QPEB 1YN6B 3K2KA 1MWAL 4LVNB 1YEKH 3VFPA 1J8SA 3VXTA 3OHXC 4R8WL 4FP8H 3DKHA 4WHYH 1JDCA 3EH4B 3P30L 1KGJA 4OB5H 1ETA1 2W59A 3AT9A 3O6FD 1CGYA 5D7LA 5ANHA 5GRYA 1IVTA 3N40F 3WFDH 4HIXL 1WA0X 4OF6A 4UQCA 3E3QE 3N40P 2WBJC 3VXUE 2QSTA 2AEOA 4F7KA 1IM9D 1WK0A 2HLFC 3U79A 2Y0SA 3ZRSA 1UWXH 4CL7A 4J6RL 3L7FB 4YSOA 1HCYA 2H6PA 3BX7C 2WZ0A 3QDJD 2NZIA 5IFJB 4RESB 5DJXA 5HYEA 1BZ8A 2IPUK 4K8RC 3P2TA 3WAKA 5D55A 5CSZA 4UDTB 1D5IL 2XWJB 4ZOBA 1OM3H 4WO4A 5MEND 1GAFH 1OGAD 2YPLB 3KLKA 3NEEA 5K69A 1HVXA 2KUTA 2WTOA 3ECUA 2C7UA 2J3SA 3ARTA 3IDYB 3MRIA 3P0VH 4M9PA 5BZWA 3AT0A 3C6SB 1NCDH 2VXUH 1HHGA 1X5IA 2XOTA 2DL2A 4PRPA 2QSCL 1AFVL 5KOVC 3IN2A 3VFRB 1CIUA 1HHKB 2ZSWA 4JFPB 1OK8A 1XX9C 4WWKC 5FECB 5KJRH 5L7XL 3KPPB 2XBDA 1R3JA 3ZUNC 1UCBL 4GRWE 1XEUA 4NQDB 1GHFH 2QVKA 2WGXA 4WJ5B 4LHUD 4NP4H 1YY9D 2A77H 1Y0LA 3BUYA 4I5BA 2VXQH 2X53A 4XPHL 4X4XB 2Y24A 3FO2A 4RFEB 4Q6KA 4NNYB 2XJKA 1J8HB 2BINA 2H1LM 3DBSA 2KLRA 2WVSA 3WENA 3ECBB 3L4WA 3EO0B 3UAJC 2NY6B 4QRRE 2Z8RA 2X10A 1CLZL 3JV4B 5IHUL 1OZUA 1XGQB 3NCWA 4U4BA 3GSXB 3VXSA 1AYOA 4K5OA 3O11A 2W0KA 3N1FC 5D4IA 4F3FB 1HOCA 1SY6H 5HYSB 1E67A 3POCA 5E6YA 5JHLH 4OJDH 2VLKA 5E4EB 4RGOL 2KERA 4R7LA 4G7RB 5TE7L 4EUPB 3Q8EA 3DO4A 4Y5YA 3BPNC 3PWUA 2IBBA 4RNRB 1R3KA 3IFLH 2VZ3A 3M86A 3P40A 2LFEA 5FHBH 4TTGA 4MNQD 3LQAL 4Y4HA 3TEYA 4HUUA 43CAA 2KT6A 5A2IH 4MS8C 2A9DA 1QA9B 3PRZA 4EMZA 5T3ZD 1XTMA 3HPJA 3Q8FA 1WZAA 1EMTH 2X6MA 3DRQB 3WLWD 4DGIL 3Q1EA 5FCUH 2J73A 1CDIA 3CZNA 3DV6B 4RZCA 1P9MC 4FNSA 1N5AB 3JSSA 3OX8B 2WLLB 2B4CL 4HGKC 5CR1A 1AGBB 1ZT1A 1S7QB 4YDJB 3CFCL 1DN0B 3KLAB 5TFSH 1AO7E 5CWSB 1IQWL 2IGLA 2FD6H 4NZUL 4D0CA 3ULUF 2DEYX 1A4BA 1ET8A 2CO1A 1WZKA 3SDDD 4HG4J 5I1AA 5I5IA 4XWGL 2NY6C 2H8PA 2NXYC 2UYLB 5GGQL 2KPWA 5JOFB 5GGVH 4AL8H 1KYUA 2PR4H 3OJMB 5GGUA 5L8KB 4U6TA 5KSBB 2Y22A 3ELAT 3AUVA 1CLCA 2P4AB 4M48L 3V7MA 5IEKB 3POHA 3TYFA 2E27H 5KSBF 4XNYH 2WZ6A 2Y5TA 1KN4H 2HFFB 3ZDYB 1D5MA 2I07B 1V3JA 9CGTA 1SY6L 2Q76A 3LZOA 3CH1A 4EE2A 3VQLA 2IQ9L 2R0KL 2J88H 4NFDA 5JLZA 3RX7A 3SCMC 4HKXA 4KKCC 4PHXA 2R29A 3GTTA 1EEZA 5FYJH 1NSNH 1R4XA 4U3SA 5H94B 3NQIA 2X3BA 2R1YA 2VE6B 1RY7B 1SYVB 4JRYE 5DJZB 1K5NB 4BFOA 3VMOA 3BRFA 1A66A 1JAEA 3SGDI 3BKML 3V6OE 4DVRH 2Z7WA 5IY5B 2OSLA 3AS0A 1CQKA 4XNUL 3BE1L 2V2TA 3FQXA 4ODUA 4M93B 5IIEB 1RUQH 2CHWA 5ABAA 4G6ML 5IESH 1KZYA 5B39G 5I6MA 4L3EA 4N6RA 2OZNA 1WC7A 1KLGA 1ZHNB 2DMHA 2JSFA 2DTMH 2VMEA 4ILDA 4IRJD 2NXYD 4NBYB 4NKQB 4TQ8A 5LGKA 2WBJB 4C4UA 2XPGB 1BQHB 1FZKB 3VRJB 1UWEL 4KVPA 4LCYA 2J4WL 3ZE0E 1UA3A 4GBXA 1VESA 1YNTF 1IBGL 5IHZB 5KVDL 3QWOA 3BD3A 3HOGA 4E41E 2AW2A 2Z35A 4LKCB 1ORQB 1XL4A 3EJUA 3BGFB 2FIKB 5IGXH 1U92B 1ZLWK 2VDLB 2WBJD 3BFWA 4BELD 3TNMB 3PXHA 3FB6A 5BO1H 1NGYA 2HLEB 1DCLA 4P23B 2YAMA 4KNQA 1WUNT 2YGNA 2WXQA 5DK0B 4OI7A 4QXUL 3S5LA 3SKNA 4X6CB 1IBBA 5CZXD 2IH3A 5C09A 1T66C 2DI9A 5EU6A 3QIUB 4U6YB 1N26A 5BQDA 5IVXF 1KT2B 3VXNB 5HYJD 5I0DA 3UZQA 1NC4D 3JWOL 2XA3A 4WI2A 1YLBB 4XCFL 5A2LH 1SOSA 4YXKH 4TRPL 5DFVC 1NKRA 1OF2B 1B4LA 3HPJB 3PQYA 3NIDE 1IARB 1E4WH 2CXKA 4QKTA 4FNPA 4YFLI 4Z7WB 3ECVA 3AACA 1DVYA 1KJ2A 5D1ZA 3FSVA 5KVMC 5I2IB 2JKXA 3KBFA 3WS6C 1U2CA 4MJJA 1UGKA 3ORJA 2R56L 4KGLA 2YIHA 2VC2L 4YSEA 4HV8B 2EKSB 5E56A 1RP9A 4FERA 1URZA 4LO9A 2EEXA 4AYGA 4IRSB 1FP5A 1OCWL 5T1MA 4WFED 5JHDD 4LGRB 1ZHBB 2DIJA 2IJ0C 5TE4H 5I75B 1QG3A 3CVHB 2W1NA 1HHIA 1Q0YL 2AQ3A 3CQQA 4KI5C 4BCYA 4DGYL 3BH4A 3WNPA 1CG9B 4OY9A 3L3HB 3UIZA 4O58H 5AYUH 5KBPA 1U8PA 2PO6A 3HZMB 3MLVH 2Y3NA 4Z5RA 3KYOB 3V5HB 1OB1B 1N64L 1NOFA 4FLOA 3MLWL 1OB1A 2F74B 1YAIA 1IU1A 1O6SA 2D4FA 5EG6C 1DL7L 2Q6WB 3NCJL 1MFNA 4Y7MA 4AOFA 3O9WC 3ASOB 5AAPA 1JZ7A 5SWSA 4A37A 2CALA 4KMLB 4H88L 1N68A 4XN8A 1J87A 1XR8A 2E8YA 2VR8A 4PRPB 1D7BA 1DANU 1PPIA 2HJLB 1TO5A 4Q2ZA 1W15A 4JRYA 3BPLC 2HJFB 2NY5L 4K5PA 3FU5A 5J11B 2GTQA 4YLQT 3CFUA 2FH6A 3L45A 4NAJA 2Q0ZX 5D4JA 4A2GA 5IBTH 4DPBX 4FA6A 1NCWL 2XTSA 3QFDB 1ZLSH 1MF2H 4OIIH 2KDYA 3WFDL 5IG7A 3MUGB 4OUUB 4P3CH 4XPBH 4YL9A 4Z76A 3UJTH 1HWHB 4N24A 4XO3A 3U0PB 1A6WH 4R7NB 1KXQE 5L4FA 1G0DA 1BF8A 5F7BA 3S5LG 1H6EA 3AY2A 3L2NA 4EXPX 3EJJX 1MQKH 4U2ZA 4JFSA 2P5PA 3U6XS 2LR4A 1SXZA 5F89A 2R2BA 5TK2A 4HPHA 3CZLA 4PWHA 1NANI 3PWJB 4G8GA 3L3IA 1WS8A 2DJUA 2OSXA 2OTPA 3F00A 5GRWA 5DHEA 4LLVB 3GXTA 