4AZUA

Crystal structure analysis of oxidized pseudomonas aeruginosa azurin at ph 5.5 and ph 9.0. a ph-induced conformational transition involves a peptide bond flip
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure analysis of oxidized Pseudomonas aeruginosa azurin at pH 5.5 and pH 9.0. A pH-induced conformational transition involves a peptide bond flip.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport(copper binding)
molecule keywords AZURIN
total genus 31
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1993-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4azuA00
1CYXA 1J5DA 2IWKA 1PLBA 2P80D 5D4JA 5AKRA 1JVOA 2DWTA 3OQRA 5A7EA 1ILUA 2EIJB 4KOCA 1GS6X 2I7OA 1KGYE 1ADWA 2ZOOA 1J9QA 1A65A 2VSKB 3FSAA 3X1NA 2FWLB 2IWEA 3ZIYA 4YSAA 1BXUA 2CUAA 9PCYA 3CVDA 5I6NA 3CZUB 4A2HA 4KNTA 2EINB 1JZGA 4M4RB 3UAAA 4A2EA 1L9QA 3ZBMA 1JZFA 3BVDB 6PAZA 3EH4B 3WNJA 2EIMB 5I26A 1GS7A 4Q89A 2IWFA 5B1JC 2I7SA 4BWWA 4K9JA 4DP1X 1ASPA 4PAZA 1RKRA 3FS9A 3HEIB 1V55B 2DYRB 4GP4B 4DPBX 3OD3A 5I6MA 1M9WA 1GW0A 2UXFA 3IN0A 3UACA 3HB3B 4HCIA 1I53A 1OE2A 2OJ1A 4RH4A 1XB3A 2IDUA 3NYKA 4E9QA 4JHVA 3T9WA 2DV6A 2EILB 2HRGA 1AAJA 2OCCB 2A3TA 3QQXA 4G7SB 3X1FA 3CVCA 1ZPUA 4P5SA 4A66A 1GY2A 1N68A 3ASNB 1MDAA 5E9NA 1AZCA 2YAOA 1W8EA 1TEFA 1ZV2A 2B3IA 1AG0A 2YARA 5IY5B 3SBRA 4DP5X 1XMEB 1JZHA 1EHKB 4A2DA 3OM3B 2DY2A 2FQFA 3T6ZA 2FT7A 4W9ZA 1KCBA 1R1CA 3WKPA 1SFDA 1IC0A 1QLEB 1MG3C 1OCOB 2IH9A 4AKOA 2YAFA 1W6WA 1AG6A 3IE9A 1AZUA 4E9YA 1A3ZA 4DP8X 2ZXWB 4YSOA 1NPJA 2RACA 4YSPA 4QLWA 1NIDA 4HAKA 2PP7A 3G5WA 3N2JA 6PCYA 1AOZA 1YLBB 1V10A 3T6WA 4BXVA 1NWPA 3S3BB 7PAZA 1SF3A 4BDVA 3MBWB 1PLCA 3EH5B 2VMJA 3CG8A 2HXAA 4AKQA 5I6OA 1PF3A 3UABA 2I85A 2PPDA 3DIVA 3QJRB 5B1JA 1OOWA 4QKTA 1IUZA 1PZCA 3AG1B 3NP4A 1NINA 1AS8A 1ETJA 1MG2C 1SDDA 1TU2A 2PCFA 5D4IA 3GDCA 4P5RA 2BP0B 2BW4A 1ZIAA 4YL4A 2VSMB 3KW8A 4BK5C 4WTQA 5AFAA 2JFCA 4G71B 1BQKA 3BQVA 3AW5A 1CUOA 1OV8A 4YVUA 5B7MA 4BDVB 3QJUB 2TSBA 3FU7A 4DP6X 2VM3A 2X88A 5B1BB 1X9RA 2YAHA 3X2QB 4JKNA 1WA0X 2AFNA 3FYEB 1NICA 4DP0X 3ERXA 3AG4B 1NWOA 3NJMA 3T6XA 1TKWA 2XYBA 2PPEA 1BYOA 4E9VA 4HALA 2XX0A 2J57A 1KCWA 1XB6A 2IDTA 2JXMA 4MFHA 2FNWA 2X87A 2XU9A 2FT6A 2BP8B 3X1BA 1JZEA 2XUWA 1FWXA 2J55A 4UF7C 1JVLA 3QJSB 1RZQA 3PPSA 1HAWA 2N0MA 2BZ7A 5I28A 1IBYA 3NSDA 1AZBA 2PPAA 1L9OA 1OF0A 4BWTA 5B1AB 3PCYA 3ASOB 2GHZA 1WA1X 1XB8A 2TSAA 2GSMB 2CCWA 1F56A 2WSDA 1JOIA 3TA4D 1J9SA 2BZCA 3UADA 1ILSA 2BP8A 4BXSV 2XXFA 2QPEB 3TASA 4WKXA 3DKHA 1BYPA 3NSCA 5F7BA 2HX8A 3FSZA 5I6KA 1AZRA 1E67A 1CURA 1SFHA 4AKPA 1CC3A 4YSTA 5AZUA 1OE3A 4YSDA 2QT6A 3U25A 1PNDA 3FPYA 1QNIA 1N70A 3EH3B 1L9SA 1B3IA 1HFUA 2IDQA 2AANA 4YVNA 2XXGA 1AS7A 1AQ8A 3FU9A 4KNSA 4UAHA 3NP3A 2FTAA 1E65A 1A4BA 2UX7A 1IBZA 5F7AA 3UAEA 2QDWA 4KO6A 4YSRA 3IN2A 3SBPA 1NIEA 4A68A 3FQ2A 1BQ5A 1NTDA 4KOBA 5I6LA 4KO7A 1SF5A 1KBWA 4E9RA 4F2EA 1PLAA 2AZUA 2LLNA 1AACA 1PAZA 2PP9A 3AY2A 2IAAC 2OV0A 3RYMA 2XVBA 3WIAA 1FFTB 2VW7A 2H5UA 3D12B 1IKOP 1NIBA 3NJHA 1L9TA 3EF4A 2YXVA 2BHFA 2EIKB 1PNCA 3PAUA 3PLYA 3TBCA 3IBOA 1VLXA 1PMYA 1OCRB 1AANA 1BQRA 1QHQA 4YSSA 3S3CB 3NJIA 3ABMB 1JZIA 2UXVA 3V9CA 2R7EA 1AIZA 1NPNA 1JZJA 4HIPA 2H47C 3FQ1A 2HZHA 1JXGA 1BXAA 2W8CA 2BW5A 2HLEB 1L9RA 2H3XC 1JERA 3FSVA 1WS7A 4CSZA 4Q8BA 4NERA 3TBBA 2YAPA 3V9EA 4E9SA 2GI0A 2PP8A 3ABKB 2GB2A 1SDDB 1BEXA 1MZZA 1RCYA 2IDSA 4KO9A 2VW6A 5I5IA 2Q5BA 2QDVA 3NT0A 2BP0A 3AZUA 3SQRA 1NIFA 2VW4A 4DPCX 3WKQA 1GY1A 3IEAA 5LDUA 3QJQB 3ZX1A 4G72B 2FQEA 4KO5A 5ANHA 2GC4C 3QPKA 3ABGA 2NRDA 3FU7B 1ID2A 5B7EA 2BWDA 4HCGA 1EZLA 1ASOA 2CAKA 2HX9A 1AR1B 1KDJA 2CJ3A 3X1GA 3TU6A 1NZRA 2FT8A 4N8UA 4F2FA 1J5CA 4W1TA 1FA4A 3FU8A 4DP9X 3FT0A 3WNIA 3QJVB 3OMIB 4JHUA 5D4HA 5I5JA 3WG7B 1WS8A 3NJJA 3NJGA 3JT2A 3NSYA 4HZ1A 2J56A 4EF3A 4TXVB 5I5MA 1GR7A 1T5KA 4G70B 3X1EA 2FJSA 1PY0A 1RZPA 3AG2B 2AZAA 3CDZB 2XV3A 4E9WA 1PZAA 4GP5B 4UANA 2PPCA 2Y69B 2HX7A 4FA7B 2CALA 2JKWA 3NSFA 2DYSB 4ZK8A 1E30A 3FYIB 2FQDA 4PCYA 4DP2X 1ET7A 3WI9A 3JTBA 3MX0B 2BO0A 1W6LA 4G7RB 2VM4A 4DP7X 3T71A 1E5YA 3SBQA 4HCFA 1L9PA 1UATA 1GSKA 1ASQA 5TK4A 2PPFA 4AZUA 1JXDA 3S8FB 2Q9OA 3ABLB 2MTAA 1DYZA 2Y1AA 3T6VA 4ENZA 3PAVA 2UXGA 4DPAX 2PLTA 2IDFA 4A2FA 5PAZA 3OMNB 1CYWA 1BXVA 2UXTA 4BWUA 1X9UA 8PAZA 1AZNA 2FQGA 4CSPA 3GYRA 3EHBB 2GC7C 2AVFA 4E9TA 4N4YB 1JXFA 1J9TA 2PCYA 1BAWA 2ZONA 4NB7A 1M56B 1A4CA 2E86A 2YAQA 1NDTA 4L0PB 1KDIA 4YSCA 1AS6A 5B3SB 1PCSA 4AX3A 4G7QB 1DZ0A 2VN3A 2YAMA 3NJFA 4E9XA 3NJLA 1J9RA 2WO2B 2W88A 2XX1A 2YAEA 3CDZA 1E5ZA 2XV2A 3ZDWA 3NJNA 5B1KA 3H4FA 3KW7A 1A4AA 4YSQA 4GP8B 2MRYA 1ZDSA 3FSWA 4M3HA 1NIAA 3PXLA 2J5WA 4YSUA 4KNUA 2DWSA 1PZBA 3C75A 4AI7A 3NJKA 1V54B 5FC9A 1KV7A 1SNRA 1GYCA 2GIMA 5PCYA 3QJTB 2YXWA 3CVBA 4DP4X 2HRHA 2ZWNA 1SJMA 2XWZA 3OMAB 4FAAB 1SHWA 1URIA 4GXFA 2UX6A 1ZDQA 3DTUB 1A8ZA 2XV0A 1MZYA 1SHXA 3H56A 3N55A 4GYBA 1KYAA 4X4KA 4YSEA 4HHGA 2XLLA 2IH8A 2WO3B 2P80A 1WAEA 3S8GB 3S3DB 3UGEA 1GS8A 1OE1A 1TEGA 4NAJA 1WA2X 5B7FA 1OCZB 4F7KA 2YQBA 4A67A 1OCCB 2R7EB 5TK2A 3H4HA 1M57B 5I6PA 2QPDB 4GY4A 3FPXA 4HHWA 2CBPA 1ET8A 1ZIBA 3PAZA 7PCYA 1KBVA 2GBAA 2B08A 3FQYA 1HAUA 4A2GA 1ET5A 3L45A 5EHFA 3AG3B 2BWIA 3GXUB
