1J9QA

Crystal structure of nitrite soaked oxidized d98n afnir
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
336
structure length
336
Chain Sequence
b'ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNINFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
publication title Alternate substrate binding modes to two mutant (D98N and H255N) forms of nitrite reductase from Alcaligenes faecalis S-6: structural model of a transient catalytic intermediate
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
total genus 91
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2001-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1j9qA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1j9qA02
3NSCA 2GI0A 2IWEA 2W8CA 4E9RA 2HLEB 1ET5A 1PNDA 1MZYA 4G71B 4UF7C 3X1EA 1NZRA 3PCYA 3T6ZA 4FA7B 5B1KA 4A68A 2DYRB 3EH3B 1AQ8A 4G70B 4A2FA 3UABA 1EZLA 1WAEA 1AACA 3ASNB 1NIBA 2UX7A 2YAFA 2PLTA 4CSPA 1W6LA 3TU6A 1L9TA 1AAJA 2UXVA 3AG3B 5I5JA 2AZUA 2XUWA 5FC9A 2XV2A 1VLXA 2AFNA 3WI9A 2I7SA 2CAKA 1YLBB 2HXAA 2XV3A 2QDWA 1AIZA 2FQFA 3PLYA 4E9XA 4HIPA 4HHWA 2PP8A 4KO9A 3CVDA 4GYBA 4YSUA 3ASOB 4YSSA 2VSKB 3T6WA 4F2EA 4DPAX 1AZUA 4E9YA 2HX9A 3OMIB 2I7OA 1UATA 3PAZA 4YSPA 2FNWA 2QDVA 1JZEA 1QNIA 2IH9A 5F7AA 1E30A 1SDDA 4FAAB 3NT0A 4X4KA 1GS7A 1TEGA 3TASA 2RACA 3S3CB 3NJKA 2UX6A 3AY2A 4KO6A 1AS6A 3EH4B 3DKHA 4AKPA 2BP8B 3DTUB 2TSBA 4P5SA 1PZAA 1HFUA 4AKQA 1MG3C 4DP4X 1W8EA 2GBAA 4HALA 4BWUA 3ABKB 3SBRA 2PCYA 1ZDSA 5D4JA 3QJSB 1ID2A 2UXTA 3UGEA 3UACA 1SF3A 1X9UA 2BWDA 4AKOA 1PMYA 2VSMB 3CDZA 2QPEB 3CZUB 4KO7A 1BXUA 5I6PA 2WO3B 2AVFA 3FYEB 3OD3A 3NP4A 4GY4A 2BP8A 1BQKA 2JXMA 1GS6X 2J56A 1KDIA 3EH5B 1OF0A 3FSVA 3X1BA 3NJJA 1ZDQA 3NJGA 2VW4A 2GHZA 1BQRA 1PCSA 2YQBA 3N2JA 1PAZA 2YXWA 1J5DA 2BW5A 3T71A 7PCYA 3AG4B 3WKQA 4A2EA 1JXFA 1KCWA 4KOCA 5B1BB 1A4BA 2OV0A 2XX0A 3WIAA 2H5UA 2DY2A 5B7EA 3ZX1A 7PAZA 4E9TA 2FT6A 2I85A 2YAOA 4ENZA 2WO2B 1RZQA 3G5WA 3FQ2A 1AG6A 5B7FA 2TSAA 1MG2C 3ABMB 3QJRB 4YVUA 1SJMA 1BXVA 4KOBA 2VMJA 2GC4C 1WA0X 1JZIA 1WA2X 4HCFA 4E9SA 4AX3A 1KDJA 3QJQB 1NDTA 2HX7A 2IWKA 2X87A 3FU9A 3FPYA 5F7BA 3FU7B 2IAAC 1DYZA 1M57B 3NJFA 2BHFA 2HRGA 2OCCB 2EIMB 5TK4A 4W1TA 2XWZA 2XXFA 2YXVA 3IBOA 4MFHA 3QJTB 4JKNA 1R1CA 1XB3A 4DP5X 2BZ7A 2MRYA 2HZHA 5B1JC 4YSCA 4L0PB 4WKXA 4BK5C 2DV6A 5E9NA 1L9QA 3NSFA 2CCWA 2A3TA 1SF5A 3CVCA 1ILUA 3FU7A 1SHXA 3UADA 5D4IA 1JZGA 1OE1A 1F56A 3NJIA 1NINA 4F7KA 1NIDA 1A4AA 3N55A 1V54B 2GB2A 2NRDA 4DP1X 1L9OA 1CUOA 2GIMA 2PPCA 3TA4D 3GXUB 2B3IA 1A65A 1L9SA 4YSDA 3H4HA 3WG7B 8PAZA 1RCYA 4A67A 2J57A 3CVBA 1B3IA 1OE2A 1SFDA 3OMNB 5EHFA 6PAZA 1CYWA 3DIVA 4WTQA 2E86A 1ZIAA 1V55B 1FA4A 3CG8A 5B3SB 1E5YA 4YSEA 1AZNA 4HAKA 3PAUA 2Q9OA 1WS7A 3ERXA 3JTBA 5B1JA 3SBPA 4GP4B 1I53A 2EIJB 1NIFA 1AZRA 4G72B 2PCFA 3PPSA 3WNIA 3X1GA 1JXDA 2BW4A 3BVDB 3FS9A 4A2DA 1E5ZA 1E65A 1L9PA 1N68A 2VM4A 2OJ1A 2XLLA 2XU9A 1GR7A 4A2GA 1IC0A 4Q89A 5ANHA 1AS7A 1IBYA 3ZIYA 2UXGA 3HB3B 3NJHA 5AZUA 2CJ3A 5AKRA 4GXFA 3ZBMA 2N0MA 1HAUA 1KCBA 3H56A 3NYKA 2CALA 1BQ5A 1NWOA 3IEAA 1URIA 4A2HA 1PLBA 1XMEB 3ABGA 2DWSA 3KW8A 3PAVA 3U25A 3IN2A 4E9QA 2GSMB 3FSWA 5D4HA 1GY1A 1A4CA 3V9CA 2PPFA 5I6MA 2ZWNA 3H4FA 2XXGA 1AZBA 3NJMA 4DPBX 4BXVA 4AZUA 1ZV2A 2FWLB 4NERA 2MTAA 1X9RA 5I5IA 4DPCX 5I6LA 1NPNA 1L9RA 4RH4A 2IDQA 2WSDA 2W88A 1JXGA 4Q8BA 2ZXWB 3AG1B 2YAEA 5I6KA 1ETJA 4KNUA 4YSTA 3OQRA 4NAJA 4YSQA 3AW5A 1TKWA 3NP3A 1CURA 3PXLA 1PLCA 2IDFA 3T6VA 3S8FB 3S3DB 3L45A 1SNRA 1PY0A 1NIAA 2VW6A 4ZK8A 1J9TA 1BXAA 2HRHA 5A7EA 1J9RA 2FTAA 5I6OA 4DP2X 1QLEB 3WNJA 2H3XC 1GSKA 1KV7A 2AANA 2PPAA 3ABLB 1RKRA 1ET7A 1WS8A 4HCGA 6PCYA 4BWTA 3FT0A 3GDCA 1ASPA 5AFAA 1OCRB 1XB8A 3X2QB 2FT8A 5PAZA 2DWTA 2QPDB 4UAHA 2FQEA 4KNSA 1A8ZA 1BAWA 4KO5A 2J55A 5I5MA 1AANA 3T6XA 1OCOB 3FQYA 3QJUB 2XVBA 3FYIB 1SFHA 1JVOA 5I26A 4QKTA 3MBWB 2Y69B 1OV8A 4TXVB 1BYOA 1MZZA 2JFCA 3QQXA 4CSZA 2P80D 1OCCB 1NIEA 1T5KA 2XYBA 3OMAB 3QJVB 4YVNA 2UXFA 2GC7C 2VW7A 2Q5BA 1J9QA 3TBCA 4BDVB 2FT7A 4DP0X 3HEIB 1ILSA 3NSYA 5LDUA 1ET8A 1N70A 5B7MA 1KGYE 1BEXA 2EILB 2IH8A 3OM3B 1E67A 1NTDA 4HHGA 1ZPUA 5PCYA 4G7RB 1SDDB 1AG0A 3FQ1A 3X1NA 1JZFA 4N8UA 1CC3A 2BZCA 3GYRA 2YARA 3AZUA 1HAWA 3EHBB 1GS8A 3UAAA 9PCYA 2ZOOA 4BDVA 2IDTA 3ZDWA 2JKWA 1AOZA 3X1FA 1NWPA 2PP7A 3EF4A 1PZCA 1M56B 1DZ0A 1TU2A 1W6WA 2IWFA 3MX0B 2HX8A 1TEFA 2EINB 4M3HA 4YL4A 1JVLA 3CDZB 1KBVA 2YAQA 1NICA 2FJSA 1GY2A 4E9WA 4YSRA 3NJNA 4KNTA 1J9SA 1WA1X 4HZ1A 4DP8X 1FWXA 4JHUA 2EIKB 4HCIA 2XV0A 4K9JA 2BP0B 5IY5B 1IUZA 1MDAA 2H47C 4W9ZA 4PCYA 3FSAA 4UANA 3JT2A 1IBZA 1ZIBA 4N4YB 3SQRA 4YSOA 4EF3A 3BQVA 1GYCA 1NPJA 1EHKB 2YAHA 5I6NA 2YAMA 1XB6A 3V9EA 2B08A 2LLNA 1PF3A 2IDUA 4QLWA 4E9VA 1OOWA 1JZHA 2AZAA 2FQGA 1OE3A 2BP0A 3WKPA 1JZJA 1AR1B 2P80A 2BWIA 2X88A 3TBBA 3UAEA 2VM3A 1ASQA 4G7SB 2XX1A 2DYSB 3NJLA 2ZONA 3FSZA 4A66A 2PPDA 2Y1AA 2CBPA 2J5WA 1FFTB 2PPEA 1JOIA 1SHWA 2CUAA 2R7EB 3D12B 1ASOA 1J5CA 4P5RA 4DP9X 1QHQA 1GW0A 3FU8A 2IDSA 2VN3A 4BWWA 3S8GB 1PNCA 2PP9A 3QPKA 1A3ZA 4PAZA 4DP6X 2FQDA 4BXSV 3IE9A 3AG2B 1JERA 1PZBA 2BO0A 1BYPA 4NB7A 1M9WA 3SBQA 2R7EA 4GP8B 1CYXA 1AS8A 3IN0A 2QT6A 3FPXA 3KW7A 4DP7X 3NSDA 1V10A 2YAPA 1KYAA 4GP5B 1KBWA 4G7QB 5TK2A 3RYMA 4M4RB 3C75A 4YSAA 3T9WA 1AZCA 1RZPA 4F2FA 1OCZB 1PLAA 3S3BB 4AI7A 4JHVA 5B1AB 5I28A 1IKOP 1ADWA
