4AZUA

Crystal structure analysis of oxidized pseudomonas aeruginosa azurin at ph 5.5 and ph 9.0. a ph-induced conformational transition involves a peptide bond flip
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport(copper binding)
molecule keywords AZURIN
publication title Crystal structure analysis of oxidized Pseudomonas aeruginosa azurin at pH 5.5 and pH 9.0. A pH-induced conformational transition involves a peptide bond flip.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 31
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1993-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4azuA00
1JVOA 2GSMB 2XVBA 1PF3A 2BZ7A 3T6VA 4HALA 3IN2A 1BEXA 2RACA 2EINB 1AZUA 1JZEA 2JXMA 2XV0A 3ABLB 3NJMA 2HX8A 2Q9OA 2XV2A 2FT6A 3CG8A 1WAEA 1CUOA 1TKWA 4RH4A 3ZBMA 4QLWA 1GS8A 2YAEA 2BP0B 4ENZA 2FQGA 2BW4A 4DP5X 3IBOA 2Y1AA 3X1EA 3X1FA 2YAHA 3OM3B 3DKHA 5I6NA 2LLNA 2VW4A 1NWOA 2IWEA 5B1JC 3UAEA 5D4IA 1KV7A 4AI7A 1J9QA 3T6ZA 2BP0A 3FQYA 3S8FB 2HX9A 3FPXA 4KNSA 2UXVA 3ERXA 1AOZA 1KGYE 4P5SA 2J55A 5TK2A 4EF3A 2QT6A 1NTDA 4AKOA 4YSPA 2PPCA 2HRGA 3NJIA 2FJSA 1GY2A 4DP8X 1R1CA 2ZONA 5LDUA 2AFNA 2QDVA 2YXVA 3IE9A 1TEGA 4JKNA 3X1NA 1JZHA 3U25A 3FQ2A 2IDQA 4X4KA 1JXDA 2TSBA 3CZUB 2CUAA 2IDTA 3FSWA 3FSZA 5E9NA 1A65A 3NJHA 1QHQA 2VM3A 1W6LA 3WIAA 1KDIA 2XV3A 3ABKB 1E65A 1QNIA 4Q89A 4KO9A 1OCZB 4G71B 3SBQA 1AS8A 1AZNA 2VW7A 3FSAA 2OCCB 2VN3A 4G7SB 2GBAA 4HAKA 2PLTA 1SHXA 1ET5A 3PLYA 3QJUB 3DIVA 2DYSB 4DP7X 2NRDA 1J9SA 2HRHA 1E30A 3FT0A 3MX0B 3CVBA 5AKRA 2YAQA 1AAJA 2HZHA 1AZCA 2EIKB 3WKQA 2IDSA 1RZQA 3L45A 2VSMB 2FT8A 3AG4B 4AX3A 1MZZA 4GXFA 1BAWA 1ZPUA 4E9TA 2OV0A 1JZGA 1HFUA 1GSKA 2UX6A 3N2JA 4JHVA 2PP7A 1NIAA 3NJNA 1A8ZA 2EILB 3AY2A 3V9CA 2XUWA 5B1AB 1JXGA 1WS8A 1GR7A 2FT7A 1TU2A 2UXGA 3IEAA 3JTBA 4E9SA 2R7EA 1JVLA 5B3SB 4K9JA 2H47C 2E86A 4YSOA 1ILSA 3QPKA 4BDVA 3N55A 2XXFA 1E67A 8PAZA 2DWTA 1IC0A 1ZDSA 4NB7A 2CCWA 3OMNB 4WKXA 1L9QA 1PMYA 2IH9A 4GP4B 5B1KA 1MG2C 4AZUA 4YSUA 1RCYA 1T5KA 2PCFA 3FQ1A 1CC3A 4CSPA 5TK4A 3MBWB 3QJTB 4MFHA 3ZX1A 1ET8A 4BXSV 3UAAA 5PCYA 1IUZA 4BWTA 2BWDA 3S3CB 1A4BA 1X9RA 3FU9A 4G72B 3UABA 2VMJA 2J5WA 1CYWA 3T71A 1X9UA 5I26A 3AG2B 1GYCA 2PPEA 1V55B 1SF3A 3KW8A 3ABMB 2JFCA 3QJRB 4AKQA 3WNJA 2I7SA 1AG0A 1F56A 3CVDA 3OD3A 1AACA 1JOIA 4E9RA 1L9OA 1JERA 3HB3B 3PXLA 1M56B 3H56A 1OE2A 2AZAA 3WG7B 4YSDA 4DP2X 1NIBA 2CALA 1NDTA 3IN0A 1W6WA 2J56A 1URIA 3S8GB 4DP4X 5B7MA 6PAZA 1NIDA 2I7OA 1BQRA 2GIMA 1XB8A 1V54B 3NYKA 2XLLA 3PPSA 2FNWA 4GP5B 4TXVB 4BWUA 1IBYA 2DYRB 4KOBA 3FU7B 4KOCA 1NZRA 4BWWA 1BXVA 3AG3B 1KCWA 5PAZA 3CDZB 3UGEA 2BHFA 4YL4A 1E5ZA 3EF4A 4A68A 2PPAA 2PP9A 1SF5A 5I28A 1WS7A 2P80A 3FU7A 4JHUA 4KNTA 1DZ0A 4YSEA 4AKPA 2Y69B 5B7FA 1BQ5A 4YSAA 1AS7A 2J57A 1J9RA 3CDZA 2XXGA 1KCBA 2XU9A 1PNDA 1ASOA 1ET7A 2PPFA 3NSYA 3X2QB 1AS6A 1BYPA 2AANA 1KBWA 4A2DA 2OJ1A 4HHGA 5I5MA 1NIEA 4FAAB 1ZDQA 2MRYA 4F7KA 1HAWA 1ZIAA 4G7RB 2XYBA 3NJFA 1J9TA 1XMEB 2W88A 2B08A 1NWPA 3TASA 5ANHA 2H3XC 1L9RA 1IKOP 4W1TA 3T9WA 4CSZA 1SDDB 5B1JA 4E9VA 1M9WA 1ASQA 3FPYA 4NAJA 4UAHA 1TEFA 1WA2X 4YSSA 3T6XA 1ADWA 9PCYA 1PZAA 4M4RB 1SDDA 5I6KA 2PPDA 4YSTA 2X88A 3H4HA 5EHFA 4E9XA 2FTAA 3PAUA 1PAZA 4ZK8A 4WTQA 2R7EB 3GXUB 1DYZA 3AW5A 2EIMB 2XX1A 3NP4A 4NERA 4BDVB 2IWKA 2GI0A 1A4AA 3NT0A 4YSRA 2WO2B 2DY2A 3V9EA 3HEIB 4N4YB 2YAPA 1ZIBA 3UADA 1PLBA 1YLBB 3FYIB 7PCYA 2IDUA 1J5DA 2QDWA 4DPAX 4N8UA 1PY0A 3AZUA 3TU6A 1PNCA 2AVFA 4BK5C 4E9WA 4GP8B 4UF7C 3EHBB 5D4HA 4G70B 2VSKB 2HXAA 2YAFA 2ZOOA 4KO7A 1A4CA 5I6OA 4HIPA 3EH4B 4KO5A 4BXVA 2HX7A 3NSCA 4DP9X 1CYXA 1MZYA 3FS9A 2WSDA 3C75A 4GY4A 1SHWA 3D12B 4HZ1A 1PCSA 1NPJA 4HHWA 1MG3C 4DP6X 2I85A 1CURA 3PAVA 3OMIB 1FFTB 3JT2A 1N70A 2YAMA 4A66A 5IY5B 1E5YA 4PAZA 5B7EA 2UX7A 4HCIA 4YVNA 4L0PB 1ID2A 2GC4C 3NJGA 1JXFA 2IDFA 3SBPA 2BP8A 2GHZA 3FYEB 5A7EA 1A3ZA 5AZUA 4A2EA 2BZCA 2IH8A 3PAZA 3EH3B 1UATA 1ETJA 4W9ZA 4DPCX 3NP3A 1I53A 5I5JA 5FC9A 7PAZA 1GS6X 2GC7C 1B3IA 1AQ8A 1BXUA 2VM4A 3SBRA 2VW6A 2BO0A 1ILUA 5F7AA 5I6MA 1BQKA 4P5RA 3NJLA 4KO6A 3WI9A 4Q8BA 4KNUA 3S3BB 5B1BB 1AANA 2QPEB 2XWZA 4UANA 2CBPA 2W8CA 2YAOA 4A2GA 1MDAA 1SFHA 1J5CA 2PP8A 1KDJA 4HCGA 1XB6A 4QKTA 1RZPA 1KBVA 2IAAC 3ZIYA 2DWSA 1OE3A 2TSAA 2B3IA 4G7QB 2DV6A 4A67A 4DPBX 4YSCA 2GB2A 3X1BA 1OCOB 1FWXA 1ZV2A 2UXFA 2BWIA 4DP1X 4FA7B 2UXTA 6PCYA 4A2FA 4M3HA 1N68A 1FA4A 3BQVA 1WA1X 1IBZA 1SFDA 1AR1B 3NJJA 4PCYA 4E9YA 1AIZA 2Q5BA 2CJ3A 2YQBA 1PLCA 3WNIA 3TBCA 5I5IA 1XB3A 