chains in the Genus database with same CATH superfamily
2EYSB 4E5XA 4AT6A 3DIFA 3C6EA 2CIIA 3S3PA 4Q56A 3BZEB 5GS1A 4ZSOA 3VCLA 5MHSE 1UC6A 4KTEH 3V0GA 5AWNH 4YHML 5IWLA 3W39B 1QWUA 1Q72L 4QRAA 3GMPB 4NO0A 1J48A 4FHKA 3L95A 4NOFA 1VZGA 4MJ5A 3WNOA 3ARGA 4DPRA 3N44B 5C0BD 3AJ7A 1I7ZA 4NO2B 4YSAA 3LKQA 2XETA 3UJIL 4DOHE 3OB0H 5D1XD 2PXYA 3VFSB 25C8L 2BVQA 4FCHA 1K85A 1MJJA 3IDXL 1SXSA 3V0EA 1L3NA 4KK6C 4XO8A 3TGXA 1U3YA 3KPPA 1FL3A 4EJ1C 3QEGL 3PQYA 1RKRA 3RY4A 2UZXB 4HOWA 3CLFL 2A9AA 1TITA 3SKMA 1VSCA 1U2CA 5IB4B 3G08A 4LLDB 1BPLB 1JK8A 1ZLWH 1P9MA 5L7XH 5CEYA 5TF1L 2NZIA 1OE2A 1Q9KB 2VQTA 1GZPA 3PDDA 5L2JA 4I5BB 2X4NB 1TVBA 1HDMA 2OKMA 2VDNL 3N1PC 3WO4B 2EDRA 4FYQA 5DK0A 3Q43A 1GY2A 3RGVB 4B5EA 3ORJA 4I9WE 3II1A 1V05A 4LLUB 4OLVL 4MLIA 4ONGH 1TMCB 3QUZD 1IT9H 4GO9A 3WD5H 4ZX6A 2P5WE 4AVJA 1X4XA 3OJVC 4N2NA 4U6HB 1FO0H 2V3FA 1KELH 4QRQB 2YEVB 4WTZG 5DVPA 3LKOB 4OZ4A 4PGBB 2FQFA 3U30C 2X4RB 3Q3GB 2CO2A 2MFNA 3JV4B 4KK9C 1FAIH 1HHJA 3SYOA 1T4WA 4GUCA 4N20A 4HGWB 3E1F1 1X5FA 4H4NA 4M48L 5EMYA 5BO1H 3O2DH 4YSOA 3MFGB 1TJGH 2HT2C 3F6IA 1UM6L 4JFFE 3VXUE 1KIQB 4TSBH 4WW1A 1YEGL 1IBGH 3WS6A 3ARGB 1ZEAH 5GS0C 4DT2A 4WHCA 1EHLH 1RZGB 4NX0A 1MAMH 1FP5A 2ZNWA 3QFDA 2VO8A 4Y5VA 5DEFA 2Q2EB 5K39A 2FIKB 3LXBA 3CHPA 3QJRB 1F1GA 2IWGA 4QEGA 4OCSL 5BJTA 1A9BB 3F7VB 5FM4A 1DLFH 3DRTB 5DUJA 4RZKA 5JPMC 3NCEB 3UBXI 4JHZA 3FOMA 5EU4A 1AFVH 2BCKB 3TWCL 3D0AA 5JIQA 2X6BA 3B8YA 2Y2TA 1EJ8A 5CINH 2CR3A 4N87A 4NP9A 3ZE2E 2NX5B 5EC1B 4Q6IB 4XB8A 4PJXE 2EIBA 3THMH 2WYIA 3OX8B 1C1EL 1F00I 1HE7A 2G60L 2WQ8A 3ZL4L 5TFSL 2J2ZB 2BIQA 3ARUA 5BQ7A 3B1UA 4G11A 1E5BA 2WO4A 4APQA 2AJXH 4ZUWA 1D6EA 1U36A 2MEJB 4HH8A 1YEEL 1PD1A 2R83A 4JG1L 4S1RL 3QZLA 5FCSH 3IFNH 1XGUB 4X5LA 5MERA 3ELQA 1DBJL 2A4ZA 2B4CC 3KEDA 4PY7B 3AY4C 4L8DA 4R97B 5DK0B 4TNEA 5FYLD 4LDCA 3RUGE 1FJ1B 1ONQA 3MBEA 2PPEA 4JHAL 4YEEA 4Z7UA 4PJDA 1JFHA 4A6YB 4LHUG 3T65A 4KH9A 3TL5A 3GIZH 5KYYB 4WO4D 3A6BL 4GSXA 3HOGA 3QDMA 1FFPA 3PWPB 1WISA 3L4XA 5G4NA 2X1PA 1EJOH 4ZFOB 1MFAH 3FFCB 2Y4SA 4JM2C 1N4XH 3STZB 1VACA 5J6SA 2J55A 4OCYL 3HB3D 5LNDA 5JR1L 2NZ9D 2X9ZA 5DVOA 3BSZH 2O6PA 4U1HB 5D5ME 4ESKA 4J3UA 2BZ7A 4IIZA 4GT0A 2EADA 5HHNB 3P69A 1E4XI 2CPUA 2E7LC 4GUQA 2WLZA 2BSCA 5IREA 3MUGB 3CFKB 2PTTB 3FCTA 3ZKMD 5C0CE 1XVSA 1XB8A 1F56A 4YMPA 3VD2A 2V2TB 3U6XA 1B2WH 1QW9A 1KB5L 4I88A 4XNXH 5B38B 1BBJA 3TCLB 3FU0A 3BAEL 1LYQA 4FQXC 1A9BA 5DZNA 5E94B 5I6KA 3H6JA 2PWEA 3G5YB 3ZZQA 1UACL 4PJAA 1YAZA 1BP3B 1UCBL 1TTGA 3ECBA 4MQSB 4JGJA 1TF4A 2H32B 1FE8H 4WNJA 3HJEA 15C8L 2A6KB 4TQ8A 5IQ7L 2AV1A 3IRPX 4N6RB 2BINA 4X4MA 3OX8A 3Q1EA 1L6XA 3OB0K 5I71B 2VDPL 2HA1A 3EZ8A 5BQ7B 1P4UA 3PNWB 2ATAA 3ELAT 3NP3A 5HD8C 1NGYB 1A7QH 1NDMA 3FT3B 4Z3HA 2XJKA 1A4BA 2CWRA 3OZLA 2R4SH 2V3EA 2WXNA 4U3XA 3ZSSA 1CI5A 2BNQD 4IBYA 5E2TL 2X9XA 3GHEH 5I1AB 3KPOB 3S5YA 1FJ1A 1HWWA 1ONQB 2CK2A 2X7LB 3IJSA 4DQOL 3DPBB 4EE2A 3F7YA 3FTGA 4PB0L 2FSDA 4QYOB 1FFTB 3K6FA 4HFWB 3C5JB 5D7IF 3JUYA 4IOSD 3BGMB 4X5PA 3UP6A 4R90L 2YD9A 4Y5XB 5KYXB 3QXDA 5D70L 1PDKA 2ZUQC 2BHFA 5CZRA 1SMDA 4Q74A 4GG6B 1PSKH 2VN7A 3KLHC 2DKMA 2JKNA 5IJKA 4X5QA 3D69B 2MJWA 3E80A 3DMMA 4YDKH 3PHOB 2X6UA 2R9HC 4P4RA 5HHNA 1UM5H 3B2VL 1TLKA 3G6AA 3KYNB 2XT1B 4PD4K 1M53A 3D4CA 3VD0A 1BZQK 1D2OA 3KCPA 3O41A 1JZJA 1RIVL 2H47C 2NXYB 1W0VB 4AM0Q 5JA8B 5BQDA 2NT0A 4FYTA 2B59B 2HT3D 2DYPA 1WCBA 4PRBA 4JNXA 4K71B 4LEEA 3QDJB 1FC1A 4WNQB 4ZO8A 5DZLA 4Y8DC 3TZVD 3SJVD 2PETA 1BEXA 2JELL 3VD7A 3ECBB 3IAQA 4I9XA 3L54A 2BP0A 2B4CL 3SYPA 3ILEA 2QV4A 3L48A 3DX4A 4JANA 1T21B 3B9KD 2VM9A 3FFCD 3NCBB 5F1NA 4RMTA 3F7KA 1MJ8L 3VYNA 1CFVH 3FU7B 4XODA 5DYOA 2PCXA 3BQUD 4FULA 4HKBB 1WIPA 4Y2LA 4H5SA 4EUPG 3U4EB 4J27A 5CLWA 3VXQA 5HP5A 2X2IA 3X1GA 1KEML 5I0ZA 4JGNA 2X4SB 4N8UA 4UQ3B 1RD6A 2DICA 3BVNA 3QIUD 3FO9B 4D0BB 5EUKB 5EU6B 4KI1A 1KIRA 2LFEA 1QSEE 3WJMB 1U3HA 3NDYE 3IF1A 1D7DA 3FQNA 3K3QA 3JT2A 3FQXB 3NSYA 4RNRB 5I76A 4WVRA 4RDQF 1SEBA 3R8BB 3ULAB 3LH8A 1VA9A 3PPEA 4AQ1A 3LS4L 4OZGE 2G5UA 1KNOB 1F11A 1W8NA 5D7LD 4F8OA 4P3WA 4ZMTA 3MRNA 2J43A 4FABL 3DURA 4I0PB 4ZK8A 2AEPH 3KPNA 4Q58C 1VERA 2EDYA 3HJ0A 5D1ZA 3SCMC 4DP2X 4E41B 3JTBA 4OUUA 4TKWA 1W6LA 4G7RB 3KPMB 4DP7X 3B9KA 1DFBH 3OTTA 5IFAH 2GAZB 1U41A 1JF6A 3DOIA 4DTGH 5I1KH 4NCC1 3N9GL 3PL6C 3TWYA 2Y1AA 1TJXA 1X5MA 5IJBC 2P5PA 2DYPB 2P5WB 1DL7L 4DF9A 4NKQB 2FD6L 3K0WA 1RUMH 5L88H 3JSSA 2GUOB 4DKAA 5F9OH 4JEGB 4N2IA 3L3OB 3B5HA 3V0DA 4OQTH 3WY4A 4UV7L 4UT9L 3S5LG 4BK4A 5FYLL 2CLRA 1BQSA 2W92A 2R8SL 3B3IA 1H0DB 1VZHA 2H2PC 1KCUL 5HHVL 5F7LB 4J2XA 5JDSA 3AM8C 4X9BA 2YPVL 1N5YH 1T3FA 2D2OA 3D25B 4E42B 4IW4C 4UM9B 1E5AA 2K45A 2X2HA 3V4VB 2AJZB 5ALCH 1XWVA 5ACLA 1QFHA 3MLYL 1S7WA 2NY7H 1BD2E 5AVVB 2MRYA 4M3HA 4O51A 4ZQKB 1RI8A 1U8KB 4YAQA 3HPJA 1M2VA 4WUUD 2YC1B 1XGPB 2CRYA 3LRSA 1AIFA 4JN1H 4RVBA 1KN4H 1QFWL 2HJLB 2CIIB 3L6FA 4IBQA 2WXKA 3KLKA 3BT0A 3V6FB 2LLLA 2CJTA 1WV7T 4WSGA 2NR6C 2ZYHA 3LIZA 3U4BL 3WTYA 4OD3H 1YEIL 3BP6A 2HRHA 3QC5X 4JFPB 5D1QA 3RWEB 3RHWF 4JZNB 5DXWA 2ZUVA 4HSAC 