2GABA 3KPMB 3K0YA 1FYTD 2A74C 4R8WH 5EZJA 1P2CA 4AIZA 1IILE 2Y7QA 4WUKL 3RTQD 1P53A 5BRZD 5I16B 2FJUB 2OMNA 4M8UA 3P30H 4WUUB 2DY2A 2YUXA 3OKNB 4H20L 1FH2A 4OFYD 1G1YA 3WUWG 1JZIA 1M4KA 2LT9A 2VR9A 2ZONA 1E0OB 4FFVC 4JR9L 4LIQL 4FZEH 5E5UB 5AVRB 3U36B 1ACZA 5GGTH 3CAFA 3S5LB 1P4UA 4PJ9A 5DFVD 2IADB 4JY4A 2BW4A 1UACL 2FIRT 4FQHB 4ZMWA 3VXRE 3UBXI 3EOTL 2CAKA 1T1XB 1Z9SB 3VXMB 2DQJH 2X4OB 1KBWA 4M4RA 2VKWA 5C6TL 2WMPA 4MNGE 2P47B 1JXGA 1T22A 3Q13A 3TO4A 1UVQB 4NJAH 4OGAD 2IO5A 1ES0B 3IDGA 2NNAB 1RUML 4H40A 3SKMA 1YA5A 3ARFB 3MBEB 5J1AB 4G1MB 1YUHA 3DJZA 1RURH 4UIMA 3TIEB 5MHSD 1NGXB 2AV7A 4X9BA 3IJ8A 1BHGA 3KYAA 4KZEL 3RNQB 5CN3A 2XYBA 3BISA 4GAGL 2F0CA 1KB9J 4PV9A 4IRSD 4M7JL 3W11C 5JXAH 3O2DA 1H0DB 2FWSA 3C6LA 4K8RD 1UM4L 3MV8E 5HDBF 4Z7QB 5C6TH 5IFHH 4Z7QE 1UYWL 4F20A 4ONGL 3HNVH 5K9JH 4N5UA 3QGVA 5DJZA 1J0JA 4UCFA 1A6TB 1NUFA 2EXYD 5LAXB 2VUYA 3K91A 3PNWB 5E5MA 5DJAA 2BC4B 5EUOE 2GKIA 4MQXC 4U3SB 3NJFA 4LF3A 2CIIA 2WM0A 4N26A 4X6CF 3B2UD 1A2YB 2YQGA 3GS0A 3GZPA 3PGFL 4KBPA 3CN4A 4YDVA 2I32A 4UTBL 4D9RD 2DF3A 3PWPB 1Z32X 2YK1H 4JRFA 3CLEL 5D2LA 3FRPB 1CFNB 2W8CA 4MAUH 3TEUA 3B1UA 3GMQA 1SXNA 2X38A 4AEFA 4HDIB 1N70A 1KIRB 4NGHL 4WENB 3NJXA 1TZAA 4GXVH 4N8CH 1P4IH 5JR1H 4QHPA 4PJFB 1QSVA 4P4KA 3QA3A 5HVHB 3K0WA 5E4OA 3VYOA 2EAEA 3FQNB 3S3DB 2G60L 2NT1A 1EQWA 3D1MC 4ONHB 1X5HA 3WCYA 4MZ2A 4PJ8D 1EFXA 3ZE2E 4E68A 3MUZ1 4RH4A 3VD7A 3ATBA 3MRGB 4ABVA 4OCSL 1QLEH 3RX9A 1H19A 1LLAA 1CVSC 1AZUA 4G8GE 3RVUC 1NCOA 4TSCH 4M3JA 2VXQL 2BDNH 1U8LB 4I3GA 3NIGB 3KLAA 1AOZA 2WCSA 5F1NA 1EGJL 3N41B 2NY0C 1ZJAA 1F13A 4X9FA 4MVBC 1TTGA 2YPKA 1L9NA 3H2WA 1LNUB 4XNAA 2AABH 5GIRB 5GJSH 1PW3A 1UKTA 1LO0H 2Y6SD 1A47A 2XIBA 2BHZA 3NCYS 1YEFH 1G6RL 2YAFA 5C0CB 3EO1B 2DQTL 3C8HA 1UHVA 5F0MB 1VIWA 1QKZH 1RZFL 4QJ4B 2Y7SA 4LCUA 1CN4A 5E6IC 4G9DB 1PZUB 1QA9A 2VDRB 2WSPA 5CHNA 5CR8A 5EO1A 5LCVL 5ERWA 1CXLA 2B3IA 3ZU8A 4AL8L 1DL7H 2GJ6A 4H1LB 5DCCA 4U1MA 1XB3A 1EO8L 2ZD0A 5IW6A 3UTZB 4ABQA 2FECL 3MYJB 5FFOA 2DTSA 3QEGH 1Y6MR 2YFNA 3VH8B 3CHOA 1EGJH 1P1ZA 1IM3A 5IHBA 1J8KA 3MR9B 1R33A 3ET9F 1COBA 4UQ3B 1QBLH 4A66A 2ORBH 3SJVB 4YSQA 3O41A 5C0AA 1KG0A 1LP9A 3MXWL 2G2RA 4Z78B 2W9LA 3FC8A 1FE8L 1U21A 2CJTA 4YX2H 4HUWA 1LL1A 1NFIB 1EJ8A 2EIDA 3GBLA 4HIXH 3BFQG 1VSCA 3ARFD 3FB5B 4XNQB 3TO2B 3RZCD 8FABA 3PUUA 3NAAH 2OZ4A 4OIBA 1YDPA 5HHQB 3O6FB 3EYUL 3QA3B 4BZ2L 2KKQA 5EBLB 1RZGA 1OF0A 2HN7A 1ZVYA 3LH2L 3MCLL 4X6BA 4X99A 2TSAA 4AGNA 3OKEB 7FABH 3KPPA 1NFIA 3P54A 3KWUA 2ZYRA 4G8AC 3KPSD 1FFOB 4ZODA 3SIKA 1S7RB 2R2EA 3RHWK 5AZEL 5AOKA 1FJ1B 4KKCD 4RMTA 1W91A 3O6LL 1DQIA 5FEBA 4HJ0D 3DUSA 3T8MA 1DQDH 1ZWIA 1NLBL 2AC0A 5L6YL 5GGSY 4X9GA 1OGAE 4PRID 5KBLA 4XNZC 3MXVH 3C5ZC 4PH8A 3VWJD 1XGRB 2AJSH 4N9GA 5ERWB 1AMYA 2MIZA 5EIVA 1ZK9A 4JN1H 4OBSA 4DSYA 1AIFA 1DO5A 4PJCE 1CF8L 1IGIL 2ZTBA 3Q3GA 4XNXH 2WWMD 4TTDC 3VGAC 2K7QA 5D1ZC 1JWMB 2X87A 2DM2A 1NCIA 1EO5A 2WQ8A 1LNUA 2I60H 3P9WB 4GSDH 4GI9A 1YEGH 3Q8BA 4LHUB 1ES0A 1NM4A 4B7LA 1WHPA 5ADPL 1YO4A 2IANB 3QIBB 4S1RH 4K71B 3ULUH 3IU3B 3DHUA 1XSOA 2OMUA 4EQ3A 4YGVB 2PR9A 4MVBD 4APQC 1Z0MA 4I2XE 1T1ZB 3VCLA 5F7LB 3WL9B 1CD0A 1II4E 5J11C 2B0SL 2UZYA 4HEME 4UINH 1D5IH 1DJSA 4X4YB 4HETA 4GP8B 3D3VB 5HDBB 4G6JL 4F2MB 4IRZA 4KV5E 5JPNB 5CIPH 4PJGE 5E9DA 4F2ME 5FLUA 1B2YA 3WFHB 2O30A 3X17A 5GJTL 4HUVA 3WN5A 1TCRA 4OQTH 3L4YA 3N44F 4Y4FB 3VB8A 1NBCA 2HLAB 3K7UA 6PCYA 1XGTB 1MHPL 5EZJB 3RWHA 4AIZB 1HL8A 4AE0A 2AI0H 2FRGP 3GIZH 4GB9A 5D8JL 5KVFE 2UY7A 4M6NL 3CPLB 1MOEA 5I1IH 3R7QA 2J5LC 4M29A 1Y18A 4ZYKA 4JMXA 1OAQL 3A24A 4XXCA 4ZS7H 4ZSOE 1VADB 3MHZA 3QWRA 5A3ID 2AK4E 5I8EA 1F6AB 1BVNP 3JTSA 5FO2A 2VDPL 2GJRA 4N86A 4AJWA 1Z6JT 4FQQB 1INEH 1G4RA 2DYPB 3DWTA 1QUNB 4R0LA 4X50A 5J6GB 4XMKL 2CDEB 2YXVA 1U8HA 1ZT4B 4I89A 5IJVB 1D5ZA 5GGVL 1FNEB 4Q6IA 3VM5A 4ZMLA 5E2UL 2K4WA 3CHSA 1I7UB 1Z7JA 2WN3A 4GRWH 3ZKQD 2X4SA 6FABH 4M48H 3H7BA 4ZMPA 4Q97A 4L4VE 3T6WA 3RUGB 1E9OA 2WXJA 2ZPKL 1XR8B 3TH2T 4X7DC 4HWNA 4J6IA 1DTUA 2XRAH 2QADB 5A2FA 1SXCA 5F44A 3JYCA 3HA0A 3LIZH 1OE3A 4HS6B 3M7FB 3NDZE 3KYOA 5DUML 5LHDA 1WJ3A 3VQMA 2R7EB 3FFCE 2O26U 2UY6B 3OB8A 2H0JA 4Y2DB 4ZAKB 2OMXA 1Z0NA 2M83A 3ZE2F 4CW1A 5EEWA 4QY8B 4WV1A 1N7MH 4UT7L 4F15C 4Z7NE 4KROD 5LBVA 1T5XB 4BE6A 3MLXH 1QYGH 4G7YH 4JKMA 1P6AB 3BUDA 3V8OA 