3ASNB 4YVUA 1PZBA 3BVDB 5D4JA 4YSQA 1BXAA 1L9TA 4A2HA 1JZIA 1GW0A 3NJKA 3QJQB 4F2FA 1SJMA 3NSFA 5I6PA 5I6LA 1NPNA 1V10A 2XX0A 3OMAB 1NIFA 4F2EA 3ASOB 3RYMA 3CVCA 3G5WA 1SNRA 2JKWA 1AZBA 3QJSB 5AFAA 2QPDB 3DTUB 1NINA 2FQEA 3PCYA 2YXWA 3OQRA 1KYAA 1GS7A 3KW7A 3ABGA 2AZUA 3FU8A 3QJVB 1EZLA 2X87A 3GDCA 1M57B 4E9QA 2CAKA 4GYBA 2HLEB 1AG6A 1HAUA 3AG1B 2YARA 2MTAA 2N0MA 3QQXA 1RKRA 3NSDA 1BYOA 1NICA 2ZWNA 1JZFA 3GYRA 1OCCB 1L9SA 1W8EA 1OE1A 2H5UA 2ZXWB 1EHKB 5F7BA 2EIJB 3S3DB 3SQRA 3UACA 2P80D 3ZDWA 4DP0X 1OCRB 1PZCA 1OV8A 2FWLB 3TA4D 3FSVA 3TBBA 3WKPA 3T6WA 2FQDA 1L9PA 2FQFA 1GY1A 1WA0X 1OF0A 3EH5B 2BP8B 3X1GA 3H4FA 1AZRA 1JZJA 1PLAA 1QLEB 2IWFA 1VLXA 2BW5A 1OOWA 2A3TA 4HCFA 1ASPA 2WO3B 2PCYA
chains in the Genus database with same CATH superfamily
1D5IH 4KRPD 3U4AA 2BZ7A 4EE2A 3VXTA 3T2OA 4HIXL 5IESH 2MCG1 1CGTA 3RHWK 5DJ0A 1AMXA 1AC6A 2XV0A 1MCKA 4LHUD 3BFOA 4NLHA 4C54A 4GO9A 1D5ZA 3KPNA 4E41E 4JFOA 1XTLA 1HILB 2OMTB 2X4PB 1XIWD 4YHLL 2BSBA 5FYJE 1H3PH 1OY3B 2HAZA 4XC3L 5T1LA 2ZUTA 4KKNA 1HWWA 1S7WB 3QUZA 1T7VA 2WUBL 2FQGA 3NSJA 2WPGA 2KUTA 1FFPB 4QOKD 5SWZE 2X6BA 5HD8D 3ECUA 2UYLA 2LLNA 1JPGA 3K2IA 1IC1A 1E8XA 1XXDC 1DQJA 3CLWA 3D18B 3QXVA 3UCRA 3L7FB 1KV7A 3FO0L 1OAKH 2HLFD 4U1GC 5D9SA 3OKEA 4GKZA 4J8RB 1U93A 4JO4L 2CD0A 2ICEC 1KY7A 3WIFB 3VVWA 3V4PA 1KSRA 3RP1A 1SEBA 1UM6H 2ZCKL 3V0HA 4V2CB 3FW6A 3GEFA 4WI9A 4IRJD 1T2XA 3BQUA 1QRNE 5EULV 4AGQA 4HV8B 2FJSA 1QNZL 3BAIA 2FSDA 1MFDL 4GRWF 3NACL 4OCSH 5LDUA 3ZQ9A 2YXVA 4TPRH 4Y89A 2PW2A 1MI5A 1BBDL 4DHLA 3ZQXA 1RUPH 1VDGA 2KKQA 1BIIB 4TNVF 5JMRA 2F0CA 1BJ1J 4X42A 2N7BA 2QLYA 2MNWA 3BGFB 3OAUL 4ZMAT 4XVOA 4QRRA 2H0JA 3IT8D 5D7IE 3INOA 4JRYA 4EAEA 1KIQB 1EEQA 3RY6A 1A7NL 3EYFB 1P1ZB 4N2NA 2ZOLA 3T1FB 2EDQA 3E38A 1F2XK 2ZG2A 4XPAH 2GUOA 2VN3A 3FCSA 4KAQL 3SKMB 3PJLA 1SHXA 3A22A 3QWOB 4G43A 1EO8H 5JW3H 5CEZE 4NOBA 2W94A 3UTSE 4AEIL 5I15H 1JJUA 4NN7C 4FQHB 4JCLA 1PX4A 2O5NA 5KTEL 4AOFA 1RUQL 4Y1AE 2R1WA 4Q7DA 4P5MA 5LBSL 4Z77B 4R4BA 2J1ZA 4AM0A 2I69A 5LKNA 1VZGA 2RALA 3LKNA 4JFQA 5EDXA 3QXDA 1MUJA 2QLVB 3DJ9A 5DJCB 3GMPA 3BZ4A 4PJEE 1CLYL 3RNQA 1Q0XH 5EN2B 5E8PB 3FFDB 2ROXA 2VC2H 4H0IA 2D3VA 4I1NB 5GGRB 2XWCA 3AM8C 4HS8L 4B9FA 4PRDB 3ELQA 4P3CL 3Q2CA 1XCTB 2XUWA 4LO9A 43CAB 5IT2L 4DK5A 2UXGA 1Q9OA 3M17A 4IEFA 1T80A 4F7TA 1I9IH 4BCXA 2UVFA 3VM7A 2R4SL 3T5WA 2V3EA 4FG4A 3RTQB 2IV8A 2DJUA 4ODUB 1PVHA 2W1NA 2NNCA 3OMNB 5F9OL 2Z3FA 3HFML 5I24A 3WYRA 3CC5A 4KDVA 5AVUB 2F7IA 4GLRH 3ZR5A 4LXFA 3LEVL 3QRGL 3V7AE 4WSKA 3ARGB 3VA6A 5T3ZE 1AGFA 1L5GB 3OR6B 5CEXB 4IU2B 3UTPD 3MACL 4GH7B 3KHOA 1ZLWH 3CZKA 2FEDC 1C5DB 5PCYA 4WWOA 5G5DA 2XVKA 4BWTA 4U2YA 4ZUVB 3TCLB 1A21A 4CUCA 1NCBH 2N56A 4Q9RH 1X9UA 1J7VR 2Q8BH 3D3VE 5MI0C 4L9LB 1M05A 1E0OB 3RVVD 2VDNH 2A73A 3FN3A 4MAZA 4WI2A 3QJRB 2IWGA 5J7CC 3ALPA 3LIUA 4QAMB 1HK6A 1JHTA 1NM4A 4FKHA 1HCYA 2AMUA 3WNOA 1N12A 1AACA 3OLGA 3I3EA 4XXDB 1JERA 4NAQA 1UG9A 4FDWA 4DP2X 2P9RA 1E9PA 3NABH 5CIPA 5EU6B 3RUGA 3CBJB 5CR8A 2H32A 5FM5O 3S8GB 1BGXL 1BVLA 2VTFA 1KJMA 2AABL 3L9RB 3MN8A 4I2XB 2UZIH 1EAPB 1XB8A 3QFJD 2PTTA 3TH3T 1RAMA 4P49A 1IBYA 2DYRB 3SD2A 4FABH 4GAAA 5GGQL 5E4OA 5AYUL 2AK1H 4R5VA 5TF1H 1OHQA 3X13B 5LGJA 4LESA 2VO8A 2HMID 2XACC 5J9PB 4RIRA 3NCCB 2F61A 3BWAB 3T2NH 2YXMA 3M07A 4GSQA 4JFZL 3L54A 1Z9OA 5B7FA 1BQ5A 3DK2A 2XG4B 2D31A 4L0YA 3CDZA 1H8SA 2EDKA 2DJSA 4QRRE 3SDXF 4ABUA 4UIMB 3GXMA 4UM9A 4JRYE 3FU6A 3VGGA 4URTB 2CO4A 2K6ZA 3HUJA 3OL2A 3W9DA 3CXDH 3ULSB 5LNGA 3GRWL 3DWTA 2YRZA 2OMZB 1MCWM 3VH8A 2VLRD 1BZDA 1K4DB 4X6FA 1TPXC 1JN6B 3NQKA 1YEGH 4F1SA 1AGCB 2V7HB 4ZXBC 5CJQH 4HMEA 3WOVA 2N7AA 4DKTA 1JPFB 3BKJH 3SDDA 5LO7A 5HVHB 4CJ1A 1QLRA 4HG4J 3X12B 3ARQA 4NOFA 2HT4C 4UV7L 1CK0H 1KGWA 2XIDA 4HWEL 1FNHA 4CVZA 4EUPB 4PS8A 1NEPA 4S11A 2PPDA 3QQ9C 5L9DL 4NKMA 3SDCC 4APQD 3KGRA 1DLFH 3NFSH 5E70A 4WTQA 3F84A 3GXUB 2OP4L 1IC4H 2BOLA 4OR1A 4W4NA 1BX2A 4KROC 4XNQA 2F18A 2G3ZA 1OGTB 4OV5A 4Y2DC 5C9JB 2CO6A 4MD4B 1IM3A 4M62L 1R4XA 4PJ5B 1JHLH 2PWDA 3TX4A 1UZ8A 1PEZA 4AY0A 4QY8B 5HY9B 1KB5B 3F12B 4Z23A 2ESVB 4B41A 1SMDA 4QKXB 4DH2A 2GEEA 4HS6B 5FA3B 3A6BH 1GYWA 5AOMA 3TBTB 4L3EB 3VI4F 5D7JC 2OZNA 3LQAL 2NXZD 3ZHFA 1VENA 3C75A 4G7VL 1W8NA 1SJVA 1OAKL 3LKRA 2VSDA 3CD4A 3GSNA 3MROB 1FZOA 2I9LB 2QQKH 1A7OH 2QSCH 3SDAA 2O5YH 2P43B 2OMUB 5ITFA 4S2SA 4U1IA 3SGKC 4A66A 1TQBC 2X2HA 1AGEB 5IJKC 4QF1B 3WS6C 2IH3B 4BIKA 1CVRA 4NC0B 5IEHB 4JX0A 5IY5B 1ZT7B 2OX5A 1RU9H 3WTWA 4QGYA 2GJPA 2BP8A 3T8XB 