1QHPA 2UX6A 3DRQA 4J39A 3MOQA 2ZXBA 3CDCA 1KOAA 4AYBA 4QJ5B 1EDHA 5GS1C 5IIEA 2ZZUT 1W9XA 1BAGA 1BZ9A 1SYVB 4FNSA 4UV4L 4ZAKD 3HVDA 4R5VA 5DSCB 5BMFL 2VDLL 5A2KH 1JZ5A 2EZ0D 2NY1D 4XNUH 1JUFA 4JM4H 4U49A 3ZE0E 3V6OE 5FUZL 4F7KA 3P2DA 4KVPA 2GAZA 4HKJA 1ORSB 4JLRA 4B3VA 4UT6A 4TUOB 4R3SB 3MLPA 1I3GH 1IM3D 2UZXA 1CT8A 1ET8A 5F8RC 1OP5H 2LQRA 2K6WA 3LNHA 3G08B 1PG7H 2N7AA 3CVHL 3IPBA 3QXTA 5A7BA 1CD1B 5KVEE 3MO1B 3D0VA 3ECWA 4KMTL 4XO3A 8FABB 4OJYA 4P2YA 5F9AC 1G1OA 3KNBA 1CB4A 1OK0A 2FHCA 5CS7A 3MNZA 3PNRB 4ETQA 4KKRA 1DEEB 1BVKA 2WY3B 3LQAL 1PQZA 3KVQA 1GTNA 3RGVA 3P0VH 1GAFH 4NJ9L 3WV0A 3UBGA 4IS6B 4P9HH 1WTGT 3HA0A 3HE7C 4X6EA 4NRZA 3A3YB 4RMRA 1S46A 1GGIL 3HZMA 4E41D 4GO8A 2L7JA 1SDAB 4L4VE 4UTBH 3X14A 4IRSC 1ZXKA 1PU0A 4ORGB 5KUMA 4X4YB 5JIKA 2IGLA 2ZXDA 1MWOA 1U8KA 4F20A 2H4EA 3MLWL 1I9IL 1M6OB 1KXHA 3CVIH 2RJMA 3VM7A 3W3BA 2DQIH 2OL3A 5HHQA 5HGDA 4IRZL 4J4PA 3N1MC 1JV5A 4FLOA 3EJCA 5JW3L 4LSDA 1IAKB 4A38A 2XTLA 4Y4FC 4OSUH 1KIQA 1ASPA 3CN4A 5IESL 3CFJB 5EZJA 4IIQB 3UPCA 3TYFA 4LCWA 3DRQB 1Q0YH 3HI1A 3J07A 2QSCL 4Y1SA 2V9QA 2AKRA 3B2PA 3N43F 5MENE 2H2SC 5DEFB 2PMZA 4RH4A 1M3IA 4X50A 4H25B 1DO6A 3ARGC 4HA1A 1K4CB 2XWJA 4PH8A 5ADPH 4KPHL 1D9KD 4RMVA 3E2HB 5C08A 5KSBB 3BEVB 4ZPVB 3ZN6A 4WFFD 5EA0H 4O58H 1ORSA 4XXWC 5DR5H 1ZT1A 3ZKXB 1HXMB 3OJDB 1MCCA 4QTIH 4UILL 1NKRA 2VL5B 2ZP9A 2ZWKA 5BVJB 4JZJC 1EZVX 1W91A 1OHZA 1SN5A 1GHFH 4YHYC 1MHHB 5JPNB 4KKQA 4HP5A 1K6QL 3RB7A 4DGYL 1DBBL 3ZHDA 3MNZB 2JJUA 1K9TA 1EEYB 1EGJH 2FYVA 3RIFK 4LU5L 1BWWA 1XF3A 3IE9A 1AZUA 3MRHB 2ADFH 2MCMA 5E6YA 1NPJA 3VWJB 4Z77B 2VZTA 4YSPA 3HZVA 1M71B 3MLSH 5DQDL 4NQCD 3MXWH 4XBPA 3UYRL 4BDVA 5KYYA 1ZTXL 5D5MF 1UG9A 2WCGA 1IBFA 2GJZB 3GRWA 4GAJL 3KH4A 4NKDA 2BVEA 2OZ4H 2AABH 3S36H 4ZNEA 2EDKA 1Q9WA 3QXAA 3ULSB 4QKTA 1HKLL 1CTMA 3ZMEA 2DQTL 1X5ZA 1AS8A 4XBMA 3V6ZB 1RULH 1FFRA 3MLXH 1KWGA 4P5RA 1AMYA 1FIGH 3M8OH 4YL4A 4PJBE 2E8ZA 4PGJA 5LGJB 2DJUA 1XF2A 5EBMB 5KJ7E 1V3MA 5BOZG 1AO7A 4K5PA 5KTEH 3MUGA 3CFKA 1URZA 4QGYA 3WDJA 2YRPA 1CUOA 3EXLA 2YRZA 4UCFA 5DD5H 4D8PB 4LCWB 3QJUB 1OHQA 4YE4L 1NEPA 2BXYA 3MVSA 4G8GA 1DSWA 5E9DD 3QQ4A 3KL0A 2BS9A 3X2QB 4JKNA 1WA0X 2NX5E 3I9GH 5EUOA 3NFSH 2VR4A 5J6GA 3AG4B 3EADA 4HWNA 4Y0GA 5EN2A 5FKAB 3MRCA 1JNHB 2AI0H 4ANKA 2Q7YB 2EDLA 3EO9L 1YA5A 3D2TA 5K9KB 3PU7A 4W81A 3ARFD 4MMYB 1KIPB 1O5DT 1BG9A 3RJOA 1MLBA 2WTRA 1RZKH 4PJ7B 2D7MA 5AOLA 1NDMB 2E9GA 3FT3A 2QFRA 3DBSA 4NBZB 3WFDH 4URKA 3MV7E 4WW2F 4YQXH 3GSVB 4TQPA 4NWUL 4E36A 4MNQB 3NSDA 3K2IA 2QSQA 2DW5A 2F7RA 2R2HB 2X7LA 1CLZH 4KUZL 5AVYB 3V79C 4Z3JA 3EOBA 2HH0L 1GKEA 4P2OB 3DMMC 2VYRE 5F0LB 1BXXA 2WSDA 2CDEA 3GPSA 4FZ8H 3NSJA 4Z3GA 3O3BB 3QW9A 4KHXL 3HR5B 4XPBH 3QUHA 3VI4E 4I9WD 2LAGB 4LQFH 5C08E 4XVUC 1IFHL 2P26A 1F97A 3WHE0 3GLEA 4P4RB 4P0DA 2ETWA 1FBIL 2E3VA 5J11C 5GGRY 1WWCA 1ACYL 3T3MF 4LL9A 4L8SC 1NSNH 4G2AA 4W4NA 2C4XA 5DD1L 2C3WA 3UCRA 1LE5A 4HIJA 4WI2A 2OYPA 1EXUA 3VFOB 2I60L 3BP4B 1BVLB 3O2WL 1AY1L 1RK7A 4FXTA 4MCYA 1B4RA 3FTXA 5D1XA 1ANUA 2ZP8A 3RWHB 1HQRA 3TXAA 1X5XA 5GS2H 2A9NH 3AREC 3MOAH 3BRGC 2OW6A 2GY7B 1OTUC 4XNYL 1L7IH 1UT1A 2BNRA 3HNSL 4CGUB 1KPRB 3NA9L 4GUPA 5CJ8A 1PAZA 4M02A 2BMKA 5CILL 2B3RA 3LN5B 1CGTA 1G9NH 5BOPA 3FCSB 5D6CB 3WIAA 2B8OT 4Z0XA 4PWEA 1JG9A 5F1NB 1MRFH 3CDGB 3BUYB 4R97C 2E5EA 4EBQH 4MQXD 2MOVA 3VTMA 3FUIA 3ILPB 3IS1X 3P4NB 4MD4B 2UVFA 3B9EA 4IBLT 3DVNB 1WPCA 2QVTA 3EOTL 4LSQL 5HI3D 2WNGA 4RAUA 1XEUA 2EUVA 1EO5A 3QHTC 2BRRL 3DTXA 5E9AA 3JWNE 5F3BA 1YMMA 1IIKA 3BKJL 2D2CC 4PJBF 4MKTA 4R9HA 1OW0C 1AANA 3KAAA 1ZANL 4JPVL 1JHKL 5EIIG 1KYDA 5BW7C 4UQEA 5CP7B 2X4QB 3FQNB 5DLLA 2OMWB 2JJWA 1XF1A 5JHDE 2G3ZA 3VFMB 1VGKB 5IFJA 1J88A 2F5AH 5J1TC 3V7AG 1CFTB 1U91B 2FNBA 3B7RL 4ODXA 1F11B 3EW3B 4G82A 2JSFA 4DN4H 4E9SA 5DC9B 2XN2A 3KCWA 3RG1C 4CSSA 4UOQA 3H7BB 4LVEA 3ZYIA 4G6KH 4MXVE 1S5HB 3AZUA 4ZQTA 3H9SD 3WU1A 3ARSA 2AGJH 2KERA 3EO1A 3DUHA 5I8EB 4Z7NF 4D9QE 4DGIH 3DXAA 3Q01A 2FQEA 1P2CA 3C2SA 3UH8A 3GSUA 3QO0B 4LP4A 4CBZA 1MPAH 1CE6A 1X44A 4PG2A 4PJFA 5ANHA 4CMMA 5HHXH 1VCBC 3QPKA 3ABGA 5IF0B 1WBYB 2ZUYA 5I1DB 5M94B 1DQTA 2QQKH 4FFYA 4IKIA 2AXFA 3SE8L 4PYHA 4OLYL 1XGYL 4NUGH 3SBWC 2IH3A 3H2WA 1JYVA 2UY7B 3EJJX 4O02B 5DQ9B 5EZOH 4FXLA 1QUNB 5FGRA 5ABAA 4KITB 5L2KD 4QLRA 2GFBB 3WTUA 3GTVA 1LMKA 1LO0L 2X3AA 2GIYA 4FMKA 1BGXL 2OCJA 4PBDA 1BJ8A 4QRTA 3TIEA 1WVZA 3FCSA 4PGCB 2HRPH 1BF2A 5AAMC 3MTRA 4FNUA 4DVBA 4FFZH 4YNYA 3ROOA 2WLKA 4XT1C 3P4NA 1ZLSH 2L7QA 3V4VA 1ACCA 2IALA 2P8PA 4M8VA 2HX7A 2L7EA 5K1VA 1E30A 1G4RA 3DARA 4DKDC 4O4YH 1CGSH 5I1LA 4F27A 3EH1A 3IAGC 3AREB 4KJPD 3ULUL 4NPYA 1QZNA 1FQ9C 2Y22A 1CDJA 2ZCKL 1M2VB 1BVOA 4JFEE 4NQXB 5ERWA 1TEYA 2NDGA 2VUOA 2AK1H 3ESNA 3QIWC 4UDTB 1YC8A 1NCAH 4JRFA 5DHEA 3DX0A 5FA3B 1CZ8H 3MV8D 1YNLH 4S1SL 4DZ8B 2BVOB 4XC1L 1UT2A 3DI3B 4AZUA 4BH8A 2J88L 4ENZA 2ADGB 5JOPE 1RPKA 3FUNA 3GSQA 4LL1A 2Z1PA 4ODXB 1S7QA 4G42B 4A2FA 3U6RA 5TDPB 4OJFL 5EF3A 1UA3A 1CFMA 1BQLL 4BWUA 5BZWB 3W81A 5ID1B 1BZ9B 1SYVA 2VC2H 1AGBB 3G5VB 1HI6A 3ISRA 3PWPD 3EHBB 2ED9A 3QR0A 3QGVA 5HJDA 4NB7A 1JPFA 1TOXA 5J1AB 4ODSL 2NY6B 1BM7A 4CVXB 2W0FA 