1PKQE

Myelin oligodendrocyte glycoprotein-(8-18c5) fab-complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
121
structure length
121
Chain Sequence
GSGQFRVIGPGHPIRALVGDEAELPCRISPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDAEQAPEYRGRTELLKESIGEGKVALRIQNVRFSDEGGYTCFFRDHSYQEEAAVELKVEDPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the antigenicity of myelin oligodendrocyte glycoprotein
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords (8-18C5) chimeric Fab, light chain
total genus 25
structure length 121
sequence length 121
chains with identical sequence J
ec nomenclature
pdb deposition date 2003-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1pkqE00
3PWPA 1OAUL 1PDKA 2X4TA 3VI4F 3TLRA 1JWMA 1FFPA 3MV8A 3G6JA 2DQIL 3QI9D 4HH9A 2VXSL 2O5ZH 3LEXB 2CXGA 4UOW1 2VQTA 1HSBB 4NO0D 2E5EA 1T21A 2VC2H 1MIML 1YYLH 4NZDA 5DRNB 5GGRA 2C3GA 4E5XA 2F54E 3EW3B 2PKDA 3MOAH 1XGUA 2X4SA 4LLDA 4LEXH 5FXCH 1JPSH 4S1QH 5J3HC 1DVFA 3WUWA 4DEPB 3PV6B 2NXYD 4P5KA 1MI5D 1TITA 3RHWF 5F88A 4EEEA 1PG7X 2V5MA 4X8XA 4JFFD 5GJSH 1U8JB 3QPXH 1TVDA 3M17A 1M05A 5E99H 2O26U 1G0DA 3CU1A 2GIYA 3PV6A 1KC5L 3LB6C 4ZPTB 1BM3H 1TNNA 2XN9A 1DEEB 3FB8A 4ONFH 2G9HA 3STZB 1QFHA 1UENA 3MODL 1TJHH 3VFWA 4LSVH 5HYSB 1NAKH 1F42A 3MYJA 3V5HB 4GUPB 3ZE0F 3DV6A 4L8CA 1YMMD 5FOJA 15C8L 3KG5A 1NAMB 5LBSL 1MLBA 4U3HA 1IM3B 3WHXB 3QWQB 5C0RH 4K7PX 1ZLWH 2P49B 4GAFB 1EV2E 3K3QA 4FHBD 4U49A 5IBUG 4NZTH 3C2AH 3TJEL 3B9DA 4FOMA 4J6RH 1QACA 2NY1C 5HI4C 1AQDB 3MRPB 5GGQH 1N6VA 3QRFM 5F8QC 3VFGL 2AEQH 1C1EL 3VFUA 4ONOA 4QRPE 1RY7B 1IM3A 4UI2A 3WHXA 4LL9A 5MERA 2F54D 1BMGA 2YRPA 2DYPB 4N0CC 2HVKB 4XZUB 4DW2H 5BRZD 4W68A 1Q9WB 2JJUA 4YEEA 1DBJH 5E1AA 1RZGB 1MSPA 3FKUS 4K3EH 1JIBA 2PXYC 4N5UA 4FQQB 3WO3B 1C12A 1SEQH 3OPZH 3VXSA 4XRCB 2WIMA 2X4TB 2AQ1A 4NDMA 1BFSA 4HC1A 5T3ZE 1QD0A 3P4OA 3T0AA 2JJTC 2EYRB 1CIUA 1P2CA 5C8JA 1OTUD 5I16A 3EDFA 5HYFA 1BX2B 5I6XB 3CX2A 3HE7D 1IC4H 3TO4A 2ZKHH 3MJ8A 1DANT 2P1YA 3HZVB 4Y4KD 3SJVE 4YHPB 3T3PE 1EEYA 5BS0A 2EXYC 5GGUA 4EN3D 1MCHA 3CUPB 1FYTA 3BHBB 3QDME 5DS8B 5IMOB 4OKVB 4K9EL 4LSTH 2RBLA 1LNUA 3BP7A 1VFMA 2K1MA 4WEBL 4LU5H 32C2B 4M7JH 3RTQC 5D7JD 1I9RH 1AGEA 4K94C 2V5TA 3H7BA 3TNMB 1JYWA 2DM4A 4P4KC 1BZ9A 1F00I 3FT3A 5JOPD 2D9QB 1MAML 2EDKA 5FYKU 4OI7A 4H1LH 3MRFB 1TQCC 4ORZC 1ZT4B 3L3KB 2H41A 1U58A 4M1DH 1XF3B 3QEQE 1V3JA 4Y2DA 4PREA 1GC1H 2VITA 4UOW0 4EKXA 4ZUVA 1IM9B 1EDQA 4NKIL 4BSJA 3KYNA 3Q6FA 2Q76A 3HKFA 4DUWA 1YEFH 5DGRA 3BJ91 1UQSB 4EI5D 3CZFA 3L3DA 4PGZA 3C5JB 4Q6YA 3WXWL 5C9JA 1ROWA 1L9MA 3U30B 4QY8B 4F57L 4KI5F 2H9GA 3IJSB 2J5LB 2PTTB 3EKCA 2EH7L 1WJ3A 3BRFA 3OKNA 4H5SA 2E6JA 2EIZA 5DWUL 3MREB 3O6FD 3PWUB 4PGEA 1Q0XL 4QHNA 4P3CL 3MLSH 3VXRA 2HKFH 3GMPB 2X40A 1OF2A 5DHYB 2Q8AL 1IBGH 4XP5L 3OZ9L 5K9OB 1X5XA 3GMMB 4WEBH 4WENB 1T3FA 3V6OC 4D9LH 5F44A 4PRID 3SKNB 2ZUVA 4M6NH 4ZTOL 2FH6A 4ONGH 1UJ3B 3TV3H 5HHPA 5IB5B 3RL2A 1UZ8B 3HNSH 1OTTD 4HPOH 1X5IA 4G6KL 4MCZB 1RUMH 2VXVL 2FJFB 2ZCHL 3GSVB 5HYSG 4LBEB 1NGZB 3MBXH 4LCCB 3OB8A 1NCAH 5E24E 3ARPA 5JUEL 2D0GA 2P5WA 5E94A 1I3VA 3HI5H 2JB5H 3U0WL 1C16A 5GSVB 1GL4B 5IFAH 4KHXH 5J13B 4KI5D 2C1PA 3MLWH 4RMTA 4XC3H 1S9XB 3UTTA 1B0RB 1FVEA 3TJHD 3DJ9A 4P2QA 1VEOA 2X4OB 1JHTA 3BHBA 1BBJB 4MLSA 1XGYL 4BSVA 2ORBL 3IETA 2HJFA 1LWRA 3CC5B 4GRMB 4PJHA 5B39A 4PR5B 4DW2L 5GSVA 4LGSB 3VG0H 4MNQE 3FB6B 2F74B 2OQJB 3UTTB 2J8UB 1Q0YH 2E3VA 1I3UA 3QQ9D 3D39A 3K80A 4L1HA 5E8DH 4YK4B 4FQ1H 5CJBA 4YHLH 3WLWD 5EIIA 5EU4A 3RWIB 5TGBA 3MRDB 5CILL 3GGWA 1A5FL 1INDH 1JNHA 4LSPL 3BE1L 4YHKL 1KGCD 3P3YA 4WTWA 5AYUH 4BQBA 5ISZE 5F1IB 3LKNA 1PBYA 2H26B 3P4LA 4YX2H 4KKCC 3M8OL 4L8BB 1E4JA 4YFDB 3WFBH 3R1GL 3F8UB 2ADIA 3KPLA 4LVHB 3JBG7 4NQSB 5INCA 3CZFB 5CMAB 2C3XA 2L7JA 5KSAA 3QUXC 3RHWK 3VXRE 4TSCH 3I6KA 4Z7VE 4MVBC 4GFTB 3IDYB 5I2IA 5E99L 5JDSB 2OTUB 1A02N 5DVMA 2VTFA 1YJDL 2HLFC 2VB5A 4BFEA 3DV4A 3LB6D 3V4VL 3BP5B 4NUJB 1ZHBA 4N5ED 1NLBL 1CFQA 2Z4QA 3LKRA 1RI8A 4JFYB 3MJ7B 4Q58C 2XQBH 3QIBD 1PJ9A 2R69L 5HHMB 4UDUA 1A6UL 5DJ8B 8FABB 3RWGA 1F4AA 1U8LB 2LTQC 3EYQC 1RAMA 1DE4A 2EO1A 4WW2C 1NGZA 1I1AA 1I7TA 1PLGH 2WBJC 3ARRA 4NJAL 4XP4H 4Q6IA 5IVZA 5LXGH 3MJ9A 2PYFA 4RMUA 4UT6H 1BOYA 4KC3B 4XCFL 1MFEL 4IOFD 1QNZH 2IAMB 2BNQD 1FG2B 4NKQB 5GGTA 4LOUC 5D7JB 1U8PB 1NSNL 1I1AB 5F9JB 3D85D 4H26B 1KLFA 4PJ9A 4UT7L 3LOWA 1KB5L 1J8HD 1YEDA 2WBWB 4E42B 1T1WA 4AEIL 5AWNH 1FG2A 4LCUB 4G8FB 3TO2B 2R2HB 4HQQH 1WAAA 3RUGA 4HXAH 2EDEA 2Y5EA 5FGRA 1MQKL 3C6SB 4PTUA 1NBZA 4KK6D 3ULVC 3VXSD 3PGFL 3OF6D 3VXNA 5IOPA 4DFIA 2UY7A 1N6UA 1BQSA 3CFDA 4NRZA 3SKUD 4BQ6A 3CLFL 4K7FB 3D0VA 4S1SH 5CP7B 4LSTL 1RVFL 1FO0H 4X7TB 4RMSA 4L4TD 5DQDL 3DURB 3HLAB 4HPOL 3HNSL 2CIKA 4LPTA 2DL9A 4M6NL 1X6LA 4ZTOH 1JN6B 3SE3A 4PJIA 1EIBA 2VYRE 2CUIA 1UM4H 3WIHA 2DOCA 4XAWL 5IOPB 4MDIB 5CEXA 1P7HL 3QFDB 1WLHA 3L5WB 2NNAB 2AJ3B 2R8SH 3MRCA 4J3TA 3LV3B 3PWVA 4O5LL 4GXUN 4UTBL 5MP6L 3MJ9H 5BOPA 2XKUA 4CVWA 3TCLA 3IDUA 3FONA 1CXFA 1ZAGA 2HG5B 1SEQL 3TH3T 3MCKB 2D4FA 3EDJA 5DJXB 4F57H 1S9KC 3LRSB 3QAZB 4EDWL 2FLBT 1B4JL 2R0WH 4BH7A 1DBAH 3SQOL 2EDWA 3H2WA 1JZ4A 