chains in the Genus database with same CATH superfamily
1AIFB 3QR1A 2LGNA 3SKMB 4ZS6C 5FHAL 3VXSE 3MLZL 2C1OA 2BC4B 4LSUH 3FK3A 4OCRH 2OXHB 5HVFB 2A6KA 3VFGH 3EKCA 2V17H 4XNAA 4ODHH 1L5GA 1WAEA 1NC4D 4AYFA 2Z64C 1KTBA 3LV3A 4LSTH 4QRPE 4LCWE 4A7TA 2F68X 3BSZL 3JTSA 3ZO0A 3BUDA 1RULL 4EDWL 1VKXA 4NO0B 4MWFB 1JDDA 1ORSA 1WBZB 3AG3B 2VDPL 5M95B 5AW6B 4XNMB 4N0YH 2Y7MA 1HHHB 3HI6L 2V5RA 3LKNB 3QHZH 1AGFA 2XZQH 4JFOA 5I71B 1VFOA 4RGMB 3FQTA 1MHHB 3PLYA 2BNQA 3DBXA 4D94A 4P9HL 1DQLL 5HJ3A 1DR9A 4DO4A 1M71A 3ASOB 4YSUA 1K6QH 1AVAA 4DVBA 2XTJC 3RL2B 1W0YT 3MUY1 2NXYD 2ROXA 2XBTA 1HCVA 5CNHA 4KVPA 1RQ5A 3HFMH 1PZUB 3CN2A 5B39G 4GQ9L 3ZT7A 5G4MA 5DJDB 2CLVA 1W72B 4UQBA 3ARFA 5E6ZA 1KBKA 4ZAKD 2W60B 4P07A 2VLKE 2DMCA 5I18L 2GHWB 1JN6A 2TSBA 4FMKA 5C0BE 1PZAA 4N22A 4ICWA 1BQLL 4AKQA 4LAJH 4ZG1A 3ECQA 3E6HB 3FU5A 4Y4FA 5CEZL 1W8EA 4EZKA 4PJBA 3ZGHA 2FX8L 2BS9A 4Y88A 3SBRA 5FLVA 1YYCA 5DQ9A 1HI6B 3MXVH 4X6DF 5FHBH 5D7JB 2ZNXA 5FOBB 1U8LA 3CBJB 4G8AC 5EF3A 2PO6D 4HPYL 1ZVSA 2BRQA 4IMLA 1DVUA 1NCDH 3DHUA 3WIHL 3CFJA 2GTZB 3GMMA 3KPPA 9CGTA 3P2DA 1CF1A 1CGUA 1JV2A 4TNGA 1TO4A 2WQ8A 1CK0L 1DJWA 1AMXA 4JQIH 2C1PB 3RFZC 1EXGA 1LP9F 3TEYA 4OI7A 1G1YA 4TKWA 3N42B 4KY2A 4PJXA 5C0AB 3QJZA 1JD9A 3UPRA 1WUNT 4WI8A 2VE6A 2IGLA 1BMZA 1C5CH 3BH9A 3CC5B 3CH1A 5CEZE 1NGPH 5B1BB 1FP5A 4R0LC 3KNBA 1CGTA 3DUSB 5I75B 1N9PA 2BFVL 3GTVA 2H0PA 4QRQA 4HK3J 3ZL2A 4EIGB 2I85A 4P5TA 3FKUS 3LQMA 5DLLA 2AMUA 4LFHD 1UD3A 2FLMA 3B5HA 4BZYA 4PRPA 5C6WH 2F8OA 2NY0B 2FLBT 1WGOA 1JMZA 4JPKL 4IMKA 3FN0L 4LCWB 2V2TA 5D2NE 3KPMA 3WFCL 4Y5YA 2R2CA 4YAQA 3MBEA 2X4NB 3NJFA 4XMTA 2VMCA 4AEHH 2Y6SC 1KGWA 4PJ7F 1VZHA 1ZK9A 3LZOA 1FZJA 4ZX5A 4OZ4B 2B20A 1VFMA 1BW8A 4RQQB 4PVLA 1PU0A 2DRUA 4X7FC 4R4BA 1RJLB 4S1RH 1DANU 1KG0A 1ZLUH 2XC8A 2CCWA 1DSWA 3NZUA 3OZ9L 1LNUB 5F9JB 4TULH 1T6WA 4YHLH 4APXA 2NY3D 1DBML 5DUPH 1KULA 4PJEA 2CKBH 3GHBH 3NJIA 2P8LA 4PJGE 3UOAB 4U1LA 2WB1A 1NIDA 1II4E 4QRSA 3UGXA 4N6RB 1S7TB 1AIFA 2VUOA 4KROC 3SKMA 4HGWA 1ORQB 2F7QA 5IJKC 4NKQB 4OCLC 5C0BB 5IJVB 2OXHA 3FCGA 3QWRA 4WTZG 2A73A 1F6AB 2E27H 3M7OA 3L1GA 1CVSC 4HZAA 2Q86B 3NJVA 4LCIH 4BIKA 2H6UA 1CLCA 2FHCA 1U8JB 1BVOA 1NGYB 5JHBA 3CG8A 1VENA 3N41B 4ALAL 2XXMB 1WBZA 2OBGA 4HAKA 3D8MA 5I8OH 3EYUH 4XNMA 3PAUA 1DSYA 1HHHA 1URZA 4XE5B 4NIKB 3KPQA 3LKNA 1ZTXH 2ZXEB 4OD3L 2AEIT 3QUMH 3TFKC 1CJYA 3ERXA 4AG4H 4QHPA 2NUTB 1ZLEA 2ICWI 1XGUB 1MHHA 4KY1L 3VA6A 7FABH 1OAJA 4KFMA 2JJVA 4P59L 2X1WL 3CU7A 4ZQKB 4UZUA 3WMPA 2AJYL 3RL2A 5D1QE 4RSYA 4QJ5B 1U8CB 1JXDA 1Q9OB 3MRKB 3ZZQA 3SDAC 1MLBA 2DTMH 4MCYA 3BVDB 3PJSB 3VXMB 4C4KO 1CBVH 3DJ9A 1E5ZA 2VM4A 3WXWH 3B9KB 2UZYA 4JN1H 4HX1B 4JKKA 1K3ZA 3T2NL 4FFTA 1W72A 1CYGA 2B5IB 5KJ7E 4YHIA 3QULB 2W60A 5EZLA 3TS8A 1QI3A 3QAQA 1F4HA 5KVDH 3I6LD 2NTSP 5IW3A 1ZA3B 3LDBB 4DSYA 1FVEB 2YBGA 4RMQA 3WGVB 3GK8H 4FXLA 2F7IA 3AGVA 2YOCA 2NY6D 1URIA 3E6HA 3SPJA 3OHXA 1T83A 1AJ7L 1RHFA 2DQCL 2G0LA 2VZOA 2WXQA 1CR9H 1OARH 2K7QA 5D7KE 3U7AA 4O9HL 4PB9H 1HI6A 4XMZA 4EI6B 1I9RL 5D7JA 4AIEA 4TSBH 5FOBA 3F7KA 1S7XB 4MCNA 5D2NB 3IMBA 1YEGH 4JNXA 4R7VA 3RTQA 2A9NH 2KQNA 3PU7A 2HJLA 4MXVF 2MTAA 3M1BB 1Z7JA 1TTGA 2GTZA 3MRRB 4OCNC 3HG0A 2QTVA 3R8QA 2VQUA 2F5AH 4NUGH 2YD8A 2C1PA 4WI4A 5D6DC 2VH5L 2FEEI 3NRQA 4OT1H 3BVTA 4K3DL 3JV4B 1P4IH 3CU1A 2CRZA 2Z6FA 3ET9F 3OKMB 1EEUA 2KHAA 3BKCH 3TWCL 3DX7B 5EN2B 5DYFA 2R23B 5C0AA 3X12A 2APTA 4KTEL 2MOQA 1WE5A 5T33L 3ARPA 4TQ8A 4BFJA 1N59B 4JY4A 2IAND 3CC5A 5E03A 1PY0A 4C56D 2EVJA 3SQOH 4PJGB 1OZUA 3EGXA 1XX9C 2WWMC 3DUSA 4ZK8A 4YS4A 4M6OH 4E42B 1UB5B 1PD0A 4I87A 4WEBL 1C5DA 2WQWA 1DQDH 2J88H 2NPLX 4HBCH 4O2CA 5IESL 5C0CB 4X9IA 4G83A 2WCGA 1UVQB 4P3CH 1DQMH 1C12A 5L2KB 4WK0B 1CF8H 2GSIA 3NIFE 4HIXL 2HVJB 5DD6A 5I30L 1JP5A 4LFHG 3B2VL 5B4MC 4HV8B 1ASPA 1FZKB 3FFDB 4UAHA 1I3RB 3LKSA 1UWEH 1ZK5A 1OAZH 2X4NA 3FOMB 1NCTA 5JIHA 3U4BH 2WLJA 3UX9B 2OJZL 3GXPA 5BO1L 1LL1A 3MLTB 4E41D 3GUTB 4ADIA 1TVBB 2ADGB 1ZWIB 1Q8MA 4G6AD 3VRIB 1NCAH 3MV7D 3GHPA 2VZTA 3L08A 5DC0A 5CGMA 3L5XL 4HETA 2QPUA 2JFCA 5DK2A 1YJDC 4CSZA 3OG4B 5FYKD 5EZIH 2E7CA 4N90D 4M3JA 1OCCB 4XPTH 2EDDA 2P26A 1P4BH 3ZKXC 1LNUA 1S6NA 3RA7H 1H8NA 3QJVB 5AZ2H 1MQKH 1RP9A 4NQCA 5EUOE 3MJ9L 4JR9H 3HUJB 3WYRA 1DVFB 5C0DB 1X7SA 1NAML 2Q8AH 4N6RA 1S7TA 3TN0D 1F6FB 4KKPA 3N40P 1BAFL 3MBWA 1ORQA 2ZCLH 1MWAL 1WD8A 2BSDA 4YDJB 4WY7H 3MBXL 2FJGA 5IJVA 4IBWA 3RX9A 1F6AA 3VJ6B 1J1OH 2Q86A 1E8ZA 1ZHLB 4MBOA 4JG1H 1WAAF 4K4KA 2AXGB 2R0ZL 3QZWG 2CBTA 1U8JA 1NGYA 2NW3A 5C08D 4Z7VE 5D8JL 4QUOA 5AW1B 3QEQD 4GG6F 2J1YA 5JXEC 1HNYA 3QEHA 5CGYD 3T4AB 3ZE2E 2DQTL 1TU2A 2ZX8A 2AEPH 2NUTA 2HX8A 4HUKB 1XGUA 4WU7B 5CJOL 1X4YA 4M3HA 4YL4A 1X5HA 4OLUH 4NC0B 4G82A 3NSJA 4E9WA 2UY7B 4AV0A 5JHLA 5TQ2H 2X09A 4RGND 1G94A 1U8CA 1Q9OA 2QVIA 1AOHA 4FQJL 3GT6A 2BWQA 1CD0A 4AEEA 2EIKB 3P4MB 2VZ3A 3VXMA 3K6NA 3MOAH 1T3FB 2GABA 2HJFB 4W9ZA 1ZHNA 3B9KA 1N18A 1NFDB 2PCXA 3BESR 3FUHA 4Q4EA 4XN7A 