4JQVC 4QDGA 2EC9U 4TVPE 3VXMB 1U30A 2C4FT 4QPEA 4HKJB 3QFGA 1UKSA 2BH0A 3FT9A 5IBTH 4AJWA 4NLAA 2DTML 3VG0H 2X0VA 2X2JA 4P9ML 2W0LA 1XR9B 3T1FB 4G1EB 5HDBF 1KIUA 5JW4R 5JTWA 5FUOL 4JM2D 3L2LA 3BWUF 3A22A 4WEMB 3IGKA 1N8ZA 4B95C 4ES9A 2VC2B 5T1JA 4CW1A 2CXGA 2XACC 5EU6E 4KNQA 1PZBA 3VXSB 3IDGB 4WO4C 4PWIA 2O5ZL 2J12B 1LD9B 1G84A 5JPNC 5B21A 3TCTA 2LVEA 5I9QC 4MS8D 2R23A 2EDDA 3QUKB 4V1DA 4EI6A 1A47A 1KPVA 4KXAA 2ROYA 3EJSA 3G9AB 3OHXB 2YOAA 3IJ7A 3QDGD 4BBWA 2WQXA 2IALB 2P8PB 2XZQL 3AQDA 3MJ9H 4X7DC 1KBGH 4NFDA 4A2MA 1MRCL 1R3JA 3LRKA 3VU1A 1AC6A 5I1LB 3BIKB 3QYMA 3CFTA 3LOWA 4BD4A 3FN0H 1WAEA 5HVGB 3F2LA 5ERWB 3S3DB 1GS8A 1HHIB 3VWKC 1WBZB 4ONHB 4B41A 1WA2X 2DQCL 4EEEA 3MV9B 3VFUB 2EQDA 3QIWD 3QULB 4P3CL 1KLUB 1FORH 2CLZA 1EVTC 4UWQB 3AADB 1LK2B 2HKFH 1IRAY 1R3HA 3ZKSD 1QSED 2B08A 3U6RB 1PL3A 5L2KB 3FQYA 5TDPA 1G94A 1MQKH 3GNMH 3NRFA 1CVSC 1GKOA 4QR7A 4FXGC 4NNYA 2YPLB 1LEGB 2XWRA 2VR9A 1JGDB 1HQ4B 1AGBA 1WFNA 2B5IC 2ZNXA 5K59F 3L8QA 2XWJB 3UTSD 1CDIA 4PLJD 4X6BB 4HK0A 1J0IA 3BGFB 4LCYA 3A6CL 3VXMA 3EJZC 4AUYA 4HMCA 1BMGA 4A7SA 1A1OB 3FFCE 3FK3A 4FFZA 1ZT1B 1E4KA 3F8UB 5FYKU 4N8PA 1NGWA 1X4YA 4R2GB 5AYTA 3TO4A 3ZY7A 5AAPA 5KS9A 3SOBL 5LVEA 5BVJA 1FRGL 3T1FA 1PPIA 2X9YA 3NGBB 4DWHA 3H54A 1OWRM 4ES8A 2DIAA 3ZQWA 3TT3H 3RAJH 5H37G 1WAAA 4L4TD 4CVZA 2AQNA 2DEWX 2XN1A 4WWID 2IAND 4CW1B 4A2EA 4N28A 2KLRA 3VXSA 1LE9B 3VFNA 1PCXA 1UWFA 3BVDB 3D39A 3HBGA 1L0PA 2PCPA 3CH8A 2A9ML 2EDXA 4PUBL 1QNZH 2DQHH 3GO1H 3OKKA 4FFYH 1EZUA 5GJSL 1K2DA 3NMEA 4K9JA 4BSJA 4NZDA 4JM0A 2EE6A 2HMIC 1KPVB 2OJZH 4NZFA 4JZJA 2APSA 1R17A 2DWEB 2Z7YA 4NQEB 3NEEA 3TVMB 1B4TA 1F8TL 3C60C 3LB6D 2NUTA 3B2XA 2I9TB 5HGHB 1GW0A 3TBVB 3WN6A 4K9EH 1J8KA 3S35X 2OJ1A 4GBXD 5F9JA 5KYWA 1NL0L 4IOIA 4ZFFA 3QZBA 1P5UA 3L2NA 2ZCLH 4YX2L 4EN3A 2ZP0T 1I1AC 3CLWA 3V6ZA 4Z23A 3UL4A 5GS1B 3DSFH 3ZO0A 5C9KA 1T66C 1QO3A 1MDAA 3W39A 2B3IA 1CICC 3LZNA 3O2VL 3TV3H 2H6PA 2ZOUA 5LAXA 3IDYC 3RILA 5E1IA 5KBPA 4QCIB 2ZOLB 5T8IA 4AH2A 3RNQB 2D03H 2QVFB 2QEJA 3LRHA 1I8KA 3Q5YA 4HS8L 4LEOB 1R1CA 1EEUA 3OJ2C 4AQZA 2XYCA 3RHWK 3PYCA 3BCFA 4OZGF 5JXEA 1B0RB 1J8HE 1YYLH 1MG3C 1M6UA 3FU5A 2NTFB 3D5OF 2XKUA 1J5IA 2Z4TA 1UASA 4QRPB 3HE6C 3CZEA 3KPPB 4KDTC 2PP7A 3QCUL 2MQ0A 1XD1A 2H26B 4EN2A 1U93A 4KK5C 2A74A 4Z7AA 4TQHA 1NWPA 2GIXA 2F18A 1FLRL 4PVNA 2ITEA 4AZ8A 4LCIL 5I6OA 2VLKD 3EAKA 1BIIB 5I66A 4LK4A 1QLRA 1EK3A 4XMLH 1E8ZA 5IB1A 3SJVB 4NT6B 1GOHA 4X5RA 3VGBA 4E2OA 4TVPH 4H88L 1RZIA 1IAIH 3NTCH 2P24B 4QHKI 4XOAA 5D4IA 1AGDB 1N0LA 5AD0B 2OQJB 2EDWA 2DLEA 3TOPA 4LHUA 3F7LA 3FONB 4NZUL 3KW8A 2R69H 3HAEG 4PRPD 4L0ZA 3RFZA 3W38A 2R0LL 4F57H 3JTTA 4Q0XL 3BQVA 2BC4B 2J8OA 5F1IB 3VNZA 5HY9B 2D8KA 1K8DB 1Y07A 4W9EC 1HCZA 3T0EB 2QPFA 3C08L 4OZ4B 4PGBA 5EIIB 1ZT4B 3BH8A 3T0EE 4DUXA 5GIRA 4XB3A 1M7DA 3L4YA 4G6FB 2YD5A 4NCC2 2WZPD 4XNZC 4IOIB 3UYOD 4ZFFB 1XX9C 4RFNB 3DV4B 3J2PA 4G3YL 2G0KA 3CZGA 1T0NA 2G2NA 2OSLB 3WE6A 12E8H 3ERXA 2PR4H 1CE1L 3P02A 3KM1A 4UT7H 5IHWA 1S9VB 3G04B 3KMDA 3MJ8B 4P3DB 5IM7B 3RUGF 5K33A 2BIMA 4UT6L 4JPIA 4Y1AD 2CLVA 2XX0A 1HZHH 3LEYL 4LDOB 4OFYA 1BFSA 2H6PB 2E6QA 2VQUA 3CBKB 4MA1C 2F68X 3O11A 2KBGA 1D5XB 3QFDB 4YIQA 2FT6A 3U9UA 1TJHH 5F7WC 4ZUUA 1MVYA 4FNLL 4BQ6A 3PPSA 1JTOA 2IAMA 4FZEH 4ZBJA 1KB5A 5CCGE 1IX2A 2B77A 3C8KB 3E8UL 4NDMA 1FYTD 2OMNA 5EEWA 2OM5A 5K9QG 1WF5A 2Z0UA 4MMXB 1T22A 2GHZA 3ATDA 4X0KA 3EYFB 5D6CA 5L7XL 2BWQA 3HHSA 4HBCH 4Z7OB 3CDGA 4R7VA 2FZ3A 4BA0A 4JFDE 1N7ML 2WOBA 2QJDA 4ZUWB 4YEFA 5DD3L 2A38A 3VI4F 2R0WL 1CXFA 3X3GL 4EIGB 1FO0A 5CSGA 3TN0D 4M6AA 1KJ3H 5AG9A 1PAMA 3HFML 4QTHA 1TIUA 2WSKA 3V52L 5L8KB 5HYSB 5CIPH 2YA1A 2BY2A 2GTZA 5CZXD 4ONGL 1UKQA 2XVKA 3BUTA 4Z7UB 5E8PA 2YA0A 4A6YA 5TPWL 3BP5A 3P40A 3JWNC 3EH3B 5HDOA 1RZ8B 3VX1A 4PJ5D 2IDQA 4LRNL 2AANA 1MWAL 1P6WA 4WUKL 1F3DH 3FU9A 1M7DB 5DURB 1HKFA 1NCOA 1BQUA 2ODHA 5C0FA 4LFHD 5I30L 1C5BL 4GQZA 4WHYH 3SCMB 5CEZD 4O2CA 4V33A 2PXYD 5GPRA 3BKML 3JYBA 4E9RA 3WIHH 4AWJC 5EU3A 1EANA 2ZSVB 1A9EB 1IJ9A 1IBGL 3CMOL 4S1DC 4UZGA 2PTTA 3MCKB 1F6LL 4LBAA 4D94A 2L0DA 2B9BA 5I8EA 2F74A 1RUKL 3GEWB 3IGAB 4MDIA 5D7EA 3SJVE 4DKFH 1IVLA 1P2CB 2IFFL 3BGAA 5T3ZL 5E5LA 2HG5A 2YUVA 5LGHH 2H5UA 3W2DH 4AC4A 1XEDA 3BT2H 5D9SB 2WBXA 3H9YA 3MJ7B 4N0CD 1CXHA 4PYGA 2K6YA 3IVKB 2LU7A 5IEHB 4DO6A 3LZFL 5EZLA 4JW3A 1EQWA 1MLCB 2P7TB 1MJ7H 1Q38A 1ZHKB 1LJMA 4PY8I 4DN3L 4XAKD 3Q6FA 1J18A 1LTXA 3NRPA 4PS4H 2IPTL 4DHLA 4YGVB 1UTDA 5ISZE 4GKZA 4IYKA 2V5RA 6FABH 4N6RA 1CICB 4C54A 3RVXC 4ZX4A 3ARGD 3EFDL 2CRZA 3RGBA 2W38A 3NABH 4M1CC 4WI8A 4BQBA 3HZ3A 1XDTT 2H2SD 2RCSL 2JB5H 4FXKA 3TBBA 5IUSA 3EGSA 5LBSA 3JVGC 1SDDB 5AKVA 1RCYA 2IG2H 2IDSA 2K70A 3L5WB 5I1AA 4I3RH 1A1NB 1AHWA 2ZSWB 4MA8H 1HNYA 2WN3A 1YNTF 1RIHH 2OAAA 4Y4FD 2ZCHH 2VWEC 4ZYKB 3K46A 4N9GA 3F7YB 1V7ML 3FTGB 4X8GA 3P4MB 2VABB 1MFAL 2UY6A 4K23H 2YD8A 4OCYH 2XVGA 4JO2H 4N26A 3VXRA 1U8IA 4Q9CA 4G6AD 5D8JL 1CU4H 1FF5A 4ZUTB 4QF1A 4GMSH 2J5LC 3RE0A 3G6JE 3RDTA 3E6HA 5TQ0L 3GUFA 1C5CH 2PKDA 3IDNB 5HHOB 4PRHD 1R75A 3UPRA 3HE7D 1D7FA 1MN4A 2XPZA 3G6AB 4JVUA 3O4OB 1F42A 3RPKA 3VFGH 1LO3L 4KVNH 1OP3H 1OKEA 