2XY2A 1V7MH 3LIZL 1JGDB 4NCC2 3X17A 4E9LA 3VWJA 4FXKA 4X4XB 4F33A 4WUKH 2P5WE 4E0RB 5F7NC 4JKMA 5FGCB 4YWGL 1G9NH 5TPWL 3S4SA 5T3ZL 2OR7A 5C1MB 4U6VH 5LG1A 3UJIH 1T1ZA 4NN7C 3QIWD 5JHLH 1RPQA 2GSIA 5I8OH 1Q38A 3NCBB 4U31A 1K2DA 2B4CH 4U0QB 3WFDL 2Y25A 4G8GA 2NXZC 4NM4H 4KJQD 3SDXA 2CK0L 3DECA 3EO0B 4M48H 5F96L 5TDOB 4WWKA 5CGMA 1IGJA 1KJMA 4WV1B 2FB4H 4ZAKD 3F62A 4ZUTB 1CG9B 2XN9D 2VIRA 4L3EB 1AY1L 3IXAB 4WI4A 2X5PA 4ENED 4U7MA 3QG7H 3H9HB 4U1NA 2CDEA 5JW4M 1G7QA 1DLFH 4K9EH 5DJDB 1F3RB 2QHRL 1D5ZB 5H94B 2BOBA 1YDPB 4LCUA 4YHOH 4ZOAA 4J4PD 1A3RH 1SJHA 4MQSB 4N8PA 1X3DA 2J8HA 2GSGB 3HI1B 1MI5E 4FFYL 2OK0H 1CDBA 1WVZA 3KXFE 1G6VK 4IRJC 1DUYB 4OSUL 4JQVC 4PRIE 1RZFH 3CH1B 5D2NE 1R5VB 3RAJH 3RDTA 4DK6A 3DMMD 1UCTA 1MUJA 4DQOH 5ENWA 5IJVB 5C3TA 1FORL 3LKOA 3SCMD 4XNQB 2H2PC 1G6RA 2LE9A 2V7NA 5I15L 4J3VA 1IGFH 3S37H 2J4WH 5KJRH 4AM0B 3KYKL 4YE4H 3UC0L 4Z7WB 3LDBC 2DI8A 5CHNB 4EXPX 4K94H 3I02B 4DZBA 4ODHH 1YPZA 2DQJH 3TBVA 2FD6L 1DN0A 1IAOA 3PXHA 4UINL 4APQB 1RZ8A 2R0KH 5I76B 4ZS6C 1A6PA 1NL0L 4ZFFA 4XCCL 1KTLB 3FRPG 4XPGL 1NEZA 2HT4D 2P5EA 1F4YH 3DX9A 1IQDA 4UNUA 4CKVX 4LF3A 1Z5LB 3RBGA 1S7TA 4PJ8C 2CMRL 1HXMB 2IAMC 4F3FB 5DLML 1KN2H 4KQ3L 1EO8H 4NQEB 2IH1B 3BMVA 4ERSH 3LEXA 1K6QH 4IHOB 1D5IL 4FTVD 3O3AA 2EDYA 1YEEH 2R0WL 2AJZB 4PG2C 4PJ8A 2NY1B 4V1DD 3NCCB 3AFLA 4HKBA 4M6OH 1C08A 4TUKH 4AEHL 3EYUH 1NGWB 5FOBA 3P4OB 3EO0A 5JQ6H 3PL6A 3MPCA 1J8HB 1IAIM 2IH1A 1YMHA 1QVOB 3MRRB 4R0LC 3V8CA 2F5AL 5FYLH 3UJIL 2DDQH 1N0XH 3GKZA 4DKFH 4CDGC 2NR6D 2FGZA 4HIEA 5E2VL 1ZV5A 4HXBH 4PJ8B 4KHTH 1G9MC 1MPAL 1J1XL 2EE3A 5DS8A 5DT1L 1P4BL 3O81A 2W0PA 4Y2DC 3VRIB 2VABA 1LNUB 3P0VH 5H94A 4ZOCA 4ZXBA 1OQOA 3ELAT 4LAJH 3RIFK 4QGYA 4L3EE 3U48A 5DRNA 4EJ1C 5FGCE 4WUUE 1UB6A 1UG9A 2ZUQB 1HHGB 5SWSE 2DMKA 4QHLA 2IGFH 4LHUG 5D2NC 1WV7T 1RUKL 1LDSA 2VZ3A 4NZRL 5EOCL 1D9KD 2RCSL 2DLEA 5H37H 1UM4L 5TDNB 1ACYL 2PO6C 4PREB 3HB3C 5AWNL 2CJUH 3DX8B 1VEMA 4HUKB 2Q8BH 2ICWI 4JREC 1RJLA 1KB5H 3KYNB 3IU4L 5DQJB 1MHPH 4WHTB 1QBLL 1QLEL 4GMSH 5E8EB 1OL0A 4BJLA 5ITBL 2VLKD 4DTGH 1P6FA 2H3NB 5JIIA 4H5SB 4XGZA 4DVBB 4HFUH 1CVRA 3OF6A 4NJAH 1FYTD 4UAOC 5EU5B 3T0EC 2R0ZL 4YXLL 3ZHKA 4XMLL 1E6OH 1JK8A 2A83B 3GMNA 4P46C 35C8L 2W91A 2VR5A 3UTSE 4OFPA 4P0DA 1TETH 2L4OA 4JZNB 3SKOB 2XG4A 3HPLB 3CZJA 3KPRE 5I16B 4OLWH 4EBQH 4A6YB 1KLUB 4F2MB 3B6SA 3FMGH 3ZZ1A 4PJDA 1J0JA 1P4LA 3ZKMC 1NBYB 5FKAA 3S88L 3QJFB 1LVEA 3NH7H 1BAFL 4ZFGH 2NY4B 4XPAL 4FQXC 4UV4L 1M71B 2DQTH 1WEJL 4GKNB 4O4YL 3V8OA 4LCCA 1C08B 1LO0L 4RISH 4JKPL 1O5DT 4X7SL 5IMOA 1S9WB 3P11H 4ZPVB 4XP9H 4I3SL 5ALCH 5EORL 3BQUB 4PJDB 1KENL 3INUL 2EYTA 1GPOL 1YN7B 2XT1B 3KJ6L 4YIQB 5EBLA 3I3DA 2QLVB 1A6WL 4QHMB 1OAQH 2YSSA 1HHHB 2YKLH 3ULVE 2HJLB 3VRIA 3S5LG 1CR9H 2QHLA 5CS7A 5E1HB 5ETUB 2BC4B 3ULUH 4XHQA 1NFDF 3TWCL 4Z95H 4J1UA 4AYFA 2EYTB 2XTJD 5CD5D 3MRFA 1MRFL 5FDYA 1R24B 3B8YA 3FQRA 1DQQB 7FABL 4WNQA 3FT4A 5EB9A 1JRHH 1S78C 4Z9KB 3BP7B 2NW3A 2NY7H 2NX5E 2VERN 5DRZA 5C0AE 4F7EA 2GTWA 3EOBA 1NC4B 3H9YA 1T20B 4TPRH 4JQXC 1KT2B 1QLRA 1UEYA 5E00B 5MENB 1JWSA 2YS4A 1X9QA 4NM8H 1AGDB 5F89B 1CBVH 5HHME 3TYFA 4ZOEA 1NCBL 3QG6B 2XWTB 3MOBH 2HH0H 2UZYB 3BZFA 4PIRF 1NC4A 1KPVA 4HMCA 4NO3B 5KSAB 1CFNA 1U95B 4ODSH 1ZVYA 4ZUVB 1I9EA 4JFFE 4YO0A 4PJDE 4YPGB 5FA4B 5IGXH 3WCYA 4R6UA 3E2HB 4PJXB 1IJ9A 4XNYH 5D9SA 4CL7A 4APQC 4HMEA 1C5CH 2X6MA 3RL2B 1JNLH 1X5GA 4XMKH 3IU4H 4ZUWA 1RUML 2VXVH 2ILLA 2PXYA 4PS4L 2F9BT 4OJFL 4JJ5B 1WBYB 3QDJB 1KPUA 2HT3C 1ITBB 1JGEA 3NCYP 4QYOA 3VGEA 2RGSA 1ND0A 2YD1A 1ZLSH 3QA3B 2HLAB 5KZCB 1IBGL 4XP5H 1HHJB 2BXYA 2Y1VA 5SWQB 2VAAB 1Y0LA 2O5XH 4PBVC 2X9XA 4CU7A 1Q0XH 1LP9F 2DM3A 3VRJA 5E2UH 1TVHB 3P4NB 1K4DA 3WS3B 4KTEH 4MAUL 1UZ6E 5DUBB 3P11L 5B8CB 2HT4C 4LKCB 1N59A 5FUZH 5HHPB 2BY2A 4FXGA 4OFVA 4HBCL 1ZLVK 3CDFA 1Y0LB 4V1DB 1CD1B 3H6JA 1GGCH 3RWJB 4ZODA 1A6TA 5DO2C 1G7HB 4LASL 1FZJA 1T89A 5AZEL 1QTYT 4L4JA 43C9A 1SMAA 1HH6B 3O0RH 4RGNE 3KPRD 1HQ4B 2ARJQ 3EOAB 5C70A 4DKFL 5J12B 2DN7A 2H6PB 5J12C 5KVGL 1A14L 4P99A 3TO2A 3VCLA 1MCCA 2AQ2A 3RNQB 4GS7B 3RWJA 4R4BA 1S7XA 2DLTA 4JN2A 1FP5A 2CKBB 3GMRB 1QHPA 1E6OL 3MRLA 2IPTL 2AKRA 3KYMB 3VJ6B 5A40E 3NVQA 2HJFB 3IETB 2F5BH 1HOCB 4LGPB 4MJ5B 3BRDA 3Q6GL 2VLJE 3WN5C 2ZPKL 1R5WA 1VKXA 4P48A 4AEEA 3RNQA 4KRNA 4M7JL 3QPQC 1TZHB 2JCCE 2P8MB 1RIVH 1F3DH 3MRHB 1MHPL 3P4MA 1CL7I 1N4XL 5I1DB 3T2NL 5JDSA 3BOVA 4JDTH 3O2DA 1MJ8L 4MDIA 2XWTA 2VDQL 5T1KA 4D3CL 1HEZB 3M1BA 4WY7L 2AJ3A 2Z91A 1KPVB 1AO7E 1NGXA 3HZMA 4OUUB 3RP1A 1YNTA 2NXYC 5EU7E 3Q48A 2ZKHL 2E7MA 3EIFA 4XCCH 4OKDA 5CGYD 1DFBL 5IR1A 1BJ1J 1CFSA 1QBMH 2IBZY 5JNYB 4MXQD 1LO4H 3BDYL 3Q5YA 4M8QB 4JDVB 1FDLH 1NGXB 3HZMB 2DMCA 2CGRH 3GSUB 3T8XB 4OTXL 4UBDC 3GSRA 4H0GA 5C3LD 5K9KB 4GBXB 3CFEA 4PJAE 4FABH 3B9KA 3KDMA 3FOLB 3D2UD 2FECI 3S4SB 4B7IA 2AV7A 4OLYL 2VLLB 2XY1A 5AD0B 1EERB 3LEYL 4M8QA 1BVLB 3IS1X 5DUML 5CJQL 5EFIA 1D5MA 1X5YA 1MHCA 3DO3A 4OZHA 1IKNC 3QAZC 2XACC 5D5MB 3B9KC 5LVEA 4MLIA 4B53A 2V5SA 5IHZB 2X4NA 3L7EA 4K2UH 2NY1D 5HI4D 4MJ2A 3TVMD 2Q86B 3BGFC 4ZFOB 2MCG1 3E3QC 1G7HA 3ISWA 4WI8A 5FYJH 2ICEA 4MB5A 2W92A 4NQVA 2QBWA 4XAKE 