1PKQE

Myelin oligodendrocyte glycoprotein-(8-18c5) fab-complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
121
structure length
121
Chain Sequence
GSGQFRVIGPGHPIRALVGDEAELPCRISPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDAEQAPEYRGRTELLKESIGEGKVALRIQNVRFSDEGGYTCFFRDHSYQEEAAVELKVEDPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords (8-18C5) chimeric Fab, light chain
publication title Structural insights into the antigenicity of myelin oligodendrocyte glycoprotein
pubmed doi rcsb
source organism Mus musculus
total genus 25
structure length 121
sequence length 121
chains with identical sequence J
ec nomenclature
pdb deposition date 2003-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1pkqE00
2E8ZA 5E8PB 5JIIA 3ZTNH 1S7SB 4LHQB 1FNFA 4JG1L 2ERJB 4NJAH 3QG6A 2DM7A 1K8IB 3MRMB 4MMZC 2YPLA 4AH2A 3R4DA 1CLOL 1CLCA 1UJTA 4WUKL 4I3RH 4E0RA 1BQUA 1IGYA 4OF8A 4TVPE 5F7FA 4ERSH 5KS9B 3DTXB 2VLRB 4ODWB 1EXUB 5BRZE 3DGCR 2UVEA 2NCMA 4URTB 1CICB 4OBRA 3SDDB 3AM8A 1RJYB 2EYSB 3MRBB 2Z31C 3MGTB 1CGYA 4TNWF 2YC1B 5DTFA 1P5UA 3C2SA 5J12C 4ZYKB 4J1UB 3GSRA 2BFVL 5DHVA 4JM4L 4N8VA 5C6PB 4QRQB 4HUWB 1MCNA 3RIAF 5BS0E 5GS2H 3TO2A 2HJKA 4WFEE 3PHOA 4AT6A 5CEXA 3D0VB 4GRMB 2HRPH 5DQ9A 1WUNT 3BP6A 4P5TA 1YPZA 1G7LA 1A9EB 1J0YA 4JRXB 5CP3A 3D87B 4KKCD 5FDWA 3UYRH 2JB5L 3VXRA 2VQ1A 4Y0GA 4RNRA 1JRHH 5CILL 1BJ1H 5D8JH 2WANA 3LS4H 4P46A 1CGVA 3VFMB 1U8JB 2J12B 1R0AH 4LLVA 4HGKC 1G6VK 1WIUA 5GS1B 3QDJD 5H2BA 3VXMA 3VRIA 1A8JH 3H42H 3MRCB 3O3AA 4H25B 2X2YA 2SEBB 1AR2A 5FGCB 2G60L 4UDUA 1IAMA 1TVDA 2OX5A 1LNUB 4KZDL 4BH8B 3C6LB 1HHKA 1JFQH 3QR2A 4BSVB 4PRHE 2A9NH 4IMKA 4MZ3A 3QHFH 3RVWD 5AYQA 1MAML 3OPZH 5FV1L 4UNVA 5F7YC 1SBBA 1YMME 1AY1L 4EVNA 4JKWA 1XR8B 2CH8A 1YMHA 1F42A 2FJFA 1VADA 4AEEA 2DM2A 4NM4H 1H3PH 2NY4C 3K4AA 3S6CA 5IJVA 4YFEA 1OTUD 3ARBC 5I17B 4JY6B 2BY2A 3UZVB 1DANT 3QO0A 3CVIL 4Z0XA 4WV1A 1QFWL 5BJTB 3H3KA 2Q86A 3TFKD 4M7LL 4H0HB 1OAUH 4PJ5B 3TYFB 3I6KB 4NFBA 2MTPA 4OUOA 3X11B 5C1MB 4XC3H 4Y89A 3HAEG 5B3NA 1UCBH 2DOCA 1PG7W 1SJHA 5F1IA 4XMPH 2IBGA 3N9GL 1NFIA 3CFJA 4IRSA 4X6BB 2CR3A 3AREC 4IDJH 5D7JB 1EAPA 4POYA 3K46A 2HKHH 1MWAA 4JFPA 2D2OA 5MEQA 1ZA3A 5FCSH 2H2SD 3HZKB 3EO0A 4OD3L 2V2XB 1FL5A 4NO2A 1SY6L 3KPPB 5FUCE 3MNWA 4MWFA 4XPFH 2ENYA 2R8SL 3SGJA 4F9LC 5FAAA 2I9TB 2CJUH 1F11A 2VB5A 3BN9C 4WWKB 3BE1L 4Z0BH 2P1YA 3KPSB 4XCNA 2CRZA 1JIBA 4XPHL 4OLXL 3ZTJG 4HGMA 2DTMH 1RZKL 4BZ2L 1IKNA 2E3VA 4R4ND 2CXKA 4MXWH 4UTBL 3KLAA 3BGFC 1RURH 2O5XH 5J3HD 4FABH 1I3GL 2CDFA 2N1KA 4X6DA 3H9SE 4Z7VF 3O6LH 1CE6B 3SQBA 4QO1A 1L7IH 3GIVB 3O3EB 4L8SB 4O5LL 1CXIA 1OAQL 5E4EC 3VFPB 2HTKC 5ESAB 4OCXH 5IBTH 2IAND 1NFDA 4Z77B 4WU7B 1AGBB 4OV5B 5J13B 2H2PC 2ICWA 1F4YL 4ONGH 4M93B 3WLBA 4KFZC 4HIHB 4NHUA 5ISZE 1KPRA 1YY9D 4R2GB 3BH8B 1W72B 1L7TL 2NXZC 2F58H 2XZQH 4XMLH 5FA4A 3CMOL 3S5LB 3I3EA 1ZA6B 3HG1B 3Q3GB 1HKLL 4YBQD 5EUOF 3QFDA 4N8CH 5DMGC 4OZGA 4OSUH 1IGTB 4R97B 2LAGB 5C0RH 4J4PC 1UKSA 4NRYB 3RIFK 4YE4H 2VDPL 4YHNB 1I3RB 1YNLH 4P23A 1E4XI 4RFOH 1U92B 3EO1A 4FQIH 2FDBP 2VITB 3H0TB 4ODUA 2YPKB 4WFGE 1HXYB 1P4LA 3DX7A 4K7PL 2OZ4L 1RHHB 3QIWB 2YUVA 2IH3B 3OL2A 3BWUC 3CNKA 3ZKND 1REIA 3LDBC 1JNHB 4OKDA 3LHPL 1NLBL 1QD0A 3HI1B 5E8EA 5E6ID 1BF8A 5C3TA 1J0JA 1JHLL 4KK8D 4PJGE 3BAEL 4PGCA 2APXA 2C3VA 1W8OA 2GTWB 4UI2A 5IESL 3TCLB 4ZOBA 1BZQK 1Z9MA 2GITB 1Q9LB 3DX6A 1M7DA 1X5HA 1SJEB 5C2UB 2D7OA 4NZUL 3TZVB 5BRZA 4CMHC 3RI5K 2R4RH 1JGLL 5IOPA 1ZS8B 5DC9B 4ZS6D 1K6QH 1ACZA 2ZCHH 3D85D 5C09D 2XN9B 1IEBA 3MZGB 4LKCB 5GHWH 5KSVA 3QG7H 3C5JA 3QCUL 1A9BB 2NY6B 4EXKA 1P1ZA 1J1XL 4L4TD 2BVUA 3Q5YA 3UTQA 3DRQA 5BS0A 1EFXD 3MV7D 3MNZA 3FCTB 1Q9WA 2AV7A 3VXSD 4CJ1A 3ARFD 4M61B 4XP4H 1RUMH 1PY4A 5IEHA 4R96A 2W9EH 2X41A 5D6CA 1QSVA 1LO4H 3UJJL 3QNZB 1IGFH 5EZOH 1JV5B 1Y6MR 2ARJA 1I85C 3LY6A 2WIIA 3QFJB 4DKFL 4I3GA 1DQJA 4U2ZA 5CGYD 3P9LA 1JGDA 1YQVL 4ORGB 4O51B 1S8DA 5HHQA 4ODSH 5KJRH 1JGUH 3QUKA 4OIIL 1T7VA 5SWSB 3CFBA 4Z6AT 2BOBB 2ATKA 4RSVA 1NGZB 3JVGC 5DJDB 1CXFA 4HC1L 2DQDH 1A7PL 4ODXA 4KHTH 3B9KB 4MNGE 3JWOC 4OCMC 1B0RA 2YD2A 4GG6B 4PRHA 4L3AA 3CXHJ 4IM8A 1T0NB 1B2WL 2AEQH 3W5MA 4EI6A 1KFAH 2UWEB 1YMMA 2YZ8A 4YBLC 4X5LA 3VXQB 3ME0A 4X5XB 3EYVA 3DBXA 1ZGLB 1J1PH 1KJ2H 4GRWH 1T1XB 2ATPA 1OP5K 2LU7A 5DFTA 3CVHA 4U7KA 5TE7L 3L7FB 1FP5A 3T04D 2BNQE 4LCWD 1G7PB 2R1YB 1NMBH 3L3OA 1XCTB 1DBBH 1FC2D 2H32B 4MA7L 2DKMA 5I8EA 5EIIB 3LPFA 4LSTH 2O61B 3U9PH 5C8JB 5INCA 5LWYL 1N5AB 4Z7WA 4WU5A 4ZFFA 3LEVH 3STLB 4AYFA 4Y2DD 3IU4H 4QY8B 5J11B 3WFBL 5T3ZH 4P2OD 5ERWA 4NWTL 2FYYB 3AAZA 2YK1H 4TULH 5JUEL 5HY9A 2Q8BH 3P4NA 4LLYA 3IFLL 5DJ2A 2C7UA 4YXHL 2WUBH 4JDTH 4F57L 2QKIA 8FABB 3FJTA 2JB6A 1T7XA 1NEZA 2VDLL 3GSUA 4N1HB 1S9KC 3B9AA 5DA4A 4OFKA 5J6GB 3PV6A 5F8QC 5JIHA 5HGBA 4XVJH 1FFOB 2IQ9L 3H7BA 3RPIB 3C6SB 3INUL 4PJAF 2A1WL 5E8NB 4PYGA 3GGWB 4CAGA 4OFPA 1HOCB 3KPOB 4IJ3B 2WWMC 4XP5H 3WNKA 4CMMA 4CNIB 5A16A 4OGAC 4KKBD 2X4SB 4PRDA 5I1LB 4L8BA 2JJUA 2CUHA 4XHJC 2FR4B 5TH2B 4L8DB 4YHPA 3LEXB 4KI5F 4Y19D 3BQUA 2FSEA 1J12A 2J5LB 3PIQB 3FHQA 4RA3A 5SX4H 5FECA 4PV9B 2E6QA 3O0RL 4Y4HC 1QSFB 