2SEBA 5DMJB 4YZFE 4XNQB 3TA3C 2ZXAA 4R4BB 5KW9H 4J3WA 2GI7A 4FFVD 1N18A 4R26L 1Q94B 1YZZA 2ZAHA 3LCYA 4KTDH 4P5MB 5DMIH 4ZFZB 3C2AH 2RALA 3MROB 2E59A 4J6IA 4AVKA 1CWVA 3FYIB 3S96B 5EBWB 4PBVC 4NO0D 4PBWD 3F7PC 1A8JH 4KZDH 5AW1B 2LT9A 1I9RH 5DVKA 15C8H 5IQ7H 3ECUA 4WAFA 5IBLD 4XP4H 2EE3A 3GBML 2Z91B 3QWRD 3T71A 3BUPA 3FTUA 4HXAH 5IVXE 4XCCL 2ALAA 1UYWH 3NA4A 3ZTNH 4EUPH 1RSYA 2H0PA 4V1DB 4BZ1L 4EI6B 1MVFA 3NPZB 5A43C 3IB4A 1A7QL 4UAOB 5LXVA 4G7VL 1EFXD 4M9OA 5DYOB 1U8PA 3RVVC 4PTTB 1AXSB 1XH3A 4K3EH 4M8UA 4YH6A 2KL6A 2NQDA 3VI3B 4KKPA 2DYPD 1SXCA 1QMUA 1W15A 3CAFA 2OULB 3BIKA 3GD1C 4KI5D 3BKCH 4EI5C 4CSPA 3BAJA 4NO5A 4QIRA 2DD8H 2GC7C 3MX0A 1TNNA 5CGTA 4J3OD 4EUPA 2FL5A 2D4DA 4PB0H 5HSFA 5F1KC 4AX3A 4RNRA 5I76B 4Y4HC 2VN3A 2A83B 3MV9A 5DJZA 3V0AC 1KTCA 2ZJSH 3VUAA 1WBXB 4ZFGL 4JRXB 2HFTA 5B8CC 2XV2A 1GC1H 4YDLB 4M7ZC 1U8IB 5L2KA 2ARJQ 3NJNA 4IGBC 3T2NH 1SM3H 2WXHA 1IGML 1E7VA 4NXSA 4PJGE 3QUZA 4EIBA 1G0XA 5BRZD 3CHRA 1N59A 3LEVL 2V2XA 3OPZL 4JFFA 4LKXA 2J8HA 3B2MA 1XH2A 3CN3A 1T0PB 2ZUXA 1G7JA 3CN2A 3S3JA 2DWDA 3U30B 2J6EH 2YRLA 1QBML 1U8CB 2XNAB 3RTQB 2O93L 1KYUA 3KPRD 4X80L 1WSST 4DGUA 1DVYA 2NX5D 4NHUB 3UROR 4DP4X 3PABA 1E43A 1I7UA 1TTRA 1S5IH 4GI9A 4ISVA 2AHIA 3ALXA 5HJ3B 4JDZA 4OR1A 5E4OA 4ZFZA 5DMYA 2NY6C 3ECQA 4GXUN 4OFDA 3S96A 5GRUH 4ZTOH 4WW2B 3CLEH 1LDPH 4KRPC 3PGDA 5I18L 2P80A 3L3GA 3ZE1B 1NAMH 2H0JA 3CHXA 1H0DA 3ARBB 3NFPA 4TVUA 3WFHB 3SYAA 1FLTX 4L1HA 5FF6A 3OKKB 4QRSA 4DETA 4X5WB 3NJXA 3D8MA 2A0LC 5ACMA 3RBGA 4KY2A 3HS0B 5DK2A 2F7QA 3L9RA 1OAQL 2AJZA 1XH3B 4YHIA 4UNIA 1EPFA 2O5XL 3LRLA 2NY2C 3TFKC 2VE6A 1E9QB 1NEZG 1OM3L 4JQVA 3ARQA 3ZRSA 5BVPL 4PD4J 2WUCH 4QD2E 4Y9GA 4AXWB 4JFEB 5CJBA 2VXSL 5GSRB 2YEQA 1JVOA 2A83A 4QMEA 4LIQL 3UTTA 1DVSA 2CU9A 4RISH 3LS4H 3IMVA 1N2RB 1E4HA 4ZPTB 2QHLA 4JZNA 1YECH 3LN4A 4YJZL 3K72A 3UGXA 1I31A 2E76C 3CFCH 5C07B 4HG4J 2O6FA 3BC9A 4UZSA 2FWLB 3X11B 1HH6B 1WFTA 3O3EB 3AXLB 1KJVB 2WP3T 3VXTA 4ZMVA 2IOOA 1GJIA 4PGDA 1BQHB 4Q9QL 2VRQA 3U46B 2H8PA 4HHAB 1R46A 1P5VB 4OZFB 2DWDB 1EFXB 1GS7A 4M7JL 5B1JC 3PDGA 1DJYA 4PJ5B 4U3SA 4MGXA 3ZSTA 2Z8VC 1KTLA 3CFQA 4MXVF 3HEIB 3PF2A 2DYRB 2MOGA 3MOBL 4LHQB 2W1NA 3Q0HA 4L37A 2UUDH 4AZ8B 1Y18A 1NC4B 2ERJB 2FX8H 5A2LH 2WLIA 3KD4A 2WXGA 4NAQA 4WW2A 4MBRA 4KKNA 5E1HB 4ABUA 3MRDB 3T9WA 2HRGA 1AAJA 3L3GB 4MA3A 3X1FA 4AQ8A 1DVTA 1XSJA 3FTYA 4UQIM 5EIQA 4PJBA 1QR1A 5CNHA 4LHUB 2CDGB 5J89A 5KVGH 4FQXB 2NPLX 3SEPA 4YN3A 4X6EB 5B22A 1XGRA 3VG9C 3PP3K 1FN4A 1YY8A 4JJOA 3SBRA 2NCEA 2CDFA 4KJQD 3IFPA 1PZ5A 1MJUL 2DPKA 4F33A 1UZGA 2I26N 2QHRL 1V3KA 5LBSL 1QLEL 1XZWA 4AIXA 3U0WH 1KCBA 4GPVA 1U8NB 3FO1A 2V7NB 1E28B 1HN1A 1OCOB 1SRDA 3L5IA 5HGDB 4YFLF 4AMKH 5CN3A 5C92A 3T0EC 2DMBA 2EDHA 5D4QA 1ERNA 1TQUA 1GIGL 1IGIH 1YEKH 2E9IA 3POCA 5FYKH 1IGYB 1IAKA 2E9JA 3MJ8A 4KKLD 4P3DA 5FM5O 3ZTEA 1MFCH 2N59A 3HN8A 4WU5A 2PR9A 3K72B 1Y0LA 2IBGA 3CG8A 5IB3B 2P5EE 2WLHA 2L3BA 3MRPA 4LSTH 1VEOA 2FECL 4GRLD 4PRIE 4AV0A 3O3EA 4IU3B 1OP5K 2N7SA 2E46A 5B1JA 5E8NB 2EXWC 3FF7A 2XRAL 4UQBA 5ACZB 1KB3A 5FUZH 3BUBA 5E70A 1OW0A 5DJ8A 2ITDB 5KVDL 4JDTH 5C6PB 1MNUL 1OY3B 2LGNA 1ZLEA 3QG7L 4JB9H 1XD0A 5J0BA 4M3JA 5F6IC 2AMGA 3CU7A 4PS3A 1S3KH 4A39A 5T1KD 2IF7A 5B4MC 4JE4B 4XZUA 1G1KA 3LMJL 1OV8A 2JJSA 1U58B 2VDRB 4YVUA 1WT5A 5FPIA 4EIUA 1UXMA 5B8CB 2N4IA 1N19A 5A16A 2Z92A 4ADJA 1H3VA 5B39G 2OMYB 4IMLB 1F4AA 4HH9A 3EUDA 1WG3A 3HR6A 3KYKH 3QNXA 4N0FA 4GSQA 4LSSH 5ABZA 5JW5B 2CQVA 1YHPA 2R0ZH 3GSWB 1MVUA 3WNKA 2K8QA 1FZMA 3NJMA 4WUUA 3BD5A 3QH3B 4N90E 4E9VA 4KY1L 1FC2D 5DZAA 4UM8B 1XQ4A 1WAAE 2CK0H 4JFVA 4LPVA 1KCWA 1Z6JT 2AQ3A 2FH8A 1KC5L 2AC0A 1UXLA 4BFOA 4N22A 1B0IA 4HCRH 2LTQB 3F5WB 3OAUL 3LQZB 4OIFA 1DE4B 3Q3GA 4ELKA 4JFQB 3SBWA 2DQIL 5D55A 3RWIA 3UCQA 1JPSH 2XQYA 5EO1A 4LSUH 5IJDC 5JW3H 1IAOA 3GMNA 5DEJA 2OTWA 5KG9A 4FJYA 3E9UA 4IU2A 3MZTA 3F05A 1UWXK 2QVMA 1WWWX 2BOCB 2ADJB 1T1WB 2VKXA 3K74B 3PV6A 2QQNH 5I8KH 4Q6KA 4QHLA 5FO9B 5B1AB 5IESH 1A9EA 2ZSVA 3NPSC 3GSOA 1FVEA 1IEBB 1JVKA 1E8WA 1WA1X 2XTSA 2GW5A 4MDIB 1DBML 3EYQD 2ZX5A 4Z76B 1BZ7A 1PIGA 4XRCA 2GSIA 1PY9A 5HDBB 1KCSL 5DJCB 2VSCA 4HISA 4AMXA 1ILSA 4CDHA 2F8VA 2VZ1A 3DKHA 3VO0A 3TLRA 4KJYB 3EHBD 3H53A 3GMRA 1MLCA 1SGKA 5C09D 3SDAB 5B38G 2QADC 1HZLA 5EU4B 1JZ2A 4NUQA 3CZLA 3W57A 1ADQH 2QT6A 4HIXL 2XIDA 5KSBE 1OAUH 3D07A 1BVNT 1PNDA 1VRSA 3RJQB 4CC4C 4YGVA 3WGVB 1NAMB 5F9WC 3UZEC 1CL7H 3US1A 4GW5B 3G7TA 4ZXBD 5AWNL 4KQ4H 1YYCA 4LCUA 4UM9D 4PJ7A 4APQB 5D71H 2OMYA 4IMLA 5DHXB 3L17A 5CJQH 1JRHI 4HH9B 2NT1A 2YUZA 3UAEA 2YWZA 4IBVA 4KO6A 5CO1A 3IN2A 2AJVH 3BXNB 1E2ZA 4LPXA 5LWYL 2YJLA 1MVUB 5GS0D 3WJJA 4QRFA 4GUOA 2MOQA 3MLSL 5TTRA 5DFTA 5IOPA 3IDXH 3FQUB 4PJHF 3BVXA 1MCOH 5CP3H 2J44A 3PWNA 1TZHB 1QSFE 4Y1TA 3WBDA 2VKWA 3APDA 3NCCB 5DVMA 3SY0A 1DN0B 5EOCL 3QXUA 4AUJA 5MI0B 3QORB 3ZDZB 1HEJC 1G6RB 1AHWC 1FGVH 4A7GF 3SGJA 1RULL 1OSYA 4UBDD 4ODHL 4LLQA 4F7MA 3QXVA 1Z0NA 4YZFF 1NCCL 3MCG1 5EPMA 5A2AA 1WDAA 5J13C 4E68A 3BZ4B 1JWUB 1BQRA 2HN7A 3E9TA 3NJIA 3OMZA 4KX9A 2MNJB 2DQEH 1WEJL 3L4VA 4IMKC 4Z7VF 3BWSA 4XRCB 5GRYA 3SPVB 3TN0A 4K5LA 2V2TA 5AZEL 4OLVH 