2O61B

Crystal structure of nfkb, irf7, irf3 bound to the interferon-b enhancer
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
314
structure length
314
Chain Sequence
MDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords 36-MER
publication title An Atomic Model of the Interferon-beta Enhanceosome.
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 314
sequence length 314
ec nomenclature
pdb deposition date 2006-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00554 RHD_DNA_bind Rel homology DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2o61B02
2.60.40.340 Mainly Beta Sandwich Immunoglobulin-like Rel homology domain (RHD), DNA-binding domain 2o61B01
4ONGH 4D0DB 5D70H 3KPMB 1OGAA 4JZOB 5I8KL 3ULVL 3KLAA 5DD6B 1N7MH 2CKBH 3LRSB 3C09C 4IHOA 2Q87A 2X44D 1UACL 5DJXA 4Z95L 3QRGH 1HN1A 3AGVA 1N64H 3LN5A 4DTGH 1TETL 4PJDF 4OGXH 2D0FA 5D6DC 4ZQKA 4MDJB 5HHOB 4JDTH 4XT1C 5EOCL 1F8TL 3BRFA 3FOLA 5D2NA 4JY5H 1NDGA 2YPLD 2DQIH 3B2UD 3FAXA 1XF5B 1ZHNB 1MHCA 2YN3A 2O93L 5D1QA 4LASH 4YNYA 3V0VA 3VXNB 1Q0YH 4Y5XA 3HC3L 5HYEA 4ESKA 5GGVH 5CSBA 1ZT4A 1QLEL 2H3NA 5A3ID 3TN0B 3W0WB 4NRXB 4Y4KA 5TDOA 4LNRB 3BISA 2GJ6E 1OT2A 3UTPD 3F7QA 4PRPE 1N3NA 2HFFB 5DA0B 3S7GA 1ZA6B 2VMFA 1S9XB 4P46B 2FHBA 3MV8D 1AO7A 3KPSA 4KDWA 1CD0A 3THML 3HS0B 3RVTC 4K7FB 1NGQL 3CLFL 4I0PD 1BFVH 4LPCA 1I9RH 2PXYB 1TZGL 4JPWH 3GJFA 1DTUA 4ZFGH 4TUOB 5BXFB 2VABB 4QY8A 3IJHB 3PJSA 4KQ4L 4LKXB 1MIMH 1Z3GH 2OM5A 1MJJA 3IJSA 5E2VH 3OHXA 4NFCA 5A16A 3F5WA 2A83A 4D9QE 1E28B 4NBZB 3RJQB 2VAAA 3T0DA 5DHXB 3SDCB 3ULVC 1NCBL 1OWWA 4RSVA 2AJZA 5BVJB 4LCUA 1IC1A 1BECA 2VDML 2C4FT 2EDFA 4QO1A 2PO6A 2PW2B 5GRJL 4YBLB 3VXTB 5E9DD 2H6PA 2BSTA 1MCFA 2F53A 3H3BC 4KVCL 4X6EB 3MO1B 1I4FA 3C9NA 4S2SB 2XKNA 3GFUA 3T4AB 1MUJA 3KPTA 1XF4B 3VA6A 4RGNB 1HYSC 1R3LB 2NTFB 3IKKA 4LL9A 5FCUH 1IM3A 4G8EB 2DI8A 5FHBL 2DN7A 4MA8H 3GJFK 1EFXD 3BQUD 4K3JH 3JTTA 2ZUQC 1T3FA 4P9ML 1T03H 4ZDHB 3TZVD 2UWEB 3MRIB 3BKCH 4Y5YB 5GSVB 4TULH 1I85C 3RUGE 5FYLL 2HYMA 4JPKL 2V17H 2B2XH 4PJXB 3RVVC 2EH8L 1BMGA 4ODUB 3HI1A 5A40E 4N0YL 3HCVB 3I6LD 3VWJC 3HI6L 4Q6IC 3S36X 2D7TH 4UAOB 2HWZL 1OARL 1Q9WB 2FBJH 1DR9A 4MS8D 3WFCH 4UQ2B 3BHBB 4NQDE 1LHZA 3O4OB 2Y06H 2BERA 1ZTXL 3WKML 2VQ1A 4NKDA 3HUJF 2DQEL 2VISB 4P57B 1TCMA 1NEZG 4N0FA 3O45A 3WHE0 2IAND 2VXSH 3DETD 1EGJA 1BQSA 1ADQL 1JNJA 4YAQA 2Q7YB 3MRHA 4BK5A 1VGKB 2SEBB 5KSAD 2ARJQ 5DD5H 4HDIA 1KCRH 4F33B 1K3IA 5AEAA 3ZDZF 3RU8L 4GAJH 3LB6D 3LV3A 4MAUH 3VMNA 4IOIB 2LTQC 1CZ8L 3L3DA 5GGRY 3QDHA 3VGAB 3OR6B 3RWCB 5KJRH 1UB5B 5I19L 3B2VH 2E27H 4DOHB 1KF9B 2VE6B 1WAAF 5E6IC 1NC4A 4M6MH 1KXVC 3WL9B 4JO1H 4ZNCD 4GXVH 2J8OA 5E4EC 5F96L 1JZ4A 3K4ZA 2DM3A 4LVHC 4ZOAA 1PEWA 4HIHB 3V6FA 4HKJB 1IT9L 3UDWC 2X4PA 4LP5A 2E7CA 4PJGA 3SE8H 5C0NC 4POUB 5DMKA 3IGAA 1WITA 5MEOA 1T2XA 2VLKB 1TZHA 1K4DA 3MOBH 3V95A 3VXOA 4PJHA 3CCHB 3P4NA 1M7DB 4AL8H 2OMBA 1B3JA 1HWHB 1RMFL 1TMCB 5J3HC 4FMKA 4BSWB 2P5WA 2ZCLH 2Y07H 5A43C 2NY3D 4LDOB 4A6YL 2EE6A 5HDQH 5J1AA 2EYTA 2FNBA 3D85A 1IE5A 3W39B 3MXVL 3RA7L 4FQ2H 4PRDB 4JHZA 4LLDA 5FAAA 3RVUD 3SGJC 1OD9A 3MR9B 3GNML 4ISVB 4YDJB 5JW4M 4MWFA 5GIRA 4LNVA 2BOBB 4HIXL 1RZIA 3P73B 1S5HA 1INDH 3ABZA 5E2JA 1AQDB 3RZWA 3MGOB 4KHXL 1T1YA 5FGCE 4U1NA 3BE1H 3PHQB 1ACYH 3MJ8B 1CFQB 1F11A 3I50H 5F9OL 1D9KA 5MP6H 2WSKA 5D1ZA 3S88H 4X0KA 3VXPB 2V2WB 3VWKC 4J7RA 4NNPL 1DJSA 4X4ME 4GW1B 4LSUL 3WEXA 3GRWL 4PTTA 1VFAA 3H9SD 3HG1D 4ZPVB 1RJZA 1GAFL 4MXWL 1ZS8A 3FB8A 3QDGE 3QJFA 1WBXB 4FQJH 3CFKB 2CRZA 1LEIB 1JHTB 3UYRH 4FNLH 1DQML 4NZTL 1JN6A 5BZWB 2ZCKH 4PBXA 4KKCD 3AY4A 1C5BH 5IW3A 5I8CA 5C0BE 4NQVA 1NUNB 3SQOH 2VUYA 4IRJB 1JPTL 1VADA 4KC3B 2XN9A 2DLGA 5CEXA 1MNUH 2APFA 1GZPB 4RBPK 5HTSA 2NY5L 4WI7A 4RNRB 5DEGA 3VXME 4PJ5B 4KI1A 5KG9B 1HQRB 3WFHA 5CKAA 4Z7OE 4PJ8A 3QCUH 1UZ6F 1ES0A 2Y25A 4GKOA 1JWSB 2AK1H 4DUXA 1VACB 4MQSB 5F44A 1R3HA 5AZ2H 5F3BB 3FFCD 4JN2A 4JM4H 4MCZB 1II4E 3EFDH 5DRZB 2QKIA 1RJLB 1H9VA 4Y2DC 2B8OT 3EOTH 3QWQB 2EDJA 5L9DL 3OKOA 4DZ8B 4TSAH 3I84A 4PP1C 3NPZB 4KKBC 2X1XR 2XQYK 4ZO8A 3SCMD 1TCRA 4K8RL 2ZOLB 3RIAK 2NY0C 5BRZB 5EC1B 5FO8A 3X13A 1IGJA 3LPFA 3SDXF 5ECJE 3FN0H 4OFKA 4BZYA 4R26H 1CK0L 1IFHL 3U2SB 2MTPA 2DF3A 4NQUA 1FORL 3C8KB 5D1XB 3HZMA 1NFIA 3U1SH 4OLVH 4IOFD 1NMAH 2P46B 4QRPD 2FWOA 4NSKA 5EIIB 3IFPB 2Y23A 5I1AB 4Z76A 1MREH 4G8GB 4NJAL 5DD1H 1I1FB 2R2HA 2JCCE 5D72L 1A64A 5KSUB 2FL5B 4H5SA 3C5JA 1CBVH 4X5LA 5C71A 1IKNC 4PS4H 3UTTB 4CJ0A 1KACB 5F1IB 4WV1B 4UOW1 3H3PH 3OPZH 5HVGB 3O3EA 3BIKB 1MCWW 1NMCC 4HKBB 1A1OA 3GSXA 3JWOL 2YA0A 4TPRH 4M7LL 1EXUA 4AT6A 1F42A 4YX2H 3QWOA 5SWZE 5DLML 4QLRA 5JO5A 1A2YB 3WBDA 5JPNB 2DKUA 3ARBD 4W81A 5E1HB 4MNGB 5IBLC 1O5DT 1JGLL 2GCYA 3PWVB 5DA4A 2F19H 2DM7A 3C60A 2IC2A 2F8OA 1WFNA 4PB9H 3TA3B 3DGCR 3IETA 2Q6WB 5D2NC 3DI3B 1CF8H 1G1YA 4XP5L 2JJTA 3LKNB 4Y0GA 5HYFA 1NLDL 5CCKL 3CFDB 5HHOD 4WI4A 1IC7L 4X99B 3WDIA 3K3QA 1C5DA 5JNYB 5I17B 4M43H 2B0SL 2YD8A 3IDGB 3WN5C 5E00A 3MMEB 4K8RC 1DANT 4Y4KC 4UINL 4OGAD 2X1PA 1CU4H 4XH2B 5EO9B 2DBLL 3CU1A 2YPVL 5DJ0B 4LLWA 3EHBD 2R29L 1V7NL 4R4BA 1O7VA 3KLDA 3K81A 4LVNC 