4AZUA

Crystal structure analysis of oxidized pseudomonas aeruginosa azurin at ph 5.5 and ph 9.0. a ph-induced conformational transition involves a peptide bond flip
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
b'AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AZURIN
publication title Crystal structure analysis of oxidized Pseudomonas aeruginosa azurin at pH 5.5 and pH 9.0. A pH-induced conformational transition involves a peptide bond flip.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport(copper binding)
total genus 31
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1993-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4azuA00
3H56A 1CYXA 4X4KA 1JZFA 5I6OA 3T6VA 3HEIB 5AFAA 2H3XC 3CVDA 2BP8A 1AANA 2PPDA 2IH9A 4AKOA 3FSZA 3ABKB 1W6WA 1NZRA 2LLNA 1MDAA 3FU7A 4UAHA 2FNWA 4AKQA 1AG6A 2R7EA 3PAZA 1SDDA 1M56B 1L9OA 2CBPA 2XUWA 3S3DB 2BP0A 1ET8A 4DP8X 1OE3A 2ZXWB 3TA4D 4AZUA 1T5KA 4KO5A 3WKQA 1MG3C 4JHVA 2Y1AA 3QQXA 1WS7A 4HALA 3FU8A 1KV7A 9PCYA 1YLBB 3EF4A 1KBVA 1ASPA 1BEXA 2IDFA 4G71B 3U25A 2VW6A 5B1JC 3OMAB 4YSPA 1GSKA 2UXGA 1BAWA 1AG0A 5D4HA 1SF5A 3PAVA 1AZCA 1GS8A 2YXVA 1OOWA 4M3HA 4DP5X 4DPAX 1ILSA 5TK4A 2YXWA 4NERA 1OE1A 3QJSB 2QPDB 1EHKB 1TEGA 2Q5BA 3PAUA 3AZUA 1PLBA 2XV2A 4DP6X 4G72B 3NJMA 3AG3B 1BQKA 1ZPUA 3ASOB 3ASNB 1GW0A 2CALA 2YAFA 4E9TA 1SFDA 2DY2A 2PP9A 1JXFA 1WAEA 5AZUA 4E9RA 2HX7A 2IDSA 3T6WA 2XLLA 5B7EA 2HLEB 3WNIA 2BW5A 4A66A 1GS6X 2VMJA 1MG2C 5B1AB 4FA7B 1V54B 2YAMA 1X9RA 3DIVA 2QDWA 1SNRA 1RZPA 2I7SA 2AFNA 2GBAA 2FQEA 2IWKA 3WG7B 1X9UA 1ZV2A 3FQ1A 2CAKA 1WA1X 2QDVA 1PCSA 3NJLA 1AS6A 4M4RB 3QJVB 4W1TA 1WS8A 3KW7A 3WIAA 1AQ8A 3WKPA 1BYPA 2QPEB 4KO7A 4YSQA 1R1CA 1SHXA 4QLWA 3SBQA 2XVBA 3CVBA 2HRGA 3N55A 3OM3B 3KW8A 4DP4X 2VSMB 1PLAA 1PAZA 3AW5A 1PZCA 4JKNA 4YSTA 4BWUA 2TSBA 4BXVA 2XXGA 3NJHA 2OV0A 1L9QA 2W88A 2GC4C 3FQ2A 2DYSB 3L45A 1BXVA 3TBCA 1SFHA 3UGEA 4HCIA 3CZUB 3FQYA 2VW4A 2H47C 6PCYA 5B3SB 2HRHA 1GY1A 4KNTA 1JZGA 1L9RA 1W6LA 1QHQA 1BQRA 4BDVA 1AAJA 1MZYA 1PZBA 1NIBA 2GB2A 2XV0A 5I26A 7PAZA 4E9WA 3BVDB 4BXSV 2B08A 2BO0A 2Y69B 3IEAA 3UACA 3TBBA 5A7EA 1NPJA 3AG4B 4G7RB 2GC7C 1XB3A 4UF7C 5I5MA 1KCBA 2PLTA 3NJIA 2PP7A 1ID2A 5D4IA 4N4YB 2X88A 3EHBB 2EINB 1MZZA 5I5IA 3G5WA 1E65A 3FYEB 4GY4A 2ZONA 1ADWA 4MFHA 5TK2A 3AG2B 4F2FA 1CYWA 2VM3A 1V55B 3OQRA 2PPCA 1AS8A 5PAZA 2TSAA 2J5WA 1NICA 3MX0B 4WTQA 1M9WA 1SHWA 2IDUA 2PPAA 1KDJA 1QNIA 4HZ1A 4GP4B 1E5YA 4P5SA 1QLEB 1ASQA 1J5CA 1WA0X 4KNUA 3OMNB 2PPEA 1GS7A 3BQVA 2DWSA 3PCYA 1AACA 3T9WA 2Q9OA 1JZHA 3V9EA 2MRYA 1SDDB 3ZX1A 2UX6A 1KCWA 3FPXA 1AZUA 2FT6A 2AANA 1NDTA 3SBRA 1I53A 3UAAA 1CC3A 5I6NA 1BXAA 2VW7A 1NINA 2WSDA 2GHZA 4Q8BA 1JZEA 3IN0A 1A4BA 2AVFA 1RKRA 4AI7A 4HHGA 3X1NA 1J9SA 5B7MA 1NPNA 1N68A 4PAZA 4HHWA 2BWIA 3ERXA 3NJGA 3NJKA 2QT6A 2XU9A 4G70B 4DP2X 2YAEA 5PCYA 1IBYA 4L0PB 2EIKB 2VM4A 2CUAA 2JFCA 4UANA 4YSOA 4PCYA 1NWPA 4G7QB 4GP8B 3S3CB 3X1FA 3UADA 2ZOOA 2FWLB 2UXFA 2B3IA 4QKTA 5B1BB 2PCYA 1AIZA 3T6ZA 1JXGA 2E86A 1WA2X 1AZRA 5D4JA 1RZQA 4DP7X 3QJQB 4K9JA 4NAJA 5IY5B 1PF3A 3NSFA 2WO2B 2BW4A 5LDUA 2PPFA 1A4CA 3NSDA 2EIJB 3FT0A 4YSDA 3GDCA 3ZIYA 1FFTB 2IDQA 1A4AA 2YAHA 1KYAA 3CG8A 1AS7A 4NB7A 1PMYA 3CDZA 1L9SA 2YAQA 2YARA 4DP1X 3UABA 2RACA 4KOCA 2H5UA 4YSCA 4E9SA 1PLCA 1M57B 2DV6A 4CSPA 4HIPA 2DWTA 4A2EA 1CURA 5F7AA 4AKPA 2I85A 3CVCA 6PAZA 2FQGA 4A2DA 2XXFA 3SBPA 1OV8A 3ZDWA 1ZDQA 2BHFA 1A3ZA 4EF3A 1BQ5A 1JXDA 2CCWA 5I6PA 2OJ1A 2X87A 3T6XA 1NTDA 7PCYA 2IH8A 5I6LA 2FT7A 5F7BA 1ET5A 3FSWA 1F56A 1JZJA 1ASOA 1SF3A 2GSMB 1ZIBA 2FQFA 5AKRA 1IBZA 2XX1A 4E9QA 2IWEA 1AZNA 4A2HA 1E30A 5I6KA 1JVLA 2FQDA 1OF0A 1ETJA 1OCOB 2AZUA 2YQBA 3V9CA 1CUOA 2VN3A 3X1EA 2P80A 4DP0X 1BXUA 4G7SB 1AZBA 2AZAA 2I7OA 4CSZA 2CJ3A 3NSCA 2YAPA 4GP5B 5I28A 4Q89A 1DZ0A 3HB3B 1IUZA 4KOBA 1IKOP 2YAOA 1AR1B 3UAEA 1HAUA 3FS9A 2BP8B 2IWFA 3FSVA 5B1JA 1PY0A 1FA4A 3NSYA 4N8UA 3IN2A 2IDTA 5ANHA 1EZLA 1E5ZA 3AG1B 2JXMA 1URIA 3FU7B 3OMIB 3PPSA 1NIDA 3DKHA 3N2JA 1J9TA 2XYBA 4E9YA 2R7EB 3QJRB 1JZIA 4YSRA 4YVNA 4DPCX 3NP4A 2N0MA 2ZWNA 4KO6A 5E9NA 4RH4A 2BP0B 3EH3B 1HFUA 1VLXA 3X2QB 1ZIAA 1JOIA 3S8FB 3AY2A 1NIAA 3QJTB 4ENZA 4DP9X 4A68A 3NJJA 4GYBA 1A8ZA 1ET7A 4TXVB 1B3IA 1BYOA 1XMEB 1FWXA 2HXAA 2HX8A 3S3BB 1JVOA 4F2EA 5B1KA 3C75A 3D12B 1GY2A 3FPYA 2FJSA 2NRDA 2BZ7A 4HCGA 2HX9A 3PLYA 3IE9A 2P80D 4YL4A 1V10A 3NJNA 4HAKA 3S8GB 4AX3A 1PNDA 4A2GA 3JT2A 4YVUA 2J56A 2EILB 1W8EA 4W9ZA 4FAAB 4P5RA 4YSEA 3IBOA 3MBWB 1AOZA 3QJUB 5I5JA 2HZHA 3GXUB 1KDIA 1OCCB 4A67A 1J9RA 1ZDSA 1KBWA 2BZCA 2UXTA 3ABGA 4ZK8A 1NIEA 3X1GA 1KGYE 1GR7A 1GYCA 2IAAC 1XB8A 3EH5B 1NIFA 1DYZA 4WKXA 3RYMA 3X1BA 1JERA 4E9VA 2XWZA 3NJFA 2JKWA 1TKWA 1RCYA 2XV3A 3NYKA 4A2FA 2GIMA 1TEFA 3DTUB 1L9PA 2VSKB 1OCZB 3JTBA 2FT8A 2PP8A 3OD3A 3WI9A 1SJMA 3GYRA 3ZBMA 3ABLB 2DYRB 1E67A 4JHUA 1A65A 4BWWA 4F7KA 4YSAA 4KNSA 1TU2A 3ABMB 3EH4B 3NP3A 1OCRB 2UX7A 3FSAA 3PXLA 5FC9A 3TU6A 2PCFA 3QPKA 2J55A 3WNJA 1HAWA 2FTAA 4BK5C 4KO9A 1XB6A 1ILUA 5EHFA 4YSUA 4GXFA 3CDZB 4DPBX 1J9QA 1IC0A 1L9TA 2UXVA 3T71A 1PNCA 3FYIB 3SQRA 1OE2A 2OCCB 8PAZA 2XX0A 2W8CA 3H4HA 3H4FA 2WO3B 5B7FA 5I6MA 1PZAA 1UATA 4YSSA 3TASA 2EIMB 1J5DA 2MTAA 3FU9A 4BDVB 2BWDA 2A3TA 2GI0A 3NT0A 4BWTA 1N70A 4HCFA 4E9XA 1NWOA 2J57A