1T22A 3QWRD 4E0RA 4A2EA 3VNYA 4TPRL 2UZYB 1V7MH 1ETJA 2I32A 3QDMD 4OZHB 3IBEA 3RJOA 3R7QA 4KKRA 5ABAA 4ZW3A 2M1KA 2RGSA 3N44F 1RUPL 5L2KB 4YC2B 2KLSA 3SBRA 1ILUA 4N3TA 4ONOA 5C0AB 3HNVH 4L5FE 3QJZA 3RI5K 3RUGE 3W0WA 1J8HD 3ZL2A 3B9KA 3BUYB 1DSFH 1IB5A 2VDLB 3LN9A 2XWZA 4WW1A 1EAQA 2YBGA 2DQIH 3E7JA 3ILEA 4Z7QE 2K1MA 2YPLB 3WY2A 5DA0B 1KG0A 3D85A 4OJAA 5F1NA 4F37K 2IAAC 2R51A 2ZAIA 4PUBH 1W9XA 2P3YA 2J2ZA 1O7SA 4NQXB 4C56E 3SE6A 1UYWH 4M1CC 5HYFA 3C9NA 1F3JB 4D8PA 4M3HA 3IMSA 4H44C 5EBLB 4WW2A 3FMGH 4UQ3A 1TITA 5MI0B 4RFNC 3HUJE 2GJ6E 3LNEA 4JO2H 1MFNA 2FJHB 1AVAA 3CLEL 4Y4KA 1XIWB 4KQ4L 3Q1SH 1Q0XL 2IJ0C 4MZIA 4URKA 1RIHH 4LLQA 5TE7L 4X83A 1M7DA 1BFOA 2CDFB 2DIEA 2VC2L 1BPLB 4TSCH 4BFFA 3NSFA 1DJWA 1AZZC 4QOKB 1ZLDA 1SXBA 2GAZB 3LS5H 1ROWA 1CIDA 2FO4B 3FRUB 4KXDA 2NUTB 5GSVA 4F15C 3EJUA 1B6UA 2DQHL 2YPKB 3BH4A 4M61A 3I75B 1I9IL 1MVFA 4OLXH 3VI3B 4PG2A 2NSQA 4K55A 5F21B 1C16A 3QO1B 5FYKL 4J3BA 2I24N 1CF8H 3A4AA 4PI2A 4ZW8A 1DQVA 3IKCB 5GRZA 4ZUUB 3V4VH 1GGCL 5SWSD 2CGZA 1GS7A 2LVCA 1NFDF 1SLVA 3GUFA 1GIGH 5J13B 1G4MA 1OF2A 4AQZA 2CAKA 4PRPA 5HHOA 2VWEC 2J88H 4Z3GA 2IBZX 5D1ZI 3SGEH 2D9QB 1KFAH 2HLEB 4PFEA 3ULVC 1QVOB 1UB5A 4FOMA 1RZKC 4NC1C 3OV6A 4PJHF 1HZLA 3N85H 5E08H 2WD0A 1UWYA 2OMVA 4BFJA 2OSWA 1RKRA 3BP7A 3PGDA 4F7PA 4PJ8C 4P4KD 1MW2A 2YUVA 4OD3L 1RIUH 1UZ6F 2IEPA 3H9HB 4LAJH 5DJ8A 2P8PB 3N9GL 1R3LB 2APXA 3QZMA 5ITBH 3IDIB 3DARA 4ZXBB 1EZSA 4JFPB 3OTTA 4NQVB 2BXZA 4GG6B 2L7EA 4DOHB 2VDMH 3DX8A 3HC4L 4HWZA 4XXCC 4KUCF 2CHNA 1FLRH 3QIWC 2ERJB 1WWAX 1WBYA 3NABL 1IBBA 3IRZA 4HWBA 3TJHD 1PF3A 2WQRA 2R69A 3ZYIA 3NIDB 4Q0XH 4BEIA 1JPSH 4RBPK 1IT9H 3QCVL 4X9BA 1JZEA 5D1XC 5F96L 2V7NA 2ZOTA 4FG0A 4JFTA 4JFFD 2V3DA 2MHAB 3LCYA 2XN2A 4Y2DB 4A7QA 5IMOA 1ZT4B 1WAEA 2EYRB 2OAAA 3GS4A 3WNMA 1ZHBA 4OI9A 3T2NL 3D39E 5JOEA 1ZA3A 2WXRA 1YVLA 4LSUL 2E7DA 4AYDC 3RIAF 2JCCF 1J8RA 2G5RA 1A7PH 4RAVB 1GA2A 1WZ1H 4KHXH 3TBWB 5EDSA 3BH8A 2V2TB 2RR3A 1YUKB 2A9BA 4KJQD 2HX9A 4FGMA 1ADQA 4LOEA 4WHCA 4Y2OA 3V6OE 1OT2A 4ZYKA 3LMJL 1AOZA 4JLRB 4QRPB 4G6AD 1JZ5A 2D7OA 4WI8A 5DJYB 5MHSD 5C0DA 3WHE1 4DGVH 1N8ZA 2C9AA 2APTA 1YAZA 4M5YL 4Z7WF 5E6YA 2WZ6A 3DSFH 3U1SL 2VXTL 2IANE 2V8LA 4JJHA 4DP8X 4LEOB 3GLDA 5FGRA 5HGGS 1PFOA 3BKJL 5E00A 3WFBL 2J73A 4ZZFA 3L5XL 2WQVA 2D9CA 5D1ZA 3NA4A 4EI0A 4ZAKA 2F53E 2C3VB 1JXDA 4WZ9A 4DZBA 4L8SC 1BM3H 1F97A 3FTYA 2F7QA 4FTVD 5DHVA 2CUAA 1EFXA 4Q6KA 1OTTD 1RIVL 1T3FB 3NPZB 3ZTNH 5GJTL 5I1AB 3PWLA 2PWHA 3OZKA 3KPPA 4FQXD 4G1MA 3ABKB 4K8RH 3DJTA 2WVUA 3EO1A 1AZNA 4OLVH 5AVVB 3UBHA 1VGKA 2KC0A 3FC8A 5GGSY 3DUUB 3IU3A 4FFWC 4YK4C 3AQDA 1NGPL 2VDOL 2VLJD 3DX6B 1OSZA 2DYSB 3JV0A 2OSLA 5F6HJ 3WO4B 4M43H 4DP7X 5F7LB 2YHGA 2XI9A 4XCEA 4JRXD 5DWPA 5IG7A 5K1JA 3ASWA 5KVMC 4Q14A 2YAQA 3A6BL 4YO0B 5ALBH 1EVUA 3N42B 5E56A 2Q2LA 2X4OA 3EYQC 1YPZA 3EYUL 3QFJB 4RNRB 1AKPA 2EIKB 2BMKA 2V17L 4PRBB 3RWGA 3ILPA 4L1LA 5IJVA 4PJ7A 4PRPE 4XPGL 3C5XA 3RPBA 1G5AA 3MUZ1 4WSGA 1KCRH 2I5YL 5F7DA 3EXLA 5CUSH 3DLQR 4RRPA 3RKDC 4IMKA 3UBXB 3MRLA 4EMZA 3E0GA 1QEXA 1ECZA 4RRPM 2HT2C 2EE6A 4RFNB 5I0WA 5IVZB 1NIAA 4WU5B 3P02A 5ICXA 3TFBA 3VWJD 4YN3A 5I66B 3VXNB 3BKML 5EMYA 1WS8A 2EE0A 1VKXA 1MCEA 5M94B 3MV9A 2IGFH 3BVWA 3NRFA 2IAMC 5ETUA 3VXMA 1CS6A 4RMSA 4GOSA 2AEPH 2EYTB 2RHEA 4KNQA 2WOYA 1SBBA 2HG5B 4H8HA 4F15B 5EO1A 3VGDA 3MLWH 2VLRB 4YGVA 1NFAA 1NC4B 4P2CG 4GEIA 1JZDC 3BDBA 4M1GH 3I84A 4DKAA 3HNVL 4JY5H 4OW6A 5F70A 1WFOA 2DLGA 3K2MC 3QS2A 4I7ZC 4U3HA 3EBHA 2EXWD 5INCA 1T5KA 5IK3B 3RWFB 4DSYA 4MMZC 4LFHG 3S3SA 1LNUB 1GW6A 4DVRH 4XOEA 4X50A 4HLZH 5H4ZA 5E8EB 5D6DA 2DQIL 1A64A 2DLTA 5CKAA 1DE4A 1FVCB 4H1LG 3UAAA 1CU4H 1UVQB 2ED7A 2BWDA 2WZAA 5DEGB 3QSKB 3ZE0E 1E90A 4APQB 4AEFA 2DQCL 1NANH 3UXFA 1R3HA 3MBWA 3RVUC 3AG2B 4ZX6A 1XGYH 2VABB 3V0AC 5HYSB 3MYZA 1N0LA 1SF3A 1XZWA 2PUQT 3IDUA 4Z3IA 4HPOH 4Q6IB 4YHIA 4OZGF 3G6JE 4IDLA 1RK0B 1WSST 5KYUA 2WCSA 3LZLA 4JRFA 3GTVA 2XIIA 4D2NA 2HWZH 4FD0A 1COBA 5CZKA 3Q2VA 2XTJC 3LB6D 4ZSOB 4PJBA 5C2UB 1DQQB 3K8MA 3LRKA 5EORL 2MIZA 1KENH 5H37H 3GMRA 2IGTA 3OMZA 3Q8AA 4MA8H 1T0NB 3S96A 1JRHH 2RB8A 3P3RA 2I7OA 1JV2A 2VDLL 3FFCE 5ISZA 2A0LC 1V54B 4AJ0A 4TSCL 3PPSA 2KZBA 2C26A 4NM8L 4PJFE 3FU7B 4ISVB 3VD0A 1PG7H 3AG3B 2YPVA 1KCWA 5I6XC 2IFFH 1EDHA 5IOPA 5KG9A 1HCZA 2OA9A 1M3JA 2OTUB 2YKLH 1I85A 1E4HA 1MCPL 2ZE0A 3D1MC 3B7TA 1XCWA 1KF9B 5D1XB 5IW1B 5JIIA 4G2AA 2PP9A 1SJHA 4PJAB 5D70H 2MH4A 3F7KA 1R24B 1WBZB 2AJYL 5JXEC 4YSAA 2DQFB 1WK0A 3I02B 1SXNA 