5JLZA 3GO1L 1WBZA 4YXKH 3H2WA 3L3IA 3OKLA 1I7RB 1UXSA 1Q38A 5JDSB 2NPLX 1R3IL 5IK3B 2DMBA 1IQWL 4M7JL 5EBWA 2EDQA 1LGVA 1FYTE 2W0FA 2XNAA 1AGCB 1JIBA 1HK6A 5F6HJ 3JV4A 3V4VH 3EYUL 2NY4C 5J6HA 3BPOB 1GHFH 2EDLA 2PXYD 5DO2D 3H42H 3W11D 1S9VB 3SKMA 4MLIA 5CLTA 2Z8WC 4PRHE 4OCNC 4OLYL 4WW2B 1D3CA 3SQBA 3T0BA 1EGJL 2YD3A 3JWOC 2ZUXA 3U9UA 3AREC 3EGSA 3R0MA 4OBRA 1IGTB 3UTZB 3U7AA 1S3KL 4IDJH 4QTIH 4D0CB 2J1KA 4U2YA 4MJID 5B3NA 5BS0D 1ORQA 4NNXA 2FR4A 4HS3A 1T7YA 4RX4A 2AI0H 2FECI 4PY7B 1U8KA 3ILPA 4POZD 5T5NG 5HY9B 2CDFA 2EXWD 2HJLA 4WEUD 5CP3H 3GHEH 3MLSL 5J12C 2YD7A 4JZJC 2ZSWA 3U36A 1NL0H 1FRGH 3FMGL 3W9DB 2E6JA 4HKXB 4R97B 4Y7MA 15C8H 4Y19B 4EUPB 4YDLC 4NN5C 2B1HH 3S5LA 4MJ6A 2WP3O 4CMHC 2OTWA 2DLFH 3O3BB 1JPSL 2GW5A 3BEWA 5IM7B 3VJ6B 4R8WL 5B22A 3IDXH 1YA5A 3G6JB 1JWUA 1LK3L 4KZEH 3M07A 3L95B 5LQBH 1A47A 3VXUB 3AMKA 5GGQL 3ZTJH 3QDME 1REIA 3G6DH 4R7DB 1I1RA 3KYKL 1A22B 2RJMA 3VD4A 1GGYA 1IJ9A 4LRIA 3MXWL 3GMMB 4UV4H 1SJEA 4WUUE 4UNUA 4ZFOB 1QEWB 3WE6A 4EI5C 3M17B 2XWJB 4W4NA 4YFLI 2IFGA 4YEEA 1OWRM 1L0QA 3P30L 4DKFH 5F7LB 2GFBB 4X4XB 1JHLL 4F3FA 2GKIA 1LO4H 1F4AA 4HCRH 2ITDA 4JB9H 3LKOA 4PJ7E 3MREB 2IALA 3OX8A 4OZ4A 3LCYA 4HWBA 1YEJH 4OZHF 5BVPH 1AXSB 1UADC 1QSZA 1JNNH 2FJGA 1I8KB 2XRAH 2F5AH 3B9KD 2BY2A 4MD5B 4YEFA 3OKYA 1BEYL 5I1DA 3GMPA 3KYOA 5GGRB 2ESVE 1LP9E 4IIQB 3GUTB 4XVJH 2C4FU 3MLYL 2VIRA 4Z6AT 5D5ME 2VLJE 3L7EA 4RZCA 1BQHG 3QNXA 2DQFB 2P42B 2BCKA 4FZEL 1KPUA 2ERJB 3RTQD 1Z0MA 1B4JL 2E7BA 4L8SC 4OB5H 4A2MA 3DSFH 4X7TB 2GUOB 2HN7A 4RFOL 4NM4L 1TENA 4WEBH 4GJTB 1K6QH 1G7HA 4PBVC 1S7TA 3BGMA 4QTHA 1R5WB 1G7JA 4HIIA 2BNRA 5F7DB 2WW8A 3KNBA 1DQLL 1BREA 3UTSD 4OFVA 4QHMB 5DJAB 3L3HB 2CXGA 4I5BA 5HHQB 5IW6A 5DMJB 4G9FE 2V7NB 1NCWH 1A6AB 1IGYB 4JFEA 5E6YA 1B0GA 4GRMA 1I7UA 1S9WA 1YQVH 1NCNA 4ZS6D 1DQQA 2BSED 3ZL4L 2NW2B 5KSBF 4NRZB 3PGFH 3UAJC 1JYNA 1PJ9A 3LIZL 3VH8A 1JF1A 2A6DA 1G6RB 2AABL 4QHNB 1OP3H 1LEKB 3MRLA 3WJJA 3DVGA 2OP4L 3X17A 4LQ1A 1H3WM 5IEHB 4U7MA 1H8SA 3F58L 4PG9B 1Z2KA 5ESVB 4EN3A 4XX1G 4NWTH 1SM3L 5IESL 4N0CD 4DVRL 2VLME 2IPTH 4U6HA 2O5YL 1IL1A 3FQRA 1T0NA 2V2XA 5ESAB 1AR1C 5CBEB 3DMMB 4TVPE 5KAQG 4C83A 1LO5A 3L7FA 3OJ2C 5HXMA 4UT9H 3AXLB 1H15A 3MPCA 4L3ED 3QFJE 5A2IH 1QVOA 1D9KC 2NX5B 3VFOB 4EVNB 1W72A 3FONB 2C3WA 1D5XB 2AXJA 4I9WD 4ZUWB 1RIUL 3RDTA 1G7PB 3MRCB 2BRQA 1OQXA 2YWYA 1YEFH 4KGLA 1FYHB 3KLHC 3FCTB 2I24N 3FO2A 4I3SL 3G9AB 4PRIE 2HG5B 5IQ7L 1KLUB 1RSFA 3ULVE 4ODHL 5FM5O 4L4JA 4JFQB 2C7UA 12E8H 3QUZA 3MBED 2XT1B 2M1KA 3BN9D 5SX4H 3S9DB 4OZFB 1VFOA 3QAZC 3QPQD 5E5MA 4M1DH 5EBLA 3I6GA 3JV6B 3U46B 5GHWH 4JO2L 4X7CC 2V2TA 5IT2H 5IBTH 2VH5L 4IRJD 3C5ZA 1OTSD 1NFAA 3CZFA 3LKRA 1XFPA 2X89A 1IEAB 1KPRA 2R23B 5E7BA 1X5KA 4KJWC 4I0PA 4NCC2 1DVFC 2D4FA 1DDHA 4GUPA 1YECH 5DJ2B 4JRXB 2Z31C 5F89A 1A3LL 4OZGE 4YDIH 3TJHC 2R69L 1QSEE 3T2QA 1SBBA 3QNZB 3U7YH 1QRKA 2X1OA 3WFBH 3SDAC 4ORZC 4HG4J 3SJVA 5ITFB 3HAEA 3WUWG 3LZFL 5DRWA 5FM5M 4L3CB 1K8DA 4O9HH 1T1ZB 5HYJB 1HHKB 5L2KB 1ZANH 1A7OH 3J7HA 1J05A 1V8HA 4J4PC 1Y0LB 3PWPB 3B9EA 2DTSA 4OFYD 1C16A 3ARGA 3C2AH 4YHLL 4JM2B 5GZNC 5IOPB 2ADIA 4LCCB 3OZ9H 3KYMB 1CLYL 4YC2B 1BZ7A 1CFNA 4CVXA 1BGXH 4EQ3A 1FFPA 5ERWA 5E9DA 2GK0A 4FQIL 4YBQC 4DAGH 4ELME 1ZVSA 3CMGA 4OI7A 4JKPL 2B7DT 4QRRD 1T0MA 3QQ9C 3BRDA 5D1XD 3RGVA 3LN4A 5F1KC 5TQ0H 1KTLA 1FC1A 1ZHLB 4LHJB 4S0TD 4L1HA 5EIVA 3SGKC 3T0AA 3C5SB 4NO0B 3LPGA 4GRLD 1N2RB 1IAOB 1U92B 1TJIH 1KB5B 1E4XH 5E8DL 3IFNL 2VITA 4U6XB 4RAVA 3IAPA 3UTTD 1IEHA 3OWEA 3EJZD 2CLZB 3OKDB 4Y4FD 5DDHB 1CFVL 5I66B 3DIFB 3LKSB 2XA8L 4XZUA 1A6PA 3QEUA 3WFDH 4HX1A 1P7QB 4XBGA 5JQ6H 2GTWB 4LLYA 3W2DL 1IGFL 1JVKA 4FQHB 4Y8DC 3KPRE 5IVXA 3GKWL 3QDJD 5H2BB 2CD0A 2XZAH 3FO1B 3T2NH 5E03A 5F9JB 1YEDA 1PKOA 3TA3D 1QHPA 4PP2B 4MAYD 4ZAKC 4V1DB 5B8CC 2IQ9L 1A6VH 2BVOB 4UDUA 2FYYB 3CFCL 1IGCL 3QULB 5C0BB 4ODXA 4G8IA 4PJAE 2PR4L 4FQ1L 4KKLD 4FQXC 2WUBH 1P4IL 4H20H 2NZIA 3D0LB 4ZYKA 1NAMH 2GTZB 4QEGA 2OBGA 1UZ8B 1U42A 5HI4D 3NA9H 3MODL 3CSYB 4L4TE 3PDDA 4ONOA 1U41A 5D7IE 3WIHA 3FQTA 1A7PH 3OKEA 2WP3T 4LARH 5HGHB 2VB5A 1BF8A 1C5CH 4OV5B 3PP4H 4QRTB 4QRQA 3BSZL 3IDIB 3NAAL 1U8JA 5ID0A 5DFTA 4YHIA 3BZFA 4GKSB 5GS0D 2JELH 2Z9TA 4YHZH 1A4KA 4YFDB 4HWBL 2LABA 2AV1A 4JG1L 4TUKH 2X4SB 5IB1B 5AYUH 2A1WL 2P8PA 1RUKL 2EDTA 5DJ8A 4WTZA 3UJJL 3WSQH 1URLA 4AM0A 3DX7A 2C1PB 4RIRB 4FFYH 4PJFB 2IAMC 2NZ9D 4Z7OF 2F15A 3ALPA 3OGOE 3CVHB 3ES6A 4XMLL 5DD0H 3JWDL 3G5XB 2LV4A 4JFPA 1JZ6A 4QNPE 3CSPA 3INUH 2OJZL 1OSZA 4TOYL 2UYLA 5DQ9B 1BQHA 5CZXD 3D2UA 5KVMC 3I75B 4OCSL 1WZLA 5K9QG 4WWKC 4FQLL 3LSOB 5I16B 3HE7B 3QQ4A 1AD0B 1U8NA 3A0OA 2E8ZA 2I07A 4KJQD 2NXYB 3E8UL 2VL5B 3KPQA 3OXSB 5EU5B 2AGJH 1J8HB 3X14B 4NC1C 1DANU 1UURA 4L4VB 2BC4A 4OT1L 5FHAH 1NANH 1LE5A 4NJ9L 1LDPH 4CVUA 1NCTA 1RVFH 2QR0B 4NHCL 4O2EB 1DLHB 3QJHB 5LBSH 1DEEA 2BJML 5I1KH 4P2RA 1ED3A 5IVNA 5I8OL 4M9PA 1N0XH 1EMTL 4X6BA 5D7LA 3VXUD 1AGDB 3MRGA 5IMOB 1FE8L 2NNAB 1SYSB 3OJMB 2APXA 5BZDA 1M7IA 1WCQA 4H8WL 1FNGA 2HMIC 1ORSB 4NQEA 4XPAL 1HOCB 1M71B 3CFEB 3IRZA 2EIBA 5EPMA 5EZOL 4PGDA 5EUKA 4WDIA 4WI9A 5L88H 4G6KH 3T0EB 3U9PL 2NW3B 