chains in the Genus database with same CATH superfamily
1SRDA 4HH8A 4XNQB 3FF7A 5CUSH 5DJ8B 2EUXA 4V11A 4LCWE 3DVNA 4TOYH 5IV2A 2RGSA 1QFPA 2LABA 5KOMC 2LLNA 4XMUA 2VXTH 1MFUA 2GTQA 1AG6A 3VD7A 4HZLB 4HC1H 5SV3A 3LZFL 4PJ5B 1HK6A 3A67L 4P2YA 2VDML 3LXBA 1JWMB 1GRWA 1A6TB 4DP8X 2O6DA 4Y4KD 1NMCB 4PJBE 5L0QC 2ZWYA 3QNXA 5BXFB 4M03A 2YUVA 3B1TA 5TE6L 2XZAL 3V4VH 3PL6C 5ABAA 4B96A 4NRXB 4P59L 2VXSL 1J5IA 4XCCL 2ICWI 1VZGA 4OLVL 5I0ZA 3DRQB 2X42A 1CF8H 2JK5A 4OUOA 2IC2A 4R5XA 1XL4A 3RGBA 1KXQE 1AZZC 2JJTC 2UXGA 4X6FB 3V0WL 4HC1A 4QWWD 3ZE1E 3V6FA 1ZA3A 3V5DA 4KBPA 4UDTB 1WFJA 4I5BB 5E4EC 5LLIC 5EEYA 1M3JA 4TVPL 5FF6A 3GTTA 2YXWA 1DBJH 4O4YL 1NL0H 4MD0A 3QJSB 3RAJH 3PDGA 5E1GA 2N7AA 3DGGA 3FUFA 3TEYA 1A9EB 4TV3A 2GITA 4YQXH 4PHXA 2HH0L 1P7KB 1N6UA 3VA6A 3VQ2C 1GHFH 4JUSA 3OKEA 4KXZH 1E3FA 1ED3A 2KHAA 5EIIG 1KXVC 1QVOB 4X0KB 2HFFA 2W59A 2J72A 4G9FD 4FFVD 5EUOB 5BVPL 1NDGA 3ARGA 2BNRB 3N41F 2Y7LA 1TNNA 1PDKA 3GBDA 4MZ3A 5IG7B 4FQXA 1WGOA 3U0TB 3DUSA 5HHOA 1YNTB 2JKLA 3APDA 5DUPL 4AH2B 2I7SA 4CA4A 1CMOA 1XD1A 3WIHA 3LNDA 4V2CB 4D3CH 1X9UA 2GAZB 2V17H 3V9FA 2GY7B 2WINA 1ZE3C 1FPTH 5FAAA 2KYIA 5I19H 2I26N 1A7QH 4IS6A 3ZTNH 3OBAA 3MNWB 1SBSH 4FQCH 2XKNB 3T8XB 3MACH 1QHOA 1C5CL 5I17A 3MA9H 2DIJA 3ZTDC 4X6CB 3V7AG 3IJ7A 5F70A 4A7GA 3T1WA 5IBTH 3IJSB 2QV2A 4W93A 4ZD3L 4CSTA 2DWYA 4PRHA 5EIVA 4ODVL 3PHQB 1P53A 3A5VA 4LEOA 4EN2A 4TYUA 4ERSL 3BQUD 3L2MA 3GMNB 4FMKA 2IPUK 3CPLB 3CFBB 4YHKH 3R1GH 3G7TA 3OM3B 3TCLA 4LHUB 5CEYB 1KXHA 3MFGB 4WI0A 2WNWA 1XZ0A 4HD9A 1G0XA 5D1ZC 3FO0L 4G6JL 1HXYA 1M7DA 1OW0A 4R96B 5DO8A 5DK0A 4ZTEA 3ULVL 4RMRA 2Y2WA 3RGVD 3ZL2A 3L48A 2DYSB 3CUPA 1IVLA 4UQCA 3UGEA 3CZUB 5GSVB 1L9MA 3VXUA 3IGLA 3MV11 2YGPA 1BQLH 1F4YH 1UCBL 4RDQF 1NANI 5BQ7A 4UZGA 1RUKH 1S2EA 4G43B 3HG3A 3S5LG 4BDVA 1JYXA 3OHXC 5DHDA 4LLQA 1RP8A 4NUJB 5H37G 5IQ9A 3C8DA 5F6IB 2Y69B 4XC3H 2CBOA 5ACZB 2WN3A 1OPOA 2EAEA 2KMWA 3TTYA 4G7RB 2OCFD 4N8CL 5SX4H 1SMDA 2COQA 3WNPA 2WXJA 4N4YB 3H42L 3RLSA 4WTZG 2OMXB 4CRPA 4K23L 4Z0BH 2YBRA 4BKTC 4KAQL 2BVEA 2M1KA 2FJGB 3J27A 1FGVH 2VAJA 4MXQD 5BV7L 3FFCE 1NLBL 3OQRA 4RAVA 3U4BH 5CCJA 4YHML 2J5WA 4BSWB 2D03H 5AWNH 1RZGA 4XZUA 3KE0A 5IBUG 2XFXA 2Z0BA 3VXTA 1NDMB 4FTVB 3WN5C 2H2SC 4ZUUA 2X2IA 4C56D 3U0WH 4Z7OF 1B6DA 4TF4A 4I4WA 3QPXH 5CIPB 1QFUL 4M56A 1QLEB 2X53A 5GGUA 5CAYB 2OAAA 4R97B 3IU3B 2DQDL 1AP2B 3OAYK 4HJJH 4U1KA 3SDAD 4GG6B 1Q1JL 2J73A 3BO8A 4X4YA 5E8NA 5FYJU 4Q14A 1BOYA 2JLPA 1AZUA 1F8TH 5BV7C 4KFMA 1VERA 4ZQTA 1X4ZA 2K78A 4WI2A 3VI3A 4JFDB 4XVTH 4NO5B 5DMKA 2WXLA 1MIEL 4R7NB 3RNKB 3IN0A 2CDGB 3DX4A 2AKRA 1JGDB 3F83A 3KJ4C 1TTBA 2A6KA 4H8WH 3RWJA 4AI7A 1ETB1 4MS6A 1EUTA 1NSNL 3LPWA 4N2FA 4WTWA 5LAPA 4AT6B 2VZUA 1D5RA 5C92A 5GGQH 2YZ8A 2FDBP 3MRFB 1KT2B 4M8QB 4HHWA 4LU5H 4ZFFB 1Z9NA 3QUYD 2CDEA 5FYKH 3IM1A 5IVXA 3SGDH 1Z1WA 3NCJH 2FBJH 4YE4L 3L5XL 2XPZA 2B20A 5DQDL 4S1DD 1LEIA 3GIVB 4OCSH 4NC1C 1S7WA 3A22A 1XF4A 2O6FA 3L7FB 3NDYE 5B22A 3S3CB 4MNHB 2FWLB 1X5GA 3TWCH 4PJ9C 4HD5A 2JLLA 4ECNA 1JP5A 3MLZH 3BP6A 1JXGA 1UVQB 2Z92B 5A2CA 4ANVA 1I3GL 4MX7B 2JB5H 4H13C 2QJDA 4NAJA 5IY5B 3D51A 2FO8A 1GZPB 1FI8C 3MROA 4F2ME 5CZKA 2PPFA 5LCVL 3DURB 1R9FA 4JQXA 4KZEL 3PNRB 1JBJA 4WY7L 5KYYA 3Q2NA 3TNNB 4MVBD 1MCSA 4AW7A 4NWTL 1TOXA 2D8KA 1ZTMA 2IDQA 4EBQH 1KJVB 1L6ZA 1I9JL 1Y0LB 4UOQA 4M8VA 4YHPA 5FB8B 4GI6A 5TE4L 2F5AL 4PJDA 4AK2A 2YAQA 2NX5E 3C6LB 4HGWB 4FFZL 3QDJD 5F2FA 2HVKB 3M8OH 4H0LC 1SEBB 1CQYA 3T2QA 4YSCA 5KSAD 4GUPB 4HIPA 4OGAD 4FQJH 4TUOB 5I24A 3D2UB 3BRDA 2DWTA 1P7QD 2HSIA 2IOOA 5KSBF 3H7BB 2G4EA 1YDPB 3WFZA 3KCWA 4MJ2A 4BZ1H 1Q9KB 3VXNB 3U46A 4JZJA 1PKQA 5E95B 3VMPA 2R2CA 2XWJA 4UQAA 4LVNB 1NTDA 1IKFH 5CF3A 4FL4C 3SBWA 1IAMA 5CZRA 4QWWC 3FMGL 4OCYH 3L5WA 1QFWI 1I1AB 4G11A 1G7PA 1UASA 4DZBA 4A2HA 4LQFH 1CBJA 4EXKA 2CJSA 1P5UC 1QFWH 1EGJH 2IPKA 4M1DL 4F3FB 4WK2B 4HZAA 3ESPA 4Y16A 3MXVL 4QJ3B 3SGJC 3TXAA 1Z5LB 1UKQA 5CZVH 3NSCA 3U1QA 4ATWA 1CK0L 2CBTA 5K39A 4J2XA 2G3MA 1U21A 1WVZA 1N5AB 1FC2D 5IEKB 4JQIA 4FFVC 5GRUH 1OP9A 3BSZH 2HKFH 1ZHLA 2XQ0A 3MJ9L 2DZEA 3LIZH 4OSUH 1MREH 3UTSA 4XAKD 2QQNL 2JWYA 3VRIB 5C0EA 4FQHB 4ZNCD 3V6ZB 5C0FB 3OMIB 2WLLA 5EC1A 3OX8A 4P3CH 4DGUA 2NTFA 3M1OA 4JAMB 2QKSA 2C7UA 3EIFA 2FGWL 1NOAA 4DJMA 2EP6A 3WKMH 2FL5B 1WZ1L 3IU4L 4NM4L 1A1NB 1ZK5A 4BH8A 3KWUA 4RVBA 1K8DB 1T0MB 3QDGB 3T2LA 4WO4A 3VWJB 2EH8L 4PW3A 4ZXBA 1G5AA 1ZLEA 2H2PD 3UTPE 2VGLM 2F18A 3WHXA 3NZ8A 4KY1L 4PJXF 1BX2B 1BYOA 4WWKA 5CJQH 1SOQA 3ILDA 4JVWA 3UBFA 1NA8A 5I76B 4J3TA 4AUYA 4JFZH 3BPNB 1L0YA 4IBWA 4RX4A 1E2ZA 2OW7A 3GLDA 3FONA 1JXJA 3LV3A 2HX9A 3KS0J 3PLYA 3X3GL 2P80D 5F3HA 1XGRA 2NY6D 3K6NA 2VLJE 5CSZB 5D2NB 1X3DA 1JWSB 4KV5E 4XZ4A 1GZHA 5C0CB 1R3JA 4YVUA 2VL5B 5I1CH 3GO1L 2YQ3A 4DFIA 4G42B 3RGVC 4NRYB 3IBOA 3MBWB 2W81C 4JBSA 1W9XA 2RJMA 2UWEB 5I5JA 2HZHA 5EORL 3TIDA 4RWYL 3QIWB 1CD8A 2F8VA 4NNXA 1MFDL 2GKIA 2YWZA 4AK1A 1M71A 1F1AA 4HG4J 4NBXB 1ZJAA 3U48A 1Q9LB 3G5VA 2DI8A 3MXWL 3V79C 1RK0A 5I0XA 