1PKQE

Myelin oligodendrocyte glycoprotein-(8-18c5) fab-complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
121
structure length
121
Chain Sequence
GSGQFRVIGPGHPIRALVGDEAELPCRISPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDAEQAPEYRGRTELLKESIGEGKVALRIQNVRFSDEGGYTCFFRDHSYQEEAAVELKVEDPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords (8-18C5) chimeric Fab, light chain
publication title Structural insights into the antigenicity of myelin oligodendrocyte glycoprotein
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 25
structure length 121
sequence length 121
chains with identical sequence J
ec nomenclature
pdb deposition date 2003-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1pkqE00
5FUCC 3TN0B 4P2RE 5LJYH 1OT1A 3WFZA 1KG0A 4PJXF 5CKAA 1VA9A 1D5IL 4GUPA 4LEOA 3RDTC 4KI5C 5IF0A 1A1MA 3O3AB 3BP6B 3HCVB 4OIAA 3WFCL 3EOYG 5GRYA 3WNMA 1LE5B 3VXUB 3KXFB 5AEAA 4MHHI 5IEHB 1R3HA 1T4KB 4UV7H 4Z0BL 3MUZ1 4MA8H 5EUOB 3H9SD 3T1FA 4GRMB 3DXAE 4M62L 5CFHA 2UY7A 3IDYB 2ATPB 5ESQB 4OT1L 2BNRE 5D9SA 3RY6C 1SY6H 3NIGE 4HDIA 1KBGL 1W0WA 4H0HB 1TMCB 3NPSB 1KENH 5F7DA 3PL6D 1KPVA 3CLEH 2EXYD 4RFNB 4OBSA 3O6LH 3O2DA 2Z8RA 5HY9B 4OT1H 1G1YA 4MAUH 4RMRA 3MCKB 3H9HB 4B7LA 1T0NB 1UM6L 4P3CH 4XP5H 4FABL 3KYMB 5F6HJ 5MEPB 1LO4H 3MV9D 3RIFK 2R0LH 2ZCLH 3REVA 1VERA 3GBLA 3OG4B 5T1KD 3LKPA 5F1KC 1P4BL 5JPMB 5AG9A 1MCIA 2EDDA 4L1DA 4DGVH 1MAML 1R5VA 5BS0D 5E8PB 1RD6A 5KSBE 3VXRD 2YSSB 3FN3A 4GSDL 2AJUH 1FJ1B 1BZ9B 1KPUB 1X5YA 1CGWA 4JLRB 5ALBH 5SWZE 1KCRH 4K3JL 1PSKH 1T0MB 1A1MB 5IB2B 5SWSE 1I7UB 4L4JA 2J1KA 2ESVE 5HDQH 5EU5B 4FQPA 1OY3B 2VZOA 4WW1B 1AY1L 1ETZB 4RAHA 5A2LH 1YEGH 4LCUB 3BH8A 3EFFB 5JOFA 2VXUH 3PL6C 5HYIA 3DUUA 1JTOA 3KPSE 2EXYC 5IVXB 3M17B 4NO3B 3OJMB 4N0UE 5DRZA 5HHOB 2O5XH 1S7TA 3HMWH 4QT5A 5HGDB 1KB9K 4D0CA 4KK9D 2PYEB 4Y1AD 3S8WA 5EZOL 3VD4A 2FB4L 1GL4B 4K94L 2OK0H 2H2SD 4GO6B 2OJEA 1J12A 2VUYA 4R26L 2CLRB 1QSZA 4P23D 3HNVH 3N1QC 1BD2E 5F7FA 1AQDA 1RULL 2AKRB 1K8DA 1BBJB 3LQMA 4FTVA 4PGBA 3VFRB 5DR5L 3B9KA 5KVDL 1LEIA 2ZCKL 1RHFA 4TUOA 2R69H 3C8DA 4HFWA 1MCFA 4HJJL 1FPTH 3GGWA 5B3NA 5EPMA 3PABA 5LGJA 4ZPVA 2CLZA 4GG6E 2YMXH 3ZE2E 1QA9A 1S7WB 2YPLE 1LP9B 3OKKA 3S3PA 1OTSD 3TYFB 1UWEL 3TIDA 1C1EL 1AKJB 2DWEA 2C26A 1IGCL 1UM4H 1FVDB 5D1QA 4UDTA 2E9WA 1V5JA 4YIQB 5F6IC 3CFJB 3LPGA 1MPAH 2VZ1A 1HI6B 3HZVB 6FABL 5FV1L 1P7KB 2V7HB 1MCKA 3QISA 2B20A 4L8CA 1Y6NR 1GGIL 2IFFL 3L5IA 1VSCA 3JWOH 5D71L 2G9HA 3L5WA 5I1IL 3M45A 1O7SA 1K4CA 2YPKA 5F7UA 3MGAA 1F11B 2MKWA 1BHGA 3ES6B 4P23C 3V95A 1EBAA 5CJQH 3V6ZB 3HE6A 3D3VD 4Z7NF 4TOYH 4DGIH 1QBLL 3P9WB 1RK1A 3CFBB 4IOSD 4UIKH 3MYJB 4UV4L 4JKPL 3VFOA 3C6SA 2BMKA 5KOVC 1CXLA 3VFVB 4QF1B 2CJUL 4HAGA 4LSPH 4MQTB 3ZTJH 5I1GH 1TNMA 3L7FB 4XPBH 4DW2L 1AQKH 1T0PB 1VGKA 4TUOB 5I2IB 5I6XC 1IEAA 1XMWA 1OTSC 2AGJL 2W9EH 5HPMA 3ROLB 4PGEB 2EO1A 4UOW0 2DMBA 3O4LD 4OGXH 2N7BA 1A1NA 5ADPH 3IAPA 4G6KL 3FB5B 1S5IL 3ESVF 5ESAA 3QRGH 2RHEA 2VL5B 4M1DL 3CPLB 1CLOL 1D9KB 2EIZA 2FECL 4WU7A 1E6JL 3E8UH 4FQHA 2NTFA 2YD7A 1B0RA 4ZUWA 4I3SH 4R90L 4M6OH 1HH9A 4E5XA 3VA6A 3EOAB 4W81A 4F33B 3BSZH 2AJYH 5GGRB 2CKBH 4TSCL 1WZLA 3LHPH 4NCC1 5J9PB 4OZIE 1UCBL 2OJZH 3RGVA 5BZDA 1TIUA 1JPGA 4G8EB 3BW9A 2GSGB 4YDVB 5FUOL 2W60A 4YHZL 1GOHA 5C0GA 1P5VA 1J1PH 5C8JB 3WS3A 3QQNA 3HI5L 2YD6A 2IPKB 1HXMB 1CDJA 3BZEA 3BGMB 2JTDA 3SDAB 4EN3B 2AEQH 2XT1B 4PRNB 3F7VB 5TFSH 2P4AB 4LSRL 2VLJB 3VXSA 1L9MA 3KJ6H 2CO6B 4OLWL 4RAVB 4HMCA 3VFSA 3QI9D 4I0PD 5FA4B 4ETYA 4WGWB 1BJ1H 2ADJB 2MMXA 2IADB 4V1DD 5BZWB 1OF2A 5F21B 5GGVY 2G75A 4JY6B 5DWUL 5L6YH 1CTNA 1HQ4B 2JK5B 2ITCA 4WI8A 1Q72H 1WBXB 2GY5A 3DBXA 1OP3K 3WJJC 4LVOC 3MACL 2X7LB 1PKQB 4RX4A 3VD9A 3MROB 4M7JL 5B39G 5C6WH 1B4JL 4FQQA 1Q9LA 2VTFA 1BZ7B 1KELH 3MODH 3PWVA 4AIXA 3Q2CA 2NX5A 4X6BB 4XBEL 2HWZH 4GRLA 2I26N 1OAQH 5IR1A 2X4OB 5JDJA 3ARPA 4JDVB 1WIOA 3GMMB 5D7JA 1NLBL 1K6QL 2Z31D 1YA5A 3RUGA 1V3MA 3H0TB 2MNUA 2CRIA 4JE4B 2W07A 3RUGF 3NGBC 4QHNA 2IBZY 5C09A 4LCWD 3S37X 1W2KT 2W9LA 1N8ZB 1G6RL 2JJSC 4M7LL 5L2KA 3QI9C 1R5IB 1Q9KB 5DK2B 5DJZA 3VXOA 2Z35A 1XCTA 2XQYK 1OHQA 3ZYJA 5E95B 3MJ9L 1JZ2A 4FZEH 2VDLL 4LLVB 5GS2H 5K59E 2DBLH 3M07A 3LRSA 5KZCB 4HUXA 3LQAC 1LO2L 2CMRL 4LCYA 4Y16A 4K7PY 1QVOB 1WBYB 3KPRB 3QDMB 5IUSA 3BP7B 4P9HL 4URTB 3E6FA 4NZRL 4D9RE 3DRQB 2ZG3A 3U0WL 2AK1H 3ILPB 4XNXH 2HH0H 1IJ9A 3P9MB 1PG7H 5C07E 2EE2A 2V17L 1HHJA 3HG1B 5D2NC 4H26B 1YYMH 3DSNA 5E2UL 3T4YA 2PXYB 2VE6B 3QDJA 2W65B 4ORZC 4IRJD 3U0WH 2YA2A 5I17A 1ZA6B 2IQAB 3D18B 4MNQA 4DAGL 1NGYA 1JPFB 4KHXH 4F8QA 1T1YA 5IKCB 1UZ8B 4NBYB 4ZXBB 3RTQA 4I2XE 1XGPB 1S7RB 4JPVL 1UJ3B 4HLJA 4ZO8A 2EZ0C 5AUMB 1L0XA 1IEBA 1RIHL 1JWSB 3MA9H 1Q9OB 3BUTA 2VLRD 3WV0A 3DYOA 3FQNA 3O4OC 4DKFL 3P73B 2IWGA 2IAMA 1A3RL 5GSRA 1I85A 1DQTA 4KVCL 1RIHH 1I8MA 1NMCB 5BCAA 4X7FC 2XNAB 3QCTL 2B2XL 3LRSB 3PDDA 4RSVA 3QFJE 3ZZ1A 3M8OL 1A8JH 4OGYL 4KJPD 1ZXQA 4H1LH 4F58L 1N0XL 2ICEA 5D1ZB 1A9BB 4XP6H 2FATH 2XN9E 5JA9A 1G7JA 3NOIA 1SJEA 2P47B 4H20L 1FZMB 1N5YH 1OD9A 4N8VG 2UVEA 3KPOA 3MBXL 5KVFL 3IDMA 3QEQA 4NPYB 4HD9A 5AYQA 4NM4L 4MZ2A 3DARA 3G9AB 