1AY1L 3IAGC 4Z0XB 3E6FA 3OF6A 4X5WA 5GISL 1RQ5A 5FUCC 4LOUD 4HWEL 4M5YH 2QSCH 4OUUB 2P45B 3LQZA 5CEYB 2E9JA 1IGIH 3JWDC 5ICYA 1BOGB 3A67L 4LEXL 3P11H 2VDPH 3LH2H 4XP6H 3WV0A 3JTSB 1G7QA 2ZKHL 5D7KD 1NGPH 1CXHA 4PRPD 5I1LB 3K8MA 5EUOB 5TE6H 5BV7C 4NO5B 4P2OD 1I1AB 3EKCA 1OGAE 5ANMB 4IS6B 2HLFC 5ADPL 1X5AA 2BSSA 1VSCA 4GH7B 4DKEH 3I2CL 3V5HB 1CFTA 1P9MC 2CKNA 4TSCH 3GM0A 1EA9C 4OD2A 4U1MA 3UTQB 2VDQL 1MF2L 1F3DJ 4YWGH 4O5LH 1MIEL 4M02A 3BP7B 3EO9H 2WLYA 4X7SH 3SCMA 5E5UB 4LCYA 1EHXA 3CXDH 1FLRH 5DJDA 1U3HA 1FH5H 3KS0J 2RBLA 2EKJA 2NCMA 2R1XB 4L8BB 5D2NE 5F7NC 4KKAC 2VN4A 4TTDC 3O2VH 1IAKB 2W60A 1HI6A 4D9QD 5D71H 1XCTB 3FT3A 1J8KA 3PWLA 4ZSOA 3HB3D 3DXAA 1Z5LA 1WCBA 1N8ZA 2C1OB 1OGTA 3N1MC 4QRPA 5F7KC 5HI5D 4H8WC 4UIMB 3MACH 1VDGA 5DSCB 3P0VL 2BRRH 2V5MA 5GS3A 1S7XB 3VGDA 4KK6C 5EN2A 4K9EC 1J1OL 5EORL 3T1WA 4EN3C 4GKNA 1H8OA 1Q9OB 1S7UA 4HLJA 4LSRL 1AO7E 3KPSE 5MHSE 3GSUB 4PJIA 3BKMH 5B38G 1JHKL 3S4SB 3VFGH 2ED7A 3RWEA 4LLVB 5GRUH 4E9LA 3C08L 4TVPH 5DI8B 1S7RA 2HT2D 1H0DB 2AJUH 1X5JA 5FGBA 1OAKL 2GITB 4BKLA 2WV3A 2JIXB 3RBSA 2CXKA 3OAYK 1YY8A 2BVQA 3D3VA 4JFOB 2ADFH 5EA0L 2R1WA 4LFHD 3VFMA 1SYVB 5IHUH 3ARBA 1IEBA 3ARDD 1FFNA 2L7JA 2L0DA 4D0DA 3KPMA 1I9JH 4XHQA 5FA4B 1RZ8B 2UZIH 4JZOA 5HHNA 3RRQA 2DLHA 1NFKA 5DD6A 4LHUB 5L0QC 3MJ9H 3LRSA 4GAYB 2APVA 3K2MC 1GGBL 3G08B 2ATPB 4P2YA 4OCRL 3B2UC 4AQ1B 5I8KH 4HEPG 4L3AA 4F9PC 5C1MB 3ULVH 4MDJA 2Z8RA 1BHGA 5HHOA 1SJHB 2Z4QB 1UACH 4Z95H 2A9NH 1MEXL 2OK0L 4H1LH 4K07A 1TETH 3PWNB 5A3IC 1XF5A 1M6OB 1ZHNA 2EDNA 2AEWA 4U0RB 4U7SA 3LY6A 4O00A 2P43B 1KOAA 5DWUL 2CO7B 4LGRB 1VEOA 2WWKO 5JUEL 3VXNA 3SDDD 5D7SL 4U1LB 3TN0A 3W0WA 2WM0A 4NRXA 4PGBB 2Y36L 4LNRA 4Y16B 3HC3H 4WEMB 4I0PC 1QLEH 2HFFA 1EAPB 1UYWL 4ZS7L 4LCIL 1ZA6A 1S9XA 2AJXL 4P46A 3GSNB 1NCAL 1Z6JT 4I4WB 3HS0A 4K7FA 5KANG 3VD3A 3MV9E 4PJ7F 1IAMA 1N59A 5HDOA 2FEDD 3DO7B 4JRXD 4TUOA 5BXFA 1NGQH 2VABA 3V4UL 3CLFH 1QFUL 3IJHA 3KPLB 4P2QA 5FYKL 3V7MA 5DR5L 3ISWA 5TQ2L 4KKNA 1TZGH 4LKXA 2VNCA 4Q9BA 1FG9C 5DHYA 4C55A 3ARGC 4KQ4H 2FIKB 5L2KD 1FO0A 3DX9B 1E28A 5JHDB 5D5MF 4W70A 4QGYA 1R24B 5KVGL 3SDCA 4D9LH 5LGKA 1MCOL 3KXFB 3WIHL 5IMLB 4JM2D 1H3GA 3VGEA 4CBPA 1L7IL 4YUEL 3V6ZB 1NCBH 2PW2A 3VXTA 4ZUVB 3OL2A 4X6EA 3MO1A 3BQUC 4S2SA 4ZD3L 3T4AA 1KN4L 2KQMA 3TIEB 1XF4A 5GRJH 5IMMB 2NTFA 3SE4C 3TZVC 2Y5TB 3D39B 4FABL 4FFWD 5CJ5A 1KCLA 1F00I 1FAKT 1U3JA 4ZDHA 2UWEA 1KXQE 3ET9F 3MRIA 5DURB 4JVPA 5FHBH 4Y5YA 5GSVA 2FGWL 3VGHA 4PJXA 2DKSA 5F7HA 1KJMB 2JLLA 4MS8C 1GSMA 1X5FA 5C7XL 4EEEA 4ODUA 4PJGE 4AH2B 3GSWA 3HCVA 2FD6L 4JPKH 5DC9B 1EUUA 1P7QD 1Q9WA 2YUZA 2EH8H 4PV8B 4MB3A 4FOMA 3GMNB 2H45A 4PJHE 1FAIH 4N0YH 4UQ2A 1FGVL 5J9PB 3HI6H 3BHBA 2X1WL 3DETC 1OARH 5GS1B 1MAML 3EDJA 3QDGD 3EYQD 5CZVL 3IJYB 3S3SA 2P5WE 2VISA 3G5YB 4XNZC 3U0WH 4P57A 4ZOCA 3ROOB 2HKFL 5CKGA 5KSAC 4HBCL 3S36L 2VQUA 5C0FB 4GXUN 4NQCB 3BGFB 1ZTXH 5C0BD 3WKMH 1ZE3C 2DQEH 2AVGA 4N0RA 3LB6C 1VGKA 2SEBA 5DHVB 5DF0A 4I1NB 3MYZA 1ADQH 3RY4A 4F33A 1N0LA 3ULVF 2JB5H 5EU3B 1A3RL 1HYRC 2R2BB 4IOIA 2D03L 3SE9L 3OR6A 3RWCA 4OD1H 3RU8H 1UB5A 3B5TA 4YH6A 5EU6B 4R0LB 2VE6A 1CZ8H 3WL9A 4D94A 2BNQB 5I19H 2EEDA 4HIHA 3LOWA 3VDAA 4HKJA 4OLUL 1HKFA 1YN6B 1H8NA 5IF0B 3QO0B 3NIFE 2VLKA 3BYYA 32C2A 4OZGF 4PGEB 1W2KT 4S1DD 1MI5B 3DV6A 2XN9E 3CCHA 1CLCA 1M7DA 5DZLA 2NY3C 3RWDB 4BSWA 5E2TL 1UB6B 3L1OL 3RVUC 3TO4B 1AHWC 1YYLL 4JLRB 4M7ZB 1HQ4B 5I1CL 1RMFH 4XI5D 2DQCL 3SHSA 3HE7D 3W39A 4OUOA 3HPLB 4KMTL 3MR9A 4ISVA 4YDJA 3QNYB 4Q6YA 2BOBA 4A6YH 1J8HD 1BX2A 3NCYS 3P73A 1AQDA 1WISA 3H7LA 3MGOA 3TO2B 3MXVH 3RA7H 3PGCB 4NZUL 3GNMH 2H32B 1T5XA 2AQ1A 2AV7B 2IQAB 3IDYB 3PHQA 3HPJA 4AMKL 4ELMF 4HIXH 2YPKB 3AM8C 1INEH 4KHXH 3VXPA 2V2WA 3HI5L 3SDXB 4EOWL 2W65B 4GW1A 5JR1L 1E6OL 2W91A 5TF1L 1CN4A 4ZPVA 5F9OH 2EDKA 4GOSA 4KKCC 4NNPH 2YXMA 5IW1B 1WBXA 4LSUH 3VFSB 4ZTOL 3CFKA 1UGNA 3GRWH 3Q1SL 1LEIA 1JHTA 5LKNA 1GAFH 1T6WA 5BZWA 3E3QC 4MXWH 5C09E 3WD5L 2V5TA 3TH3T 2P5EB 3T0ED 2KQNA 4WFFE 4EZMA 1JGEA 4KV5E 1DQMH 4IRJA 5JPMB 4AJ0A 1WV7T 4NZTH 5E6ZA 4JQXA 4YR6B 4TNVK 3WIFB 1RHFA 1BM3L 5IB2B 3ZTNL 3AMLA 4OLZL 4RNRA 4PJ5A 5KG9A 2CDEA 1JPTH 4NPYB 1BD2B 1HQRA 4NFBA 5B21A 3BP5B 4P0DA 2GK2A 1OAQH 1JWSA 5GJTL 2NY5H 4JFFB 1VACA 2CGRL 1OTTD 2XKSA 5F3BA 5IMKB 3BW9B 1MCCA 4MCZA 5DRZA 1RJLA 4HUWB 1FYTD 3ULUL 3SCMC 5T33L 2A9ML 5I73B 4DZ8A 4K3EL 3SKUD 4XNMB 4PJBF 5IP4A 3PL6B 4LFHG 3R06B 5L9DH 2K1MA 2DMKA 2ZOLA 3PDGA 1CFSB 2UZXB 3PE9A 5D7IF 5BRZA 5EC1A 3U82B 4D0BA 2X10A 3KPNB 4OI9A 2V7HB 4IOFC 3ZTJG 4MLSA 3U2SA 3O3UN 1GPOL 1QBBA 5K33A 2OL3B 4M4RA 3TP4A 3C8KA 5D1XA 3IDUA 1MVFA 4LMQE 2EDHA 1NFDB 1CK0H 4F8TA 4LQFL 1IFHH 4OF7A 2YC1B 5EIIA 2CRYA 3IFPA 4MJ2A 1S7VB 2WWKT 3ARTA 5I1AA 1FORH 3MGTB 4HC1A 4G8GA 1I1FA 1U8LB 5KSUA 2FL5A 3GMOB 4JGMA 4X9FA 4UT6L 3UTTA 5F1IA 4M03A 4WV1A 1CTOA 4NJAH 3DTXB 3ARBC 5GSRB 4PYGA 3BIKA 4HKBA 5D72H 3R8BB 4XNUL 2CRIA 1NUDA 1T7ZA 3QIWD 3L3KB 4N8CL 1UCBL 3VFPB 5I9QB 1A2YA 4F15B 5JPNA 4NUJB 3WCYA 2XKUA 1D5ZB 4JFDB 3S35X 4YO0B 2FLBT 4BFBD 1U8IB 3QDMD 4M7LH 1G0YR 1U8QB 3PWVA 3D18B 5D9SB 5DLMH 4NHUA 2R8SL 1KN2L 4LHUD 5CINL 3TA3A 1UWGL 2Q6WA 