2BW5A 2LFGA 2NY0B 1FGNH 3SN6N 4JFHD 1IT9L 2P8LB 5EO0A 1CPUA 1TQBC 2CIKA 2NSXA 3RWHA 3TO2A 4ZTPH 3V9EA 2NY3D 2V0AA 5D1QD 3SDAA 4YBQC 2I9LA 1GPOL 1S7VB 3CFDB 1PX4A 4NKOA 4ZW8A 3WFEL 2J1YA 3BHBB 4WO4B 3DNKA 1F4XH 1RV6X 2UZYB 3LV3B 5KYNA 5I23A 2VW4A 4H8VA 1WZMA 5BO1L 1NAMA 1N6VA 3WSQL 4Y9BA 1TJGL 1BZDA 2Z7WA 3NCFB 1XBRA 4NJAH 3C6SB 1CF1A 3ZTDC 3WFDL 5C0AB 1F3JB 3PP4H 4IKJA 3UG5A 4GFTB 3MJ9A 1C7TA 1HTYA 2HX9A 2AQ1A 2YD4A 2WXIA 1AR1B 1KDJA 1J1XL 5E95B 2A1WL 1NZRA 3QEUA 3TU6A 5KOMC 3HUJF 4V2CB 3PIQB 1OANA 2VXQH 3WNIA 4PJIE 5DEGA 3PHAA 1AGCB 1J05B 2J6EA 3QNFA 3S4SA 5H35A 2OSWA 3NJGA 4JKPH 4YL9A 1F5WA 1EAPA 1WWAX 1A3LL 4GKLA 5KZCB 4XVSL 4U1NA 3WHXA 4PJGF 1BM3L 3FQWA 3IYLW 4ZTEA 2E9BA 1A6WL 1IBBA 3D30A 4ACPA 1ETZB 2ICWA 4JDEB 4PJFE 1E3ZA 3DJRA 4WQOA 3E8VA 3CNKA 4FL4C 3L81A 4R4FH 4ZFQA 4U3CA 5CR1A 5SX4I 2AJXL 3K6IA 4LKXB 1A3QA 4HQQL 4IMKA 4JCLA 4X9GA 1OM9A 2YQ3A 4NSKA 2HN7B 3U7YL 4Z0BH 3F58L 3JWOH 5INDB 3QWNA 1HE8A 4KKAD 1U8CA 5IT2L 5JA9A 4CMMB 5TK4A 3S8FB 1ZPLA 2DZEA 2Q9OA 1AY1H 3T8XA 3PAVA 2QGCA 3TEZA 4TF4A 4PRHE 4JDZB 4MZ3A 1OWWA 3ES6A 3QQDB 3BEWA 3QEHA 3V9FA 4QRRA 3HNSH 2Y1ZA 3GLZA 3V5HB 1G7PB 2FQGA 1S7VA 4YXKH 1P4BH 2VITA 5TE6H 3WXVH 2W81C 1N4XL 2WNKA 4ZUVB 4E9TA 1BAWA 4WO4A 5CILH 4K7FB 4YGAB 1NFKA 4LOUC 4K7PH 3IJHB 2DLTA 4DJMA 5B3SB 5ANMB 4W9CC 1MRFL 1BYNA 3I75B 4QRSB 4X4XB 3EG9B 3HLKA 3NJLA 1DCEA 2AAAA 3O6LL 4MD5B 3U0PB 3ZDWA 4XN2A 3WIIH 3GINA 4QXVA 4FI7A 3SGDI 1RZ7H 5CLZA 3BKJH 1T04A 3VXQB 3A0OA 1DSYA 1MFDL 4KKCD 4ZJ9A 1YSOA 4D0CA 4CN6A 1JHKH 3VQ1C 4OM0H 5GS3A 2A6DA 4JDVB 4XNXL 4WWPA 3SGEI 4CAGA 3MRLB 4G59C 3TNNA 1LO2H 4N24A 4TTDC 3S98A 2EC8A 2NY2B 4MVBC 2CHWA 2F5AL 5DVNA 4XMPL 1B2YA 3PXJA 2AEWA 3VI4A 2X38A 5HYJE 4ZNCD 3CXFA 2YUXA 3DOSA 4GG8A 3I02A 4NI3A 4LEBA 4CILA 4W9KC 1FE8L 1FNEB 5TF1H 1FNFA 3GUTB 2BSBA 1EMTL 2ICWB 1ETZA 4FADA 3WEBA 1YUHA 1JHTA 4I0PA 4H7VA 1KYAA 2HFEB 4OVVA 1I9EA 2X6AA 5TQ2H 2AGJL 1O7SA 3GGWA 3BPNC 4WCYH 5FO8A 4NSKB 4UOJA 3MR9B 4NUJA 4CVXA 3MBED 1A21A 3DJZA 1KYOJ 3QYCA 4FQHA 3TO4C 4NRXB 2G5BA 1XH1A 1KTLB 2CUHA 5E23A 4N5EC 4AYEC 1NPUA 5I6XC 2GBAA 5C0EA 4G1EA 3OQ3B 4L37B 1G7IB 1RPQA 1HAUA 4Q6YA 4S2SA 2DH2A 3N44F 4JG5A 3O4LA 4RRPG 4FKHA 4I48B 3HC3H 3V5HA 4M48H 4OBRA 3DXAE 5T1MA 3EYVB 3CHSA 1UH2A 2IWKA 3I3BA 5AENA 1NUNB 1A6ZA 1L0YA 2J8UF 1J12A 4L3EE 4TSBL 1QPPA 3GLDA 1SEQH 4Y4KB 5D7LB 4J1UB 2YLHA 4OY9A 2C9RA 4WWNA 1KGXA 4JO8A 3UP1A 4QKXB 4GXVH 4PJFF 4EIZC 2Y7MA 2CDFB 2NY0C 1C08A 3KGSA 1OAJA 4EDWH 4PP2A 2B1OA 1DLFL 1CDYA 1ZHBB 2VXQA 3ARFA 2EXTA 1G7LA 2XI9A 3I6KA 2W9EL 1T1XB 3EBAA 5JHDA 2B1HH 3DK0A 2UYLB 3KYMB 2HTLD 2EYSA 1MCQA 2KPWA 5I26A 5IQ9A 1YY9D 3QUML 4OZIB 5BNXD 3L3IA 2I7SA 4BE5A 4OLXH 3QULA 2BVUA 4FLRA 3I02B 4PAZA 4BFJA 4NQCE 4ODVH 3GMPA 1JGEB 3LKSB 2O6CA 1AD0B 1MJ8H 3O6FC 1CFVL 3RDTD 1RLBA 1NBVH 4E9QA 5E5UB 3WLWC 2YBGA 2PXYB 3AVEA 4AEEA 1OPGH 1AI1L 1JGUH 4JFOA 1KEMH 3CX5J 3UAJD 2J6WA 4U1IA 4GKNB 1FL3B 1UZ6E 1YDPB 1E5UI 2NXYC 4XZUB 5FO7B 3B34A 5D1XE 1OGAB 3RY5A 4HUCA 1G7IA 4A2DA 4R7LA 5B8CA 2DY2A 3QIBB 4U7SA 3D0VB 3QDHA 4M56A 1FG2A 3CFMA 8FABA 1S9WB 2KZBA 2BP3A 3WKPA 4X6DA 2RR3A 4KVCH 3CFBA 3UTSE 3E6FA 5T1LD 1BVKB 4M4PA 2HFFB 4HUUA 3KPSB 4HAFA 2UVEA 2EP6A 2JJTA 3ZE1E 4QLWA 5GRVK 2QSTA 3VU2A 1PBYA 3KPLA 5CJOH 5L9DL 3EBIA 1V10A 1PJ9A 3S3BB 4PTUA 2EYTA 4GT7A 2V8MA 5JHLH 4FNTA 2G3XA 3BAEH 1TPXC 4FMFA 3KR3H 4AL8L 3X14B 5I1KL 1CN4A 3DYMA 5F7KC 1ZHBA 5CSZA 2O6EA 4N86A 3RQ3A 4V1DD 4MJIA 3EFOA 3WIHA 4XHJD 2ZXCA 1QSVA 1UD3A 1BZ8A 3QDGA 1WTLA 2FJFA 7CGTA 4TNVK 3R18A 2PW2A 4X8CA 4NQED 1KG0B 3GBNH 2VSMB 3ULVD 4JUTA 1C9SA 1AE6L 5LDSA 5D2LF 3UO8B 2JMRA 1KCUH 2ZT9C 4U4BA 5LAXB 1IM9D 4D9RE 4Z76A 1Q1PA 1W80A 1ZE3C 1LM8V 4DP6X 5T1KA 2AKRB 1C8QA 2R4SL 3UDWC 5E00A 3LDBB 3DUUA 1ADQA 5DYFA 1NCGA 2CMRH 4JFFD 1K4CA 1QRNA 3K6OA 4W93A 2YD1A 2X40A 4Z7WF 2J8UE 1NICA 4WNSA 3BYYA 3IT8D 2E7LA 4QHMB 1BYOA 2R2CA 1R5VA 4R90H 2VL5A 35C8L 2J7LA 4HUWB 1X9LA 4H20H 5AB0A 2VTFA 2PUQT 2WMPA 5D2LA 3OG4B 1A7PH 1E4XH 3KHOA 4C47A 2PYED 4L29A 1M3JA 2NY4B 5JIPA 4LCUB 2QKIA 4OD3L 1RPUA 1U8LA 2OZ4A 4N1EA 3X1BA 4J3SA 1FNLA 1D6EB 3HPLA 1V3LA 3CFBB 2CE6A 5E4EC 4PI2A 4PJHE 4NC1E 5FYJL 4YE0A 1QNZL 4X2UA 3GO1L 4FFYL 5AD0A 5IVXB 3KPSA 5I28A 1AZBA 4OLWH 3STLB 1G9NC 3MV7B 4YK4C 2PPAA 1L9OA 5E1GA 5H4YA 3KS0H 4ZX3A 3RFZB 4PU2A 2O72A 3SY6A 2ITFA 3NIDB 2DQUL 4Z7VB 3GZOA 4PCKA 4PTUB 2B15A 3KWWA 1TZHA 3GRBA 4AW4A 2TRYA 2WGXA 2IVFC 1R3IL 3MLUL 2P52A 4NKDB 4PWFA 5DEZA 1FFPB 1ZT4A 3BH8B 5H4ZA 2E6PA 2QKIC 4MJIB 2VXUH 3VJ6A 3S2AA 4A2LA 4FKKA 4RDQG 3PHQB 5JYMA 3AU1A 3UZVA 2WZAA 4U1SA 1Z5HA 4QWWD 5KSBF 1I8LA 3QPQD 1KG0A 3BZ4A 1OP3K 5D93C 4EPSA 4DGWC 1AO7B 4KDVA 4WGKA 1QNIA 4KMQA 1MI5E 2R27A 3F62A 4G9FA 5JHMA 2ICWJ 2DQJL 4BFIA 3DX1A 2QGEA 3SPVA 3O11B 4IRJC 1SVBA 5LQBL 4LVOC 3LJ3A 2MPAH 1TCRA 1H6TA 1YYLL 2QR0A 2ZCZA 3DUUB 1W72B 4LSPL 4EMZA 4CJ0A 1BWMA 4OZFH 1IBZA 5FYJD 4XCYA 1H6UA 4C4KT 2C1OB 4QHKJ 4YSRA 1S8DB 2OR9L 1NIEA 1OTTD 2Y1YA 3ILQC 2WNXA 3C8KA 3FQ2A 1G9EA 4FOMA 4Y9EA 3QCUH 4FTVD 3CWGA 4G43A 1JNHA 4NDMB 3CXHK 2EVJA 4KJWC 3MV8B 3F85A 3J27A 1M7UA 3U9PH 4I3GA 2NSQA 4H13C 2LAAA 4HJEA 4RMBA 