4Q6IB 5IVZB 5JORB 3QEUB 4LCYB 3ZSTA 3BKYH 5SX5H 1KCSL 4N9GB 4K7FA 3EYOA 4GQ9H 3GSNB 1G9NC 2BHYA 4MXVF 2A74A 4BQ9A 3GMLB 2GK0A 3EYVB 1M7XA 1A6ZB 4IOSD 4NFDA 4GQPH 3AY4A 1XGRA 3O3BB 1MJJB 7FABH 1BEYH 2YPVH 1JN6A 3JV6A 3L9RA 1YNLH 1CXEA 4XPGH 3WLBB 1Q9KB 3EFDH 3JSSA 3N06B 4Z6AT 3FCTB 1F4XH 3MV8D 5IUSA 2V2TB 3B9EA 1DBBH 3N9GH 3CDGA 4CVXA 2EKJA 4Y4KC 2GJ6E 3FO0L 4ODWA 1JMZA 5JA8B 3VXMA 1Z3GL 5ELIA 2VDKL 3BH8B 1GVIA 2VDPL 3RKPA 1HEZA 4AIOA 4TTGA 4XP9L 3SOBH 1CU4L 3DRQB 4AIZA 5E08L 2W60A 1AKJA 3TBVB 4N1CA 1GOHA 4ORGA 4KK9D 1T4KA 3SGKA 1AO7B 1UC6A 1HHIA 3WFEL 4XPAH 5HPMA 1EJOL 4Y4FC 3LRGA 4MA7H 3VXMB 4F37K 3ZE2E 4UMGA 5DJ6B 3RWFA 2I5YH 3S97C 4TVSa 2WK2A 4PGDB 1CICC 4HV8A 1JNNH 1CDJA 3UZEA 4MJID 4PGBA 3GB7A 3JTSA 5F6IC 2Z35B 5HPMB 3JWDH 3BZEA 2ICCA 5EZLA 4QF1B 5D7SL 5D7KE 1MF2L 2A6JB 3MBEB 4I2XA 2XZAH 2F58L 2UVEA 5DJ0A 4ZOBA 4HV8B 3TP4A 2G75B 3UTSD 4Y5VB 3PGFH 2FZ3B 4AQ1B 1M1SA 4LCIH 3W9DA 1DUZA 4Z0XB 4M1CC 3IDYC 3VRLF 3L7EB 2Q1EA 1I3RA 3W0WA 5LWYL 1OW0C 1ORQA 1YDPA 4R2GD 5IMKA 4X98A 3C60A 4G5ZH 5JIPA 4ZFOA 1Z0MA 1UH3A 1NEZG 5I8OL 3MNZA 5L2JB 1IAKA 2J88L 3RNKA 5KVGH 3RVVD 3GRWL 3QSKB 2B2XH 5CBEB 4Y5XA 5DURB 4JPKL 4LLDB 5B3JE 2I26N 5J3HD 3QQ4A 2YD3A 3LIZH 3PNWB 2VIRB 4TRPH 5FA3B 1CD8A 4Y5VC 3IKKA 1WSST 3RVTC 2VDOL 4WI9A 4XC1H 3DYOA 2N7BA 2V9QA 3H9HA 4XAKD 5FUZL 4JY5L 5DJAA 4AEFA 3KPQA 5DJCB 1NBQA 1EX0A 5F7MC 5DFWH 1NJ9B 3MLVL 3N50A 3HUJF 3F65A 3MGTB 2QADC 4GOSA 3FO0H 3D0LA 2GSGA 3HI1A 4OIIH 5HDQL 4NRXA 3U7WH 3K4AA 5BS0D 3ULSA 5ISZB 4Q9CA 4JFEB 2JLLA 2XYCA 1Y6MR 4OFYA 3A6CL 3FB5B 3LKOB 1T22B 5IHBA 1PSKH 3GJFK 1JV5A 1NGPH 3PQYE 4Y4HA 1G6RB 2ZUTA 3G6AB 3E8UH 4M00A 4NHUB 2KPNA 5LWYH 3QFJB 1JNLL 1NC2B 4G6AC 1CD9B 1MJUL 2YWYA 4HLZG 4OLVH 2E9BA 4YDKL 4XB7A 4NQEA 5DMGC 3TBWA 4JR9L 2XZQL 2GITB 1KTDB 1YPZE 4XNZB 1WAAE 1ZOXA 4LHUA 1A1NB 3WFBL 1N3NA 4HXAL 1FIGH 4C83B 3VXUD 5BW7C 2IAND 2BSSA 2MQ0A 3BPCB 4FQIL 5EZLB 5BVPH 3MROB 3I3EA 1YYMH 2X10A 4G7VL 2BCKA 3ES6A 1ZA6B 1FNSH 1XR9A 1L7TL 4OCXL 2FIRT 5ID1B 1Z5LA 1NBYA 4CMHB 4HSQA 5T1MB 4XVJL 2PO6A 3QUXD 1JTPA 3JV5A 3O3DB 5DK2A 4WU5A 2PYEB 5L0QB 4RMWA 4I18B 1QRKA 1CGUA 3L5JA 3QUZB 1AFVL 3EO9H 3RZCA 3V0VA 1R0AH 4NKMA 5FDWA 1KN4L 2G60H 1GGTA 4MXQC 3V7AE 3QXDA 3WXVH 2HLFD 4HGWA 5A2LH 4U6XB 5DEGB 4U1SB 5KAQF 3RKDC 1PAMA 2M2DA 3FFCD 5D7LD 2VDPH 4P49A 1V8HA 4XPBL 3CDCA 4OKVA 5L8KB 5DGQA 3NZHH 5EA0L 5I71B 1I4FB 1DDHB 4UZGA 4Y16D 1JPTL 3QZWG 3K1DA 1J10A 4PRIA 2JCCB 3RX8A 3HFMH 3O4LA 3OAYH 3IS0X 3IDMB 3EFDL 3EOYG 1YJDH 4IRJD 4KRPD 5IK3A 4L4VE 2FJGA 3KPQB 4WFHD 5DJCA 5EUKB 2CRMA 3DETC 5DRZB 1VFUA 3NMEA 4JFXA 1Q94B 3FHAA 4QCIA 4KROD 3RJDA 4ELKA 5HYJD 5DEFB 1CF8L 2AI0L 3FO2A 1W8NA 5EU7C 3V2AR 3ARFC 1REIA 1EVUA 1F8TL 1S7SB 4C55A 4HUMB 4F9PA 2NY0B 4LHJB 3BISA 1BZQK 4XGZB 4DVBA 4AK1A 1F4WH 4GSDH 5GRWA 1FFNA 9CGTA 2ZOLA 4BUGA 1UQSA 3KHQA 5KG9A 5TDNA 2YUZA 3ULUC 1TENA 2W0FB 1FLRL 3EOTL 4JG0H 5D7LE 2XTJB 1HH9A 3D85A 4BFIB 3HMXA 5D1XC 1AE6L 4KKBD 4OCRH 1DLHA 3U83A 4Y4KA 5EZJA 2X4UA 1QEWB 1KJ3L 3QUXB 1OCWL 4PJ8D 3VXQA 4LFHG 4C83A 3UTSB 4WO4C 1IGIL 1YUHB 4OQTH 3GMMA 3A6BH 1E4WH 3PHOA 5DMJB 4K55A 4M1DL 4ZPVA 5F3HB 4RA3A 3AY4C 1T04B 4P3WA 3VMOA 3G6DL 4KI5E 1U8NA 3BO8B 5HGBB 4WGVB 2OR9L 3MJ9L 2VUOA 2ZWLT 3MLRH 1I8LC 2ATPA 1QOKA 4JRYA 1Q9OA 5E94B 3QZWA 3P9LB 1GSMA 1T0NA 3ZKNC 5M95B 4LU5L 2ZSWB 5FKAB 4CRPA 4ZNEE 2AEPL 4JDZB 1S9XA 3FQRB 2BZDA 2OSLB 1FZJB 2WUCH 4FQHB 5HD8D 4LLYA 3LN9A 4ZSOE 5JPNB 1S9WA 3DXAE 3BAEL 3CC5A 5KSVB 4JY4B 5DQ9B 3QIWC 3CSYB 1XCTB 3AU1B 4LHUD 5BV7H 1HINL 1FBIL 5EU6D 3QHFL 4D94A 3EOBB 3BXNB 5TE7H 2LU7A 3OJMB 2AK4D 2NXZD 1AGCB 1OM3L 4HKXB 3VFRA 2O61A 5IK3B 3OWEA 2RHEA 4R8WL 5T5NG 1JHLL 2EH7H 4F15C 3PIQB 4U1MA 1VADA 4JO3L 1DBJL 3Q3GB 3AGVA 1AGEB 4U0RB 3MA7B 2C3HA 3VMPA 3IGAA 4QRPD 5GS3A 3X14B 1K6QL 2P8MA 1S7SA 1F4WL 4GSDL 1LD9B 5DDHA 3R0MA 3FAWA 5FA4A 1LHZA 2EIBA 4G9FD 4KMTH 4HX1B 4PLOB 2XOTA 5GGQL 4F7EB 5C0AA 3SDCB 4N0FA 1WCBA 1B6UA 4J6RL 4P4RB 1XF3A 3TJEH 4N0RA 1H15A 1C7SA 1MH5A 2QADB 2OBGA 3R8BB 1AR2A 1VDGA 2CQVA 5H8DA 4K8RD 3N85H 4OD1H 1UT9A 1AGDA 2DL2A 2GJ6B 2CDFB 1FRGH 4UIKH 2IFFH 2JJWA 3LSOB 3CMOH 5EWIH 2FR4B 1BP3B 1LE9B 3VDAA 1UYWL 1CR9L 4P46D 5D1QC 5D6DA 1OP5H 4FTVE 2FD6H 2B5IC 1B4RA 1KYOJ 3BP5A 4NUJA 1GJIA 2NW2A 2JJSC 4W4OC 1F97A 2CLZB 4ODHL 3NZHL 3DVNA 3IRPX 4ZAKB 2V2WB 3TNNB 3LKRB 4RMQA 1CLOL 1CXLA 2GTZB 3BX7C 3EAKA 3RWDA 1BREA 4UDUB 2Q87A 3GRWA 1FL6A 5EO1A 5SWZE 1BLNB 2Q3AA 4WFGE 3D3VD 5HYEA 4MJIB 4X7SH 1T5WA 2VUYA 3ME0A 4FQXD 3BPLC 5L8JB 3LN5A 4P3DA 4OF6A 3PABB 3S8WA 3IDGB 1JGEB 4G6AD 3CXHK 3SDCD 3IFNH 5C0BA 2L7UA 1ZVSA 4PGJA 4OLWL 3ECBB 4OZ4A 3HCVB 4X9GA 5IT2L 1AH1A 1MQ8A 5MEPA 3CCHA 5ICXA 5IP4A 1NUGA 3G9AB 3FJTA 1FO0B 3QUYA 4QXTA 4G7VH 5DXWA 4J3UA 4L4VA 3MR9A 3VFOA 4MJ5A 4QTHA 4ODVH 4R97C 4YC2B 4YHKH 1ED3A 3PF2A 4LSPH 3VWJD 2OZ4L 1EHNA 5IBLC 5ID0A 3O8XC 3EYOB 1AFVH 3EO9L 1R0AL 1GIGH 4J8RB 4DTGL 1PKOA 1A6ZA 1I7RB 2GFBA 1JHKH 1EEQA 4M62L 2EXWD 3VFOB 2VDLL 3ZDYF 2H8PB 2PR4H 2CPCA 1Y6NR 4JO4L 4DEPC 5I1HL 1I85C 2X7LA 3TCXA 4MD0A 4CNIB 2VZ1A 4FZ8H 4XVSL 2OMBA 2OQJA 5CP7A 1X4ZA 2D03L 5C0EA 1KCRH 3D39B 2PETA 2CK2A 