5F21B 1JGLH 2QADD 3T3PE 1OAUH 3MLPA 4DN3L 3LKNA 4RGOL 4OGAC 5KOMC 3G6AB 3CFDA 5JNYA 1P7KB 4U7KA 3ARYA 3JVGC 5I17A 3RAJL 3WIIL 4OD3L 3EDKA 3IDGA 4XP5H 5IROA 3EHBC 3E6HB 4G42B 3ZHKA 3ROLB 3MMEA 5CCKH 1IC7H 5JOFA 2MJWA 1JP5A 4XH2A 5EO9A 4ACPA 1TFHA 5DJ0A 2B0SH 3IRPX 1PSKL 5J06A 4U4BA 4NC1E 2XI9A 1F90L 4XCEB 2DBLH 5IQ9B 2XY2A 2YPVH 1UG9A 1BBJB 3D5OF 1JK8B 1QFWL 1Z9SA 3QRGL 5MENB 1I7RA 2PXYC 2R29H 1V7NH 5JDSA 5IK3A 5DO2C 2CPCA 2HVJB 2OQJB 3W11C 1MVUB 3KLAB 1BJ1J 1GVIA 3OKNB 2X4TA 5IFAL 2C9AA 2O5XH 4WW1B 1AGCA 1KIQB 1ACZA 3GO1H 1B9ZA 2EE9A 5EOCJ 5JW3L 4XB8A 5EB9A 1R3IH 1X5IA 5JOPD 4M7JH 3NABL 3BWAB 1ERNA 4U05A 5BW7A 1S9VA 2J8HA 5TPWL 1NGXB 4WW2A 3EYUH 3KYAA 3FB5B 3P3YA 2DDQL 4OZHB 3RVWD 1IGTA 2DLIA 3RWFB 4POZC 3UTZA 4C58B 3OQ3B 2EXWC 4OLYH 3V0VB 4OZIF 4HAFA 1MY7A 1EGJH 5ICZB 2VKXA 4KWUA 5F7UA 5JHDD 4HZAA 2UV3A 4G9FD 4PY7A 3TH2T 1S3KH 1B6DA 4NBXB 4YBLC 5HY9A 4P59L 1J18A 4CNIA 1MCLA 3EIFA 3W9DA 4HKXA 3T65B 5HGDB 5IKCB 2AQ3A 2GY5A 4LKCB 1IARB 4KDVA 4QCIB 4ZFGL 1W0YT 4Y19A 3QHZL 4EUPA 3MLSH 5IG7B 4HXBL 4KK8D 3L6FA 3FMGH 3PQYB 3QUKB 2OS7A 2B5IB 5C0IB 3GJFB 1Z3GL 2BVEA 3VJ6A 5IM7A 5T3XD 1TQCB 2VLMD 1B0RB 3G6JA 3GB7B 2BNRE 3CJJA 1JPSH 2CK0L 2JE8A 3VXUA 4CRPA 1HHJB 1P5VA 3QFJD 4R7DA 3DVNB 3TNNB 5HPOA 1JRHL 5IGXL 1A66A 3QT2A 5IFHL 1LK3H 4JHWL 1HH9B 1UUSA 3EJYD 3GMMA 4ZFOA 1CG9B 1LDSA 1QEWA 5GGQH 4APQD 1D6EA 3M17A 2XWJA 3QG7L 3KYKH 4JFEE 2DJSA 3JWNC 4OIIH 5KSBB 2ENSA 3MXWH 2GFBA 2KDGA 3TV3L 4PRID 2YMXL 2VDOL 1KG0B 1ZV5A 3P9LB 3B9KC 3MREA 3P30H 2F53B 1XGTB 4KK5D 1AXSA 3ARVA 5IWLC 3QIBD 1WBYB 4K3JL 4JJ5B 1A8JH 1I8KA 1BZ9B 1CDHA 3VXSB 4R4FL 2N7BA 4MD0B 4UZGA 4MD5A 1IM3B 4RBPH 3EDFA 3RWHB 4TYUA 1WLHA 1BOYA 4IIQA 3GUTA 3RTQC 3P0YH 1BEYH 2F74B 3UZVB 2DQFA 3LEXB 3R0NA 1ZEAL 5DUPL 1PVHA 4S11A 1CXEA 2D7TL 1ZLUH 3MLYH 4X7TA 5K9QI 2GUOA 4M6OL 4G6FB 3GMRB 4H0HB 1EHLL 5DQJB 1B4JH 1R5WA 3TM6A 1WK0A 5F7DA 1OP9A 4RFOH 4QHMA 5DJAA 4HGKC 1F5WA 2BXYA 3L3HA 4K94L 2FX8L 4ZS6C 5HHQA 4XPHL 4LVOB 4N0FB 2DJUA 1IZKA 1A6AA 2O61B 1FVCB 1IGYA 4KQ3L 1KCRL 1FVEB 2CSPA 2Y7QB 2Y1VA 3NPSC 3KWWB 4GAJL 2NW2A 4NRZA 2EXYD 4JVWA 4MAUL 1C12B 2EH7L 1G6RA 1M1SA 3LD8C 4QHNA 1LEKA 4N0CC 3MLWL 4BFEA 3VE0A 1O0VA 1G9ML 2QHRH 3ZL4H 5IEHA 4TUJB 3MZTA 3TT1L 4PG9A 3LIZH 5ESVA 3TO4D 5ISZB 4OIAA 4GXVL 4MA1B 2H2PD 2OP4H 1CGVA 2C3VB 3HZVB 3AS2A 2I60L 4ZUTA 3WNKA 5LGHL 3PGDB 2PYEB 4Q9QL 3F58H 5CBEA 3DMMA 3SJVE 3WUZA 2D31B 1SM3H 3U0TB 1J0ZA 5IESH 3AXLA 4DVRH 4PJ9B 4G6AD 3X3FH 3HR5B 3ARFD 2NX5A 3VFOA 4EVNA 4F2MB 3FONA 4ZODA 1D5XA 3O41B 4ZUWA 4UTBL 3REVB 3MOBL 4U1JB 5T1KB 1G7PA 4G6JH 2R9HC 3MRCA 4X8JB 4PV9B 3BPLB 5JZ7D 3FCTA 3MBEC 4GG6F 2DTMH 3BN9C 2HG5A 1RIUH 1FL6B 3O9WD 1OQOA 1E4WL 4HC1L 1KLUA 3GMQB 5JXED 3QPQC 3KPRD 4JFQA 5E9DE 5FK9B 1E6JL 3OB0H 5IBUB 5AZEL 5TDPB 5MEQB 4I3SH 1BVZA 4P5TD 3GSVB 1D6VL 4K7PX 1TVDA 5IQ7H 4WI3A 4ODHH 4IRJC 1A7NL 4OZFA 1JTPA 2G9HB 5J11C 4CL7A 2LAAA 4JQXC 1OTSC 3FFDA 1N6VA 5K9KB 3JV6A 3U46A 2P5ED 1ZXQA 4Y89A 3CX5J 3NCJL 4P4KB 2FGZA 2B39A 3I6KB 4HFUL 1IEAA 2R23A 5DFVD 1OOAA 3QZWG 4PJHF 2VH5H 1BD2D 4MQ7B 3DWTA 1G9MC 5D1ZB 4JE4B 3I6LE 3L3JB 3LN9A 4JFFD 3QNZA 4Y5VB 2FEEI 2AEIT 4JEGB 2D7NA 3O6FD 5ITFA 4JDVB 4L3CA 1FV1B 2HFGL 2R69H 1T89A 2ILLA 2ZG1A 3FB8B 1T1ZA 4N5ED 4XPFL 1HHKA 5HYJA 5L2KA 2IMMA 1OD7A 3SQOL 1Y0LA 3PWPA 2M8XA 3PL6D 3LZFH 4WGVB 1RHHB 5FYKE 1MNUL 1NLBH 3O81A 4OGZA 5I8CB 1WTGT 5FYJU 3O2WL 2OR9L 4LCCA 4NQVB 5IOPA 1T5WB 1RURL 3KYMA 2NY6D 4LHUG 5D1XC 1YNKL 3FT4B 5I0ZA 4P48A 4PG2A 2NTSP 3G5VB 5GS0L 4GRLC 1RZ7L 4LIQL 4YPJA 3MUGB 4B7IA 1DBJH 1CLYH 2BY0A 5JIKA 4PJ8B 5KS9F 1ZHLA 3BPCB 1ZMYA 1ES0B 1YY9D 4FQIH 3C5SA 4JKPH 3T77B 4NO0A 1N2RA 2HA1A 2EDOA 1IAOA 4UB0L 1U92A 4TSAL 5CLWA 1KB5A 2Z93B 3LHPL 3EJZC 4RAUB 4Y4FC 1CQKA 2MNUA 1N26A 5HHME 4U6XA 3N85L 1KJ2B 1X5LA 3RIFF 3LQAL 1TQBC 4HKZB 1J5OH 5E8DH 3N9GL 3IFNH 5BOZG 3AB0C 2CLZA 5J4MA 3OKDA 5DDHA 5DK2A 2ZCHL 3QR2A 1U91A 1SMAA 5I66A 4KU1A 2X4RB 3DJ9A 4ODSL 1BIHA 5HD8D 4DKAA 1Z9OA 1P7QA 3TA3C 1P84K 2GTWA 2R39A 3WMSA 1IGJB 2M26A 4JFDD 4MAYC 3F12B 1CFVH 4Q2ZB 2XZZA 4OLEA 4XTRD 4FQHA 4XCYB 5EBMB 4Z7QE 5H2BA 2XA8H 2LU4A 3Q6FB 3FO1A 3EUUA 5DFWH 1RZKL 1VFUA 5F9JA 3IB4A 4PP2A 4KKLC 1IGFH 4V1DA 3GKWH 1FNEB 3KHQA 1A21A 2BVOA 2D2OA 2WBJA 2FYYA 3QULA 1RIHL 1ONQB 4X80L 5JMOC 5HI4C 3K0WA 2QQLL 4JQVA 4D3CL 1T83A 2IQ9H 1QR4A 2I9LB 4TPRL 5A2LH 3D0LA 3CFCH 1IGCH 2GTZA 1WWAX 4Z5RB 1UZ8A 3N1GC 2ZUUA 3O3EB 2PR4H 4FQ1H 1A6UH 3V79C 3HE6B 1P4IH 1C08B 3CSYA 5GZOD 1S8DB 5GS0C 1UKSA 3SE3A 4P2RE 5DC4B 5HGHA 4K3DH 4OV5A 3MODH 3H9YA 5INCB 4QRTA 5D7LE 5MEND 2H2SD 1HIML 3HMXA 4OCLC 4E5XA 4GKSA 5I1JH 4LSQL 1U36A 4KV5F 2WINB 1QBML 2NZ9C 4NQEE 3F7PC 2X4SA 3BSZH 5IB1A 3NAAH 3GI8L 1CE6B 1AD9B 4BSVB 1RIVL 1MJ7L 2C1PA 4RIRA 4HWBH 4U2ZA 5EFIB 2J8UB 1X6LA 1OB1B 3E1F1 4JG1H 4Z7VF 4XWGL 2A1WH 1RUKH 5CZXC 3G5XA 3UJJH 4Z0BL 3W81A 1N6UA 5J0BA 3TCLB 5D1QD 2NY7L 3UYPA 3V6OA 1XZ0B 3CK0H 3SBWA 4XMLH 4LLWB 5DQ9A 3JWDH 4HH9B 4KJQC 4XPTL 1K2DB 2IFFL 3F65A 3I75A 5D6CB 3EOAB 2XXMB 4GAFB 1RZKC 2XWTB 1AXTH 5J8OA 3LSOA 5I16A 4TOYH 1YEKL 3HE7A 1NBYB 1RV6X 2VL5A 4OCSH 1KT2B 2MHAA 3OXSA 3ECBB 1AO7D 