3HBQA 3FQNB 1XB8A 3HUJE 4ABWA 3WAJA 1O75A 1FJ1B 2EXTA 4M5ZH 4HEME 4R2GD 2J4WL 2C34A 5KVFL 3NJFA 4YWGH 1WCBA 4ZUTB 5E9AA 4OJFL 3X17A 1QP1A 4Y5XB 1FZOA 2NY3B 4L3EB 3DTDA 5CHNA 1TZHA 3A3YB 4L1TA 4MXQC 5CU9A 1IM3A 1TU2A 2AI0H 5KBPA 4U3SA 3MVSA 3N6YA 3ZQ9A 5T1KA 1EXUB 1PD1A 1NCJA 4GAAA 1A7NH 4JDEA 2ERJB 2V5SA 4L37A 2WQXA 3AVEA 3GNMH 1FV1B 1CDCA 3JXAA 3JTTB 4N2MA 1M2VB 1L9TA 2Z9TA 4PJIA 5GGVL 2OTUA 4Q0XH 1EEYA 5ERWA 2AXGB 1L0XA 4PJHB 5IFHL 4Z7UE 1MHCB 1JD9A 2V5RA 2WXGA 3SDAC 1DBAH 3WXVH 3H4FA 1NUDA 3KWTA 4LKXA 5CD3B 5E6YA 4G8GA 4M4PA 1IGIL 1KGWA 2CGRH 2DQJH 4RAHA 4HOMA 3LDBB 1EAQA 3LKSA 4OJAA 4PW9A 3ZHNA 4AUJA 4LP5A 4G8FB 3J7HA 3E8UH 4WAFA 4G6MH 5DJ6A 1CYXA 1RMFH 1T83A 3L9RB 1OALA 4AVHA 4PV9B 3OKDB 1JYNA 2IPTL 5F9OL 3U6XS 3QWNA 4FOMA 3OLEA 4TNWF 5JIMA 4M3JA 3UJJH 3QUYC 1BGXH 3ARFD 1U8KA 5J56B 1DE4A 2R7EA 4PHZA 1E4KC 3ZYJA 4JM2B 4S1DC 3TOPA 4NN5C 3MRHB 4OUUB 3WV0A 1JDAA 3F58H 3JVGC 3WMPA 1TSHA 1MN4A 5EPMB 1T5KA 3WS3B 3IDGB 5IHZA 1S7TB 5INCA 3N91A 1M6OA 1NAKH 2I69A 1K3ZA 3CBRA 5FEBA 4M43L 3GIZH 2W94A 1N0XH 4FLQA 1HJBC 5EWIL 5K93A 2X3BA 3OMAB 1QHPA 3DIFB 3DHJA 5J6GB 2YLHA 5K9KB 4KX8A 4MGXA 1ILSA 2EEDA 4P4KB 2QVKA 3T0XA 4MVBC 2VLRE 1C16A 3O8XD 4DH2A 4Z7WF 3L9YA 2F8XC 5E1QA 4K7PL 1F2QA 4UAOB 2F74A 3KWXA 3QCTL 5DZ9A 2JF1A 1CPUA 2AV1B 3ZRSA 1K2DB 4FXTA 1ZPUA 4F9LC 4JPWH 3U6RA 1GW0A 5K9QG 1MH5A 2R4RL 2GBUA 1D6VL 1DBKH 1R24A 2YIHA 3PWUB 3O6LL 1UQSB 1ZVNA 4OGAC 4OCMC 3HC0B 1R6VA 3MLTB 3OKLB 3U30C 4GRLA 5I6XB 2D7MA 2QSCL 2IH1A 4MCYB 1JF1A 2FWOA 4Z7NE 4U6TA 5DYOA 4ODXA 4M7KL 3T4AC 4OIIL 1U8PB 3DIVA 2QDWA 4Z7QF 5GS0D 1XSJA 4OF3A 5LVEA 2DWDB 1RZ7L 3FN3A 2IWKA 3P54A 4XMVA 4Z5RA 2OZ4A 1XV8A 4HJIA 1TZIB 3VFWA 5FGBA 1DQTA 4OZHE 1FG9C 2JE8A 1DQQA 2BSSA 5I1KL 4WK0B 4PJAB 1DVYA 4M4RB 4B3EA 1E6JL 1OAQL 3CFCH 3NCBB 1KN2L 3FTSA 3FTGB 1N8ZB 3GPSA 2X4OB 1BYPA 3O6FD 4H40A 1LD9B 4P07A 1DVTA 3RZCD 1C08B 4UTCA 1RERA 3FT1A 3MNDA 1C5DA 2AMGA 3QUXD 4Q6IB 1DVZA 4PH8A 1PEZA 2VZ3A 4WHCA 4DKEL 3OKKA 4L4TD 1CDIA 3AW5A 1UFGA 3LXCA 1T2JA 1NC2B 1OKEA 3BGMB 4AQEA 4MXWL 4JLRB 2TSBA 2FUQA 5JW3H 2BSRB 3EYSH 4GKSB 1TKWB 4PREB 2VDKB 3GRWH 3FH8A 3PRZA 4IRJB 4ZUSA 25C8L 3BIKB 3KYMA 2VW4A 3B3BA 3IETA 4V33A 2ENYA 3AM8C 1OP3H 5C9JA 5KBDA 5JMOC 5E6IA 2CIKA 4KNTA 4NGHL 3LPPA 4JDTL 4Y9EA 1HHJB 1TETH 1QHQA 1J0HA 1IU1A 1DSFL 2NXYD 3B9DA 3VJ6B 1GIGH 4WCYH 4LLVB 5E9DD 1J1XL 4ZTPL 1P4LB 2VITB 3KPNA 3SDDD 2PYED 3I6GB 5I26A 2H2PC 2NX5D 4BXSV 1W2KT 4CC4C 1K5NB 1ZSDB 1JRHI 3Q43A 4JRYE 1S7VA 4MAUL 4B97A 5TTRA 5I8OL 3CXDL 4GAJL 1A4KB 4POZD 4QTIL 4WNJA 5DZJA 3JSSA 3SE9H 1IARB 1DEEA 4M61A 4E42A 3TZVA 4OQ1A 1XGYL 3D3VB 4NZTL 5JHDE 3NRPA 5DU7A 3QJFB 1ZA6A 1HOCB 2NY6C 4ADGA 3FQXB 2OA9A 4M7JH 4AG4H 4RFEA 3P69A 5HJGA 4WUUA 4ZUVA 1NFDE 3UYPA 3FB8A 3A6BL 4X6EA 3VFNB 1IX2A 1E2WA 4YR6A 4PRAA 1SYSA 4KROB 3IDUA 1KDJA 3FRUA 4W6XB 1FAKT 3JYBA 1LP9A 3B9AA 3B2PA 2A9NH 4GKOA 3D0LB 3P30H 2IJ0C 4J39A 4Y2NA 4TNVK 1MFCL 2RFXB 3UOAB 2Z1PA 4HFUL 4KPHH 2GY5A 4ZPVA 1WK0A 4TM9A 1I7ZB 1TTAA 2HKHH 3A6CH 3CFDA 4PI0A 4QRQA 4XMLH 3FPXA 3LN4A 4R2GC 2P5PA 4PB0L 4HQQL 3O2DA 5IJVA 3PWNA 3TA3B 3VE0A 1JZEA 3QNYA 1SMOA 2X4SB 2FVNA 4X8JB 5C0AD 1YNKL 1EDQA 1RJLB 4HYTB 4JO5A 5C08B 2RIKA 2FSEB 3ERXA 2XRAH 4GB9A 4O02B 4Z3FA 4CC1A 2BC4A 3I85A 2O5ZH 1MKFA 1PYWA 2IPUG 4NNYB 4Q52A 5JQ6H 3FN9A 4S2SA 4N2AA 5E94B 2VR6A 1BQUA 1TQWA 4YSOA 3IGAA 3UTPD 5LNGA 3QE5A 1JXKA 5KUMA 3W11D 3OPZH 1LMIA 1HSBA 1WA2X 1I3VA 4YDKL 4G1MB 3PWPD 1GZQB 4Z7VF 2IANB 2WGNB 4MMZB 4F92B 4V1DD 4APQA 1OAXL 2VLJD 5ICZB 3AREA 1URLA 3FB7B 2RD0A 4HAGA 2X70A 4KH9A 4FXGB 5FHBL 3T3PE 1JCKA 1W0WA 3VXPB 4R90H 4W9CC 5I1DB 4LEXL 1KFGA 2APXA 3E6HA 2AQ3A 2ZAIA 3L17A 5HYSA 4L8CB 4JCMA 5F7UA 4JE4B 4TTGA 4OY9A 2ESVD 4FYRA 3RG1C 4RMWA 1QABA 3POCA 4YO0B 5EF1A 2R1WA 2R15A 2J25A 3ARFC 3TL5A 3ULAB 5C0BB 2VO8A 3MHZA 1OGAA 3DOSB 1CE6B 1GMIA 5TH2A 4BFNA 1CURA 4XNUL 4ZPTA 1CGUA 2BZDA 2VB5A 5F9WB 2FQGA 1GGBH 1IILE 1YMHB 1KOAA 2R59A 5DRNA 2G5BA 3PE9A 4Y5VC 4IOSD 2OFQA 2XSKA 4WSJA 1ACXA 4GLRH 2J1YA 4NDMB 2Q76B 4IYKA 1T6WA 4H5SA 1O9VA 5HDBB 1T0OA 4QRRD 3KYKH 5L9DH 3IGUA 2YFOA 5M7QA 3VYOA 5T1DL 2FT7A 2PCFB 1EVTC 1MCKA 1GGYA 4QOKA 4XNQA 5DJ8A 5SWZD 3QRBA 3GZPA 4X9GA 1BBJB 3QI9B 4UTAH 2HN7B 2DTSA 4BSVB 5BVJA 2EUWA 1JVLA 1TSRA 1KV3A 2H6PA 4R26L 3O8XC 4TPRL 3T0EB 2YQBA 5C07D 1TZ8A 3QHZL 1XBRA 4FNSA 1WISA 3CWGA 4Z7WA 3SCMD 1OT1A 2YLKA 3BESR 3GMRB 4JKLA 4ONFH 5BXFA 4CMHB 3MX0A 1HXMA 1WF5A 5E08H 2BFVH 1XXFC 4N1EA 5MEQA 1QYGH 4PGZA 3O3AB 2DQCH 5L6YL 1TJIL 5LBSH 5CJOL 3T5WA 4RZCB 2P44B 1ZLSL 1KG0A 3P77A 4NT6B 2RR3A 3PS6A 2FIKA 5FYKU 4H0IA 3D85B 2EXWD 4JKWA 4PMFA 3T77A 2GIXA 5DWUH 1VACA 4UDTA 4U6VH 4I5BA 1NCBL 5GS0C 3L7EB 2YK1L 2GK2A 1KB5L 3RVXD 1GC1H 3MODH 4WW1A 1A9EA 4MJIB 2ZWNA 4Z3JA 5FX3A 4U0RC 4LLYB 4FQ1L 2W5PA 4TTDD 4EN3B 2FJFB 2LU7A 2NNCA 3FBKA 4D94A 3MLRH 3VXMB 1JFQH 5E2VH 3W3BA 3IJEA 2ADIB 2EXYD 1AIFA 1YYLL 3O6FC 2IG2H 4EE2A 3RZCC 2BNRA 4R4FH 1FN4A 3E6FB 3D33A 2HXAA 1K3IA 2QQKL 3EHBD 5IG7A 5MEPB 5B1KA 3QUXC 5GJTH 3U1SL 4UQDA 3FPYA 1EHAA 4HK0A 4WUKL 2APFA 3IE9A 4QY8B 1KJ2B 4KDTA 4KHXL 4NHCH 2GAZA 1T22B 3HC3L 3MUJA 2ODHA 1YN7A 