1RUAH 2X4NB 1A22B 3GMNB 3NCJL 4OF7A 4Q2ZB 5J89A 4I77H 3MJ9A 1NEUA 3MXWH 3H9SA 5HJ3A 3VJ6A 4JFOB 2X4QB 3DRTA 4X0KA 3QIBB 4I0PA 4CADB 4TSAL 1GZPB 3PGDB 1KEGL 3P4OB 2RHEA 2E7LC 3KPTA 3VW3L 3LV3B 4O2EB 4LCCC 1DDHA 5ISZA 1ACYL 5F6IC 1MFDL 5C0BB 1QHOA 3HR5B 1YYLL 1XZ0B 2OK0H 2W65A 1IEAB 3EOYG 1S7QA 1AIFA 4P2RD 5CSGA 2OP4H 1X3DA 3DVNA 3S34H 3NA9H 1IAOA 4PJ7F 3G08A 3ARGA 5HYJD 3ARDA 1ZLSL 1OP3K 1OM3H 3O6KL 4FZEH 1U0QA 2B2XL 4LSUL 4U1LB 4HFWB 4YZFE 3VD5A 4MJ6A 1B0GB 2X4PB 3HCVB 3QDJE 5CEZL 4MNQB 3S88H 3IJSB 2YPVL 1PG7L 2CLZA 1YEGL 4UQ3A 1EZVX 3HAEH 1CL7I 3LZFH 4KTEL 5INDA 1XGRB 1MIML 3RPKA 1I8MA 2BVOA 1MCOH 3UYPA 4J6RH 5GGVL 3WNNA 1CFVH 1Z2KA 3SCMD 4B53A 4KY1H 3G6JF 1NEZG 3MRDB 2X05A 1WBXB 5EWIL 2EC8A 3KDMA 5DHVH 5J6HA 1I8IA 4LLDA 3AS0A 4YO0B 1T22B 2DIBA 5I8OH 5ADPH 4UTAH 4HIIA 4PLJC 4XRCB 3FQUA 5HI4D 1LO0H 1TJHH 3UJTH 1S7WB 4Z95H 5D5ME 4NGHL 5I8KL 1FZKB 2IQAB 1MOEA 4J3WA 5FK9B 1XR9A 3QPXL 4DZBB 2HKFL 4U1NA 2XZAL 3IRPX 1NC2A 5CP3H 1U91B 3ZTJH 1KCLA 4YHML 3MPCA 2EYTB 3L3KB 4OUUA 4C83B 1MFNA 3EFDH 35C8H 3F8UB 3MXVH 4H88L 5KSAB 1FO0H 5HXMA 2GJJA 3F58L 5CLWA 5C0AB 1LVEA 1IBGL 4LEOA 4X99B 1HHHA 2EDOA 2ZUYA 1P69B 2OSLA 4QRPB 4JO3H 2DL9A 4ENED 4I4WA 4TSCH 1JYVA 5KZCD 1L0QA 4IRJD 5BQ7B 3PJSA 3GSOA 1MIEL 3QEUA 5SX5K 1VEPA 3MFFB 1INDH 1S9WA 4WVRA 1BQLL 4TUOA 5CJOH 4R4FH 5JMOC 2X70A 1YNTB 4PP2B 1OLZA 3BEVA 2AJSL 2UYLA 5EOQL 2A73B 5IP4A 3MODL 3GB7A 4MNGA 2B0SH 4G42B 3UTSB 4HK3N 1F6FB 3OHXB 3CFCL 2J4WH 3EKCA 1T5WB 4F7MB 3EDDA 3VI3F 1UWXK 2B5IB 4Y5YA 3ZLQC 1TCMA 3DURB 1LDPL 1GAFH 3ROOB 3B3IB 4WUUD 2VZ3A 4KRNA 3ZDXF 3WS3A 3QA3A 4NZRL 3AM8C 1TQCC 2VISB 3MUGB 3GNML 3IDUA 2Q8BL 3ULUL 1UVQA 2DLFH 4JDTL 4N1EA 3EFFA 1MEXL 4Q7DA 4OM1L 1YJDH 3VWJD 1NBVL 5IIEB 5EA0L 3WXWL 2FX9L 3LKPA 1UM5L 5K9QI 1MWAH 3QIUD 1AXSB 4FG6C 2VDML 3M8OL 5FHAL 1G9NL 2BY1A 1XAUA 4P5TC 4RDQF 4U6HB 3BZFB 2Q7YA 2DI9A 4PRIB 5IB1A 1MCEA 3BGAA 1FDLH 1SEBA 2FJGB 1NDGB 4X7TB 5BW7A 3P9MA 5FYLD 4Z76A 4XVUD 3RJQB 4XCCH 1H3WM 3UBXB 2Y72A 5I19L 3TIEB 2YD9A 1CF8L 5DWUH 4NBXB 4CJ0A 2FO4A 1QKZH 4L29B 3SDAC 5HDBF 1A6UH 3BGMB 1FGNL 1U8LA 2ED9A 2H26B 4KI5D 3V0WH 4EUPA 3JXAA 5KVFH 2W59A 4G9DB 4JAMB 3WFHB 2YD4A 5D1QB 1KB5L 5ALBL 3ZKXB 5I76A 3MLVH 5CD5C 2GK0A 3SDCA 1FFQA 4IMKC 4Y16D 3MROA 2EC9T 2G2RB 4EDXB 4M7JH 2ZOKA 3RDTD 1JPTL 4OD1H 3C08L 4ZODA 4HS3B 1YDPA 1A2YA 2WUCH 1RIHL 3VXUB 3LKQB 3PP4H 1G7IB 1DQMH 3Q5TA 3TM6A 5D7IF 3EYUL 1N3NB 5FYKL 5K93A 4A6YA 4E41B 3IDGB 3V7MA 1JWUB 4MJIB 2WLZA 1T5XA 4WV1C 5LBSH 5C09E 5K9KB 1G9MH 1IZKA 3REVB 2EH8H 1AE6L 2QHRL 2R1XA 3HNTL 4DOHB 2CUMA 4PJHB 2BNRE 1V3MA 5C0CB 1PD6A 3WS6A 5B8CA 3QCVL 4L3ED 3HE7B 1LQSR 1ZEAL 3VXSE 1N59A 5KAQG 2QTEA 4TNVF 2YKLL 1KIPB 4R4BB 2F15A 4IRSC 4NN7C 4S2SB 5DK2B 4YXKL 1UADC 1K4CB 3P40A 5EC2B 1KPVB 4NHCH 1GPOH 1N8ZA 4L4VA 5LGJA 4ZSOA 3N1MC 1A6VH 3U83A 3BDYH 4P2QB 1SHMA 4RMRA 1DLHB 4QOKE 4OLWH 5D72L 1KUMA 5D7LA 5HHOD 4DWHA 4NYLA 4GMTH 3T0EE 1TLKA 1WSST 3CXHK 4JQIH 1R3IL 2V7NB 2NX5D 5TPWH 3QDJA 2Q1EA 2W60A 3HTLX 4U1GC 1CZ8H 3QQ9D 4ELMF 4LDOB 3MOAH 3SGJC 3TJEL 3U46A 5D7KE 4LHUB 5D7SH 2R56L 2CDEA 3HPLB 3KPMA 4TVPH 4YC2B 3DYMA 2O5ZL 3MRPA 2UV3A 5IVOA 1A7RH 3EJYD 1RZIA 1RAMA 2CRMA 1HI6A 3O81A 4J3TA 5DJAA 4EBQH 1XF3B 4GAYA 4OI7A 4OQTL 2PXYD 4YDKL 3IDJA 1F4WL 2PCPA 4KJQD 1CDHA 4KK5C 5AZEL 4PRBA 5T1KD 4YXLL 5IMMB 1F6AB 1WEJL 4ODHH 1NGQL 4K7FB 3FT4A 3WIHA 1HSAB 1L0YA 5E9DB 3I2CH 4NUJA 4Z7QF 4EUPG 3EZ8A 1AQDB 3HC4L 2EZ0D 4LCWE 3FAXA 1U8KA 5GSRA 1NCDH 3BKYH 1VESA 2ADFH 5D5MA 3ILPA 3NFPA 5F9AC 5EU4A 1OAKL 4PGEB 1GJIA 2Y07L 1XGYH 4Z8FL 2HAZA 2XT1B 4EI5A 1HQRA 1OT1A 1OARL 3LRSB 1G9MC 1MI5D 3RNKB 2DQEL 3PHQA 3D9AL 5KSBF 2P42B 5DD5H 1MUJA 3UTZA 4P57B 4HT1L 3MC0A 1R3HB 2EYRB 4PG9B 2APTA 5DRXB 1U3HB 1FYTA 4JN1L 1ITBB 4Y4FA 8CGTA 3LIZH 4P23C 1QVOB 2BMKB 2XQBL 2GT9A 5FIEA 3BI9X 5KSUA 4KQ3L 3BP5B 1QLEH 4JM2B 2XTJC 3MUY1 3HLAB 1GGBH 5B38B 1KENL 4X7FC 2CGRH 4Z7VE 3VXTA 2NR6C 3S96A 4OM0L 2BSSA 2VL4A 5KW9L 3QQ4B 3ROLA 3ARQA 2HFEB 4M1DL 5FOBA 2AK4B 3D39B 3RVXD 4Y19E 2BDNL 4NKIH 3VFWA 5I1AB 3L7EA 5A2LH 1F90L 3GJFB 5ALCL 3WFEH 1UACL 2W9DH 4LLUA 1RI8A 1JZ7A 2JELL 1ONQA 4LU5H 4IOFD 3NZ8A 5GGQH 4NQDE 2VTFA 4QHKI 5LXGH 2Z92B 4S0SD 3GRWL 3ZE2E 3LN5B 1O0VA 4JHAL 3CZFB 1CD1B 4K7PX 2VERN 4XTRD 3LKRA 5ID0A 4DVBB 2W92A 3PWJA 4KUZL 5ETUB 4TOYH 3K1DA 3DMMA 3RZCB 2VL5B 3UMTA 5LVEA 4WO4D 3VGEA 2JK5A 5C0EB 1F8TH 1FIEA 3ZMRA 4LLWA 3TBVB 1K3ZA 3VH8A 3MFGB 1KCRH 3HI6H 3OR7A 4QYOB 1FZOB 1DBAH 2IFFH 2Y36L 1XF2B 1I75A 1DEEA 5DJ6A 4P2RE 2F74B 3FRUB 4N5UA 3GBNH 2IG2L 1OL0A 2OTUA 1INQA 3BP4B 3JTTB 5HYJE 3GMOB 3L95B 1BIIA 1FNSL 4FTVD 4DVRH 3MCKB 4XVSL 1AR1D 3DXAE 4G8FB 1I1AD 3LKOB 2YA1A 4DZ8B 4JE4B 3UX9B 2OXGA 4LDEB 4PJIB 4ZTPL 5T3XD 4HZLA 3KPLA 5JHDB 1A6TB 2PO6A 3MLUL 5DQJB 1QLRA 4LP4A 2BHZA 4MVBD 3PWVB 4DW2H 2NW2B 3QDHA 4KHXL 1R5WA 3OJ2C 3ZKSD 3P11H 1XIWD 3M1BB 3GSWB 4PJEB 4RIRA 1JF1B 3NGBB 1A6WH 1Q9KA 4HIJA 2IGFL 1FYHB 1NAMA 3WKML 3GI8L 4JFEE 3FHAA 2IWGA 3F6LA 3DECA 4JY5L 1U8QA 3DUSB 2H3NB 3WSQL 4ZAKA 5KVDH 1M7IA 2F54B 1R3LA 1FE8H 1HCVA 5JDSA 1A3QA 1D6VH 2BJMH 4PJBF 5FOJA 4OJFL 1T1WB 4XNQB 5C09A 1S9YA 1DQLH 3GKWH 