3BUYB 5EU5A 2XNAB 3UPRB 1J8HA 3X14A 4L4VA 2WIIB 5JHLL 1HDMB 3E8UH 4JFZL 4X8XA 4NKMB 1JTTA 2QR0A 4O2EA 1DLHA 3QJHA 4CUCA 2JKXA 5IB4A 4OT1H 3S8WA 2A73B 3ZT5A 1RK1B 1X3DA 4NJ9H 1HXYA 3MA7B 4U1GB 4LLQB 4NHCH 1AGDA 5IMOA 2NNAA 4MZ2A 4NQXB 2BJMH 1MCEA 1SYSA 4K3HA 4XVSL 1G6RL 4QRUB 4YDKH 5I8OH 2W0KA 1EMTH 1ORSA 1AKJB 3QRFM 4ZSOE 1FRGL 1M71A 1FE8H 3CFEA 3DXAE 3GSRA 1VA9A 3M1BB 1JMZA 4MQXD 5FECB 4LOUC 4QRPE 15C8L 4L8DB 4H8WH 5I2IB 1QPPA 2B1HL 3T0EA 2NW3A 1YPZB 2ZSWB 4XPAH 4Z0XA 1QOKA 2IH1B 1C1EL 2PO6D 1N6QL 5EZOH 4RFNB 5C0GB 3EO1B 3IXTB 3QXAB 2F53D 2MKLC 4PJIE 1MCDA 4MJ6B 3U9PH 4OUUA 4ZNEA 2DWEB 1AY1H 3BT2L 1YMMB 3GGWA 5CEYA 2WANA 3QA3B 5ACLA 1BOGA 2ADGB 3VXSD 4P2OC 4HWEH 3NFNB 4X98B 1TVBB 5DGQA 3BWUC 3QDAA 3JTSA 4DKDC 3Q5YA 3D3VE 2YRZA 3RI5K 4NGHL 1W72H 1TZIB 3A67H 2ERJC 1OW0C 5TH2B 4UV4L 5EUOA 5I1LA 1AIFA 4NO5A 4LEXH 2PUQT 1I1AA 4XHJD 2ZKHH 5ANMA 5EBGA 4IS6A 3TFKD 1VGEL 2OJEB 3V5HA 4HV8B 4JCLA 4HCRL 2RR3A 3UTQA 4WI5A 3NIGF 3BP7A 2X4QB 2X5PA 5HHOE 3K46A 3I2CH 4RMVA 3ZMRA 5KZCD 1JNNL 2XA3A 2R1XA 4L8BA 2VDQH 1MF2H 4F37F 2HLAA 4OKDA 3HB3C 1EEUA 1KCKA 1IAKA 1MIEH 4YE4L 3ULUE 4PUBH 5HI5C 3EYFB 1R3JB 3BYTA 5K59F 1XCTA 2DOCA 4PIRF 4EIGB 1T7XA 3I3EA 4CN1A 3CFIC 3W0WE 2C1OA 5FOJA 1JE6A 4UIMA 3TVMB 4P5KB 5DSCA 3GIVA 4G7VL 3WJLC 1IAIL 4AZ8A 1CGTA 3WS3B 1HEZB 1J0KA 2HT2C 2XZQL 1Q9OA 3GSUA 5F6IB 3FB6A 3P0VH 4M5ZH 3VFUB 3C6LA 3HA0A 3VFTB 4QHKI 3S4SA 3ARDC 2LFGA 3DMMC 1NC2B 2CK2A 5EORH 4LLVA 1YEHL 4I18B 4WJ5B 5DI8A 5ISZD 1WGOA 2AERT 1H0DA 4LSRH 2GITA 3HAEH 1JF6A 5DJ6B 4LCWB 2JIXA 4WFEE 1JHKH 4JFOA 3SO3B 1CI5A 4QTHB 5T5FH 3WYRA 1SYVA 1XAUA 3LRGA 1AGEB 3C08H 1NC4D 1OAKH 5LJYH 3TBYB 1YEIL 1NMBL 1U2HA 5DVLA 5EA0H 1JZ5A 4I5BB 3EDEA 1YQVL 4HUVB 1CICB 5CJBA 3T3ME 4GAYA 3MTRA 3G08A 4YLQT 2ATPA 2ZUSA 3B5HA 5T1KD 1B0GB 5AG9A 3V2AR 1SJHA 2Z4QA 1CIUA 4LU5L 3WLWD 1WTLA 3C09B 1GGBH 1SEQL 2YZ8A 1HNFA 2YKLL 4WGWB 4OCRH 3SDDC 1CLOL 4NWTL 4M1GL 1KB5L 3MRLB 1M6OA 3RP1A 43CAB 3A6CL 3RY6A 2OK0H 2B1AL 2P5WD 5D2LF 5GGUB 4RGNE 4U1LA 3D6GA 3QUMA 4HMEA 2G2RB 4PGBA 3QUYB 1IL1B 4Y16A 3FQRB 3OGCB 4PGCB 5DWUH 4ODWB 3D85D 5JUEH 2BHYA 1UM4H 1E4JA 3MNZB 1EAPA 1H15B 2FEDC 4P4KD 2UWEE 1A5FL 2Y36H 3GSNA 3RHWF 4I4WA 1P69B 2AEQH 3MSPA 4PJXE 4ZS7H 1UYWH 4LCIH 4ZFZB 2AJXH 3CAFA 3DO7A 1F13A 5D1ZD 4U6TA 3KPLA 1KTDB 4WTWA 2IGFL 1WC7B 1Q9KB 3V5DB 1Q0XL 3V4UH 1QFUH 1HHIB 5FYKH 5DR5H 5C2BL 4JM2C 1IMHC 2FIKA 5DJCB 3DX9A 5JHDA 3L9RB 4LCCC 4TTGA 1R24A 3LKQB 4JANB 4UV7L 1CD9B 5IJKC 4PG2C 3CUPB 3KXFA 4PY8J 5IMLA 3EAKA 5E8EB 5SWSB 5EIQA 1PKQB 2BHUA 4I8DA 4CVZB 2VXVL 5KVGH 3V6ZA 5HHXH 1MCOH 3CZFB 4RDQG 4ZUVA 3WIHH 2AK4B 4HHAB 1JV5B 4FFWC 4RWYL 1L7IH 4YUEH 3LKPB 1BWWA 4R96B 3TIEA 4HIJB 4PJ8D 5IMMA 3EOBB 2J6EA 4LLMB 2Y5TA 3MLZL 4NCDA 4M00A 3D39A 1QQDB 1GOHA 1I7ZB 1WAAA 2NR6D 4ZD3H 1KN4H 1PLGL 25C8L 1ZANL 1I3UA 3BEVB 3U83A 2E9BA 2K3TA 4DOHE 3WLBB 4LK4A 3CVHL 3NBNA 3DYPA 4Z9KB 1TTFA 4FABH 3OZ9L 1R0AL 2G75B 4E41B 1KJMA 3QXVA 5IVZB 1Q9LB 4AH2A 3KJ4C 1YC7A 2FGWH 1K85A 4JVUA 2VLKE 3EYQC 5C7XH 3HRZB 5CFHA 3GMNA 1AR2A 4KRMB 5J9PA 5E8PB 1ZVSB 2FD6H 1CDJA 1X4XA 5GS1A 3QBTB 4Q6IB 4Y8AA 3IJYA 1Y6MR 1L0XA 1CDUA 1KTLB 1ZHBB 1WT5A 5DC0A 1EAJA 1G7LB 1FGVH 4HK3J 3ROOA 1UQSB 3QSKB 4FRWA 1MAMH 1G9EA 3ZKND 2M2DA 5C0FA 2ZUWA 4NQCA 4L8CB 4FXLA 4WFFD 5CZVH 4WI8A 1MRCL 3BH8B 4PTUB 2HKFH 3BZ4B 4HBCH 3S36H 3EYOB 4M6NL 5DHVA 1DCLA 1AC0A 2JB6B 4KRLB 1T1WB 4DGYH 4I9WE 4OF6A 5EU3A 2R2BA 4L9LB 4U6VL 1UCTA 4JKMA 3NZ8B 1KTKE 5EU6A 4R0LA 1OTUD 1U3YA 4JFXB 2D03H 1P2CB 4KDTC 5IVXB 3SE9H 2LTQB 1INQB 3C60D 4DWHA 2BNQA 1A3QA 4AQOA 1RZJL 1OAZH 2D7QA 4QHUB 3D9AL 4KFZC 4N8PA 4S1DC 5E6IB 2G60L 3GBLA 4NN7B 1YN6A 2BVPB 4Y1AB 2OTPA 2HRPL 3SBWC 5IF0A 3QO0A 4JREC 4LVHB 5J13C 4N0UB 2W38A 3FRUB 4OLXH 5LGJB 3ARPA 4HQQL 1MI5A 1G7IB 1DN2A 3NA4A 4HT1L 3NVQA 2CLRB 4XGZB 5T5NF 3RWDA 4XI5C 2JF1A 3HE7C 3O3AB 4PJ5E 1UB6A 3TO4A 1JFQH 4PJEB 1I8MB 4JLRA 1JWMB 3MLVH 4NNYA 3OR7B 4FXGA 1HQ4A 4NT6B 5DUBB 4YHZL 2CIKB 1GH7A 1QNZL 5F7YC 5ACMA 4TNWF 3L1OH 4QRQB 1YYLH 5AYUL 3HPLA 4Q9CA 1Q94B 43C9B 3QNYA 4XXCA 5I1CH 1MWAB 1HXMB 2DQCH 4FFYL 4PJBB 3TO2A 3VI3F 2JK5B 3PGCA 5IR1B 4KMTH 2DL9A 2H32A 2IQAA 3MLTB 5F7MC 2W9LA 3INUL 1FN4B 1X4ZA 3SDXA 4NZUH 5BRZE 2W65A 3RWGB 1KGCD 2OLDA 4AMKH 3FB7B 4JFPB 5T1DL 2LVEA 4YGVB 1AE6L 3HI5H 4EOWH 4RX4D 3RVXD 3MBXL 3T0EC 3VWKB 4DGIL 5IW1A 3VFSA 5JR1H 1E6OH 2OI9B 5TF1H 1CGUA 2AEPL 3BP4B 1EJOH 1RZJC 2AGJL 2PW1B 4KMQA 4ZTOH 2I07B 2P5EA 3Q1SH 4M93B 4G8GE 1JZ8A 4WUKL 3O6KL 3UJTL 1E4XI 3BKJL 4MXQD 5JPMA 4RRPA 4YR6A 3WIFA 1OP5H 3UTTE 1X7QB 5IB2A 3QCVL 2R4RL 5CWSB 3T08A 1OTTC 4BSJA 4NPYA 1BD2A 4HWUA 4Z7QF 5CGMA 4N68A 1B88A 2P7TB 1DEEB 1ZT1B 3BP5A 4WFGE 1BM3H 2NXZD 2QBWA 3ZTNH 4OTXL 4JFFA 4OLZH 5MEPB 4YXLL 4MCYB 4X6BB 1T6VN 5IMKA 2Q20A 3BW9A 4MNGE 3OKKB 5AAMA 2YA1A 4QGTA 5BZDB 4HUWA 5GJTH 5F8QC 3BPNB 2CGRH 4NYLB 4XNMA 5FO9B 3PL6A 4YHML 2H26B 3ULUH 3BUTA 4Y2DB 3MUY1 2A9MH 3R06A 5T33H 5DS8B 1CFSA 1YUHB 4K3EH 3ORJA 5CP7B 3KPNA 2KZ1B 4LAQL 5CHNA 3UX9B 2VDPL 2OX5A 3LH2L 2E9IA 5GRVK 1U95B 1BP3B 2J88H 2O5ZL 3KJ6L 4ONFL 2OL3A 2NY0B 2HVKB 2YC1A 3TVMD 1GPOH 1S7VA 4ZPTB 1QFPA 