2ZCZA 1QRNE 1CFQA 2D9QB 4YK4B 1JNLL 4G6FD 5KSAD 3ME0A 1U4FA 5D6CA 5DJ0A 5I15H 3F62A 2YA2A 2HKFH 4YSRA 3TT1H 3BGFC 4XN2A 4MCZA 1QYGL 3MC0A 3IBEA 3TL5A 1G9NL 2E0PA 3ARDC 3Q1SH 1SHMA 4P3WA 3K71A 4N2MA 3O6MH 3MA9L 3SBPA 4ELKB 5JZ7C 3LQAH 4JRXD 4PCSA 3MBWA 1QR4A 3U7WL 4H26B 4A6YL 5GSVB 3WGVB 5LLIC 3LCYA 4I18B 3FU6A 4GMSL 3Q6GH 3KPQA 1BWWA 5I1LB 5B7EA 1KFAL 1MFEL 3TH3T 1RK0B 2DIBA 3NBNA 1PX4A 1Z5LA 4PV1C 5H35B 3FO1A 4A7UA 1RSFA 5D7IF 1NFDF 1A1NB 3MNVA 4TULH 3CTTA 5F7DA 4JPKL 4GKSB 2ZICA 3RKDC 3K6FA 3SKNB 1JPST 4KROC 2Y2WA 4JO1H 2CRZA 3MNWB 4C8XA 2ZSVA 2K9UA 3CSFA 4HLEA 5DZVA 3DOIA 2DICA 2EUXA 4G6KH 2P28B 4MD4A 3UTTE 2X6VA 1QI5A 4BWTA 2Q6WA 1TEGA 1CLOL 5DD6A 3TIDB 2GK2A 2P43B 3IDIB 3K1KC 2BSRA 3G5ZA 4HXBH 2XVGA 2GCYA 2AJVH 4LVHB 3ARGD 5IOKA 3S8GB 3HC2A 4RDBA 2MOGA 3QQ3B 3FO9B 1J0YA 3R7RA 4PYGA 1T2QL 2RGSA 4XOAA 3WFBL 3VSVA 3TNNB 4LEOA 4HIJB 4L4TD 3RI5K 3A6BH 4WW2C 5I76A 3FZUC 3GBEA 2I9LB 2YMXL 4PGEA 2PMZA 2YRLA 4J3OC 4F33A 4WEBL 1VAHA 1A3LH 1WRFA 5DLMH 2NXZB 4QTIH 4BGDA 1TF4A 1ZT4A 3AG1B 1IFRA 4DO6A 5I30H 4N8VG 1CXEA 1W8EA 4RWYL 2WAQA 3V6OC 2L4OA 5GRUH 2F68X 5E99H 3QIBD 1OSZB 1L7IH 3FK3A 5DD1H 1P5UB 2AK1H 4A2FA 2NY4C 2W0LA 4Q14A 4WFEE 3S98A 2MKLC 2N4IA 3OL2A 4JFFD 5LBGA 2YD8A 3HRZB 5D1ZI 1XBDA 3CWGA 3TV3L 2YAEA 1KJ2L 5HGAB 2YEQA 4XC1H 1P7HL 1NEZA 2Q76B 1QMUA 3QG6B 4Y2DD 4S0HA 1JF1A 1TYRA 2V7NB 4OTXH 4BSWA 4DEPC 1WPCA 1IBZA 4LRIC 4KZDH 4XMWA 2YD1A 4MWFB 3GTNA 3LOWA 4PREA 1EJFA 4U05A 5ES4B 4G8FB 4UTBH 1BAFH 3KL3A 2Q86B 3TBCA 1GOGA 4X4YA 2NY3C 1O7VA 4LPUA 4FZ8L 1E27A 2OP4L 2Y69B 4TQEL 4E41D 3P11H 1X5XA 4IOIB 4K5LA 1KYAA 1OSYA 4YGVA 2XQ0A 1OP4A 2DQFB 5DFWH 1MI5A 1OP5H 3Q2NA 4ZPVA 3WFCH 2YXMA 1AS8A 2X0UA 3K2UH 4AQZA 3S5ZA 1LK2A 1NUGA 4TQEH 4QRSA 2R4SL 2SEBB 4FEIA 5IW1B 3CVDA 3OWRA 2AGJH 2YQ2A 4Q9RL 3L48A 3NSCA 2J56A 1L0YA 2XJLA 4GG8A 2CCLA 1BLNB 3LIUA 4M1DH 5C0BA 1QATA 4S1QH 3H9ZA 3WO3B 1DBML 4M8QA 4YQXH 4WEUD 5D1QB 3LKSB 1WP6A 5D1XB 4AYID 5C07A 2E6JA 1CFSB 5JTWA 1GOHA 1MFBH 4ANUA 4N9OB 3MRDB 1U95B 1OCZB 1FRGH 3T0DA 4BFFA 5L4IA 3U2IA 5D2NC 2DM3A 2EH7L 2HVBA 3GBDA 3LN4B 2X4NA 4FFYL 1P9MA 3WKYA 4YXHH 1RV6X 4RNRA 1I9JH 4PJDA 3EFOB 4EIZC 4L37B 3S3JA 3BWAB 4DF9A 2BSTB 2C9XA 1PNDA 5F9AC 4U2YA 4X7FC 3GMLA 3ZE1F 5JNYA 1AC0A 2IIJA 2OK0H 2C1OB 4HKXB 4P23D 5TQ2H 3O4LB 2PXYB 4AEEA 4KXDA 2UZXA 1VCBC 1F11B 3VDAA 4G9FA 5FDWA 3OKOA 3BQUD 5FA4A 4JPIA 1TUPA 4BFIB 5ENWB 4OFVA 1LWJA 3CX2A 3QQ3A 3BYYA 4CJ1A 4Y1AA 4XE5B 2MKWA 3ETTA 5J1TC 1XGUB 4RISH 5A40E 1GGBH 1CDJA 1E4XL 2ZWYA 4HJ1A 4J39A 3Q44A 4DZ8B 1ZTXH 3AVEA 2BVOB 1DBBL 1DEDA 3U0TA 1RIUH 3KVQA 4LMQE 4XNXL 5DEGB 2NTFA 2VXUL 3QZWA 2WP3T 3B5GA 1AS7A 5KW9H 3BUTA 2Y25A 3LZNA 4PJ5A 3MLYH 5HGHB 1TYEB 4NSKA 4IOSA 5HHPB 1UOLA 1XH0A 2GYSA 3VH8G 5I6XC 3EZ8A 4O5LL 4TOYL 1BM3L 4F80A 4AY0A 4XTRD 2NOYA 4AT6B 3KLHC 4BBWA 1TETL 2ERJC 5E94B 3MLRL 1JGVL 1YY9C 4NXSA 1UGNA 1ZV5A 2WTPA 4RGMB 1KB5L 1IGML 5FK9B 1NLBH 3L1EA 5TE4L 2WC7A 1Q9LA 4L9LC 3K46A 4XWOD 5EHFA 3QARA 5KTEL 5DHXB 5HHOE 4BXVA 4WK0B 4BSJA 5L2JB 2OM5A 2VXVL 4OJFH 5T1KD 3RY6A 4Y5YB 1C7TA 4GUQA 1TSRA 4K15A 1JGDB 3W82A 1NFDE 3BAIA 4K23L 3L3JA 2AXGA 5CKAA 2J44A 2OX5B 1LO2H 3G04A 5F3FA 5AD0A 3BPCA 2ZUYA 1NZRA 3MA7A 4G6AD 5B1BB 4HCFA 1KCRL 2Y36L 3ZRCC 4KK9D 4ONHA 5G4MA 3UC0L 1X5FA 3H42H 2FR4A 1UUSA 1FNLA 5C07E 7PAZA 3K6OA 4RMQA 4H44C 5DQ9A 5A2AA 3DO7B 4OQTA 3ZTJG 4JKNA 5C0DB 1WA2X 4X83A 3BP7A 3UC0H 2HRLA 1UWFA 4PJ7B 4PWFA 1M05A 1AH1A 2H32B 5IMKB 1RFDL 1HHKA 2ZSWB 4XN5A 1VZGA 4J4PD 4PRHE 4OLYL 4WFFD 5AOMA 2EUZA 1IC4L 2A4EA 2FATH 5HD8D 4NQSA 5GS0C 5LDUA 4PJ5B 3ZZLA 2YR3A 4MHHG 4PGJA 4OAWA 4WO0A 1W6LA 1I85C 4XHQA 2V0AA 3EADA 4QNPE 1ASOA 4MYWB 5C0CE 3ESNA 1AZZC 2A4CA 3TC9A 2IPTH 2XY1A 2O6FA 4ZMOA 3VSUA 4KKQA 4HH9B 1LILA 1LO0L 5DZPA 1X5ZA 2YEZB 2FHCA 5HVFB 1TNNA 4XE0A 1AXTH 3SQOH 5CLYA 1N6QH 1BX2B 1WAAA 1KTDA 1YEDB 4IDLA 1ZLWH 5BZZA 2BDNL 3Q43A 4CJ0A 3TIEA 1KZQA 2N7AA 5D1QE 4CC0A 1AD0A 3KXFB 4ZMXA 4AZ8A 3SCMD 5ISZD 1M42A 4B3VA 2WYIA 2HTKD 5GS3A 5EWIH 1A7QH 4F27A 2VRKA 2H3NB 3EYOA 4GLRH 1A6PA 2ADFL 5IB4B 4LAJH 1BFVL 4FTVB 5DU7A 4Z7VB 3BKMH 4LE8A 4DP2X 1QI4A 4FTVE 3C8DA 4ZPTB 4NIKB 2WLYA 2OMTA 3C5SA 2FZ3B 1BLIA 3OGOE 4L2YA 4JY4B 3MRNA 3ARBA 1NSNL 2YD6A 3V4PA 3SD2A 4CDHA 4AMKL 2F53E 2NY4D 4FQ1H 1U8JA 1E4JA 1UXSB 4KQ3H 3FQUA 