3OG6B 3TH2T 5BMFH 5C07A 2DQGL 4KJYB 3W9EA 4XT1C 1D6EB 2BNRA 1G1YA 5L9DL 1NCBH 5ID1A 4CVWA 2HVKA 2Y06L 4LLQB 1UB6A 2I27N 5DDHA 4RZCB 1C16A 3VXSA 5ICZB 1MJUL 4XCYB 5D1ZB 5E00B 4FNLL 5IVXE 4PY8I 4JG0L 2OJZL 1WBZA 4EN3A 2VDQH 1TCRB 1MVFA 3O45B 4HBQA 2P8LA 5JIPA 2EC9U 3MV8B 4TSBH 4PLNC 5IMLB 1A0QH 4MJ2A 1QNZH 2ZG2A 5JO5A 1KC5L 4QOKA 3VH8G 5EOCL 3FB6B 3T0EA 2J6EL 3LVEA 4D9LH 4NN5C 4PJDB 5ESVA 2VAJA 4NC2B 2ITDA 2RCSH 2E9WA 5CBEB 5IBLD 4TNWK 5FUCC 2XRAL 2IAMC 1XF4B 2FJHB 4JHBA 1CFSB 3MCLL 3SE4A 5FKPA 3HNVH 4NQEB 3RIAK 5FO9A 3GSNB 1F58L 2LU3A 4K3JH 4M7ZB 1SM3L 2X4OA 3GSVB 3D48R 3L6FB 3MNVA 4WUUE 4F15B 3SKOA 1LO5B 4JO1L 1F02I 1A6ZA 3CCHB 1T20B 4MD5A 2D9CA 4HS6A 2VLRD 1MSPA 1B4JL 1I9JH 1RVFL 5DD1H 3RP1A 4X4ME 3G5ZA 1CICD 3O9WC 3SDDD 1NSNH 2C1PA 2A6DA 4I0PC 3BT2H 1UXSB 4HJ0C 1KXVC 4ETQB 3V6ZB 2CMRL 4HS8H 1JF6A 2J7LA 4F7CB 3ZKMC 1GZQB 4BK5A 2DQTL 3F62A 4HHAA 2IALB 2BVEA 5C0JA 4XP1H 1RZ7L 4XXCC 3QH3A 5GGSA 5BCAA 5B3JE 5I1EH 1E28B 3EDFA 2WK2A 3O3BB 3BMWA 1AP2B 5E4IA 4DGYH 4MSWB 2IPUG 5FYLE 1MCQA 2XZCL 3ARGC 1YY8A 4XI5D 1U6AH 1WZ1H 2RGSA 3OKLB 1W0VB 4R0LB 4G80B 4JRXD 5JORA 3HS0A 4PP1D 1PBYA 1WCBA 1BOGA 4RFNC 2FHBA 4KI5E 1X7QA 4OZIE 2GSIA 1VB9A 4G5ZH 1BVKB 3TPUB 4ONHA 2VXQL 4LCUB 5FYJD 4MMXC 2JIXB 3FB7A 1S3KH 4HCRL 3F65A 4P4KB 5HYEA 5MEPA 1S7UB 2Z4QA 3C5ZA 3UO1H 4AEHL 1AFVH 3MLXL 1NMCB 3VGAB 2ZSWA 4U3CA 4Y19A 4N1CA 5DJXB 3QUZB 5F7HA 2GY5A 3VFVA 4X98A 3Q6FA 1QSEB 4PJ8D 4NQDA 4PV8B 1PG7X 2F8VA 5DURB 3SKJH 1P7QA 4L8CA 2NXYC 4JN2A 2X1XR 4NNXB 4G9FB 1U3YA 2PYFA 4NCDA 1GL4B 1D3CA 1H5BC 4HK0B 1BEYH 5ITFA 4NQSB 4BSWB 4GG6F 5JOPD 4M6MH 3STBA 2DQUH 3QRGL 4FQQB 5K9QG 1RZ8A 2FCBA 1DN0A 1XFPA 4OLUL 2UWEF 4L3EE 3J7HA 5T1MA 4ZXBA 2XACC 4PJ9A 3VWKA 1JUFA 3MMEA 1Q72L 4RISL 4RRPA 3X13A 3X3GL 4ETYA 1I8KA 5A3IC 4PLKC 4M3KB 4AG4L 4JKMA 4IIQB 3OAUH 3UCRA 4TTGA 5TDOA 2UY6A 4NP4L 2F5AL 1QR1B 1J9CT 4EUPH 5EBLB 3BKMH 5HYJA 1N64H 5HHOE 2WWKO 5FHBL 3DXAA 2NX5E 5TFSL 5HI5C 4KKLC 2BY0A 3IDYC 3IU3B 4U05A 5IR1B 3TO4B 4HW6A 2OL3A 1UEYA 1QA9B 1UKQA 5F7EL 1F3JA 1BOYA 5IB4A 2A74B 1UZ6E 1Q9OA 3BUTA 3OAYH 1DQDL 2QQKL 4WHCA 3BP7A 3SCMA 3VRJA 4CRPA 3HPJA 4TTDC 3MACL 1CI5A 4ZDHB 1ZHBB 3WD5L 1XGUA 1GYAA 2DI8A 4UIMB 2P4AB 1KB9J 4WWKD 4UOJA 1NCWH 3IDNA 2XXCB 3D3VE 4AM0B 1U95B 2NY0D 3KPSD 1I3VA 2CD0A 1HH9B 1IEHA 4Y5YC 1IZJA 2Q87A 3RWIB 5J1AB 2FD6L 1AD9B 4JFEA 3U9UB 1LEKB 4H26A 2Z35A 5F6HI 3V4UH 4CKVX 3TESA 5MEOA 3GI9H 4LCYA 1VHPA 5I66A 4LVNC 3U2SB 1YN6A 1I9IL 5F9WC 3PUCA 1N0LA 3I75B 4H5SB 3BYTA 4CVXB 5KVMC 3QJHA 1LP9E 1MI5E 2ZP0T 5FUOH 1W0WB 4AMKL 2MCPL 4PUBL 1KJ3L 3D18B 4MA3B 5BV7B 3HE6B 4APQB 3VFOB 3QUMH 4R2GD 4WI2A 4OGYH 3HRZA 3EHBC 1DZBA 1Q8MA 5JLZA 5IVXA 4HF5L 5IGXH 2GAZB 4OLYL 3HG1D 2FEDD 2BVQB 2E8YA 5CIPB 1FL3A 2XFXB 3V95A 2HG5B 5C0FB 1OSPL 2VQUA 3O2DL 1MCDA 4Y5VB 5IHZA 3BH9B 3OBAA 5EC1B 4MXQC 4MDJB 3ZDXE 3GHEH 4QHUB 3MA9L 1K9TA 3LKSB 3QPQC 4RRPG 3SDCC 3TVMB 1ZHNB 3CIQA 2KQNA 3QIWD 3WIHH 4YBHA 4OZFB 5MHSE 3ZDZF 1IVLA 1VEOA 1JVKA 1YEJH 2FL5A 1VGEL 1S7TA 5JOFA 5GRJL 4D0DA 3DO7B 1BD2B 2EXWD 4NFCA 2ZUQB 1MVUA 2Z8VC 4P3DA 2ARJQ 4RWHA 3VFTB 4HUUB 3C9NB 2DJUA 4J3XA 1E6OH 4NBZB 2FBJL 2Z91B 3QUYB 4JFYA 4D94A 5HVWA 2CKBH 3TZVD 4U1SA 4NCC2 4P4RA 4X4MA 3TN0A 4OCYL 1ERNA 3ULSA 5EU7E 1RULL 4LBEA 3S7GA 1D5MB 3MBXL 3WS6C 4JRYB 4AL8L 1MNUH 1T21A 4N90D 5B8CC 1P2CA 3WHE1 4HJJL 2XN9D 3IXTA 2OTWA 4N0FA 5HVHB 3JV6B 1MREH 3W39B 1J1OH 1DQQB 3QIUA 5A43C 2NY6D 3JWDH 4G5ZL 2C5DC 3W82A 4DK6A 4JZNB 1EK3A 5J1TC 3ECBA 2NY2B 3DV6A 4ZO7A 1FSKB 2AXGA 1QRNB 4KKCC 3F5WB 4FTVE 4EIZC 2DWEB 4LVOC 1VFBA 4YHLL 4CW1A 3HMWL 1MAJA 2HMID 1BGXH 3V0AC 5I15H 4O02H 1NBZA 4GFTB 1BQSA 4NO5A 3EZJB 1X5IA 4HAFA 4HKXA 5CZVH 3GK8L 1A6PA 2EEAA 3KYOB 3MRFB 1ULVA 1DVFB 3OKNA 1T1ZB 3LN9A 1EEYB 4QRSB 4OZIA 2GFBA 2P8MA 4QF1B 6FABL 3WFZA 4X9HA 1CE1L 2XWTA 5SWSD 4F37F 3FQNA 5F7NC 5EG6C 2HJLB 1FAIL 5GGSY 2AJXH 4Y16A 4G3YH 5JHLH 3G04B 3TBTB 3CMGA 3RVWC 3BIAX 3IKCA 5BXFB 1KIRA 1WGOA 3WNPA 3IDXL 3K2UH 3B9KD 2VDRL 1QBMH 5CAYB 4KROC 1LK3L 4U2YA 2X7LA 3RAJL 5DUBA 1NGXA 1CL7H 2YD7A 1FZJB 2WAHA 1T2QL 5IM7B 2D03H 3AMKA 4A2MA 4X6FB 4GAGL 1I1FB 1NJ9B 1FFNB 3FQWB 3BXNA 3CAFA 3GHBH 3HMXH 3TFKC 2WZPD 1T2JA 2VZ1A 1TITA 1X6NA 5CD3A 2CR6A 3S9DB 1Z3GL 3DNKA 2A38A 5GIRB 4G8IA 4K94H 1CBVH 4EI5C 1DEDA 3A6CL 3MLZL 1FORH 4GXVL 1C1EL 1YN7B 3W9DA 4HUVA 3T8XA 2PYEE 4AEFA 3PQYB 1N7MH 1QTYT 2RAMA 3QAZC 5C70A 1DSFL 15C8L 1M7XA 3BVNA 4U1MB 5T5NF 2R0LH 4FFYL 4AZ8A 2VH5L 3SDXB 2DLHA 5E99H 5KVEH 4N9GA 5DMKA 5DMIH 1G7QB 5GJSH 3A67H 4OCRH 4XNYL 3SE3A 4FXKB 2VLLB 2NX5A 4GRLA 1TQBC 3EOAB 1ZLWK 4D3CL 4CVZA 3BPNC 5CZXD 4QWWD 5GGRY 5TDNB 2VN4A 5JMRA 5FV2A 4D8PB 3RWCA 4ZNCD 4GSDL 1IILE 3VI4E 3VA2C 5KBNC 4K71B 4NO3B 3KLHC 2MPAL 4KVCH 2P24B 4OQ1A 2ZCLL 4P59L 4P5KB 4M8QA 4S11A 1JK8A 2PXYA 3VE0A 4R4NC 1U8MA 3F7YB 4UINL 1RJZA 1C5CL 1KCKA 5T1KA 3D3VA 2H9GB 5JR1H 1P6AB 1BX2A 1ZHKA 2KZWA 2Q7NA 4MLSA 5KS9E 2VLRE 2AEPL 2NY7L 4X7DC 3GMMB 2AABH 1M05B 1KTLB 4X6EB 3LN4A 1QSFD 1JI1A 2DQIH 4PGZA 3DMMC 2X9YA 4YR6A 4JDZB 2D0GA 2EH7H 3BPLB 5DVNA 5IT2L 2QSQA 5HHVL 1UC6A 2V9RA 1MJ7H 3QIBD 4DN4L 5EN2B 3TBWB 1YY9C 3KXFA 