3CHXA 3BWSA 1H3PL 2PUQT 1EDYA 1FP5A 2ZX6A 4TLUA 3WNOA 4NYLB 2NT1A 2XKNA 2ZUXA 3T8XA 3OB8A 3GSQA 1YJDH 3JWDC 2OSYA 4UV7L 1OOAA 1RSFA 1AHWC 2A74A 3IJSA 1UH4A 2EJ1A 3M7OA 3BE1L 5CS7A 2NXYC 2X2UA 3WL9B 1THAA 3PHQA 4BQCA 2M2DA 5AD0A 3GMNA 3SDDC 3SZ6A 4OV5A 4J7RA 5CEYA 3GMMB 2R2HB 1CO1A 2UZXB 4S1RL 3GSNL 5CBEB 3QJHB 4ODTL 4POZC 1ETA1 2AQQA 1JNHB 2V5TA 2YA2A 4PD4J 2XQYA 2DQ6A 4XPTL 1UT1A 4L1HA 4OFYA 3LD8C 5EULV 1G6RA 1EEQA 2OYPA 4GXUM 4WLCA 1LHZA 3MMEB 5E2UL 3UCRA 2NQ3A 5HVHC 1TZAA 4UQ9A 3L3OB 4X6DE 3OZ9L 4HIEB 2A99A 4KNQA 2UX7A 2O5YL 1P4IH 4NUJA 3LVTA 5GGRY 5KG9A 2AQSA 5J8OA 1VKXB 1GYAA 5FC9A 2WOBA 2YPVA 1PG7H 1SGKA 4P23B 5ACZA 3F7VB 4QJ5B 4YFEA 2Y7OA 4L3AA 3MRGB 4HK3J 1I3RB 3GBMH 4F8NA 1KPUA 1RU9H 1HNFA 3EADA 3P3YA 2NY5H 3FYIB 3ZL1A 3DXAE 5D6DC 3QZMA 4JN2A 3CLEH 3QUZA 5CIPH 1YEDB 2DMCA 3EYVB 1QLEH 4MQXD 1LK3H 1XHHA 3BKMH 2FJGA 5J3HC 2V7NB 1KCVH 4PVBA 1HESA 4WFGD 3DVFA 3GMQA 3SJVD 2GI0A 4LCWB 2OR8A 3N1GC 5AAMA 3W1ZA 4BSWA 4XMXA 4YLCA 3ZQXA 4BH7B 2ZXWB 4QIRA 5E56A 4F1ZA 4RGND 3FUIA 3I9IA 4X4KA 3RPKA 5I71C 1ZWIB 2J8HA 3CVDA 5EEZA 1A7RL 1WZAA 1BXXA 1MRFL 5ABDE 3NA9L 3C9NB 3ZYOA 1KTDA 4AYID 3FT2B 1A6VL 4AENB 3PGCB 2I27N 4PJBB 3QDMD 3ULUD 1IBBA 3FZUC 4UAHA 3W0WA 1I85C 2F7OA 2KC0A 3EBAA 3PGDB 4RMSA 1G84A 1CLCA 3ZHFA 4GG6A 4I77H 4NQCD 5ICXB 2DM2A 1LL1A 5FA3A 3DOHA 3QHFL 4XAWL 3S36H 4JRYD 1FLTX 3W11C 1MG3C 2O6PA 4J8QA 4JFDA 4JHVA 2F54E 1TCRB 2R0LL 4XHJD 4UZUA 5DEFB 5IK3A 4R7NA 4JM4H 4PRBA 3RNKA 3VQLA 1W80A 4MD4A 2G60L 3LKPB 3UZQB 5D1XD 1JTTA 4F24A 2DEWX 5TDOB 3L4UA 2FLRT 3SPVA 5CD5D 3SDCB 1U3HA 3A4DA 3MRFA 1KT2A 3N0AA 4M8QA 4ZFFA 3MUHL 1C8QA 2P52A 4OLZL 3E1ZA 1EPFA 1U6AH 3QUKB 3WS6C 1JCVA 1SM3L 1S5IH 2G2NA 1AFVL 2NCEA 4XPBL 1JHTB 1IC5L 3CD4A 4I7ZC 4LSRH 5AVQB 2XIBA 4Q9BA 3CZGA 3QUML 2GJPA 2CALA 4MNHA 5GRYA 4CU8A 2MOVA 2VL4A 2PP9A 1SFDA 2ATKB 2Z92A 4XOBA 2X4QB 1JPEA 2L7QA 5AZUA 5FM5O 3VM7A 1MI5E 5ICUA 3WYRA 1Q4NX 5I0WA 1NCDH 2IFGA 4OM0L 5D7IE 4M1CC 3II3A 1BD2E 1TJHL 3B4NA 3DURA 5GGTA 1I7RB 2Q6WA 1JHLH 1TLKA 3EJZD 3EGXA 4EDWL 3QGVA 1AO7B 2CNZA 4PR5B 1HYSD 4KRPD 4GEJA 5FUZL 4Z23A 1KJVA 3WG7B 1Y0LA 1HH9A 1PQZA 2HP4A 4JFUA 3REWB 5FB8A 3EO1A 2CAKA 2O5XL 2BLFA 2J5LC 1AXTH 2HVKA 4JREC 2LTQC 4EOWL 4R8WL 4ISVA 3WUZA 3GINA 3WIAA 4TUOA 1FL6A 1GW6A 5IEHB 3H7BA 3SGEH 4YSQA 3SCMC 3HN5A 3ARTA 5EZJA 1CU4L 3S35L 1FVDB 1C1EH 1DUYB 2VZTA 1Q9KA 2O61B 3NPSB 2RQ8A 3VXNA 3FUEA 5TE7H 4G82A 2YMTA 5D2LE 1CFSB 2E6PA 4IRZA 5T3XE 4ORGB 2VT0A 4XWOD 2DYPB 2HAZA 3BZDA 1DQVA 4EEEA 3CZFB 5D7LE 2J8UB 3BEVA 1T04A 2EXWC 4AGLA 1AKJD 2XXGA 1YEGH 1T20A 2OV0A 4IDLA 1I1AA 5AW8B 3W37A 3TYGL 1XX9C 5DZOA 4LSPL 4LLWA 3UERA 3BAIA 3AROA 4L9LC 4MYPA 5A2JH 3FQYA 4K4KA 4JRFA 4TN9A 5DRWB 3TEUA 1HWHB 2FYVA 5JW4M 1JS4A 3U2SB 1SBBA 4TTDC 2NQDA 1JSYA 1VZIA 5E8OB 1VCAA 1MNNA 4ONGL 3CHQA 3DO7A 2DQUL 4XB3A 2HMID 1CL7L 2EXYC 2Z8VC 4NJ9L 3V0IA 5IJKC 4AIZA 2TRHA 3QRFM 4GPVA 5HGDB 3BZ4B 3QK0A 4DGIL 5FYJE 1DJGA 5D4IA 2WVVA 3EHBC 3DVGB 3TEZA 4OLYH 4FA6A 3TEXA 3U0PB 2ZPKH 5CSBA 5C0FA 1S5HB 2JCWA 3FFCB 4GO8A 2X9XA 3H9SE 4NQSA 3RVWD 3BH9B 3ETSA 4JAMA 1CYWA 4RMBA 5FOBB 1J11A 5DEGA 5TDNB 3JYCA 5IHWA 2ZG1A 4ZW3A 1QD0A 1A1NA 2IFFL 3PL6A 3R8QA 1K8DA 1IGCL 1MWAA 3QDGA 4I3RL 5LHDA 3VFSB 4GG8B 3K4DA 2YZ1A 5HHMB 4A1RA 5JW5A 3UGXA 3C6EA 5IMOA 3H2QA 3P2BA 4P59H 2VXSH 5F89A 2JJTA 1HZHL 4GQZA 5DJDA 1H15A 2WQ8A 3OMNB 2MOQA 2BWQA 4XN7A 4AM0B 2IV8A 4P49A 2ENPA 3IAGC 4GMSL 5L4MA 5D2NA 1JWSA 4N6RB 1XT5A 2AJZB 4FMFA 3O2WL 4G6FD 4YLQT 4TVPH 5I74B 5CFAA 1IAKB 4L29B 2WHVA 3TV8A 1SUHA 1OHZA 4G42A 4M9PA 1NCCH 4C4UA 4LKCB 3LXAA 4OV6F 1A6WH 2UWEA 4ZAKD 3QIWA 2ZUVA 5B7MA 3GUTB 4KRMB 1AZVA 3WAKA 4XH2A 1WC7B 5I1IL 5AOZA 4JFWA 2DLEA 3Q44A 1Q9LA 2VIRA 1KCRH 1VADB 3DJ9A 1GPOH 5DC2A 3BVNB 3FQNA 3MOBL 1KB5B 4OF6A 4ES8A 1J8HE 1BDYA 2BINA 3MV9E 1Z2KA 4PVLA 4YGVA 4ZFOL 1P4BL 4F93B 1AXSB 4G80B 3E2HB 2WLIA 2CXGA 1GKOA 5DFTA 4LBEB 1BW8A 2R29L 2CO6A 5BRQA 4GP8B 2OL3A 2PW1A 2X4TB 3A47A 2UXFA 4F2MB 4ZUTA 4OZFG 3LHPH 4NBZB 1KB9J 3LKNB 1TYEB 4L3EA 1RZQA 3GI8L 5EO9B 4U1GC 1EXGA 4MQXC 1B4LA 4F37K 2XTLA 1OK8A 4Q4IA 1DR9A 5K9OB 5IGXL 1FFNB 1C5CH 4ABVA 3C60D 3K71A 3FT0A 1NCNA 4XN8A 1NC4A 3BAJA 3UJIH 3HS0B 1JK9B 4RGNC 5DDHB 4CN6A 1P7BA 4LCUA 4Z1PA 1LO4L 4HWBL 4JANA 3G6DH 4GRMB 4TUJA 4LESA 2WCPA 4KQ3L 3ARDB 5D1ZA 3U7YH 3ZGHA 5GZOA 4WW2C 3JTTA 1M2VA 4OGYH 5M95B 3L3KA 4YHNB 2AXGA 4PJHA 4FLSA 1BVKB 3ULUC 4HS8L 4IK7A 32C2B 3ELAT 4A2EA 2AV7B 1G43A 4YIQB 5F7AA 5AOKA 3HZKB 5CD3A 5GRJH 4J3VA 1DBBL 3VI4F 1P6WA 2V9RA 5AVTB 2AABH 1BQ5A 3OHXA 3KYNB 4NCDA 4XHJC 5ID0B 1WUZA 5HYQB 2P5WD 2A9ML 3RKDD 4G8FA 2JELH 2EQDA 4BKLB 1J87A 1RLWA 3L9RA 5JTWA 4XVSL 5EEUA 1MEXH 1SEQH 5D1XC 5DFWH 5B8CC 3B9VA 3GSNB 5ISZE 2VYRE 4HLZH 2VDRL 4OCRL 1N67A 4K5LA 5CD5C 5AKRA 3U7WH 2DD8L 2WIIB 4MXVF 4N8CH 8FABB 1IFHL 3HBPA 3OSKA 3B6SB 1H3GA 4JM2A 2OK0L 1DSWA 2LVEA 3H42H 4OUUA 4X83A 3PUUA 3QR0A 3VFTA 5E2JA 1M6UA 5EPMA 1OGTB 3L5IA 1CQKA 2JJWA 4ZFZB 1WBYA 3MNZA 3IRPX 4RGMC 5DURB 3WN5A 3NEXA 1D5ZA 3MBEA 4NRZB 2DLFL 2H3NB 1BLNB 2EVGA 2X1PA 3FT3B 1DHKA 2VDLL 3JZ7A 3B9EA 5J6GA 3ILEA 2IWFA 4JY4B 1MUJA 1CXLA 3QR1A 3DPBA 