4Z7IA 2Z8SA 3DX6B 3VI3E 3BGAA 1JHKL 2E3VA 4H8QA 4YSOA 4H88L 3U0WH 2CWRA 1ZA3A 4EZJA 5I6NA 3BUYA 2CDEA 4M43H 2VDQB 3G6JF 3K7UA 1UXSB 1CD9B 2X1OA 2P48B 4QLWA 3EFFB 4XP6H 1BGXH 2V5YA 3U1QA 3DHPA 1WISA 1SUJA 4KXDA 1RFDH 2I25N 4XOCA 3WUZA 4TNVF 3WKPA 1LTXA 1JZJA 4UT9H 2BNQD 3M88A 4IBQA 2FX7H 2V8MA 4EI6A 3FULA 1UT9A 1MVUB 1S7XA 4R5XA 4AVHA 5D2NA 1QFPA 3FSZA 3WS3B 5GRVL 1XH2A 5DD0L 2VAAB 3MRRA 2AAVA 4XX1G 3LHAA 4PG2C 2BIHA 4OQTH 5A7BA 3S88L 1SJVA 5BZZA 2YMOA 3HTLX 1MAJA 2FEEL 2RQEA 3SPHA 3ARFD 2YPLE 5E00B 1CWVA 3JV4A 1IKNA 1AGCA 2I07B 1CDJA 3DX7A 1VDGA 2R23A 1MH5A 1B2WL 2WVVB 4I0PC 2OMXA 5HPMB 4Y4FD 2VDMB 1X5LA 2LW3A 3S7GA 3IU4L 5HDRA 4M48L 4UTAH 3MLRL 3NSDA 5ICYB 3L5JA 3L81A 4U0QB 1U6AL 4Y5XB 5IZ7A 1WGVA 1O5DT 4E42A 1UB5A 4PI2A 4YSAA 1DANT 1RZPA 2W95A 4DGWC 4CDGC 3H9SB 5C0CA 2KMWA 5DJZB 1UVQA 1DBAL 4FXTA 2D31B 3TCLB 4HWBL 5L2KA 4PGBB 3I74A 4LNRB 2GI0A 2IWEA 5JIIA 3S37H 3CCHB 4YHPB 1E3ZA 1HWHB 1MZYA 2WLNA 2BMKB 2XA3A 3MRBB 4N85A 4PRHB 4R3SB 1A8JH 2CUHA 4HJSA 5BQ7A 1JZ4A 4HV8A 4Z7VB 5SWQA 4PW3A 5KSBF 1FZKA 3FFDA 4ESKA 1KXQE 4GRWF 3UJIH 1I3RA 2HH0H 4RIRB 1C5BH 2BS8A 2OP4L 4P23C 2PLTA 3D85B 1CFNB 2PCPB 3ZE2B 3TU6A 1LE5B 3P69A 3GUTA 1L9TA 1E4XI 2QGDA 3HHSB 4HXAL 2ADGA 4XCCH 3A6BH 1ZWIA 2FD6H 4PH8A 2BP5M 2VR5A 3VRIA 3OTTA 2GK2A 4Z0BH 4G6MH 5IKCB 3WTSA 4PBWD 4LKXB 3Q5YA 2WC7A 2QDWA 4P5TD 1E27A 5KTEH 4S0SD 4OH2A 4E9XA 4XGZA 2APWA 2PP8A 4PRPD 5ESQB 4OZFB 1S3KL 3SPIA 1YPZF 3QG7L 5I8KH 3HUJA 1DVFA 4WUUD 1QPPA 1BFSA 5B8CC 1E4KC 3V5HB 3TVMA 1K5WA 2CJTA 1ZA6A 3GS7A 4YDJA 3IGAB 3MBED 3TJHD 1IFHH 3NIDF 3ULUF 3N1FC 2ERJB 3FOLA 1HZKA 1ZHLA 1QBLL 2OJEA 2FIKA 4QMEA 2ENYA 3GSUB 1QG3A 4CAGA 4M5SA 5J1TC 4KGLA 2DEXX 3C09B 4NKOA 3LZPA 5L88L 1RK1B 4QAMB 2W07B 2AXHA 5J56B 2RB8A 1XIWC 2YN5A 2PCYA 3RNQB 3V0IA 3T4AA 4ILDA 1RHHB 4X80H 3MGTA 4JO3H 2HT4C 4LSPL 5SX4I 1Q90A 2MH4A 5EBWB 3WFHB 3IXAB 1X4ZA 1E9PB 1MY5A 2AVFA 4S1SL 2UY7A 2BP8A 1TPXC 4G2AA 4G7YL 5CO1A 4HJEA 1J8KA 1BHGA 1LWJA 3ULUC 5CZVL 3U0TA 1C7TA 3QWRD 1IJNA 1U21A 4UQCA 4UQIM 1E40A 1ZKAA 4CKVX 3LS4L 4M1GL 3MXWL 1NFDA 1OSPL 3KCPB 3DX6A 5KS9E 4L9LC 4FQ2H 3BEWB 3QYCA 1T89C 4NFCA 3QEGH 4M4PA 5AD0B 1N0LB 1DN2A 2P7TA 1HNFA 1LO4L 1UXSA 1OHZA 3GMNB 3ENEA 3EFFA 1XF5B 4KOCA 2Q87A 2CU9A 4HS6B 4LPWA 3D07A 1XAKA 2DY2A 4I1NB 4RGOL 1YECL 3L5WB 5CSZB 3ZX1A 1LO3H 1N5YL 2WO2B 4JRXE 5CBEA 5B38A 3KPOA 2ATPA 5DZLA 5DRZB 1OP5H 4LLWB 2YGPA 2VXUL 2G2RB 2MSPA 3U9UB 1BFVH 2DICA 5AB1A 2VAAA 5A6LA 3CXDL 1XCQB 4HD5A 3QWOA 5T5FA 2AITA 2WXFA 4JJOA 4NWUH 3D25B 1B90A 4XPBH 4Y4HC 3K2IA 4AL8C 2KZBA 3WFBL 3KLKA 3O2WL 5E00A 3DVIA 2K6ZA 2BHFA 4JZJB 3HS9A 2OMBA 2I07A 2IGFL 1NMAL 1UB6B 4W1TA 4KKAC 2V5SA 3US0A 3BPNC 5EEWA 2V9TA 4QRUA 5JDSB 2MRYA 1KB5H 3OB0K 4A7QA 4WIQA 5DJ0B 1QACA 4Z7WE 4XNXH 5ICYA 3WIFA 3HKZA 4Y5XA 3DTXB 4LCCB 2QQLH 1KJVB 3GRWH 4TRPL 4XPAH 5F0LB 3JUZA 5LN4A 5BO0D 3RTQD 4JM2D 3H9SA 2XRAL 4OUOA 4TUJA 3GI9H 2BFGA 1NLDH 4PGBA 1U4EA 3CCHA 4YHPA 1QLRB 2Y36H 3MRBA 4PRHA 2BMKA 4R3SA 3TA4D 2L4OA 3P4NB 1A65A 1YNKL 2NY4B 1XBDA 5GGQL 3KLAB 1TZIB 4GAJL 1FAIL 1QATA 4GUQA 5CJQH 2CRYA 4BFNA 4MASA 3D85A 1SFDA 1CFNA 2O6FA 2PCPA 2ZT9C 5C0AD 1H3VA 5D7LA 2UZIH 1E4XL 1WK0A 3KGRA 3MR9B 3HS0C 3HHSA 3MLZH 3L9BA 4I0KA 1U8HB 3VQMA 3BAEH 4LPUA 5HYSB 4AQEB 4ZFOL 1IJ9A 5TTRA 1OSEA 3FMGL 3OKKB 3RJOA 5DZPA 5C3LD 4KVNL 2WKOA 4LKXA 3BSZH 1SXSA 4H8UA 4X8JB 1RULH 3FU0A 4EDWH 1L6ZA 5ESQA 3T77B 3FF7A 3O3BB 4PJIB 3D0AA 4OZFA 3A6OA 1BIIB 3HI6H 3GMQA 3X1GA 4JANA 1FH5L 3BKML 1KIRB 2E9WA 2ZUSA 2XA8L 3V5HA 4U6YA 1MXGA 4JFFE 4KNQA 3IGAA 4EI0A 4N0UE 1IBYA 2NNCA 1FCCA 1LEKA 3ELQA 3NPSC 1HEJC 4QCIA 1UH4A 2ZJSL 1RK0A 4GIAA 2R29A 2GIXA 1U95B 4JFVA 3WNPA 4IRJA 5DJYA 4DO5A 3MLWH 1XDTT 1Z0MA 4GQ9H 4F9LA 5CFHA 4J3TA 2W07A 3VD3A 3UDWC 2RR3A 2MNWA 2DQUL 4WJKB 1A7PL 2QFRA 4FKHA 5I18H 1JI1A 4B0MM 5EBWA 3NJMA 3WFHA 3IXAA 1BQLH 4NQCD 5EB9A 3G6DL 1E9PA 4FXKA 2AJSL 4LLMB 3VWKC 5CEZH 4L8SB 5J11B 1BJMA 2FX8H 3PV6B 4CNIB 1MCKA 5I6LA 4PG9A 3HR5B 3CPUA 4KJPC 3WY4A 5C0GB 2JKNA 1G7IA 5SWSA 3IBEA 1C16A 4LSVH 4MXWL 4FG4A 3DROA 1G9EA 2LOEA 4HPYH 3IDGA 2YAEA 4JM0A 3CWGA 5EZOL 3KCPA 1DLHB 3OQRA 4NAJA 4Z7WB 4D0DB 3RVWC 4J3VA 4FHKA 4GW4A 2OSXA 3GTTA 3TX4A 5DS8A 1U91A 5AW5B 3F8UB 5JIQA 5AD0A 4LF3B 3TT1L 1CK0H 5ITFB 3GMNA 4PVNA 1XF5A 4HJJL 1D5XB 3GBML 3OR6B 1OD7A 2ZAGA 4HS6A 5CCGE 5CSZA 3L5WA 4MKTA 5I6OA 1PCXA 1NM9A 2WQRA 1CTOA 3CX5J 2EDNA 2HMIC 1KCUL 1RKRA 4FJYA 4TTDD 5DRZA 3QUGA 4LLWA 1LJMA 4PS7A 2G2RA 5HHMB 3U9UA 1DEEB 4LBAA 4FA6A 2X4SA 5IM7B 1HYRC 1XCQA 3NPZB 4TUOB 3VXMD 2BFVH 5CLTA 4L0YA 2O5XL 3B9KD 4LARL 1ACXA 5HGHB 5F3HB 2HWZH 2ADJA 4YX2L 3N91A 3OSKA 4LLUB 2FB4L 4JZJA 4JPKH 1UB6A 3B2XA 5K69A 4P4KC 3ZE0E 4MGXA 4QKTA 5HHXL 1DVZA 2Y69B 1L3WA 1OV8A 2P1YA 3QC6X 4XN5A 3SE9L 4HXBL 2EO9A 5CKAA 1FIEA 2A77L 5SV3A 1H6TA 3V4PB 5F9WB 2HYMA 3DTXA 1EAJA 1E2ZA 1KJVA 4LCCA 4JFFB 3VD9A 3WJLA 2NXZC 2X9XA 3AACA 3ARBB 5C70A 4N0UB 1IX2A 3DJSA 5KYWB 3CZFA 2FT7A 3T3PE 1ILSA 4ZXBA 2H6PB 3ESPA 4WQOA 2ZUQB 2IH8A 3P4NA 3OZ9H 1TT6A 2X6BA 2N3JA 3I6SA 3KH4A 5BZDB 3VFWA 1DBMH 1N19A 3C8HA 2F58L 1WF5A 4OAWB 1QWUA 2V7NB 1HAWA 4JHWL 4BFBD 5DJ8B 