1I3UA 4Y1AE 2Z31B 1LP9A 4XCEB 1UXWB 25C8L 4X7SH 2XPGA 1WWWX 1MHHB 1EIBA 5J12B 3HZMA 4YEEA 3V4PL 3WIFA 4LIQL 1T04A 5DI8A 1R5IB 3RWJA 2GJ6D 1T83C 5C0BD 4K94C 4MX7A 5FO8A 3RWEB 5I1CH 5HYIA 3NFNA 4J8RB 4JRXE 4KPHL 4X9BA 3KYMB 3HB3D 2AI0L 4FFWD 5LCVL 5CP7A 4JHWH 1TVHA 5EORL 3VD9A 3RWHA 2PO6C 3CFKB 1IM9A 5E2JA 4ALAL 1PSKH 4MNQD 4TPRH 1I1YB 3ZKNC 4YDIL 3FMGH 4P2YA 2BXZA 5D71L 2YSSB 4M1CC 3EYOA 5E6IC 4FMFA 4JANB 4AENA 4KK8C 1KCUH 3WXVL 3JWOL 4G43A 3TJHD 4UBDD 1D5IL 3MJ7B 1ORQA 2YEZA 5FCUL 4HUKB 4DKEH 4M6OH 5JXED 3CUPA 4Q9RL 4A2LA 3IGAA 4ZAKC 3GMPA 4F3FA 2HH0L 3IETA 4ZS6C 3BDXA 1T66D 3VXOA 1NUGA 3HZVA 2AERT 2FLRT 5C0IB 2VABA 1HXMB 2YN5A 3MBEA 5ADOH 4QRUB 4HKZA 1R24B 3ZHLA 3H3BC 5JTWA 1V7MH 2DQJH 3ARBB 5F1OB 4IHOA 1CFNA 2AXFA 1B6UA 2FBOJ 3BHBB 2VXTL 2B7DT 3DROB 3IB4A 1O7SA 3IJHA 1A4KB 1CLZH 4OFYD 5KSAD 4EN3C 1KSRA 1S78C 5L2KB 3L5IA 1NCUA 5C0AD 3FQXB 4U0RC 5CGYC 2LTQC 4NQTA 4TUJA 4LSRL 1LEIB 4QRPD 1UA6H 5EZLB 1F3DH 1ADQL 3E6HA 3T0EC 3FZUC 3T4AB 2QADD 2APVA 2IPTL 3AREB 3OG4B 4KMTL 2AK1H 2FEEL 2VE6A 3T08A 5DD0L 1GGYA 4NKOA 3RX7A 1U9KA 2Z0BA 3DETC 2CRYA 1S7VA 1N0XL 4YHKL 5ILTL 5D93C 3SE4C 4DKDC 4WI8A 4JPWL 3QDGB 3KPSE 1U8NA 5E7BA 5FA3B 5DR5H 4K9EH 4JM2F 4PTUA 1WFTA 1ZHLB 1AO7B 2V9QA 4WY7H 1KGCD 5D2LB 4ONOA 1AGDA 4NSKA 3QNYA 4UUJA 4U6VH 4H1LA 1PKQB 4RGOH 4X6CB 3SJVB 3U48A 3G6DL 1IAIH 4QRRE 3G5YB 3BGFB 1JF5A 3VD3A 2P5EA 4YHOL 5C0DA 4M9OA 3MO1B 4OI9A 2R4SL 2AKRB 3IAGC 1AGCB 1TETL 1JNNH 3UZEA 1ZT4A 4XP6L 2H1PL 3OJDB 4HQQH 2PYEA 4Q6IA 5DO2D 3TT1L 3BWAA 1Y6KR 1I4FB 1A1OB 4L1DA 3NCYP 4LRNH 4YAQB 3TNMB 3LB6D 5I1DA 4C56D 2X4TA 5HTSA 3HG1E 3NACH 1MFBH 2M1KA 5AWNL 4LSPL 4PRID 4NKDB 1H0DB 2NXZB 3QI9B 3MRRB 4K07A 3P73B 4LSQL 3GMRB 1BVLA 3WLWD 1UQSA 2VLKB 5EZIH 4RMSA 1NANI 1T80A 5CBAB 2IBZY 2X9XA 5E8OB 3A6BL 1MCRA 3MRQB 1JGEA 4KKBC 2YMXH 3ZT6A 3L3HA 5D1QD 5CKGA 2C26A 3LSOA 4X8JA 1CFTA 3BFOA 2IEPA 5AZ2L 4PJIF 5E70A 1R3KB 4U4BA 4TNVK 4NUGH 3H2WA 4CU8A 3IVKA 4WW2A 3LDBB 5EOTA 3VXUD 5MENB 1DLFL 3QXDA 4OGXL 1D5XB 2VZSA 1LO3H 4BUGA 4X8XA 4HXAL 2Z8RA 1M6OA 4K9EC 2WW8A 2VC2H 3RUGB 3OZ9H 2XY2A 1OTSD 4G6KL 4PJEF 4N90E 4HGWB 3UJIH 4YHZL 1FNGB 5EUKA 3MUJA 3OKEB 5E2UL 1IGIH 1M1SA 3O6ML 1RHFA 4CMHB 4ZXBC 4PJ9C 3VWKC 2XG4A 2H6PB 1K5NA 1OB1B 5C0CD 4HAGA 4Y1AA 3SN6N 5KVGH 5TE6L 5DJYA 1T1YB 2XKSA 4UIKH 2OM5A 3SKNB 5E2VH 2Y1VA 4WI5A 5CZKA 5JNYA 3HE7D 3EAKA 3QZWB 3RWFB 5FGBC 2YRZA 4H1LG 5I1IL 4RBPK 1ED3A 2Q6WA 3QO1B 5K33A 5E5MA 2VDNL 5C6TH 4YWGH 4ZFGL 4RAUB 2VDKL 1WITA 1CGSL 4OLVH 1G7MA 3QDME 4P2QD 2IPKB 3OKYA 2HVJB 5JPMB 3KPRB 2H8PA 4NQCE 3CDYA 2CIKB 2LE9A 4GQ9L 3SCMC 5L2JB 3WDHA 3WMSA 4LHUD 5GISL 5CJ5A 4I0CC 2NY3D 3MRHA 4GO6B 1LE9A 1KNOA 5CEZD 3MLSH 1ODAA 1UZ8B 2X09A 4RFEB 3WE6A 3QUXD 2IH1B 3FQRB 1MFEL 2JCCA 1E6JH 3FAWA 4N0UA 1OPGL 5GGTA 5KANI 3KJ4C 4BFBD 4PJDF 4PJXB 1I9RH 2WBJA 1MF2H 4PJ8A 3N1PC 5HI4C 3WDJA 1K8DA 1IC4H 4S1SL 4KUCF 3L3JB 5I16B 5HD8C 3K81A 1BP3B 1CLZL 3EBAA 5DEGB 1DL7H 5DC4B 5I30L 2BVPB 3ALXA 4YBLB 3TT3L 1YECH 3BN3B 2R1WB 5FYLH 5EO9B 5F3BB 4U6YA 3I6KA 1QYGL 5BZDA 12E8L 3O4LB 2CK2A 4F7TB 1CYGA 2QV2A 43CAA 4TQEH 1KTDB 4I5BB 4XBPA 5JW4Q 2VQTA 3W0WD 1N6UA 3QHTC 4OAWB 4FQXD 3THML 3FN0L 4KRPC 4XAKE 3QYCA 2C4XA 1FGVH 1NGWB 3QWOB 1ZTXL 3QWRD 4IRJC 5CJQL 3CGTA 1U3HD 3NN8A 1A64A 3FN3A 4KKAD 3B5HA 2ZZUT 3MUHL 4G8EA 4RMQA 3P30L 3ARUA 4LDLB 4YPGA 1KT2B 3HZKA 2DDQH 5SWZB 4XNZC 4NQXA 4JM2D 3FL7A 2FX7H 1HQ4B 3RWDB 3MA7A 4XNXH 3B2UC 3WNMA 4PRPE 1RZGA 4YNYB 5M94B 3DJ9A 1Z0MA 5E08H 2OMNA 4CUCA 3CDGA 5GS0C 3HUJA 2MWCA 4LGSB 4AIOA 4NKQB 4QRTB 3F12A 3KPSA 2AK4D 3D39D 1DP0A 1FNEA 4NRZB 1JHTA 5HDQH 1NBYA 4M48L 3RGVA 1JRHI 4D0CA 1YEIL 1EBPA 1QSFE 4LGPB 3VGHA 4JGJA 3OKKA 4ZUUB 3VCLB 3DX9A 3DHMA 5F7UA 2I24N 4YIQB 1A7NH 1BHGA 3MLRH 3GIVA 3TN0C 1BFSA 1WAAE 4UDTB 5C2BL 4QRRA 2J8OA 4GUPA 4Y4HB 3VWJC 4HBCH 3RZCD 1NUDA 3O11A 5IFAH 1U8HB 1QEWB 2OS7A 5E24E 4OV5A 3QCTL 1TVBA 3QIUC 3U4EB 3SDYH 3MOBH 1OF2B 4XHQA 3AS1A 2GJ6E 4AIXA 4WTWA 2EXYD 3MJ6A 4S0TD 3ULUD 3HNSL 4K3DH 1G7JB 1CLYL 1KJ2B 4ZS7L 4XVUC 3MRGA 2CKNA 4FQJH 1UM6H 4NRXB 4ZO8A 4LCCB 3RVUC 5IQ9B 1Q0XL 5F89A 5F6IB 1IGTA 4HXBH 5DEFA 4YFLI 1JWMB 2OTPA 3BPOC 5EU6B 4KI5C 1FH5L 4MNQE 1MFAH 4PJCB 4DUVA 3QXAA 4B50A 4HWBA 4U6XA 5FF6B 4LPUA 3V6FB 4R8WL 3NAAH 5D9SB 3DX8B 2VITA 5H35B 5K9JH 4OIBA 2K9UA 5JHDD 1JPST 4Y16C 3WFCL 4UV4L 1BFTA 5A2JH 4JR9L 5JPNA 1NKRA 2E5EA 3CU1A 4FXGB 1I8LA 3MR9B 3T4YA 3RDTC 3CSPA 3UPRB 1OT2A 3I3BA 1JNHA 4I13B 4LEXL 2G9HB 3IXAA 5AUMB 2AV1B 2HT2D 5C6WH 1M71B 4G7VH 3E2HC 1N2RB 4AEIL 1JWSB 1J8HA 4NO0B 5EZJB 1T7ZA 3NABL 1DR9A 2Q8AH 4U1HA 3TZVA 5GSVA 3T65B 2BC4A 1A6AA 3WO3B 4OZ4A 3SO5A 4B7IA 32C2A 5I1HL 4I2XB 4JDVB 4L3CB 1RV6X 5CMAB 3TBSA 1I7ZA 1S9XB 1NCCH 1X5LA 4XZUA 4YJZL 5IK3B 3DUUA 3D69A 3TH3T 1OAXH 3LQAC 4XPGL 4Y8DC 5JZ7D 5F1NA 4JKPL 5E5RB 5C0AE 1WFOA 3T1FB 4IOSD 4M61A 2QSCL 3VMPA 1A21A 4M6NH 5D1ZD 2EO9A 3JV5A 2BVTA 1QHPA 4QRPE 3C2AL 5TF1L 3SE3C 5HDOA 1R3JA 4HWZA 1XT5A 2GCYB 4PRNA 3GSQB 4GRLC 1HSBB 1J0KA 1RD6A 1VDGA 3MV8D 5JXAL 2FZ3B 3QQ9C 5EO0B 3QDMA 3B9VA 2EDHA 7FABH 1AQKL 1OGTA 3SKMA 4Z7UE 1FV1A 5HDLA 1EHLL 2DD8H 2VAAB 3MLYH 1NUFA 2NW3B 