1G7PA 5JR1L 4ODWB 4HJ0C 2UUDH 4WI2A 1MJ7L 3GNML 3BIBX 1NMBH 1RK1B 1X5JA 4OIIL 3U0WH 2JB5L 4LRIC 3RX7A 3SE9H 5D93C 1MELA 4RGNB 4ZFZA 3QIUA 1WZMA 5DF0A 1AXSA 3NIFE 1U3HA 1G9ML 4UIMA 2N7AA 1FVDB 3BGMA 1CIDA 2Y36H 3D6GA 2R2BB 3OL2A 5I73B 3PQYB 1BAFH 4ZFGL 1R5IA 5IHUH 3QEQD 4RAHA 3QIUB 4P5TD 3UBXA 2HVJB 4FQJH 2B20A 2AERT 1RU9H 1S7WA 4RMRA 5HDQH 3LS4L 4XCNB 5LKNA 5HGHB 1QFWL 5D1ZC 3ULVL 3BPOB 3CX5J 3N1GC 3V5DB 4UU9A 4JY6B 4HDIA 4P9MH 4ONHB 3BMWA 3ULUD 1II4E 1RIUL 5L88H 2FZ3A 3TZVC 5E5MB 3CJJA 2FO4A 1UWXK 2LU4A 1ZVSB 1C7TA 4NYLA 5GGVH 3K4ZA 3L3JA 4GW5B 1BBDH 4JG1L 2WLYA 5HYQA 1CG9A 1I9IL 4OM1L 3KLAB 3RUGE 2FO1A 3MNZB 5C08E 1MJJA 1TJGL 4IDJL 2CKBH 4AG4L 4G3YH 1TCRB 4YBQC 3VA6A 4R0LB 2Y7QB 4MNHB 5E8PA 5F9OH 3HUJB 2BDNH 4PV8B 2V2TA 4WDIB 4EZMA 3PNWA 1AGBA 1UH4A 3QCUL 4WFEE 3NFSH 5DMIH 4ODTL 5CJXC 4MXWL 1QNZL 3X13A 4PP2B 3LAFA 4JN1L 5GS2D 5ENWB 1FC2D 1OGAE 5IJVA 5DA0B 5AZ2H 4KZDH 3VXTA 1JPFB 3PL6D 5E08H 5C86A 2GUOA 4P2CG 1IT9L 3S3PA 1XGRB 4N1HB 1B90A 5F70A 2IANA 5KANG 4HUVB 2AXFA 1QFWH 1SYVA 4POZD 2DLFH 5C0GA 4EOWH 5IFHH 4JRYE 4DQOL 3MV9D 3IF1A 5ICYA 1KNOA 3N9GL 4I48A 3T4AB 3OGCB 1E27A 3OG6B 4Y4HB 2V5YA 1W0YT 4Y5XC 4MVBD 2Y5TA 3DX6A 5DK3A 4ZS6D 5CCKH 5MENE 4KK8C 1JRHI 3MV11 3V52L 4TUOB 5EOCJ 2QHRH 1ETZB 2KQNA 5ICYB 2XTJE 3FRPA 3UBXB 4WEUD 4P2YA 4IEFB 4PRPB 3W9EA 4E41D 3QXAA 5KSBE 2VDRL 3PWLA 3I3BA 3U46A 3QIBC 1MI5A 4YNYB 2NX5D 3T77A 3ZTNL 2ZSVA 1OP3H 1F4XL 2V7HB 1NCTA 2G5BB 3K1KC 1HK6A 1P6AB 4TULH 3SDDD 1MFCL 3U0PB 3O11A 3MO1A 4DGIH 2PO6B 2YPVL 3RIAF 1PZUB 1IAKB 2WBJD 3NCJL 1N2RB 4MZ3A 2W38A 2MPAL 4U1LA 3STLA 4J2XA 4QF1A 1AC6A 1IFHH 3S98A 3PL6B 1JF1B 5GRUL 5FDWB 2EKSA 5IM7B 1YPZF 1F58H 1G9NL 5TPWH 4I0PD 3ZTJG 3FL7A 4HF5H 4KAQL 2BSTB 1FNEA 2AXGA 4LSVL 3VG9B 4OFYD 2F19H 3GSNH 5EO9B 3EHBD 1TCRA 2HT3D 1BM3L 4NOFA 4EDWH 4CMHC 5IM7A 1U8QB 1KUMA 1MIEL 3DTXA 2PW2A 5D1XB 5JOEA 1EEUA 3KPNA 3C6LC 4NQCD 3VFNA 1QRNE 4K3JH 1RZKH 4M9OA 2NTSP 1T2QL 4M9PA 3O4LB 3PHQB 5IT2H 5C2BH 3PGCA 4GAYB 5CBEA 4WI7A 1F6FB 5IW3A 5F8RC 5HI3D 3B5TA 2OYPA 4P5MB 4F8QA 4OLYH 4XAWH 3T2QA 3KPNB 3HA0A 1T22A 4ZPTA 1JPGB 3QDGE 1QFPA 3QRGH 4WUUA 5CSZA 5DEFA 1P7QB 2MSPA 3GIZL 2YOCA 3ZO0A 3F7VA 3RQ3A 1QSEE 2FX8L 3QCTH 2VZVA 5JW4Q 3S9DB 1A4JA 3WNNA 5F97E 3HAEG 2R9HD 4HUXB 1FH5L 2WINA 4R4FL 1YQVH 4X9FA 5AAMA 5DFVC 4L8DA 1AY1H 4R4NC 3FFDA 3QEGH 5DI8A 5L6YH 1JGUH 4X80L 5D1ZB 4I3RH 5CZKA 1NCCH 3PWJB 2Q6WB 1ES0A 1UZ6F 2BSSB 3BPCA 4QTIL 2YRLA 2ENSA 1CT8A 3LS5H 1I8MA 1S8DB 3E6HB 2Q7NA 2VDQH 5DYOB 5HGAB 4OF3A 2CKBL 4D9RE 1TJGH 3VXQB 1LK3L 2VN7A 4D9RD 1DQJB 1OAYH 2V2XA 1RIVL 1T2JA 1YEFL 1I9IH 1NEZB 1X5AA 4XNMB 3W39B 3QUZA 3B9AA 1T7XA 3TBWB 3QYCA 3IFOA 3QNXB 1A6AB 1FV1B 4MJ6A 3H3BC 4OLXL 3QXDB 1S9YA 5KSUB 1J0HA 4PJGB 3WS6C 3ZL4H 3WN5A 4R26L 4OCWL 4XRCA 1F3JB 3STLB 4LRNL 3AM8C 4NZUL 2ENYA 1UWEH 2OP4H 4IJ3B 2N4IA 4QXUH 1I4FA 3RY4A 1G7IB 5MP6H 1FNGA 5I1LB 3LS4H 4MQ7A 2AJVL 2FSEA 3GMOB 5D4QA 1W2KT 3D1MC 4Z77A 5L2KE 2X70A 1T2XA 3DIFB 2FJGB 4QRRB 5J9PB 5FUCE 3AXLB 3FO1B 3AMLA 1LEKB 3ARZA 2I25N 1NCDL 3E3QE 4X9BA 2MKWA 1VA9A 4LSSL 3K46A 1U6AH 4H20L 1S78D 5LQBH 3B9KD 3ZHDA 2DKUA 4NQTA 2E9WA 3MLYH 3AXLA 4QWWD 4LFHD 1ZLWK 1QQDB 3Q3GA 1U8MA 3LZFL 2OZ4A 1DQDH 1CVSC 4HCRH 1JWSB 3PUCA 1KELH 2D03H 4D0BA 2LVCA 1Z9LA 2RR3A 4NM8L 4QHLB 1A6VL 3M07A 4G7YH 4S1DD 1EUTA 3HE6D 2DICA 2OTWB 4F7PB 1KN4H 4F58H 2DKSA 2VDLH 3SJVD 5DUPH 3ARGC 2OJEA 3QJHA 3OXSB 4HGMA 4LLVB 1A21A 1KFAL 2VE6A 1UM6L 1P7KB 3FO9A 3F7PC 5GS0L 3C2AL 1KJVB 1YN6B 3ZE1F 1HKLL 1JRHL 2B5IB 2CDFA 1L7TH 2QSCH 1UVQB 2CLVA 1FFOA 4GG6E 1AJ7L 3PL6C 1RUAH 4L9LC 1HILA 4ZUWB 1RUPL 4LSUL 3H9SB 3VFPB 5ESVB 4RQQA 4K7PH 1N5YH 2NW2B 3MRNA 3BVNA 2HN7B 3U2SB 3MLWL 4NBZB 5D2NA 5EU5A 1WFNA 4JR9H 1ONQA 3MV8E 5HHOE 1CTNA 3REWB 3GMNB 4WRLA 3QHZH 1AO7D 2IH3B 3HI6H 3MZGB 5FGSA 3MRNB 1LK2B 1UXSA 3HAEA 4HULB 4G6KH 4CADA 5BRZB 1QR1A 4PJ9C 2LQRA 1X7QB 1PQZB 2DQTL 4M5ZL 4UV4H 4XX1E 2NY5L 3C9NB 3REWA 3SBWA 3AU1A 1T7ZA 4UDTA 3EJZD 2AGJH 4NDMB 2X4OA 2JE8A 1B0GB 2EO9A 1HH6A 4CN4A 3ILPB 4J12A 3IRZA 3MLSL 3V7AG 2LABA 3KJ6H 1EA9C 1KENH 3TN0C 5FFLA 2OI9C 1KTRL 5ALCL 1UWEL 4X7FC 2IWGA 2VLRA 4HJGB 4WFED 1KSRA 1BF8A 2YSSB 3SPVA 2DQFA 4XHJD 1MOEA 3NN8B 1WEJH 1XF1A 4GBXC 3OKLB 4KRPC 4JPVL 4HK0B 5EBWB 1MVUB 1BZ7B 4EIGB 5E8DL 2X7LB 2R56L 4YH6A 2ZUUA 3VMNA 5IW1B 4D9QD 3FQUA 4MDJA 3ARDA 5TH2A 4JGMA 5IG7A 1WCBB 1R3HB 1NDMB 4OIAA 3E6FA 5C0EB 5I1GL 1A4KA 3ARFD 3L3GA 3T4YB 3FT4B 3ALWA 5HVHC 3FN9A 3DI2B 4JE4B 3NFPA 1A6VH 2J88H 1GC1L 3C87A 4ZYKB 3B5GA 3P4MB 1I3GH 5MI0B 1XF4A 1J7VR 3BEWB 3PP3K 4NQUA 1PX4A 1Z0NA 4L9LA 4MDJB 4X6EA 5CMAA 3WFHA 1DJSA 2GT9B 5D2LF 4QTIH 2X4PB 3O3EA 3JTTB 1KCVL 1X6NA 5IFAL 3IGAB 1M7DB 1A1MB 3NCYS 3HI5L 4ZYKA 3G04B 1IC5H 4GT7A 3L6FB 1FVDA 1D5BA 4M5YH 2IADA 4JDVA 2XWBA 4PPTA 4TUJB 4W70A 2FX8H 3QCTL 1WTGT 3VFPA 4WO4D 2FDBP 3GSRB 3R8QA 2QADD 4HS3A 2PCPB 2WANA 1U8IB 3G6JF 2EEBA 3GIZH 4Z5RB 1EO5A 1MCKA 3HNTL 1ZXQA 2VR4A 5F1SA 3UJTH 3BIKB 4JRXA 4FQXA 5EOCH 3AVEA 4D9LL 3PDOB 3X12B 3ZSSA 4HWEH 3ECBA 3FOMA 4G6JH 4R4ND 4FQLH 3V95A 3I75B 4NNPL 5FYLL 5K9OA 3C5SB 1A7RH 3HAEB 1RZKL 2GJJA 5IWLA 4L4VB 3G6DH 