4Z8FH 2BFVL 3HBGA 4CMHB 1RFDH 3HA0A 3EG9B 5ECGA 2CGRH 4G80A 5F3HA 4HH9B 1C9SA 5DD5H 4UT9H 3ESMA 2FX9H 2ZXQA 4QD2E 3NIFB 2MRYA 1HAWA 2ITDB 1KFAL 1S9YA 3QDMB 4NT6B 5CCKH 3EIFA 4U7MA 1VPOL 3N85L 1Q94B 4HWUA 3MRKA 1OARL 4OTXL 3BVUA 1AXIB 4ZFOL 3P1VA 1YNLL 2RAMA 1CFQB 1LO4H 3MBED 3JWNH 4RWYH 4Y1SA 4G8FA 4OD2B 2PCPA 4NAJA 2EXTA 1UM5H 3FT4B 3NIGF 5EUOB 1TEFA 4V1DD 2TRYA 1YY9C 2XSKA 3MLUL 4FMFA 4PGDA 2WB1A 2O5XH 2Q7AA 9PCYA 1PZAA 3M46A 3V0VA 4RX4D 2WSKA 4RVBA 2BVUA 1SGKA 3RX9A 4AYEC 5EHFA 2X9XA 2IPKA 1FLRL 2EH8H 2OKMA 5FA4B 3ZDZE 4UMGA 3DDFA 3BAWA 4PU2A 1HEJC 5DHYB 4L8SB 1I8AA 2D7QA 2QFPA 4NERA 3VXSA 4AQEB 1QPXA 1RJZB 2DPKA 2GW5A 1XF4B 2RD0A 2CM6A 3C60C 1NPUA 3C8HA 4J28A 1A6UL 3AU1A 3ESUF 2YRBA 4ELMB 3NCYS 1GAFL 3F83A 2HH0H 1RZIA 1K2DA 5BZDB 1TCRA 2PYEE 1RZJL 2WAHA 4DK6A 5EPMA 4HJGB 4R3SA 5HHMD 1MVYA 1YYLH 3TN0D 1HNYA 5IJDC 4KO7A 4B9YA 1B0RB 3NK4A 4P23D 5E9AA 4ZMXA 3P9MB 3LZFL 4R7DA 5BJTB 4NO5B 5FAAA 5DD6A 3NGBC 3MFFA 4U6YB 4K94C 2KZ1B 1S7XA 4N2HA 4ONHB 2PABA 3CSYB 1EV2E 5AOIA 2NXYD 3GJFA 3J27A 5EO9B 1EO7A 4KFMA 3CU1A 4NO2B 4PWJA 1E8YA 1KPUB 3WFCH 4JM2F 3KL0A 2H2PD 4YDLC 2R9HC 5A2LH 1YN7A 4GFXA 4DGVL 3B37A 5DQDH 4HCIA 2YC1B 3VGAC 4FQ2L 4K23L 2JB5H 4UNIA 1A3ZA 5JPNB 2E0PA 2R0LH 5SWSB 5C0EA 1G7PA 2C1OB 4BSWA 1F4YL 3ARED 4EPSA 4MXQC 3ZZQA 4RCAA 4Y19A 1BQUA 5E1QA 4OF3A 5IHHA 3BKCL 3MV8B 3GBLA 4XMPL 4EZKA 5C07D 3V4UH 3BIKA 3KWVA 1P5VB 5BXFB 1PJ9A 3RURA 2IAMB 3SO5A 2PR4H 3JWDC 4U1MA 4NXSA 3KE0A 1GKEA 1Q9WA 1DVFC 1UCBH 4PTUB 4KNUA 5B3NA 3WIHA 5IROD 4D0CB 2EE3A 3UZEC 1XR8B 1H19A 2YAOA 4X6DF 5ISZE 4FADA 5SWQB 5HI5C 1KY6A 3MV7E 4J3OC 4YDVA 2BSRA 4JFWA 4PWGA 3RZCD 2APFA 4N68A 2QJDA 2F8IA 1RZPA 3VSQA 4LSVL 2J7LA 1E2ZA 4F20A 1U91B 4MMZB 3OPZH 3RVTC 1XL4A 1G9HA 3TNMA 5MEND 3B6SB 2GB2A 3X1BA 3IVKA 4X6BB 4JANA 1OCWH 2EDFA 3IDJA 4OAWA 1HE8A 3KS0J 3LTVA 2X3BA 5E2WH 2P1YA 4XTRD 4Y16D 1CE6B 1E4XH 1FC1A 4GBXD 1PZ3A 4HOZA 4N1CA 2FJFA 1QO3A 5EOCJ 3PREA 2R29A 4O4YL 1AIZA 3BN9C 4F27A 1FORH 2YQBA 4KUZH 2BY1A 3WNIA 2O61A 4MB5A 3POCA 2D73A 5DS2A 4XHQA 4JK0D 1MFVA 1E9OA 2APBA 4I5BA 5BQDA 2XTJB 4X8JA 3QI9D 4TSBL 1SOSA 3MJ6A 4PV8A 2K6WA 3DPBA 4WI3A 5AVSB 1G7HB 1G87A 3MOAH 4F2EA 3HBPA 1BIHA 5JW5B 3AAZA 5AW9B 3VXPA 1I3GH 4LRNH 3O6FC 4R2GD 1MRDH 4JE4B 3MLWL 1U6AL 5AFAA 3CN0A 5GIRB 3ROLB 4M1GL 1JNHA 3AXIA 2FQEA 4A63A 3H0TA 3GHBH 2SEBB 3OKKA 2DMCA 2WWMD 4LLMB 3GDCA 4ZMOA 3KHQA 3VFGH 3HC3L 2NMSA 4FZEH 4DN4L 4G59C 3MRNA 4CC0A 3V0JA 1AQKH 3MQIA 4PW9A 4ABVA 5IV2B 3EJTA 5C0IB 4BFIB 2DJMA 3VD2A 4G9FB 3BYYA 1ZSDA 3OHMB 3PHQA 3NSDA 3HKZA 5AVZB 4Z0XB 1SY6L 2DLFL 4BH8B 2ZXWB 3U7AA 5FUCE 2VE6B 5E2VH 4PJ9D 4RAHA 3FTWA 4OCXL 4DP0X 3WKYA 1EHNA 4FQXB 2NNAB 1CWVA 2NZ9D 3B34A 2YXFA 3DUSB 3LIZA 4XBGB 5GRJH 5K33A 3SD5A 4HPOL 3W2DH 1GGIL 5GSRA 1WA0X 4FULA 3I50H 4FLOA 5L7XH 3GSVB 2PXYD 3H4FA 5DR5L 5I75C 1CXHA 2HWZL 4KC3B 3WTVA 5D7EA 4DZ8B 1T7WA 2JELL 3C09C 3RL1B 4O2FB 5FPIA 4QHUA 4HSQA 4RZCB 3FQNB 4MA8L 1MCNA 2XZAL 4JRXB 4OZFH 1JRHL 2RACA 4FQCL 2CM5A 1ETA1 2EXYD 4L4VB 2NR6D 5DUPH 3EOAB 4EN3A 1AFVH 1QSFB 4HK3N 4IOFC 2F5AL 4N2MA 5C0CE 1QWUA 1WIPA 2P47B 3DBXB 5HSFA 5AUMA 4Y19E 2IFFL 1INDH 2PWFA 3C60B 2AXWA 2GTWA 1ETZA 1PSKH 5GGSA 5HGDA 5C6TH 3VFRB 2VXQH 3JZYA 4ALAC 5F8QC 1JXJA 5AEAA 2FJGA 5CWSA 2JK5B 1IIKA 1EEZB 3ULVL 4GRWE 1RZKL 5HGAA 2Y1AA 4GRLA 3L1EA 1XGUA 3WLBB 5A6MA 4MCZA 1KTCA 1ML0A 5DZLA 3RWJB 3VWJB 4Z8FL 3KVPA 1U3YA 3BIBX 3HC0A 4HJ1A 3ULUL 1OLZA 4HJEA 4FYTA 2H8PA 4AGNA 2FX9L 5HHVH 2J55A 4OCRH 4BK5A 4H5SA 3NGBB 1K6QL 1S5IH 2W9EH 4W9HC 4RMRA 3K4ZA 2JJTC 5G4OA 1RUKH 5K59F 4OCLC 4Y9BA 3RG1C 5INDB 3EAKA 3SDXA 1F90L 3UBFA 4R0LC 2ODIA 5MEQB 3EH1A 3T77A 3UJIH 2AQPA 3VFNA 3WXVL 1R1CA 4P46C 2LE9A 2PO6A 1I7ZA 1WD9A 5HPMB 3S5LB 1QQDA 2E47A 2GTZA 3GLEA 3QR2A 4EOWH 2E3VA 4FXGC 3Q2WA 5F97E 4B0MM 3BP4A 3CMOL 5CJXC 1BWWA 4MLIA 3QYMA 1JIBA 2W65B 1J1PH 5KSAD 5I1HL 4IGBD 1YEJH 2Y1YA 1RV6X 4AQOA 3PL6B 4HKJA 3QWNA 3FSZA 3PWJB 2WZ0A 3G5YA 2P5WE 2PWEA 1QSZA 1FL5A 2WLJA 2EH8L 1FNEB 3ECBA 3LV3A 3M45A 3NJHA 3B2XA 3V52H 1LD9A 1XSOA 4XMUA 1LWHA 4J3XA 3S36H 4NRZB 2Y36L 3IF1B 3L6FB 2UVEA 3G5ZA 1PEWA 4WUUA 3PXHA 1UEYA 1CGYA 1IKFH 5IP4A 2XWJB 3QK0A 4XR8C 4OH2A 3FH7A 4ZUTB 5ANMB 2LV4A 5F0JB 1CF1A 1SVBA 2GVYA 3F5WB 4UQEA 4M7JH 4MNHA 5E8OA 5FDWB 3SE8H 3SY0A 2H0PA 1KWGA 4HZLB 2R2EA 4R5XA 1ZMYA 5B39B 1MCIA 4ZUWA 2Y7LA 1ZSHA 3LEXA 2UWEF 2CKBA 4U05A 2IIJA 5I71B 4NSKA 3K6DA 1ZVSB 3V6ZB 3L5HA 4Q9QH 1NA8A 1H9DA 4MBRA 4TVPE 4C57C 1I1AA 1W0WA 4X4MA 