2JJSC 1V3LA 2N4IA 4RWHA 3UJIL 1U8LA 4L1DA 1L6XA 1BFTA 3NGBC 4LQFH 4O5LL 2EKSB 4LIQE 4P4RB 3QIWC 2PF6A 3VRIB 1GZQB 3PNWB 5FOBB 1WVZA 3DTXA 5GSRA 3T09A 3IKCB 1RJYB 1NC2D 3W9EB 3QFDB 5KAQF 3NH7L 3V4PH 2DL2A 3L3KA 1TJGL 2FHCA 4UILH 4RMWA 2BNRD 4NUJA 1LNUB 1EHAA 1D5ZA 4JFDA 4YO0A 5HVHB 1NMCB 2QADC 1QG3A 1RI8A 2YD1A 4OZIB 4U1HB 5C0AB 3O0RL 2W60B 1U8QA 5JMRA 3D18A 5D9SA 4N8CH 1Y18B 2XPGB 1CICD 1T04B 1OGTB 5HPMB 1I1CA 4JGUA 2AAVA 4JFED 1KN2H 1V5JA 2J6EL 4U0RC 4EI6B 3G6AA 4NOBA 4WO4B 5CINH 3BKML 5T3XL 1P7KA 3S35L 1PZ5B 2QHLA 1XF2B 3E6HA 4G42A 4DN3H 4O2FB 4RGOH 3ROLA 4Y19E 1JPFB 3WNMA 2ADFL 4U3CA 4V2BA 3MLRL 4GS7C 4LBEB 1QA9B 1NANI 2QJDA 3RAJH 5IHUL 4OD3H 4XPBL 1JI2A 4DW2L 4HW6A 3DVFA 3WN5B 2I25N 2XY1A 3QUYD 3GDBA 1ZLWH 4XCEA 3G6JE 5IQ9A 1NGWB 5HGBB 1BBJA 1JK8A 5MENA 5T3ZD 5C07B 3VXUE 3NIDF 2HVJA 5HHNB 2OQJA 1MVUA 1F90H 1PYWB 3OKNA 3MLXL 4WW1A 4Z7WB 1KIQA 1QFWH 4LVNB 2A9NL 4PJIF 1T4KB 3RDTD 3RVWC 3FAWA 3BWAA 5IFAH 4HPYL 1NGXA 1OAXL 2PTTA 4FTVA 4P3WA 5JW3H 2HH0L 3FB5A 1PQZB 2NLJB 4OZHA 3NABH 4BQCA 5TPWH 1QSFB 1EO7A 3RWFA 1P84J 4MDIB 1YC8A 3QUZD 4I48B 5EWIL 2XZCL 5IIEB 2DDQH 5ICZA 2V9TA 3OJVC 3AREB 5ENWB 4YHKL 5DK0A 5I76B 3GBNL 5D7KE 4EXPX 1PY9A 4HUNB 4G43B 4J23A 1RZFH 4KK8C 3C5ZD 1J9CT 5D93C 3T65A 4RMQA 5HGDA 5IKCA 1FJ1B 4LKCA 5I15L 4QCIA 1BQLL 4KK9D 3HFMH 2DM4A 2X89D 3BAEL 3HNTL 4P59H 1N59B 5IG7A 4R7NB 2DS4A 3PQYA 3QUKA 1XMWA 5C0IA 1BZQK 5J12B 4JZJB 3MRMB 4HGWB 5FV1L 3QHZH 1F4YL 2BVTA 4P2QB 1B0RA 4BZ1L 1UWXH 3QI9B 3GB7A 4R2GD 4HXBH 4YDLB 4NN5B 2XTJB 3EJYC 5BOPA 2GJ6A 4CMHB 3SJVD 4BUGA 1G84A 1OF2B 1EV2E 4NM8L 5HGGS 4APQC 5DHYB 1HHJA 1MHPL 4ZO7A 1IRAY 4D9LL 4N5UA 3DVNA 3TNNA 3T4YB 4NO3B 1FO0B 4BQBA 2DQGL 3NTCL 3RX5A 1HH9A 2CK0H 1CG9A 1X9QA 3MRQB 2WZPD 2H9GB 2FEEL 2B20A 4URTB 1QRNB 1OT1A 1WSST 3ARGD 1QR1B 1JRHH 5IGXH 5KSBA 5IFHH 4JHWH 4KK5C 1KELL 2GT9B 5GS1C 1KLGB 1WQVT 3QIBC 3BFOA 1KG0A 2PETA 1WT5C 3P9LA 2D7PA 3DRQA 3QG7H 5DQDL 4EI5B 3KR3H 2PTUA 3WO4C 1XGTA 2Q7NA 3TV3H 2YMXH 2AJ3B 2VDOH 1R6VA 1WBYA 3BGFC 4JJ5A 3RGVD 1BZ9A 4DVBA 3BI9X 3VXSA 2VDNH 4MQTB 2HJFB 5AD0B 4EDWL 4MD0A 3ZDYE 5JIHA 2I27N 3EYVB 3T3MF 1DN0B 3RWHA 2VZVA 4B5EA 1CIDA 4R4FH 3MOAL 4H25B 2X4OB 2VYRE 2F74A 3C8HA 3LEXA 2NX5E 5E94B 2BHZA 3ESUF 3H3KA 4LSTL 1A9BB 1EK3A 4U1IB 1WZMA 1NCCL 3GSWB 1FAIL 2DQTL 4GG6B 1V3MA 1ZEAH 4M3KB 5DUPH 2DWDB 5JORB 3GMRA 5DQJA 5FXCH 4YHYC 2UUDH 1PFCA 2NY1B 3C87A 4YXHL 4L8SB 3U0WL 4M6OH 3V6BR 1EHLH 4XB7A 3W5NA 5TFSL 4MJ5B 3RL2B 1JZ7A 2ARWA 2EDYA 2UWEF 3WFEL 1GXEA 2EXYC 5IHZB 1S7QB 3FKUS 4WY7L 3CD4A 1EZVX 1O7SA 4PB0L 5FYKD 2O61A 1FVCA 4PJXF 4RISL 4K94H 4Y1AD 2FX8H 1FVEA 2Y7QA 1RULH 5DZOA 3KWWA 4XPHH 5CUSL 4U1KB 2JB5L 3Q48A 4HAGA 3TO4C 1C12A 4CDGC 1J12A 4OCYH 4KQ3H 2VLRB 2H2PC 4KAQL 4OD1L 4TUJA 1A7QH 1KBGL 2EH7H 5ISZA 1XGQB 4JRXE 4P49A 5ESQB 3MLWH 3TH4T 4R4ND 2C3VA 4G6AC 5CZKA 3HZVA 1G9MH 3ARFC 2A77L 1AGBB 4XC1L 5I30L 3PGDA 2PYEA 5C6WH 3PXJA 3TT1H 4WENB 4KRPB 4W4OC 3S5LG 3VFVB 2D31A 4HBQA 1WJ3A 1NCDL 4XRCB 3U0TA 1UJ3C 5HHMD 4PJ9A 5MERB 2HT4D 2I60H 3HR5A 4JDZB 3QB7C 5LGHH 4F2MA 1QLRB 5JZ7C 5HYJE 5L2KE 4Q9QH 5GGTL 3O41A 1FDLL 3PWPE 1G1CA 3O9WC 2OL3L 4JKLA 3REVA 1AFVL 4U1JA 5T1KA 5JXEC 4IEFB 4X8JA 4PV9A 1C7TA 1KB9K 5DZNA 1RUQL 1B90A 4P5TC 32C2B 4UTBH 3VMOA 3CXHK 1FL6A 5IVOA 3SDYL 5FF6B 1QLFB 3DV6B 3GMQA 4BUHA 1G7MB 5FK9A 3TBWB 5FFLA 5TDPA 5KS9B 4J3OC 5MEQA 3GSVA 3AS3A 1E4WH 1J0YA 3D2UD 4HC1H 1GC1L 1EO8L 4DGVL 2G9HA 1E6JH 2RCSH 5E2UL 2KZWA 5AZEH 5K9KA 4DK3A 3FQUB 1D6VH 5DFVC 1FFRA 1A7NH 2DLTA 1LD9B 1LO2L 4KI5C 3QXUA 4P4KA 3PV6B 1VHPA 4CADB 1BX2B 3QAZB 3BZEB 3LEVL 1INEL 3I6KA 4K7PL 3T0WA 1NKOA 4OF0A 1T5XB 3HPJB 3NCJH 2RFXB 4V2CB 3O6FC 4NOFA 3Q6GL 1FVDB 1IC5L 4MQ7A 3CMOL 5JIIA 3N1QC 1MOEA 5LAXB 4P2RD 4HFUH 3L3JA 4N5EC 4BZ2H 4Y5VA 4IJ3C 5D7LD 4BFIB 5KSVB 1A1MB 1DVFB 5HYSB 3PL6C 4JDVA 1ZAGA 2F5BL 1ZVYA 1FV1A 4IMKA 2Z31B 4EBQL 4P23B 4TNVF 4CAGA 1UWEL 1I3GL 4NQED 5SV4A 4PJCF 3LPWA 3SDAB 2NY6C 4M4PA 5CD3B 4V1DE 3TNMB 2HFGH 3TWCH 1RHHA 4PRAB 4XPFH 2Q86B 1JGEB 4Z77B 4ODTL 3S3JA 3OF6D 1T5WA 2LU7A 3FT4A 4J1UB 2MOVA 1YY9C 3G5VA 3WFZA 1RFDH 1MQKL 1OAQL 5CILL 3O2WH 2OR9H 2R2EB 3MUGA 5IHBA 1VERA 1RURH 2CDEB 1YNKH 1CS6A 3F8UB 3K1KC 3BPCA 3HC0B 1JGUL 1WIUA 5H35B 5GS0H 1RZ7H 3VH8G 4LIQH 3T77A 1DL7L 3M45A 4P9HH 2V5RA 2I5YL 4UI2A 5F72S 1GC1C 2WIMA 2HAZA 2Z93A 4RAUA 3MRRB 1N4XL 4BQ8A 4Y2OA 1KJ2A 4UB0H 5EZIL 1MFAL 5HD8C 5I9QC 4R90L 4X7FC 4HKZA 3LHPH 3SO5A 3IFOA 4JZNB 2Z91B 1JI1A 2WBKA 3QEHB 4LSSL 4XTRC 3N85H 4Z7VB 2IBZX 5C0EA 3QIUB 3LQAH 1NEUA 2LU3A 4PJFE 1OCWL 2X4RA 1U3HD 3IFLL 3BXNB 4JRYB 3N9GH 4D0BB 1ZSDB 4OI8A 3F12A 2ZCHH 5C0AD 4Q2ZA 4W6WB 4XCYA 3MV11 3UPAA 5EBMA 3Q6FA 4ODSH 3V6OE 3C6SB 1G6VK 4U1SB 1I8IB 2GY7B 3CX2A 3DXAD 4XBEL 3VRLE 4XPGL 4HS6B 1FNEA 1RZKH 4WO4D 1ONQA 2B4CL 4EUPH 5LCVH 4HUXB 5GZOC 4ZAKB 4QYOB 2I9LA 5B8CB 4N1EA 1J8HE 1RIHH 4X80H 4L4VE 3SGEH 4J12A 4Z5RA 2QQLH 1BBDL 2WUCL 3HE6A 4D3CH 2CUHA 1C08A 2H2SC 4FQXB 4M48L 5EDXA 3WNPA 3F7RA 5CJOL 1S8DA 5D8JL 3H9ZA 2NY5C 3D3VD 3JV0A 2Q8AL 5HYQB 4FMFA 5INCA 1QTYT 3BO8A 5C07D 1OAUL 3VDCA 3L5JA 1MCBA 4NHUB 3ZKXB 2AKRB 4G5ZL 2AQ2A 