3FBQA 2EVIA 3EJZC 3MUZ1 1HL4A 1YAZA 1HYSC 4YOKA 4KRPC 3DKHA 2NY2D 3NSJA 3MJWA 4C4KO 4NQEE 3S6CA 1OSZA 3F7PC 4WEBL 4YEFA 1KEML 2AV1A 3SKOA 1K2DA 1UZGA 3E3QE 3G04A 4MCMA 4J6RH 4H88L 3SKUD 2BNUB 1Z9PA 3DV6B 4WSGA 4NQDB 5FDYA 1SHMA 2Q20A 4G6KH 4Y1AB 3T08A 4P2AA 4X4ME 3ET9F 4MAZA 3M88A 4MCYA 2Q7AA 3F7LA 1WYJA 3K0YA 3RUGF 3BPOC 3A24A 4XX5A 2CK0L 1AY1L 2W60B 2VC2L 3BDXA 43C9B 3IJYB 4XWOC 5EUKA 4QGYA 2F54D 4LCYB 2DWDA 2AQNA 2P7TA 4JFFE 3ES6B 2H6OA 2PW2A 1ACYH 2DB8A 1MCBA 3GMLA 1XSOA 1TZIA 4UTBH 2DLIA 2PTTA 1YEFL 2Z4TA 5EU7C 1V7NL 4ELMF 2ZJSH 4M4RA 4IKKA 4FAAB 1XCWA 2WZPD 1UJ3B 3FTGA 3BZEB 3VAEA 4JFXA 4LGRB 5H4YA 3S98A 1NEZG 1RHHB 3FU0A 5FUOH 4Z77B 3HUJB 1ZDSA 4ODBD 5E1AA 3II2A 3UAJD 1TMQA 2VDKH 2NW2B 4A63A 3R06B 3X1GA 1EEUA 1WFMA 3DSFH 3ARBB 4Q58C 2P24A 3UC0L 1WFNA 2WANA 2HMIC 2EDWA 2IQ9L 2QQLL 3EFFA 1SXZA 5LO7A 4A55A 3MREB 1UOVA 4Y4HB 4RDBA 4P5MA 3ZO0A 1IGMH 4UNTA 3A21A 2MEJB 3C6SB 1WICA 4N9OB 2BSRA 4GKSA 4UCFA 1TKWA 1RCYA 2UUDK 2E59A 2YUXA 3HE7D 4N3TA 4PREA 4PRPB 1BD2D 2FT8A 2RHEA 1P84K 3GYRA 4Y8DC 3ABLB 3RVWC 3VFRB 1E67A 4MNQE 4UUJB 3ZBMA 3O3UN 1HHJA 4OJCA 1EJ8A 4Y4KA 4QF1B 5LCVA 3GJFA 1CFMA 4LLVA 2VITA 1LDPH 4WV1C 3I6GA 3MOAH 1FFQA 2EDLA 4CW1B 1I9IH 1ZSDA 4Z7UB 3CK0L 1A14H 3CDZB 3MOQA 4ZMVA 5B39B 3FOMB 4FFZA 3P02A 5AL8A 3T71A 4L5FH 4URTB 2PO6C 3W39B 4FDWA 3M86A 3QUHA 1P5UA 2L8AA 3N42F 5DRXA 5EOQL 1DN0A 1N64H 4OFVA 1J5OH 1YEEH 2XG4A 5T3XD 2AITA 3FQXA 4YSSA 3BAEH 2HUHA 3SGJA 1QA9A 5D9SA 1TNMA 5DZVA 2EE6A 2YBGA 4HBCL 5C2BH 2BWDA 4BCXA 3KLAB 4IEFB 4RFNC 2CO4A 1JHKH 1M57B 4P2RD 3VFNA 2ZQKA 2BOLA 1Q0YH 4G9FA 4WI5A 4ZAKC 4JGMA 4Y2LA 3G9VA 3HLAB 1IE4A 1CD1A 1E9PA 2BP8A 3PWLA 4HF5L 4F8OA 2QPUA 3KPRD 2DIAA 2JJUA 2VXUH 2Y1ZA 4QRFA 4ZDHB 3HNTH 3D0LA 5J4MA 1NFKA 2EEXA 4WTZA 4ODWB 2FNWA 1NGZB 5IMLA 3AT9A 2HJFA 3FN0H 1B2WL 4WZ9A 4O02H 5CFHA 1XDTT 2BJML 3Q2WA 5T33H 3ARWA 3LQAL 4H8QA 5F93C 1IC7H 3FCTB 5ADOL 3KPTA 4RMTA 2EICA 1WS7A 3RWIB 3TA3A 1NKRA 3ML8A 5IW6A 4MMYB 3DA0A 4PUBH 2VLRB 3MJ9A 3OJDA 2X4UB 5BPPA 2L7JA 3H9SD 3UEZA 2CKNA 4AGQA 4M3HA 3C60C 2FSEA 4DPAX 2ZKXA 3BQUA 4DEPB 1OTTD 2A0LD 4NNYA 1ZLVH 3TX4A 3DC0A 4JPVH 3IJ9A 1D5IH 5IW1A 1IM9B 5E94A 3M6DA 4PJGE 4KFZC 3NJMA 3V6OE 2UY6A 3ZE1F 3BUIA 4XGZB 1W8OA 3IKKA 2H1PH 4IJTA 3RGVA 3T1FB 3VWKD 5JPNB 2AJ3B 2JCCF 1UGNA 3EDEA 3EFOB 4XPFL 1PIGA 1Z0MA 2BPBA 1VF5C 3LSOA 5DO2D 4HS3B 1LTXA 3QQDB 2IDSA 2IBGA 2ZOKB 3WNIA 2HLEB 1QBLH 3ELQA 1IIKA 2A6IB 4MMZA 1T1WA 1MNUL 4NKDB 4ZYKB 5ICZA 2ZAGA 3BWZA 4RSYA 2ZKHL 4IKNA 5JDSA 4XNZC 2Y5TB 4ZNEA 5K59E 4FXGA 2Y0SA 2G2RB 2YAMA 3RKDC 4OZHB 1MFDH 2G3NA 2ZX9A 1OY3B 3O4LB 1K8IA 2EE0A 2WYZA 4GW5B 2X0UA 3U6XA 3VXPA 2GBAA 3P0VL 5I1DA 1WUNT 2DPKA 2VLLA 1V3LA 4M62H 2QEJA 4L8CA 3B83A 3JV4A 3MXWH 1KCSH 4ZW8A 4F9PC 3EYUL 2VZVA 4I18C 4YO0A 3UJTL 5CLWA 3UZVA 5HI3D 2E7DA 5KAQG 3KW7A 3S37L 4NKOB 3D18B 1Z6JT 1YQVL 3DOSA 1CE6A 4G8AC 2J4WH 3BUQA 2ARJQ 4KO7A 2EE9A 1IC1A 2UV3A 1A5FH 4BFBD 1JPGA 4KX9A 2BHYA 2Q76A 1LO0L 3TBSB 3DWTA 4B7LA 3UG4A 2D31B 2R69L 3HMXL 3N04A 4TQEL 4ZFOB 4C56A 1VFOA 1YVLA 4YPGA 3WGUB 4FABH 3QI9A 3D39E 4DQOH 3M45A 1KY6A 3HFML 4BK4A 2GC4C 4CVWA 4BSVA 1RIHL 3VXQB 1SFHA 1T1ZB 4KKAD 4HCIA 4ADIA 2HWZH 4YBLB 4NNPH 2Z7UA 4L2LA 2NY2C 3SDAA 1PS3A 3BCFA 1ZLWH 5GGVH 3NIDF 2FD6L 1A6AB 3CHPA 1QBAA 1DQMH 2FIRT 4OLWH 1MZYA 3HG5A 4QLRA 4AQZA 4WFFE 4XCEB 2AK4E 3O3AA 3ABZA 2XQBL 3R4DA 4Z95L 2W9LA 3G5YB 4P9HC 3KH3A 1FAIH 5DJAA 3B37A 3N0PB 5T5FL 5BZWB 3MRRB 3MKKA 5I16A 2E7LC 5JHDB 1XB3A 4KMTL 3WEXB 2WXOA 3TO2A 1P5VB 5GISH 1T21B 5CEZE 3CH1A 2CZNA 3DYPA 4JG5A 1KGIA 4HV8A 2ZXCA 4CBZA 1HS6A 3QUYA 3UBXB 5HSFA 3C5SA 4X8XA 3RUGA 3L7EA 4EZLA 1NFDB 1SY6H 3I2CH 4L48A 1J8RA 3P11H 3STBA 2Y6SD 1AVAA 3NFNB 4JO4H 4EN3A 3RDTB 1B0IA 2UVEA 5ISZD 2PPCA 3JVGA 4KKRA 4PJCF 4B41A 1KJ2H 3P4OB 4YNYA 4Z9KB 3VSVA 3KPOB 5EBGA 3ARUA 4B9IA 4XBEL 4XWGH 4JY6A 5E00B 4EIUA 4F58L 4K7FB 2LFGA 4AZ8A 3UAJC 2R0ZL 4AC4A 2PR9A 2X4RB 5DI8B 3ATBA 4XNMA 5MEPA 5AZ2H 2OJZH 4M43H 1NGWA 3NUKA 5L2KE 3O6KH 1YPZE 5I9QB 4QY8A 4NXKA 1AJ7H 1G1KA 2IALA 2JXMB 3IDIB 3T2NH 1SLVA 4DCQB 4R3SB 1GAFL 1KNOB 3OJ2C 1FZKA 5C6TH 2IEPA 1WTLA 5F7MC 3M07A 3UAAA 5C0JA 4K7PH 3QDJA 3HE7C 4XCYA 5HI4D 5C3LD 1JG9A 3HG1D 2BMKA 5KSAA 1UXMA 3FSOA 1YC8A 4TKWA 5EN3A 2YKLH 4JB9L 3DMMC 4BJLA 5T3XL 2VDLB 3EDFA 3RWHB 1YEKL 3RVUD 4FLOA 5G4MA 4DOHE 5AG8A 5JO5A 1D6VH 1V05A 4AYSA 3U4EB 3MYZA 4XOCA 4NQED 3TWYA 4Y19E 3GSRB 5IB5B 4DP2X 4Z76B 5PCYA 3FUMA 1DQDH 3RWFA 2CO3A 2QSCH 2XBDA 1DBML 2EIKB 4KMLB 4KZCA 3BW9B 3MJ6A 2UZXA 5C7ZA 4EUPA 3OR7B 4UANA 2E4TA 4M48L 3QJHA 5E5MB 4U4BA 1M1SA 4Q2ZB 2MCMA 4FEIA 3NCMA 3O3DA 1RZ7H 2BSCA 1HN1A 4K5PA 2WQAA 3VSTA 1SXSA 1HJCA 1F18A 1AZRA 3VUAA 4AGOA 1AGFB 1VGKA 1O7DC 3UH8A 4PRID 3T3PB 1WT5C 2VRQA 3W56A 2EACA 4XMPL 2WBJD 5DRZB 2V3DA 1VFAB 2VC2B 3LNIA 4OZGF 5AB2A 4GFXA 1AMYA 5FYJL 2R9HD 2BY0A 1R3IL 2NSQA 3F7VA 2XN9B 1BFOB 3IWVA 4BRVA 4PY7B 5I23A 1I3RA 4AGNA 1BPVA 5FA4A 5EBMB 2NNAB 4DP1X 5KOVC 1XCXA 4PGEB 1KXTA 1DVFD 1RL1A 4D9QE 2K3TA 1Z66A 1R5IA 1QLRA 3EYVA 3FT9A 3KHOA 4PI2A 3AM8A 3QYMA 4KTDL 4D0BB 3RPIB 4LASH 2V7NA 4ALAL 1U8JB 5FYKE 5AW5B 2XOTA 4EF3A 1BLIA 1JXDA 