4ZFGH 5JNYB 5C08A 3VI4A 3QRFM 3PIQA 3QUZC 3JV6B 4NQDA 3QA3A 3QQ4A 4XO9A 3JWDH 3DROA 1TNNA 1Z5LB 3IJEA 3KLAA 3O41B 2ZSWA 5CU9A 3G6DH 3K91A 2Z7UA 2V2WA 3SCMD 5E7FA 4Z3HA 3KNBB 4PGEA 3GXIA 4X9FA 4PVLA 3MLTB 1FRGH 2APSA 4YSOA 3DRQA 1N2RA 5IREA 3HS8A 1S4IA 4HZAA 4P2OB 2C7UB 4WKXA 1L9QA 4XN8A 3V5KA 4XPBL 3HG1A 2IH9A 1WEJL 3CVHH 4HA1A 1JGVH 3D2TA 4O2EB 1M7XA 1NCWH 4PLJD 5KUKA 1P7KB 1MG2C 3T4YA 1CGWA 1IEBA 4XC1H 3G5VB 5FGSA 1UWEH 5CZXD 5TK4A 2DQUL 3BPLB 5LCVA 5GZND 1HT6A 4L3CA 4TQIA 4V1DB 3C8KB 2OQJA 3SPCA 4BFBD 2G5BB 2NUPA 1MNNA 1Y1DA 2WY3B 1D2PA 1QPPA 2ARWA 3WBDA 4E41B 4LBAA 1GXEA 1H15A 4CJ0A 4QIRA 3DO4A 3MUY1 1MF2L 3VFWB 2CUMA 1Q9KA 1OCWL 4KHTH 2XFGB 4A7GF 4X0KB 1LK2A 5CGYC 1HH9A 4ZUSB 2JFCA 4MD0A 4XP4H 2ZWKA 4YHNA 5GHWL 4FQIL 1CJYA 1GSMA 2DMKA 2DQJH 4P5KB 4S0TD 4M03A 4WI0B 3N06B 2R8SH 2ZP0T 1U92B 3DA0A 2XN9D 3MRHB 4NFDA 1SXAA 1FPTH 4KUZL 1ORSA 3VFVB 5BRZD 5DI8A 4LLYB 3O4LA 1QAWA 3SDXE 5C1MB 1V5JA 2J20A 3GSOA 1U3ZA 3LN4B 4DUWA 2Z0UA 4JZJC 1NL0H 3TS8A 2FNWA 2R1XB 1INEH 1MVUB 5I75B 3JUZA 4P23B 4U1JA 4W9IC 3GNMH 1QRNB 1X5HA 4ADJA 4KKLC 2DEYX 1UXWB 4LOFA 4XPTL 4M48H 3FO2B 2PPAA 4JY4A 1EJOH 3GMNB 4I48A 3P4MB 2NXYB 2VSCA 4YXKH 1PAMA 1I3GL 2E6PA 1PG7W 4JUSA 5TPWH 2NY2D 2NY1C 1I7TA 1CE1H 1HQ4A 1MRDL 2R0WL 1MCHA 2XPYA 3I6GB 2TAAA 3QEQA 4FFVD 4JDVA 3IGKA 4UOJA 2FBOJ 5JMOC 2EEAA 2HKHH 3QR1A 5EUKB 3KGUA 1U8KA 1XGTB 5EZJB 3WENA 5D7IB 2ZJSH 4WUUE 1F1AA 3HLKA 2F6AA 4Y4HA 5AD0A 2B7DT 4ZO6A 3P73B 3WDHA 1XMEB 4QXTB 1A22B 5CAYB 5DC0A 3TASA 1NFDA 2FEEL 3OJDA 3RFRA 3SJVE 4Z6AT 1CLOH 3VQMA 1IZJA 4Y7MA 3PU7A 5E2VL 3UROR 4JFHE 2CPCA 4NQQA 4FQQA 3DV4B 4OGZA 4PJDB 5DJ2A 3UTSB 2BVOA 1UA6L 4PJHA 1VFAB 4DUVA 2QFRA 4WEMB 2KMWA 1N0XH 1Z3GL 1KLUB 3TO4D 2IMMA 3L3OB 4Y1AB 4E36A 5GRJL 4ZO8A 1FZMA 2ZX6A 1IQDB 2VN7A 5AAWC 4FXGB 3QNZB 4ZFFA 2WWKT 3SKOA 3P40A 4B27A 3K5RA 4KKCC 4M7LT 2R27A 4OT1L 4AENA 5AW2B 4JZNB 3TF7C 4PJEB 5C08E 4DIXA 2GK0B 2UY6B 2YA2A 4ALAH 3AGVA 2MKWA 1H3XA 4NQDE 1DBML 4DTGH 2XBDA 3MJ9L 3VMNA 5E6SB 1HJCA 1M1XA 2DLEA 3APNA 5J5EA 4Y16B 3Q8FA 4KVNH 2DF3A 2X2UA 4HIIB 4RSVA 4WK4B 5FW7A 5KBDA 1ZA6B 3K6SA 1EGJL 4RGND 5FYLE 1BZQK 2AQNA 4OUUA 1INDL 1R5VB 4AIXA 2CU9A 5C6TL 1PSKL 4KFZC 4HK0A 2D7MA 5EBGA 2ZNWA 5T3XE 3IMBA 4L8BB 2VSKB 2VIRB 3HG1E 3ARDD 1T0MB 5A2FA 1SEQL 4HU2A 4NN6C 1XH1A 4XCFL 5CEZH 1T03H 4JFXA 2ICCA 3K6FA 2FR4B 4MMYA 3EO0B 2DKSA 5DEFB 1CYXA 3HB3C 4YX2H 5D7HA 1LWRA 3QI9B 4JGNA 4LSSL 3JWOC 4HHWA 1AHMA 4ZNEA 5FCUH 4UT7L 1MJUH 2OXGB 3BGMB 3F7YA 3DXAA 4GI6A 5FOJA 2HLAB 2ILLA 4OCRL 1O7DE 4PCTA 3F64A 3ESPA 1PX8A 4YBQD 3ZKXC 1S5IL 4EUPG 5T1KA 2JCCA 3U2SB 5B7EA 3CSFA 3MA7A 2QR0B 4XN4A 5GZOD 3P69A 1G9EA 1AQMA 1XDTT 2CO7B 1JXFA 3UJIL 2ID5A 4WTZG 3SBWA 2NY7L 5JLZB 1U8HB 2IH8A 3QIUD 4MYPA 5CILL 3D3VB 5DMYA 4MGXA 2Z0BA 4Z0BL 1CTNA 1P69B 1R17A 3W11D 3T65A 4JG1H 5FC9A 3UC0L 7PAZA 1GS6X 2FD6L 4D8OA 1AY1H 2D0FA 4Z7WA 4HF5H 3QUMB 1ZGLP 1F8TL 3D69A 3HBZA 5E95B 4EKJA 2Q7NA 3L8QA 4M7KH 3FULA 3ZT7A 1PQZA 1T6BX 3O4LE 1IM9B 4LEXH 2G60L 3UYRH 2D2CC 2XZQH 2CBPA 4LLVA 3SDDC 5DK2B 3DOHA 2NY5C 3PABB 1VB9A 4GAYB 4OU3A 3QDGB 3GXPA 3WMPA 2LU5A 3PQYD 5I0ZA 4U0RC 3IJ8A 5T3ZH 2ZICA 1F3DH 5ICYA 2B0SH 3FOLA 4U1NA 4K94L 4OGXL 3KCWA 2PXYB 5CGTA 3A21A 4M7JL 4R83A 2PW1B 4K7PX 2X4QA 3HOGA 1MFEH 1OAQH 1ND0A 2C4FU 4MMXB 1AJ7H 4OFVA 2BY0A 3QEQE 4PMFA 5EU7C 1N9PA 1RQ5A 3J8F7 3T0ED 3U4BH 4CNIB 4C47A 4B95C 15C8L 5A3IC 4B6ZA 4DFIA 2OL3A 2AP2A 2Q5BA 1XAUA 4P07A 1I8KB 2A1WL 4J1UB 3VRLF 3EO9L 5EBWA 5HHPA 1P7QD 3ARFD 4NNYB 1XF3A 4GAFB 3LRLA 1MWAA 1BM7A 5HI3D 3V4PH 4ANXA 4PHXA 4QWWC 5F3BA 4A2HA 3NJKA 2IOIA 1G0YR 2RIKA 3BHBA 4MA7H 3SODB 4N5UA 5K9KB 4FKKA 5J12C 1LDPH 3C2AL 5C09D 2ZYIA 4YWGH 5AOLA 4PJHE 1NLBH 3TZVC 4IRSC 3LX9A 4IOIA 4PLOB 3WS3A 3KXFA 4P9ML 4X5LA 3DOIA 5JHDA 2LU3A 1SMOA 3MCG1 3DTDA 2JKWA 5CEYB 1AZBA 1UZ6E 2NSXA 2WVSA 2EVIA 1W15A 1EZVX 1FBIL 1S7SA 2A4EA 5ERWA 1HQRA 35C8H 1CL7H 1JGVL 4K8RD 1M57B 3RGVA 1KLGA 5D7JD 5CIPH 5E9DD 4R4ND 3FF8A 4XC1L 2GI7A 1T66C 2Y6TE 5AW1B 4PY7B 1CQKA 3AXLA 4DJMA 1D7DA 1MCFA 4QRQA 1KWKA 5I0DA 3NDZE 3HVDA 2MTAA 1KYDA 2OTWA 3DVNA 1DTUA 5KSAB 3EJRA 4IGBB 5I1IL 2KS0A 4IU3B 4ENED 2J6EL 1D5XA 4TOYL 1IAKB 1T5WA 4XMWA 5DVMA 1HSAB 1MREL 3THMH 1ZXQA 5DUBB 1CI3M 3X11B 5HGHB 5AL8A 5BZWA 2HVKB 3LNIA 3ZUNC 3ZDXB 3S4SB 3V6OC 4EZMA 1OGAE 1G43A 4NQED 3RVWC 1AZVA 1FJ1B 4N90D 1X5MA 4KJWD 1M71B 2QHLA 4R7NB 1X5GA 4ODWB 4WHTA 1VFBB 3PWUB 3QJHB 3GXNA 2A9MH 1TZ8A 2BW5A 4I18B 4KY2A 5IQ9B 3O4OB 3E6FB 1BZ9A 