3BZDA 1DN0B 1U8HA 3OLDA 3SE4A 1TZ8A 2ZOOA 5HYSA 2QMKA 4AQEA 4FQCL 3SDYL 4AW7A 3AXIA 5CJXC 4PJHB 3OKKA 3OVUB 4FLRA 1V3KA 5EU3B 5D72L 1MIML 2LAAA 3NAAL 4X8JA 1IGJB 1NICA 4ALAH 1RPKA 3T77A 3O3BA 4PJIA 4C83A 4FFZL 2H6OA 5FYKL 3O4LE 2E7LA 1E4HA 4HZ1A 5FK9A 4OD3H 1FWXA 2IFGA 4IK7A 3HS8A 1E5UI 1I8UA 2A0LC 5J12C 5GSRB 4BCYA 5EPMA 3T04D 4MMXB 4KY1H 1MDAA 4F93B 2V2WA 2GJ6E 3GXNA 4K7FA 4P59H 2DBJA 2AJYH 4PJFE 4L4TD 4HUXB 1EHKB 4FDWA 4GB9A 5FO7B 2XWBA 1ODAA 3HZVB 1PF3A 4QY8B 4G43B 1K4CB 4NWTH 4Y1AB 3DYOA 3IETA 2Y7LA 2KLRA 3F05A 2ZXDA 1HKFA 3T2NH 2F08A 5FKPB 5J1AB 3GEFA 2V2XB 4FJZA 2BWIA 2X88A 4MLSA 4UT6A 5FXCH 5IVXB 4BSJA 5D2LF 1FFPB 1DVFD 4LLMA 1AJ7H 2J5WA 4NO5B 4L8SA 5I1GL 3PV6A 2R7EB 4GMSL 3TVMD 4O9HH 3QGVA 1I9RH 1EAPB 4DJMA 3A6CH 1PNCA 3GKWL 1J11A 1W0VA 3QUXA 1MWOA 3MRMA 3O6FC 3QIUC 4K94L 4MQXC 1GXEA 4KRPD 1DLHA 4EBQL 2DYPA 1FUNA 1BX2B 4K5NA 3SGKA 2F7RA 4KDVA 3SBQA 5EBLB 3FRPB 2L0DA 1ED3B 1FORL 2AABL 2ZXGA 5I2IB 5ITFA 1TSHA 2VH5H 1FFNA 3CFEB 4K3DH 1E0OB 1ZLDA 5CR1A 4GP5B 1KNOA 4G7QB 4JG5A 3RYMA 3TWCH 5C08E 4U1NB 3I50L 4KTEH 3QEQE 5T33H 3ZMNA 5GZNC 5B1AB 1I3UA 2F53D 3ZDZF 3SJVB 1ADWA 2HUEA 3N04A 5IM7A 5E9AA 1QA9A 3L3HB 3F6JA 3H9ZA 2VDRB 4GQZA 5IQNA 4HIHB 1LEIB 5HGHA 2VDMH 5IESH 5F3HA 1EZLA 4DNLA 3AY4C 3DVGB 3DHMA 2X3BA 1ZSHA 4O2FB 3C5ZA 3PYCA 3T65B 4HIXH 5I30H 3BWUF 2XJKA 2QGEA 3JVGA 4UWQB 2P9RA 3S4SB 3B2VH 1YNTF 3WEMA 2KZWA 3H54A 4U3CA 4HYTB 4A7GF 1AHWC 3ALPA 1FFOB 4CMHB 4YJZL 3O4LB 3FT2B 3B3IA 4ODSL 2OJZH 4UM8B 3V4PA 4CMMA 4ZMLA 1D6EB 4IW4C 4OJFL 3SKNB 2PCFB 3DX3A 1IMHC 4GUOA 3ARBA 2GJ6B 1G4MA 3L5XH 2B1AL 1NBVL 1QRNE 3L3DB 1H3XA 2H6PA 4P46B 3RVUD 1F4XL 4YEFA 1HIML 3NQIA 3W11D 4JGJA 5BZDA 4UAOB 2W9LA 1GS7A 1GW6A 1ZLUK 3S3CB 2UX6A 4F7EA 2HFFB 1NAMH 2V7NA 4W81A 1BAFH 1I8IB 5DJ8A 3MBXH 4APQB 5GIRA 2X5PA 1MJJB 3H1ZA 4LCUB 1IM3D 2Z91B 4PJDE 4PJHA 1JYNA 2EYTB 4MJ4A 1P5VB 2VO8A 4ZW8A 5DVKA 2HSIA 3RU8H 1K5NB 5EU3A 3H9SD 1XV8A 3E6FB 4OIAA 5D8JH 1HQ4B 1QZNA 2QKSA 4S1QL 5C8JB 3NP4A 4MD0B 1UWGL 4LVHC 2J56A 1KDIA 4PRHD 4JL1A 3HC3L 4DGUA 3KHOA 3NCFB 2DQTH 5GSRA 3IVKB 1HKLL 5CJOH 1OP4A 4IGBC 2OZ4A 3O8XD 1QABA 4K3GA 2X12A 2VQ1B 2Q6WB 4HJ0D 1N7ML 3NQKA 3IKKA 3SCMB 5D7LD 1J5DA 3U2IA 3K1KC 4FQJH 1L7TL 4XHJC 3PWNB 4HUXA 1KY6A 3HVDA 4RAVB 4Z0XA 3HZVA 3UZQA 5ISZE 4QY8A 4UTBL 1K4CA 4Y1AA 5T3ZE 3Q06A 2AXFA 1COBA 2FSEB 3UMNA 5TGBB 5FKPA 4K2UL 5J1AA 1JHKH 2RH0A 1WRFA 4YUEL 4H88H 2JH2A 5B3NA 2FT6A 1FC2D 4MXQC 5IVXA 2YA1A 3G5WA 5HHPA 4L5FE 1BFOB 3ASWA 2TSAA 4NO5A 2KZKA 5DMIL 3EYFB 1JS4A 1BXVA 3LZQA 5ECJE 4L3EB 2GC4C 2WCSA 2WCPA 1T5XB 2K70A 1G7HB 4WWKC 1VEOA 3QJQB 4R90L 3DJTA 2KPNA 3FPYA 4JRLA 1WIOA 2X4PB 4XN4A 1A21A 2DJUA 5C0ND 3Q1EA 4WUUE 3ZUCA 5DD0H 2Z4TA 2NY1B 4IRJD 2EIMB 1BX2A 4NQDB 3KLHC 1BLNA 2LR4A 1I9IL 3S88H 4YO0B 1IC5L 2Y5QA 3FRPA 1ED3A 5EBLA 5I2IA 3IRZA 4HLJA 2OTWB 5AL8A 2HVKA 1QRNB 1XEDA 4KQ3L 3WHXA 1WITA 3VYOA 3WSQL 3VDBA 1B2WH 1JZGA 1NCHA 5D1ZI 3CDFA 5C07D 1NINA 3SJVA 4S2SB 3IU4H 2KH2B 4M48H 4UM9B 1UA3A 3MLRH 4U6VL 5SWSD 4EVNA 1U6AH 3WUWB 1UD8A 2A83B 4N2CA 2J2ZB 1GRWA 2R39A 4TSCH 4PY7B 3Q0HA 1D7FA 3DVGA 2HT3C 1DBAH 4GIOA 4O2FA 1UKSA 1VA9A 4HWBH 4WAFA 1HXYA 3SPCA 4OLVL 3T65A 3UXFA 2P5WB 4GIPD 3BZFB 3ARGC 1FA4A 3AT8A 5EC2A 2XKUA 2Z0UA 1J8HD 1E5YA 2VR9A 1AZNA 3P3TA 4UOW0 1CIDA 4L0ZA 1MCOL 3C5JA 3G7TA 4FQHB 2OP4H 3Q44A 4OFIA 4U2ZA 3BKYL 2MCG1 3T0AA 1D6EA 1EEZB 2J71A 2PYFB 4HXAH 5ESAA 2EIJB 4MJ6B 4M1CD 3SKNA 2PCFA 1NBZB 1UJTA 3MRLB 1VF5C 2NR6D 4JHZA 3ES6B 2BW4A 4BUQA 3BSHA 3L3DA 4UNUA 2IG2L 1A9EB 1D9KA 4P46A 4A2DA 4LLVB 4HUWB 3ZQWA 2QKIA 1XR9B 4OGAD 5IW1A 3ZKND 5ISZB 4PRDA 3FB6B 5KJ4A 3JUYA 3D52A 4JN2B 1S3KH 4OLXL 5CU5A 2JJTA 2PXYC 3QG7H 4CBZA 3NIGE 1YQ2A 4N0CD 5AZUA 1ODUA 4KZEL 2HFFA 1IBHA 4DAGL 3NZHL 1XF3B 2WSKA 3BRGC 1OB1B 1NWOA 2EH7L 4DFIA 4FG0A 1MJJA 1S8DB 3VD0A 4WFHD 1I8AA 1TTRA 1TDQA 5TJWK 2EYTA 3ISYA 1QBLH 2P47B 3G08B 4JFTA 2EUZA 1WSST 2WQSA 1K5NA 3N43F 4QT5B 1A4CA 1IEBA 3N9GL 3WTVA 2G75B 1HQ4A 1W91A 2DQHL 4AZUA 5L88H 5C8JA 5CN3A 4ODBD 2OCFD 5JW4N 1ND0B 2D7QA 4ZXBD 4LEOB 1OO2A 2ZKYA 3VGEA 2CCLA 4FLOA 3IVKA 2ZIDA 4Q8BA 4YR6B 4IOIB 5J6HA 4LSPH 3TPKA 4CJ0A 1R3IL 2Q6WA 4S1SH 4GKZB 4G7YH 1QSEA 4YSQA 1I8KB 5CZVH 2YPVH 2JTYA 4CC0A 4RAVA 4U3HA 4LHQB 1NCOA 4EDXB 3OQ3B 1HEZB 4H8HA 1OTTC 3BT2L 3MXWH 4NNXB 1BZ9B 3A5VA 6TAAA 1KT2B 1QLFB 5JOPD 4LSRL 2W91A 3K4AA 5KANG 3EZJB 4FQLL 4KHTL 3HPJB 3HC0B 1Q38A 1H5BB 5I1HL 3T2QA 5DVMA 1OAQL 5AKTA 3TBVA 1Z3RA 3EYFA 4OZFG 2A38A 3FAWA 5DUJA 4L3EA 4RGOH 2DKSA 1T5XA 1IQWL 4G8IA 5JPNB 1G7HA 2YD3A 3SO3C 1N5YH 4JPQA 4OD2B 3CX2A 2G60H 4MA7L 2XI9A 3L3KB 3LRMA 3MV11 1VZGA 3QDAA 3U6XA 3U6XS 2FQEA 1IV8A 1NMCC 2X4PA 1AXTL 3EIFA 2VXUH 1AANA 3ZXAC 3CXDH 3FYIB 4NQDA 2QHLA 3VRLF 3QP3A 2X89A 4D9QD 1FYTE 5E8PA 5I26A 3DECA 1V5JA 3INUL 2ZUVA 4K8RD 4ZUSB 3V6ZA 5FLUA 5LQBH 3WFBH 4P5MA 3PRZA 4YGAB 2OTWA 2XG4B 4N2KA 3KE0A 2D0GA 4GQRA 1IU1A 2IGFH 2NQCA 5F7LB 3ABZA 1P4UA 2XYBA 3RRQA 3KXFB 1D5MB 3MOBL 3VI4B 4F9PC 4J4PC 4S2SA 3NIGB 4UM9A 3IKCB 3DX9B 1BEXA 4RFEB 3WUWA 4WHDA 2A83A 4G6KH 3QUXD 4TRPH 5JHLL 1ZPUA 1U3HC 2XRAH 2PYEE 2BM3A 4KK5C 2DL2A 2BNRE 5F6HJ 2DYPD 