2F58L 2B0SH 1QG3A 3FQ4A 1IBDA 2G5RA 3NIFB 3DWTA 3FOLA 4KK8C 3SDAC 4JMXA 1KFGA 1MCFA 4PHXA 3ZOAA 2O61B 3PV7A 1F3JA 2WQVA 5C07E 4L3CB 2CJSA 1EUUA 2XZCH 3T4YA 3C87A 5DK3A 2D4FA 2OMUB 4OCMC 3BRDA 1G9ML 3IFLL 2GUYA 2R2BB 4AQEA 3STLA 5JPMA 1FZKA 1E27B 2X2UA 4YLQT 5CKGA 1SJVA 3EJYD 4I13B 4F24A 1AGCA 1J05A 2TRHA 3IWVA 3IJEA 2VLJB 3D9AL 5J9PA 4AM0B 2H3NB 2C9VA 3C08H 5EA0L 4U1NB 5LCVA 3WHXB 2MHAB 4F7EB 2OX5A 3BGMA 4GQRA 1G1YA 1UD4A 3KPQB 5I15L 5AVWB 5IEKB 1WZ1L 1JERA 5F9OL 1UD6A 1PKQB 4UT9H 4NIYE 3RZCD 2PR4L 1LEIB 1CDGA 6CGTA 3UZVB 3SDXA 4AIZB 5E2WH 2BOLA 1EEZB 4K8RL 1MZZA 3D69A 5HHVH 4DGYH 4UT6H 3PHOA 5JXED 1N5YL 3RNKA 2W0PA 2X41A 1HZHL 3LEYH 2CBOA 3FT1A 4MRBA 1NIFA 4MASA 5CKAA 3MCKA 4NYLA 1ECZA 3UTPE 2ADFL 5C0DA 4G9FB 4OIAA 3D7PA 2IJ0C 3QRGL 5ALCL 3GMMA 2A77L 3REVB 1DJZA 4WI6A 3CSYB 2B59A 2AK4B 5EORH 1HK6A 4FZEL 4ADGA 4MZRA 3EFFA 3UTTE 2A73A 5SV4A 4XCYB 3E8UH 4XPGH 2P7TA 2VLLA 1A6TA 2EEXA 4GBXA 2Y9RT 4JRWA 3IGLA 1X6LA 2AABL 5CEXB 4EN3D 1ZA6B 4Z3IA 4QHNB 1CFQA 3OVUB 1YEIH 4N2CA 4WY7H 2JV6A 1LXMA 4HZ1A 4HU2A 1GR7A 2BP5M 5DQJB 3S35H 2FJSA 3X1EA 1HU8A 1JF1A 4Y1AB 3AG2B 4HDIB 4X8JB 3LNFA 3DECA 1FI8C 4JPWH 1PS3A 2ICWI 4HKBA 1YPZE 3IJ9A 1HH9B 3MRFA 3CZJA 4PV9A 5DHVH 4WFGE 1FZKB 1VEPA 3HMXL 5EU6A 5ELIA 3RVUD 1EHXA 2VM4A 4LF3A 2IV9A 5CP7A 4L4TA 1R24B 5INCA 2EXSA 3INUH 2Q20A 2NXZC 1RZJC 4LRNH 4Y4HB 4PG9B 4L5FE 4WUKH 3CVHH 3VI3E 1U91A 3LS5H 1BBDL 4N2MA 1HSAB 4PRIA 2Y7LA 2IQAB 1Z1WA 1PKQA 4MAYC 4HMDA 3RI5K 5ITFB 3JBG7 5E8EB 1TTUA 3IXAB 1JMZA 4G6MH 3BESR 3E6HB 1X9UA 2FE0A 3BZDA 3MLZL 3CVHA 4KAQL 3UPRB 3LYRA 3MREB 2ICEC 4MNQE 3GJEB 4OUUB 3SZ6A 2YAQA 3CC5B 1NDTA 3FTZA 1RUKH 3KYAA 4PGZA 2Y5TA 1HCYA 2HCZX 4ALAL 2LV4A 2FGZA 2CUIA 2P4AB 4M6MH 2X3BA 4HJUA 3B2UD 2AQ2A 4A7GA 4A6YL 1CE6B 2NXZD 4PJFB 2G9HA 3N40F 1VAHA 2OI9C 4X4ME 4NZTH 3EUUA 3MRJB 2QVIA 2AXJA 3FH8A 4FQQB 1G1CA 4H8UA 3KLDA 2ZX8A 3CVIL 4S2SB 1MHCB 2UY7A 2VR7A 4O02A 4GP8B 2ZXGA 4XWOC 1QUNA 2COVD 1QBBA 4LARH 3ARPA 3UTQB 1ZA6A 3LVEA 4PS4L 2DWSA 2NUPA 2GFBA 5IMMB 2AXGB 4PVLA 3TVMC 4AI7A 4XX5A 4IHOA 1U8HB 3GBDA 2GBTA 1IFHH 3GMLB 3RKDC 3K6DA 3FC8A 1Q0YL 4XXDA 3V0HA 1WAPA 3B3BA 3BFOA 4DVBB 1SJMA 4NN7B 1ML0A 5IVXF 1ZDQA 4M43H 1XF5B 5DD1H 3VRIB 5A40E 1ZVHA 3HG1A 1YJDL 4PIBA 4X4KA 1N5AB 2FWOA 4GJTB 5IQLA 4MA8L 1F4WL 2ZIDA 4QRPD 2D3VA 1T1XA 1TNMA 1MF2L 4C55A 1URLA 4M5SA 4OZHA 1WO2A 5IVZB 4LAQL 5DUML 3BVTA 3STBA 2QQQA 1P84K 2VQ1B 5D2NA 2ZX7A 4P2OC 1YQVH 5IB2B 4F2MB 1TDQA 3PJNA 4W68A 2NY4D 2CHNA 3K7UA 1UH4A 3OAZH 1K6QH 2WB1A 4IEFB 1H6FA 1Q72H 4GMSL 3WNLA 2VAAA 3O8XA 2Y2WA 5TQ0H 5ITFA 1I1YA 1EGJL 4MDJA 4EBQL 4PRDA 2EDMA 2YPLD 5TE7H 1B6UA 1JE6A 5CZVH 5DSCA 5IBUG 1UWEH 3T04D 2X53A 3WMPA 2WXQA 3UJIH 3UC0H 3ARVA 2AW2A 1I4FB 2C1PA 2W0FB 3UTSB 1QUPA 2EO7A 3ISYA 5D4JA 3DYOA 3C6LC 3V4VH 1ZT7B 2F1AA 5EEXA 1ZGLM 4XPAH 4Y88A 2H0EA 4RAVA 4YC2B 4GAJH 4TUOA 3PABB 3TBYA 3SPCA 2BS8A 2AAVA 1I1AA 5CN2A 1CTOA 4F5CE 3T2LA 3BO8B 1J8SA 1EUTA 1I82A 3CLFH 2DQTH 2GHWB 2WC7A 4QHUB 4A55A 2KC0A 3SGEH 4HPYL 3UTQA 5KUKA 2FYYA 3VGGA 5I1IH 1WGVA 2V5SA 4HLJA 5DJ2A 3I85A 2J8UB 1MWAA 2IH1B 4CA4A 3O3DA 1U8HA 3HBQA 1R3LA 4X8XA 1U4FA 5DD5L 1YNTB 4MQ7B 1I1RA 2ZKWA 4EVNB 3VI3F 5I1CH 4J8RA 5CCKL 3OHXA 5AVZB 2H45A 4KBPA 3KDMB 4M6OL 2X10A 3Q1SL 1HCVA 1OGPA 2MKWA 4PWHA 3NIGF 1UB6B 1I8AA 3FQTA 1UWXH 2EABA 1R3JB 4HCIA 1BMZA 4PW4A 1EA9C 1NGPH 4AYFA 3TEYA 1XB3A 1FO0L 3O9WD 1KELL 4WK4B 4ANUA 5CIPB 4U6YA 3Q9PA 3QJHA 4K7PX 2EYRB 1HHIA 3ZMNA 4XVTL 1ZPUA 4JG0H 4OGAC 4PW3A 1FAIL 4Z3TA 2C3VA 3HUJE 3WL9B 3LZLA 1ETA1 1KLUA 3O2DL 2Z35B 3VTAA 3RY6C 1LK2A 1UM6H 2Z1KA 3FCBA 5HDBE 2CO6A 4OF6A 4Z7WE 4Z7IA 4H40A 3TYFB 2MQ3A 3OM3B 1FH2A 4NQSB 1IMHC 3LEVH 1NOLA 2HUHA 5LB1A 1HQ4A 1HYSD 1JS4A 4D8OA 3LKRA 5IZ7A 4Y2DB 2VXVH 3L2MA 1HXKA 3UMTA 2H8PB 2YAFA 4HHAA 5KSUB 1QBMH 3QNZB 2W91A 2ZWSA 4JY6B 2HH0H 1KT2A 2DKUA 3ARZA 1MCWW 2JIXA 4OCSH 4RMWA 1JNNL 3BN9C 4RGMB 2VR5A 5CMAB 4QHMA 5AUMB 1KN2L 4PREB 3PFUA 2OW7A 2P45B 2GTWB 4OCLC 4RGOH 1BLNB 1EDQA 5CINL 3SE3C 2OBGA 3MBWB 2WMPB 2WQAA 5JO5B 1LDPL 1T89C 2CHDA 2YGOA 4XPTL 5IW6B 4WFFE 2JQAA 4OKDA 3MLTA 1NUDA 1B0GA 3VACA 2EDJA 1BQLH 1T7ZA 2NZ1A 1ZLUK 3MC0A 3ZPDA 1CLOL 3VXUD 5I71C 1NEUA 1RQ5A 3O45A 3MV7A 5AW6B 2WXMA 4FLSA 1X5YA 4GKSB 1AZVA 5F7YC 1H15B 4A7TA 1DBJH 1E2VA 5AYUH 4BSWA 3FHQA 4OJCA 4NQEA 4ALAC 3WY2A 3GIZL 4KDTA 4KFMA 1AQHA 1AZZC 4JHWH 3A6BH 3LSOA 43C9B 3FQRB 3PQYE 4MZ2A 4P9MH 3HS9A 4AYFB 4M29A 1UH3A 5CIPA 3MPCA 4KXZH 4D3CL 4YLCA 1D5BA 2VERA 4LIQH 1TG8A 5A2BA 4XOEA 4N2BA 5D7JA 1TZIB 5EUOE 5KSAC 2ATKA 1XH0A 3QAQA 3ARBD 3QIUA 3W11C 2UWEA 2HJKB 2YKLL 4XNBA 1Z7JA 2BK8A 4P23C 3WO4C 2JJSC 3ULVC 5IB3A 3ZDZF 2XU9A 1I8LC 2JLLA 4ICWA 4G8GB 4MAUL 3U36B 1VF5C 5JHLA 1KB5H 1S78C 4CADA 4P5KA 4WTZA 2NTFA 1J8RA 4PJ8C 1NBYA 5A2FA 1ITCA 2XICA 3MJGX 3QNYA 3TEXA 4Y7OC 3B9AA 3GM0A 3IDJB 4X7SH 3MV8A 2ZF9A 1MH5A 32C2A 2H26A 2NTSP 2A74B 1LVEA 1K5WA 4DCQA 4OZFG 4JRYB 4G8GE 4G9DA 3ZE0F 4KI5E 2LW3A 3NIGE 2WBJB 4JFWA 1UQSA 2EDBA 2P5WD 5FV1L 1J9SA 4DEUA 1E2WA 1QLRB 5JQ6L 2FDBP 4KUCD 2EECA 1UGNA 2VDPH 1LK3L 3ROLB 3T0VA 4NT6A 3IRCA 5EN3A 2HX8A 2V17H 2Z93B 1B0GB 3REWA 