4LCWA 1CWVA 4YDJA 4G6AD 1H8NA 3UTTD 4Q9QH 5I6LA 5F7BA 1ZWIA 1RZKC 2NYYD 1J1XH 1CTMA 1IEAB 5IROD 3DTXB 2HPTA 1OTTC 2A0LC 4PJBA 1CZ8H 4DO6A 4GAJH 3V9CA 4XOEA 4PEEA 1QRND 4QTIH 2P80A 4JM0A 4ZRGA 3ARSA 1A3LH 1WE5A 4WI7A 3VCLB 2MQCA 4LP4A 5G4NA 3ZSTA 3NESA 1BZOA 3LPFA 4NZTH 4KJQD 5CKAA 2OSLB 1JK8B 4GP5B 5JHLA 3D9AH 1KXQA 4H8UA 4IU3A 1LO2H 4NCC2 1IUZA 1W72L 2A73A 3UO8B 4CUCA 2OJEB 5DO2C 1HAUA 5IFJA 3NJVA 4N2KA 4U1HB 1NBYA 3KPQB 2WC7A 1L7IL 4DESA 1PY0A 4CU7A 4KKPA 4LHJB 1R3KB 3X3FL 1IC4H 1XSKA 1YY8A 1WEJH 2ALAA 3BCDA 5E9NA 3W5NA 1MFCH 3MUUA 3HZYB 3EH3B 1U92A 1FE8H 3FU6A 1TZOA 3X2QB 2BH0A 1TG8A 4FZ8H 3PP4H 3S8FB 5DEZA 5HI3C 2ATKA 3BN9D 3FO1B 3FQRB 1HILB 1CTNA 2I60L 2F61A 2YD3A 5DC4B 5GRXG 3WJJA 1B4JL 3QCVH 3KJ4B 5DHYA 2WMPB 3W82A 2BVOB 4HJTA 5BS0D 3MU3A 4IDJL 2NRDA 4PR5A 1XGTB 2DL2A 4PU2A 1YNKH 5D7KE 1BFSA 4JJ5B 1KJ3L 1MCPH 1KYDA 3EGSB 2OMVB 2WOYA 1T5WB 1PNDA 4JR9L 5FCUH 2D2CC 5J57B 1MCFA 1UGKA 4W9ZA 1RURH 3NABH 4GT7A 4KKAC 4QXTA 3GM8A 4GFTB 1MHPH 1QAWA 1I8MB 4JRXD 3HN8A 4FA8A 3IMBA 5IEHA 4NJAH 4A67A 1FFPA 3FJTA 1FVDA 3D30A 1DUYA 1XQ4A 5GHWL 2B1AL 3E38A 2C7FA 4QJ4B 2GPZA 2ZNWA 1INEL 1NIFA 1CLZL 3CZFA 3ZSSA 3WTXA 1JD7A 1A6ZA 4MA7H 1JPSH 2VN7A 5FHBH 3X1BA 3I9PA 3BEWB 4HPHA 3MO1B 1ZD6A 4A2FA 4LLUA 1NAMB 5HYJD 4X6DB 3ULSA 4JRWA 3Q8EA 5EU6E 3O3BA 1A1MA 3ZKMC 3FUNA 2P8LA 5C1MB 4HXAH 2V2WB 2Y6SC 2WTRA 4AQ1C 3RL1A 3WJMB 5JR1L 3BUYB 5I30H 5E8OA 2NUPB 4Y5VA 1RUMH 1ZT1B 3EH4B 5IB2A 1QPPA 4FG2A 3QUGA 1UB6B 2CU9A 4WU7A 3GXTA 1BMGA 2WWOA 1WTGT 2BHUA 4NWUL 5LBVA 4AQ8C 3TNMB 3QXDB 3MLPA 2FCBA 3DXAB 3VW3L 1VEPA 3BVUA 1DUZA 3DVGA 4FL4B 1DLFH 1BZDA 2HG5B 1Q9WB 1MFAL 3GMOB 5HVFB 3U0PA 4JFOB 1FFRA 1S3KH 1KBBA 1RP9A 3FFCA 1Z7JA 3O8XA 5ECGA 1IAOB 2QHRH 3IMWA 1FZJB 3UYOD 2BDNH 4XPAL 2BP5M 1RUQH 3RTQB 2EIMB 4HIJB 5E4IA 5IBLD 4R26H 3TYFB 5DUJA 5TDNA 2O26U 2YN3A 5I8CA 3L3IB 3LJ3A 5HI4C 4QRUA 3D39D 2MSPA 4GG8A 1NWOA 3QEHB 3S5LB 1N8OE 3X12A 1HHHB 1O7SA 4EI6B 1BIIA 3MZGB 3HEIB 1A3RL 2ZSWB 2EYSA 3RVUC 3IDNA 3VH8B 3HS8A 1F00I 5CNHA 1JYVA 5I2IB 3FOLB 1NZRA 1CFQB 3B2UD 4B7IA 2B15A 1MF2H 3UO1L 1J0ZA 1S8DB 1P6FA 2HT4D 2Z93B 3KJ6L 2DTMH 1CYGA 1PSKH 2AK4D 3QXTA 4N0RA 1WWCA 4PRHD 3IMSA 4WFFD 1HWGB 2BHZA 1T7WA 2Z0UA 4AEFA 2AJZA 3TEWA 3VG0H 5CLXA 1NCBH 4M6NL 1I9RH 1KLFA 4XN5A 4L29A 4HWZB 1KB5H 4KO5A 4GW1B 3S7GA 3EOTH 4J8RB 3WCYA 1QUNB 3Q5YA 4HIIA 2JV6A 3OB0K 4LKCA 2EEBA 2OTWB 4HXBL 3EF4A 1L7TL 3VTAA 1HINH 4A6YB 5A1AA 5J89A 3NIFF 3U25A 3ECBA 4FFYL 4GBXA 3O6FA 2I5YL 3GUTA 5KN5A 3RZCA 3BKJH 1OAZL 1WC7A 2YSSA 2WBJC 4MJJA 3L3HA 4L8BB 3MLSL 4PRDB 1K4DA 4NZUH 1VADA 3AGVA 1I1FB 4HHAB 3D4CA 3VXUD 2A2QT 3BVNA 5KZCB 1DFXA 3Q1SL 4W6YB 4G7YL 4PBXA 2P3YA 2R9HC 3QH3B 2E75C 4FFTA 2YWYA 5DGRA 3WEBA 2QQKH 4I8DA 4D9LL 3DO3A 2MCPL 1AXSA 2N7BA 1PLBA 3EYQD 4X9IA 3U1SH 4YHLH 3TP4A 2C1PB 2ORBL 1QBBA 4LBEA 1C8PA 3HB3D 1NUNB 2X4TA 2ZWLT 4N0FA 2BIIA 3APNA 3S48A 5D7IB 4DO5A 5CXPA 2Y7MA 3IXAB 1DVFC 5KS9E 3LKNA 3ASWA 4FQQB 1HI6B 4FQIH 3P9LB 5EOCJ 2WUBL 1OD7A 4OIFA 3O6MH 4BELD 1HHKB 4OZIE 3X13B 3DSNB 4MBOA 1PZUB 2MKWA 2BW5A 4A66A 4WHYG 4DN3L 2DJ4A 5E8PA 5E9DA 3SDDA 2PYEA 1SNRA 1V3KA 3HS0A 4JL1A 2ZWKA 3BE1H 2NX5A 3SOBL 1BFVH 2KL6A 2NYYC 4YZFF 5IROC 4EI5D 2V5YA 4HCRL 3CSYB 4DN4H 1U95A 1ZHKA 4Z7NF 4LRIC 4ONHB 1P4UA 4H8HA 4S0SD 2LLGA 1YZZA 5DQJB 5DJYA 2FJHA 1PZSA 3ZYZA 2QFRA 1Q94B 4N25A 4XP9H 4ODHH 4YIQA 5D2LB 4CGUB 3HZKA 4AV0A 5E4OA 3LEVH 4KJQC 4XPTH 4UM8B 4ZFQA 4PTTB 1FFOB 3BH4A 2GFBB 1H3TA 5E2UH 2Q0ZX 3L6FA 5E2WH 2ZE0A 3GSNA 3IJHA 4WI9A 2ZOUA 3RBGA 1DANT 5FYLE 2YRLA 2ZIDA 3RFRA 4BWUA 5F88A 4XN2A 1OB1B 3TBCA 2WZ5A 1BXVA 2B2XL 5D5ME 1VB9A 3K2IA 4QPEA 3W9EB 5F3BB 3PG2A 3B3IB 5EZOH 5D6DA 4B9PA 3B6SA 3H3PL 2GYSA 1ID5I 3BZ5A 5LQBL 2D3LA 4LFHD 3UCQA 4XVOA 2CD0A 3HI6H 1MHEA 1OGTA 4HX1B 2VUKA 3VXOB 4O00A 4QTHA 3BN9C 3KYOA 4JHWH 1E90A 1KCKA 1UHVA 3UACA 3ZTEA 4F33A 5KVDH 5A7EA 1E9QA 2MMXA 1H8LA 2MWCA 4WW2F 5FKPB 4S1QL 1LWHA 2Y7QB 2L3BA 4D9QD 4FXKB 5H2BB 5C0AA 4B50A 5C2UB 2QFPA 5EDXA 1PFCA 2DQMA 4RIRA 5C09E 3ULUF 3F05A 1MSPA 4UB0L 4EIBA 3OXRA 3G6JE 4O2FB 1A7RH 2ODIA 4W9JC 4NM8L 1I85A 4UT7L 4F2FA 2AJVH 2E46A 3SPIA 5CUSL 5KBMA 1I8LC 2IBZY 4LVOC 3TIEA 1TJGH 1KIPA 1TO4A 1N5YH 1HKFA 4CDHA 4AW4A 1SYVA 4N2GA 3L5JA 3N1QC 4YPJA 2VXTL 3DV6A 4XAWH 3P3UA 5AAWA 2BNQE 3WEAA 3HAEH 4GNKB 4V1DA 4J28A 2VLJA 3NG5A 2W60A 3QJZA 3BQVA 4X4XB 2KQMA 3V4VL 2WD0A 1AACA 3V9EA 1SDDB 1XGQB 5AVWB 4MBRA 3WS6A 1I8IA 1CF8L 3DX7B 4UNIA 4TQIA 2XWBA 4U1SA 2WSDA 4JS7A 1G1YA 1AFVH 4FNPA 1M3IA 4OCWL 1LK2B 1ZS8B 4B60A 2DMBA 1DBJL 1OL0A 1BZQK 1NL0L 5EN2B 1NPNA 3HUJA 4LFHG 4Z77A 1KIUB 3QULA 3MV01 4YQXL 1J8HB 3CXHK 3MV9B 2NW2A 4PAZA 1AMXA 4IOSA 2QT6A 1GHFL 2C8NA 4GXVH 4HEMA 5F8QC 4ZMAT 3OL2A 3VXRE 4ZX3A 3OLIA 2VXQH 4NAMA 1YYMH 4Y16D 1ZPLA 3MREA 4Y4HA 5T1MA 2X7LA 4QHKJ 5IB4B 1BQHB 1ICTA 1EZSA 4EDWH 3C6SA 4G7QB 4DGVH 3GZKA 3KGRA 4QYOA 3QUMA 4JKKA 1QATA 3NCFB 2PCYA 2FH6A 5EC2A 3JVFC 4ZG1A 3GBEA 4NO0D 3NEEA 1ZMYA 3VFRA 1CLVA 3UTSD 5HHXH 2VRAA 1RXLA 3TJPA 2RALA 2BW4A 5IBLC 4NZ8A 4D3CL 5B38B 2V17L 3VD2A 3QJOA 2Z8WC 3BT0A 1FPTL 1U8HB 2UZYB 3MRLB 2Y9RT 5I19L 1A7QL 1FSKC 3BWAA 5JOEA 