3H53A 4PRBA 2WYHA 1KIUA 3U1PA 2P5WA 3AZUA 3BZFA 5CZXC 4Q2ZB 1QFWI 4BDVA 2C7UB 3RX5A 1AGDB 5I1DB 4EUPH 4K55A 3T0XA 5GGQH 4GI6A 4GAJH 1FAIH 3D9AL 2JKXA 1M56B 4FQHA 3CZGA 1PX8A 4MMYA 4PJAB 2IWFA 1UXWB 4KK8C 3CDZB 1DUZB 1EEZA 1WFJA 3ZZLA 3QXWA 1DO5A 1NBZA 2MOGA 3MRLA 1X5GA 5HHMD 5L2JA 3FO2B 2JKRM 3WDJA 1JGDA 1A3RL 1VCBC 5E1QA 3T2OA 3FMGH 3UZVA 2KS0A 4KVNH 4O02B 3DVNB 4HCIA 4YFLF 2BSRB 3MRJB 3BAXA 4LLVA 2HJKB 4WDIB 4HUWA 1XR9A 2DLFL 3QXVA 1AGBA 1G9NC 1JHLL 1ZGLA 2Z65C 3C5ZD 4JN2A 5ID0A 3SQRA 4ZOBA 2B59B 1UM6L 5B22A 1DQKA 3BQVA 1FH5H 3BKMH 3LNDA 4N8VA 1MCCA 2XA8H 1XF3A 3LKOB 5CZKA 3BMWA 2L3BA 3UTQB 5CSGA 5DUBB 5HDLA 3RE0A 4EN3D 4X9BA 5EU7C 1B9KA 4ZUUB 4ZMQA 3CGTA 2WN2A 2ZJSH 3G08A 2F74B 3GSQB 1R3LB 5I0ZA 3AGWA 2BSSA 4CGTA 4JPWL 2G75A 3ARBD 4X99B 4A66A 5HYQB 2EDMA 2GEEA 1HILB 3BQUB 3N0AA 1U8KA 1ND0A 2PPEA 3RURA 4LEOA 4DPRA 1H3UA 4TM9A 3AB0C 2DQUH 2VUKA 4BWWA 4YR6A 4IOIA 5SX4H 1FYTB 2F6AA 5KW9L 3VTTA 1N64L 1E43A 3G6DH 4XNYL 1E5BA 1CICC 2WMPA 1Y18B 3IDYC 2AJSH 4JDZB 4I5BB 1ITBB 4GKZA 4Q9QH 1I8KA 1SVBA 1N10A 3AXLA 5KUMA 1A3LL 1O6SA 3NCEB 5DVPA 5M94B 4MXWH 2VKWA 5AAMC 2QT6A 1HEZA 4EDXA 3ZTEA 3MA7B 4NNXA 1BZ9A 5EZOH 4BCXA 2ZYHA 2YWZA 3WKML 5HYSG 5JR1L 3OAWA 5I8EB 4DKFL 4LOEA 3HPJA 1KXVC 3K2KA 3LZLA 4U1LB 1AZCA 3HC0A 3FUDA 2AQNA 3B9EA 3CAFA 2F54B 3TT1H 1H5BA 2ESVB 2PYEB 4H0HB 3HBZA 3CDGA 4NCC1 1G7QB 4HJJH 3GBMH 4E9RA 3GJEB 1ET5A 4HPHA 3X1EA 3OZLA 2VZUA 1IAOB 3HA0A 4WSGA 1EHAA 2H9GB 2IADB 4OD2A 5LWYL 4B97A 1ZJAA 3RZCB 1KCUH 3E3QE 4XP5H 1XXDC 4UV4L 3FH8A 2AQQA 2YAFA 3SGJC 5IV2B 4TL4A 5IMOB 4P3DB 5DA0B 1YUKB 5D93B 4R96A 4P9HC 2GG1A 4JQXC 4Y1AD 4XN2A 2O5XH 5IROC 4LARH 2G3NA 2VXQL 4I85A 4YDLC 5E8NB 2XUWA 2XV2A 4YX2H 1J0KA 1ROCA 1TENA 4YIQB 5JORB 3VO0A 4L4TE 4E0RA 4FYSA 5K1NA 5KSAC 4YHOL 1BFTA 1NCCH 4NBYB 1KGCD 4UDUB 3KXFA 3PWPE 5HHXH 2EVGA 1D5MA 3VI4A 3LQZA 2VLJE 2V9UA 4ABVA 4F57L 2WKGA 3SE9H 4HXBH 1CDGA 4QTHA 1CFSB 3IKCA 2A77H 3OMIB 3EH2A 3DX9A 2K8MA 5E94B 3CLEL 4YSPA 2SEBB 3TO4B 3WE1A 3LN5B 3OJDB 5E9DD 5C2BL 1T0NB 4GFTB 3S3SA 3AY2A 3MCG1 3SN6N 1JUFB 1VAHA 2QGCA 2GBVA 3OAYK 2EDEA 3PP4L 1QFWL 3R1GH 4PV8B 3I3EA 4XVOA 3VFPB 4YHZL 2GBTA 2C7UA 5I1DA 1AGDA 4D8PB 4P57B 2E76C 4AVIA 3ZL4L 3MJ7B 2F58H 4R4ND 1QQDB 4PJAA 2UXTA 3RPKA 1FLRL 2MJWA 1TTBA 1UXWA 3QYNA 4JHWH 4Z7OE 3DGCR 3PQYE 3CDZA 4WO4C 3K72B 5C7XL 3PDGA 5ETUB 2OX5A 5D6CA 3L1FA 4FQCH 3SDYH 3VWJC 5IJDC 4ANVA 3EH5B 4R97C 4XNQB 1KLUB 3O9WC 2DJMA 3DVNA 3NJJA 1NOAA 3X1BA 3RDTA 1XBRA 2BSRA 5D72H 4WDIA 2HJKA 4HWEL 1EHNA 3VXQB 1I7TB 2F53E 4OTXL 4FFZH 5F7YC 5FYKH 3QNXB 5T5FL 5IVZB 1X5MA 3BPCA 2BIPA 4NC1E 1A6AB 4JO2L 3WKQA 4PP1D 4KJWC 3UTQA 5KZCB 1CLZL 1JHTB 2JLPA 5I0DA 2JKLA 4U1KA 5AOLA 3LH9A 2CZNA 4ZUUA 4X8CA 2H5UA 1OTSD 2C4XA 2F74A 7PAZA 1ZEAL 1R3LA 5BCAA 5HYQA 1O7VA 3I85A 4EI5C 1MG2C 3BQUA 4GEIA 4MS8C 3RL1B 3VRJB 4A2LA 4AYBA 4XPFH 5CAYB 1TVDA 1D9KD 4P46D 1FI8C 2XPZA 4OCXL 3QS3A 1G7LA 2FJFB 3APFA 1SHSA 2DQFB 1Y18A 2NNAB 2ZOLB 4JDZA 4I5BA 5I1GH 4GMSH 4NUPA 1WWCA 2QADB 2EIDA 2RCSL 5GRYA 2YXVA 4XO9A 3VVWA 5K39B 3T2LA 3TJEL 2QPSA 3PWPB 4G9DA 4IDJL 3GKWH 2D3LA 2VR7A 1H0DB 5D1QC 3T1FB 3MA7A 4K94H 3CIQA 2VLJB 5FV2A 2CBMA 1E5CA 1TQCC 3NSFA 1A6VL 3TIEB 3WOVA 4EBQH 4Y4KA 2H2SD 2VERA 1AGEA 4NS0A 1R0AL 4QPEA 2A74C 3ROOA 4F2MB 1E9OB 2CJSA 2F54A 1XD0A 4Z3JA 2AABH 1FORH 2ESVA 1HXKA 3QXUA 2Q7NA 1G7QA 3GJEA 3P2TA 2B3IA 1NGXB 1KYOJ 3DGDA 2LT9A 2XICA 3PFUA 3GQFA 3SDCC 3VGHA 2DI7A 1QSED 5DSCB 1A1NB 1QFUL 5TF1L 3OHMB 5IV2A 5IMOA 4P3DA 4WTQA 1V55B 2FO4B 4QTIL 3IGUA 3PQYB 2CE6A 5E8NA 1MIEH 1RV6X 4ABUA 3K8KA 1BMWA 2Q9OA 4J3XA 4XBPA 5BJTA 3JTBA 5JORA 4ZW6A 2HP4A 3HRZB 4X6CE 3AS3A 3UYRL 5IEKB 4ADGA 1QSFB 2D7MA 1TZGL 4UDUA 1CGYA 5DC9B 2PF6A 3NIFF 2AXJA 4WEUD 5DFVD 5IHUL 1DQTA 1Q9LA 2YKLL 3EJQA 3RZWA 5HPOA 5KN5B 4L3ED 3ZL1A 3UROR 1J7VR 1S78C 4GAYB 4MAYA 4ODSH 5E94A 4PM1A 2SEBA 3CLWA 2Y06L 3TO4A 5GGRY 4OJFH 3UJJL 3F62A 4E9LA 3ZIYA 1FNFA 3JBG7 1T0NA 4IIQC 4XTRC 1NBVH 2X89D 3P02A 3QAZC 4QYOB 4PV8A 3VFPA 2G5RA 5DJXB 1F4XH 4HOWA 5ADPL 4GSRA 1HIMH 4MB4A 4MJHA 2EE0A 5HJGA 4EOWL 4WKZA 4D8PA 3EXJA 4P57A 3KW8A 4MJJA 3FRPG 4B50A 1TQSA 3IN2A 3MJ7A 5DEJA 3WELA 3VD1A 4KQ0A 5GRWA 4RMRA 1QSVA 5EUOF 1JXKA 2VC2L 1P9MC 2ZX7A 1UD6A 2LVEA 4RMUA 5HJBA 5LLIC 5T3ZH 5EZJB 3ZSSA 1G6RB 3L48A 4HUNB 3ARSA 4QRFA 4G11A 2A1WL 4MD4B 4GRLC 2YMXH 4Y16A 3ZVVA 5JZ7D 5E4IA 1WICA 4JKPL 4JL2A 1U0QA 2NZ9C 3V6OE 2P4AB 3C5XA 1H6EA 3RBSA 5BRZB 1K8DB 5C07E 3VXQA 3L4CA 4S1QH 4JFPA 4MX7B 3L4TA 4Z7VF 2P5WD 5IVZA 4W9HC 4ZFQA 1UWGH 4ZSOE 4B5ZA 3HC3H 1IM9D 2DMKA 2IOOA 2XHNA 2GAZB 1E2VA 3GGWB 1A6AA 2W92A 3S8FB 3MUUA 1HKLH 1A9VA 3S4SG 3ZE2F 4HJGB 3H3PL 4IDLA 4I18B 1NIAA 4JO1L 3K1DA 1IAKB 4HSQA 1ZLSL 2PETA 4UI2A 1N7MH 4ELMB 5DRNB 1MLCB 2ZKXA 1OWRM 4OFKA 1DTUA 1J8HE 2ID5A 4QHMB 3UGUA 3WEXA 2AANA 3PWUB 1HHGB 2AQTA 2GQHA 2WB7A 4UTBH 3KBHE 3CFBA 3BUPA 4JUTA 5F7DB 3RL1A 3VRJA 4P2CG 1JZ6A 3U0PB 1BECA 3CQFA 4K2UH 2X4RB 1NC2B 3L7EB 2XZZA 3HE6C 4XR8C 4YUEH 2DAVA 3VI3F 1FBIL 3LNEA 4GSDL 4JAMA 5CGBA 2DQFA 2NNAA 3ARQA 4NQSB 1EZVY 1FJ1A 5DFAA 4XT1C 4F7MB 4URTB 3PNWB 4PB0L 3ME0B 3JXAA 1MW0A 5F1KC 2CDFB 3VNYA 1DLFH 