4P4KD 4UZGA 4W68A 1NCTA 2VDOH 3ZKQD 3TBTB 3GMRB 1KIRA 4HUUA 1G7MB 1FCCA 1NGWA 3VFGH 25C8H 1QLEL 1HINH 3SO5A 3T0EE 3TPUA 4MNQB 3KWWB 1N64H 5T1DH 2H3NA 1DQDH 4AENB 3ARDA 1QFOA 4Z0XA 3L5HA 4YFLI 5JHDE 1QLRA 5E24E 1QRNA 2BNUB 4X8XA 4Q6IA 1AXTL 5FB8B 1QSVA 2LTQB 3O2WH 1INEL 4YPJA 1WITA 5F3BA 1CZ8H 3HE7D 4JO4H 1Z9MA 4JFOB 3JXAA 1BEYH 1IMHC 5DSCB 2R56H 5HVHB 4FQ1L 2PO6B 1FG2A 2EH7H 3DXAD 2W0FA 1YC8A 3BP5B 1H0DA 3SOBL 4NOFA 4OQ1A 3MMEB 2BNRD 1BBDL 3MRMA 2EICA 5T1MB 2XQYG 4MA1B 1A14H 4IMLB 4N8CH 2RBLA 3B43A 3U9PH 1W0VB 4GKSA 3LQZB 4M6NH 2X2YA 1I1FB 5SX5K 3LZFH 1U8KA 4HS8L 1VB9A 2QSTA 4P4KC 1TZHA 3N1FC 1CU4L 1J18A 2FGWL 4DEPC 2ICWJ 5IROA 1RU9L 4EIGB 3QXAB 1N2RA 1MF2H 5FGBC 1X7QB 4G43B 1KTLB 4OF7A 1F2XK 2HJFA 5B4MC 4L4TB 5LG1A 4XNYL 5TDPA 1R5WB 2P1YA 3DO7A 3QUXA 3OV6A 3QWOA 2ZUWA 3ULUL 1B3JA 4EBQH 4LOUD 4AH2B 2F5BL 4KHTL 4XP9L 5A1AA 2JJTA 4AQ1B 1UACH 2VSCA 4HXBL 2VL4A 3MX0A 4XCFL 1TJIH 5E9DA 3SE8L 5JORA 3MRLB 5IVNA 1ACYL 3QBTB 2WIIB 3O6KH 4J3SA 2VXQH 2VOTA 4MD0B 1N7MH 5KSUB 43CAA 4IJ3C 3GO1L 1OARL 3KYNB 1DANT 3DGGB 4YX2L 3ZL4H 1HN1A 1QFWM 4L4VE 1H5BC 3SE4C 5FKAB 1QZ1A 5I19H 5HGHB 2IALA 2X41A 3VGAC 4EI6A 1NCDL 1JNNH 1LNUA 1A1OA 1M71B 5C2BH 4LRNL 1RUMH 3AU1B 4G8GE 5E7FA 1U92A 4QRRA 4R7NA 4NQUA 5C9KA 1MI5E 2PCPB 1L7IL 4JPWL 1RZ7H 4JO2H 4QGYA 1UVQA 1EMTH 1YNLH 4LOUC 4Y89A 4L5FH 2JIXA 4Y4FD 5J1AB 4CDHA 3O6FA 4RMTA 4LF3A 2DTML 2DQUH 4I18B 1S3KL 1Y0LA 3OXSB 1RZFL 3TT3L 3WXWL 3QG7L 3HI6H 2J8UE 1BWWA 3CIQA 4MB4A 2D03L 4HZLA 4OD3H 2R2HA 4Q7DA 4WDIB 1HILA 4OB5H 3WSQL 1F6AB 3NAAL 3Q6GH 3QUYD 4OM0H 4F8TA 1OQXA 4IOIB 1KIQB 4NWUH 3MXVL 3ARBB 3AM8A 1I9JH 1A6WH 2XOTA 5DC9B 3H6JA 2OL3H 4C4KO 1JTPA 5D7IA 3WNLA 4HG4K 5HGGS 2IGFH 1G6RA 4FXGA 5KOMC 2J3SA 1FL3A 4WV1C 3TBSA 3MJ9A 3EGSA 4QGTA 1K85A 4NUGL 3QDGB 2V5RA 5A2JH 3NCEB 5IIEA 2G5BA 4WTZA 4OZHE 2X1WL 4U1IB 3VWKD 3MLUH 4LLUB 4Y4FC 2ZUTA 3RVUC 4OCSL 3RWDA 5HI4D 1EFQA 2OZ4L 3S4SB 4BZ1L 1BREA 5F8QC 4UBDD 1GC1C 3QUKA 1OVZA 1MLBB 3L3HB 2J88H 1KEGH 4JQXA 5C3TA 3O6FB 3KXFD 4FZ8L 3GMQA 2EEBA 4XCNA 4KH2A 3RWGB 3IJSB 3UCRA 1I8LC 3ZYIA 5FM4A 2AI0L 1DBAH 2W9DH 3SY0A 2NXZB 1JGVH 2C4FT 4UTBH 2WNGA 5H2BA 5CEZE 1S9YB 5TQ0H 4Z6AT 2WBKA 5MENB 1ZHNB 3IVKB 2WLYA 4F7EA 3RAJL 4D8PA 1D6EA 4PB9L 4M02A 4PY8I 3R8QA 4JPKL 1S9XA 3FONB 5DDHB 3UTSA 4WO4D 4NQSA 4NQVA 3RFZC 4NGHL 1R3LA 1AD0B 5IFHH 1VCAA 4B0MM 4UT6H 2JELL 1CDGA 3B5GA 3SO3C 2AV7B 2CDFA 4P3DB 4XCEB 1CFVH 3F7YB 2F8VA 4KK5C 4PJBA 4NBZB 5HVWA 1UT9A 5EBWA 5MI0B 3J7HA 1LGVA 4Y19A 4E0RA 5IJVB 3VWKC 4PJBF 1P7QB 3TBSB 4YWGH 5DMGD 1C08A 1NCCH 4FXKB 3ISWA 1BGXH 2FWOB 2YRZA 3AGVA 1KJ2H 2FSEB 4JVUA 4UIMA 5J6GB 5ESVA 4P2QB 5DRWA 5GGVL 5T3XE 5JW3L 1I3GL 2P5EA 7FABL 2SEBB 1AFVH 2HFEA 4NQCB 4RWYL 1OM3H 4DK3A 3RX7A 3IDYC 5EIIB 3MV7A 3NA9L 1QO3B 2IANB 5SX4I 2CPCA 1A6TB 4JM4L 4XCYA 1N6QL 3F6LA 2DQDL 3R1GL 4AYFA 3NPSC 1JZ4A 1G9NC 4P46B 4YO0B 4XPFL 3JSSA 3VI3E 5C08B 2H9GB 2X4NA 1WFOA 2VABA 1D5ZB 2Q3ZA 3N85H 4ODSL 4WO4C 4KFZC 5SWQB 1TZIA 3DHMA 3R1GH 2X4UB 2OR8A 4U3HA 5DHVA 4EOWH 4O9HL 1KTDA 2BZDA 3HZMB 3VW3L 1KXQE 3IKCB 1LO5A 4TRPL 4HC1H 2PYED 2XA3A 2P7TB 4Y4KD 5FYLL 4YHLL 1DSFL 3MLYL 1T6VN 3IDJA 3MZGB 4DOHB 1C5CH 4UUJB 4NNXA 4OI7A 4X80L 2NY5L 3DRTB 5DMGC 5BRZA 4WRLA 1KJ3L 4WEBL 1JHTA 2E6QA 4MQ7B 4DWHA 5FYJE 1XIWB 3E0GA 4K7FA 1FYHB 4S1QH 2ED9A 3F7PC 3Q6FA 3F58H 3MQIA 4X80H 3TA3A 32C2A 3FN9A 5E2VL 4JG1L 1UB5B 4MWFA 4PRDB 1TETL 4NQTA 4XBGA 4WI5A 4K7PL 3GB7B 1CLZL 4K2UH 3L5JA 5ADOH 3FZUC 5TE7H 3QIBA 2AJZA 3EO0B 4Y4HD 4H5SA 3ZHDA 1G7LB 4PG2C 2EYRB 2NPLX 5EZLA 3ARGA 2ZKHL 4YHKH 4HK3N 4EDXA 5ISZB 3OKDB 3CMOL 3U4EA 2DI8A 4RISH 2DIAA 2XA8H 1ODAA 3QXDA 1FRGH 3LS5H 4OM1L 2XTJD 3W11D 4D9RD 1MJ7H 1T21A 5H94B 2LE9A 4OTXL 1MVFA 3SN6N 1YYLL 4GW5A 1LO3L 4PJEB 3CMOH 3BDYH 5L8KB 5DD0H 4R6UA 4YHML 3CC5A 3ULVF 1V3KA 1K5NB 1OD7A 3MRCB 2BHZA 4OD1H 1IQWH 1D5XB 3OL2A 4NZDA 3ULUF 3R06A 1IQDA 5I66A 3IFLH 3DVFA 4HAFA 1RZIB 3IXAB 5F96H 4EI5D 1EGJL 4PLNC 2BCKA 1X4ZA 5CIPA 4HH9A 4ZSOB 2IH1B 3OGOE 5H8DA 1T1ZB 1KCVH 1AHWA 3PF2A 2I5YL 2FJFB 4Y4HC 3KLHD 3QYCA 5J6HA 1JK8A 3TJEL 4FQJL 3FFDB 4L9LA 5AYUH 1B0GB 2FBJH 4N1CA 5LGHH 3L3JB 5E2TH 3MXWH 4QNPE 2GJZA 4NJAH 4ONFL 4ELMA 4HBCH 4Z7VF 3VI4F 1T22A 1KLFA 2ZSVA 1QR1A 2VH5H 2XTJC 3W11C 1CE6A 2Y1VA 2CGRH 3QFJD 4LLYB 5EBLB 5CJ8A 4M3KB 1MVUA 4AZ8A 1S9VA 1OTTD 1VFAB 4ZUVB 2AK4B 4AQOA 4BZYA 3MNZA 2F53E 2A38A 3NCYS 5FDWB 4NNYA 2YEZB 4HK0A 3QEHB 1XGQB 2CUMA 3WJLC 2QQNL 3SDXF 3V79C 3QIWA 2EIDA 4PJ8A 4KQ3L 1HYSD 3O45B 3MV8E 5JW5A 4GAJH 4NSKA 1D6VL 3J8F7 3P0VL 4YXLH 2XACC 2X42A 1JTTA 5BXFB 4P0DA 4KXZI 3C60D 2FD6L 1FN4B 1ITBB 2DQIH 5IOPA 5LGKA 1JJUA 3DTXA 2Q86B 1L4IA 3SDAD 4EN3D 3EOBB 1GSMA 3G5ZA 3WDHA 3RVTC 1NBYA 2VLJD 2R2BA 1FBIH 2A6IA 4U1KB 1J8HB 4CADA 3WUZA 1GJIA 4AEIH 3ZMRA 3FFCE 3AS0A 4KAQH 1FO0L 4X7TA 5TE4H 4HPOH 1YNKL 5CHNA 5J6HB 4Z7VB 2UYLB 4ISVA 1D9KC 4Z7UF 2H26B 2GJZB 3EJZD 2I25N 1OTTC 3LD8B 2AJXH 1CFNB 2UZIL 3G6AB 1DBJH 3L3OA 4LBEA 3QWQB 4MD5B 4BZ2L 4LAJH 3AMLA 5MERB 1HNGA 1OCWH 1T3FA 2OZ4A 3GFUA 5DMIL 1PEZA 3MRGB 4QXTA 3Q3GA 1K9TA 5J3HD 2UWEF 3P4MA 3SDXB 2DQTL 4LLQA 5E6IB 1A6UL 1FNAA 1HYSC 4BZ2H 3LSOB 