1U36A 3OKOA 1W72L 1B0WA 2FGWH 1FYTE 3QA3A 4EI6B 5IB5A 5EU6A 4DJMA 3IFPB 2ZNWA 3MUGB 4HWBL 3GSQA 1E4WL 3RPKA 3I75A 4LOUD 3KLAA 5HSFA 2CDGB 2AK1L 3MRQA 3ILPA 1OAZH 3QUML 1A3LH 1XGQB 4KPHH 2BSRB 4B50A 2Z8SA 2VZUA 2PF6A 4Z7UF 3WJLC 5D70L 5T1KD 5J6GA 3MUGA 3IFPA 1DVFD 4CNIA 2R2HA 4DK3A 3GZKA 1QSEA 3CXDL 2A9NH 2DLHA 3FQWA 5GS1A 3GMLA 1UCBH 2DBJA 1TIUA 3G5VA 3LS5L 3OKLA 3DYPA 1T80A 2BSRA 1BGXH 1WTLA 3ARGB 5EBWA 2CLRB 43CAB 3IJYA 1OT1A 2MHAA 1OSPH 1WAAF 1MWAA 4ZMAT 5GS1B 5ILTH 1GIGL 3QISA 5HYIA 3D39E 3DMMA 2AK4E 2VLMD 4WWID 1U3HB 4RX4D 4GRWB 1ZK9A 3T04D 2HJKA 3SE4A 4RFNC 3KYKH 2DJUA 4XVTL 2CLRA 3WD5H 43CAA 3GI9L 3STBA 3GIVA 5CEXB 2R1YA 3FHQA 1RUQH 1BQHA 3LV3A 1TZHA 1YECH 3EYFA 4NT6A 1IRAY 4ETQB 3TCLB 1EHLH 1AXTH 1J0YA 1JP5A 1VACA 4MA1B 3WFCL 4HLZH 3S34L 3N0PB 5DUMH 3MV9B 4U1JA 4LCWE 3LRSA 3DETD 3UDWC 1D6EA 3KNBB 4Q7DA 1ZS8A 3MLTB 4N0UE 1J8KA 2XNAA 1CXKA 5CP3A 4MHHI 5I2IB 1FSKC 4MWFA 1CLOH 2CGRL 4XX1G 5CIPB 4LPVA 1JMXA 4LPXA 4U1JB 1F11A 4JFED 2XIDA 1NUDA 1T7YA 2HVJA 1L0XA 1NMCC 3U82B 3BPLB 1CWVA 2OK0L 2KBGA 5EWIL 5K59F 4PJBE 3BUTA 3BYTA 4MWFB 5D1XD 4EQ2A 1ZGLB 4PJCB 1A7PH 2W0LA 5KN5A 4WY7H 1BEYL 2NTFA 1I3RB 5FYJE 3MRMA 3HUJA 4KRPB 5CGTA 1V3MA 3TFKC 1BJMA 5C0DA 2XZZA 2VXTH 4HDIB 3T0XA 1UACH 5CEZH 3ZYIA 1DE4B 2G2RA 1KXQE 4Q0XH 3JV4B 1KCSH 5IB2B 4HG4K 1D9KB 3L7FB 5H37G 3WUWG 2ZUSA 1I9JL 3LKQA 1JWUA 5EOQH 5SWZD 5C07B 4KY1L 3TZVA 2PW2B 5D1XA 3OR7B 3HMWH 4J4PC 5D7JA 4M48L 5F96H 5ADOH 1B4JH 3QI9A 3VXOB 2VL5A 1ZANL 1J05B 1Q72L 3G5VB 3VD3A 4PJAA 4C4KO 1IILE 5BO1H 5DSCB 2IMNA 5DR5H 3RRQA 2YA0A 5GJSL 4E42A 4ZSOB 4PD4J 4YDVB 4BYHA 1EH9A 3BKCL 4X8JB 4UTBH 3OR7A 4O5LH 1ZEAH 4JM2A 4LCWD 4F9PC 1IQWH 4MAYB 2GK0B 4KPHL 1CLZL 3ARBB 3EDKA 3SCMC 5CJQH 1J05A 3EJZC 4LEXL 1XGPA 2AEWA 1I1YA 4WTXA 4QRQB 3L9RB 4QHUB 4KJYA 1V7ML 3TBTB 4JRYD 2XI9A 1S7QB 3FFCA 4NIKB 1WWBX 1JPFA 2UY6A 3D18B 1FO0L 2FGWL 1PY9A 3G08A 4MB4A 4QRTA 5CJ5A 1FDLL 4ETQA 4PY7B 5I8CA 4JM4L 4IRSB 4AENB 1NLDH 1KTLA 2DQIH 1P1ZA 5A3IC 2CO7B 5CLTA 1RMFL 1S7QA 5EG6C 3HG1E 1QFUL 5IBTH 4HWEL 4LNRA 4XBGB 5E0QA 2MCPL 3FT2B 2VLKA 1KTKE 5ESQB 5EZOH 1DBML 2ATKA 5F9OL 5BJTA 4KMQA 4EXKA 2IALB 1E6JL 5E6IC 2Y06L 1QRNB 3O6KL 3BKJH 4JFHE 5GZOC 4FZ8L 4TUOA 4UT7H 1L6ZA 1ZHLB 5HHOD 1P53A 2DYPD 1FNEB 3NABL 4PRPA 3PWPB 4PJIF 3UBXG 4JVPA 4K8RC 4OQ1A 1NGWA 1IEAB 3VGAB 3AAZA 1FFPB 3MV8B 2J3SA 5T3XD 4HQQL 3V0VB 5D2LA 5C0DB 1YY8A 3ROLB 1I3GL 3DXAB 3WIFB 1IL1B 1AHWC 4EDXA 1KCUH 3K8KA 1ORSA 1OB1B 4GAGH 4Z7QE 4PJ7B 3W0WB 1IM9D 1F8TH 2I5YL 2COQA 4NRYB 1T7WA 3GSOA 4FQ2L 3SCMA 3KPOA 4DAGL 5C0BE 4P57B 1IL1A 4JM2C 4EQ3A 4OLZL 1UKSA 5J89A 1AHWA 5F88B 1MCEA 4U1NB 1LO5A 3ORJA 2OR8A 1H8NA 1O7VA 2CUHA 4HUXA 5I19L 4RGOH 1XF5B 3PP4H 4JFZL 4MX7B 4P59H 3SY0A 5I8KH 4MZ2A 2A9MH 3WL9A 3QXVA 4QXGL 2X9YA 1OPGL 2YPLA 3KS0J 1AHWB 1T83C 3PWJA 4ISVA 4WWKC 1NMBL 4QHUA 1DBBL 4NWTH 1HI6A 4GW1A 2CRZA 1I8IB 5IMLB 4O2CA 3UBXI 3WL9B 1GOGA 3D69A 5J1TC 4OAWA 5CSZB 1GZPB 1G9EA 4HJJL 2FIKB 4O58L 3CSPA 4YZFE 3QEHB 4AENA 4RGND 3HI6L 1DQLH 2UZIH 3WE6B 3HS0A 4NO0B 3ABZA 5DK0B 3RVXC 5F7DB 3NH7L 4FQ1L 1QZ1A 2PTUA 4KKBC 2MQCA 2IJ0C 2AK4A 5FK9B 1DBKL 4M61B 1I8KA 2CIIB 1FVCB 1QPPA 1JV5B 5I1KH 4LVNB 5TFSH 3M8OH 1J0KA 4OCXH 1YUHA 4H88H 5IEHA 4QRSA 5I1JH 4PJEF 3UYOD 5CSGA 2P5EB 2IG2L 5JW4R 4MA8H 1KTDA 2KKQA 1MHEA 4M43L 5I1LA 4ALAL 1A47A 3KYOB 1LILA 4HT1H 3L3OA 3QBTB 3W0WE 1IGMH 1FZKA 1MHHB 5IB1A 3GMOA 4EIZC 3U4BL 2XZQH 4GMSL 3NGBB 3GJEA 2NY7L 2P7TB 2X70B 1W0WA 1XF2A 5F1KC 5J9PA 4IHOA 3I6LD 1M6OB 5FUCC 3QR2A 4AY0A 5KSUA 5IV2A 5E6IA 1AGFA 3O6KH 1FCCA 2E9IA 1PSKL 1RK0A 4JPIA 5SV3A 2Y06H 3RVVC 4ONGL 1SJXA 3TO4C 5FOBB 4XCYA 3OXRB 1ACYH 4M7ZB 3GJFA 3U7WL 4WHYH 4YBLB 3JVGC 3MLYL 4QRUA 4XPFL 2D7NA 3QO0A 4PYHA 1A6WH 3DO7B 3OB0H 5CD5C 2IPKB 1U8MB 4KJPD 3BFOA 3WDHA 4P3CH 1WT5C 3KPRA 3QNYA 4JKLA 1QFWM 1AC0A 3MLVH 3B2VH 3MBXL 4RGOL 3IKCA 4O02L 2VR9A 5KVMC 1BFVL 1MVUA 3GO1H 3RUGF 2QQQA 3DSFH 3SHSA 3MJ8B 5HHVH 3DO7A 4LLWB 1MNUL 5CKAA 1UM5L 2QQLH 1LEKA 1U0QA 2LFGA 4P5KB 5LAXB 5C0BD 1V5JA 4FQ2H 1Z2KA 1MREH 5KSAC 3T3ME 1NDGB 3HRZB 1KJ3H 4I77H 5DJZA 2R9HC 4YBQD 5GZND 1UEMA 1ADQL 3DUUA 2A1WL 1MCSA 2EDXA 5T3XL 4X6EB 5D72L 5LAXA 4CVUA 4NPYB 4YBHA 5DR5L 2FIKA 5C2UB 2VLME 4QY8A 3O6LL 1OWRM 3G04A 4HFUL 5H2BB 3ESUF 5DMGD 3SKMB 3OKEB 5JPMB 3MV01 1VB9A 2ZOLB 5TE7L 3ET9F 4MD5B 2VZOA 5AEAA 3CXHJ 4X5WB 4R3SA 1VCAA 2EYSB 2DQCH 3GMPA 3HNVH 4LLMB 3T09A 2BY1A 4MJIE 5ECJE 3DUSA 5SWSA 3G9VA 1FH5H 4FMKA 4AQOA 3TNNA 5EUOA 5DD6A 4HBCH 4HK3J 2WUCL 1MCPL 1U92B 1X7QA 5LGHH 2C3VB 3RIFF 4JB9L 2GAZA 3FOMB 3MBEC 1MHEB 3VFUB 3QUXA 5E9DE 3P2TA 4B0MM 1ZTXL 4R7NB 1QFUH 5IBTL 3WS3A 2P7TA 3TH2T 2JIXA 3B6SB 2ID5A 1YQVL 2R4RL 1T66C 1K8IB 3UP1A 5CBAA 1QRND 5D7LA 3RKDD 2GY7B 5HGBA 2YR3A 3CVHA 1KIRA 2O5YH 1Q9OB 2IFGA 25C8H 2VDKH 3CAFA 2FATH 1ZLVH 3ROOA 4KDTC 4OCLC 1UZ8A 4GKSA 2FEEL 2IPKA 3O8XD 3OAUH 4YHPA 4JDZA 4NC2B 2Z31A 4YDJB 1GCFA 5IB3A 4OSUH 3QT2A 3GMRA 3GBNL 4XI5C 2BVQB 5FM5M 4PRPD 2P5WB 3RA7L 5E8OA 1TNMA 2AJUH 3RU8L 1P9MA 1HXYB 4L9DA 4JQIL 1YNLL 2HH0L 3C5ZA 2OLDA 1KIPA 3QNZB 1W72B 2XXMB 4U6HB 2MQ3A 4LLWA 2D0FA 4XBEH 4Y0GA 3ILQC 4KROC 