4XNUH 4DPAX 1S9VA 2QTEA 3NSJA 2VLLA 1KWKA 5DUBA 3CUPB 3H2PA 3MAWA 4IQHA 15C8H 5DVPA 4D0BB 3G9VA 1QLRA 4NRXA 4V2CB 1FFRA 4H25A 3T9WA 1PEWA 1G7HA 3OB0K 3IFNH 3MYZA 4KAQL 2KLTA 1E4HA 3WSQH 1HE7A 3MLTA 1HNGA 2FT6A 1JRHI 4BWWA 4HP5A 4OZHA 2WJ7A 4FFZH 1IGCH 1KEGH 2F5BH 4LLMB 4ZPVB 4IBVA 1BQHG 1GKOA 4BRVA 3D0LB 3UO1H 3K3QA 3H3BC 3H55A 3WN6A 1JK9B 4BQ6A 1E5ZA 1CC3A 1KJMB 1SVZA 2J6EL 1KWGA 4N9GB 4OCLC 2I60L 4GSDL 4DFHA 4PJDF 1ROWA 1NBYA 2NQ3A 4HJTA 3MXVL 4TNEA 1YRKA 1GY1A 4MMZC 3PFQA 4X5LA 5AW3B 1DFBL 1T1WB 3EGXB 4IW4C 3CZFA 3VXMD 5I19H 1K2DB 1H15B 1NBZA 4NM4H 2E7LA 5DEFB 3B7SA 4HSQA 4JZJB 4FKHA 1VACB 2B4CC 5ABZA 3CD4A 5C08B 1D7CA 1QSFD 3HI1A 2B9BA 2PTTB 3T4YA 3ZT6A 4YHML 2P5WA 3B7RL 2VLJB 3DTUB 1JBJA 3E2HC 3F6IA 5AVXB 1M05B 2VXTL 4JGNA 4DAGH 4Z7NB 4OFKA 1OWRM 5K59E 3DO7A 5ICXB 2QVFB 2QZ5A 1QBBA 3ARGC 3CQFA 3QO1B 2VXQA 4QRRD 7CGTA 4J5VA 2BVTA 3RWGA 4NQEA 4M7ZB 1J5CA 1KTCA 1DQLH 5TTRA 4ZT1A 4M6NH 4P57A 3I02A 1GCFA 3BPCB 3SE6A 2OMVB 3QXUA 5C2UB 4LEBA 2I9LA 2VQTA 1PAZA 2AEWA 4M7KH 3RIAK 3P4OA 4M8RA 3A67H 3B9KA 3S37H 2MEJB 2QMKA 3TNNA 2XC8A 5B39A 1PX8A 4MCYA 2VAAA 3F64A 3NJMA 3HR6A 3MR9A 2NCMA 5EUKB 3QEGL 3BVNB 3NSFA 3PGCA 1P7KB 3QUZD 4N3TA 4NNPL 4RGND 4I4WA 4KTYA 3P02A 1RP8A 4P5TA 1HX0A 1HILA 1EEYB 3QQ9D 3PP3K 1Q9LB 2YBRB 4XNMA 3FMGL 1EBAA 5ITFB 3SDAD 3AG4B 2Q7YB 1REIA 3GK8L 4LCWA 3WHE1 3BD4A 4N25A 2VYRE 2VMFA 4L4VA 2V5RA 3P3TA 3VM7A 1MFEH 4YHPB 3L8QA 4N0FB 3TFKD 5E0FA 1GL4B 3DXAE 4AT6A 3LXBA 4V1DA 3DXAB 1YEGL 1YMHA 3MU3A 3NPZB 3AQZA 5DHVA 4IHBA 2YPLD 3QXVA 3ZTCC 4J4PC 4LEXL 5D7KD 3MLUH 4FFYA 5F1NB 2AABL 1KIPA 4OLVL 5J56B 2ARJB 4NNPH 4DPRA 1UD8A 4CU7A 1X4YA 3G6JB 3QEQB 1L0QA 4TUUA 1WSST 5AKRA 5I73B 4XI5D 5HPOA 4DN3H 5K1NA 1DEEA 4OCYH 3AGWA 4NHUA 2JLLA 2H2PD 3DURB 1DLFH 2J5WA 3SPCA 4NNXA 3QPXH 5T3ZH 3BDBA 3HJEA 2ZXDA 1QZNA 5F8QC 3RIFF 3OLIA 5L6YH 3B2PA 3RFZC 1H3VA 3T6ZA 4PJFA 1BZ7A 3KVPA 5LDSA 4FNUA 3B8SA 5DMKB 2ATKA 3T77A 1INDH 3V52L 3VWKD 2CKBA 2MMXA 3A67L 3ESOA 5DMYA 1ZTMA 1J86A 3IGAA 5IKCB 2CMRL 1P4BH 2IBZY 5IMLA 2X7LA 3PHQA 4M5YL 4O02B 3LIZL 3BN9C 5E8EA 3OD3A 1ERNA 3QEHA 4P9HH 1HZHL 1Q9KB 2A4ZA 2HX9A 5E03A 3HNTH 4HHGA 1EPFA 1G7JB 4HIEA 3DTXA 3BD5A 2FJSA 1V7NH 5IBLD 1E4WL 2EEAA 3MUJA 4I1NB 2GFBB 5C9KA 1S8DA 4TUKH 4V33A 3H85A 4ZFOB 1PVHA 2ZOOA 4UNIA 4UOW0 3IGLA 3MACH 3EHBC 1XCXA 3VXPA 3MJWA 2P8LA 1U91B 4FDWA 3VFSA 3PY9A 4HU8A 3QK0A 1GC1C 1DVXA 2YHGA 1D5MB 2I07A 4P46D 4W9JC 4ZO7A 1VEMA 5ACMA 5DJYB 3RL1B 1FIEA 5IQ9B 2B39A 4GAGH 2YPLE 4NFCA 4JM2C 4G1MA 2ICWI 1CD9B 4QXTB 1I7TB 2E9IA 3QNYB 2XNAB 3OMIB 1OV8A 2F5BL 4XP4L 1LEIB 3IJSB 3NJLA 5GGUB 4AV4A 3T1FA 2V17L 3CBKB 2D9CA 3O3EA 4R4NC 1SOXA 2IH1B 4UZUA 1QAWA 2NYKA 2J6EH 1GGCH 1KDIA 1IBGH 1IQDA 4PJFF 3O4LD 4URKA 1L4IA 2VT0A 3VGBA 4TF4A 3SDYL 2BK8A 2XPYA 1USQA 4JL1A 1BWMA 4UU9A 2BX5A 1G7IB 4LLYA 1XXDC 3WEXB 3O2DH 3RPKA 4YR6B 3E8VA 3V0WL 3N42B 1E5AA 4XO4A 1HEZA 3PL6D 1UXMA 2FVNA 2C3VA 1P7QA 4P5MA 4KDTC 5F71A 3GZQA 2ZYIA 2AKRB 3H53A 4EUPG 4FHBD 4C56D 4LLAA 3MLSL 4WUUA 5IJBC 3CZUB 1NDGA 3LQAC 4P2RD 2OJEA 2N01B 5DDHA 2NSXA 5MEQB 1ZT7B 5IZ7A 1OCOB 2WBWB 3C9NA 1A7RH 4IBYA 4P2AA 3T6VA 3U7YL 5FUZL 4HXBL 4RBPK 3ZE2B 3LX9A 4P9MH 2FUQA 2HYMA 2X4UB 4LLWA 4LSRL 3TBBA 5KG9B 3P0YL 1HK6A 1UJ3C 1AGFA 5IVOA 1ZA6A 4PRDB 4G42B 1VJSA 2X2JA 5I9QB 2L7UA 4R4FH 2VC2B 1OK0A 5EC1B 1T0MA 1ZIBA 5JQ6H 1QNIA 4S10A 1OCRB 4MKMA 3A23A 5JYLA 1GC1L 5EO9A 1VGKB 3ZR6A 1FQ9C 3PJNA 3MX0B 3L16A 3QO0B 3JV4A 1T20B 3NFPB 4LSSH 3FCTB 4QXTA 3FH8A 1UT9A 2JELL 3CDCA 3M17A 1WZMA 2G3XA 2VDLH 1FL3A 4YZWA 3V0VB 1JWMA 1HXKA 4OU3A 4RFEA 5AOLA 4H8WL 1AIFB 4AEIL 4ZMZA 4QOKE 4OJCA 1O6SB 4OZIE 5IMMA 3C60A 4M6OH 3VGDA 3AB0B 4D9QD 5DD6B 3MJ8B 4F57H 4Z7OE 3LKQA 3VFRA 4WW1A 3S36X 3N1QC 2HXAA 3LH2H 2OP4H 3MLVL 2QKIC 4OSUL 5MI0B 3MOBH 4HIEB 3V4VA 4J3OH 4A68A 2GUOB 2DYRB 4J3BA 1RUMH 1I7UA 4GMSH 3OC5A 4HAFA 3I6LE 1DSWA 4KY1H 1G87A 2JB6B 3D48R 4OKVA 4IRJC 2IAMA 4L4TE 1E28A 4X5XA 4R0LC 5D96C 3S2AA 1RFDH 4XCYB 4GEIA 1SXBA 2LLGA 1UD6A 4K3GA 2HT2C 4KX8A 3TN0A 3O3DB 2UZIH 5IFJA 3UO1L 1QLEB 3GLZA 5HHOB 3UABA 2GITA 1FNGA 2F54A 3FQYA 3WD5L 1QRNA 5L4JA 4ZFFA 1AGFB 4YXLL 2I5YL 5E6UB 2V9UA 1LK3H 3TPKA 1R0AH 5CINL 1K6QL 2H1PL 5E2JA 4AQEB 2MCAA 4ZUVA 3FUJA 1BBDH 1ACYL 1N8ZA 1UH4A 1I8AA 3MCLH 1BA9A 3OAUL 4NHCH 4CSTA 2XI9A 