4PLOB 4NQCA 2I5YH 4LNRA 5DJDA 5T5FL 4QHNB 3QNXA 2PXYC 3HFML 4KUCD 3I50L 4WHTA 4NQED 4JB9H 2ZPKL 2QQLH 2Q3AA 1KGCE 2AJVL 3V6OE 4M1GL 2Y7QA 1FIGL 3C8KA 2XA8H 2YPLB 3VXQA 5DRWB 3VGBA 2IF7A 1IGYB 3FOMB 3CX5J 4QNPF 5FGSA 2ADJB 1FBIL 1T3FA 2D7NA 2QBWA 3QXVA 3U4AA 1VKXA 2GEEA 3BKJH 4J3OC 4QKXB 4ZNEA 5DTFB 1IQWH 5ITBL 2FLBT 4FFZL 5GJTH 5J0BA 1I7RA 3GSRB 3ZT7A 5IV2A 5DHVB 4MYWB 4C56E 3GUTB 4O9HH 5E2WL 4N8VB 1YNKH 4XGZA 3VFRA 3TO2B 3P3YA 2ESVE 3L3GA 3AMLA 3MLWL 2R69H 2HJKB 3PHOB 1KIQA 1ITCA 5DQ9B 4HKBA 4P3WA 3BP6B 4OLZL 4P5TB 1YPZB 1G7LB 1RQ5A 4PY8J 4XNMA 2GK2A 4GXUN 5FDWB 2X89D 1KXTB 1MJ8L 3VXRB 2VQ1B 4RNRB 5KN5A 3RPIA 2W0LA 3DOSA 1JHKH 1PVHA 4P46B 5GGUA 2JIXD 5E8NA 5T1LA 4LLVB 1KEMH 1LD9A 4PRPA 5H2BB 3VRIB 2B1HH 1NL0L 4HD9A 4P4KD 1IC5H 2ZUSA 4LGRB 5TDPA 5EUOB 4UDUB 3KR3L 4XB8A 1DBJL 5CINH 4UILL 5EBMA 5IVZA 5IFHH 1HHKB 4OF0A 3LEXA 3VXUE 4PR5A 4UOW0 3W11D 4RAVA 4RMTA 3QUZD 2PTUA 3T3MF 4QXUL 5I9QB 2BSED 4XTRC 1EO5A 4PGDA 3K74B 1IGML 3CVHL 1QSED 3BKCH 5AAMA 4MAUL 4WO4C 5DURD 1EX0A 3MBEC 1YMHB 3JZ7A 4G9FD 2FJFB 1VADB 4UV7L 5EU7C 1WAAA 3BYYA 2X4QA 3RL1A 2J88L 5IJVB 3QIBA 5D1XB 1GIGL 4PJHE 4EOWH 5C0CE 4RMUA 2FGWL 3QO0B 4Z0XB 1JZ5A 3U7AA 4WV1B 2Q86B 2YA0A 2PTTA 3EDKA 1DUZA 2GJ6A 1E4JA 4JJ5B 2ZKHL 3RTQA 4RBPH 3V6BR 4H20L 4F8TA 2O5YL 3NH7L 4KQ4L 4DTGL 1OAZL 1ZKAA 1YEEH 1SJHB 1EGJA 5DHXB 5F1IB 4RGMB 5F9DC 1NFIB 3CFJB 4IRSB 1FLTX 3ARSA 3BOVA 2B1AH 1HIML 2XIDA 5J56B 1EAPB 2X4PA 3LPWA 2VZTA 5DMJB 4MNQA 1YEKH 2PN5A 1J87A 1JZ3A 2XTLA 1MFCH 3TO4D 1MWAB 4JFPB 1JZ2A 5DFVD 5MEQB 1MY5A 1ZA3B 5FM4A 2QSVA 4GG8B 3SDXF 1HWHB 4XXDA 1XGRA 4F58H 3EO0B 5M7QA 1FL5B 5CEZE 2CK0L 4NO2B 4U1GB 5LKNA 5JW5A 3MNWB 4MWFB 2R39A 1OSZA 1F11B 3FO0L 3MRDA 3MV9A 1B0WA 2M26A 2VZUA 2OZ4A 3ZDYE 5EU3A 1GGUA 3MJ9L 3LQMA 4TN9A 2G75A 4XCNB 3BRDA 2LVCA 2K3TA 4Z7NE 1OQXA 3KLAB 3OAZH 1CR9L 3CLEL 3ALPA 3OKDA 1JNLL 2CDFB 3O6FB 4X6DB 5D70L 1P6FA 2EEBA 1QO3A 1ND0A 5E8DH 1A14L 4ZO6A 3RVTD 1A7QH 3Q6GL 2HYMA 4KU1A 1CQKA 1JGVH 4EZMA 4KJPC 5GZND 3NZHH 2I60H 4ODBD 4Q6IC 1K4DA 4S1DD 1XGQB 1NFDB 4ZOEA 3WNLA 4LARH 3L3KA 3RL2A 5SX4I 4F7EA 3B6SA 2ICWB 2WLYA 3W0WE 5T1DL 3MRJB 1ZSDA 1OCWH 3WLBB 4U1IA 2DBLL 3HE6D 5C0AA 1KPRB 1TJIH 4X99A 2VSDA 2G5BA 2W38A 5IB2A 4F9LA 4M5ZH 2Z9TA 2OR9H 1EAJA 3IF1A 5FA4B 5F44A 2LV4A 4E5XA 1HHJA 3QFDB 4DCQA 1NMAL 4PPTA 4PBVC 1GGIL 3P4LA 1TZGH 1HNGA 5FUZL 4Z7UA 1BMGA 1Z9OA 4P23B 5I71C 5MP6H 1YYMH 1FNAA 4PP2A 3EO1B 1IKFL 5C0GB 4DGVH 3GEWB 2XTJB 1UKTA 3D39E 1P4LB 3DX7B 2CO7B 1YEHL 2X42A 4WW2C 2ZUXA 3T2NL 1L0XA 2NY5L 2BRRH 5E8EB 3V6OA 4ZUVA 4PGCB 3LS5L 2FWOA 3A0OA 2C3VB 1CICC 2ADGA 5T3XL 2FATH 5HPMA 2MQCA 4FQLL 4JGMA 1GRWA 3QUYD 3L3DA 3DX6B 1M7DB 5F6HJ 5DD3H 5BRZB 3KS0J 3H3PH 4WFHD 4BZ1H 2MSPA 4JRYD 2HLAB 1MH5A 2P47B 3CX2A 4OT1H 3ULUE 1IEBB 2ITCA 3T0XA 5KSVB 2ED7A 4QXGH 3C5JB 1NC4A 4XI5C 4ZUTA 1P1ZB 4C56A 5LAXA 3NTCL 2F53E 3BZFA 1UWGL 3UTQB 2NY2D 5DZLA 2YD3A 2X1QA 1QRND 1A3LH 4QT5A 5HVFB 2ESVA 2B1HL 2FJGA 3MNZB 3VDBA 3MRKA 1Q9WB 2AV7B 2IMMA 4JLRA 2E6JA 4MXVF 4R96B 2X1WL 3BUYA 4BH7A 5D6CB 1AXTL 2XY1A 2ARJB 2AQ1A 3PWUA 1UH3A 4Y4KA 2VXVL 5JHDE 1RFDH 2WIIB 1OGAA 1DVFD 4BKLA 3Q1SL 1DQJB 3P9LB 1JGDB 4IRZH 4HIXH 4G9DA 1S8DB 4HIEA 3GIZH 5HHMD 5D1QA 1CS6A 3QUKB 2E9BA 4OTXL 3CFBB 2AAVA 4JZOA 1A7OL 2ATKB 3GM8A 4PJEE 1C08B 3ETBF 2G2RA 4ODXB 2R0WH 4G6ML 1U2HA 3PV7A 3AB0B 4PJ8C 3TNNA 1B0RB 5CWSA 2OQJA 3LKQA 1G7IA 4KDWA 3QULA 1KN4H 2R9HC 1E4XL 3RBGA 4EI6B 1FPTH 4XNUH 1YMMB 2V5YA 3CH1A 2W0KA 1W72H 4OF3A 3EYVB 3N85H 3DBXB 4XX1E 2AXHA 2VXSL 1CXLA 5FYKE 5ENWA 2ATPB 3CVHB 4PJHA 1KCSL 1LEGA 1JYWA 5C0CA 1U93A 3QQ3A 4RQQA 4M43L 1SEQH 4XVTH 5D2LF 2I9LA 3L3OB 1QLFA 4JFZL 4LAQL 5CLTA 3FT3A 5C08A 5IUSA 3KLDA 5I8EB 5JW4M 1BBDH 1YC8A 4NNPH 4FZ8L 2CIIA 1P4BL 5INCB 5I75B 4Z7WB 4WU5B 4ZFFB 1J10A 3JVGA 1GC1H 4LPWA 2PR4L 3S35L 3QEHA 5ERWB 4BZYA 3AAZB 1V7NL 5HY9B 2HT4C 3P4NB 4LLYB 5DJ2B 1Q1JL 4IS6A 5F7KC 2C7UB 5L6YH 1E4WH 1P4IL 2QKIB 2V7NA 2JB6B 1FVDA 2A0LD 3VFNA 1UJ3A 3GSUB 3S37H 2FB4L 3KAAA 4G7YL 1H3XA 1DBKL 2F19L 1ZVSA 5HYQA 1ORSA 4LCIL 3TH4T 1Q38A 4QXTB 1QZ1A 5HGBB 1CGTA 3H7BB 1SQ2N 3KHQA 4ZOCA 4JG1H 2NY0C 4NN5B 3CX5K 5KTEL 4NQEE 2DS4A 3QUXA 4GJTB 1XF3A 5LGKA 4K23L 4MZ2A 1CLOH 1QFPA 3RGVC 4WUKH 4CMMB 1MCHA 3TA3A 4A6YL 4PRDB 4XBEL 2BNUA 1F6AA 3WO4B 5B39A 5E2TL 4YHPB 1J0ZA 1B3JA 3BQUB 2FSEB 5FECB 3PDGA 5FYJL 5TGBA 4M6AA 4BJLA 1HHIB 2BFVH 3H9SB 5HJ3B 4NDMA 3W2DL 4JM4H 4L4JA 3VJ6B 2B8OT 4HWUA 5E6ZA 5LGHL 3DRTB 4QCIA 4X0KB 5DVMA 4I0PB 4OCWL 3V52L 2EICA 1P9MA 1TZGL 3ARTA 3BD4A 5ESQA 3NIGF 3W0WA 2JLLA 4K3EL 4FQXA 3RUGF 4OZHA 3P0VL 2YWYA 2GTZB 4F2MA 1DDHB 4GKZA 1N5YL 4PB9L 1G84A 5ISZB 3UTPD 4JFFD 4Z5RA 3QWRA 4G8GA 4R97C 3SEPA 3RU8L 4K2UL 2JB5H 2W65B 3FB8A 4MDIA 1S7QB 1IAKA 1AIFB 4LSSL 5CILH 1QQDA 3DVNB 4NJ9L 2BMKA 2VNCA 1IAOB 4GAFB 3G08B 3ARGB 3ARDB 3WIIL 4I18A 1GC1C 1S5IL 2G60H 1L4IA 2DI7A 4V1DD 2Q76A 3QIWC 1KXQE 4MJ6B 3K1KC 3RWGA 5HGAA 4G6FB 2GHWB 4KZDH 2CLZB 5H94A 4UQ3B 3PF2A 3RY5A 4NN6C 3OB0K 4LMQI 5INDB 1MAMH 5I1AA 1I8MB 2BVOB 2KPNA 1AY1H 1NANH 1ZXQA 1QSEE 2H32H 2ID5A 2ICES 4XH2A 3TZVC 2UUDK 4G9FE 4O58L 1H8OA 1ZV5A 3IFPA 4JFDD 1X4XA 