2VRAA 5GRVL 1R0AL 4G6KH 3RWCB 2GITA 3RWIA 4CA4A 5EF0A 1DCLA 4OZGA 1NL0L 3QH3A 5EN3A 1INEL 2HFEA 3PWPE 4WW2C 4AEHL 3IJYA 1S8DB 5FO7A 5AZEH 4JPIB 2O30A 2OMWA 2ZSVB 4QUOA 1KIUB 1VFUA 1SJEB 3MRCB 2DWEA 4Z7WE 1UM4H 1DBKH 4R96A 3QXTA 4EQ3A 3H1ZA 1CGVA 3RU8H 5FYJL 3R0MA 5CD5D 1CE1L 5F88B 5DZPA 4RZKA 4AXWA 2HJLA 5ESAB 2ADFL 2XJKA 1T20A 2M26A 3GZPA 3L16A 3IXTA 4RMTA 5DZOA 1U33A 5F1OB 3F7VA 4QRTA 1EXUB 3NQIA 4YQXL 3SCMB 1IL1A 5FIEA 5JHLH 1TJGL 2EYSB 3TO2A 2PYFB 2CA4A 1G1CA 1QYGH 2GJZA 2ZJSL 3PE9A 2Z34A 5T1DL 4PG2C 2OMYA 4H20H 5AW7B 2DTML 3UO8B 3AWFA 2DAVA 3U36B 2ADGB 4HW6A 4CDGC 1JHKH 2ZONA 2OCFD 1BFVL 2OYMA 4LCIL 1HOCB 4OZHF 3LZNA 5AAMA 4CN4A 4CU6A 5I5RA 4LCWD 3WJLA 1OP9A 3TNNA 3X1NA 4C56B 1A02N 5I1GL 1F58L 1KELH 3RVXC 4Z78A 3BOVA 1DJXA 1YSOA 5HYJB 2IDTA 3JTSA 4Y4FD 5F0PB 2NYYD 4UZSA 1OPOA 3GM8A 3ILQD 5IF0A 1OB0A 1O6SA 3BVXA 2VQUA 4NKDB 2VM3A 4FRWA 1FN4A 3B9VA 4HQQL 1AKJD 3L3DB 2ZUVA 2OMBA 4H0HB 4XN7A 4I3RL 4C55A 4CC4A 1QP1A 4YFLI 4AVJA 1LO3H 1FV1A 4FLQA 5E03A 4MQSB 1N5AA 1KCVL 2J8OA 2R0KH 3KWWB 1ET5A 1FC2D 4JQIA 1R3JB 2F58L 5EWIL 3JWOH 5IFHL 4IJTA 4J4PD 4NUGH 5ADOH 1J9SA 2XN9B 1NCOA 1OIOA 2ATKA 3A23A 1JPTL 4U0RB 12E8H 3ARBD 3DRTA 1A47A 4X4XA 5D5ME 3UJJL 4Y0GA 4NP4H 4NN5B 2MCAA 4ABWA 1Y6KR 4F92B 4GT0A 1MLCA 2YSSB 5TE6L 1AAJA 5IB2B 3LRMA 3HZVA 4UILL 3AG4B 4MAYD 4YX2L 1GVIA 4N8PA 4X4ZA 4XMZA 3MLPA 3D4YA 3D09A 2AV1A 5F9JA 5L4MA 5F6IB 1E5BA 5DD0H 2P5ED 1NLDL 1YDPA 2UX6A 2OK0L 2Y06L 4IW4C 3V5HA 3ZL1A 2EIEA 2VRKA 1KXQE 4H1LA 4ZOEA 5DFVC 1MRFH 1U8LA 1OAYH 1VRSA 5DS8B 1TZIA 2K3HA 4MNQA 3RWDA 5L2JA 2BP3A 2XQYK 3AVEA 1XH3A 1XSKA 2Y6SD 3M86A 4WFGE 1KTLA 5TJWK 1JUFB 4UNUA 1YG9A 3S35H 4W9CC 5L4IA 2LHAA 3WMSA 2FZ3A 2QMJA 4JM2A 4KTDH 5IKCA 2NY5H 4R7LA 2FSEB 3D0VB 3CFTA 3CN3A 3IMVA 2V33A 2BNUB 2HYMA 2DWTA 5IHBA 1IC0A 3TZVB 2XBZA 5CP7B 1PMYA 1TVHA 3HE6A 5KJ4A 1E2WA 4M7KL 1VFOA 5B1KA 3EOYG 4LEXL 3P54A 2XZQL 4G8IB 4OZGE 4D9LH 1EAJA 3FQ1A 1IGIH 3WY1A 3GS7A 1PZ2A 1F1DA 1NC2A 1QG3A 2VUOA 4BXSV 5D1ZC 3TO4B 5T3ZL 7TAAA 2H6PB 4ZAKC 3NUKA 4G1EB 4L1TA 3V9FA 4PGBB 3EOBA 2XPGB 32C2A 4P2RD 4X6DA 3UYPA 3ETBJ 4HLZG 5E99H 3GSQA 3LPWA 4Z7UE 3ZY7A 4GSRA 3HE7C 4KMQA 5CLTA 5CSBA 2NDGA 1EFQA 3P3UA 4GG6F 2YR3A 4ZOAA 3D39B 2Q87A 4WGWB 2IG2H 3KPLB 4RMVA 5F3FA 3ABZA 1CCZA 3OC5A 1M56B 1YYML 2ADIA 3QUML 2R2HB 4RGNB 2CALA 5D7SL 1FSKC 5IFAH 3GSNH 3IN0A 1W6WA 3LRHA 3V95A 5IR1A 3NIDF 4FLRA 1J5OH 4P2QA 1KXTA 4W9FC 1NUGA 4KK6C 4QTIH 5GGRY 2VQ1B 5KBNC 7FABH 3ARXA 4RGMB 4UTCA 4Z5RB 2WBJD 4ZQKA 2IANB 5IB4B 3W81A 4FC3E 4JO3H 3MGOA 2JKTM 2VMFA 4YL4A 5C0BD 4R7XA 2ISDA 3DMMA 3BWUC 5AYQA 4JHUA 2P80A 4U33A 3C6LD 2CLZA 3BW9B 2F53B 2I07B 3HZMA 1LYQA 1ET7A 5DRWA 5TH2B 3NIGE 4MNGA 4ONFL 1CL7L 3OR7A 3BVNB 3SPHA 4A2DA 4J6RL 2NW3B 4OSUH 4P4RB 4CVXA 1FFNB 1BP3B 1ETB1 5HYSG 1Q90A 2DQGH 3JYCA 4XAKD 3CFKA 1WFIA 4G7RB 3CN4A 1HHHB 1CPUA 4Y5XA 4I9XA 4LP4A 2QHRH 4QTHA 2B08A 3O2WH 1NWPA 2DBLL 3TEYA 5HYEA 1U8QB 1SDDB 3CH1A 4CSZA 2FL5A 1JNLH 5AWNH 1XO8A 1GZQA 2WYIA 1R47A 4G6JH 2VDPB 3O3BA 4BRJA 5D7LA 5IMLB 1FI8C 3ARPA 3IFNL 4NO0A 1ASQA 1FZJB 2KPNA 1A6AB 1IGTB 1UGKA 2AJZB 2GFBA 1DL7H 3CSBA 3BP5A 4KQ3H 5J4MA 4TQEL 4YSTA 3PQYB 3ET9F 1CD8A 3H4HA 2VO5A 2YUZA 5LBSA 1G9NL 4TM9A 5LGHL 1CGSL 4PBVC 5C97A 1XX9C 3RA7H 3FUHA 2XX1A 1Z9NA 3K71B 3CUPB 1ID5I 2BOCB 3ZRSA 2WLYA 1TF4A 5I8EB 3C5ZA 2AJ3A 5EZOH 5L88H 4G8GB 5C0JA 1MHEA 5IWLA 1ZV9A 3VMPA 2DKUA 1C5BH 5I9QC 3QULB 4WI5A 1PY0A 2WZPA 3TBSA 3SHSA 1VJSA 3TU6A 2CNZA 2AITA 2WBXA 4CN6A 3QNYA 4LPCA 3G6AA 5A1AA 1LP9A 4XMLH 4I85A 3ARFB 4YXLL 1DBKL 4BQBA 2VITA 2ZOOA 1GH7A 3N42F 4V33A 5HJ3B 4HIPA 4U1KA 5HVGB 5MEPB 4KO5A 4PWIA 1QATA 3HNTH 4KTGA 2WQWA 4WJ5A 1NFIB 1HDMA 4JR9H 2C3WA 3SO3B 1Q0EA 3BKYL 4G6MH 1MHHB 4N22A 5C09B 4DCQB 2NDFA 4LSQH 5JHLL 3PV7A 4HHAB 4OM0L 2G30A 2YWYA 1L9NA 2R4RL 4UV4H 4G7YH 5JZ7D 4XBPB 4FQJH 3CZFA 3WJMA 4ATWA 3EGDA 3G5XB 3KYNA 4TTDD 5HDLA 1KJ3L 3F7PC 5T5NG 3KVQA 2YD1A 3IFPB 4X6DE 5HXMA 5KJRH 2VDRH 3ESOA 1KBKA 5EU4A 1N3NB 1OSPH 2X7LA 1A6WL 5E6UB 1UUSA 3MCYA 4Y5YB 3RDTD 2BIIA 3DO7A 5DHXB 4DPCX 1FDLL 3FQWB 4KK5C 1A1OB 4NJ9L 5E2UH 1CFNA 1RMFH 1WIUA 2F5BH 1BXUA 3KPOB 4GMTL 3V6FB 3E2HB 3MRPB 2BO0A 1NGZB 2WYTA 3DV6A 1BVKA 1FGNL 1I1RA 3Q5OA 3QFDA 2EDRA 5T33H 4Q8BA 4EQ2A 4ZZKA 2QV4A 4H4NA 5J8OA 3PHOA 4UANA 1HEZA 4L5FL 1KTKE 4HT1L 2OSXA 4LBEB 2R69H 4WWKD 3V5DB 1MCOL 4UOZA 4PJFB 1RZFL 1QLEH 3UH8A 4NQEB 1KBVA 4Q9CA 2A38A 3ULVF 2QVIA 1IGYA 1TXKA 1LHZA 1HHJA 1IKNA 3MR9B 4G7QB 1QI4A 2Y22A 2X2JA 