5E8OB 3VXTA 4ELKB 5D2LA 5C92A 4NKOA 2E27L 4Y88A 4LSQH 1TNNA 1CLYL 5D2LF 5JR1L 4Q9QH 3SDAC 3FO0L 4EN3C 4GMSL 4G80A 4JN1L 2QQLH 1P53A 4ZO7A 2A83B 4HKBB 2M1KA 1E4XL 2NY6B 1F45A 2G60H 3CFCL 5B3JF 1NBZA 4OLVH 4OZGE 3EYOA 4Z7UB 3LV3A 3V52L 4ZD3L 4LL9A 4NM8H 4HPYL 3CFCH 4ISVB 5EWIH 3QDMD 1PLGH 3MPCA 1I1AB 4X7EC 1AC6A 1F5WA 2CIIB 2ZNWA 4I13B 1ZLVH 3MTRA 5A2IH 3OX8B 3D69B 4M6ML 4Q2ZB 3HFMH 3MJ7A 3PNWA 5J3HC 1IKNA 3K0WA 2UWEB 4L4VD 5C0AE 3KPQA 3UBXB 3QNZB 3HR6A 1A7PH 4QWWD 4NO0D 1JV5B 4OLUH 2DM3A 4NHCH 5E8EB 3EYFB 3UX9B 3VFUB 1R3KA 2VISB 3QQ4A 4LLQB 4MX7A 5SV3A 1MJ8H 4G8GD 5GRJH 3D39B 2X70B 4PJIA 5GRVK 4ZXBD 4YAQA 1JHLH 1MI5D 3WE6A 4FQXA 2YA1A 4G6FD 4RNRA 2WBJD 3S4SG 3SKJH 1QYGL 1RZGA 2VERN 3PQYA 4X9FA 5IMLA 4MDJA 3C6LD 1WEJH 4DK6A 3CMGA 3BO8A 4JB9L 4MNGE 5ITFB 2DDQH 3MLXL 5IT2H 5K33A 4DKDC 1KB5B 4JAMB 4TNVK 4TPRL 1GPOL 4O4YL 5KAQF 2Z91A 4QY8A 4WGVB 4OCLC 1PYWB 4XNZC 1A2YB 4X5WB 3RVXD 4ZOBA 4RA3A 1OB1B 5E5UB 1T1XB 1XGYH 3OB8A 5D1ZD 3KPPB 1WJ3A 1RZJC 4PJAE 1FFQA 2UVFA 4X6EA 3WIIL 4HMEA 1RJYB 2PXYC 3S88H 5TDOB 4K8RL 4X99A 3GSVB 4GAGL 4QWWC 4FQCH 4M61B 1MOEA 4JVPA 4PJHA 2EYTB 2ERJB 4BSJA 2AP2A 1ITCA 4G42A 3ZDZF 1KF9B 3ARUA 2GJ6A 4PJHF 2IQ9H 2VXTH 3MR9A 5IW3A 2KKQA 4WFEE 4HIXL 4ZXBC 5M94B 1NUDA 4MX7B 4D0DA 3CJJA 1UJ3C 2VQ1A 2WBJC 1S7SB 4EDWL 1CGSH 1FNGB 5FO7B 4PJDB 5C6PB 5GJTL 5ID1A 4OV5B 2OTWB 4KWUA 4DKEL 5KVGH 4LLDA 3PQYB 1SM3H 4F7MB 3T2NH 4K3DL 3KYKL 4U3XA 2Y25A 5BVJA 1WCBB 1NMCC 2VLME 3UTZB 1EEQA 5HYJE 2RCSL 4O2EA 1SYSA 3GSWB 4WVRA 4M4PA 3PHOB 4OAWB 2Y06L 5D1ZC 1KEMH 4JREB 1KSRA 3VMNA 3LKNA 4Q97A 4R0LC 1SYVA 4IDJL 4NKIH 3HLAB 4MVBD 3TT1H 1BP3B 1EGJA 3JBG7 4JFED 2VDKH 2DS4A 2Y06H 3VD7A 3IF1A 1CXIA 2Q8BH 4Z77A 3K2UL 3PGFH 4U1LA 4DFHA 1DVFA 4PGDB 3O11B 3ZKND 3ZSSA 3KR3H 4U31A 3FJTA 2ADFH 4M1GH 5DJ8B 1CIDA 1T04A 1QLFA 3HC0A 2AERT 3RWEB 2ZUQB 3V6OC 4KV5F 4DZ8A 5C0EB 4GKZA 3D25B 4L4TD 4J3TA 3T0VA 1KC5H 3RIAF 2LTQC 3QSKB 1VENA 4OGAD 4B41A 5ID0A 2J8HA 1M7DA 1J10A 5IESH 1OSZA 2ADIA 3WKNA 4P2OA 4HKJA 1BX2A 1OTUD 5HVHC 1JNLL 5T3XD 4XCCH 3QZWB 2XFXA 2HVJA 4RIRB 4P5MA 3GSOA 3IAGC 1JGEB 3HC4H 5I1JL 4M48H 3SGJC 4W4NA 3S36L 4QXWA 1NBVL 3P3YA 4MA1C 3MRHA 4ODTH 2Z4QA 1SYSB 5SX4H 4HGWB 3FQRB 4MVBC 4F9PA 1QG3A 2EDJA 4JG0H 1A7QH 1IBGH 1U8MA 4HWNA 4D0BB 1NBVH 3GJEA 4WY7L 5D7LA 2B1HL 2PW2A 2BY2A 2C7UA 1Z5LB 2AEPH 5EC1B 3VFMA 4LDOB 4MJ5A 5KVEH 3ZKNC 2VQUA 1IE5A 4OCYL 5ETUB 5EUOE 1B9ZA 3G6JB 5EO1A 2BJMH 4RDQG 4KMTH 1FO0A 3FB8B 1CCZA 1L7TH 2NCMA 3QJHB 5KSVB 4NZJA 5I8CA 5E94B 4OGAC 3HAEH 5FYJD 2EIBA 4C56A 1FFPB 4KJYB 4WFHE 1EXUA 2VZSA 5DD1L 1ES0B 3MUGA 1OTUC 5E03A 4YE4L 4FQ2H 3LKSB 3W9DA 2Y4SA 1MCPH 4P5KA 3TFKD 4OF6A 3N9GH 3RWHA 3ARFB 3SJVD 1JPSL 4OCRH 2AV1B 2DWDA 3L3IB 4PJXE 3HPLB 1WK0A 4MQSB 4JHAH 4XNMB 3U1SL 3GHEH 4AT6B 3EYUL 4ZFGH 4OCMC 1TDQA 2XPGA 4G6JH 1EPFA 2P43B 15C8L 1QNZL 3T2QA 4LDLB 2VDNL 1YJDH 4PJ7B 3BKMH 2VR4A 4JGJA 1WBZA 3GUTB 2F8XC 3DV4B 4PGZA 4QRTA 1BFOB 3PWPB 3OAUH 3MGTA 4LPWA 1RZKC 2MKLC 1IAII 2R0WH 4MLSA 4JY4A 1P69B 2GTZB 4JQVC 1G9ML 3ZSTA 4FFYH 3TZVA 4PP1D 4P9ML 2HFFA 2YOCA 4IMKA 4DVRL 5GHWH 4HV8B 4U6YB 5DUMH 3V6BR 3D0VA 1R0AL 2B4CH 4LFHG 3P9LB 1RVFL 4AMKL 1S8DB 3TVMB 1HHGA 5DVLA 4JZNB 4I18C 1NDMA 1RIVH 4N0CD 1ZHLB 4O51A 4J8RA 1FLTX 2CIKB 3EYSL 2E7MA 5TE6L 5DQJA 3MV01 4UMGA 3CDYA 1SJVA 3NIDE 5F1IB 2FLBT 3CSPA 4XHJC 4HT1L 3TCLB 2DQJL 4KRNA 1KLUA 4HQQH 2AXGA 2FR4B 3WHXB 2NXZD 3W9DB 1E28A 5HYSB 3VGBA 4CU8A 3O3UN 4LRIC 4PRBA 3TF7C 3GK8H 2FHFA 4LLMB 4HUMB 4DVBA 2OM5A 1HDMA 4OZFB 2Q20A 4JFFB 4PG9B 4G8IB 5KW9L 2C1OB 2XPGB 5FF6B 1IGIH 4DCQB 3W0WA 2X09A 5C2UB 1VGEL 1ZEAH 1RV6X 3WNNA 1WF5A 1HWHB 4Y5VA 3UJTH 1TZGL 5JZ7D 2F53D 4KRPB 4ZFFA 1EEZA 3BE1L 3MRJB 3H3PH 4G8FA 4PP1C 5GS0D 1NGQH 3UYPA 4KZDL 1UKQA 4TSAH 1IM9B 2AQ2A 3PHSA 3KYAA 3L3KB 2X4PA 2ENYA 3LEYL 3TZVB 1G7QA 3TBWB 2D0GA 1EFXA 3GRWL 1K3ZA 4FFWC 4A6YL 1U6AH 4M5YL 4P2QD 3KNBB 4PRPB 3SGKA 5JXED 2FO1A 1FAIL 3DECA 3WNKA 3BP4A 5CP3H 5B38B 4KXZH 1NJ9B 4NQCD 5SWSA 3BQUA 2NXZC 4IEFB 5IW1B 4CVXB 1BIHA 1YEIL 5GS3A 2F5AL 3FFCD 5TJWK 5E00B 2NY2D 4XGZB 1NCAL 4IRSA 3B83A 3G5YA 5C08D 1F42A 5IMOA 4PIRF 4KY1L 3FOLA 3MUJA 1NEZG 2F5AH 2IH3B 3MLSH 2OBGA 1QFUL 4IIQA 3JTSB 5EORH 4FTVE 4JANB 1AE6H 3CK0H 5EO0A 2AJVL 5JZ7C 2WZPD 3O9WB 4L3EA 5MI0C 3UBXG 4N1HB 5I1HH 5IK3B 5EUKB 2FX8H 5GS0C 4P48A 1I9RH 2QSCL 2Z93B 1OP5H 5HHNA 2V7NB 3CDGB 1MWAH 5CGMA 4HWZA 2ICWB 2B7DT 4TVPD 5GSVA 2GT9A 1V7NH 3FO2A 1T20A 1XIWD 3UTTA 1XH3B 3P4OA 2LAGB 2DICA 2BNQA 4XPHL 2EYSA 2GFBA 2DQFA 5JXEC 4IBLT 1A6AB 1RURH 1JYVA 3EJJX 2DD8H 4XPGL 3B6SA 1I1YA 1U41A 5EZIL 1UWXH 4X9BA 1DQML 1VHPA 2CK0L 1KXVC 2GK0A 3PWLA 4Z7NE 1FYTA 3RVWD 4YLQT 1NFDB 1UG9A 4UT9L 2YPLA 4XWGH 3MA7A 1A9EA 1KCSH 5EBMB 3TESA 1PFCA 4KDTC 3DIFA 4Y2DD 5F88B 4CGTA 1F8TL 4FFVD 5ISZD 3SDDB 1MREH 1U93A 3T8XA 5CZXD 2HJKA 4W6XB 2A9ML 4HS6B 5E4EC 2AJSH 4WNQA 1W72H 3T4AA 3GBNL 5F7EL 5KANG 4I4WB 4PLKC 4P57A 1G1CA 1OGAB 3FB7B 3OKEB 3LDBB 5GISH 5JNYB 2FX7L 4JFYA 2K9UA 2F58L 4PLJD 1FZOA 2O5YL 5DQDL 1L6ZA 4AY0A 1VFBB 4PTTA 1XIWC 3MLWH 1PQZA 3H9YA 3N50A 3RVVD 2X1QA 4XVUD 2X4RA 3DHJA 3KPNA 2E9BA 1FIEA 3K7UA 4PR5A 3OJDA 