2WW8A 2OL3B 1R24A 1MCQA 3U4EA 3VI4E 1SM3H 3WFHB 1I7ZB 3BWAB 4FFVD 3NAAL 3H7BB 1A7NH 4JRWA 3MACL 3O2DH 1ZHKB 3EHBC 4FFWD 3D25A 1D5BB 1BZ7A 3FB6A 2D2OA 2E27L 3M1BB 4TTDD 4RBPK 4H1LA 2DB8A 1IFHL 3ZYZA 2D7QA 4XCEA 2CK0H 3CX5K 3KR3H 2R0LH 1WC7A 3I6KB 2F54A 1GGIL 5DC4B 1CFSB 3AS2A 1VACB 4NUGH 3OKEA 4YUEL 4UTAH 2Y4SA 4HWNA 2EDQA 5C09A 5C9JB 4P4RA 3I6GB 1AIFB 3IXTB 4JZOA 1XFPA 5KANI 1IC7L 1U95A 4P5TC 2I60L 2UWEA 4PRHB 4E41E 1CGYA 4YO0B 3ESVF 3U79A 5DD6B 4OF0A 3WIIH 1F11B 3V5DA 2ICES 1KGCE 1YC7A 5T1LD 4LMQE 4KVNH 1U8LA 4HWUA 4OV5A 1EPFA 4BH8A 4Z5RA 2CR3A 1EEZB 3BDYH 1JL8A 4L8SA 4LLUA 3MRKB 3NPZB 4JFHD 3LKSB 2FO4B 1XGQA 4PJCA 2JIXB 4BKLB 4M7LT 3L3JB 1N26A 3O6MH 5TE4L 1DFBH 4JLRA 1T5WB 5CLWA 5JXEC 4FZEH 1KIRB 4L8SB 3JWOH 5SX5K 1G6RH 4CU6A 4HBQA 3V4UL 2OL3H 1OGAD 5AZ2L 3TN0D 4KZDL 1GAFH 2N1KA 1EUUA 2A74B 4GG6F 2XXCB 1G7LA 1VFAA 1VERA 5CKGA 3O3BA 1OAUH 3VG9C 3CSBA 2YD5A 4PJHE 4X4MA 2OMNA 4ZSOA 1G0YR 3HC4L 1KIPB 3BD3A 1SMOA 4OB5L 1RIUH 2R1YB 3GI8L 2JELH 2Q8BL 2DQUL 1UXWB 4R90H 2CJUL 3KXFD 3QWOA 2IBGA 4Z7VA 5BZDA 3ARFB 1A2YB 3O8XB 2JJTA 3WIHL 4I77L 4WCYL 4JG1H 1EXUB 4E41A 5F9DC 3MV9E 4YHYC 1Y18A 2EC8A 4FP8L 2FH8A 4HWBH 4JRXE 3T2OA 1A64A 4KK9C 5I1IL 2W9EH 3DYMA 2XNAB 3T1WA 5D2LE 3D2UA 4OIBA 3GO1L 2HJKB 2J1KA 3H9SD 4HUWA 1BFVH 4KK8D 5DEZA 1FL3B 2UYLA 4NQSA 1CGWA 3DOSA 3D0VB 3AMKA 1AI1L 3L5XH 4G80A 4QWWC 3SKJL 1CICD 2VLKB 4NNPH 4KK5D 1DR9A 1CGXA 3GB7B 2A77H 4J23A 4J3XA 4ZQKB 5B38A 4RBPH 2X4RA 5E9DA 1MY7A 2WIIA 3A67H 5CWSA 3HAEH 3QH3A 2UYLB 2F53B 3TBSB 3TVMA 1H8OA 3U0PA 4LCCC 4JFPA 5ICZB 2ZG2A 4XVSH 4M6OL 3SDYH 3MV7B 1S7WB 3FONB 3CFEB 5EIQA 2XA8H 1KEMH 5TF1L 1NEUA 4GLRI 2H32H 2K9UA 2NQCA 1OLLA 3THML 3T2PA 5B38G 3GBMH 4FXKB 2FWOB 3V4UH 3MRGA 1SEBB 4N0CD 2VH5H 4HCRA 3NZ8B 5HJ3B 2YRZA 4IJ3C 3MV7D 5GS0C 1DANU 4K2UL 4GW5A 5IBLD 1A5FH 1QLFB 3QDMB 3JWNC 1UWXH 4NRYA 3H8NA 5HYQB 1K2DB 4HC1H 2E7BA 2F53D 3BDXA 1QSZA 4JKWA 3EGSB 2EXWC 4N0YL 4NNXB 4QRPA 2XICA 4UINH 3SDXB 4QRQA 4GXVH 4L5FH 1DUYA 3C08H 4WWKB 3WFEH 1SBSH 4JFQB 1MCJA 3P73A 4ODVL 4PJ7F 1IGFL 1MRFH 1P7QA 3IXAA 1SYSA 2ADJB 4EN3C 3EFFA 4PG9A 3WIIL 4NRXB 3GK8H 4AM0A 3ULUL 1G7QB 3HE7B 2B4CC 3E0GA 4HUUB 4KMLB 3SDDA 1GYAA 1IAII 4JM2B 1IC7H 4HKJA 4MHHG 5GXBB 4OLUL 2DLGA 4O2EB 1D5XB 3O2WH 2ESVB 1WWCA 1GPOH 5I76A 1W0VB 4XHJC 2GCYB 2ZOKB 2R29L 4X99B 1GGIH 1RUQL 3RTQB 5F7DA 1JPST 3BZ4A 4YHML 4KTDH 3KR3L 3PGDB 1U8HB 2YXMA 1KNOB 4MA1C 1AKJB 3KGRA 1D5XA 3GHBH 2DAVA 4QRTB 1H3VA 4M6AA 1BD2D 1XR8B 2ITCB 3OKMB 3KPSA 5HVFB 2X4RB 1LP9E 4P2QD 2ERJC 5DJXA 3FQTA 1ETZA 5FYJL 4YAQB 1HIML 1FIEA 2YD6A 4TTDC 3T08A 3OGOE 3DXAA 3TF7C 4M4PA 4N0UA 2B4CL 4XNZC 1JWMB 3L1OL 2ESVD 2DWDB 3HG1B 3IFLL 5C0JB 4OV6F 1J8HA 2V7HA 4M93B 3RVWC 1RZGA 3V6BR 1T89C 3TIDB 4YGAB 1Q0YL 4TVPL 3VE0A 3VXSB 1MCWM 4MSWB 5I9QC 1P4IL 4LSRH 1KJ2L 4F15B 5T5NF 3OXRA 5F7WC 1BQLH 3TT1L 3RGVC 4LIQL 3UYRH 1BWWA 3V0WH 4NQCB 3MUZ1 2FEDD 5E2WL 2WWKT 1DBMH 3HUJE 4XC3L 4GKZA 4L3ED 2XZCH 3IDMA 1LDPL 4MXVE 1UB6B 4YXHH 5ADPH 3HPJA 2ICWA 3B8SA 4TYUA 1JGUL 2YEZA 4X80H 5I8EA 4K71B 1OB1A 4KUZL 3MNVB 4TVPE 5IMLA 4KRLB 4R4FH 5JZ7C 2R39A 5EZIL 2J5LC 4X4YA 3HNTH 3UJTL 4I9WD 5I1AA 3FB8B 4OGAD 2X09A 1UWGH 2VXQH 1XGUB 2VQUA 3GHEL 1RZKC 2ZCLL 5DJZB 1R5VA 1HYSD 4NN5B 1CDHA 4S1DC 3SDDB 1QFWI 1JZ5A 1U9KA 1RULL 1NAMA 1OCWH 4NN6B 2Q8AH 5IGXL 3EYSH 3QIBA 1D6VL 1EJ6A 4RAVB 2HKFL 1PYWB 4PJ5B 1BHGA 4KV5E 3U7YL 4ODSL 4ISVB 4N90E 3RPIA 4WHYG 3IFLH 2HRLA 5J57B 4WV1C 2NY0C 4K3JL 4W4NA 5CP3H 1M05B 1K4CA 4C4KT 2B1HL 5HGGS 1Q72H 3LD8B 4R26H 4X5WA 3NOIA 4PJDF 2AW2A 5HDBE 4PJ5A 4D2NA 4AT6B 3DUSB 5SWSB 5GS2H 3B5HA 5CINL 5GSRA 3VFTB 2WP3O 5JOFB 5GZOD 1MCDA 5EUOB 3UZQA 3OKNB 3SE8L 2UWEE 3HTLX 1DBKH 1XF2B 2EIEA 3MX0A 2BOCA 3PWUA 1IQDB 1P4LB 5HGAA 1J1OH 5HDOA 5LXGL 4FQQA 2UZIL 4KDTA 1WK0A 1YEGL 1M7IB 4QHKJ 1M71A 5H35B 4YHMH 5C08D 1FLRH 2IANE 3C5ZD 2DWDA 3EJJX 4XNMA 4WW2B 5HGDA 1WFUA 4XH2B 3EJYD 5DVKA 1R3KB 4ZS7H 4TULL 2UV3A 3WS6A 1QBAA 4I3RL 1XAUA 3I9GH 4IM8A 3WYRA 5L6YL 3MGOB 3QEGL 3QNYB 1BIIA 1K3ZA 3O9WD 1HHHA 5JPNA 1Q9WA 5DJYB 5FB8A 1QA9B 3PP4L 4Q9QH 3ZT7A 4G6MH 4EUPB 5IV2B 3HZKA 4MNGB 5E4EB 1T21B 4U1SA 3TESA 5JHDB 5E6YA 3IDXH 5EBMA 1A7BA 3VFRB 3HFML 4U1GB 2O61B 3MUHL 1FZMA 5HI3C 2WZPD 5FB8B 1XIWC 3RI5F 2W9DH 1JPTH 2NYYD 5C0ND 3R1GH 4QOKB 1QG3A 1TJIL 4OI8A 3ARDB 4HT1L 3VD9A 1T2QH 2AJSH 1EEYB 3K2UL 4XXCC 2IMMA 3ZDYE 5KAQG 1I7ZA 5JHDA 3AREC 5T5FH 4C57C 1RUAL 2EDDA 1EFXB 5J6HA 4MS8C 5HHMD 4OM0L 4YR6A 1WWAX 3VFMA 1FIGL 1K9TA 3SDCA 2DQHH 5JXEA 4KVCH 5IEKA 2JIXD 4WIQA 4HF5L 4XXCA 5HHQA 5AUMA 1F3DJ 4JRXD 2GK2A 3QIWA 3DX8A 4XNXH 5KS9E 1ULVA 1OP9A 4U7KA 4KROB 2P4AB 2RJMA 1QFOA 1RJLB 4XTRD 4W6WB 1N5AA 1ZA3A 2XA8L 3QIUD 4P5TB 4OZFH 4DN4L 4L8SC 4GS7C 3LQMA 1GGUA 3NIFF 2IQ9H 2E9JA 2Z92B 2ORBH 4F9LA 4Y2DB 3WFDH 5I18H 2NLJB 4P2RA 2HTKD 3O41A 2PXYB 5MENA 2EE2A 4RWHA 3JXAA 4WI5A 3OBAA 4KRMB 4ZAKA 3A67L 5JOFA 3BIAX 5F89A 3UAJD 1L6XA 4YWGH 4JRXB 3RWDB 5JPMA 2A77L 2HLAA 2VWEE 3M45A 4XNUH 1OPGH 3BZFB 4R3SB 4FRWA 4KQ4H 5FO8B 1FPTH 1YY9D 1F45A 5D7LB 4OD2B 3UTSA 2DTMH 2H9GB 3IJSA 2KZWA 3LN4A 1CDUA 3MRBB 2W65A 2HN7A 3U2SA 2HAZA 4PGCA 4PRNB 4HFWA 