3KDMB 5J6HB 1I8IB 4LLDB 3CVIH 1QFWH 3NCEB 5IWLA 3FQUB 2DMCA 1NAKL 2NZ9C 4M7LH 1FJ1A 1KLUA 1PQZA 2NXYB 4PRAA 3X12A 2FO1A 3NIDE 4PJXF 1Y0LA 4ISVA 4LVHC 3MLPA 1XR9B 5I0DA 4U1NB 4UAOB 1FFRA 5B39G 1NC2B 2HMIC 3N9GH 4I48B 4POUB 4YX2L 4OUUB 1WC7A 2F53A 4FP8L 1ZLUH 2PTVA 5L2KD 3LQZA 3CSBA 3MCKA 1T03L 3B2VL 4LEOB 1HHHB 2C3WA 3LKOA 1J11A 1F6LL 2OSLB 2H41A 3FO2A 4DK3A 1RJCA 1WICA 3FONA 4OD3H 4I4WB 4EIGB 1T7YA 1SY6H 4G6AD 4NBYB 3SGEI 3BISA 3ARED 3L1OL 5GS2D 1ETZA 2L7JA 4LL9A 3PJSB 3GSOB 2R8SH 2PNDA 3QEUB 5TQ2L 6CGTA 3IDYB 3GJFK 1S9WB 2NW2A 3BE1H 4TUOB 3CC5A 3KWWA 2X70B 3ZHDA 5FDYA 4OLXH 3QDGD 1RZKH 1NDMA 5DUPL 4C55A 3PWPD 4BZ2H 4R7NA 3BEVB 5LQBH 4W4OA 2UYLB 1MELA 4UTBH 3GB7B 1KB5A 4MNGB 3WYRA 2XI9A 4PTTA 4XVTL 1AO7D 1I3GH 4ZFOA 2V6HA 3BN9D 4O4YL 3CD4A 3L3IB 4O5LH 4Y5YB 1OAQH 3REWA 5DQDL 1JTPA 4M62L 3QA3B 4TRPL 3SJVD 2OCFD 4MAYA 1F4YH 5DEZA 5DZOA 1UVQB 3D6GA 4LVNB 2P45B 4KZEL 4L9DA 1TENA 1L7TH 1QOKA 3DVIA 3F7VA 2V2WA 4LMQE 5ICZA 4P9HL 3CMOH 4NC1E 3T2OA 1HKLH 3LKPB 2NQCA 3O45A 1FL6A 2Q7YB 4QWWC 5IB1B 1IGJA 2VDPH 2NXZD 4HFUL 2CUIA 2XWJA 4IDLA 1SEBB 3QI9D 3HAEA 3P9MB 4Z76B 3PGCA 4NWUL 3WEXA 2VLKD 1CT8A 3AVEA 4K7PH 2FO4B 4OCSL 5DMGD 2OZ4H 1X5GA 3FB5A 4GRWF 3MGOA 2A83A 1A3RL 2VR9A 5KSBB 1U8LB 4KK6D 2OYPA 4J4PD 3LHPH 4EUPB 1NLBH 1JHLH 1NAML 4QTIL 1RZFL 3BAEH 5I76B 3U7YL 2MHAA 4CU6A 1VGKA 2J5LC 2GK0B 4S1QL 3SDCB 4PJCF 5IESH 1EHAA 3MROB 1JPSL 3GBML 2W91A 4NQVA 1IM3A 5BO1L 1T6VN 1CDIA 1HHGA 4NZUH 1T20A 1CXKA 1NGYB 5MEND 1A2YB 1RZKC 1JGLH 3U0WL 3CK0L 3OSKA 2X1PA 2EDWA 3L5HA 3RNQA 3QIBC 4A6YB 4WFHE 4PJFF 1T5XB 1MY7A 2Y6SD 1CTOA 4KV5F 3U6RA 3SBWA 3QCUH 4MQSB 2F5BL 2OBGA 1J1XH 1GZQA 1NGPL 1FO0A 3V5KA 2R1XB 3ZE0F 4JPKL 5EO1A 3SDAA 3RTQC 4WHYG 3SQOL 5IMOA 3NIFF 1S5HB 4ZPVA 5CCKL 1T4KB 1EV2E 1QRNE 1WFUA 3HB3C 4F7PA 1N59B 3UJJH 5GGVY 5F71A 3TYGL 3QP3A 3OKLA 3ARYA 4LAJH 4DKFH 4XX1G 1YQVH 4LLMA 4L4VB 2EKSA 1RZJL 4LVOB 5LGJB 4XPBL 4ZSOB 4OIIH 1BVKA 3G5XA 4O00A 5D7LB 4LCUA 4B41A 4NYLB 5HHME 3KPRD 3FTGA 3TJHC 2GSGA 1GHFL 3QDJB 2W60B 4HC1H 1A7PH 4UBDC 5FKAB 3OKMB 1KN2L 4UZGA 4JFXA 1QBLL 3T2PA 3FOLA 4U31A 5DT1L 3LEYL 3U46B 1FVCB 1JPFB 2X10A 5IKCB 2CDEB 2DLTA 3KPMB 4ZTOL 1B2WH 3EUUA 3MRPB 5HYSA 1U8OA 3D2UA 4RA0C 3QUZA 1RZIB 2WSKA 1HI6B 5DJAB 2APWA 4GAYB 3LAFA 1MRFL 1FAKT 2AJUL 2YD6A 1VSCA 2AJZA 3IDJB 3IAQA 2PCPB 4O2CA 3UC0L 4PRBB 2EDEA 4KROB 5TE7H 5BOPA 3UTTE 3EJZD 5EDXA 3FT4B 1RPQA 2MQ3A 4NUJB 1EEZB 2R15A 3IFNL 1BQHA 4MA7H 5E1HB 2R2BA 1U8KB 5GSRB 3QEQA 2VLJB 1VPOL 1TMCB 5D5MB 2Y5TA 3ILPB 5LWYH 3NFPB 5EU4B 1Z5LA 1ZWIA 2V7HA 1Q0YL 2A77L 3WFBH 2GJZA 1OAYL 4NWTH 4ODVL 3O4LD 3VG0L 5JUEH 3IFLH 4EI5B 5FM5M 3SDXE 3GSXA 3PHQB 4YXHH 3P0YL 4IOIA 4F57H 5DA0B 4PJBB 1KCVH 2I07B 2VDLH 2QADC 1Q94A 2EIBA 3FKUS 3QAZB 3UTZB 1ROWA 4AIZB 3I9GL 5LQBL 3IU3A 2IQ9H 4L9LA 1EO8L 1FYTB 4RWYL 3INUH 4Y4FB 2XQYK 1QA9A 2A1WH 4YGVA 2DAVA 2GUOA 3PP3H 5SWZD 2GT9B 5KSUB 4MD0A 1IT9L 2A74A 1EA9C 4M7KL 3BPNB 2VZVA 4ELKA 3I6GA 1AGEA 3VXTB 1YPZF 3S96B 3WUWA 2BSSB 5C9KA 3ROLB 3FFCE 2AEIT 3GBLA 3V6OC 5FOBB 1HH9A 3O0RH 5F21B 5BOZG 1KG0A 2WWMD 3VFWB 3NCJH 2EEDA 3L7EB 1JPGA 2Q20A 4OGAD 3QXTA 9CGTA 3DGGB 4RGNE 4LLUB 1FVEA 5ANMA 4LASL 1ONQB 3C60B 2ORBL 3QISA 3GMLA 1X6LA 1WCQA 1FRGL 2A9ML 4TSAH 1KEGH 3LKRB 5ID0B 4Y4HD 4YHIA 1VENA 3PWJB 1BZ9A 2J8UE 2YUZA 5DO2C 3VW3H 3DMMB 3D0LA 4UQ2A 1V5JA 5DRNA 2JK5B 5HYSG 3CFDA 1F4XL 4LLWB 4JCMA 4XAWL 3VH8B 1ACYH 3MRLA 1MFDH 1IFHL 1CK0L 1YYLH 3HE6A 3OR7B 5C9JA 1BFVL 5KOMC 3UTPE 4JFFE 1DUYA 5CFHA 1DEEB 5DJ6B 2R2HA 1ZLSH 2GAZA 3O6KH 1SMOA 2B2XH 2OTUB 4LSUH 4OKVA 5IHUH 3WLWC 1BLNA 1INQB 2OL3L 2XFXA 1BQHG 3F7PC 4JPIA 5DZNA 1TZIA 5CEZH 2QR0A 1BIIB 4PBWD 4Y4KC 1NKOA 4V1DE 2YPVH 5EU6D 1F4HA 1PG7H 3T77A 1A1NA 1YEGH 3IYLW 5F7DB 1OW0C 3V4VL 2DLEA 3L5WA 5D1QC 4W4NA 4XWOC 4KTEH 3BESR 1MIMH 3GDBA 4HZLB 3KPLB 5GGVH 2PO6B 1S7RA 1YC7A 1URLA 2J6EA 1QLRB 3MYZA 1CXEA 4MJ5A 1EEUA 1R5WB 5EWIH 3OF6A 4LF3B 5E7FA 4RIRB 4OFDA 1Q9KB 4HIJB 4JFDE 1BJ8A 1NAMB 4NO0D 1OTSC 2QSTA 3BW9A 4NGHH 5I8KH 4R3SA 1U8QB 1IQDA 4PGBB 3CSYA 3QPXH 2HKFH 3H8NA 5CGMA 4ZAKB 4UT6L 1M7IB 4R26L 1R3LB 4FQ2L 5H37H 2XZAH 7CGTA 1F45A 5JDSB 3OQ3B 5C09B 3WUWG 3MJ8A 4YHMH 1S9YB 4NCC1 5DGRA 5C07B 4H88H 5C7XL 3W9EB 1RY7B 2BNRB 3F58H 5ID1B 1R6VA 2HVKB 1CFQA 1IBGH 4WJ5A 1UB6B 5L2KE 3UYOD 1FFPA 3D25A 4X6DF 5DDHB 1C16B 3VXSB 2VR4A 4DQOL 3PL6A 2HN7A 2IJ0C 1NLDL 4X80L 2R2EA 4OBSA 1WBZB 4EN3B 1UJ3C 1NFDF 2FECL 1MIEH 2P8LB 4DUWA 1TNMA 4U0RB 1CG9A 1BQLH 2LTQB 5CSBA 1BBJA 5JO5B 3VXPB 4QOKB 5E1AA 1JZ4A 3T0EB 4R7DA 1LO2L 2NY3C 4NZTH 2AJSH 4UT7L 4YDVA 5ESVB 5EOQH 2ITDB 4LQFL 2XICA 3MODH 3QDGE 43C9A 3QUXC 3PWPE 3S35X 4OFVA 3TA3C 5BVJA 3CFCH 1KELL 3TWCL 4OZGF 5D96C 4F8QA 4JO4L 5D93B 5FKPB 1LDPH 5FO9B 1RIUL 4NZRH 2CSPA 1FZJA 2X4OB 2B20A 1PKQE 4M02A 3MNVB 1VFMA 3SKOB 3GNMH 2QQNL 4X6CE 3ULUH 3W5NA 4HULB 2WWKT 4XCFL 1A6ZB 4MD5B 3UTTA 2C3HA 2V2TA 2HFGL 4HS6B 1MEXH 4OM1H 1XGPA 1KCVL 3C5SA 3G5ZB 1NBVH 4LSVL 3BO8A 1JMXA 5EA0H 2C1PB 2A6DB 3WXWH 5K9OA 1P9MC 2FX9H 4PS4L 1UM5H 1U36A 1HWGB 2WP3T 1FN4A 1QBAA 2YA2A 2VDMH 5D6DA 3M8OH 5JW4R 5FHAH 1G9NH 3RY6A 4FQXC 1UB5A 4HHAB 4PB0L 4L5FL 