2AQ1A 4NN7B 3IDNA 1C7TA 2PW1A 4X5XA 2R23B 3BRFA 4CMMA 2DF3A 5I30L 1UXSB 3DVGA 3VFNB 4QLRA 4NP4H 1C5BH 3MRNA 4K9EH 3BESR 3QB7C 3LOWA 1CD0A 1FVEA 2ZG1A 4XBPB 2QQKH 4NKMA 4F2MA 1UENA 3FOMB 4FFVC 5IWLC 2FRGP 1I75A 5I1AB 4WW2F 3TBYA 3KAAA 4L8DA 5CZXC 1KB9J 3VFPA 4NCDA 3QH3A 4BQCA 5DRNA 1CGYA 2VDQH 4X6CF 2XZZA 1CICA 2B0SH 5GGSB 4JRYA 3FO9A 1QBAA 1U93B 1XR9A 2GQHA 3R0NA 4C4KT 2AK4D 4AM0B 1F4XL 5C0ND 3HMXH 5I8KH 4HIJB 2FZ3A 3CFDA 4HWBL 5F44A 1ZANH 3V0AC 3MRQB 4HX1B 1NCWL 3VXSE 1J9CT 3RVVC 5DI8B 1MFBL 3U30B 3MJ8B 1HZHH 4ERSL 1NGXB 2OCFD 2RIKA 5JO5B 3OPZL 1HWGB 2E8ZA 5J8OA 2OP4L 4MJIB 4IRZH 4LFHD 1X5HA 4LEXL 5GGQL 2VXVL 4PJFB 1U8IB 3H42L 4EQ3A 4U49A 4ZAKB 5C0CA 3VDAA 1IVLA 43C9A 4XVJH 4PR5B 4O2CA 3TCXA 1MFDL 3HKFA 1J8HD 1RUQL 3WL9A 4O58L 4X5XB 3QZWG 4PTUB 4CVZB 2DKSA 5DURB 5E8DL 2A2QT 4JFZL 3GJFB 2H32H 2X1XR 3VFTB 1X3DA 1PX4A 3RA7L 5FYKD 5FO8A 2NX5E 4WW2B 3OJVC 4LGRB 1YY8A 2FHCA 3O8XD 2FIKB 4YDKL 3NFSH 4U6HA 4F2MB 5EG6C 4OBRA 4X6CB 4XPTH 3RZCA 1EUTA 1DE4B 5GGTL 2GCYB 4OF0A 3VGEA 2FYYB 5C0NC 3DVNA 2HYMA 4MD4B 4QRQA 5EU6B 3RUGE 1RMFH 2BSRA 2FJGB 3ULVC 4U1GB 5CMAB 3S98A 1FH5H 2E8YA 4I3RH 4ODHL 4PY8J 1OAYH 4JRXB 3H9ZA 1MQKH 1R3IL 4ODXB 3MFFA 2JB6A 2Z92B 5C09E 5E6ID 2ATKB 2CKBB 1R24A 5TDNA 2LVCA 3S37L 4NUJA 5L2KE 4G9FA 4PRIA 1IL1B 1YMMA 1YQVH 4ZS7H 3BIKA 2VJXA 4UQ2A 4C55A 5IG7B 3LIZL 5HJ3B 5LKNA 1NCBH 2RGSA 1HHKB 4NQDD 3PWNB 4MA3B 1XCQB 4BELD 5C0DB 3D2UB 1W8OA 1A0QH 1A7NH 2ARJQ 3V2AR 1MHEA 4DTGL 5DMKB 4ZDHB 4WU5B 3D6GA 4HHAB 2DBJA 1QSFA 2QLVB 4ZODA 4X6DA 4C83A 4QRSA 1F4YL 3BKJL 4R4FH 4NRZA 7CGTA 3O8XC 1G7PB 4LSDA 4KUZL 1A3LL 3QDJE 5FKPB 3C2AL 4X6DF 3QJFA 2HKFL 5M95B 1I7TB 4XMPL 3LD8C 4O2FB 4UOJA 4S1RH 1IGFH 4GQPH 1AGCA 3QXUA 4MNQE 5IB4B 2YXFA 2FL5A 3F6IA 1MIEL 4KGJA 4P4RB 1CE1L 3ME0A 4F9LC 3HA0A 3G9VA 1M7XA 2XXCB 3A6CL 3PIQB 5DMJB 3UAJD 3GRWA 5L2JA 1MCRA 4A6YA 4BSVB 4APQB 5E6IC 4CN6A 2EH8H 3B9EA 4WUKH 2X5PA 5ERWB 1T5XA 3WN5A 4AJ0A 4RBPH 5B8CB 2X1OA 3RNQB 1FFOA 2YN5A 3GI9L 5MP6H 1U58A 1A64A 4Q6YA 2PTTA 2MPAL 2A9NL 3C8KB 3EFDH 2HVKB 4OCNC 4UQ2B 2V2XB 1BWMA 1IKFH 3IRZA 3QPXL 4JZJB 5ICXA 4HMDA 2VQTA 3TO4A 2P48B 2NNAA 1TVHA 4WJ5B 1TCRB 4BFGA 5CEZH 1URLA 5CGYD 1RK0B 1I8KB 3DX9B 4WFHD 3S3JA 2NY6C 5DEFB 5IEKB 3VFWB 5IW6A 4OQTH 3MUY1 4MDIA 2A1WH 4WEMB 3VDCA 4G7YL 4E9LA 5I71B 3FMGH 2CD0A 2EE9A 5DUPH 1DBKL 3LN4B 1QSFB 4P59L 3SCMB 4P5TA 3QG6B 1YNTA 5HYSG 3LPFA 5JW4Q 3CDCA 4LARH 1I3RA 1CL7L 2F54D 3D85B 1NAKH 1MHCB 1I7ZA 4OZFG 3TM6A 1ADQL 2NMSA 2X4SB 3LVEA 5I74B 1XGTA 5CBEA 3UAJC 4OCWH 2JB5L 4TNWK 2X4QB 5F9OH 3GMNA 3WMSA 4DN4H 3EW3B 1AGFA 3T3MF 4D9QE 2BOBA 5FECB 1RIUL 2OQJB 4HCRL 3T0DA 1DEEB 1QRNE 4OIIL 1TJHL 3I3EA 5FA3A 3MCLH 2VLKB 5AD0B 5T3XH 3BXNA 3OF6D 4F3FA 1S5HB 3VRJA 1RIUH 2IPTH 1ONQB 3P30H 3VG0H 4S1SH 5IBTL 1IAIH 4WWKB 1N5AA 4NYLB 5CGYC 1JPST 3QEUB 4R4NC 1BJ8A 5CCKL 5DQ9A 3KS0J 4QEGA 1IT9H 1OPGH 5IQ9A 5IHUH 3CXHK 5E08L 3T65A 5F1NA 4ZMAT 5B38G 4MAYB 1AO7B 2D7NA 1KN4L 2CUIA 3BN3B 5FHBL 1YMHA 4JZOB 4F7TB 5DJAB 3INUL 3MC0A 3O2VH 4M7KL 3UPAA 3WFEH 3STLB 1XAUA 1A7RL 3MGOB 4Q74A 3O0RH 3HUJB 4LCCB 4YHOL 3CSYB 3RWFB 5DF0A 4H1LB 1NC4B 4I77L 5EN2A 5FYJH 4CMHC 5K9KA 3ABZA 1HHHA 3RU8H 2NY0B 3CUPA 4KPHL 1CDHA 2QV2A 2ID5A 2ERJC 4G7VH 3BYTA 4BSWA 3WEXB 4Z7OF 3QUMH 3RDTA 2HLAB 3WFBL 5TH2B 1CFBA 2ZCHH 2GJJA 4Z7WF 4JKMA 1NUFA 5ACZB 5K9JH 3VE0B 1MCCA 3GEWB 4KI5F 4X4MA 4XAWH 2NLJB 5KS9A 3C5SA 5E9DE 1Q0XL 4NT6B 4JM2B 4PP2A 4MNHB 1WT5C 1KJMB 3GJFK 3MREB 5KS9F 3ROOA 3FCTA 4W6YB 1U95A 3RY6A 1EEYA 2XWJA 1FVCB 2EDWA 2N4IA 4XVSH 3UYOD 1U8NA 4NFCA 2Q76B 4WIQA 1KTKE 1TTGA 3T65B 3VRIB 4WUUA 1A22B 1BFSA 1J05B 2DJUA 1BF2A 5I15L 4JFXA 4H8WH 5D7SL 3MLZH 4HWBA 4AEFA 3X13B 2YBRA 5TF0A 1IM3A 1NGPH 4PJ5B 1QSEA 1Z6JT 4R3SB 3L9RB 3R4DA 2K3TA 3IFOA 2R8SH 4LVNB 3LQAL 1FORH 1X5KA 1YPZA 5I1EL 4QRRE 4XPAL 4EUPA 5DVOA 3G08B 5LAXA 4S1DD 3ZKMC 4EIZC 1YPZF 5IBUB 4ZFZA 1NFIA 5FGCB 3QFDA 3B9KD 3IJYA 5AZ2L 2JCCB 1CBVH 3HRZA 5I1EH 4Z7WB 3CVIH 3UJJL 4NKDB 4X9HA 4JN2A 5IB5A 4YDLB 1TXKA 1VACA 1KIPA 2ZUQC 5E0QA 3P11L 4D3CL 3VXMD 1DUYA 3CVHL 5HI3D 1RJZA 1GOFA 2CDGA 1OP9A 4E41B 2YKLH 5I76B 2VWEC 4OLXH 5HXMA 3H2WA 35C8H 3PJSA 4NOBA 1IAKA 2XKNA 5D1QD 5GGTA 3PL6A 5EOTA 4Z78B 3T77B 3P11H 1ZT4B 3HPJB 5DK0B 5DJ0B 1EUUA 4AL8L 1QOKA 2XZQH 3QNYA 2BVEA 3O3EB 4HH8A 3DI2B 3VXNB 4MJ6A 3RL1B 3FTGB 4HUKB 3MV9A 3UPRA 3ARFD 5D7IE 2HJLA 5CEXB 3HNSH 3VWJB 3W39A 2BOCA 2DKUA 4Z76A 1A6ZA 4G5ZH 5GS0H 3HE6D 3ILQD 5CINL 5HSFA 1KT2B 3C9NA 3LEXB 3BPCA 3DETD 2XXMB 2FJHB 1ND0A 4ZUUA 4M5ZL 4HWUA 1VEMA 4QRUB 3S7GA 2I07A 2H8PB 2APTA 3SGEI 1OAKL 2ADGB 3MRBB 5DJDB 3WIFB 2H6PB 2IANE 5HHXH 5HI3C 4TQEL 1A4JA 1ZLSL 3BN9D 2X4TA 3DGCR 3H9SB 5DUBB 3TVMD 3JTTA 4HFUH 4K71B 2FBOJ 2NZIA 4UDUB 4N0YH 1TPXB 2DQCL 1JE6A 1CDCA 3WFDH 4PFEA 5DRXA 3LMJL 5I1KL 2WWKT 3GMOA 1MHPL 5BV7C 1LEGA 1MCEA 4M7ZB 5D96B 3ARFC 1ZHBA 5GIRB 2YPVH 3DLQR 2YWYA 4X98A 2YRLA 4DQOH 3GZKA 3FQXA 3VXQA 1X5FA 3V5HA 3HE6C 3EAKA 1SQ2N 2BVOB 3EYQC 3BMWA 4PJBE 3MV9B 3ILQC 4TUJB 3UZVB 3EYVA 1E4KC 2OTUA 3OR7A 4P23A 3RGVD 4XMLH 3I3DA 3VGFA 1P84K 1RJLA 4Y19E 4YHNA 3WUWA 5T1KB 3G5XA 1T2QH 1NCNA 3DETC 3MLTA 2K7QA 