5AG8A 1MW0A 2V37A 1AKJA 1UJ3A 2O5YH 3D2UD 1NBCA 2WIIA 4MNQA 1E27A 4DGIL 4U4IA 2FUQA 3GM8A 1MPAL 5E0FA 2ZX6A 3H7LA 1D5IL 2F9BT 3HBPA 3QDAA 3ZDYE 4AM0A 5JLZB 1WHOA 1HFUA 2Y5EA 3OKOA 4IJ3B 4PJEF 4LMQI 3SE8H 4I89A 3PWVA 1QVOA 1XGYH 5IROD 2C7FA 1DE4A 4DIXA 1FRGH 3ZZLA 1ZGLP 3WLWD 4EI5A 5F7HA 3NN8B 4UINL 1IGIL 1YEKL 1F4YL 1KCKA 2CKNA 3O6FD 4IU2B 4OFIA 3FSOA 4KWUA 1S9VA 1SF5A 2ADJA 3GXMA 5AKSA 5FS5A 4ANWA 2Y6SD 2I07B 2W0KA 3HNVH 4JFHE 3VH8G 2NYKA 2HPTA 4YDKL 3GSOB 5I73C 5TGBB 5DC2A 5EEZA 3FN9A 4FEIA 3CQFA 4HV8B 3BRFA 4XMVA 1D5XA 1Z9NA 1YY9C 2JTYA 2VN4A 4NZRH 5DWUH 3D85B 2Z6FA 1LHZA 4OQ1A 1HZKA 2ENYA 3PLYA 1CJYA 1MHEB 4X99B 1EGJA 2IAMB 4JDTL 3EDDA 1KB5B 2Y1VA 1EXGA 4I3SH 1BFTA 2VZ3A 5CEXA 1CZ8L 4AG4H 1IAMA 2NLJB 4WK0B 4WEBL 2GCYB 4QXUL 2AEIT 4DZBB 3QWOA 1YPZF 4GW5A 3T3PF 1AVAA 5DQJA 1YUKB 1NFDB 2FZ3B 5M95B 4I4WA 4F37K 4FN0A 3SO3B 3NGBC 1Z9LA 3K2KA 2VC2L 3TV3L 1UZ6F 1ULVA 5BUGA 4LSSL 1OD7A 2LU3A 1S3RA 4FG6C 4NERA 3P4OA 1KXQE 1IC1A 4IK6A 1BVNP 2GB2A 5M7QA 3P3YA 5HYSA 1YMMB 2ZOTA 4JL2A 4U6TA 5C09A 1JN6B 3FUHA 1WC7A 1I3VA 1M7XA 3QQ3A 3W5MA 3EYSL 3V4UH 5IROC 4NNPH 2QGBA 1L9MA 3IFOA 5FXCH 3ZX1A 3TO4D 3CIQA 3IAPA 3RGHA 3ZRFC 2AK4D 3TTSA 1LO5A 3RWGB 5AVTB 4OD2A 3LNDA 4J3OG 2BWDA 4C83A 4W9DC 3BE1H 5HJGA 2O26U 1XV8A 3KXFB 5AZ2H 3SKOB 1HCFX 2GVYA 2FGWH 3RL1A 1Z0MA 5C09E 2ESVB 3CE1A 3H7BA 3IGFA 5EV7A 3TIDB 4UTBA 4HW6A 1DBMH 4U05A 4ZDHB 1VIWA 3IKKA 1NCTA 4JFSA 1HINH 3LNIA 2VB5A 4K71C 2IBBA 4KI5F 1T5KA 2P5EA 3N0AA 4MYWB 2F53A 5DRWB 1C7SA 3TBSA 1QYGH 4BFNA 5TDNA 1IQWL 2Q8BH 3WTVA 3H55A 3P0GB 5D6DA 2Y69B 1A6VL 3MNVB 5IEHA 1MHEA 4X99A 4HPOL 1BOYA 1R3KB 1S78D 4Z7VE 1TQBB 3PWJB 4X9YA 5CBAA 2PWGA 3WI9A 4KKCC 3ZT5A 5LHDA 4HKXA 2XXCB 4N2OA 5IVNA 2B2XH 4P5TC 4NC2B 4GFXA 2UZYA 1OCWL 3LV3A 1H8NA 4JZOA 3VSTA 2E0PA 4OQTL 2JKRM 3ZDYF 2JKIS 4W9GC 1L9PA 3DHJA 2EIZB 2AITA 3W11D 1WUZA 3OJMB 1NFDA 3GNML 4OQTA 1DYZA 5D71L 5C0BB 4WI0A 3TZVA 2KH2B 4V1DE 3RPIA 3LIUA 1NKGA 1XF5A 4WKZA 5D1QE 2XKNB 3D18B 3EGSB 3WDIA 2NY5C 2XA8L 1HILB 3GB7A 4P8QA 5D2NE 5EG6C 1X7TA 2AVFA 2Q7AA 4NPYB 4MYPA 3VWJD 2BNUA 3KGRA 3RKPA 4OZHB 4AJVA 5FOBB 1JYWA 5IW3A 2CG9X 3S4SB 2XG5A 1KB9J 1DQIA 4GH7B 5E6ID 4HYTB 2VQ1A 2WW8A 5DZ9A 2BJML 2DQDH 3FZUD 1LO5B 4JX0A 3RWGA 3E2HC 3LIZH 4P4KA 2BHZA 3U4BH 1KEGH 4CN4A 4NRYA 1Y6NR 7TAAA 4ODHH 2VAAB 3O8XB 1JDCA 5B1KA 3GS7A 4Q2ZA 3UEZA 3ZDXB 3PE9A 4KROD 4EQ2A 2WCSA 3T0WA 5SWQA 2W9LA 4YSUA 2ESVA 4UYPA 4AYID 1HI6B 1DEDA 3KLQA 2WXFA 4O02H 4ZS7L 2Z4QA 3C09B 1KSRA 3JXAA 4HK3J 1IKNC 5INDA 1I4FA 1V54B 5J06A 1AYRA 4NBXB 1SNRA 3TTYA 5DFAA 5AZEH 2KI6A 2GIMA 4P59L 4PJDF 4NFCA 1HYRC 1Q94A 4K9EL 1VFMA 3RA7L 2VUYA 5K5YA 4WHDA 3BN9D 5KBNC 1VDGA 1SOXA 1JPGB 3O8XC 3RTQC 3ULUF 3QIBC 1A8ZA 4HULB 3WFEH 3ATBA 3DVGA 4TVPD 1N8ZB 4WK2B 3AAZB 2XLLA 4R5XA 2PN5A 1KCLA 2C8NA 2IH8A 4MX7B 2XFGB 2ZTBA 3R4DA 5I30H 3WIFA 4N85A 3WSQH 3FO0L 1R3LB 3O2VH 4S0TD 4PJHA 1KXTB 4H0LC 3U1QA 1VB9A 2JK5B 3EG9A 3PP4L 3VH8B 2QPDB 5I1GL 4ODBD 2D03L 1BOGA 2W60B 2Q6WA 1Z5YD 2G4EA 4ZMLA 4ANXA 4PRAA 1DHKA 5HHOD 4ZZFA 3PWUA 4OGAD 4P9HL 3RPIB 1ZHNB 5AW7B 4XXWA 3EDEA 3G6JF 5J3HC 1FNSH 2R4RH 4UAOC 2ZD0A 3LH9A 4QRRD 3O9WC 1RK0A 5DHVA 2C9XA 3MRLA 2OFQA 5KBDA 1PLBA 3WCYA 3QDGE 4XVSH 2VIRB 3MLWH 2YMXH 1IKFH 1G87A 5DLML 4WFED 2X70A 5FGCE 1BM3H 5CBEB 3I6LE 2C3VB 1FLRH 5SWZE 4DN3H 1QAWA 3LH2L 1A6WH 5T3XE 1XIWD 2EC9T 2I7OA 4H1LH 1NGQH 4K5MA 5EWIL 3GUTA 4GRMB 1OSPL 1D5RA 2CO6B 4OSUL 4X6CA 3F12B 3FSAA 4TVPL 2NNXA 4H88H 2CO1A 2E7CA 1KACB 1JGDA 2IMMA 4AGNA 3SO5A 3F58H 3JWOL 1FG9C 4C4KO 1JZGA 1LNUA 1M1XB 1T7VA 4HS6A 4Q7DA 5CP3A 3VE0A 2R29L 5EU7C 4N0RA 5F71A 4A37A 4Q0XH 2JIXB 4Y4KC 5DMKA 5JOFB 5DI8B 2IWFA 4DH2A 4W6XB 1CGYA 1NCWH 4PREA 1T0OA 4EZLA 3VW3H 2X1XR 3IE4A 4L2YA 4BUGA 4HAGA 4P2QD 3SQBB 4LGRB 3U1PA 3EYOA 3MBWA 1NC2B 1F0LA 2CO3A 2ZUQB 2DB8A 1I53A 4RSYA 4PJ9A 4TS6A 2CBTA 1IM9B 3WFBL 4UT7L 4Z18A 2DV6A 2EILB 1F45A 5FYJU 4IBSA 2KLTA 1TU2B 3LAFA 5FYKD 4J4PC 5DHDA 4MWFB 5CGYD 1FNGA 4M7ZB 3O45B 5C97A 1T89A 3WHE1 4YHYB 1QABA 4LHUD 3QCTH 1OARH 1BOGB 2YARA 4BSWB 4X7TA 3Q05A 2X6VA 1RHFA 4HIIA 3FB8A 3ISWA 1VENA 3GZKA 1MFDH 5DQDH 1EHKB 5KW9L 4FNLH 2FATH 2JI3A 4MD0B 2VE6B 1NOFA 3ARFB 4JO3H 2QSVA 4W9ZA 5DTFA 4YHLL 5DHVB 2OYLA 1UD5A 4NENB 2IH9A 3BW9B 3KVDD 1P5UB 4OJAA 3B2DC 4XMPH 3S36L 1F58L 4WHTB 4B9PA 1MW1A 4EXPX 4QRUB 3JWNH 2PTUA 1X7SA 5ADOL 4OZIA 2ATKB 4LBEB 5CM1A 3KVPA 4E0RA 4HBCL 5CU5A 2XFXB 3OGCB 3MLXL 1EMTH 4X98A 1N7MH 4G6FD 4BXVA 4TUKL 4GRMA 5KTEL 1KGWA 3R7RA 2OL3L 4XC3H 2Z8SA 3V52H 4ADIA 3BLKA 5ESAA 5C0CA 4HCRA 2PPDA 3QUYC 2MTPA 4C8XA 3T6QC 4XWOD 5H94A 3U36A 3NP4A 4P23B 3LNGA 1LLAA 2DM4A 3W9EB 2EKSA 3OF6A 4OZFA 5D5MA 4NC0B 3TBWA 3N5AA 5DI8A 4F1SA 1RK1A 2ATPB 2B9AA 5F8QC 2BCMA 4FDWA 1DZBA 2YSTA 2A9CA 3PG2A 1P1ZA 2D73A 5GRXG 4G9DB 4M8RA 3OKMB 2DRUA 3MACH 3MXVH 4YHNA 2FWUA 2PO6C 1AO7D 1C5BH 3PUUA 2QELA 2YSSA 4JO4L 4PJ9B 4X9FA 1NDGB 3RVTD 4R4NC 3ARDB 4FXKC 5IB1B 3WIHL 3E6FB 3FYEB 1QLFA 2FJHB 5GGUA 3Q6GL 2OTPA 3VFWB 1SEQL 3JQOB 3QS3A 2VR6A 4WDIB 3LEXB 5CJXC 1A9VA 3Q7JA 4DKFL 3G6JA 4P2AA 3V5DA 3I3DA 5LGHL 5JHAA 4NC1C 5DZJA 5IWLC 1DDHB 1JFQL 2RFX