1HSBB 3P9MB 2WINA 1WWWX 1HIMH 4W6XB 1CE6A 3IU3B 4LSQH 2K7PA 5D1QC 1AD9A 4BSVA 3HAEG 3UBXI 5EFIA 1QBMH 2J8UA 4WVRA 1OB1A 3T0EE 4NZRL 4Y5XC 3GI8H 5CIPB 1NEZB 3ULUD 3QHFL 4S10A 4H0GA 3TCLA 1RIVH 1MJ7H 1QSFD 5JOFB 4ZNEE 3P77B 1XZ0A 4XWGH 5DJYB 2IAMB 4HH9A 5B4MD 2QEJA 5E56A 1K2DA 1EEQA 4Z0BH 5DVNA 3TN0D 3W0WD 4I3RL 5D6CA 3EOAA 3DX8B 4YHNB 2NY7H 2XWTA 5C0CB 4X6DB 2O5XL 3MRJB 4NQSB 1NBYA 4XPTH 5EUOE 5D7JB 2IFFH 2B5IC 4P46D 1FBIH 1KT2A 3ECBA 3BUYA 2X4TB 4YPGB 4YHOL 5ANME 3UPRA 2B4CC 1YEKH 4WWKB 2WIIA 5E4IA 1HDMA 1J0JA 3AAZB 4NKMA 3FL7A 5DK3A 4WFED 2IBGA 4KUZL 3UCRA 1NAMA 4P2QD 5D96C 5JHLH 3QI9D 1T2JA 1UH3A 2A73A 4NN6B 1RK1A 3QUXB 2XTJD 4JFZH 5F70A 1EFQA 3MA7A 4LLQA 1IILE 2DIAA 3MJ7B 5JW4Q 8FABB 5DMYA 4NQXA 4MQXC 4U6YB 3U30C 4Z7UB 1MCHA 1JUFA 4QRUA 1I7TB 1AKJA 2KL6A 2F9BT 3MV7B 4MA3B 1AI1L 3M1BA 2PO6C 3SDCD 2BVYA 2NMSA 4QRSB 5FECA 4QXTA 4XVSH 3GSOB 1G6RH 4L8DA 1TJHL 5I2IA 1M05A 1YPZA 4CNIB 3K1DA 2IH1A 4PYHA 5C0GA 3EO1A 1FP5A 3IXTA 3QXAA 1XH3B 1FSKC 2DBJA 2GHWB 2DWEA 4I0CC 1YMMA 2FJFB 3L6FB 3QA3A 4GBXB 1C1EH 5ETUB 2ADGA 4RGND 1L6ZA 1N6QH 3NFNA 1BF2A 4XHJC 4X98A 1TVBA 3ARSA 1PG7X 3BT2H 3TYGH 3TFKC 2YXFA 5I1EL 2ZJSL 2EDEA 1TZIA 3VRJB 5TH2A 5FUOL 3IVKB 3QEQB 1J0HA 2YD6A 1ZGLM 3NACL 1QBAA 4QOKB 4X6CF 4IMLB 3W82A 1DBBL 2BFVL 4LSVL 2XICA 4OIIL 4NGHH 1XIWA 2OJEA 4WNQB 1J7VR 4HV8A 1U6AL 1D6EB 4PLNC 5BV7B 3P0GB 3NFPB 2X4QA 1VGEH 3LS5H 5JIPA 3B83A 5L6YL 5BO1L 2NY1D 5C6PB 4OZFH 3G6JF 3DHJA 2MWCA 4WTZG 2FDBP 5D2LB 3TGXA 3EYFA 1ZWIB 1R3JA 1YEEL 2A6IB 1CE1L 4YE4H 4WUUA 3H0TA 3P0YL 2BOCB 3QXWA 3TVMA 1HSAB 4P5KA 3MUZ1 2W59A 1NAKL 3WS3A 1HEZA 4CN4A 5KN5B 1ROWA 2CLVB 4AEIL 5GGSA 5FO7B 2EYSB 1TNMA 2VLRD 4MA1C 1UJTA 2VXUL 4G7VH 4JG0L 2P8LB 1IAIH 3VFUA 3ZE0E 3VFTA 3AVEA 1NC2A 5JOPE 4I18A 2XZQH 3UEZA 4WJ5A 4LVEA 2OSLB 4LAJH 3SPVB 5DJ6A 1UXWB 4LCWA 3PHOA 4C56B 5SX5K 5F9WB 4O51B 1H3PL 1YEHH 1AGEA 1TLKA 3ESVF 4KRPD 5FIEA 1UH4A 4M8QB 4G8FB 3TBYA 4YHPB 3BPLC 2YR3A 3DRTB 4HUVA 3L5XL 1CGWA 1CICA 1KTRL 3PHSA 5JHDE 3WLWC 4IM8A 5HGAB 3I9GL 3VD5A 1YEIH 1NMBH 3S37L 5DT1L 4LEOB 2FJHB 3KXFE 4DCQB 1S9YB 4N8VA 2QHRL 2RQ8A 2EICA 5L2JB 1WICA 2VLKD 2W92A 3BDYL 3QPXL 5EC2B 1BLNB 2W9DL 2YPLB 3I3DA 3VE0B 43CAA 2XWBB 3DX6B 4LU5H 3SN6N 3DGGA 3P2TA 1KJ2L 1SEQH 4HF5L 3HZYA 2YKLH 4AY0A 5GGUA 1CLOH 4DQOL 2YSSB 4M1GH 1KB5H 4XCNB 4P4KC 3WNOA 3IXAB 1CXLA 2BX5A 1UM5L 3A6CH 5T3XE 2G2RA 2X7LB 3QUYA 1J1XL 3D39E 4U0QB 3X3FL 1D5MB 4ZUTB 2AJYL 3OGCA 4PGCA 1WAAE 2B1AH 4ODWA 3UZEA 3MNZA 3QQNA 2R0ZL 3RNKB 1QUNA 1LILA 4BK4A 2DD8L 1WUNT 4G6JL 1FIGL 5CD5D 5D1ZC 3MV8B 3MCKB 3UO1H 4XWOD 3GMLA 2IH3B 2DTML 1A9EB 5AG8A 2VL4A 4P99A 4ZFZA 4F57L 4HMCA 1A5FH 5HYIA 4B7LA 3ZHDA 2BSRB 2VZTA 1KTDA 3ZDYF 3PV7A 3L5WB 4ZTPL 1WC7A 2CRMA 1Q9KA 1HINL 2X42A 3V5DA 3RKDD 2R9HD 1BVLB 4P23D 1NBVL 5EO1B 1HHIA 3AY4C 5AYQA 5DJCA 1K3ZA 2CMRL 1F2QA 2IGFH 3L9RA 2P8MB 1RUPL 1RY7B 3LKQA 4I13B 4JANA 3RUGF 3ZKQD 1Q0XH 5EH1A 3CUPA 3FFDB 5C2BH 5C3LD 4NQCE 3O3DB 5E8EA 5SWSA 1PKQA 3QXDB 4UV7H 5F7FA 4CVZA 1TPXB 3IS0X 2F8XC 4PJ8C 1PG7W 4UNVA 3NN8B 1U8PB 1IQDB 2AK4A 4JPIB 3LEYL 4HHAA 4NZDA 1JV5A 2NR6C 4JR9L 4PJ5D 5C08B 2VXVH 3LKPA 4X9BA 4JAMB 4R96A 3X3GL 4CU8A 4HIJA 3EOBA 4LLMA 2DIBA 3UPCA 1MFBL 4RWYH 1QQDA 1I7ZA 1CTNA 2HTKD 4C59B 3BEVA 5FB8B 5EU6E 1EFXB 3BQUB 3WLBA 3BZDA 3MLZH 4PFEA 1MSPA 2EIZB 3TZVB 3GBML 4PR5B 1NLBL 4OQTA 2BNQE 1PLGH 25C8H 5ALCL 1FIEA 3F7YB 3T0XA 2G75A 4E41A 3CVHH 3AU1B 4KTDL 5IVZA 1Q9LA 4FQQA 5CEZD 3NOIA 1BQUA 3QIUD 4S1RL 2R1YB 5E1AB 4XBPB 4GRWB 4AG4L 5BRZD 1U8MB 1R0AH 1DBJL 1G0XA 2CR6A 3HRZA 1FG2B 1MI5E 1CQYA 1S5IL 5E8PA 3ZKNC 5C3TA 5HI3D 7FABL 2V9QA 3DO3A 1L7TL 3F62A 4Q6IA 1CLZL 1ZHBA 3OSKA 1G7LA 1UQSA 2EO1A 2FATL 3KLSA 2IANB 4L8CA 4G8GD 1J5OL 3BH8A 4PTUA 4CVWA 2Z8SA 4KXZI 4JM2F 1J1PL 3BZ4A 4UUJB 3EYOA 3RFZC 5KSAB 4YJZL 1VFMA 4XAWL 3OAZH 3RPKA 2JB6A 1MRCH 3VDBA 1HILB 1T1WA 3PUCA 3UP1A 1WFTA 4ELMA 2UVFA 2UY6A 3EW3B 1OTUC 2ITCA 5DK2B 3OV6A 1GL4B 1U91B 4G9DB 1I3RB 4L9LA 4M6NH 3HC4H 3T0VA 4WFGD 1PX3A 5E8NA 3C60C 5EOQL 1FGNL 3SY0B 1SJXA 5GGVY 1WFOA 3NZ8A 3RL1B 1F3JB 3SDXE 2ZP0T 4Q97A 1YDPB 5GRXG 4JFXA 4U6VH 1P2CA 2JJTC 1INQA 4XC3L 3EFFB 4QHUA 3VXRB 3WDJA 2HT3D 3PP3H 1R5IB 5E6IA 2Z0BA 3VFWB 4AEFA 1K9TA 1TDQA 1RZJH 2WBJB 2BVPA 4Y1AA 1FC2D 2P5EE 3D9AH 5C6TL 2CJUL 1A6UL 2A6JB 2LVCA 4YK4B 4R3SB 4X9HA 4N0UA 5LGJA 3FRUA 1V3KA 2G60H 3N1FC 1G7IA 4MNQB 2AP2A 4XVUD 3UDWA 2X9YA 3VW3L 2CLRA 4XGZA 2HRPH 4G3YL 4K3DL 1DUYB 3O3AA 5I6XB 4F7MB 1BD2E 4KI5E 4HQQH 2EIDA 4PJEA 1I8MA 1JWMA 4PY8I 4HT1H 3OR7A 2QQKL 2VWEC 2VZOA 5I1JL 4NT6A 5DUBA 3HZKB 3BD5A 1NBZB 2CIKA 2MMXA 4JFFE 5M95B 5D7JD 2VZSA 2VOTA 3BX7C 3FZUD 1HNGA 1Q94A 43C9A 1AHWB 4E5XB 2YRLA 4UDTB 1MWAA 1HXMA 2GSIB 3BN3B 1QNZH 4PJBA 1FZJB 1LE9B 1X5YA 2GJZB 2JK5A 5IR1A 4U1GC 3SGJA 4ODVL 1SY6A 3MLTA 4CU6A 3FQXB 1X5XA 5D7IA 1FN4A 3E2HB 3CK0L 3RVXC 3QUXD 1U9KA 3BOVA 3RWGA 4ERSH 1H3XA 2VO5A 3FB7A 4LMQI 4J8RB 2DB8A 5I74B 3N0PB 3H9SB 3HG1B 4YGVA 1AXTL 3SGDH 2YUXA 3VWKA 4HWZB 4QHKJ 3S3PA 1RUML 4MXQC 3ALXA 2X6MA 1NFDE 1T2QL 3BP4A 3H9HB 5T1DH 1AE6H 2PW1A 2FHFA 4PGJA 1HCVA 5A2FA 1CR9L 5JA8B 3MBXH 2VTFA 4DGIH 4CN6A 