4KQ0A 3ZTNL 4KZ0A 1SBSL 4H1LH 4FQCL 1N3NB 2P8MA 4CW1A 2GCYA 5CEZL 3D0VB 3L5HA 3MA9L 1EBPA 3FUDA 2O4EA 4IGBD 4Z7UA 3CG8A 1PMYA 2XVKA 5IBTL 5IIEA 1G1CA 4ZXBD 3CDZA 4M93C 4WO4D 3FOMA 3B2UC 4NZJA 4B9FA 2ZUSA 4MD5B 4ANKA 1UADC 3SYOA 4O51B 2NR6D 4L9LA 3ARRA 4YHKL 2HT4C 3R1GL 4XBMA 2E9IA 4WWKD 1YQ2A 4M29A 2W0LA 3SBPA 5LN4A 3H53A 2BHFA 1A22B 1KGCD 3B9KD 1U3NA 4U0QB 5CCHE 3C5ZB 3IFPB 3KLAA 4FFWD 4IEFA 4IJ3C 5A6MA 1CCZA 1WFTA 1ZLUH 3T6XA 1ADQH 7PCYA 1H8OA 1OW0C 2BX5A 5IJKA 3IDYC 2ZYIA 5EU6D 1BQLL 1ASOA 1F4YL 1P1ZA 2QQQA 4OFPA 4K15A 4ZDHA 2B16A 1BZEA 2XX1A 1QO3B 1RUKL 1V27A 2IWEA 4X99A 2YUZA 5DMGD 5I6KA 4UDUA 2H0FA 3LPOA 4ODWA 5LGJB 1NGZA 4LRNH 5DD1H 5F7YC 3VGAB 4KKBC 4XC3L 4RQQA 3EYQC 4C4KT 5ID1A 3KDMB 2P48B 3HB3C 4ZUWB 4S0HA 4L4VE 4FI6A 4NEHB 3FCTA 4MA3A 5IM7B 5EF3A 3RWIA 2F58H 2Z31B 3PV6B 5BZDB 4MMYA 1M7UA 4FEMA 2F53B 4YXLH 4CKQA 1AR1B 3IVKB 2IFFH 2WXNA 3AS3A 4ZX4A 3FQ4A 3K2UL 4I3RH 3QB7C 5IT2H 4B53A 2GK0B 4Z3IA 3CIAA 1XF5B 5B1JA 1FL3B 1FGVL 2D3JA 3NFSL 4NN6C 1YMMD 5AKSA 2WWMD 4AJYV 2FHFA 4F20A 2D03L 5AWNL 4IKLA 4U7MA 3KYAA 1JZIA 4CVZB 4E9YA 3L2NA 2N0MA 4EI5C 3U0WL 4I9WD 2HYMA 5AW4B 3PXJA 5T1KD 3QPXL 4ABUA 4O58H 1OAUH 2QMKA 3IAPA 2ADGB 1CS6A 2O1AA 3NRFA 2RBLA 4L2YA 3T1FA 5JPNA 3EFOA 3NJJA 1IL1B 2G9KA 5ESQA 3B7YA 1CDHA 1U8LA 5A7BA 5DMJB 1BVNT 4TXVB 5AEAA 2WTOA 3Q6GL 1D5MB 4ANUA 3DX9A 1F8TL 4JFFB 4K71B 4NKDA 4TNVF 2YGVA 1AI1H 2G2RA 4O5LH 1F11A 5A2AA 4OZHA 3O41A 1D9KB 4G8GD 3FB6B 2D4FA 1YY9D 4H8WL 4YC2B 4A2GA 3LEXB 3VGEA 1I1CA 2GSIB 4U6HB 5GGQL 1ONQA 2G0KA 2GUYA 1NCTA 4AGPA 4LU5L 2EZ0C 3EGDB 5FYKL 5ITFB 1RSYA 4RAUB 3NCJL 2FBJL 1BJMA 1NUFA 2BRQA 5E03A 2JIXD 4Q9CA 3H9HB 4RDQG 5EUOE 3RNQB 1HL8A 3QFJE 4OCSL 1F58H 4IBSA 4CMMB 3GI8H 3HRZB 1BIHA 4GRWE 1KGYE 2OW6A 3HE6D 3IKCA 4N68A 3V10A 1GYCA 2AJSH 1CT8B 2FHCA 2IAAC 3TWCL 4AVKA 1A6UH 2D31A 4H8WC 1UT9A 2RH0A 4JO2L 2JB5L 3N1FC 4L4JA 2VDNL 2BERA 2R29A 5HJ3A 3B43A 4HA1A 4WW2A 1OT4A 4MNQB 1JZ2A 4JZOA 3VXQA 1T1ZA 1TEFA 3V4PL 2VSKB 4I0PB 4KQ3H 4OJYA 2V9UA 3TCXA 3SQBB 1Q72H 4JDVA 1NCHA 5IOKA 1A6AA 4JQXC 4X6CE 1XIWB 3FCGA 4HEPG 4JRYA 1ROCA 3GXMA 4IKIA 2WLJA 5E24E 3M8OL 4PW4A 4UQ3B 2YJLA 4HWBA 3MRRA 4TL4A 1XB6A 4FQJL 5BZWA 5B8CA 2EC8A 5JHDA 3WEOA 5KW9H 1PW3A 1G7HB 1P5VA 5BOJA 1A9VA 1SLXA 3K72A 5AYTA 1XF2A 1Q9OA 3M1BB 3LNHA 1JJUA 3KWWA 3AU0A 1NFDA 3UTOA 4HKZB 1DO6A 3WGVB 1IQDB 3SE3C 3CLFH 1S7UB 1IKFL 4UIKH 3QG6B 2FAUA 5SV4A 2QSVA 4IW4C 3NFNA 1XGPB 2DJSA 1IE5A 3U36B 3FU9A 4L05A 5HY9B 4IU2A 4J3SA 4P5TB 3P4OA 5L88L 1TPXC 2JJSC 2J57A 3KPOA 1J18A 1G9MC 4LQFL 4QCIB 2R83A 1YUHA 5E00A 1QFWL 3QAZC 1EGJL 1I8AA 2FATH 5F6HI 5DHVH 1TQUA 3D05A 1EAPB 1TFPA 2X4RA 3OGCA 1RK1B 1KMGA 5D71L 4X50A 2XHNA 2E56A 2DLFH 5CZVL 3FO2B 3DPDA 4Y16C 3PAZA 2VN4A 4BE6A 1TFHA 2XUWA 3IDIA 1A8JH 1BBDH 2EDYA 4UOJA 1KNOA 3BSZL 3GDBA 5GRUL 2GJ6B 5H94B 2WXRA 4M6AA 4DAGH 3I9GL 5D1QE 2EEAA 3LIZL 1MREL 3IFLH 4R7DB 2C9RA 1HNYA 5MERB 3LYRA 2J6EH 1FNGA 2VLKB 1KBVA 3N5AA 4WEBH 4XBGB 1EMTH 4WJG3 4BKSC 2F2HA 1UWXK 2VABA 3BGFC 3RWHA 4P3CL 2FX7H 5ANMB 1GS8A 2WVUA 3CDFA 1HE8A 4MRBA 3GSRA 2NY4D 4ZO9A 5IB5A 1GGIH 3WKML 4F7PB 4Z76A 3O11B 2J1WA 3LNEA 1MAKA 1O6VA 5JOFA 4IGBC 3H9ZA 2ZX7A 4Y89A 2VC2H 3FO9B 5E5MA 1PFOA 2BNQD 2WYHA 4WO4C 4Q2ZA 5CJQL 4ZXBC 1AKJA 3LRKA 3JWOH 4I88A 5CMAB 1R47A 4TULH 4QO1A 4MASA 2NR6C 4JFZL 5D1ZI 3R19A 3CFEB 2VWEE 2VTFA 5DFAA 4DK3A 4WWKC 2HX7A 4IBQA 4YEEA 5GIRA 4KRNA 4P4RB 5JIHA 3AC0A 3LS4H 3TZVD 1EO7A 4KY2A 4R84A 5I1LB 3B9KC 1VFAA 5B1AB 3DUHA 1R3LB 4AMKH 5JHAA 4XRCB 4FFWC 5HJDA 3FHAA 4N5ED 4AJ0A 4X7DC 1ZVYA 1EO5A 3QO0B 1VFBB 4IRSD 2JVUA 3KLLA 2ICWB 3N1PC 1D6EB 3UC0H 3QEQD 2K70A 2WKLA 4JQVC 3QFDB 2IQ9H 3MR9B 2EVJA 1JF6A 5DMGC 4PGEA 2Q3ZA 1TVBB 4NKMB 4OZFA 5I18H 1ZT4B 3EG9A 4ANWA 3WKPA 1AGBB 3R18A 1WD8A 3VXRD 2R8SH 1R1CA 4RZKA 3TGXA 4QLWA 5D72H 3RY6A 1ZT7A 1O6SB 3AITA 1J48A 4WV1A 3OAZK 3UPRA 1U91A 5JXAH 4I3SH 1HHIA 1LNUA 5JPMC 3CX5J 3ALXA 1PX4A 3DTXA 1PZCA 4XP6H 1U93B 2LHAA 4PLKD 4XNBA 2AQPA 4UM9D 4KUCD 4AL8H 5H4ZA 2YGOA 2AI0L 5MEOA 4B95C 3LVEA 4PMEA 3OAWA 2ED9A 5D2LF 4YDVB 1FHGA 1MW2A 3MV7E 4S1SH 4YLBA 1A7NL 3WO4B 1ITCA 4QNPF 3ZKSD 5JNYB 1WFOA 4HJSA 4OLEA 3GNML 2KPWA 3VU1A 4ZMXA 3MRJA 1BJ1H 5FK9A 1JK8A 2C3HA 2PXYB 5I1JH 2P5ED 1F1DA 4L1BA 4Q0XL 4HJUA 1P2CB 3ZE2F 1IB5A 1U58A 1HOEA 3VQMA 1DBAL 4PRNA 2JQAA 4LIQH 3WXVL 1QPXA 5KAQF 3NJIA 3KPQA 4FNLL 2X1QA 3SKNB 3TFBA 1A9BA 4RNRA 4HF5H 4X7TA 3RI5K 5JHBA 3E8UL 4G6ML 3WFHA 1YY9C 4APQD 1RMFL 3W2DH 4QXGH 4F8LA 3C87A 3ARED 5DYFA 3QSKB 3QORB 5IHHA 2GSGB 1AQKH 3GKWH 3VO0A 4WDIA 1B2WH 3UJJL 5HPMB 3FQRA 4UQ2B 4C54A 1EAOA 3ESOA 5L2KB 1E4HA 2WQVA 4QKXB 1RK7A 2R2BB 2FX8H 2B5IB 1MFVA 1YPZB 2Z4QB 4HZ1A 3IDJB 4MWFA 4PV8A 1KF9B 2BVOA 3F58L 1E5UI 1OGAD 3C60A 3HE6C 1V3JA 3NIGF 1XGTA 4UT6H 7FABH 1FNHA 2AERT 4AIXA 1I7TB 3R7QA 3EGSA 3GIZL 1IGYB 1N0XL 2KERA 5ES4B 5I1AB 2AANA 2ZNXA 3DUUB 5MI0B 3GPEA 4N2EA 4LGSB 1TJXA 1QW9A 2ESVB 3PWVB 4U1IB 4HUNB 4Y19B 1I8MA 3US0A 2GJJA 4PIRF 5DJCB 2PCPB 4PP2B 3CZLA 1PD0A 1I1RA 1WLHA 4NI6A 1NAMH 4XVUD 2X6CA 5IVNA 4JHAH 3KGSA 3F3HA 4DKDC 5FYLL 4PJ5D 1JNNH 4JPWL 4ZS6D 4OAWB 1U2YA 1DBKL 3ATEA 5DJ2A 