2X40A 5IMOA 1KSRA 2KH2B 5CSBA 3SJVA 1PLCA 3P73A 4XPGH 4BZ2A 4JHBA 4QCIB 3TZVC 4ZW7A 1F4YL 2VDOH 5L88H 1J10A 1T5KA 4K23H 4QRPA 1FL5A 3LH8A 1W2KT 2FNBA 1WWCA 4OZGE 4TNWF 1EEUA 3RFRA 2BH0A 3MRCA 4BA8A 4WI6A 1C1EL 2O5XL 4EXKA 5G4NA 4H7VA 2VTFA 5E8OA 3E8UH 4PI0A 4YR6A 5IW6B 4B3EA 3INUL 4BSVA 4LT7A 4ZXBC 3QZMA 1KF9B 1GCYA 1MRCL 3W9DB 4DN4H 4QY8A 4WV1B 4OCWH 1Q9OB 1MRFH 3X11B 4YXKL 3BP5B 3FB6B 2E6PA 2Z64C 3G6AA 3LQZA 3NRFA 4NP4L 5TF0A 2OMUB 4MAYB 5EPMA 3W0WA 1EZVX 3CH8A 2YBRA 5ITFA 1R19A 3P4LA 3PXJA 4K3DL 4I87A 3FUNA 2XNAA 3NCEB 1AFVH 1JZDC 2YGPA 3ZHLA 4NS0A 3MRHB 2VAAB 1B0RA 2XPGA 1PFCA 4JO1L 1UA6H 1N67A 3H7BB 1XIWB 3FTVA 3Q3GB 2B1HL 1CT8B 1AS6A 1ETJA 2WGNB 4HUNB 4TM9A 3W81A 2RH0A 1NOAA 1NLDL 1U42A 2FCBA 2H2PC 2Z8VC 4N0RA 1P4LA 4OD2B 3EH2A 4YBHA 1MCHA 3EYSH 3REWA 3WFZA 2C9AA 3NDYE 4JX0A 4DT2A 4IU3A 4EZLA 1DBAH 3GMOB 1PG7L 3PWLB 2DYPD 3VD3A 5B3JE 1T83A 4P4KB 3DNKA 1F6AA 1OSPH 5KVEE 5ACLA 4PJXE 3UCRA 1TENA 3RIAF 3ROOA 1MCWM 4JO2H 4RX4A 4XB8A 1U8IA 1IIIA 5AG8A 1I4FA 1BOGA 3CSYA 3PQYE 2ZOLA 4U7SA 1YJDL 3BLPX 3V4VH 3VD9A 1TCRB 3IEAA 1KBPA 4IGBC 3QIWC 1ZOXA 2R2HA 1S5IH 3G5XB 3D25A 5INCB 3GMOA 1YMMB 4MAUL 4P5RA 3I50H 2VOTA 3NCMA 3H8NA 4Q7DA 4XBMA 1FAIL 5HI4C 5DJ8B 4H0HB 4CRPA 3D0AA 4P2QE 4W9DC 4M7LT 1D6VH 5H4ZA 2P3YA 1VKXB 3BXNB 1GKEA 3C08L 2AV7B 1C5CH 1LHZA 3C5XA 1KIPB 1DVTA 3BMWA 1LDPH 1LQSR 1S7QA 4KQ0A 1DVSA 4JGMA 2QGCA 4Q6YA 1SEQH 2GBTA 4N0FA 4D2NA 3BDXA 4JDEB 4BFGA 4PJCB 3ZYJA 2PXYD 3OJ2C 1I8MA 1NGZB 4RAHA 1ZTXE 3KWXA 4I1RA 3S4SA 3HFMH 2CBOA 1SEQL 2APFA 4LZKA 4GRLD 4HG4K 1VFMA 3IKCA 1SQMA 4LSVL 4CVWA 3F65A 1T66D 3QJQB 1INEL 2CWRA 1NTDA 1H5BC 3HN3A 5D7JD 2ZF8A 1IVLA 4FTVA 3ZX1A 3FZUD 4N4YB 3DA0A 2P45B 1QW8A 5DZJA 4D8OA 4BDVB 3QXDA 1JF5A 1TDQA 1XF5B 1XGQA 4DCQA 4NZRL 3NMEA 5C6PB 3WU1A 3S8FB 2DQGH 2AJYH 3OKEA 5ID0A 4XX5A 5I6OA 1OZTG 3SO3C 5T8IA 4IIQC 5I6KA 4NQEB 1PLGL 3ZQXA 2IAND 2XWBB 4H8PA 1CL7H 1RMFL 3FOLA 3HS0B 4GYBA 4C58B 2C4FU 5F0PB 5PAZA 3ES6B 2BHFA 4A04A 2CCWA 4F7PB 2XX0A 4ZD3H 1NMCB 4ODVL 1N5YL 3ZKND 2NZ1A 4R4BA 1KIRA 3L9RA 4NQCD 1JPSL 4F7MA 5JIHA 4GW1A 1JZGA 3V95A 4NWTL 3BE1H 3V0WH 5G4OA 2VN3A 5DFAA 1YECL 5KVGE 2DQDH 2ZG3A 1X7TA 3F2LA 5TJWK 3UROR 4ZNCD 3FO0L 3VFVB 4QF1A 1E8XA 3LH9A 5T3XE 3JV6B 4JZNA 3BIKB 1QQDB 2J2ZA 4OFPA 3MLSH 2QQNL 5DUPH 3BP6A 4AK2A 2KZKA 1B4JH 3R4RA 3BLBA 2NZ9D 3REWB 5E4AA 5LBSA 2IPTL 4BUHA 4E9TA 4XOBA 2R0KH 2GTWA 3GSOB 3MRMA 4GIAA 2VXSH 5DD5L 2GJ6B 4HHWA 4PJFE 3Q01A 3TWCL 4RGNE 5A1AA 1KJMA 4ZQTA 4G9DA 1U8QB 3CZSA 4F8QA 5SV4A 1P4IL 1G1OA 3MKKA 1R5VB 2AJSL 4LLMA 1IM9A 1MCOL 5BS0A 1YUHB 3O2VL 3O6LH 4MD5A 3K72B 5D9SB 1ZIAA 2DBLL 2YKLH 4I13B 5FYKD 4ENZA 3EBHA 4XOEA 5ESAB 4FX5A 5IP4A 1TJIH 2CO3A 1KCKA 1QD0A 3UAFA 4MA3B 2C5DC 2IEPA 3ABMB 4PRNA 2L3BA 4RAVA 4ABUA 3QUXC 1BAFL 1XAUA 5TPWL 5E8PA 2CSPA 1QZ1A 4R2GB 1E2ZA 4QGYA 4XMUA 2JKLA 4U1IB 2MNJB 3F7QA 2QVIA 4B27A 1M6UA 2Y5QA 3TEXA 4MJ5A 4D8PB 1JL8A 4P8QA 1FLRL 1NMBH 1I7ZB 4U1JA 3PDGA 4YAQB 3UAAA 1FL5B 4MJIB 4UDUA 1ZVSB 4Y4FD 4KK8C 3SKJL 1LO3H 4EIGB 4MB3A 3DPBB 1V05A 3GNMH 4NZDA 1AO7A 4XBEL 1TJHL 2HKAA 3ZKMD 3S2CA 1FV1B 2WSKA 2IH3B 5ANME 1FZJB 4ZFQA 2RACA 4EDWH 1S9WA 2IXQA 4TUJA 3TCLA 4FXGB 5D5MF 3MGOB 4Z6AT 1A6TA 1G94A 3O8XB 1G9HA 2GJPA 2QQLL 3QNZB 1J05B 2JKTM 4Y89A 3KH3A 3ZKXB 2ORBL 3HZYA 3QIWD 2X4PA 4KKBD 1B4RA 5HJGA 2MQ0A 5F1SA 4LU5L 1ETZA 1RJZA 3D4ZA 3QNXA 4PJGA 5E9DE 4E2OA 2AJ3B 2F8VA 2HKHL 4XAKE 5T3ZE 4P2OA 1QHOA 5FYLE 2IAMB 2C9UA 2ITEA 3AW5A 3TT3H 4PV9B 3ULVC 1ZJBA 5IB2A 3CXDL 4GBXB 1WWWX 2P7TB 4OCXH 3FU7B 4YHKL 4AENB 2OA9A 1AHKA 1TJMA 2OI9B 2YSTA 3N04A 4XC3H 5F6HI 2WK2A 1I7RA 4KJPD 5DJDA 4G9FB 2HJLA 1YPZF 4Y4KC 3RVUD 3CFEB 4IOFC 4JMNA 1WCBA 4GPVA 4Y2NA 2OYPA 4LCCC 5I1GH 3BWSA 2WMPB 1JI2A 3UEQA 4J8RA 1RJCA 1XZ0A 3DJTA 1K8DB 1CURA 5FKAB 1Z66A 3L4CA 3IJEA 3BWUC 2YAHA 2DM7A 2FO4A 3DTXB 2VDQL 5A43C 4WUKH 1GZHA 4XGZB 4MDRA 5D2LF 3MDJA 2JTYA 4PWEA 1MJ7L 4GRMB 2FBJH 1M3JA 2GK0B 3VFUA 1IEBA 4DW2L 4PJAF 3DC0A 1JP5A 3D2TA 1M1XA 2VUKA 1S7TB 3GXPA 4HT1L 5TQ2L 5FM5O 2EDBA 3QC6X 2AGJL 4MJ6A 4OD3L 1SBSH 4HFUH 3IDJA 5KSBA 2QSVA 3WIFA 5C71A 3GSNA 3QAZB 3LKPA 1MWOA 2BLFA 2J8OA 4O2EB 4R96B 3TS8A 1HCZA 3SKOB 4E9YA 3C9NB 3A0OA 5HHXH 3B7YA 3MUHL 4YNYB 2MCPL 1B3JA 3HC4H 3EDFA 1BXXA 1UYWH 2NX5E 4P07A 2OJEB 1OAXH 1T04A 4V2BA 3U0PA 