5GRVL 4FQCH 1W72H 1MCOH 3CFKA 1N7ML 4P2OD 5EPMA 3ARDD 1PFCA 2UUDK 2PW1A 4OZGB 4LPYA 4UT9L 2C1PB 2ZG3A 4XWGL 2RFXA 5C0FA 2R8SL 1JHTB 2W65B 2BVQA 4HIXH 2ADFL 2DBLH 4R7NA 4FQJL 3PWPE 3S36L 4AZ8A 3CFKB 4TSBH 3MV7E 1T0NB 1ED3B 4MB3A 3BQUA 2OI9B 5L7XH 2OP4L 5GPRA 4JO1H 5I71C 5J6GB 3S36X 1DEDA 3MXVH 2FJFA 3GSVA 4QT5A 4JN2B 2I24N 5CZXC 4Z7WF 2P5WD 2VDOH 4S1SL 1BVZA 3GM0A 1T03H 5INDB 1R3IL 2BVEA 2GEEA 5C0IB 1JZ7A 4OZIF 4LCIL 2HRPL 3IJYB 2OTPA 1KIQA 2QQNL 2CRIA 1OWWA 1A0QL 4ZAKC 4R97B 2Z31C 2BJMH 1L0YA 2F58H 1C5BL 3NN8A 2AJXH 5INDA 1U8OB 1MFAH 4Z7VB 1KCRL 5BZDB 5J6HB 1UKQA 2VSCA 2X1PA 3JWDL 1RJYA 2NY4C 1CQKA 3RWCA 4AG4H 1P69B 4P46A 1KYOK 5T1KB 5TH2B 3KPPA 3VCLB 4QHKI 5CZVH 1K85A 2FRGP 5DJ2B 5I1GH 2Y9RT 5AUMB 1YNTB 1S5IH 3T4YA 3O9WA 4UQ2B 1LD9A 1ZHKA 4ZO7A 4R7DA 1DN2A 4HX1A 4X5XA 3RWIA 4LKXB 3QG6A 1WITA 2YC1A 3H9SE 4LK4A 3QDAA 4K94L 4I2XE 4P46B 2RIKA 3MJGX 1YEJL 5F7YC 1ZS8B 3S37L 3QQNA 3LKNB 1A9BA 3REVA 1WC7B 4OZGE 3CGTA 5DTFB 1CFQB 1NQBA 2X05A 2YN5A 4U1IB 3MREA 4RAUA 1H5BC 4WI6A 1IC4L 4BKLA 1J1PL 1HWGB 3DVGB 2F53A 2C4FT 2I60H 3RAJL 1RZFL 2AGJL 3VXRB 3DX7B 4YZFF 3E2HC 2J6EA 4Z7QF 3TGXA 3VXRD 3K4DA 1BD2E 1OGTB 3R06B 4O51B 4O9HH 3W0WD 5I30L 1U8IA 4TOYL 1VFBB 4HZLA 4ZUUB 3DVNB 4JHBA 4Q2ZA 1RHHA 1U91B 2EDFA 5JNYA 2FHBA 4L29A 1DSFH 1G9MH 4D0CB 1ZMYA 4JFEE 5EPMB 2X4NB 3UTPD 2NTFB 2YK1L 1DP0A 3DX7A 3TFKD 4EVNB 5F6HJ 1U8KA 2E27H 3QHZL 4PD4K 3T0EA 4P4KA 2X1WL 5J0BA 3F58H 4XNUL 3FB7B 5ILTL 3ZHLA 1D9KA 3L7FA 1AQKH 4LKCA 3W5MA 1OSPL 4KU1A 1OSZB 3LKQB 5E8PB 5JR1H 2CMRH 3SGJA 4KXZH 1FRGL 4Y16A 1RHFA 4UTAL 4NZTL 3HE6B 4RZCB 1SM3L 3GSQB 4OUOA 1U8KB 4HHAA 4NUGL 2VXTL 4JHAH 2MPAH 4KKNA 5FKPA 1F4YL 1I1RA 3NCMA 1URLA 4JFDB 1NBZB 5FYKE 3WJLA 3LQZA 5AYQA 1OSZA 2PYEE 1JTTA 5DMYA 3HC0A 2BOBB 3GBNH 1H9VA 5T3ZH 3HE6A 4RZCA 3KXFA 3RY6A 3SE8H 2DIJA 1SJHB 1CQYA 4PRAA 4F58L 1BQUA 1LO2L 3SO5A 1TQBC 5LGKA 3D39D 3TO4D 2NY2D 3WDIA 4FABL 5LGJB 3ZDXF 4G8FA 4LGRB 2DWEA 2DJ4A 4RIRB 3PWVB 1S9VA 4Q97A 4NFBA 3T0WA 2ESVA 3C6SA 4MNGE 5KOVC 1TJIH 1WISA 4ZD3H 3CVIH 1NCUA 2GCYA 2ZOKA 3RTQA 5KW9L 3MXWH 4PTTB 4G6JL 5A3ID 5KOMC 4OZHF 3BUYB 4JGJA 1JPSL 1MFBL 1XIWD 3CFDB 3I02A 1KBGH 1YC8A 3PGDA 3FN0H 3FT2A 2BFVH 4JPWL 2P5ED 5HHNB 4X7TA 3OMZA 1PG7W 1WCQA 4JB9H 1P84K 4LP4A 3W9EB 1H3XA 2D31B 2EIDA 3BGMB 4OCYL 1JZ2A 4YGVB 1FL3A 3MQIA 3B4NA 4M5YL 4MS8D 5CUSL 3UTTE 1I7UA 3I85A 4YAQA 3MRCB 4X7CC 4RCAA 3MLTA 4N1EA 1CLCA 2AJYL 1VFBA 2XN9E 4GBXA 3MLRL 4PB9L 2Z4QB 1SEBA 5IIEB 1YNKL 5HPOA 4XTRC 2XV6B 2D7MA 5D6CA 5LGHL 2APTA 3RWGB 4I0PC 3MMEB 3BESR 5FM4A 2CH8A 2YMXH 2OJZH 1GHFL 5EU3A 3I2CH 4X4ME 1ADQH 1B3JA 3EGSA 1I1AD 1SJEB 3P0GB 5I75B 2CDEB 5IQ7H 1OARH 4DZ8B 2BVTA 1BBDL 3SGEH 1J87A 1DVFC 5E8NB 1S7VA 3MC0A 4YXKL 4JREB 1QR4A 2Z93B 2DD8L 2Q86A 3TPUA 4YHIB 3QQ9C 5JDJA 3QDJD 3MRGB 2APFA 2BNUA 2VISB 2DQGL 4Z8FH 2R4SH 5IFJA 4LAQH 1JWUB 1TPXC 3ULVH 2V17L 5FECA 4OCNC 1KJMB 4QO1A 4WV1A 4OT1L 4G9FB 4LQ1A 3IVKB 4XBPA 3TPUB 2DBLL 4PJFE 4HIXL 1TTFA 3JUYA 4X6CE 5EBGA 5C0CA 3QWRA 4HAGA 4JFFA 4UILL 3QDJE 4PP2A 4GRLB 3V4VH 2A73A 3CFBA 3DXAD 5IF0A 1MVFA 2A38A 3VD7A 3ZYJA 3IAPA 1GGBL 3Q1SH 3X3GH 1J86A 4K8RL 1V7NH 5DQDH 1OAXL 3QQ4B 5DFVD 5C08A 1RVFH 1WICA 1GZPA 3RX5A 4ODXB 4X6CA 4JCMA 1KJ2B 4L4TA 5C0CE 1MFBH 1NFKA 1H5BB 3VFVB 1NC4D 4OLUH 1IZKA 1LP9A 3L5WA 2WQRA 5C2BL 1FGNH 1UH2A 1INEH 2Z31D 1HHIB 1LEGA 4XPBH 4AT6A 1NCBH 1YEHL 5DVNA 1NC2D 1KV3A 3ARQA 1AJ7H 3TBYA 5DD0H 3BE1H 4JFEA 1LMKA 3QNXA 5ID1A 2HYMA 4BH7B 5FEBA 3G5ZA 2DRUA 4APQA 4PJCE 5IVXE 4OF7A 5IESH 2AJZA 4JZNA 3SKOA 4XVJH 5F6HI 3T77B 3FQNA 3WNPA 5BMFH 4AH2A 4PJFB 4NQCA 4NCDA 1G7IA 4LF3B 3EOTH 3EDDA 2R23B 3BD5A 4HIJB 3VXUE 4HIEB 3TWCH 2OS7A 4P9HL 1BIIB 5E4EC 3DRTA 4I13B 5CIPH 1LE5A 4UB0L 3O4LE 3WMSA 4BELD 4DUXA 3O45A 3BPOC 5T3XE 4Z18A 4LLAA 1S7VB 4X98B 4B7LA 5MEQA 2NMSA 3A6OA 5F9WC 3VGHA 4LHQB 3THMH 1H0DA 5DHVA 4PBXA 1MJUH 1I1FB 3PE9A 5MI0C 3CUPA 5EORH 5JLZB 1DSFL 2CRYA 4G8IB 4A2LA 1HYRC 1YMHB 2XA3A 2FL5A 5CCKL 1GGBH 3K0WA 4KKLC 4Z95L 1RQ5A 3OKDA 5FHAL 3GKWL 3K2MC 3TA3D 4QCIB 4J4PA 3LPWA 1NFDA 3QO1B 5T1LA 1I1FA 2YKLL 4U05A 3ZT5A 1J1PH 5KSAD 4YFLF 3X11A 4Z78B 1NDGA 5I0DA 2WWKO 2ZCKL 3MYJB 5DJAB 1K3IA 5EOTA 3CPLA 1MUJB 1N6QH 1SY6L 3DUUB 1J11A 3L5XL 4P59L 1YMME 1NJ9A 4RFNB 2V5RA 1S7UB 4XT1C 1PW3A 1U58B 4WUUB 3RIAK 5EU6E 4Z7UB 4B41A 4IMLA 4NZUH 4GAJH 1F2QA 4XMLH 3ULVF 2EDJA 4N90D 4ODXA 4PJHF 4X6CB 4OCWH 4LPWA 3MFFB 4OLZH 4ACPA 2LU3A 1P7KA 3WJJC 4MCYB 3WLWC 3N1FC 4P5TA 4N8VG 3UTPE 4DCQB 3NABH 5IQ7L 1FNLA 3V5KA 1GHFH 3DROB 5E6ID 3W11C 5HYSA 4PJGE 5HI5D 1TXKA 2BSED 3HPLA 5J7CC 2R1XB 2NY2C 4FQPA 4JO3H 4NHCL 3SDAB 5ANMB 2Y23A 3U36B 1RFDH 4EUPH 5DYOA 3CLEH 1ONQB 3BSZH 3FN3A 2OCFD 2XQYG 1KPRB 4PV9A 1W8OA 4P9HC 3F7YB 4OD2A 1H3TA 2VLKE 2FX9H 1J0IA 4WW2F 4KJQC 4DOHE 4BFIA 4K7PY 4NSKA 4PGCB 4JO2H 1NMAL 5E5RB 2EZ0C 4LPUA 4PJ9D 1DCLA 3OAYK 5HVGB 1XR9B 3RL1A 1NCDH 1Q9LA 1QEWA 2ZCLH 3HZKB 4MNGA 2ZCHH 1OAXH 1MHHA 4QHMA 1F3JA 2C4XA 5FGBA 3BP4B 4M4RA 3QRGL 1TVHA 3P4NA 1KCLA 3LKPB 3UTZA 2NY2B 4Z76A 4RGMC 1R3KA 2VDMH 4UILH 3SGDI 1C16B 1FGVH 1SVZA 4HWZB 5TJWK 4HXBL 2MCPH 1Q9LB 2GY5A 4NN5C 3QJFA 2YA1A 