4XX1E 4J23A 1F6FB 5BS0B 5JMOC 3VXRB 5FEBA 4EVNA 2EIEA 2Y5TA 1F4WL 4PS4H 5ICZB 4EQ2A 2OL3B 4FFZL 4QOKA 4P3WA 2E9JA 2P5EE 1NBQA 3V0VA 1P4IL 1IM9D 3UTPE 3DX7B 1RAMA 3K74B 2DQGH 3MV7E 3TVMC 3BUYB 3D9AH 1S9WA 1VKXB 2X10A 3A6BH 5GGRY 3DV6A 4DJMA 1QBML 3CD4A 4OUUA 4R96A 4XRCA 1Q94B 4LCIL 1YN6A 1ADQA 1XZ0B 5FUZL 5D70H 2HFGH 3TNMA 1LE9A 3V4PH 3L3GB 4B5EA 2K7PA 4RX4D 5C0BB 1OLLA 2Y7QA 5E8NB 3DUSB 3UTOA 1J88A 4HCRA 2BVQB 2OS7A 1ZVSA 1C12B 3D3VA 5DT1L 1F3JA 5DYOA 3SKUD 4Y1AB 1IEHA 4NQEA 2BDNH 2VITA 3V5HB 4HF5L 3U6RB 1AP2B 4GRLD 3PXJA 2LFGA 5BRZE 5HDBF 5D6DC 2LV4A 4HG4J 4YDJA 1JGUH 5DK3A 4Y2OA 1DUZA 4G6AD 5A16B 3QDAA 2VR5A 4KRPC 4KQ4H 3P2TA 3DPBA 2XZAL 4KTEH 2LQRA 4JFDB 1LK3H 1YECL 1HHIB 5IMKB 5C70A 4UAOB 4ODWB 4NZUL 3W5NA 5FK9A 3BIAX 3BGAA 5C9JA 3O4LA 1JI1A 4JCLA 1JUFA 1UXWB 3MOBL 4OFYA 2KL6A 1SHMA 1K2DA 5BJTA 2WBWB 4QHMA 2FEDC 4O5LH 4DGYH 5ELIA 1QQDA 4NC1C 4Q9RH 1S78D 2R4SL 3HR5A 4LSUH 5CLWA 1KJ2B 3UTQA 3GMPA 3IDGB 1XR8B 3WJJA 4M9PA 3PP4L 4K7PX 4IS6A 4JPIA 2PYFB 4I48A 3AREB 3JVGC 1DLHB 5EU3B 2AQ3A 3MRFB 1K8IB 3PGDB 3ALWA 5GJSH 3ULUE 3RPKA 1KFAL 1WTGT 4U7MA 2BFVH 1ZT7B 4M1CC 3U7WH 5IQ7L 2BERA 3EDFA 2O5ZL 1NAML 1S9KC 1HH6B 3D3VB 3TBVB 5CBAB 3SDDD 1KLGB 2YC1B 2Q87A 2DYPA 3CCHA 2BSTA 1KFAH 4QHUA 1INDL 3TIEB 2Q8AH 4LPXA 4KKBD 4WTZG 4UILH 3X3FH 1CFTB 1MJJA 5F3HA 1M6OB 1IC5H 4QTIL 3CXDL 3ZT5A 2AABH 3F12B 3I02A 3SKNB 1S7QB 4CNIB 3GSNL 2D9QB 3PWUA 3VI4E 2VNCA 1I8IA 4PRHB 3FO1B 2W0LA 4TTDC 1S78C 4G3YH 4MQXD 4ONHB 4ELME 2H2PC 3UEZA 3SE9L 4YHIA 3GSNH 4U6VL 5C0RH 4Z95L 1OQOA 4PYHA 1MSPA 4M6AA 4FP8L 3ARWA 1YEHL 1T1WB 4ONGH 1GC1L 3PE9A 2QR0A 4H25A 1CDIA 4I48B 1R3JB 8FABA 2ZOKB 2J6EH 4PUBH 3SDXE 2CO7B 3IU4L 5D2NA 3SDDC 3VD3A 2R1YA 4F57L 1P2CB 2IG2H 3QEQD 4HUNB 1KGCD 4MXVF 1II4E 2F19H 2P8MA 4YR6A 2Z8VC 1JZ6A 1DFBH 2H41A 3U4BH 4KKBC 3CVHA 1C16A 3JWDH 5I8EB 4MXWH 4H1LG 5E56A 4IHOB 2CRZA 3LDBC 2D7PA 2ZPKH 4YXHH 4ZOAA 1UGNA 4HWEH 1R6VA 4G6MH 3KDMA 5GRUL 3Q1SL 3VU2A 3DX6A 4LCWA 3BVNB 1F00I 1I4FB 5AZEL 2WK2A 1RZ8B 2HRPH 2Q7NA 3X17A 3L5XL 3GHBL 3U36B 3DMMB 3NGBB 5JMRA 1I3VA 4MQXC 3BHBA 5I1CL 4MJID 3QI9B 5HPOA 3PWUB 4I0PB 4NN7C 5CZKA 5IM7B 1AXSB 4XNQB 4LU5L 4V1DB 2BVPB 3MRRB 5DS8A 4YXKL 4ZAKD 3L3DB 5GGUA 2GUOB 2EEAA 1WZMA 3RY5A 1NUNB 4JHWL 1GHFH 5DD3H 2GHWB 3FT3A 3C5JB 3MNWA 5D6CA 1UKSA 4M4RA 3MBEB 4G9DB 2DAVA 4RFOL 2N7AA 3A67H 2LABA 2GITB 3W2DH 4ZFOB 4HSQA 4HKXB 3L7EB 5D2LE 4WEUD 1G9NL 5F9JA 2KZWA 3LEVL 5EU6D 2ZG2A 4OCXL 2Z31B 4LAQH 1IFHL 2V9RA 3WDIA 3JWOC 1NLDH 3CVHB 3MLRL 5IBUG 4NWTL 3SHSA 3FQUB 1DL7H 1U8QA 1T66D 3G6DL 5B3JE 3U2SB 1DQLL 4UI2A 3QUXD 3BMVA 5CD3A 1MLCB 4QRPB 4OJFH 5TGBB 1QEWB 3GBMH 1HSBA 2DTSA 2NW3A 1OAZH 3MRIB 4X4YB 1VADA 2V2WA 4X6FB 4NNPH 5EO9B 3O4OB 4ZAKC 1HYRC 1BECA 1CGTA 3T08A 4LNRA 1BOYA 3WIHH 3RWJA 3HZKA 2XRAH 1FZKA 4RGMB 3O6ML 2Y6SC 4KJQD 4KUCD 3QA3B 1A5FH 1GH7A 3GNMH 3JV6A 5INCB 2P8LA 5CZVL 1FIGL 1HCFX 2DQEL 1A6VH 1CG9B 1F2QA 3QIUD 5EOQL 2YUVA 4WW2C 5CEYB 1D5MA 5BMFL 3RI5K 3NCYP 3K81A 3U9UB 1JRHL 4I9WE 3IXTB 3IJHB 2Q6WA 2XZCH 1UWGH 5CZVH 4IRJB 3AXLA 4U6TA 2AXJA 4L8BA 4K3EL 4U1GC 2P46B 3B2VL 5FGBA 1FGNH 4LLAA 1KV3A 1IAOA 4N9GB 3CZFB 4ODVL 4GT7A 4ESKA 1A02N 4APQD 1MCOL 1MH5B 1EZVY 1V7ML 1ZWIB 1HOCA 4FNLL 4NJ9H 4XC3L 5ANMB 3RIFF 1HEZB 4WI6A 5EA0H 3PWJB 3PQYE 1PBYA 1E4WH 2JIXD 3PDOA 3FB6A 3GKWL 1A7OL 1NMBL 1U8QB 1FDLH 1V3JA 3DURB 3CH1B 1T2JA 1WGOA 1E6OH 3O2DH 3NTCH 1G7HB 1OAXH 1EERB 2CDEB 3UO1H 2VLRB 3VH8B 1K4DB 5HVFB 5EU7C 2WUBL 3NZ8A 2P5WB 4KDVA 5FYLE 4NQXB 4ZPTA 4HKZA 2XG4A 1J1XH 1U8HA 1XGUA 2DQHH 2XQBL 4W70A 4KJQC 3V5KA 3K2MC 3KLDA 4YK4C 1FAKT 5LXGL 4NZTH 1L0QA 1RUKL 3BT2L 2BVTA 3QIUC 1LQSR 3GIVB 5E6ZA 3NIGF 2FECI 4ALAH 4U3CA 2ZNXA 5CUSL 3LKQB 3VDBA 1S7XB 3U0PB 3KHQA 1H5BA 1SBBA 4PJHE 3ZT7A 3SE4A 3X12A 1WISA 3D85D 5AWNH 2GJ6E 2PTVA 4P4KB 2QQQA 3AC0A 1FLRL 1AR1C 1OWWA 3OKOB 4YQXH 3OHXA 3IFNH 4HJGA 5I1LB 2OMBA 1PGRB 4P2RB 4APQC 1VEOA 2VLLB 1BOGA 1AD9A 4PJAA 5EZJA 1YEEL 1AJ7L 4RGNE 4FMKA 4D9LL 1NC2A 5B8CC 3LKRA 4J3VA 2DLHA 4JJ5B 4EKXA 2A6JA 1SEQH 5HHQA 2VLKD 2RFXA 3REWA 3VCLB 4UINH 4GOSA 4JZJC 5E6YA 5DHYA 3OB0H 1GZPB 3HE7B 3GI8L 3SGEH 2NY3B 3X3GH 4YGVA 4CU7A 4KDWA 5HHVL 1NAMA 3QUZA 1GGBH 3DXAB 3K4AA 4FQLH 1I7RA 5I71C 5D5MA 5JIIA 1MFAL 1MIML 1IC7L 5EFIB 2BNRB 1ZS8A 2DIBA 1U2HA 4MAYD 1AO7D 4Y8DC 4DUVA 1DBMH 3SKOA 2A6DA 3SCMC 3AM8C 5B39A 3RBGA 3EO1A 5D5MF 4JFQA 3MOAH 4ORGA 3UTSD 4KZEH 3W9EA 3WLBA 5LQBL 1RFDL 2J5LB 4LMQE 4BK4A 2Y07H 3WLWD 1OSPH 4HIIB 4LSVL 2D31B 1ZA3B 3P4NA 4EXKA 1ED3A 4HW6A 5C7XL 4WWID 3GSNA 4XAKD 1WC7B 3QULB 3VGAB 2R0KH 4KV5E 2XICA 4QHLB 1Q1JH 3BAEL 4Y19D 1YEKH 3NPZB 4M3JA 4M00A 1NC4D 3DX8B 3VMPA 2E7HA 2NY0D 3MNVA 5INDB 3G5VB 4N0FA 3I2CH 4Y4FA 1JN6B 5EZJB 3H7BA 1UYWL 2BC4B 5KSBB 2P45B 3S35L 2F9BT 2XIDA 5IVZA 5SWZB 4QXUH 3V5DB 5ITBH 2EKSA 2QKIB 2ZUXA 5T3ZL 3RNKB 1I8LA 5IHZB 1L0YA 4ZTPL 3STZA 5JIHA 1H3PL 4JM2D 2ESVB 4ZYKB 3E6HA 1RUAL 4J3WA 3ZE2F 5C86A 4WCYH 5H37H 1P4LA 5D1XA 2R2EB 4PY7B 4F37K 4MAYC 3OGCB 1TENA 4RAUB 2R1XA 5IGXH 5LWYH 4YFDB 3KPSB 3FT2B 2MCPH 3QP3A 4PJCA 4TSBH 5IV2B 1P1ZB 4HUWA 3BFOA 3ECBA 4Z7QF 4N0UB 5D7LE 2CXKA 4ZUTB 3VA2C 