2HUHA 3W0WB 5K39A 1G7MA 1JZ2A 2Y3NA 3DX8A 6FABH 1T7VA 4R90H 1H0DA 3GJFK 4LSQL 1E8YA 1WIUA 2J44A 4BK4A 2LTQC 5E5MA 5HYFA 2KLSA 4LP8A 3UTTB 2CA3A 5EH1A 3QZPA 5J06A 5C9JB 1JMXA 5F7KC 1ZHKB 4R2GB 3SPGA 4F2MA 1I9IH 4XHQA 1Y1DA 1DO6A 3GWJA 1IC5H 3GSWB 4HKJB 3OKDB 5GS2D 3ZDXE 2IO5A 4ZMXA 3T5WA 1FHNA 1S5IL 1CGVA 5IW6B 4PBXA 4PHZA 1KTDB 2QMJA 4KQ3H 3WSQH 1NTDA 3L6FB 4LO9A 3U46B 2JI1A 3PG2A 5E4OA 2IAMB 4GMTL 3W5NA 1PQZB 5DSCA 3VFVB 4YK4B 3FUFA 3LCYA 3O4OC 3KJ4C 4OCYL 4IHOB 3DYMA 3P9LB 1EV2E 1KXTA 4WFED 5MI0C 2PTTB 2BSEA 3E1ZA 3EJCA 5DU7A 2YRPA 3VG9C 1CXKA 4ONHA 4Z77B 1HDMB 1JE6A 5IF0B 1FNEB 3F6IA 4B27A 3HNTH 5EU6E 3HRZA 3HN5A 5IEKA 4N2NA 4Z7UA 1TTUA 1F3RB 1QSFA 2OMUB 4K8RL 4N86A 4ONFL 4Y1TA 1KGUA 2ZXQA 5FECB 3X17A 1MCOH 4PJ9B 4QGYA 1M6UA 3QB7C 5GGRA 1HQRB 4GAYA 4ZSOB 3B2UC 2H45A 5KVGE 1PFCA 5HD8C 2KPWA 3IFOA 4HGKC 3BKYH 5EMYA 3MU3A 4ZUVB 4FZEL 3LZNA 4BQ6A 4Y2DC 3C12A 3QJXA 2UWEE 2X70B 3NCCB 3ZYIA 4AMKL 4ODVL 2IG2H 1IL1B 5D9SB 1HVXA 4QYOA 3V9EA 5J4MA 2YD0A 5DRWB 3WNOA 5AVYB 1EBAA 4OI8A 4RMVA 5CWSB 4OLXH 5HTSA 1X44A 1YEEL 5I82A 5JMOC 3T0EA 4KZEH 1S5HA 1F97A 4GKLA 2C3VB 2ZOUA 4DAGH 3NZHH 4I13B 4OF3A 1OT1A 2BXYA 2EXYC 5GS1B 2XTJE 2BHZA 4KTDL 4KDWA 2EH7H 1PG7X 2GFBB 3H85A 3O41B 3GBEA 1G6RA 5EZJA 5L8LB 1PPIA 1CGSH 2BSCA 3LH8A 4P2QB 5FFLA 5J5EA 3JT0A 3AQDA 4U7KA 4P5RA 1M4KA 3C6SA 2WLZA 3FB5B 1UQSB 2H3KA 3F04A 3ISWA 3N9GH 5BRZA 3VMPA 4DUVA 2OI9B 3WUWG 2HB0A 4GKOA 1EX0A 2ZCZA 2DQHH 2FQDA 3FCBA 1WCBA 3GRBA 4PJ5E 4PLJD 5JYLA 3BP7A 3FZUD 4Y8AA 3QJHB 2XTLA 1CU4L 1EO5A 1RZ8A 5HY9B 3GGWA 3C60B 4MZ2A 1UC6A 3RHWF 1R75A 3RB7A 2Z34A 1KWGA 2XN1A 3OMZA 2HT2D 4HJGA 1RJZB 4I18A 4J3OH 5H94A 5SX5K 1IAKA 2ED6A 3IGKA 1GIGL 3L3OA 3ZDXB 2ZWLT 4JMNA 4ELMA 5DRNA 1UEMA 1MLCA 4NN7B 5A2AA 4PY8J 4NKMA 3WJMB 1CQYA 4ONGL 3T9WA 4DEWA 4PPTA 5EA0L 3PWUA 3UG4A 1FZOB 4UQEA 4WSJA 5DZNA 3ILEA 3I3DA 3BT2H 5D70H 2WOBA 3U0PA 5J0BA 3RDTD 2X4RA 4OBSA 4LSRH 2AERT 3IMUA 1NC2A 3D05A 4FQLH 4KHTH 2WJ7A 5KS9F 2ZKWA 3ASNB 4J27A 3ZE1E 5I1HH 5CUSL 2W1NA 3LKQB 1OAQH 4NQSA 4NM8L 4PV9B 3TEXA 2I60L 3MZTA 4WWNA 4F7MA 4ZMVA 4YXKH 3PNWA 5EU6B 3ME0A 1DJSA 2CDFA 1IQWH 3W0WA 3L54A 4H1LA 4MYWB 4FG6D 4QGTA 4OFPA 2GK0B 3R19A 2NSQA 4MA7H 5FC9A 4PLNC 1EJ8A 5I15L 4FFWD 1AXTH 3CHRA 3BYYA 2FBOJ 4DGIL 3UTTA 4LESA 1SY6H 2JCWA 3U9PL 2FJUB 5CEYB 2VJ8A 4J8RA 5C9JA 4KKNA 1GCYA 2DQGL 1HWGB 3CVDA 5GRVK 1HL4A 2OR7A 1PYWB 3DMMC 1ZV9A 2NNRA 2JVUA 3GSWA 4W9IC 3EYQD 2CG9X 2UWEB 3EUDA 5AAWA 5CP3A 1YCSA 1KTDA 3DOSB 4M7KL 3JV5A 1SN5A 2AMGA 1I9EA 3U46A 3MLPA 3ZMRA 4ZPTA 3KL3A 1PQZA 4EN2A 5ENWB 3VFVA 3DI2B 4WHYH 4QKXB 2OZ4L 3P9LA 4NLHA 2O30A 3F01A 3MRGA 3HR6A 3MLXL 3IK2A 3Q2WA 3D3VB 4Z7WF 1YAZA 1G4RA 2K8QA 2PTTA 2XTJB 3SOBL 1J8RA 2OA9A 4YNYB 4CN1A 5IF0A 4CUCA 5D4JA 4Y4KD 5I76A 1FNEA 4YFEA 1MREL 4CVWA 1XGZA 5J13C 2BVTA 3BXNA 1P4LB 2OMUA 1JXJA 2F54D 3R0MA 1DVXA 2ESVD 5I6PA 2VXSL 4YXLL 5FECA 3S5ZA 4PJ5B 3DK0A 3TOPA 1J86A 3AWFA 2Z31B 3D9AH 1SXNA 5EIVA 4MDIA 2FEJA 5CGTA 3ZKQD 3BUTA 2LHAA 3CBKB 4EXPX 4ZAKC 3WHE0 3U2JA 5KBMA 2VLRE 1A3RH 1LK3L 4OF5A 4WEMB 2EXSA 5IGXL 3H9HB 5D9SA 1IE4A 3BGMA 1FQ9C 5DRWA 3T1WA 1JXFA 3RHWK 2DLFH 4NRZB 4WI9A 5AB9A 1JHLH 2J8OA 4JFZL 1UM6H 4MZRA 3TF4A 1DJGA 5AVZB 3RFZB 2C3VA 2PO6C 4Q52A 3V7AE 3F2LA 4QEGA 1R17A 4ENED 5H37G 4HA1A 2GFBA 3H3KA 1M2VB 1A02N 3GBLA 1O75A 2CBOA 4J39A 2EE2A 3TLRA 4P2QA 3LH2L 4MAYD 4X6DB 3IE4A 2VXTH 1E6OL 2Q3ZA 2Z0BA 2EAEA 2JKSA 2H41A 1KGCE 3ARUA 2YQ2A 3FB5A 3LAFA 2WINB 5EIQA 1K2DB 4F27A 4R0LB 2R2BB 3PIQA 5F7BA 1NGQL 3DX1A 5ELIA 1MAML 4HD9A 2VLME 4FFVD 3W1ZA 3QJHA 1PBYA 5HY9A 2XXFA 1A6TA 5BRQA 2V6HA 4TVPD 5FCSH 3B8SA 1LP9B 5JHMA 3VQ1C 5E9DE 1M7DB 1RJZA 1SM3L 1N64H 4WKXA 4XNYH 5JYMA 1ETZB 1F58L 2ITFA 2LAGB 1BG1A 4XP1L 3O81A 3WJMA 1ILUA 3FU7A 1A3LH 3D0VB 1M05A 4MMZA 2EIZB 1FZOA 5GHWL 3RIFF 4Y16D 3WKMH 3IDXL 1L9OA 2E47A 3P30L 5DGQA 4BE5A 5JR1H 3LIZA 4WFFD 2F8XC 1L9SA 3CFUA 4DKFH 5ID1A 1SXAA 4NUQA 3LXAA 2ZKHL 1OE2A 3LKQA 1Q94B 3BP5B 2YQGA 1MCEA 4PV9A 4IKKA 3HG1A 3UIYA 2X53A 3MQIA 4MD5B 3UPAA 5HDWA 4WV1C 5LWYH 2WNGA 5CBAA 2GK0A 3AC0A 4MXVE 4BEIA 4KROB 5HHVL 1DCLA 1OALA 4IKJA 4UV4H 4PJ7B 1H9DA 4ZBJA 2FATL 4KKRA 3B7UX 4B9PA 3ZLQC 2GUYA 3VSVA 5K9QG 1PYWA 2VXQH 2YO3A 2VCOA 4QHLA 3JWNC 4LPCA 5EC1A 1KIPA 3FUEA 4G6FB 4RETB 1JDAA 3RI5K 3VFNB 3O3EB 4YHOH 5AVSB 1GR7A 3BWAA 5ANHA 1AS7A 1VRSA 3BP6B 1WP6A 2EDBA 4YWGL 2Y23A 3EFOB 3HB3B 3ZE0F 4F57H 1RPQA 4OIBA 1UACH 3CLEH 3D3VA 4N0RA 4GI9A 1EXUA 4LP4A 5IMLA 2D7NA 2X0WA 5C2BH 1VIWA 1BBDH 3L2MA 3MNMA 4U49A 3FSWA 3NOIA 1K4DB 2MNJB 4PWGA 5DYOB 1R47A 2Y7SA 1ZAGA 3QVAA 1RUKL 1P4LA 3PP4H 4L1HA 4JGMA 1HSBA 1OGPA 1AZBA 1QFWH 3EJJX 4YHZH 3T3PF 4K7PX 4RAUB 4AVJA 1JIBA 1YAIA 4X7DC 4AGLA 3T0BA 1E8XA 5JHAA 4LPTA 1DFBL 2JELL 1KZQA 1S7WA 2Z31A 2ZG1A 4X4YB 3ZL4H 1QHPA 4NUMA 4X5PA 2AV7B 4RH4A 3VXNB 1LO2L 1GGYA 1N5AB 1QAWA 4F8QA 1JWSB 1A9BB 3REWA 1OAXL 5C7XH 4TL5A 5LAXB 1BJ1H 1T22A 4W9CC 2CSPA 3RGVD 3KDMB 1JD7A 4RX4D 4LBEB 4OF7A 2CM6A 3H9HA 2NY6C 4NKIL 1Q9KB 2BOCB 3T6VA 2W65B 3KLDA 2BSED 3M07A 1EJOL 3FBQA 1IGFH 4H0LC 4DKAA 4NRZA 4OCWL 4HWEH 1N3NB 4HMDA 1DQQB 4OTXH 4RWYL 2F7OA 1J9TA 5T5FH 