1OE2A 3HBGA 4NPJA 4NRZA 3MRJB 1BPLB 3QJTB 5DMGD 1JHLH 4P5MB 4RVBA 2UWEE 2KHAA 4OLWH 2UWEB 3RRQA 1MIML 5JW3L 2AQRA 2X89A 3QG7L 3EJYC 4MWFA 5HHPA 4MDJA 5JXAL 3ULVH 3ZT5A 3IMWA 4MX7B 1IAIM 4GAJH 4XXWA 1FLTX 2WKGA 4L3ED 1UB5A 2X88A 2EDFA 1F5WA 1IQDB 5ALCL 4J27A 1QWHA 4NKDA 5KYXB 2Q7YA 3JXAA 3L5JA 4OV5A 4Y9EA 2H26A 4PLOB 1N0LB 1IGFH 2WWNA 2P8MA 1JMXA 1ORQA 2K8QA 4WI0B 1WE5A 3O0LA 4IGBA 2MOVA 4I4WB 1U8PB 5ALBL 3WHXB 1KB9K 4ZMNA 3P3RA 4I0PB 3U1QA 5LUMA 1JTOA 4GJTB 3A6CH 4LCYB 1ZEAL 3LKOB 2CCVA 1L9PA 4UT6L 5LWYH 4JGJA 3V52H 2EXWD 4E5XA 1NINA 4MAZA 2WBJA 4DEUA 5C0FB 5C2BL 1CI5A 2VXVH 5B7FA 1DSFL 4QJ3B 5FYKH 1J88A 1OY3B 1A4KB 2AK4D 3O4OC 5F1IB 4YE4L 2NCEA 1DVUA 3ROLA 2QPFA 3FQXB 5GS1B 5EU6D 5CGYC 2HMIC 1U2HA 3AS1A 3MJ7A 1UUNA 3IJEB 4P05A 5EO0B 4OLUL 3OPUA 2MCMA 4NQDD 3G5ZB 5H94A 5A7BA 1KULA 1SMAA 1B88A 4LESA 1U95A 1R3JB 1KJ2B 5EEVA 1NLDH 1MY7A 2FGZA 2WUCL 2ZAHA 4XO8A 2VZOA 2YA1A 5CIPB 5FGCB 3EYVB 3GFUA 3JWNH 4OF0A 4UWQB 1OQXA 1KPRA 1TKWB 4G2AA 1HN1A 4J2QA 1CO1A 2EZ0D 2P80D 4Z7VF 1AY1H 4MDIA 4TNWK 2FEDD 1RULL 3V0AC 2FX7H 2AQ1A 4E42A 5JXED 5E7BA 2J43A 4Z7IA 1C12A 2BOBA 2WWKT 1BVOA 3JUYA 3CVBA 1H6UA 4XMPH 5MP6L 1O7DC 4WO4B 2FH8A 2CD0A 3S7GA 4ELMF 3QB7C 4PJ8C 1OLZA 1HKLL 4PJXA 5JHDA 3Q5TA 2N1TE 3NOIA 3H9HA 1MHHB 2VDRH 3LZQA 4O2EA 1TQBC 3ZYZA 3UTTD 3QR1A 2NDFA 3GJEB 4L3CB 3U7WH 1BJMA 3FTYA 5DHVB 3KS0J 4AXWB 5HJ3A 1FVEA 1HXYA 3K71B 1AHWB 3IFPA 2PKDA 3ZE1B 1WFTA 5HHVL 3D85A 1NDTA 3GGWB 1WFUA 3DSFL 4YHPA 4KVCH 1XBRA 1KFAH 1QLRB 1ZV2A 4YMPA 1AQDB 4UOJA 1YN6A 4LCWB 4AZUA 1ETB1 1KENH 1J0ZA 2XWTA 3EFFA 3QJHB 2VDMB 3RWJB 2IBGA 4JRYD 4XNMB 5CAYB 2EXYC 5GSRA 4M6AA 3SE4A 2FE0A 2ZOKA 4EN3C 2ZWZA 2A83B 3LMJH 3OF6A 3UG4A 2VDMH 1I8KB 4YQXL 1IO4C 1VERA 2FZ3A 3WDJA 4FP8L 4XPGL 1ZS8A 4HOXA 2OR9H 2OMXB 4FQXB 5DVNA 4ZAKD 4BFNA 3OMZA 4S0TD 4W81A 4WWKA 5FPIA 3NPSB 5EDSA 4JKPL 5FGRA 4RMVA 4GKLA 5FX3A 2XPZA 3SD5A 2EH7H 3F8UB 3RTQB 3HG1A 5IHWA 3QFJD 2WLZA 3U4EB 3IMSA 5I19L 5LG1A 1JWSB 1BFOA 2ENPA 1F56A 2BWIA 4OGYL 4LVOB 2HVJB 4IEFB 3SDAB 5J13B 4LEOB 5EFIA 2X0WA 1JZHA 2XN0A 4E5XB 5KBNC 4M1CC 1T0NA 2DWDB 4QRQA 1DHKA 3FO2B 5E5RB 2JFCA 3HUJE 3LD8C 5ICXA 1VPOH 3QS3A 3OKYA 3KPLB 4XCFH 2WUBH 1DFBH 2P26A 3Q9QA 4MA1B 4F37K 3QXAB 4AV5A 3WI9A 4JO3H 1NIBA 1QFWI 3JVFC 5IR1A 4NC0B 4X8XA 2WSDA 4OKDA 1OOWA 2PTTA 5KVFL 4HZ1A 1FFNB 2B08A 4X6EB 3HVNA 2Y6SC 4D0CB 1NC2D 3GHEL 1GJIA 5DD0L 3OKLB 2KYIA 3ZHDA 1BBJB 4NQSB 4GG6A 3EYQC 2Y1AA 1FV1A 2Z93B 3EFDL 3FO1B 3HC0B 2MNWA 3GSUB 2FT8A 3UTSA 3IJ7A 2WO4A 5BOJA 2D3LA 2D7QA 4MJIA 4HWUA 3QDJB 2PYFA 3OAYH 1IRAY 2R0LH 4TL4A 2QGDA 4YNYA 3FONA 3LN5B 4AQAA 1AQKH 3MMEB 4QXWA 4F2MA 4FFZL 1KEGL 3MOQA 4UTBA 2NY3D 1U8NA 2GIMA 1OAUL 5KOMC 3AXLA 2NTSP 3JZYA 3QUYC 2YUZA 4JG1L 1MHPH 1AXSA 1G0XA 3L5WA 2VCOA 3RWCA 2IDTA 4N2IA 4KTEL 5FIEA 3WTTA 2D7PA 3IF1A 2XETA 3QRLA 1IE5A 2AJXH 4XC3L 3VXTB 4MMXC 2ZAGA 5AW8B 1YEHH 4QO1B 2WLNA 5ESAA 2GAZB 4XPAH 5CGTA 2ZX7A 4JO2L 4NZRH 1BD2B 4WZ9A 4J8QA 2G75B 3TJPA 2APTA 5I1CL 1ZLUK 2QSCH 1GA2A 4JKKA 4YS4A 4J3SA 4N8UA 5KBDA 4OZHE 3K6SA 5EU4B 2IWFA 3NZSA 1WZ1L 1CTNA 2EIMB 1OANA 5D93C 3BP4B 3IJHB 3L2LA 3RNKA 2K7PA 3H0TB 1KPUB 3EAKA 3GM8A 4DQAA 1DLHA 2Y72A 3RWEB 4ALAL 5IB3B 2WKLA 1T7YA 3EFDH 2ENYA 2ENJA 1RULH 4BA0A 2W81C 4XZ4A 5F93C 3BCDA 4JKWA 4O58L 1IIKA 4M5ZH 5E8DH 5FXCH 3CFBB 3QZPA 3ETBJ 1UD5A 4N90D 5IB2B 1N64H 1DJXA 2V2XA 5I1GL 5TFSL 3V5DA 3UZVB 1BGXH 5DSCB 3DIFA 1CCZA 3C09C 3IETB 4JM2A 4DUXA 3UYPB 4TUKL 5K9KA 5DA0B 3HBQA 2QL1A 3ES6A 1FZMB 2G3ZA 5INCA 32C2B 3ZTDC 4UV7H 3BGMB 4ZTEA 4B0MM 4XO5A 3AS3A 4HK3J 4JLRA 3CCHB 3T2LA 3NCCB 4HWZB 3CPUA 4FXKC 4GXFA 4M5YH 2F61A 1R9FA 2HT3C 1ZHKB 3QJFB 4PGBA 4PRBB 4JFHE 4J3OD 3LNEA 5I8CB 2PO6C 5CU9A 3C60C 3CX5K 4IKLA 4NZFA 3B9VA 4IBWA 1I31A 3KR3H 2W0PA 4FQXA 1IM3D 1UM5H 3OMNB 1BVNT 3FCGA 1WV7T 3IM1A 2APWA 1X5MA 5CGBA 3TA3A 4AJVA 3ESPA 4MJIE 5C0AD 4AQ1B 1K6QH 2H1PH 4I8DA 3HZKA 5DD5H 4KJWD 1CFSA 4G82A 4XX1E 5FO7B 5DJCB 5IF0B 1HCFX 2OX5A 4FYSA 3EOAB 1NH6A 1MZZA 5FWQA 2VMJA 2IMNA 3GGWA 2OXHA 4JFVA 4XP9L 4QYOB 4PJHE 5CXPA 4QKXB 2FEDC 1A4JA 4JPVH 3GKWL 2ZOUA 4JE4B 1RZKC 3BYTA 1KDJA 1T1YA 3DX6A 4MD5B 1CLOH 1LEKB 1TZHA 1ZDSA 1O0VA 2EILB 4FNLL 5HGBB 4WFFE 5ICYA 3FUMA 2WVUA 2J4WH 4OW6A 5FUCE 1DJWA 4G80B 1E5CA 4E9QA 2OBGA 5DJCA 3CVHL 3X1BA 4DHLA 4YSSA 