3PABB 2AEPH 2MHAB 3RX8A 4PJFF 4HSQA 5JQHC 3ARUA 4Y19D 4AK1A 4A2LA 4G6ML 5C0JA 2NXZC 1X7QA 4UOJA 4WUKH 4WRLA 3O6KH 4GBXD 5CWSA 3UJTH 4ETQA 3BKJH 1FQ9C 2P7TA 4WHDA 1ZT1A 5IB3B 2KH2B 5IB4B 2F54B 3QCVH 4YDKL 2R4RH 4LRIC 3VRLF 5MEPA 1H5BB 3LVEA 4MCYA 1HXYB 2R0KH 4JFDE 2XQBL 2J12B 3OKKA 3FFCB 4KJYA 4BFGA 4WWID 4B41A 1MPAH 4OTXH 4YXLH 2JCCF 3ARXA 5DJZA 4WHYH 2ENYA 4NYLA 3GSRB 5FO9A 3P4MB 1EHNA 2H26A 1SBSL 1EERB 4Y2DA 5DS8A 3OXRB 1YUHA 5TGBB 4YHMH 5CP7A 4JFYB 4X9IA 1KB9J 5T3ZL 3NFSL 4KJPD 4DK6A 3KHOA 4NC2B 3MRPB 1U95A 3TVMC 3GGWB 3CXHJ 1DEDA 3IF1B 1W72L 4M3JA 4QXUL 2HVKA 4LAQH 5HVFB 2EE2A 2ZWLT 2Z35B 3KJ6H 2O5ZH 3GSNH 3OBAA 4ONFH 1CDGA 1FCGA 1JCKA 2KBGA 4ZPTA 1AIFB 2FRGP 1ZHKB 3PG2A 5MENE 3K4DA 4EDXB 1DBAL 3GHBL 2EKSA 5DRNB 4P4RA 5FOBA 1GZQA 3PNWA 3VRIA 1W8NA 4PJDB 1P6AB 2XIDA 3UJIH 1KFAL 1XGRB 3IKCA 1RJYA 3MC0A 3WUWB 3W9EA 3QFDA 4OM1L 4TSBL 4PUBL 5AUMB 5TDNB 5LXGL 3L3OB 1IKNA 1CICC 4AENB 2HLAB 1LNUA 3CU7A 4F7EB 4OZHE 3TYFA 4OZIA 4U1HA 4C4KO 5C0AA 2BK8A 3NH7H 1YYML 1TJGH 4XP1L 1UENA 5EUOF 5GXBB 4HMDA 1Y18A 1ZK9A 2XPGA 3A6OA 3QWRA 1T04A 2XFXA 4HH8A 1RZGB 3O0RH 3CX5K 5HPMA 3JXAA 3WJJC 4P3CL 3B43A 5HYSG 3GIVB 3RZCB 4EI6A 4M5ZL 4WO4A 3GSQB 1PZ5A 4H88L 4NO2B 1CGSL 1XF2A 1ETZB 1X4YA 4LLUB 4O2FA 4K2UL 3WDHA 2J6EH 3FB6B 3KG5A 3QUYC 5T3XH 1JPFA 3C6LB 1MLBB 4HLZH 3S35H 4F8QA 2UVEA 4OQTL 5T5FL 4LBEA 1QA9A 3E0GA 3OJDB 3PQYE 4FP8H 4XNXL 2KKQA 3WN5A 4KZDL 1QZ1A 3MLRH 4AYFA 4X4YB 1NGWA 3DMMD 4XPBH 5HGBA 4DW2H 2D7MA 2APWA 5C07A 1DE4B 3TBSB 3RDTC 3CZJA 3EYSL 2VRAA 3TEUA 2NX5D 1PYWA 2OYPA 4Z7WA 4HS8H 4J6RL 2Q8BL 1IGML 1T4KA 2PN5A 3LRHA 5EO0B 2RGSA 3MLXH 5KSBE 5H37G 3QUZC 1MCPL 1NSNH 3RNQB 3GZKA 4ENED 2P24B 1PQZA 2NLJA 4K7PY 1FFOA 1MCSA 4EJ1C 4HPYH 4G80B 1OAXH 1QSFA 4U33A 2F53E 4MDIA 5BS0B 1DUZB 2HH0H 4I48A 4MJIB 2Y5EA 1UM4L 5IIEA 4JJHA 4E0RB 2NY2B 3Q5TA 5DMIL 1AQKL 3TJEL 4D8PB 3C5ZC 3VXSE 5ENWA 3AREA 3QUMB 4NP4L 5I76A 1LK2B 4KK9C 5DHVH 5EWIH 2V5SA 5HHPB 2XZCH 4G43A 5FYJL 2AEQL 4YHKH 2QQQA 4GSDL 2K7QA 3DROB 1AP2B 1FJ1A 2Q3AA 1BVKB 3GBNH 2ZG2A 1HE7A 5GJSL 4R2GC 5C08D 4R7NA 1IKFL 1P1ZB 4MVBD 4JZJA 5I15H 3KDMB 1BQLH 3MRMA 4HGWA 3BAEH 3HNTH 2CUIA 3QI9A 3IDNB 3BJLA 1OPGH 4XNYL 1SJVA 3O4LB 1OF2A 1CT8A 4JY4B 3DV4B 4WTXA 1LP9F 1F4YH 3T4YA 4NO3A 4HXAL 4BZ1H 5CGYD 3HUJB 5HYJD 4RA0C 1HH6B 2C5DC 2AXHA 2QSQA 3PWPD 3MV9A 4NM8H 3MRQA 2H9GA 1MHPH 5HHXL 1QRNA 3A6BH 4PPTA 3JV5A 3ZE0F 1QR1A 2CKBB 2DQGH 3NTCH 5EG6C 3ZSTA 2GT9A 5CSZB 5H8DA 1KLGA 5ABDE 2YBRB 4IRZL 4WU5B 3RGVC 1MCRA 4EI5A 1A6ZB 1VB9A 3UC0L 1JL8A 3SKOB 1KELH 4M62L 5E99L 1MWAL 2AJ3A 2HKHL 1EO5A 2QTEA 2R4SL 5DQDH 5ISZE 2HJFA 5AD0A 3B9KB 1DP0A 3EYVA 3VXQB 1DN0A 4NO0D 1SY6L 1A6WL 2PYEE 5DEFB 3PDOB 2W07A 4EDWH 3U0PB 4H25A 2X4OA 2H32H 1T22B 4L9LC 1Z9LA 5C0DB 1FZKB 5E94A 1K5NB 1CL7I 3MOAH 1A9BA 3RTQB 4U1IA 1MJUL 3H8NA 4GG6A 1J10A 2EECA 1MLCB 3DUHA 2DWDA 1FFQA 5JORA 1T1XA 1HHHB 4LSTH 1OAYL 1NCCH 1F4XL 3UTSB 1GGUA 2DQTH 4L8SA 2Y4SA 2XV6B 5B39A 4NN7C 5TE4L 1Q1JL 4MJ5A 3RL2A 4I0KA 4OLWH 3QHTC 1SQ2N 3VXRD 4V1DD 4JHAL 5IHZA 2L4OA 4YXHH 1S7QA 1BWMA 4RFEB 1F97A 5DUML 5HHVL 5FDWB 2WBJD 3T1FB 5TFSH 3WFEH 4BH7B 5ADOL 4DGYL 4GAGL 4U1KA 4WY7H 3F7VB 4PB0H 4MNQD 2VLRA 4RISH 4R4NC 3G04B 5CUSH 4PREB 3NPSB 3DUUB 1P6FA 3TPUB 1XGQA 5ESQA 3LD8B 2HT4C 1LO3L 4KAQH 5KW9L 1AGBA 1OAZL 4WFHE 4J3XA 4EUPG 1HZHL 1KBGH 1JGVL 3BH9B 3VFVA 1CD8A 4XRCA 3K2UL 4HK3N 5I75C 3MLUL 4PJCB 5MERA 1UC6A 2A77H 1CVSC 2FH8A 4JDZA 4L3EB 4XC1H 5I30H 1QLRA 1DFBH 2D0HA 3UROR 3KPPB 1NCDH 5C0RL 4OLXL 3CH1B 2ZPKH 1ZLVH 1E0OB 1KCUL 3STZB 5GGTH 4KUCD 3WXVL 1FDLH 1GIGL 2OL3H 1EPFA 3R1GL 2OI9C 1JFQL 1Y6KR 1QLFA 3RGHA 1AFVH 5FF6A 2CQVA 3HLAB 3MLVL 1G7MA 3AS0A 2OR7A 2A74B 3CDYA 1RUQH 4MNHB 5EU7C 3TBWA 5KS9A 3MBEB 4M93C 3SDYH 5JDJA 3ARQA 2R56L 1FNSL 4NNYB 7CGTA 4FXGB 3VD7A 4XXDB 5B38B 2EEBA 2IBBA 1U58B 2CH8A 3FQUA 1U93B 3ZYZA 3GM8A 2NXYD 5GPRA 1GC1H 1LD9A 1EO8H 4DGVH 1F02I 2KUTA 4POYA 3PV6A 3H7BA 4CADA 5J11B 5E2UH 3MFFB 3BZEA 2HP4A 4L4VD 4RGMB 2VC2L 2F8VA 1P5UA 3TC9A 1LO2H 3O2DA 2DQJL 3P4OB 2RFXA 4OJFL 3CLEL 3T2OA 1FVDA 4HJ0D 3LEVH 1ZT7A 2WK2A 2YRPA 1IVLA 5LAXA 3BPNC 4K7PH 1UT9A 2F54D 1G9NL 1CGXA 2Y6SD 3HNSL 4XAKE 4BFIA 5KSVA 3B4NA 3BD4A 3JSSA 3RWJB 1A1MA 3Q6GH 1IC5H 1DVFA 5HYSA 3CMOH 4ELKB 4C57C 1ZLUK 1EJOL 1U8HB 2Z31A 5C9JB 4P23A 2I9TB 2X2YA 1KEML 1OL0A 3SDAA 4C4KT 5CD3A 3TBTB 2F5BH 3TNMA 1XGYL 3D25A 4EBQH 4GFTB 4PRAA 1UWEH 4GLRI 1WFUA 1I3GH 2YN5A 2FX7L 4FZ8L 2Q86A 4OCMC 4Z77A 3GK8L 5F97E 4J4PA 4J1UA 5E70A 3L3GB 2FECL 3RIFK 4PRNB 4ODTH 4YFEA 2R2EA 4NDMB 4U3XA 2Q3ZA 4QRRB 3HKFA 2PYFB 1ND0B 3HC0A 1MQKH 5T1LA 5H35A 5CILH 3BMWA 2DQHL 4GRLB 3NCCB 5C09A 3N1PC 4I2XB 3F6LA 1W0WB 1I1AD 1UVQA 1JGUH 1KJ3H 3MRRA 4ODBD 1GCFA 1CD1B 4PJAF 1DL7H 3SGKA 2J5LC 2I5YH 3ZLQC 1U3HC 1QO3B 2D9QB 4M1CC 1YEGL 4JZNA 2Z91A 5HVHC 1ZA3B 3QEHA 1N4XH 4Z7VA 4Y4FB 3QIUA 1F6FB 1ODAA 5EZIH 1Y6NR 2J88L 1MFAH 2J8UE 4KI5F 4OKVB 3BXNA 3TCXA 4R90H 1TQBB 4JRYA 1F58L 1JYWA 1ZSDA 3CFJB 1MRDL 1MHHB 3KAAA 5CHNB 5J56B 4LSSH 3AB0B 5DVMA 3ULSB 1OCWH 1G9NC 3IFLH 4GW5B 3QDJB 3C6SA 4WO4C 4U1SA 1I8IA 3S98A 1MRFL 4MAYB 4HUUB 4ZXBB 4HS6A 1JNHA