3NACH 5F93C 2VB5A 3LH2L 5F7LB 4X8JB 4U1SB 3V4VL 4LCCC 4PJCF 5TQ2L 3S36X 4MD5A 1IGML 4OFDA 5I8OH 3TN0A 4GW1B 3QXWA 2NY0C 3TGXA 1BVLB 5BRZD 2KH2B 1BD2B 4WV1B 1CT8B 3OBAA 4OLZL 4C56E 1JWUB 2WUCH 1M1SA 3O3AA 3BP6A 3HCVA 1WZ1L 1J5OH 4RA0C 2VIRB 1LE5A 4YNYB 3KXFA 3VXUA 1KCUH 5IEHA 4KRLB 3RRQA 1T4KA 3SBWA 4XP1L 4X4XB 4GRMA 4JM2C 2PR4L 3I6LE 3V4UH 4QHKI 4MS8D 3NFNB 4GG6B 2ATPA 2R0ZL 5ESQA 4N5ED 2APFA 4YPGB 3AAZB 3QIBD 2OYPA 5KTEH 5E2WH 4U1MB 1OAUH 4OLYL 4CU6A 3ARGD 3QO0B 4GXVH 4FG6D 1KN2H 4PBWD 3QUYB 5HY9A 3I9GL 3LKOB 1T80A 4WO4A 2P8PB 1UM5H 3BKCL 4GG8B 3H9HA 1T0NA 1T5WB 1FSKB 2YN3A 3KYMA 5EOCH 5IMMB 1SBSL 5MEPA 2GAZB 1Y6KR 2VDPL 5HGAB 1TJGL 2QHRH 3VWJD 4DN3L 4LVNC 3RWIB 3I9GH 3T3PF 2UV3A 3ULUD 2O93L 1YQ2A 4X5LA 3SQOL 5JPMA 4LSSH 3SDCB 3EO9L 5FHAL 1MCNA 4OZIF 3C2SA 1HSAB 1Z0NA 2APVA 1EX0A 5E8PA 2YSSA 1T89C 1FJ1A 1BZ9A 1KPUA 3VWKB 1RZJL 4JLRA 5L8LB 1ZGLM 1EAPB 2NY7H 1S7VB 3CNKA 1N3NB 1T0MA 4Y8AA 4YDLC 5IB2A 1I7UA 3AB0B 1GCFA 1MNUL 4KKCD 5EU5A 1D5IH 4MS8C 1BFVL 3WBDA 4N5EC 4WW1A 4KTYA 1ETZA 2KZ1B 3KYOB 4UQ3B 4IOFC 4LCUA 3EFFA 3WFCH 1MHHB 4PG2A 4FG6C 4O00A 4YUEL 4NRXB 5IVXA 3M17A 4NO3A 1ZAGA 3HAEB 5C0JB 2WQRA 2M8XA 4Z0BH 4S2SB 5HHOA 4M62H 5ABDE 3W0WE 5IVXF 3EZ8A 5C0IB 3SDYL 5HGDA 1JMZA 4WO4B 3VWJC 2PYEA 4Y5XB 1KBGH 2ICES 3EOTL 1EEUA 1ZT1B 1ZLVK 1H15B 4M43L 2CLRA 4N8VB 1TITA 1OGTB 5I16B 1AGDB 4UB0L 3GIZL 4MCYB 4OZIB 3GSRB 1GGUA 1DBBL 2AKRA 4X7CC 5ALCL 1UM6H 1BBJA 4FABH 4PJ8D 1CFQB 2A74B 3VFRA 1A21A 3TV3L 4NHUB 5CJXA 3NN8B 4NO2B 2ORBL 2ZJSL 4KKCC 1P4BH 2Y72A 1MFEL 4OGZA 5BOZG 1MAMH 4GAFB 2X05A 5CJOL 3SKMB 4R2GB 2VDML 2X40A 1S7WA 1LP9A 3TYFA 4GSDH 5DFTA 3IETB 1AKJA 3S5LB 3ZE0F 4K71C 5CJBA 1IARB 5CJ5A 1FVDA 1TPXC 4K3JH 1MFEH 4QKXB 4YIQA 1LP9F 3NH7L 3CFJA 4PYGA 1HI6A 3HZVA 1P7KA 2V7HA 1T7XA 1BM3L 4M7ZC 5D96C 5HHME 1U9KA 1F4AA 1AY1H 3MZTA 3U7AA 3UJIL 5C0BD 4OUOA 3K80A 1U8OB 1F11A 5DVNA 3ES6A 4L3EE 1YUHB 1XF3B 1NSNL 3V6ZA 2DJSA 1DLFL 2WIMA 4RFEB 1MRFL 4NRYB 3BWAB 4OD2B 4Y4KB 4LPYA 3CFBA 4PJ8C 3MYJA 2VKWA 2HG5B 2MHAB 3GM8A 5JQ6L 3UTTE 3VFVA 4QF1A 5EZOH 2FB4H 2BNQE 4FS0A 1EBPA 4K94H 4JR9L 3CU7A 3L7FA 1B0WA 4R26H 3TPKA 1EJOL 4JFDD 1UQSB 5I2IA 1FV1B 1RULH 3NCJL 1U8JB 1U8LB 2IBGA 3ROLA 5F6HI 4NC2B 4U1HB 4PGEA 5DR5H 3VH8G 4WI4A 5KVDH 1FYTE 2ZCKH 3RJQB 1TVBB 5F72S 5D93C 1MJUL 3FB5A 4IDLA 1MY7A 4HJJH 4Y4HB 5E5RB 2KUTA 1AC0A 1QUNA 3OKMB 4MSWB 2ZSWB 2VL5A 3CPLA 1D9KA 1HXYB 3B4NA 4N90E 1UWEH 3HC3L 4LQFL 1C1EH 4BH8B 3ARED 4CRPA 5I0DA 1IGCH 4GKNB 2I9LB 3F5WB 3EOAA 5LCVL 4KK9C 1ZGLB 4F33A 2XTJB 5GGRA 5J9PA 1Y18B 4QXGL 2H2SC 1JGDB 4BQBA 1EO8L 2Z8WC 6FABH 5C07B 4G8EA 1OL0A 1KUMA 2VO5A 2GSGA 4YDVA 2XWTB 4I9WD 5C8JA 1GGIH 2IFFH 1MUJB 5A2KH 1ACZA 5D71H 2IPKA 5I1IH 2X44D 3NVQA 2D2OA 1HXMA 4XVTL 1J1OL 4JDZB 1YY9D 4EI5B 4QTHB 3BGMA 1QBLH 3SDAA 4EN3A 4PRNA 3F7VA 4UAOC 4FQXD 3BZ4B 2YK1L 2VLJA 4I2XB 4UV4H 4JKPH 3TWCL 3ZKXB 1JGLL 1Q0YL 4RAVA 1GIGL 1B2WL 1RZKL 2CJUH 5FA4A 4P49A 1MWAB 2ADJA 4YHPB 3SGDI 2IADA 5DXWA 2R29L 1MFNA 4PRHD 4DW2H 5BZWA 3VGDA 4YZFF 1CK0L 4TN9A 4JY6A 2DM2A 5F9WC 1U3JA 1HQ4A 1X6NA 5E5MB 2JK5A 1B2WH 1FNFA 1WBXA 4HS3B 1JFQL 2AGJH 2X7LA 3L6FB 1LD9B 1QKZL 2CUHA 3AREC 3I50L 1PKQA 3IGAB 3MROA 4XZUB 4JRYE 3QFJB 1NMAL 3IDIB 2OR9L 4TULL 4KGLA 1BZ7A 4G6KH 4FMFA 5EC2B 1S5IH 5A43C 4X6BA 2XN9B 3QR2A 4M1DH 1CLOH 1PZUB 4NDMB 1MAJA 1FNSL 1E6JH 5BQ7B 2X4OA 3P4LA 4JDVA 3GMMA 3QHTC 4L3AA 2EDFA 4R90H 1N26A 5DEGB 2GJ6D 3H0TA 1YY9C 4ZQKB 4TSCH 1UCBH 3T0EB 2O61B 3HNTL 5FUOH 3C60B 3BWUC 4YHZH 5ENWB 2X6MA 1CF8L 3FT4B 4RGND 5F9AC 5C0CE 5IBLD 1UKTA 1N8ZA 5AG8A 3HI5H 1R5IA 1Q9KA 3IYLW 3MRKB 4R8WL 1SEBB 4UT7L 5DK2A 3UC0L 4Q0XL 5JHDB 2V5TA 5JXAL 3DMMD 2BSSB 2I9TB 4LLVA 2V2TB 4Q9CA 2EDLA 1BVKB 1W8NA 5KG9B 5F8RC 5GS1C 2CLVA 4LSRH 1QVOA 2ZUSA 4JVWA 1WBYA 3KPRA 3N1PC 2BRRL 3QDMA 3BP7A 4OLWH 3DRQA 4BYHA 3ILPA 4XNUL 3EZJB 2FGZA 3P9MA 3MLVL 1RSFA 1XF5B 3HG1A 3MBED 2VZVA 4H26A 5DWUH 3NMEA 2PXYA 2VE6A 2W65A 3TP4A 2G2RB 5T5NG 3MACH 1ZA6A 2NY4D 5J7CC 3QRFM 2FO4B 3OWEA 4G9FE 4PRIE 1YMME 2IQAA 1N4XL 3D18A 4HBQA 4M7JH 5JA8B 1LILA 1B4JH 1JPFA 12E8L 1PJ9A 2VXSL 5IKCA 1Q38A 1UZ8A 4LHUB 4JO1L 4ZXBA 2I60L 1XGPA 4XBEH 1S7RA 3RGHA 2LVEA 2FIRT 1UJ3A 2WBJA 5L88L 5AUMA 4WHTB 4J6RL 1QD0A 1NLBH 3DMMC 1JWSA 1K6QH 1Q9OA 2G5RA 3WNPA 4QRPD 2X89A 1QSFE 1MFCL 3P73A 1HKFA 5H35B 4X6DE 4QYOB 4I0PC 3V0WL 1WIUA 1U3HB 2XNAA 1AGBB 1G6RH 4GQ9L 4M7LH 2IPUK 2CLVB 3MJ9H 5D1ZA 4TUKL 2VDLH 5TPWL 1ZE3C 1A9BA 3CX5K 4PJGF 1ORSB 3MBEC 1QFWL 4XNZB 5AAMA 1BQLL 3RKDD 2R39A 1LO2H 4J1UB 1FZMA 4POZD 2CMRH 2H45A 5CSZA 4LIQL 2WMPA 5D7LD 2NY4C 4NPYA 2GK2A 4L4VB 1CQYA 2H32B 4P9HH 2UZYB 1IC1A 1FG9C 3ZO0A 4NZRH 1CDYA 3TBTA 3GMRA 1IAIM 3NZHL 4NO0B 2UY6A 1PD6A 2Z31C 1G7MA 4R7DB 3HS0A 2C3XA 2V17H 3KWWA 2PETA 2WLZA 2M26A 5E2UH 1EHXA 1EH9A 5DD5L 2BVUA 2FH8A 4AENA 4RQQB 4OFPA 4G8GB 3V6OA 4AG4L 1E4JA 1MI5B 2BNUA 3CFKB 3WS6C 5FB8A 4G6FB 5D72L 2WBJB 2A6KB 4M93B 4DAGH 1D5BB 4LMQI 4MJ4A 3OAYH 3C6LB 4JFOA 2YD8A 4JCMA 5DSCA 4TVPL 2YD9A 1M7IB 1ZTXL 4JPVH 1JCKA 2P5WD 2PO6A 4ODBD 4KMQA 1X5GA 3IU3B 3BP5A 3K8KA 4RGMC 4ETQB 3MMEA 4KRMB 3SGJA 2J8UB 5T1MA 1NDGB 3HAEG 4IMLA 4F9PC 