4NUGL 4PGCA 5HHQB 5CF3A 2XZCL 12E8L 4ODSL 4A2FA 3ULUF 1VEOA 4NUJA 2YD3A 4ZMZA 4ZMQA 4MNGE 4N0YH 3HE7B 1RURL 3EGXB 4YXHL 4HJ0D 4DGUA 1E28A 3AS1A 2X4SB 1BREA 2JI2A 3SQOL 2FYYA 4BZ2L 4RFEB 3I6LD 3UJTH 3O6KH 5DD0L 2BSEA 1DSYA 3OXSA 3PWVA 5AW5B 1S2EA 3MLSH 1LO2L 5D4JA 3CBRA 5FUCC 2K9FB 3CBKB 3GRWA 1MRFL 1SJMA 2MKLC 1A8JH 3RFZB 1MCBA 5ALCH 5DGRA 1FH5L 3VX1A 3OMAB 3OF6D 1Y0LA 3VE0A 1X7TA 1ZY9A 4PJAF 4RMUA 3S35L 3STZB 3GTTA 4LSTH 2VISA 2CIIA 4AVKA 4KTDL 4LVOB 4NBXB 2ZP8A 4U1HA 3HHRB 3O9WC 3QUXD 4YDNA 5KW9L 2PNDA 2ZF9A 4FNTA 2IQAB 2H9GA 1XV8A 2I27N 3DTUB 3FL7A 3O8XD 4JL1A 4B9PA 5JXAH 3VQ1C 2B5IC 5DHVH 3QYNA 1UADC 2HUEA 4XP9H 2G0LA 3NIFF 1GCFA 4LDLB 4PG9B 2J4WL 4B50A 3MGAA 3GGWB 1KIRB 1F18A 5CGBA 1QZ1A 5DF0A 4M8QB 2BRRL 1UA3A 2O5ZH 1YN6A 4MX7B 1Z0NA 2CR6A 1EHLL 4BQ6A 3INUL 1A0QH 4NEHB 2VLME 4Y4FB 2HRPL 1A1MA 3MHZA 5CD3A 5DRNA 5EUOF 4JAMA 4UB0L 1AKJB 2BJML 3SDYL 4J27A 5I76B 3N1PC 5T5NF 43C9A 4Z76A 1HL5A 4WCYL 2H26A 2CBTA 2DW5A 1MH5B 3P30H 1KNOB 4PJIB 4IBTA 5KJ7E 3UZVB 1WHOA 3HPJA 1J8SA 1FL3A 5EEVA 4JFYB 5FYKU 1OOWA 4A7GA 3APDA 3QISA 2N01B 4OCWL 4JJ5B 3KYOB 2A74B 5IFAL 2XG5B 4IHOA 1C1EH 3KLQA 4HALA 1O75A 2YA1A 4OIIH 3GBML 2QADD 4NFCA 3L3KA 5FF6A 3UP1A 3X3GH 5CN3A 2Q7YA 5B8CA 3MLXL 3NJMA 4YHZH 5GS1A 2FGZA 2X5PA 1CZ8L 4XPFH 4NX0A 1JF1B 1YEWA 3EFFB 5K59E 4JO3L 3LNGA 3QZOA 3ZL4H 3CZGA 3WUWB 3VGEA 2OJZL 2W80C 2P5EB 5I9QB 1WV7T 3P0VL 1V27A 1LL1A 2OR9L 2OMTA 1HILA 2X4PA 4ZTPL 2VUKA 3NTCH 4H7VA 4L29A 4LKXB 4AC2A 4XB7A 3T3PB 3AJ7A 3NCJL 1S7WA 3ZJAA 5FB8B 5FK9B 3F7LA 2EUXA 1FFPA 4HYTB 1D6EB 2YZ8A 3EYSL 4TV3A 4OF5A 5DD3H 2TRHA 3ZVVA 2QT6A 3LOWA 5J1AB 1K4CB 3HI5H 4MXWH 3MV7B 1OW0A 2CK0H 1HXMB 5DEZA 3HMWH 3IJ7A 4A6YB 4ATTA 1PIFA 1TSHA 2QKSA 1PPIA 3WIFA 2JE8A 4GAJH 4LE8A 5HTSA 3GBEA 5JIDA 1AI1H 2JIXB 4JKPH 3FOMB 5DZ9A 5E8NB 4PRNB 1OHZA 1KUMA 2WGXA 5GQBA 3RIFK 3S48A 4DAGH 2YN5A 5C2BH 4HV8A 5C3LD 2EIZB 3CDGA 3A24A 3UPRB 1G0XA 5AG9A 4KQ3L 4NCC1 1KLFB 4CDHA 3WL9B 1ZE3C 2NT1A 3UG4A 2FJUB 2DQMA 1IBHA 2KQNA 2ED9A 3IMRA 1IZKA 3RA7L 1BIIA 2UWEE 4LP5A 2X89A 4Q89A 3ISYA 3V0EA 4G71B 4TUOB 3CFJB 1ZWIB 3DIFB 3NFPB 4FI8A 2OCCB 3HFFA 4H8WC 1P7HL 2EVGA 1X5YA 4H0LC 4HETA 3ROOB 1KIQA 1SPDA 2YPVH 1P1ZA 3T1FA 4OY9A 1R34A 1P2CB 1R5IB 1L4IA 3B8SA 4J12A 4HK3J 4X98B 3QWOA 2WXIA 1ECYA 2JWYA 1DVUA 4F7MB 2CLVA 4BUHA 5AW4B 2IDSA 1RZQA 3E8VA 4MJ5B 1FAIH 1NKRA 2EKSB 3S5LG 1IGML 4KKBC 2WBJB 1I31A 3M1CA 4S1DD 4M56A 4X7FC 4KI5E 2OV0A 3QIBD 4G6FB 2V8MA 4Z77A 3CX5K 1QWHA 4AH2B 2DD8L 1A8ZA 4PY8J 5DJCA 1FYTD 4OD1L 1TZHB 1JCVA 1FE8H 1GR7A 5EN2A 5E8PA 2VDRL 2Z8WC 3FFDA 4ORGB 1OSPL 1TZOA 4UZUA 2LTQC 5GGRA 1X7QA 2KLRA 4FF9A 3BUPA 4TS6A 4X7DC 2YRLA 4K3GA 43CAA 4TNWK 4LQ1A 4OGYH 1HZHL 2MPAH 2F5BL 4WTXA 4NB7A 1P9MA 1I4FA 3QZBA 2FH8A 3P4LA 2F9BT 2E27L 4J3OG 4QXUH 5T33L 3WD5H 4K3DH 3RTQA 1AR1D 4S1SH 1A5FL 1ZS2A 3H54A 2PMZA 4M5SA 3MRJA 5B39G 1Y6NR 3VTTA 3F65A 1T1ZB 3H9SE 4I4WB 2B5IB 1CGUA 3SSGA 4N1HB 1MW1A 5CMAA 5ESQA 3V8CA 3IYLW 3MRGB 5SX4I 4KJPD 3V0GA 3UABA 1L5GA 3V8OA 3OR6A 1F11B 4IU2A 4Z7VB 4AL8C 5CEZD 3TV3H 4UYQA 4ZW5A 3CIQA 1C5DA 5F1KC 3B2VL 4JPKH 4JHWL 5LG1A 5BVPL 4JM4H 1HWGB 1MRCL 3O45B 3L3IB 4WHYH 3MNZB 3PWNB 5LNEA 3TVMD 1D9KC 5FOBB 4ZUVA 1P6WA 1XWVA 3DJRA 1MKFA 4WFED 2GJJA 3GC3A 4Z95H 1ERNA 4TULH 1OE2A 4QMEA 3FU3A 4IRZA 1U8MB 2AV7B 1TQVA 3O6KL 3EFOB 1WUZA 2W0LA 3GJFH 1HYSD 1URIA 1R3KA 1O6VA 3BSHA 1EJ6A 2EH7H 2YGVA 4XXDA 1E4WL 1QKZH 3VG0L 1G4RA 2YA0A 3BVTA 4HDIB 4L23A 1CFBA 1PS3A 5ALCL 1DBBH 3PGFL 2F8OA 1DVXA 3L9RA 4I2XA 4JVUA 5DVOA 1EAPA 4LSTL 3S98A 1B9KA 2V9TA 3BFWA 1N67A 5KBKA 1OPGL 3NSXA 3VD9A 1AS7A 2B1AH 2YEVB 3JUYA 2XU9A 4YLCA 1ASOA 1D5MB 4GRWH 3CHPA 3NSYA 2EO9A 4N2IA 5CCHE 2VXUH 5J9PA 4E42A 1U4EA 3BWAA 2P5WB 1IQWH 4LNRB 1EJFA 4Y88A 5TQ0H 2C4FT 1KB9K 2XG4A 5CJOL 2Z92B 3RDTB 2YKKA 2HA1A 4QHKJ 3T8VA 1MSPA 1T6WA 4UIMA 4HUKB 5DZVA 4KVPA 1M6OA 2VT0A 1VHPA 4IIQB 2A83A 4TNGA 5IOKA 4R90L 3F7RA 3MC0A 3VXQA 3KG5A 3KPQB 1BQSA 2P45B 3B7RL 3LH2H 5T1LD 3ULSA 2N1KA 3QUZD 2OMZA 2Z35A 3I9GH 1WFTA 2HSIA 4XVTH 4CSTA 2YMTA 2XVLA 4BK4A 4GSUA 4OZFB 2WBKA 5IB3B 2B59B 1AGCA 2V7HA 1ADWA 2A6JB 3FRPB 2CZNA 1CD0A 4G42A 5E24E 1JPFA 3IFOA 2W0KA 4L8CB 3NEEA 3ATEA 4WWKB 5GS3A 3NVQA 1O7DC 4NP9A 1PAZA 4PWKA 1IEAB 4NDMA 3QP3A 4NQSB 3X12A 3HHSB 3QDAA 2R7EB 1MCLA 3AW5A 2ZZUT 4MRCA 1WICA 4FN0A 3IGUA 4EUPA 1NGWB 4FG2A 3EBIA 2IWKA 4NGHL 4YAQB 4BDVB 3BQUD 2GTQA 5I73C 1I3UA 4OIIL 4YSRA 4CGUB 1M9SA 4WTZA 1YEKH 3V9EA 4DGYL 3I85A 1EUTA 1ZEAL 2DLHA 