2IAMA 4JQVA 3QH3B 2AJ3A 1DANU 1KJVA 2CLVA 3PABA 2D31A 5DJZA 4KKAC 5DYOA 3WBDA 5I19H 1HYSC 1CF8H 5IBUG 1YY8B 4I18C 1FGNH 4WI7A 3EOAA 2EIZA 2VLKE 4P5TD 1FHGA 5DSCA 1G9EA 4ODTL 5TDNA 1UYWL 3HS0B 5JORB 4D8PA 1WLHA 4HX1A 1WCBB 3CXDL 1BOGB 4WHYH 3VXRD 1KB5H 1JJUA 3IRZA 5ALBH 1X7QB 3KYKL 2GSIB 4P46D 4P5MA 4PG2C 2YWZA 1IGCL 3EYFA 4EXPX 3BZ4A 1LILA 4LFHD 2P24A 3FB7B 3SHSA 3QSKB 3O9WA 3V5HA 1JPTH 3G6AA 1PYWB 2ZOLA 3C08H 2XNAA 5MEPB 2YD5A 1UGNA 3BD5A 1RIHH 3C5ZB 3FFCA 4MJ4A 1AJ7L 1FLRL 2Z93A 4MA1C 1B88A 5E94B 3RKDD 4YDJA 4EJ1C 3EYUH 4KVNL 2ZSWB 5FYKH 5MENE 4UB0L 2EDJA 3GMMA 4XXCA 3VFVB 2HTLD 3U0PA 1CVRA 4NM8H 4X98B 3Q6FB 3E3QE 3RZCC 2VUOA 5IWLC 4NQDB 1AE6H 2QHRH 1KULA 1RUKL 1P7QB 4Q9BA 2OR7A 4JN2B 3HNTH 4C54A 3IT8D 2PYFB 5DLML 5IHUL 1P7KA 5D1XD 5ITFB 1A47A 3QCVH 2EXYC 4MD4A 2J8UA 4HUMB 3ULUC 3LQAL 1UXWA 1ZEAH 3QRFM 1RZ8B 1DN0B 1L9NA 2YKLH 5JW3L 1R5IA 4YXKH 5T1MB 4ZXBB 3L9RA 4JQXA 4PJ9B 3VWKB 3G9AB 4JFFA 2CO6B 1BPVA 3MMEB 3X13B 1I8KB 2BCKA 5AD0A 5D72H 2ZJSL 3UZQA 1G9NC 5I1GL 5TDOB 4FQ1L 5DK0A 4PJGA 5HYJB 1R3IH 1DJSA 4IRSD 1BWMA 1R5VB 3KPRE 4V1DA 3DXAB 1HZHL 3TJEH 2R56H 4Z7WF 2OL3B 2O5ZH 2YSSA 5SWQA 1F3JB 2HT2C 4C4KT 1H5BA 4F33A 3NGBC 4OQTH 5HHPA 4YDKH 4E9LA 3DUHA 4W4OC 1PLGL 1F4WH 1V3LA 1Q9OB 2EECA 1S9VA 2UZYB 3ZE1E 3BP7B 5AZEH 3SCMB 4YXLH 3VRJB 4ORZC 3WHXA 1B4RA 4NIKB 4X7CC 1G6RL 3HPJB 5EIQA 1WEJH 4PJXE 4BFGA 4WDIB 1XGUB 1NGQH 3IDNB 4XC1L 4JFDA 3HC4H 5F1KC 1HEZA 1RUQL 5D2NE 4JFEB 1AHWB 3JUYA 1NFKA 2Z35B 4KK5D 3WKNA 3UPCA 3PGFL 1W8NA 4MAYC 1X9QA 1OAKH 4XMKL 3TGXA 3DV4A 2Y07H 4LCYB 5MEOB 3O6FD 4Z8FH 5I66B 2VKXA 5DJCA 1SVCP 1YN6B 4MNHA 3OR6A 4GW5A 1OARH 2GI7A 2DQEH 3O4LE 1NPUA 3D9AH 4WRLA 2FIKA 3QJHB 2BOCA 2FRGP 4HT1H 5F97E 4NZTL 2O26U 5DJ8A 3FO1A 5CSZA 4JN1H 2WNGA 3HRZB 1BAFL 1QP1A 5EPMA 2XQBH 5JLZB 5IVXB 4GOSA 4W70A 1W2KT 4KQ3H 1B90A 2YXFA 3LMJL 4Q9QL 1KPUA 4KRPB 5SWZE 1FL3B 2D7MA 2IFGA 5I2IB 1KENH 2FX8L 2NY1C 4K8RL 1ZE3C 1YEDA 4CN4A 4OM0H 1NCAL 3UAJC 4GKOA 5IHZB 5KW9H 4P23D 2IANE 4M1DH 3EIFA 5HGHA 4NC0B 5HHNA 4XNZB 2BDNH 2BNQA 3NFSL 3PWPA 2XTJD 4KJWC 4M7ZC 5FA3A 2VXUL 1F90H 3KPQA 5ALCH 1UACH 4F15C 2JELH 2VDOL 3QEGL 2NR6D 2IC2A 2YXMA 3VDCA 4ACPA 4NZDA 1MHEA 3GRWH 4OV6F 2FL5B 1S7TB 4HDIA 4JHAH 5JOFB 3QXUA 4BM7A 4D0DB 1PKQA 1ES0A 4KUZH 1MVUB 1DN2A 4X6CA 2DJ4A 4P3DB 4X4XB 4Y88A 3V2AR 4TVPD 3SBWC 1RUPL 4HWEL 3SY0A 2QHLA 4JFYB 5L8KB 2WINB 4U1SB 3MX0A 5BRZD 4P4RB 3HC0A 1MCSA 5I18L 2BSRA 3TN0B 4GBXA 3ULSB 4LBEB 1X4YA 2Y36H 1T21B 1P2CB 3IXTB 2IG2H 2OTWB 2EDLA 4N0FB 2X4UA 1C8PA 1JI2A 4GKNA 1F97A 1MCWW 3FFDA 3TIDA 4LRIA 1FNSH 3H6JA 4L1HA 3AS3A 4XVSH 5JDJA 3ECBB 4P9ML 3DV6B 2AXGB 5AYUL 1IARB 3RA7L 3JV0A 1VFBB 5EU6E 4CW1B 3WN5A 4ZTPH 1NBZB 4PJCE 4NO5B 1FC1A 3MLUH 1WTLA 4HKXB 1P5VA 3ULVL 4P4KC 3ZYOA 1D5ZA 3BPOB 1D9KB 2CLRA 4NM8L 4OZIB 2GFBB 2P8MB 4KHXH 4UU9B 3NPZB 2XWTB 3VGAC 4U1KA 2D0FA 3FQNB 3ABZA 2RJMA 2CDGB 4L4TE 3QUZC 3D1MC 4PREA 3KYNA 2IGFH 4KV5E 3EO9L 4UT9L 4D2NA 5BVPL 3KJ6L 3WKMH 3GI8H 3IKCB 3MV7E 1KIRB 2DQFA 4JY5H 3ZE0E 2EDNA 3QHZL 3WSQH 2HJFA 5ACZB 3D5OF 1YJDC 1EJOL 2X7LB 4RCAA 4YH6A 5DUBB 2W0FA 4OJFH 1BM3L 3E2HB 1GGCL 2QEJA 4I2XE 5CS7A 2DQGH 3E6FA 3BXNB 5L9DH 5CD3B 2Y06H 4DGIL 2H6PA 5GRUL 3QUMA 5CIPH 4P99A 1RU9L 4DEPC 1HCFX 3A6OA 1NCNA 3GSNL 3PWLA 2A6IA 4G8IB 1MJUH 2CRIA 2HWZL 3VGDA 1T1YA 3SKNA 5KAQF 4IIQC 3ES6A 4FNLH 3W9DB 4HUVB 1SMAA 3QZWA 3T8XB 4D0BB 4JG0H 2OJZH 4HUXA 5IQ7L 5J1SC 4HPYL 5C0NC 3ZL4L 1IAII 2DQCL 3STZA 4XP9L 3N06B 2BK8A 1KC5H 3VRLF 1KBGL 3R1GL 5GPRA 5HHXL 4KTYA 5EOCH 4L9LC 2J6EH 2Y5EA 4N9GB 5DMKB 1EMTL 3S3PA 3CU7A 3FQTA 5IG7A 3LH2L 1OP5H 2NX5B 2XRAH 4N0RA 4GRLB 4U6TA 4CVZB 4WTXA 5H8DA 5GRZA 5GXBB 2OJEA 5K59F 3PDOA 3MCLH 5DMYA 1SBSL 3C09B 3S36L 3V5DA 3RWCB 5DK3A 1F58H 2AJYL 1SM3H 1VFAA 4TUKL 5F70A 1WZKA 4RFEA 1MHPL 4M8QB 1JK8B 2PXYB 3LD8C 3OGCA 3LKNB 1U8MB 3VE0B 1J5OL 4JO1H 4WW1A 3SGEH 1RJZB 1QRKA 2CKBA 5T1KB 4EDWL 3D3VB 2BP3A 1TTUA 1B4JH 1H3TA 1RVFH 5I16A 1BX2B 1ZHKB 3BQUD 5D2NA 5F96L 1G6RB 4LPCA 5IW6B 2UZIL 3LN4B 2P5WD 2CMRH 3HC3L 2EE3A 2V5RA 1MCWM 5L8JB 4YR6B 1XCQA 2DQTH 4MA8L 1W0YT 3ORJA 5SV3A 3TBYB 4HEME 4W68A 1RZ7H 3HE6C 3O4LA 5F88A 3KXFB 4FXLA 1X5KA 1U8IA 4NC1C 3DO3A 1LP9B 1H8NA 3ZO0A 2XZCH 3X17A 2XPGB 3B9DA 1LK2A 3HZMB 1T6WA 3ZKMD 3WIFB 1T04B 4RX4D 5DI8B 3U0TA 3RWJB 2NTFA 5ISZD 4MX7B 4R90L 2ZNXA 3NFNB 3T0BA 4JPVL 5FM8A 3O8XB 4H8WL 4MQ7A 1SYVA 2VXQH 3VXRE 3JTSA 3ARGD 3ARDD 1CU4L 3P77A 5CP7B 4HCRH 1TVHB 5F9OL 4N9OB 3RWHB 3MREA 2EDFA 1IM9B 1G7HA 4G6FD 3QZWG 4FS0A 4QHMA 4MCZA 2FHFA 2IANA 4AEHH 5EUOE 3MLXH 5GGTL 3SPVA 2ZCKL 3EYOB 2ILLA 4WFGD 4AENB 1SVZA 2LVEA 3WNOA 4G43B 5I6XB 5BZWA 3BSZL 1CD9B 3EDEA 1HINL 1HNFA 1ORQB 2YEZB 3E8UL 1VA9A 3HMXA 4NNYA 1PGRB 3QUYC 2DIAA 4YIQA 1T83A 1OP3H 3IGAB 2JJSA 3GO1L 3GMPB 4F3FB 3IETB 3QRGH 3VXOB 3HZVB 5HVHC 4OLUH 4JFQA 1QFUL 3VFUA 4HV8A 5JA9A 2VABB 3MBEB 4DAGL 4HKZB 5DRZA 4CN6A 1Q72H 1C5BL 4RISH 3X3GH 2NY2C 1FSKC 3R06B 5ELIA 4AG4H 5L7XL 1CDCA 4IHOB 4NP4H 2F5AH 1NC2D 3HHRB 4J12A 3EOTH 2AXFB 3CZJA 4EKXA 3PL6C 5E6IA 1XH3A 2B4CL 5FHBH 5KOVC 2ICWJ 3IJHB 1TIUA 4KK9C 4HZAA 5TFSH 3OX8A 4HKJA 2A6JA 2DQHL 3DSFL 5D5MF 