2VAAB 4PJGB 3VG9B 1EHLL 4DKFH 1W0VA 2BX5A 4LVHB 3RKDC 3T09A 3LQZA 1A3RH 4XT1C 2X9YA 1I1FA 4KVCH 5IFAL 4X0KA 2N1KA 3ARYA 5GRVL 2AAVA 4KTDL 5DO2D 1LVEA 3QCTH 4R0LB 2B2XH 3M8OH 4IRJC 4OGYH 5CSZB 4F58H 1N0XH 2R1WB 4JKLA 3QXAA 1V3LA 1J0HA 1IGJB 3Q5TA 1X7QA 1LMKA 4G43A 1HKLL 1KTLA 3S96B 2C1PB 1EIBA 5HGBB 3KPMB 1KYOK 4H20H 3IFPB 4P2RD 1FNEB 1WWWX 5DLML 3THML 1OP5K 3MBXH 5KVFH 4L4TA 3HS0B 1R5WA 2D9CA 4NM4H 1TTUA 5HYQB 3OZ9L 2K1MA 4HXAL 1HKLH 4OZHB 4L29B 3U46B 5J56B 4AH2A 1H9VA 4NFDA 4XP4L 5DJYB 1QLEH 1IRAY 2APBA 5MEQB 5DHVH 5DJ6B 3MRLA 5KSAB 4C59B 4BFIB 3PDGA 3S5LG 3BYYA 4UTAL 2HN7B 1UWXK 2OXHA 2NY3D 4GBXB 2YS4A 3LN5B 2WIIA 3E3QC 1AXTH 5F7MC 2DKMA 1INEH 1E27B 3ZYZA 4MD0A 4KJPC 5KSUA 3RP1A 5FUCE 3KYNA 3FHAA 3DGGA 2DLFL 4Z7OE 4FQ1H 5FKAA 3QEGL 4YBHA 4Y0GA 3W0WD 5HGHA 4JFEB 2ZP0T 3SOBH 2HP4A 2YUZA 4X0KB 5T1LB 4RRPG 4NCC2 2IPUG 1BBDH 3FN0L 1UCTA 4KI5E 1M71A 1SJXA 3V6FB 3AU1A 3MO1B 2W91A 3I75B 3QAZB 4JQVA 1MAKA 3C08L 4X4ME 2IC2A 1JHKL 4HS8H 5KS9E 2PCPA 4JKWA 4U1NB 1CU4H 2P24B 2FGWH 2W0PA 1CTOA 3VXPB 3QQ3B 1RU9H 2J4WL 3X11B 5J1AA 3V7MA 5MEOB 3ULVL 1EFXD 4GW4B 3QHFL 3I3BA 4I18A 1SJHB 3OXSA 5SWZD 4LKXB 4WUUE 2OI9C 3HE7C 4UNTA 2J4WH 3B8YA 2NY3C 3HZYB 1MRDL 1QHOA 1CR9L 1E4XI 5SWSD 1BQHB 2EECA 4XNYH 3SJVA 5F7WC 3DO3A 1WFUA 4PRAB 1I9IL 4YDIL 5ILTL 2ESVD 5FCUL 1LK2B 3ULUH 5IFJB 4WDIA 1QSEE 3BH9B 4Y5YB 2F5BH 4KHTH 1F6AA 4LRIA 4IOIA 2GW5A 4XP9H 3GDBA 1XGRB 1YPZE 1KIQA 3KPLB 4HXBH 3ARBA 4XCFH 3SE8H 3KPSD 4JFPB 5HHMD 2J5LC 5DGRA 4CW1B 1ACYH 3MRPB 3GMLB 1JNHB 5CIPH 2B5IB 5FYKL 4F7PB 2BY3A 3WXVL 3GO1H 1OARH 1F3DH 3BIBX 4YX2H 3QDGA 3VJ6B 3S34L 3U83A 4U1IA 5L9DL 3AROA 3QCUL 1BD2D 5DD6B 2QSVA 4LLUA 4CAGA 5HI5D 1NCDH 4WI7A 3HRPA 2BNQD 3S4SA 3JV4B 3KVQA 4M8QB 4LRNH 4Z5RB 1MLBA 3L3HA 5BVPL 2LAAA 5MHSE 5L9DH 1IZJA 3QUMB 3AS2A 3RWGA 1GZQB 3IJSA 1L7IH 3BJ91 4JPWH 3O3BB 4XC1L 1AIFB 1TFHA 3BEVB 3CXHJ 3R0MA 3OKLB 5ACMA 4M03A 3WFHB 3MV9E 1J0JA 1FYTD 1S9YA 3SJVB 1TVDA 2DTMH 2YPLD 5MENA 4X7SL 1M05B 1ZHNA 2UZXB 1S3KH 1T7VA 2HA1A 3IVKA 5I0ZA 4WFGE 2J7LA 1RZFH 2Y9RT 3TT3H 3FONA 5DDHA 3WXWH 4QNPF 3QG7H 2D4FA 3MYZA 2KQNA 5FOBB 1AD0A 2ARJB 2D03H 5I18L 4LASL 1VFMA 2AV7A 4PV8B 4XCEA 4P3DA 3UYRL 3F7YA 4NKQB 3WSQH 3NAAH 1KPRB 1CDUA 2D7QA 3Q0HA 4LHJB 1P5UA 1PZ5B 3F65A 3MXVH 5IJVA 3SDCD 1P7QA 4K3GA 4FXKA 5HI5C 1DN0B 4RMUA 1YEDB 1NGZB 9CGTA 4GAYB 3ALPA 2FWOA 1PKOA 1T03L 2FSEA 5J6GA 3C5ZB 5JUEL 2E7LC 4P2QA 4I0CC 5JXEA 3K4DA 4NUGH 3DJ9A 1VEPA 2SEBA 1HQRB 4NQCA 3HB3D 5EIIA 2C3HA 1QO3A 2IANA 5A3ID 2C3VB 4GMTL 4OCSH 1A6TA 5CWSB 4U2ZA 5LBSL 3CFEB 3OR6B 3ET9F 4L8SB 2OZ4H 4BZ1H 4M8VA 2YD1A 4P46A 4YO0A 4AIZB 1JZ5A 2CRMA 4H0IA 5C08A 2H9GA 3QUYC 1H3XA 1D5ZA 3SPVB 3QWRD 4FZ8H 2ITDB 4KDTA 5SWQA 3SGDH 3PGCB 1ORQB 2X4UA 1FE8L 2AI0H 1FSKC 2WINB 3HZMA 1CICD 5BO1L 4ZOCA 3IKCA 2P7TA 1KB5L 4U05A 3RAJH 1A4KB 1CXKA 4UUJA 3SDCC 4PB9H 2F53B 4QOKE 1DN2A 4JPKH 3DRTA 2ZUUA 2CH8A 4JQIL 4NGHH 4MQ7A 1F58L 5IP4A 1XIWA 3D87B 3ESUF 4GKOA 4LHUG 2JELH 4LKCB 2ILLA 4RBPK 3QHZL 5HI4C 3ETBF 1UB5A 3MV8B 4PRDA 4LSTL 1YDPB 4UBDC 3UP1A 2HRLA 2H1PL 3AB0C 1Z3GL 5CP7B 3HB3C 5D8JL 1Y6MR 3L1OL 4PREB 1MCJA 3GB7A 2VZUA 5C0CD 4WENB 2HTLD 4R2GD 4HEME 4ZS6D 1CXEA 4O02L 3BZFB 3ELAT 1O5DT 3EO0A 2E7BA 1G7LA 3G04B 2EYRA 1BJ1J 5HDBE 3D3VE 1EDQA 2GSIB 3FFCB 3JWNC 5GGVH 5DC0A 4NQEE 3RQ3A 5JW3H 1I3GH 2NY2B 4A2LA 7FABH 5IWLA 5ISZA 2FX9L 3OKDA 4RWYH 4FXLA 4JDTL 5F89B 3FQWB 1CIUA 1QR4A 3NA9H 2A73B 4JM4H 4Y5XC 1N6QH 5H94A 2DQDH 2GTWB 1J8KA 5K9OB 2EDNA 4PJEA 4WFFE 4XPFH 1FZJB 4TNVF 1Q9WB 2NW2B 1OLZA 4N68A 3WD5L 5E4EB 5IB1B 1LO0L 4GS7B 4WI9A 1K5NA 4ODSH 1VFUA 2EDBA 3MRCA 1D5XA 1JWMB 2UUDK 4PJEF 4GRWE 4BFBD 1BJMA 2D3VA 4O9HH 2XWBB 2DLTA 3VW3H 4WHCA 4G9FD 1YMMD 3O4LE 4ZTOL 3FQTB 1RZIA 4TRPH 3GSQB 3IXAA 5GRZA 1H3VA 4RDQF 1DSFH 1YJDC 4YHLH 3MLYH 5FYLH 4OSUL 4XMKL 4OZ4B 4ZSOA 1U8PB 2E7CA 1JBJA 3H7LA 2NY5H 2IH1A 3BDXA 5JDSB 4H88L 4ZTOH 1T1ZA 1UA6L 2HKHL 2HTLC 4KU1A 4W4OC 1BF8A 4R2GC 1KJ3H 4WEBH 4ZS6C 4KVNL 5HHPB 3U0TB 4FQIL 3X14B 2FJFA 3MRDB 1UZ6E 5DJXB 5I73B 3BDBA 3FFDA 5E2VH 1B0GA 4PV9B 4JG1H 2HKHH 2B4CC 3L3JA 1JF1B 1GRWA 2AJ3B 1TETH 4K7PH 4OZGB 1CLZH 4GFTB 5EBLA 4LLYA 4Y2DB 1B88A 2C5DC 1VFAA 4ZUVA 2AK4A 1AGEB 3RWCB 5ICYB 4V2CB 3W81A 3QO1B 1ULVA 1P84J 4JGUA 2ZKHH 4Y4KC 3O41B 5FDWA 2YEZA 3QEHA 4ZO9A 1XGQA 4HK3J 5C07D 1GVIA 5C0AB 3GSUB 4OM1H 4M7LT 2EXWD 3O45A 4OTXH 1BLNB 1UEYA 4MMZC 1DDHB 1YYLH 2Y36L 1LO3H 5BXFA 4YHMH 5I75B 1WVZA 1AI1L 1FN4A 5L7XL 2Q86A 2NXYD 1YEFL 2CQVA 3EOBA 3IDXL 2ZOLB 5JLZB 1VPOL 4U1KA 1J8HA 1MCSA 1X5JA 3STBA 1EGJH 3HI1B 1RUPL 2VZ3A 4DZBB 1F90L 1S7UB 4Z7VA 4MXVE 2UYLA 1BZQK 1NEUA 4MNGB 5D2NE 1KNOB 3CAFA 5B21A 2H26A 2VDRL 3D0LB 4ODUB 3KJ4C 2I5YH 2Q1EA 1CFNA 2OR7A 5F7NC 1GAFL 3G6AA 3TJEH 1DQJB 4FQJH 3WHE0 5MERA 2D7TL 1DQQB 4ONFH 1X4XA 4F9LA 3MRGA 3Q48A 1ZSDB 3I6GB 2XN9D 3SDXA 2J2ZA 1QACA 4LCWE 5E6IA 2JF1A 3T2PA 3LSOA 5E8OA 4XH2B 3TYGL 3BKYL 3DSFL 4ELKA 3BEWB 4AK1A 5FO9B 4HUVB 2BY1A 2A0LD 5HDOA 4JY5L 2R4RL 4EI5C 2ZZUT 4NQDA 3KLSA 1I1CA 3TYGH 1RHHB 2R15A 5HD8D 3T0ED 2A83A 4HKBA 2DRUA 2QQNH 3ZKXC 1JPTL 4JO3L 3W82A 4KQ3H 2YZ8A 4OF5A 4JKKA 5TF1L 4Z8FL 1G0DA 