1T2JA 1BF8A 3O2DL 5HHOE 1QSFD 4FN0A 3FTGA 3RFZA 1IBGL 4Z8FL 1GSKA 2WUCL 3PXJA 4JO2H 1EPFA 2EUWA 3EGSB 1M2VA 4A6YB 1WAAE 2YRZA 5FGBA 4X6DA 3QQ9D 3O0RH 3GDCA 1MFDL 2R4RL 1ZEAH 1J5HA 2WINA 3GF8A 1K2DA 4KMLB 2DWTA 4PJFF 2CKNA 2R2BA 3P73B 4KMQA 3WXVH 4DEPB 3EJSA 3QHFL 4RLDA 3TZVD 5CIPA 3T6XA 3ZGIA 4UT7L 2YD1A 4L3CB 1JVOA 4OCXH 1GKOA 5JHDB 5ICXB 1LP9A 1UCBH 4PJ6A 4U1SB 2OL3B 3T0ED 1ETZA 4AQZA 5EU4A 2AGJH 2BINA 2NOYA 4WGKA 2FX9L 2RCSH 5E4AA 1OT2A 3OMAB 1AZVA 3TJEH 3HMWL 2YD2A 5D1XB 4IDJH 2Y2TA 1CZ8L 1RUPL 2YPKB 1UKTA 2E9BA 4P2RB 4F5CE 2DI9A 4NPYB 2J72A 3HG5A 1N70A 3JQOB 1A6VH 1KGYE 2XIDA 3S6CA 1R0AH 4L48A 3DIFA 3V4VL 1SDDB 3VYNA 2VDKL 3RQ3A 2X38A 3EG9A 5CR8A 1JZFA 4H13C 3AJ7A 3ZKXB 5E7BA 3SO5A 9PCYA 1XT5A 5MEQB 4G6AC 4MD5A 1SHMA 1S7UA 1FV1B 2JJUA 1TR7A 3ZDWA 2E9JA 3X1FA 1CLOL 2XNAB 2DWDB 4R84A 4WCYL 3L9EA 4WW2F 4DKEH 2V8LA 4WW1B 5I73B 4X5XB 2XWDA 1QFUH 4CGUB 5F7MC 5TF1H 4PJ7A 4PR5B 2EICA 2R56L 4V2CB 3VFOB 2Z8WC 4AE0A 2EABA 4FHJA 1CFVL 4PWJA 3TV8A 2CH8A 3L9YA 1EANA 2FJSA 3DRQB 4QTIH 4BQ9A 4AM0Q 3B7RL 3TN0C 4FFYA 3GDBA 4F8OA 3GRGA 3AADB 4DP8X 5K9QI 3TA3A 1MW2A 4WUKL 4UYPA 3VFNA 3ARZA 3UYRH 4AGMA 3O3EA 3KR3H 2HLFD 3OKEA 3CFTA 4PEEA 3V52L 2YKLH 2EEDA 3EFOA 4I9WD 5DT1L 3DX0A 4EF3A 3EF7A 3W0WD 5C09E 5HHOB 1C8PA 3N1GC 1YUHB 2WLMA 2ZTBA 2ZAHA 2WXOA 2VL4A 4JDTL 2Y06H 4HKXB 3DTDA 3VM7A 5CGYC 2W0KA 3OC8A 4HUVB 2AZAA 4ZD3H 2BP0A 4WWID 4KKQA 1BYNA 1J9CT 4XCNB 3PHQB 5DYOA 2O5NA 4N5ED 3TBBA 2BY3A 1HL8A 3MRHB 4J7RA 4MNGB 3STZA 4BKSC 4GRWE 4K94C 4P5KB 2PPDA 1NEUA 5ADPH 1Y6MR 3BVUA 4RGNC 4CKQA 4GG6B 3QRBA 4EOWH 4FTVE 4HC1L 5A3ID 4LMQI 5IEHB 2WZ6A 1JVKA 3DO7B 4X4YA 1IILE 5HYJD 1UA7A 4KGJA 1QBBA 1CDUA 1JWSA 1RIUH 3KLSA 2VC2H 2C7FA 2EDYA 3F3HA 4YLQT 2G4EA 1I85A 4WU5A 5LAXA 4Y2OB 5E6IA 4Z3GA 2Z7UA 2WO4A 3RBGA 1XO8A 2A1WH 1Q4NX 2ZX9A 4L8DB 4LBEA 1Q9KA 2BOCA 4JKPH 1M9WA 2W65A 4PJDF 4M56A 2YGQA 1JZ5A 2OPCA 3QI9A 1A66A 2WP3T 2H32B 5CSBA 4URKA 1N3NA 1PG7W 1DQQA 2VT0A 2YAPA 3IJ8A 5FUCC 3PFQA 3QCUL 4PJBF 4NFDA 2AJZA 3H2PA 2CIKB 3P9MB 4JFQA 4WFEE 4CN4A 1GYUA 1SMDA 3DO4A 3SD5A 3SQOL 3OKNB 3EGSA 3H3PH 2R2HB 2XPGB 3NGBB 1XZ0B 1FVDB 4JO1H 4NENB 4A6YA 4XCFL 5IMKB 1ZLSH 4FA7B 1NZRA 1FO0B 1KTLB 3ZKMD 3EH3B 1FVCB 2VIRB 3KYNB 2OMVB 3ARFC 2XBZA 2EXTA 5DDHB 3E2HC 3NACH 4ZO6A 5FA4A 3C6LD 2WZ5A 1INQB 4XMVA 4IK6A 1BG9A 5I1EL 4L1TA 3EDJA 4CVXB 2UXVA 3MGAA 3BUBA 5JHDA 1NFIB 5ICXA 2DQ6A 1YZZA 4XP4L 1FBIH 3HN3A 5CP7B 4GSDH 2CAKA 3X3GL 1P84J 1GZQA 4U1SA 1FG9C 2OL3A 3L8QA 5C92A 4TS6A 1LK2B 2FIRT 5SV4A 5EFIB 4DW2L 4PRNB 4PB0H 3AQXA 4PS3A 4JKMA 4LLYB 4Z5RA 4GYBA 3I6KA 4H8WL 5D1XA 2RMNA 3QDMA 4UZGA 4YSSA 5KAQF 1QOKA 2YPKA 4JRWA 4DPAX 2XWRA 2YD9A 4P2RA 4HW6A 4LSQH 1X4XA 4RMTA 3RY6A 2D3VA 2XTSA 3PAZA 4D7PA 5C09B 1Z0NA 2B1HL 2AS5M 3LZFL 3QIWD 1SDDA 1A14L 3NT0A 2OMTB 4KO6A 5DHVA 1G43A 5A2BA 4P5SA 1S5IH 3OGOE 5KVGH 5MEQA 3PL6B 4BHUA 5KSBB 3IJEB 3RY5A 4GRWB 2HFEA 2DWDA 1AKJA 2XNAA 3C2SA 1CD1A 4GMTH 4P5TC 1Y6NR 2CR6A 5AZEL 3RVVD 4U1JB 4OCYH 3VFOA 2DMBA 2R1WB 3TBTB 3MV9E 2N0KA 5F70A 4LPXA 4H20L 4IMKC 3JWOC 3PGCB 1MCWM 3AABA 3GSNB 2UVFA 2UZPA 4HPOL 3Q6FB 4QR7A 2N7AA 3UO1L 4KJQD 1DFXA 1UASA 4M7JL 4XVUD 3MBEC 2X42A 3TJHC 3I3BA 3GD1C 4K8RH 4ONFH 4OZGA 4N2DA 1I3GL 3P11L 4LASL 3IDNA 3MV8B 2GT9B 2YKKA 2YXWA 5HHQB 4JS7A 3HG1D 4AIXA 4MJIE 1JZDC 4YDMA 1TZAA 4NZJA 3KGUA 4K3JL 3MREB 4Y5VA 4A39A 1Z9PA 3LNHA 4HKXA 4G8FB 4ZQTA 4FZEH 3NIDB 3VDAA 3NCXA 1MFMA 4WJG3 4HUVA 4MLIA 2SODB 4OFYA 1O9WA 1WAAA 2ZAIA 4XCNA 1XCTA 4E9TA 3OGCA 1EERB 4M61B 3CDCA 3MRHA 4ODVH 4AMKH 3MRPA 4MNGA 4P5KA 4GG6A 4L9LB 3RB5A 4M8QB 5LXGH 3QJRB 1EJ6A 4N1EA 3GMRB 1P7QA 2BVQB 3DO7A 5LBSA 3SE3C 1YEEH 2H1LM 1HCZA 2HTKD 5I1LA 4I88A 4MNHB 2VDOB 3WBDA 2XDHA 5D55A 4KTDH 4Y2OA 4RCAA 2IXQB 1YEIH 4WEEA 5TK4A 4X4XB 4ZFFB 2BIOA 4J12A 1XR8B 2HZHA 3QZNA 4UQ9A 4ORGB 3MZGB 3S8WA 3WN5A 5IFAL 4PG2A 4LGRB 4XVTL 5E08L 4B60A 4Y4HB 1B6DA 2CIKA 1OHQA 2FWOB 2QR0B 2ZX5A 3G6JA 3P9MA 5DQJB 1MNNA 4ZOAA 4JMXA 1ULVA 3G9VA 1F42A 4WRLA 2R2HA 2Z31D 1FVDA 4LMQE 3NEEA 4JM2F 5IMKA 2PPCA 1H3PL 1KTLA 3H42L 3LPFA 2WIMA 1VADB 4H2CA 4YSDA 1FVCA 2VIRA 3CMGA 5DLML 3KYNA 3NCWA 2OMVA 4ONGH 2IPTL 3D34A 4N2LA 3CVBA 5EA0H 4N8CL 5F89B 3HNVL 4W9LC 1YEHL 3B8YA 1F11B 3BKJL 4OU3A 4S11A 4Z76A 1INQA 1D2PA 4KWUA 3OHXC 1T83C 3ZIMA 4CVXA 2VQTA 1CDBA 3ZQXA 3L5HA 4JJHA 3RX7A 2ODIA 5CP7A 5DWPA 1BDYA 5AKVA 2EEBA 5CUSH 3FDWA 5GGTA 1BXXA 1XF4B 1LK2A 3F7PC 4NM8H 4TOYL 4Q0XL 5EFIA 2I60H 1EAQA 1G9ML 3Q2LA 3RTQC 3EO9H 4HDIA 4JM2C 3ESNA 4PRNA 4TVPL 4LLAA 4DESA 2MOVA 3E80A 4QJ3B 4ZUTB 2VR4A 5DVLA 1AZRA 4H26A 3APCA 3RWEA 3J8F7 3QDGE 1WVZA 5I15H 4MZIA 3HS0B 2AEOA 4DGIH 3BOVA 1YY8B 1NEZB 3FS9A 4J3OF 4LGSB 4PGEB 3U9PH 1L9PA 4JFDE 3SGEH 4Q89A 2DQGH 2H7WA 3BAIA 3IMTA 3KMDA 2HA1A 1UWXK 2VXVH 4XWOC 5F7UA 2P24A 3E7JA 1ECZA 2X4OB 1SQMA 3CVHB 5C0JB 4HS8L 1AD0A 3PL6A 2D73A 4M7KH 4FLQA 5KSBA 4A63A 5I75C 1E4KA 4GBXD 3H2QA 4R7NB 1B0WA 5IFJB 1RZ7L 2FEDD 4BFFA 1GY1A 1NJ9B 2GUOB 4G8GE 1GOGA 4TVPE 2OZ4H 2C9XA 2R1WA 1MFAL 2ZWNA 3TBTA 3MLXH 2VYRE 3NPSB 1I4FB 2AK4B 4BXVA 2X2HA 4IRZL 4J3UA 3GSNA 1GTNA 3CSYB 3SOBH 4YBQD 5DQDL 3QYMA 3CLFL 3NCYS 