5A3ID 1XF5A 4CBPA 3WUZA 2BX5A 4U1JA 4TUJB 1EO7A 5F7EH 4GMSL 5AEAA 3V6FA 4Q0XL 5H35A 3DVGA 4XPTL 3PNWA 4POZC 1DQDH 2QQKH 3H9YA 5F7MC 3MACH 1N4XL 3WD5H 3D85A 4KKLD 5BV7L 2VE6B 4XBGA 3SGDH 1U8PA 4NKOB 3P2TA 3CPLA 2P7TA 1S7VB 4L4TA 3O2VL 4GLRH 2R29L 3EYSL 2FD6H 1U8NB 4M5YL 1EFXA 3MV7A 4QHLA 3VFGL 1D7FA 3ARFA 4BQBA 4PTUB 3P4MA 4I0KA 4JCLA 1Z9SA 3U79A 3K4DA 1I9IH 1AGDB 4NSKB 3QNYB 4X6DE 1HN1A 2HLFD 4UUJB 2HT3C 4H1LB 3HI5L 3BX7C 4HJGA 2D7TL 5CMAA 1S9XA 5SX5H 5I1KL 1DCLA 2R0KL 3F6IA 4AMKH 1HH6A 1I7TB 1Y18A 2MCPH 4PUBH 5D6DC 2P5EB 3RY6C 1KJ3H 1J05A 3MZTA 4HG4J 4X4YA 5C0DB 2R0ZL 4D9RD 5T33L 1MJJA 1SYSA 1C12B 2ZUTA 4JQVC 3CDFA 3U36A 2ZSVA 1ZT4B 5FB8A 2PYEB 2FNBA 2VIRA 4Q6IB 4I9WD 3BWAB 4HF5H 4OLYH 3ZSTA 1EDQA 1IC7L 1U3JA 5I1DB 3K80A 3SE9L 2X4TB 1UWXH 1KV3A 2Z8SA 2A0LC 4F9PA 1OSPH 4HWBL 1UEMA 5DVKA 3O2DH 1JZ6A 1DBML 1TJGL 3S3JA 4F80A 3MA9H 4LKXA 1BVLB 1UQSB 3EYQC 1G0YR 5EBWA 4K71C 3JV4A 4LCWA 4NT6B 3GMQA 3HZYA 3MLTA 1ZK9A 1JGEB 1G0XA 3DIFA 1LE5A 3IJYA 5I71B 5EULV 4MXQD 1VGEH 3L3HB 5GRJH 2HA1A 3IDIA 1A4JB 2LQRA 3LSOB 5IFJA 4X8JB 1AI1L 3AY4A 1CFTB 5IHBA 3QPQD 3SDCD 1EEQA 4Y2DA 3ZHKA 1A5FL 4P2OA 4RGNC 4PJAE 1DFBL 1OQOA 4FQCL 2FBJH 2VLMD 4ZD3L 5DRWA 3V0VB 4JZJA 3IVKB 4WW2B 1A7BA 3BPLC 3FOMA 3P0GB 5EOTB 4OCYH 1C5DA 3QXDB 1PKOA 1RULH 4LK4A 1J18A 2ADJA 3MBXH 1A1MA 1AD0A 5J4MA 4AL8H 1M6OB 4HJJH 1S7XA 4I3SL 1RK1A 1H3VA 5EUKB 2I26N 4N0YL 2XZZA 4JREC 4JQXC 3GUTA 1K5NB 3ESUF 2N7BA 4Z7VA 4Y1AB 5IEKA 4YHLH 3HMWH 5DJYB 4JO2H 5JNYB 2AGJL 4U7MA 5CUSL 1FG9C 3U1SL 4IMLA 3C6LD 5DC0A 3GK8H 2IBZX 2X9WA 4QTHA 1ED3B 2Q6WB 5DS8A 4GAJL 5E5MB 2E27L 3K8MA 2BHYA 4L4VD 4Y2OA 1BZ7A 1OD9A 6FABH 1RMFL 4YQXL 1CE1H 1G7MB 4ZUWB 4GS7C 1H15A 1YUHA 3C8HA 5D7LD 1FAIH 5GZOC 2H8PB 1TPXB 4E42A 4DFHA 3S4SA 2DICA 3IDXH 5JQHC 4PJ7E 5EUOA 1OWWA 5GGRA 2VDRH 3WFDL 1HDMA 1LK3H 3V8CA 3MRHB 3RAJH 4PJ5D 1KNOB 1LE9B 2J1KA 1T2QH 3WE6B 1MPAL 2JCCB 4N0UB 4GAGH 4N5ED 4P2RA 5F9JA 2WBJB 2PUQT 4PJ8B 3TV3L 3EOTL 5FGBA 4KROD 1Z3GH 1K8DB 4KAQL 3FO9A 2PW1A 4GKSA 5D1XA 1BREA 5D7JD 3G6JE 1UM4L 3A6CH 3MLZH 5I1JL 4GXVH 1C1EH 1E27A 4U0QB 5HVGB 5DUML 2DWDB 5DHYA 2VLJD 4KXZI 3T0DA 5EH1A 1CDYA 1DSFH 5CEYA 3OXRA 15C8H 4U6YB 4JJ5A 5E5UB 4FFYH 4U3XA 4BQCA 2VH5H 1H3UA 5BZDB 4Z7WE 1K2DA 4XPAL 5KG9A 1OD7A 4EI5D 43CAB 4V2BA 3L5XL 1N6QL 3W81A 4XBPB 4XNYH 2QQQA 4YUEL 4P3CL 1U2CA 3OGOE 4D3CH 1MRCL 4G6AC 2Y25A 3GJEA 1ZANL 5DF0A 3NN8B 4P2CG 3CFEB 2BSTA 2AEWA 5AAWA 1FYTD 4GSDH 4G8EB 4Y4FD 1KACB 1RIVL 3O41A 4YPGB 4GG8A 4S1RL 3B83A 4N8VG 2MPAH 5MI0C 4NQXB 4OFIA 2ZCLH 4P59H 3SOBL 1I7UA 4UINH 3MA7B 4ONFL 4DN3L 5FO7A 4NKMA 3U7WL 1C5CH 1RZGB 5TE4L 2D4FA 3CDGB 2C1OA 3HUJB 3S97C 3F12B 2NY0B 2AEPH 2DLIA 2NY7H 3SO3B 1FNEB 3KLHD 3VXNA 1JHTB 1MRDL 1NBYB 1PZUB 3RGVB 5DD6A 4D0CB 2P5WE 4OB5L 5JQ6H 3UTOA 3OKKB 1ZT1A 4HMDA 5IT2H 5HHVH 3DX9B 4KTDL 1ZT7A 3C60D 3O6FA 1EUUA 4LFHG 4UNTA 3MV01 3S4SG 4DN4H 4K3GA 1ZMYA 2JJTA 1KJMA 4GBXC 1INEL 1TZHA 2NLJA 4IRJA 1KTKE 1MHCA 4QRRB 25C8H 4GUPB 1MQKL 3ARZA 4Y5XA 3VI3E 3DMMD 1XGQA 3V4PH 1AKJB 1MCJA 4LIQH 3WJJA 3KPNA 3O11B 5TJWK 3QT2A 3MRIA 1MCPL 1TVBB 3UPAA 3GZKA 3MRJA 3ARWA 2IMNA 4J7RA 4LRIC 3ZZ1A 1EGJL 2R2CA 4KPHH 5L88L 4OCNC 3SE8L 3FT2A 4K3HA 1KLGA 4HMEA 3ZE2F 3QI9C 5F3HA 2AI0H 2ZNWA 4HPOL 5TQ0L 1MF2L 3MRGB 5LCVH 3WN5C 5FYKU 3ZTNL 4FQPA 5EORH 1TTGA 2VRAA 5F89B 4ALAH 4WUUA 5GRYA 5DEFB 3MJGX 4KK6C 4NJAL 4YDIH 4J2XA 5D71H 4ZUSA 3QXAB 1XGTB 4YHYB 4Q6YA 4U6XB 2P8PA 3WXVH 1ZOXA 3JWOH 4I3RL 5C0GA 4ERSL 1D5IH 2PO6D 3VFSA 1LHZA 3VWJA 5JPNB 5FCUH 5IMKA 3T4YB 1YZZA 5E6YA 4X9IA 2XKNB 4Q9RH 5HDBE 4M1CD 3IXAB 2HH0H 4NN6B 5CHNA 4WI3A 3F7RA 2HFTA 3M17A 2XYCA 4PJAA 3BIKA 4U49A 2YR3A 3DLQR 3E3QC 3O3DA 2Y6SC 1J8HB 5DJ0A 1AGFA 1EERB 4JO2L 2X4RA 4JGUA 5HI3D 4U1HB 5GSVB 3ZSSA 3JUZA 2Y4SA 2BC4B 1A6AB 5A2IH 2HRPL 4ZAKD 5T3XE 4OZ4B 3QFJD 32C2B 5EU5A 2HLAA 3OWEA 2VXTH 3TBSB 4N0CD 1I7ZB 5IJKC 3UYRL 5D7IE 1T2XA 1VCAA 5C07D 4XZUB 4DJMA 1JRHL 5D8JL 3LS4L 3DUUB 2BNRD 3D69B 3DWTA 4LVHB 1WBYA 4PGJA 1PZ5A 1R0AL 4IEFB 1PDKA 4ZPTA 3H42L 4IBLT 5F1NB 4LSRH 3RDTA 1ADQH 1ZVHA 2IPTH 4OD2A 1R3JB 4HWZB 1OLLA 1FZMA 4EN3D 1S78D 3J8F7 4KMTH 1JFQL 4PRNB 1OTUC 2J3SA 1WT5A 5DD0H 2A9NL 5ICXA 1BFOB 3QHFL 3QDMB 4CU7A 4QOKD 1OGTB 3OPZL 1BF2A 3SKMB 5ILTH 1N0XH 1FV1B 4YHKH 3T0ED 4JPWH 3FZUD 3WJLA 2EDBA 4NQCB 4NM4L 1H3PL 4DFIA 5I74B 5IVXF 4OLEA 4PJ7A 1C08A 4LNRB 5J06A 4UOW1 3QNXB 4W6WB 5D7KD 4FN0A 3QJFA 1VACA 4L3EA 5EFIA 4WHTB 2Y9RT 3DETD 4HG4K 4ELME 4YEFA 3EJZC 2EE9A 5IB5B 1OAUL 5D2NC 2Y7QB 4YLQT 3C8KB 3G6DH 2L4OA 4XC3L 3PWNA 3Q0HA 1UCBL 4YHOH 3BZEA 3S36X 5HHOA 3JWDC 3EGSA 4W6XB 2H2SC 2DKUA 5FM5O 2R4SH 4XMPL 3CLFH 3G6JA 3MCG1 3VRLE 3DI3B 1TETH 5L0QC 4D9RE 1T3FB 4XP6H 2H1PH 1RK0A 4FQHA 1L6ZA 4IDJL 4WNQA 1PY9A 5E56A 4PY7A 3TT1H 1VKXB 2GIYA 2HKHL 4I9WE 4Z7QE 1I7RB 3OKOA 5AWNH 5IV2B 4LSPH 5K59E 4ESKA 3ZYJA 4XGZB 3VFRB 4LSQH 5MERA 4XPFL 3L3GB 5J3HC 1H8SA 2CJUL 1JCKA 1KIQB 4Z0BL 4HKBB 2JJWA 4XNMB 3A6BH 4GW4A 2DTML 3ILQD 1L9MA 2APFA 5KSBE 1EHNA 4JFHD 4QXTA 4MXWL 5KN5B 3VU2A 5B3JF 1RURL 5JQ6L 2O5XL 5DXWA 2APBA 1H9VA 5AZ2H 5GGUB 4FABL 1U3ZA 5T1LB 1J0HA 3O6LL 3ZKQD 1LD9B 4PRPB 1L7IL