5JHDD 2JKXA 1D6VH 3P0VH 3ZKSD 3KLHC 4RZCB 5GZND 2FD6H 1BQHG 4Z7UA 3Q5YA 4OF3A 3RHWK 5TF1H 1CGVA 1MRCL 5DTFB 3WKML 3O8XB 5T33L 5HYJB 2VC2L 3B3IB 1I1AA 4HIEB 4RGOL 5BW7C 2CIIA 3NABL 1MEXL 1YEJL 3OX8A 1FO0H 5FYJU 3D69A 3CLFL 1IC4L 5E99L 3LS4L 4L3CB 4Q2ZA 1YNKH 4PB0L 4K23L 4I5BB 1INQB 2UWEA 2W59A 3UBXA 3QNZA 1IGYB 2XV6B 1JV5A 4U1JB 4J7RA 5E8EA 4U6XB 3EYFA 2EDEA 1DJSA 3VFUA 2A0LC 3CFIC 1GGCL 3RDTD 2UZIH 2VISA 5JIKA 3ZTNL 1X44A 1XF2B 3B8SA 1P6AB 5EU4B 4AEHL 3D39A 5DMIH 2X70A 4LHUD 3HHRB 3T0EC 1NKRA 2XTLA 3C60C 4MCZB 3TO2B 2DQTH 4KK8D 1A6UH 5C6TL 1KJVB 4NQDB 4BKLB 1OWRM 2E27H 5AAWA 3OKYA 1HCVA 5ITFA 4M9OA 1CLYH 5E1HB 5JR1H 2Q7YB 4WUUD 3FO0H 1KB5A 4GMSH 4JAMA 5KN5B 4JN1H 3RL2B 3S9DB 1H3WM 1G7IB 1JP5A 1LEKB 1U3HD 2F54A 1PYWA 2HTKD 4X9IA 1VDGA 1A2YA 4X5WA 1E4XH 3EJZC 1QSED 1OB1A 3PV6B 1T1XA 3P77B 3KPPA 4R4BB 3ARTA 1G0YR 1NEZB 4QCIB 1BQUA 5GQBA 2ZUYA 1RJYA 5TDOA 4K9EC 3GSVA 1N59B 1NQBA 3OKNB 4M61A 3V52H 1XFPA 4ZD3H 2EYTA 4HPYH 4PGCB 4UV7L 4MA8L 5JPNB 5I1DB 1F3DJ 3OF6A 4XI5D 1ZV5A 4M6MH 3P0YL 1SY6L 3M1BB 3NFPB 3KPTA 4KK8C 2EDHA 1KENL 1S7SA 3CLEL 3O6LL 3P0YH 3PHQB 1FNGA 1FL5B 5FO7A 4NO5B 3ULSB 1WT5A 2OXGA 4MAUL 4PJDA 4BUHA 5JQHC 4OV5A 4PJ9D 2OTWA 4P3CL 4XP5L 4PBVC 5E7BA 1LO4L 2GYSA 5MHSD 4F7MA 4PJDF 3GSXB 2R0LL 1JVKA 4OKVB 2ZCLL 2FHBA 3T0BA 1WCBA 5FM8A 1U3HC 3UTZA 2HTKC 5FV2A 4F7CB 1UH3A 3GSWA 1QYGH 2BY0A 3PHOA 2OSLB 5EBGA 4DGVL 4OAWA 5I9QB 3NIDF 3V7AE 2F54B 1TQBB 1J7VR 3BD4A 4YBQD 2AJUL 4JB9H 4PJXB 2DOCA 1XF4B 3MLXH 3HLAA 5ALBL 1BFTA 4WFGD 1KCRL 1PSKL 4TPRH 1GPOH 2PUQT 1KG0B 4O4YH 4LLWA 5FIEA 5HDQL 4XI5C 4GUPB 4CMHB 1M4KA 4LEOB 4PGDA 4OLEA 1J11A 3O11A 3AFLA 5IF0B 1WAAA 1YEGL 4OI9A 5DJ8A 3WIIH 2B8OT 2VXUL 4K8RH 4GAGH 2YA0A 3DYPA 3RWEA 4FA8A 5C0EA 1R3HB 1WAAF 3D25A 5CKGA 5DEZA 3T1FB 4PJ9C 1TQCB 2O5XL 4M93C 4JHZA 5D5ME 3HMWL 3C6LC 5D9SB 4HIXH 2EC9U 4HDIB 2R2CA 1ERNA 1W0WB 2NY1B 3QZWA 4RIRA 2OK0L 4C54A 1JGEA 4XXCC 4CN1A 4EDWH 5F7DB 1KPVB 2PNDA 5KSAD 3HNVL 4U0RB 4GBXD 1X5XA 3I85A 5GJTH 4YBQC 3VG9C 4LVHC 1WTLA 4HGWA 3RVXC 3FQRA 4DKEH 4YHYC 4K3DH 3KYKH 4ONOA 5CEZD 4D0BA 2R69L 2IMMA 3REVB 1FPTL 2RCSH 3LKPB 1Z5LA 5EC1A 2GIYA 2YMXL 5T1LD 1R5VB 2CR6A 1QBBA 3FRUA 4LLWB 1WWBX 5ETUA 3G6JA 4J12A 4IDJH 4C57C 1U36A 1UM4L 1F02I 1PVHA 4QOKD 3FB8A 1Z9OA 3QJHA 5JOEA 1ZHKA 5KSVA 3VXMA 3G6JF 1MPAL 1U3ZA 5E94A 1FFRA 3K2UH 1FFPA 3BI9X 4KJYA 1ES0A 4FRWA 3JWOL 4MZ3A 1DTUA 5HDLA 4Z7QE 4YH6A 3BH8B 3S35X 5IHBA 5JOFB 3AY4C 3DUUB 5KSAC 3LKSA 5CJQL 1LWRA 1DR9A 2IF7A 4PJCE 4GBXC 4TOYL 4DGIL 1RJCA 3ARFA 5DRZB 4UIKL 2V5MA 2AV1A 1S7TB 3L3IA 3HPLA 4XNMA 4QT5B 4AT6A 3UPCA 4D0CB 2E6JA 4N5UA 4NQED 4DFIA 1JNLH 1E4KA 4LSPL 5I1GL 2FEEL 2OJEB 4XPBL 3DWTA 2VN7A 4PJ7A 1AQKL 2L4OA 5I1JH 4WHYH 3S36H 1AQDB 3GUTA 2IBBA 3DV4A 1QFHA 1BFOA 2W9EL 1K8DB 3PWPA 1T2XA 2BXYA 4FTVB 4PJ7F 4WFFD 4PGBB 3B9KB 2D7OA 3C8HA 3QAZC 2GTZA 1LEIB 3VXUE 3KXFE 4OGXL 3FRUB 5ADPL 4HFWB 3GJFH 4WY7H 4F15B 2B1HH 4EJ1C 4HV8A 3GGWB 4U6YA 3QRGL 5EPMB 3PABB 3P9LA 4ZPVB 5LGJB 2CLZB 1S8DA 3TVMA 1ZHKB 3ZHKA 3VXMB 1QA9B 4OFYD 3E8UL 4JZNA 1SVZA 4OCYH 3OKKB 1N0LA 1NKOA 3TIDB 4MGXA 1H8NA 4I3SL 1ZHLA 2DWEB 4M6OL 2CIKA 5D1QB 3BSZL 4UDTB 2AJYL 2CKBL 3LHPL 4PD4K 4LVEA 2OJZL 3S3SA 4LHQB 5F1IA 2C4XA 3TCLA 3T3PE 2FR4A 3WHXA 5DD1H 5HYSA 4Y5YC 4L8CB 1J1PL 2AW2A 5BV7B 2G9HB 3L5WB 4LLMA 4YE4H 1K4CB 2YPKB 3UMTA 4BH7A 4OZFA 3F7QA 4JFFA 4PG9A 1CL7I 4G8IA 2Y23A 3HE6B 3V7AG 2C1OA 5FF6A 5SV4A 4DCQA 4H0GA 5D6DA 2AEQL 1RK1B 2DYPD 5TFSL 1JPSH 2B5IC 3U1SH 3EDJA 3EYUH 3KJ6L 3VFOB 1H3UA 5L0QC 3C6SB 2BMKB 5DFVD 3MRJA 15C8H 1QNZH 5DA4A 3UDWC 1IM9A 2VDNH 5FYKU 3L3KA 1VGKB 5E2JA 5L6YL 5CSBA 4KC3B 1IEAB 1Q72L 3TBWA 5HPMB 3QQ9D 3FKUS 2XG5A 1WFNA 3C5ZD 1B6UA 5B22A 4J3OC 5IB3A 3KNBA 5IVXE 4PRPA 1G9MH 3F7RA 1A1NB 5B38A 5HHOE 4P9MH 1KELL 3MODL 4DVRH 2VSDA 1P7HL 5ESAB 1NJ9A 1R0AH 2HWZL 3VRLF 3TFKC 1WWAX 2EIZB 4CVXA 1RVFH 4AMKH 5IW1A 2HFTA 5FM5O 1OAQL 4WU7B 2PYEE 3JVGA 4FQHB 2NTFB 5ECJE 1B0RB 2FH6A 1U2CA 2NYYD 3O3DA 5E00A 4ZUWB 4XGZA 5C3LD 1HH9B 4E5XB 3B2UD 3EYSH 5TE6H 1P9MC 1SY6A 2APXA 3RGVB 2IH3A 2E3VA 5BZDB 4HT1H 2DQJH 4BH7B 1JPGB 3JTSA 1KIUA 4JANA 3BW9B 2W60B 2HLFD 5C0GB 3O9WA 4H8WC 5DFVC 3WS3B 3OAZH 1QRKA 5IK3A 5EUKA 2Z93A 4FZEL 1ZOXA 2V7NA 3NA4A 3BZEB 1CGUA 5KW9H 3ZE0E 3CDGA 2DBLL 1VGEH 2ICWA 5HBBA 2EZ0D 3QQ9C 1LP9E 1XH3A 3C5ZC 1TZGH 3VXSB 1A6AA 3VFSB 3MV8D 1H8SA 3BE1H 1X5LA 2AK1L 4KZDH 2XKSA 4KI1A 4XNXL 2HH0L 4N0CC 1PG7L 4ZNCD 2MFNA 5IB3B 1OF2B 2G75B 1YYML 1JI2A 3ZDYF 2QJDA 2XTJE 3LEYH 4A2MA 2ITCB 2CSPA 4L8SC 3DBXB 2NYYC 3N1GC 1NFDA 1SMOA 3GRWH 4A6YH 3B2UC 4M5YH 5EBMA 2GY7B 1FAIH 4FQQB 1Q9LB 4KHXL 3O3DB 1NFDF 5F88A 1A7BA 3SDDA 3PWVB 4HULB 2NX5B 2Q3AA 4DUWA 2XI9A 3RX8A 2HLFC 3ARVA 2DN7A 4GRLB 1YEIH 4HS6A 5J11B 3WNOA 2YWZA 3IT8D 5IR1B 4YJZL 4I4WA 5D7JB 1NCAH 1OGAA 3MA9L 3FB7A 3OKEA 2Z8SA 3RUGB 5JNYA 8CGTA 4KY1H 2DIJA 1QFUH 5E70A 1VFBA 2HT4D 4QHNB 2AJVH 5C09B 4BUGA 4TNWF 5L2KB 2GI7A 4LPVA 5DJZB 3VXOB 2Z35B 5J1SC 1XCTB 2QSCH 4XP6L 2FATL 1DEDA 1MCDA 2R23A 3OB0K 4HUXB 1UXSA 1N5YL 4LCYB 3VFNA 4Y16B 1JYXA 4XPHH 3E6FB 3LRGA 2VDOL 4XBPA 4XPGH 3FOMA 2NY2C 5I1AA 5EZIH 3IRPX 3VFGL 25C8L