2XTLA 3FRUB 3PV6B 1VFBB 2IGFL 2V7HA 1S4IA 1LDSA 3BEWB 3EUDA 4O2FB 1XGRA 3S35X 1SPDA 3TZVA 2ICEA 3PL6C 1VZHA 4NKIH 4KQ4H 2Q9OA 2ZOTA 4YDKL 4KOCA 1OM3L 5CD5D 4TNFA 3UZEA 2Y5EA 4F7EA 5DS8A 4QRPB 4KI1A 4ZDHB 2P5EA 2KC0A 3CZGA 1HQRA 5FYKU 4PJ9C 2PNDA 1A6VL 1RZ8B 4G6MH 2P48B 1R3HB 1LVEA 2IG2L 2IV9A 5IESL 1GGUA 1T21A 5AW7B 5I6PA 3Q7JA 5HDWA 5HGAA 5D4QA 4XMLH 2GSMB 3P0YH 4HW6A 2C3WA 5I1DB 1UKSA 4TSCL 2BC4A 4HWEL 5J06A 2XKSA 4WTXA 2J1WA 5LVEA 2FTAA 5K33A 1W0VB 3IU4H 3BGMA 2QELA 5KUMA 2Y07H 2N0MA 2GTZA 5EO0A 1YAZA 2EDDA 4F1SA 3WOVA 1F42A 5HHOA 2EVJA 1JFQL 1C8PA 9PCYA 2NY1D 2CLRA 4M03A 3FB5A 1HWWA 4FABH 3FFDB 1H0DA 3C6LB 3GMPB 5I5RA 5SX5H 3RVXC 4UNTA 1PDKA 2V2XB 1Z9PA 5HTSA 5CS7A 4BDVA 3SDYH 3H9YA 3CFBA 1J1OH 1OXYA 3HKFA 3U0WL 2CO6B 4XP6L 1LQBC 4I48B 5E9DD 5A2BA 4UT6H 1CGSL 1GZPB 1QFPA 3U4BL 1SN2A 2AQSA 1OD7A 3VH8A 3HJ0A 4PJGF 4PN6A 3WEMA 3NFNB 1O9VA 4KRPB 4ODHH 3TT3L 1T22B 3NSYA 2DQCL 4A2EA 2X4TB 2GUYA 3PS6A 1KEML 3LV3B 3WFCL 3ZTJH 3FTZA 3N44B 1HOEA 1PD6A 3GB7A 3UPCA 5IWLA 1TO4A 5D1QD 1F3DJ 1T1XA 1JNNL 1I1AB 1Y1UA 3R4DA 2BP8A 1XCTB 1XF4A 2E9BA 2ZX8A 3WO4C 3ZHFA 1EJOL 3QWRD 4AH2A 2G3NA 2EDLA 1LO4H 4G8EB 2OS7A 4MDJB 1CI3M 2NX5D 4C83A 1BQSA 3FCTA 5I0WA 2DMKA 4NO0B 4QHLB 3E6FA 3Q5OA 5AVUB 2PCFA 1R3IL 3WBDA 4YPGA 2D8KA 1WBZB 3MUY1 4N1EA 3UERA 4M5ZL 2Y6TE 3C12A 4H1LG 4H20H 1A65A 3RJOA 2C7FA 1MHEB 4FHKA 2CIKB 3WUZA 3KPMA 4NDMA 1U3HA 1AXSB 2ZXWB 4RSVA 5AZEH 3GBNL 3F84A 4K3EL 2X6CA 1MJ7H 3WTVA 1RSYA 2Y1VA 5SWQA 3SDCB 2FGWL 4MJ6B 4QPEA 3VXSE 4CGUB 1XGYL 4K7PX 4C57C 3GEFA 4QTHA 4FL4C 4JFED 3B2XA 3AXHA 1NEZB 1ULVA 4X5XB 4YHIB 1HZKA 2ZXEB 4GP4B 2R39A 3FSAA 4S11A 1JXKA 3HRZA 3DVNA 3RPIB 1J5OH 1VGEH 4Z7NF 1OP9A 5D7IA 2G9HB 3ZL2A 4GQPH 4X5PA 3NCFB 2HVKA 3BJLA 1JSYA 3AABA 4WWPA 4UM9B 1MELA 2BCKA 2BWQA 4KK6D 4KVCL 1IBYA 5ESVB 1ORSA 3JV5A 2F2HA 2Z4TA 3VFOB 4B0MB 4P3CL 2GEQA 4ADIA 5I71B 1BVLB 1UB6B 2C9VA 1I3VA 3IXTB 3M6DA 2W38A 3V5HA 4HSAC 5C3LD 4MMYB 2IPKB 3B9AA 3X3FH 4H8UA 1LEIA 3PHSA 1SBBA 3CC5A 1QR1A 4LQFL 2G2NA 4EKXA 1AR1B 3THMH 5HD8C 4W4OA 5CBEB 2I9TA 4WWID 3KYKH 1NGXA 2V9QA 1RUPL 4Y0GA 4L0YA 3BSGA 1CBJA 1JV5B 3QO0A 3DOSA 4G72B 1XSIA 4RIRA 4YBLB 3WS3B 3O4LE 5I74B 2VQ4A 5LN4A 4N22A 4XBEH 4ZSOB 3NJVA 2QT6A 3S37L 4PG2A 4W70A 4PWKA 3WE1A 5EIQA 1Q1JH 1ZS8B 3GHBL 4G42A 3W38A 2R4RL 4APQD 1AKJA 4GS7C 5I8EB 1I1YA 3INUH 5CJQL 2V17H 1MWAH 3FS9A 1IFGA 4AYMC 3V6FA 3FQRB 3I9GH 1SF3A 2FHBA 5EU3B 3FT2B 3MN8A 1V7ML 5EU6E 3Q05A 3HHRB 1B3IA 1BXAA 4NBZB 4DGIH 5C9JA 3PQYB 2OR7A 5IREA 1USZA 1IGTA 2RMNA 4TSAL 1L7TH 3JT2A 5FF6A 1NAKH 4QCIA 3NESA 2PPCA 1MKFA 2PWDA 2IWEA 5FUOH 1ECYA 2PPAA 2DD8L 1JVLA 2AEQL 2IPUG 1QNZL 4Z7QF 3WG7B 4P99A 2GEEA 5B22A 2A1WH 2AMUA 4UQDA 3TM6A 1LO2L 5AAWA 1H6FA 4P04A 4ELMB 1A1OA 1E8WA 1TFHA 3I85A 2EEBA 4MXWL 3H9HB 4N2OA 5FUOL 3X14A 4NDMB 2GITB 3GRGA 5ID1B 1D2PA 3BKYL 1I9RL 1HC1A 1KB5H 2ZIDA 4R9HA 3GSWB 5D7KE 2WLIB 3QIBA 3WJLA 3ARZA 2YEVB 4YZFE 3W9EB 3ZL1A 4ALAH 4ZNEA 4YSUA 3LQMA 2EXSA 3SYPA 1UD3A 4U1GC 4ZTOH 2ICWB 4QHNA 1YYLH 3F7KA 1CGSH 4L48A 1JTPA 2HJFA 1T5XA 2I9TB 4ES8A 2VDPB 5I1JH 4N5EC 4YHOH 1DP0A 1UACH 2ED9A 3GRWL 2UY6A 4Y2DA 4XOCA 2O93L 5FO8B 2DDQH 3CDGB 3LKQB 3QULB 4L3EE 3CFKB 3KHQA 3MCKA 3OKMA 4ZUUB 3MCG1 4MHHI 1O5DT 4PWJA 1MAKA 2J71A 2B8OT 4ABWA 4XPFL 2BCKB 3MRFA 2EYSB 3CFDB 1KTLA 5GZOC 4DETA 3TBTB 3KLHD 4CC4C 1MWAB 4CNIB 2EDQA 5IT2H 2EE9A 3V10A 3II1A 1PD1A 4QT5B 1WEJH 1Q9KA 3T0EA 5GRVK 3UG5A 4GS7B 3N91A 4FQPA 1A4KA 3KPNB 3RWFA 5F7WC 2DRUA 3U6RA 5JOPD 3ELQA 1K8IA 3L3KA 3ARRA 1CL7L 5EU7C 3MFFA 2FHFA 2YSSB 1BM7A 5HHMB 3TFBA 3ULAB 3LKOA 1E30A 3BI9X 3FL7A 4HJGA 1IAKA 1KNOB 1DBJL 3NJJA 3B2VH 4RGNC 1F4AA 5SX4I 4PJ6A 3WHXA 3WLBB 4C56E 3QCUH 3L3DB 2Z31D 2M8XA 3L95B 4M62H 2X4UA 4TVUA 4M8VA 5C0BD 3VFMB 4HUCA 1LTXA 2CO4A 5HI5D 3DURA 4HAKA 4I88A 3QAQA 3PGFH 1ZT7A 4LP4A 3WTWA 1ONQB 2F8IA 2QGEA 6CGTA 1MFCH 1TJGL 2ICEC 3U4AA 2JCWA 4LSVH 4DKTA 2IDSA 1EXHA 5KANG 3CZFB 3SB3A 1JVKA 4NO5A 2WYTA 3AWGA 5GZOD 1P7BA 2BNRD 2GIYA 1GGIH 1TITA 2DDQL 1V10A 4UTAA 4IK6A 3MOAH 1FSKB 2L7EA 4P23A 1CIDA 3OR6B 3SPHA 5D1XD 1UATA 3NA9H 4AVJA 3M88A 1FN4B 3H9SA 3IN0A 3BWUF 4ORGB 1BZ9B 4G9FD 4K9EH 3WNIA 4RFNC 2CO7B 2JIXB 1TZHB 4Y19D 2XXGA 3IGUA 3SKUD 2WZ5A 3SBQA 4Y4HB 1JZJA 4MCNA 4EEEA 4OLXL 3INOA 4UTAL 2A38A 3CZKA 5AVSB 5GS2H 5GZND 