1KELL 2KDGA 4KTGA 4DPRA 1MCDA 2GTZA 5KYXB 2FWUA 3SODB 3TVMB 3E9UA 3K1DA 3MO1A 4I18A 4AEEA 4IQHA 5BUPA 4X6DA 3EJUA 1ZHBA 4GRLC 1M05B 1TQBB 2WVSA 3UJTH 3MV8E 4P5KA 3JV6A 4Q6YA 4AE0A 1XCTB 2CM6A 4GS7C 1AQDB 2NUPA 4HKXB 3ZDYE 5KUKA 4YSDA 2GI7A 5KSUB 1UB6A 3D2TA 2LR4A 4U3CA 3LRSA 5HYSG 1FFTB 3CFCL 3CVHH 4P2QE 1KYAA 4W9LC 4JMXA 2X4PB 4Q97A 2D7NA 1WDAA 1Z3RA 5CCKH 2HG5A 4UQEA 5H37H 4JFOA 3HI1B 2UYLB 4HMDA 2BNRD 4MA1C 3DJTA 2Z3FA 4KGLA 5J0BA 1IAOA 2J1XA 3WUWB 1FZJA 4WHTA 3FTUA 1RIHH 3RTQA 3S2AA 4HIJA 2PR4H 3CFUA 3QWQB 3TYFA 3ECVA 1MIMH 1EJ6A 2OCJA 3CFMA 5JW3L 1SDYA 1QI3A 3EYSL 2HA1A 5IP4A 3QEHA 4NO3B 2IBZX 1HHHA 2GBTA 2R69A 3DECA 3HMXA 1HQRA 4XR8C 3N40P 1ET5A 5CP3H 4EI6A 4MJ5B 3QCUH 3QG7H 1M1XA 2ZSWA 1B0RB 3GS0A 1TQVA 2VDNB 3MI6A 5EU5B 3VM5A 5I0VA 4Z95H 3HTLX 5I2IA 3QWOA 4A6YH 2NY4C 4E9QA 5T5FH 2HLAB 3N85L 1GIGL 3ARPA 2PWHA 4WCYL 3V4PB 1INQA 2KT6A 5E6IC 1YEJH 1S8DA 2Z93A 4KMTH 5GRVK 2OP4L 3GFUA 2VN3A 1ZY9A 3I02B 4QHUB 3WBDA 2F54A 1FVCA 4GINA 3SKMB 4DP0X 1FHNA 4ZOBA 3FT4B 4M5YL 5AOLA 1RQ5A 4HWZA 5FGCE 3S8WA 4LHUD 1CICB 1QUNA 3SE9L 3FQUA 1NQBA 2WZPA 2OTWA 1IKOP 1DDHB 2WP3O 4U1NA 3ZTJH 4EPSA 1G7IB 4FCHA 5KBLA 3P4MB 3TZVC 5T3ZH 3UAJA 1C7SA 1RZIA 4AG4L 1YG9A 2J20A 4K9EH 1I1FA 1QRKA 3SE8H 2IDTA 1J9CT 4N5EC 3B1UA 2BS9A 3AG1B 3V52H 2IGFH 5A2LH 4ETQB 3QH3A 4IRSC 1Q0XH 1MHHB 4NQXB 3RJQB 2F08A 2CR3A 3NP4A 3CLWA 4WI8A 5FHAH 4HUVA 1YEHL 4P46B 5JW4N 1ZIAA 3RILA 1MI5A 4G5ZL 2I24N 2WYIA 4HJGA 3ZHDA 4CADB 2A9NL 3P30L 2Z34A 5D7IA 1PX3A 3HE7A 4UI2A 4FQQA 2FUTA 1HI6A 1BD2A 5IMKA 4LAJH 4E41B 2RAMA 3K6DA 5H35B 3SD2A 1B3IA 3HHSA 3X13A 1EHNA 4KUZH 3AMLA 3F6LA 3MBXH 5GRWA 5C9KA 1M7IA 4LMQE 4Z78B 3C75A 4IMLB 3RX8A 2ZP0T 4X98A 1ETZB 3H7LA 5F72S 2OMZB 3KMDA 2OMWA 4JFTA 3RA7H 4YHYC 3ECQA 3VRJB 1HQ4B 1NUGA 5EH1A 4PLKC 4FTVD 1Z5YD 3QIUB 2XRAL 3FFDB 2XTJE 4YAQB 1KLUB 2EIZB 2O5ZL 4MAYB 5JQ6L 2DWEB 5D96B 5IV2B 5D2LA 1KDIA 2JI3A 1KBWA 1H0DB 3S4SB 1T6VN 2HB0A 5I0DA 4UM8A 1UWEL 3L2LA 1FYTB 4LHUG 5D7LA 1OTSD 1PKOA 5FO7A 4B6ZA 4BIKA 4DQAA 4G8EA 2F8OA 3Q8CA 1P9MA 2AJYL 1S9WB 4FG0A 3ZU8A 1WCQA 5FPIA 1E28A 3GHPA 4ESKA 4JFDD 2JKNA 1UA3A 4FJZA 3WNMA 4E9VA 2XQYG 5FDWB 3CMGA 5HHOE 2CXKA 1OB1A 3T4YA 3NYKA 4DUWA 3W9EA 1ZLVK 3NMEA 5TFSL 3O45A 4P57B 3WI9A 4PJAE 2CUIA 4UU9B 1CDJA 4APQC 1IBDA 4JHUA 4R90L 2WNKA 3AREC 3V7MA 4F7KA 4XP4L 2LV4A 1TQCC 3TS8A 4I1RA 3WFBL 3MLUL 4HX1A 3RWCA 2WO4A 4HMCA 2V8LA 3CFQA 1CIDA 1JN6B 3V5KB 2XPGA 5AOIA 3PPEA 4LL1A 4XT1C 2DDQL 1H6TA 1G7LB 2KLSA 3VGDA 3ZKXB 4FXKA 2F7QA 4MMXB 5AW2B 5H2BA 2R23A 4F7EB 1GGBL 1NLDL 3H9SA 4JO1H 4PJFF 3ZGIA 5ICYA 4QTFA 1JNJA 5DMIH 3HHMA 4JFYB 2DMKA 1PIFA 1SLUA 1FH5L 2CM5A 1OE2A 1EA9C 4Z6AT 2MHAB 2X6BA 3UPCA 3KYKL 4HT1H 4LLDB 3BT2H 4IHOB 3U9PH 5L9DL 1TENA 2ARWA 1SJEB 2I9LA 3QZPA 1ZGLB 2X0WA 4PGDA 1DJSA 4G9DA 3WN6A 3GS7A 4UTAL 1DJXA 3VWKA 4G2AA 3WLBB 3K46A 2YEZA 5TGBB 4WFHE 3C6LD 5HJBA 2PPDA 4FZEH 1VA9A 4XVUC 1KPVA 3V0VB 3NBNA 3NEOA 4L3CA 2XYCA 3FSZA 3ABKB 4ONFL 5LWYH 1L5GA 5FS5A 1KN4L 4LVHB 5TDPB 2AXFA 4X4XA 3D2UD 2BFVL 4ZS6C 3MJ8B 4JPKH 5E08L 1MY7A 1ODUA 1QYGL 4MB5A 4HKBB 4W9HC 1SDDA 2DQCL 1NMCC 2EIDA 2YSTA 5LGKA 1JE6A 3LQMA 2C3VA 3V0JA 3DX7A 5KJRH 4AZUA 3D8MA 1ES0B 3MCKB 3WIFB 1E8XA 6CGTA 4KXCA 2FB4H 4HALA 5DWUL 1W72A 1BMWA 4U6VL 1D7DA 2DOCA 3QFGA 1B0GB 2DQGL 4O9HL 3QAQA 5DS1A 5EN2A 2N1KA 4TRPL 1GC1L 1I1AD 1KIUA 3MODL 4E2OA 3GXNA 5CBAA 3WIIH 3S88H 4L5FE 3RFZB 1JFQL 1SXAA 5E2VL 5FOJA 4OT1H 1EFXB 3B8SA 3G08A 1TF4A 1QI5A 3SDXF 2W91A 3ME0B 4K94L 2C9XA 1BQHA 3RVTD 2IG2L 4C83B 4R4FL 3L8QA 4NZDA 3STZA 1UWYA 4P8QA 4ZSOB 3EJYD 3VYNA 3WTYA 4KHTH 2K4AA 5EU3B 4F15B 5LAXB 1JXFA 5GJTL 1RFDH 3NCCB 1E7UA 3PQYE 5BZXA 3ISRA 3MRMB 4HIHB 2HRPH 2O5NA 3NN8B 3VI3E 1Y1UA 2VO5A 4NHCL 3HCVB 4PJGF 3BLKA 4OU3A 1QQDB 4ZQKB 4FA7B 4QT5A 1V54B 1CXEA 4HG4K 1FVEB 2YMXH 4KDTC 3ARXA 5DQ9A 1RZPA 3L3DB 3ARZA 1YJDL 1G0YR 5GHWH 3D0VA 4X7CC 1BJ8A 5KYWB 5CGTA 3JTSA 4M7ZB 4XP1H 3NQKA 1TDQA 3OXSB 4LZKA 5FGRA 1CVSC 3QDGD 5DF0A 3VWJD 1NKGA 4MD5A 1JV2B 5K59F 2CPUA 1O9ZA 1XCQB 4BUQA 1MCOL 1EBAA 4KVCH 4CL7A 2G2PA 2QPEB 5DLMH 4ZO8A 4AQ1A 3CU1A 2V2XB 3PHOA 2IANE 5ISZA 3OLDA 3C5ZA 5E2TH 3T3MF 4W4OA 2VKXA 2C1OB 5KYUB 2AQRA 4K8RH 1YJDC 3DJSA 1T03H 2PN5A 5C0CD 4BV1A 4HSQA 5D5MB 3FC8A 4W9FC 2H8PA 3PDOB 5SWSB 3VGBA 1F45A 5JOPD 1L9QA 3ZTCC 1QO3A 1X7SA 3A23A 3C12A 3QIWD 1CXHA 1P4IL 5F7DB 2ZXQA 3JUYA 4BK8A 3VW3H 1A3QA 4LHQB 4CVUA 2XT1B 3DO4A 5AW6B 2W95A 5JW4Q 1PG7L 2PO6B 3U4AA 5J7CC 1L9RA 3W9DA 1W6LA 5AVUB 3WOVA 3IRCA 1PBYA 4TVPD 3RX9A 1NIBA 2H32H 5F6IC 1QEWA 3ROLA 4HULB 1MLBB 3EJJX 3GBML 4TMPA 4XCNB 2X0VA 2Z31A 5BZDA 5C09B 1XAUA 2NY5L 3WHE0 4W9IC 5HDBE 3CLEL 3G6JB 4N2LA 4W9GC 4AOFA 1QLEL 2GC7C 2Q2LA 3HZVA 1KCBA 5FUCE 2GK0A 2PP7A 1ID2A 2ADFH 1LK3L 1Y07A 4Y0GA 3BKML 3PWJA 4A7GF 4NQEA 2BSDA 2ZP8A 2NY3D 1KCVL 3QUZC 1DLHB 4L3ED 2VN6A 5CJ8A 1JV5B 2MPAH 4GY4A 3CC5B 2AEIT 2EE2A 3AG2B 5IFAH 4XO4A 1KJMB 4DERA 4APXB 4MDJB 5AAMC 4E5XB 3EDDA 4NPYB 2ADGA 1G9NH 2A6JB 4FQPA 4HJ1A 2WBWB 5HHVL 4LB8A 2NY5C 1UKSA 4NIKB 2BXZA 1M9WA 5DJZB 1BVZA 5FW6A 4AM0Q 1CFNA 5GZOD 2XFGB 2HT2C 4N87A 2MCAA 4PRIA 2CCLA 2D0GA 4I77L 5K9QI 1HC1A