3TPKA 1TCMA 4JM2D 1RK0B 3BO8A 4I18C 4ZD3L 5T3ZD 4GKNA 2XZCL 1X5FA 4XI5D 5KTEH 4BSVB 2ATPB 4OLEA 4Z8FL 2E8ZA 1MIEH 3JV0A 3SOBL 1DVFB 4IOFC 2VLRE 1BQLL 3TT1H 2EICA 5JZ7D 4PRIB 1YEEL 4JFDE 2F74A 1D5IH 1EO7A 5EBLB 2CKBA 4LDLB 4EUPG 5E00A 4WWKD 1U8OA 3LQAH 3VJ6A 3BW9A 4FFWC 3BGFB 3D25B 5TDPA 4JY4A 4JFOB 1MJ7H 3GNMH 4ESKA 1VGEH 3N1MC 2NY3B 3RWCB 2EEDA 5IB4B 2NY6C 2Q20A 4FG6C 3V4PH 3MOQA 1A7QL 4IMLB 3LEVL 4GRWE 2FHCA 1LGVA 4UNVA 4V1DE 5T1DH 2R0LL 1Q1JH 3IDJB 3HRZA 5FCUL 1R3LB 2XG5A 3UEZA 5I1HH 4JO4H 3KPLB 2DF3A 1U3YA 2C4FU 2R0KL 1YMMB 2OTWA 4XNXL 4QHNB 3O6FA 4TN9A 4S10A 5HHOA 4NQXA 4JZOB 3MA7A 2OJEB 3GEWB 3V5KB 1OF2B 2DQHL 4JAMA 3OJVC 2NX5A 3MRBA 4OM0H 2EDLA 5GGRY 1TZGH 1KC5H 1MF2H 5A43C 3H42H 2OTUA 3SO3B 3EUUA 4FQXB 3CDYA 2PW1B 2A83A 4OZGA 5SWQA 5I1CL 1FORH 1HSAA 4WU7B 4CVZB 4NN6C 2RAMA 4HZLB 4ZUUA 2GJ6A 2W0KA 5C0BB 1GC1C 5EU6B 1BVLA 2SEBB 2VLRD 4I0PA 4YHOL 5JA9A 3V0AC 4LVOB 4PY8J 3QUYB 3C2SA 3WD5L 2FECL 1NFIB 2EYRA 3B83A 5EN2B 4PRNA 4AL8H 5D5MA 4Z76B 3QZWB 2X44D 5IVXF 1TTGA 1WIOA 2L0DA 2IPUK 4JZJA 4WW1A 3DGGB 2VN4A 3WKNA 2J8UA 4J8RA 1VENA 4MXWH 1V3LA 4Y19A 1AXTL 3MRLB 3NFSL 2Z9TA 1MCWW 4NQVB 3NA9H 4LLYB 5KSBB 2D3VA 2PNDA 1N59B 5FYLE 1H3UA 4GKSB 1UCBL 1MCPH 4RRPA 3ZKSD 4BSWA 4V1DA 5ACZB 3WSQH 3GSNA 3V4PL 4G3YL 1IC1A 4IDJH 1XIWB 1WUNT 1N4XH 3TNMA 1ZE3C 5D70H 4U6VL 3MR9B 4ENEC 2YPKA 4RA0C 5TF0A 1SBBA 1BD2B 2A6KA 2AS5M 2VDRH 3RJQB 4CW1A 5BXFA 4HZAA 3S96B 1KIQB 1L7IL 2DWEB 5DC9B 2FEDC 1BQHB 1G7MB 1BGXL 1OD7A 4K9EC 4LIQE 5B39G 4OCMC 3L95A 2R2CA 5BV7C 1AXSB 2JTDA 2KDGA 1KG0B 4MA3A 2Y07H 3SDXF 1M4KA 3VU2A 2A9NL 1MAJA 3BEWA 4JO1L 1A7RL 1KXVC 1T0MB 4S1RH 5DMKB 3T0BA 3U9UB 4HEME 3WNOA 4ZNCD 3KNBA 5DJ2A 1QHOA 2W60B 2HTKC 5M94B 5F1IA 3TA3C 4KK5C 3OAUL 4O2FB 3UTQB 4OGAC 5IFHL 2VDML 4YPGA 3MSPA 5BOZG 1RHHB 3FOLA 4LLQB 2EIZB 4JFYA 4KI1A 2ADIB 4YGVA 3S3JA 5D8JL 5DMKA 3WNLA 1YYLL 2I9LA 3DSFL 3QEQA 4FQCL 4JY6A 4ZFZB 4EVNA 1XMWA 2HTLD 1RD6A 5DHYA 2LAAA 3GM8A 2CLZA 3MV7A 4X4XA 3ZLQC 4F33B 3QDJA 2X2YA 4TRPL 3FB7A 1OTSC 5D7KD 2PYFB 1IC5L 3T0DA 1WBZB 1YZZA 3HE7C 1UJ3A 3DVGA 1BLNA 3NPSC 1ZTXH 3BWUC 4LEOB 2VAAA 1S5IL 2I9TB 1R5IB 3MRJA 4PJIE 2BNQA 2Z0BA 3GSUA 2HP4A 1CE6A 4V2CB 3TA3B 1NH6A 1UJTA 4G8GB 3JV4A 1FFRA 1KXTB 1NFIA 2DQUH 2MMXA 5HI5C 1Z9OA 3WEXB 4L29B 4DZ8A 2PUQT 4XMKL 3HHRB 3I84A 4DN4H 5HY9A 1ZT1B 1U42A 2I9TA 1E4KA 1K5NB 1H3GA 5EFIB 5GGTL 4I4WA 4JO2L 1JFQH 1WZ1L 2DQCL 2M1KA 3UX9B 1FNFA 2CDGA 4P4KB 3VXOA 3WV0A 4QOKD 5J13C 4OI9A 4QRPB 4CAGA 4RSVA 1FJ1A 5JIHA 1D7FA 2QSVA 3WLBA 4YDVA 3NIGE 4X83A 4NP4L 1DL7L 5FV2A 1BJ8A 1RFDL 4I4WB 4R4BB 1K8DA 4RRPG 1CK0H 5T5FL 4YC2C 4QOKE 3NGBC 2XWJB 4U6TA 2IANB 5D71H 1JUFA 3P30H 2QKIA 4HIIA 4F7MA 5EU4B 5TE4H 3O6ML 3HC0B 2FBJH 4CW1B 4PLNC 4D0DB 4TSAH 4YHYB 3B3IA 2M26A 3ZE1E 4DKEH 5J11B 5TE6L 3RGHA 1SHMA 1PKQB 2E7LC 3JWOC 5ESAA 3D48R 4ZUSB 1YA5A 3KS0H 1N0LA 4Z7OF 2H26A 1KJ2A 4L4TB 2Y5TB 1MCOL 4HJJH 4Q6IC 3RFZC 3KLDA 5I1DA 4RGMB 2NY6B 4KJWD 2YHGA 5ISZA 3ULSB 5CHNA 4W6XB 2B7DT 4GG6B 3NACL 5INCB 4K3GA 2LVEA 3FB5A 4V2BA 5AG9A 4KUCF 1YPZB 1O0VA 3D3VA 2ZNXA 1D9KC 5C7XL 1NUFA 5ESQA 3CFCH 1RZ8B 3DVIA 3JTSB 3HB3D 1Y6KR 1LQSR 4XMPH 3PJSA 4GRWH 2A6JA 2FX7H 3BUYA 1JZ6A 3GK8L 1JTOA 1YEIH 1OTTC 2NNAA 4I1NB 3FQTB 4OJFH 1AP2B 2IQ9L 3LDBB 4Y5VA 1JGLL 3VH8G 4L3CA 3WXVL 1C5CL 4JJHA 4XCNA 3VGDA 3IDIB 4L4VD 3MJ7A 3SO3C 4PRHD 1JF1A 4WFGD 4MAYD 3QIUC 4N0YH 3FMGL 3KAAA 1QKZL 1IGJB 4ODBD 2XRAL 4RDQG 1D5MB 5B4MD 1PD6A 4UV7L 5DO2D 3SE3C 5JXED 3VDCA 5J1SC 4U2ZA 4M3KB 4HKBB 5GRJL 2BNUB 1RSFA 1P7QD 3MCLH 5I1JL 4PLKC 1XGYH 2ZSVB 5KN5B 5GJTL 1NGQL 3RGVD 4QNPF 4WO4B 4X6DA 4S2SA 2KH2B 1INEL 5SWZB 4G9FA 4Z7UE 2Y72A 3UDWA 2ED7A 4GKZB 4H26A 5IJKC 1B6DA 4GAYA 4GRWF 4NQDD 2B8OT 5HHXL 3CFBB 4H20H 3LEYH 4IRJA 1NPUA 2APBA 3ZKND 4S2SB 3WJJA 5F7LB 1E4XI 3QPQD 2BX5A 5FHBH 3MGTA 5ALBL 4XNQA 3G5XA 2V9RA 3VXNB 4H0HB 2BMKB 5EZOL 5HD8C 5IFJB 2AEPH 4F7MB 4Y88A 4XVUC 3U9PH 4TVPD 2P46B 4D0DA 2AJVH 4Z7WE 3WNMA 2QL1A 5DD5H 1JYVA 1DEEA 5DURD 5C7XH 5MHSD 3SKJH 1UA6L 3QFJA 1I1YB 4LSSH 4JFZH 5D7IE 4HUVA 1QYGH 2EH8L 4JY5H 3BH8A 4MMXC 1CFTA 2ITDA 4WI3A 4X0KB 4TNWF 1V7NL 1MJ8H 3TV3L 1CDIA 4UOJA 3UXFA 5CD3B 4FP8H 3OGCA 4HS6A 4PYGA 5AG8A 1T4KB 1N3NB 4BQ8A 1AR1D 4OQTL 2H2SD 1PVHA 1HXMA 2J6EH 5F7EL 4F3FA 4Y2OA 2BVYA 4TVPH 3UPRA 1P1ZB 1WIPA 3W39A 5JHDD 1MRCH 3P30L 5FF6A 1OAYL 4X0KA 1ZA6A 4XPTL 5D6DC 3QDHA 5MEOA 4I0CC 4QRRE 5IMMA 3F7YA 5T33L 4JG0L 3KPSB 2Q6WA 4R8WH 4WU5B 1EHXA 3VXUB 3C5ZC 3FFCE 3ZL4L 4MMZC 1HIMH 3ZKXB 1CXHA 3G6JB 1ZSDA 5FF6B 1OM3H 1A14H 1P9MC 3O45B 1W0WB 2GITA 1T04A 2VKXA 1BVKA 4JHZA 3AROA 4CJ1A 1A22B 3EYSL 1OARL 2HKHH 2CD0A 3OR6A 4NKDB 5FO7A 1DQMH 3X3FH 5I6XC 1N2RA 2DQEL 4KWUA 4U1LB 3BP4A 3SDAC 3BAEH 4U7SA 5FYKD 3U4AA 1UM5H 5D1QB 2EC9T 3BKMH 1FCGA 1UWGL 3HMXH 3T1FA 1QA9A 1A6AA 1T6VN 4MJ6B 4X6BA 4G8GD 4HKZB 3QUYD 5A16B 3WHE0 1QYGL 2EH8H 3TIDA 1B2WL 2BFVL 4PJGA 5EZIH 2JCCA 3ROLA 5K9QI 5BS0B 4GO6B 2I07B 1NCCL 3IKCB 1LE5B 3TT3L 2DQDH 3SDCC 5SWSD 2CUMA 1FZMB 3T1FB 5EOTB 2F15A 1NLDL 1EJOH 1RZ7H 4XPHH 1MWAL 1ZLSL 3BT2L 5C0NC 5JW5A 1XEDA 3DVFA 1FG9C 3LHPH 4MQTB 4LSQL 4Y8AA 3QDMD 4WNQB 1CU4H