1QLFB 2FX8H 5KSUA 3WHE0 4ANWA 3VFGL 2VLJE 4I48A 1T4KA 1JGUL 1FZKA 1DUZA 1AXIB 1N2RB 3WUWA 3ULUD 4P46C 1YEJL 1KB5A 4WWOA 1IBFA 5J12C 5IQLA 3BH8A 4I77L 4AK1A 1AOHA 4D0BA 3D52A 4IKJA 4K3JH 1S78D 3PPEA 3U30B 4AYEC 2RQ8A 2VZTA 4PJ5D 3HUJA 3ULSA 2VLRA 4F9PC 1FYTE 1U9KA 4ODHL 4ZNEE 2NY2C 4POZC 3J27A 3CK0L 2D3NA 3BCFA 2XFXB 3WKML 3MRNB 3NIFE 5EU5A 4I0CC 3FT3B 4QOKB 3ZL4L 2D0FA 5JORA 3NACH 5MENB 1LO3L 1MG3C 2XTJD 1Z3GL 4ZPTA 1NUDA 2HUEA 3NEXA 1OE1A 1MLCA 2WQWA 1SRDA 2OMYA 2Y7LA 5I1EL 4MLIA 4NRYA 5L0QC 3PWPA 2CDFB 3ZTEA 3K5SA 2C9QA 2H45A 2DW5A 3BUPA 5A2JH 2CIIB 1A1MB 1Q0XH 1GMIA 1V5JA 2VDRL 3T6XA 4JJ5B 4OD1H 5A3IC 1HQRB 2RTTA 5DJ6B 2PN5A 2BPBA 1NBZB 4AJ0A 2BNRE 4NBXB 2IOMA 4X6DF 5F6IC 2BOCA 4IS6B 3BPOC 1MLBA 4QOKA 1SVCP 5BVJA 4CN4A 1PG7H 2DB8A 4W9IC 4PM1A 5AKSA 1AAJA 4MGXA 4EI5D 4UF7C 4ERSH 3ILQD 4FMKA 4YOKA 1VFBA 1W80A 2V7HB 3BEWA 3LPGA 4XBGB 4BKLA 4I1PA 2A9BA 2ZXAA 2QZQA 4PTUB 3FN0L 2W5PA 2X4PB 3HMXL 5I18H 3HE7C 2F5AH 5CM1A 3WAJA 3DETD 1JZFA 3FCUB 2BVQB 3O8XA 2ADYA 1G5GA 3KDPB 3J07A 2VDKH 2Y1ZA 5CN1A 1QLFA 2R9HC 1C5DA 4YIQB 4YDJA 2Q10A 4KXZH 5CN2A 5IFAL 2OPCA 1G7HB 1OEZW 3ZE1E 3PP3H 4KK5D 2MPVA 1ZLVK 3C6EA 4M7LH 1M7DB 1I1CA 1E6JH 4YBQD 4LSTL 4NZ8A 4X7CC 2C34A 2X1QA 3EJZD 1DQQB 4D9RE 4JREC 4B9ZA 4WU7B 4URTB 3EO1A 5GQBA 1HU8A 4BSVB 7TAAA 3Q6GL 5CFHA 4JDVA 3QW9A 5AD0B 2OAAA 3AG3B 3W1ZA 4YZFF 1BJ1J 3UMNA 2Z4QA 3RG1C 1J12A 1UZ8B 2ALAA 2WTRB 3JWDC 5ISZE 3ILQC 3MA9H 4DTGH 1ZANL 2BSED 3HB3B 5I5MA 2CRIA 2J1XA 4PBXA 4HMCA 4GI6A 1G1CA 1N8ZB 1SJVA 2IQ9H 2M26A 2VN5A 4PWIA 1KGCD 4G7VL 4YDIL 4FKEA 4NQXB 1JDDA 1HQ4B 1J8HA 2RFXA 4OZGB 1JXJA 4XAWL 3STZA 4CUCA 5C0RL 5HHMD 3QYMA 1QW9A 3SQBB 3GXMA 1CR9L 3LZPA 2ICCA 5IG7B 3IPFA 3KCPB 2O72A 1MIMH 3HR5A 3MRMB 1FA4A 3D12B 1ED3B 3EBAA 1SJXA 4MLSA 2APBA 3ZSTA 4GG6B 3BP6B 3QQDA 4N0UE 4RFOH 2EZ0C 4QT5A 3CLFH 3UYRL 4WY7H 2C7UB 3MRIB 1MW3A 4BQ8A 3QI9A 4OJFL 3QUKB 1JD7A 2V6HA 4QHMB 1T1WA 1UWGH 1GGTA 1ED3A 1THCA 1NIEA 4P0DA 5HDRA 5DI8A 2WUBL 4XMKH 2V4LA 4V1DE 1M9WA 3PWNB 3HZMA 2ICWJ 1NM9A 1AQ8A 3PP4L 4HALA 1DVFC 5D4HA 3U1SL 3CMOL 1UCTA 2Q8AL 2VN4A 3T0BA 5C7ZA 1JNNH 2YC1A 5EZPA 3EDJA 4KDVA 2XG4A 1JFQH 5AW4B 1YNKH 3WTSA 1FL3B 3V0VA 4ODBD 4MD0B 4AMWA 2ROYA 2XU9A 4F2EA 4JZOA 1BM3H 3I50L 2XN9D 2LAGB 2NNAA 1BEYH 2JCCE 3MA7B 4LSPL 4DO4A 2W65A 4DTGL 5JW4Q 2B5IC 1GIGH 2BVPA 4LSUH 2WIIA 2EXTA 4IRZL 4LPWA 3VRLE 3CDZA 3U7YH 4KZDL 5IW3A 3HPLA 1WDAA 3L5IA 3STLA 1LGVA 3G6JF 5EA0L 4XZUA 3NJNA 4U1LA 4AX3A 1Z9SA 3VXMA 4HUKB 3US1A 2IFFH 4RDQF 4GIPD 1GPOL 3FB7B 1A3LL 5DHYA 5DLML 1OALA 2MH4A 5CJ8A 2X4NB 5I2IA 1UXSA 2X6BA 5KG9A 1TQTA 2ADIB 2WXRA 3ZGHA 4NAQA 5GSRB 2PETA 1QSFA 4JEGB 4YDKH 3U36A 4AQAB 1FO0L 43C9B 4HUXA 1KTRL 2P8PB 2E6QA 1G7PB 2VJXA 1PYWB 5CZVL 2CPUA 3QUMA 4R26H 1AQMA 3EXJA 1P2CB 1OHZA 3GXFA 4KJYA 1X4ZA 1RUKH 5E2TL 2VM3A 4J12A 3VXNA 3QDGE 2SEBA 3MJ9A 1MREL 3F01A 4N2EA 3HE6B 5IW1A 4FCHA 4BQBA 2WWMC 4TTDD 5F7AA 4GT0A 1RQ5A 3VDBA 1DBMH 4OZIB 4JCMA 5I1JL 4PGCA 2BIMA 2V5SA 3BXNA 1RU9H 2NTFB 3HG4A 3HN8A 3MROA 2DH2A 3NIFF 4MNHB 1UC6A 2Z9TA 3B9KD 3HI5H 4FQCH 4PCKA 1M6OB 4EDWL 4Z7UA 3TCXA 5BPPA 1WWAX 2R4SH 5AB9A 3KJ6L 4XN4A 3IJSA 1FVCB 3UOAB 4EI5B 4N2DA 2GQHA 1I7TA 1KGUA 5KSVB 3DXAD 4S1QL 2H6UA 5FCUL 2VJ8A 1S3KH 1EWHA 4MQXD 3SDAA 1MG2C 1RCYA 3A21A 4NUQA 4X4ZA 5BS0E 1ZV9A 5DRNB 3QHFL 4TPRH 3E3QC 3QHZL 4G3YL 4LKXB 3RHWF 3ISYA 2ISDA 1KN2H 2IBZX 4KI5E 3A4DA 2O5XH 2XACC 5FYKE 5DRZA 5L2KA 3MRKA 3VWJB 5CZXC 4BQCA 4HKZA 2MRYA 1KBGL 4CVZB 4LOVA 4JFEE 4Q9QH 2JV6A 1A0QH 3C5ZD 5T33L 2ZUUA 4XT1C 1BAGA 1I8KA 4F24A 1RZJC 1ADWA 1MJJA 4LPXA 4OF3A 2A83A 4HXAH 5INDB 2BP0B 4LDLB 5J9PA 3QEHB 4R2GD 1LK3L 1R0AL 1JS4A 3UDWC 3I9GL 3JWOH 1IEHA 3KPSB 3ZOAA 1IKOP 3KJ4C 5DRNA 4ES9A 3DX0A 3QHFH 3LDBB 4TPRL 3TBSA 3WNNA 1XHHA 3WFEH 4UQ2A 4G83A 2JKJA 2CK0H 1DJIA 3F83A 3HS8A 3LHPH 4MA1C 3S96B 4AGOA 4A67A 1JZEA 5IEKA 3W5NA 4W68A 3X2QB 2CH8A 4Q4EA 3MLRH 4QRSB 2BFVH 3WDIA 1KEMH 4JFDB 5IGXL 5KJRL 5EEXA 1YHPA 5LCVH 4NNXB 4JQIH 4WTZG 4MB5A 1IGMH 2D7TH 3D39A 1CICD 4MAYA 2B9AA 3NA9L 2APSA 1EO8H 4Z8FL 4HWBH 1NCDL 3MLYL 4EAEA 3BO8B 3HB3C 5PCYA 4F8TA 4GRLC 3I9PA 4HJJL 2DQJL 2BSBA 3S3SA 2VIRB 1RIUL 5CLXA 4YSPA 3HE6A 5EF3A 5LQBL 2VM9A 2C4FT 3PUCA 2V9RA 4HMDA 2HH0H 4P3DB 4PJBE 3WYRA 1UWEH 4EN3B 4LQFH 3BO8A 1KGWA 2ZCHH 3NIGE 5ANMB