4ODUA 4B9CA 3Q6FA 4NT6B 2XWJB 2AJXL 2GBUA 5KYXB 1MREH 3L7FB 1A1MA 3KBPA 2AEQL 4NQEE 1FL5B 4JLRB 1YPZA 5CXPA 5G5DB 2VXSH 3SODB 3MO1B 4YXLH 2R15A 3MV8A 2GT9A 1ZD6A 5F9DC 5HHQA 4XMLL 5HBBA 4LKCB 5G55A 4AV4A 1TLKA 3BHBB 3RUGA 4J6RL 3MREA 2YK1L 5J3HD 3VWKB 1ZLWK 4C4KT 5DJAA 1OPOA 1UADC 4GXUN 4KH2A 5B39A 4XXDB 1PX3A 1JWUB 1W15A 3W56A 15C8L 2Z35B 1M7XA 2FTAA 1LK3H 2YSSB 1S7VA 3S96B 1TNNA 5IGXH 3SB3A 2FCBA 1BQHB 3VXTB 4A55A 2DEWX 5KJRL 5TH2B 1OGTB 5I1CL 3LS5H 4L9LA 1EGJA 2QVFB 2MCMA 4M8QA 1MI5B 3GMRA 5LCVH 4Q6IB 2BVQA 3WAKA 4JFZH 3TA3D 4KHXH 2CLZB 4IU3B 2K45A 3DV6B 1OQOA 4BZ1A 4K7PY 3P77B 4MNHA 3GIVB 3E8VA 3AS1A 4GAGL 3HB3D 4I89A 3VVVA 1SUHA 2J55A 2IXQA 1HE8A 4RDQG 4Z7NB 1OCOB 4K9EL 1IFGA 1MJUL 3LH2H 5DHDA 3BP4A 1I7ZA 2WWKT 4TMPA 1E6OH 3DHJA 1MHEB 4X4XA 4ZFFA 2R2EA 1WTLA 3K4DA 4ORGA 3QDGB 3MA9L 4PMEA 1NGQH 1IGML 3OAZK 3HBQA 4AQ1C 5EBMB 5L6YL 4Y4HA 4F7TB 2NYKA 1AQKL 4YHNA 1FLTX 4ZJ9A 2QR0A 2FWOA 4JFDB 4TTDC 1QNZL 3KPSE 1MRDH 4KUZL 5I1KL 1SM3H 1J9QA 1F90L 2DH3A 4N9GB 2P5EB 1F58H 3GSRB 4P4KB 3TYGL 4WHCA 3B9KC 4BK8A 4XP1H 4NRYB 1I7RB 1QMUA 2B5IC 4HHGA 1HCYA 5E6ID 5FGCE 2I5YL 3TCTA 1OW0C 3BW9B 1DVYA 1D6VH 5F89A 1VEMA 4GKSB 5GHWH 3V8CA 1OLZA 1CC3A 1PZDA 3V6BR 2XQYA 4PUBH 3IDXH 3MJGX 4HFUH 5DF0A 5HJDA 2NXZB 5DD1L 2A6JA 3P30H 3QI9D 3CVIL 5D2LE 5ALBL 1TMCB 4LE8A 4YZFF 4PQXA 2GCYB 5EDXA 2DM2A 1F0LA 1R3JB 3KEHA 3QQ3B 3UAFA 1XF4A 5DJ6B 4ATTA 3AQZA 3GZQA 5CN1A 4UQ2B 1IQDA 1GKEA 1YJDH 5AUMB 1I7UB 4NO3B 2X6UA 4ODXB 4ZTOL 2DJ4A 2WAHA 4JFHE 3RWCB 3FTUA 2XG5B 4LOFA 5HHVH 4EIZC 3GXDA 2ZCHL 3CK0L 3HN8A 3VXUD 1KCVL 1NEZA 1C1EH 1N8OE 1RZFL 2UUDH 4PGEA 4Q74A 1IKNC 4HU8A 4OIIL 4HS3B 4UANA 5T1KB 4B9FA 4HOXA 2RHEA 1LDPL 3EAKA 3GM0A 1CTMA 1G87A 1IBZA 4KI5D 5T1MA 1VERA 5D5ME 3RP1A 3DI3B 1P7HL 3G5ZB 4LHUB 4BFOA 3H6AA 3HVNA 2YAHA 3CVHA 3GSVB 5JHDD 2WNXA 3F00A 1UWYA 5JOFB 3QT2A 4WTZA 1JPSL 2NX5A 2WQXA 2YEVB 4YWGH 5I66B 2FH6A 4R7NA 1LWHA 5J12B 3VH8B 5AOZA 5IFJA 1NDMB 2P80A 3ECVA 1OT4A 2EE9A 2GUOA 3V7MA 3ATDA 4POZD 1EHLL 3ZHFA 3E3QC 4NJ9L 5D1XD 3QDMD 4JGUA 4R4FL 1I4FA 2AK4A 2P3YA 2GJJA 2CBPA 4DGVL 2NQDA 3CSYA 4P2RD 3CQQA 4NT6A 2XWJA 2DWEB 1KBPA 3D12B 1WC7A 2WPGA 4FKKA 4KXZI 3ALWA 4TQEL 5AW4B 1IKFL 3U6RB 3L7FA 1CMOA 4HHAB 1E3XA 1RUKH 1LWRA 1FL5A 4JLRA 3MRNB 3MRIB 5F3FA 3BVVA 3MO1A 3AG2B 4EEEA 1N8ZB 1EHXA 3MI6A 4IQHA 1DFBH 2JELH 4LKCA 5TE7L 4KX7A 1JCVA 1SBSL 3BHBA 3IS1X 4NB7A 1R4XA 1XXFC 4X9GA 1OAXH 2WSPA 1AKJD 2VABB 5LUMA 4MQTB 1JWUA 1BBJB 2Z93B 4IJTA 5DI8B 4Z7OF 1QW8A 1Q9WA 3KL0A 1QFHA 2X9WA 3SDDC 2Z35A 2YSSA 4M4RB 3EDDA 2CKBB 4G9FB 1G7PA 4GPVA 3QIUB 3O6FB 1BQHA 2W80C 4NKIH 2ZG2A 1DVFC 3VXTA 1OCZB 1OGTA 5AENA 1EJOH 4ZFZB 1KCSL 2X7LB 4OCWH 3EZ8A 2WTPA 3TVMC 1MI5A 1IGCL 4Q6IA 4ZS7L 1DE4B 1VEPA 4RWYH 3RJDA 2CLZA 3O2DH 1MJ7L 1R24A 3KPNB 2VZSA 5D2LB 1OF2B 1IBGH 3P77A 4UOW1 4KRPC 2WUCH 5ABDE 4Z8FH 4RA0C 3GIVA 2H32H 4J8QA 5KSUB 4AT6B 1UD4A 4ERSL 5FO9B 1MFBL 2Z7ZA 3K81A 3PS6A 3W39B 5GSVB 2CNYA 3QEUB 1J0ZA 1MHEA 1MFDH 1R3KB 2R4RH 3QUMB 3QJOA 2ADIB 4R8WL 1NCUA 3WAJA 25C8L 1VLXA 4MB5A 3TTYA 5SWZB 5LKNA 2X44D 3V55A 4PP2B 5EBMA 1SOSA 5JIDA 1RURL 4UT7H 3ALXA 2FO8A 1P7QD 3DOHA 1KCRL 2EJ1A 4N9GA 4GS7C 1RIHL 4LOUD 2P5EA 5D5MB 4ANWA 3OLEA 4NFBA 3GSRA 4AQ8A 1NLBH 3VFTB 4NRYA 2ENJA 4RNRB 4XO5A 1I7RA 3BH8B 4DVRL 3RAJL 2EQDA 1AHWB 2FX9H 1K85A 3HMWH 1MCBA 3BW9A 3F65A 1KTKE 3Q9PA 4XMUA 1CZ8H 1PEWA 1RUPH 1YMMD 4PMFA 5KBDA 5BS0E 5HYJE 1AS6A 3EH4B 3DKHA 3EOBB 5BUGA 4Y7OC 1I1FB 1XD1A 2DQMA 5GGVY 1TFHA 2D8KA 1T03H 3ARDA 2YA0A 4AK1A 3V4VH 1AY1H 3NCJL 3QA3B 2VDKH 4BWUA 2WBWB 5DC4B 2AKRB 1R3JA 4JFWA 2E8YA 3QQ3A 3P4OA 3B2PA 1B0RA 2BWDA 2HTLD 2X4UA 1PMYA 4HLZH 4L4VB 4U4IA 5DHMC 3LRLA 1L6PA 1YNTB 4UQ2A 1TXKA 5DO2D 3BZEA 5AUMA 3U9WA 1I7UA 4ZMYA 4ODXA 3FNKA 3VSUA 1CLOH 4WCYH 2VDNL 2JKIS 2XG5A 1FPTL 4JQIA 4JZOB 3RVUC 3IRCA 3DVFA 4ZT1A 1ZT4B 2R56H 4AGNA 1Y07A 1CFVH 4HS3A 5AOJA 5T1KA 4PD4J 4KKCC 5DZOA 3VCLB 5FO8A 1T2QL 4AEIL 4TTGA 3IFNL 1AQDA 4PRAB 3WNLA 3GSVA 4HBQA 4D9RD 1LE9B 4Q9CA 3D7PA 2F19L 2YD5A 3V6FB 4LVHB 3JV6B 1GGBH 1V3MA 3CXFA 4X6CF 2XX0A 3FFCE 4EIUA 3LQAL 4HK3N 3V52H 5I66A 2H8PB 1QASA 2HG0A 3D33A 5DT1H 3VH8A 1VZIA 4JFEA 1NDMA 4U1IB 1T04A 3HJEA 3F64A 4IGBB 2NNXA 1RIVL 4U1HA 2CO7A 4ECNA 4JDTH 5LHDA 1SYSA 1TZHB 3V2AR 4AQAB 3WEAA 2DWEA 3DDFA 3BN3B 3DGGB 3WTUA 3GSOB 3U6RA 4AJYV 3O8XC 4M5YL 4HHAA 4R9HA 1NDTA 5FYJU 4HJ0C 4BA8A 4HG4K 4BUHA 3NCMA 2APXA 4HZLB 3WL9A 3LIZL 1E4WL 4HC1H 3GB7B 1M53A 3BD3A 3PL6D 5LNEA 5DFWH 3S2CA 3QJTB 4LRIA 5LAPA 3W9EB 2ZUYA 4X4MA 4YSCA 1BBJA 1AO7B 2FDBP 5DI8A 4BM7A 3DOIA 2F5BL 3S5YA 4M4RA 3DWTA 2CKBA 5HI4D 4G9FA 3O6FA 4WTWA 5E1IA 5TFSL 1DCEA 2EC8A 3P0GB 4G1MA 4M7LL 5TE6L 3NABL 4A38A 1OE1A 4ZFZA 2X7LA 1MCFA 4FX5A 3QFJB 2ZUXA 4MTMA 3AU1B 5E2VL 1TCMA 3QCUH 2AV1B 3T8XA 2ZICA 2XVLA 4I4WB 1NPUA 3KPNA 1S9VB 3LEXB 5D2LA 3CSGA 5C0NC 4AV5A 3B2DC 2V0AA 3MV8D 4WFGD 5C2UB 2W0LA 4IRJC 4XPGH 5KSUA 3UBHA 4AT6A 2HT4D 1U8IB 4LVEA 4QRAA 4EJ1C 5BRPA 6PAZA 5FO9A 1SVCP 4XCFH 2Z8VC 3U2SB 3W39A 3F85A 5GSVA 3QEUA 5GZNA 4AL8H 2MQ3A 4NN6C 4HWZB 2OR9L 3QUMA 4HMCA 4Z7QE 2ADIA 2YUZA 1EFXB 4KZCA 5SWZA 1OKEA 1WS7A 5B1JA 3D39E