3CFUA 4I0PC 1KJVB 4J3OF 4GKSB 2BX5A 4XPFL 1MI5D 3OKDB 4HOWA 3FO1B 5DZJA 3AZUA 1J0KA 1OGTA 1PNCA 5GRUH 5C9JA 1PLGH 3ZL4L 3D7PA 2HG0A 1QBMH 2H7WA 4TLKA 2HXAA 3RBSA 1B0WA 1I7UB 3QQ3B 2JB6B 3F12A 5HY9A 4NQCA 1OP3K 3CSPA 3WXWH 5SV4A 3CQPA 3O2DL 1WYJA 5B4MC 1MQ8A 4Q56A 2X4UB 4DP9X 4QRRD 2ESVA 3NTCL 2WSDA 4UQDA 1F3DJ 4M6NH 4X7SL 1WFMA 1BZEA 1C8QA 1JV5A 2WXKA 4HS6A 4GUOA 2PCXA 2Y3NA 3G9VA 5IVOA 1N6QL 2ATPB 3HZYB 4L3EA 4MQXD 2RFXB 3CHXA 4JNXA 2NTFA 4JY6A 4MXWL 1KN2H 1FNFA 2X42A 5A2KH 4BSJA 4YDIL 1BBJB 5BMFH 3MROA 3DURB 2I9LA 3QUXB 3P2DA 1S3KL 2QKIB 5FGBC 2OMUA 1JPEA 4GAJL 1AI1L 2BZCA 3AWEA 4JKPL 1AGEA 4ZMLA 1SZNA 4M8VA 2IH3A 5IEHA 2ICWB 4DAGL 2YS4A 1ZT7A 2ZKMX 1OTSC 3MLYH 4LMQI 4BFEA 3T8XA 3LIZH 2GCYB 1HHGB 1D7FA 2VMEA 4JG9A 3QUKB 4L4TB 4Z9KB 2XHNA 3CGTA 2UZYA 2CO2A 4OZHA 5KN5B 5I8CB 4UINL 3WTSA 2R23B 4K9EC 4KKQA 4BFRA 3S3BB 4GKNB 5L2KA 5GJSL 2X3CA 5A16B 1SM3H 3B3BA 5EU6E 1CDUA 3GKZA 3BUYA 1KDJA 1WCQA 3VRLE 3ZTDC 3VXRD 4OLUH 5CR1A 4I2XE 1HL8A 1MHCB 3ZIYA 2F54A 1TVDA 2IV9A 2B3IA 3KJ6L 2DV6A 3GKWH 3NH7L 1E7VA 4MDRA 2UXFA 2BWIA 1IO4C 4NZFA 1EWHA 2UXTA 5ESVB 3WFEL 5AB2A 5DTFB 3GBNH 2QGDA 5EF3A 4P04A 3LD8C 4Z7NB 2G3XA 1NMCB 1KXHA 4N24A 5BRQA 2QADB 4LT7A 4NQXA 5DJ6A 1N26A 2Z7YA 3UG5A 1N64H 1ZVNA 3DI3B 5E2JA 3QYCA 1F3JA 4ACTA 4OIFA 1D9KB 4LVEA 4LZKA 5EBLA 3C6EA 1TJHH 5KANG 3CXHK 1K5NB 3BVDB 1BSIA 2WXMA 3B2UC 3LKSB 1HWHB 2D03H 1KCUL 3LPGA 3FFOA 2COVD 5I6PA 2FJHA 5FKAB 4HFWB 4KTEL 4O02B 2Z91B 3SJVB 2EADA 4D7PA 2YOAA 2CDFA 4ZFOA 3CFEB 3GSUB 1DN0B 4LVNC 5K9JL 1THCA 4AK1A 3BP6B 3LS4H 2QBWA 1SOXA 4X5WB 1CQYA 2GAZA 3G5WA 4G5ZL 5KSUB 1A7QL 2FO4A 4A04A 4PJGB 2NUTA 1EJ8A 2MPAL 2F7PA 3I75A 2MNJB 3U9PL 3OQRA 3FQRB 3CZLA 3KW7A 5HHNB 5D7IF 4P2YA 5EC2B 4GEJA 3SBWC 1IVLA 5TD4A 3QO1A 2MMXA 1S5HA 1DQDH 5HYQB 4O51B 3IKCA 4ZUUA 1Z9LA 4WTWA 1UC6A 3O3DB 3F6IA 1L9SA 3MRIB 2BS9A 1P5UC 2UY7B 4PJ5E 4PJDF 5G2NA 3S3DB 3QZPA 5FUZH 3UACA 3MRBB 5CNHA 5E8DL 3REWB 5EFIB 3O0RH 3ENEA 3F6JA 5B38G 2ESVE 4NHUB 5D1QB 1LE5B 1DQIA 4UM9D 1T0OA 1PJWA 2F74A 2CKBH 2CQVA 3IWVA 2P8PA 2QVMA 1Q9LB 4PJEF 3D05A 1G7MA 1R3LA 4J3TA 4ZXBA 1FG2B 4N25A 5B1CA 3K4DA 2KL6A 3CK0L 3MRMB 1ASPA 4PYHA 1W0YT 3LKQB 5DT1L 4BKLB 2C4XA 3D5OF 2R0ZH 4XAWL 1LO0H 3VDBA 5AOZA 2EINB 1JGDB 5AB9A 2WJ5A 3RPIB 1QKZL 1WZLA 4TUKL 1X44A 1F00I 2CIKB 3KL3A 4N0UB 1DBBL 1Q0YL 5CS7A 2IOMA 3ARYA 3R18A 2OXHB 4F80A 4WAFA 2VDKH 4ONGH 2ED6A 4X6EB 3RI5F 3Q9QA 3TC9A 2ZWLT 3BN3B 1VEPA 4W68A 4I0PB 4PV9B 4YDMA 4MKTA 6TAAA 3QIBB 4OF0A 3GJFK 3U48A 1XR9B 2WYHA 3CN1A 3BEWB 2MHAA 4Y2DA 3MRDB 1ZT4A 5T3XH 1FYTB 5L2KE 2ZX9A 3QXWA 4AI7A 3T6ZA 2J25A 3BMWA 5C0AE 3VU2A 5TQ0L 5KSBB 4F37F 3IJHB 5M7QA 4NO3B 1IM3D 3DSNA 2XKSA 4RAVA 3S4SG 1F4WH 2VZ1A 1GTFA 1L6XA 3R06B 4AKOA 2ATAA 5LCVH 4HMCA 1WG3A 4L05A 3UEQA 2HRGA 1HH6B 1U8IB 4JLRA 4QRPA 4QWWD 2YPLE 2NY6D 2QDVA 2W0FB 1ZLVH 3PJSB 4UQ2A 1TEGA 2CSPA 3QEHA 3IGFA 1FYHB 3RGVC 5FHBH 3BX7C 3U25A 3FQ2A 1BF5A 1BG1A 1JRHI 3SGKA 5IJKA 1U8NB 4TNVK 3ALXA 3WS6A 4IKNA 1NGYB 3SDAD 2J8HA 4MA1B 1QHQA 1W6LA 2C3VA 4QXGH 1A9VA 2P26A 4HJJL 1AO7D 2CHDA 2RTTA 3TFKC 4M1DL 5I1AA 3FO9B 5IZ7A 3TVMB 3TV8A 3CLFH 4GS7B 4XP5L 3MXWH 2YD2A 4DT2A 4QOKE 4I89A 3IRCA 5F7EH 2G2PA 3FT3B 6FABL 5D71H 2WANA 3QCTL 3DUUA 3KWXA 3FBKA 3W0WD 3N0AA 4U6VH 1ANUA 3VI3E 3B9KD 1W2KT 3GSRB 3WXWL 3DX6A 2W38A 1IAIH 4P2AA 3L45A 2G2RB 4WNSA 3LKOA 5IHZB 5FO9B 2A7BA 2JVUA 3B9AA 1SN2A 1AHWC 3ETTA 5DFWH 1NMAH 5D55A 1Y18B 4P0DA 4LSRH 2ZIDA 5I18H 3KR3H 2IPUK 4LMQE 4LPXA 4OI7A 2VMDA 4MD5B 3QFJA 3D85D 3LAFA 3HS0B 4PRBA 4AGPA 1GYVA 3NJNA 2B15A 1EMTL 1KN2L 2WVVA 3C5SB 3MNWB 4CU7A 4GW5B 4PTTB 3P3TA 4TVPL 5D2NB 4Z1PA 2AEWA 2WUCH 1CXLA 1SY6A 3MJ7B 1J9CT 3Q05A 1A3LL 2Z64C 4K9JA 4WU5A 5MERB 4DPRA 4BINA 1JYWA 1ZCRA 1UWXH 1XH2A 2VAAB 1RXLA 4LSPH 4PP2B 4PRHD 4LIQH 1YNKH 3QDJA 2Q2EB 1ZDSA 3GFUA 2NY4D 4NQTA 2BSSA 4H8WL 1D5ZB 3B3IA 2H3NA 1G94A 4UU9B 5JW4N 4Y4KD 3NPSC 4GG6E 1IEHA 3BEVA 4DOHE 3A5VA 5DSCB 4PWFA 3BAXA 2XVGA 1T89C 1L0QA 1NC4A 2A77H 3EKCA 1JD9A 2J1YA 3NCBB 2NY3C 4MFHA 4XODA 3V7MA 4HULB 3EZ8A 3NIDE 5F9AC 1R9FA 3ZO9A 3RWFA 4GKZB 5IBLD 1LNUA 3T71A 3GKWL 4TQHA 3S88L 4CW1B 3V4PB 1PG7X 1NEZB 4XMKH 2X41A 1SEBB 3W56A 2ZX8A 1FVCA 3ZDXF 2FATL 1TZGH 3ABMB 1NCGA 5I0VA 2MCMA 4AWJC 1JWMB 2BNQB 1L9OA 2QQNL 5F2FA 3PXLA 4U1LB 4FP8H 5DHEA 5HHOD 5HYSA 4QJ4B 2PW2B 4PJ8A 3CU7A 1MI5B 3JZ7A 3TONA 3L7EB 4Q6IA 3IDYC 3FH8A 1I9JH 3NZHL 2Z65C 4AT6B 5T1MB 2H1LM 4QRPE 3DX1A 2VQTA 1YQ2A 2HJFB 4GQ9H 3H53A 4KOCA 4ZSOA 1DQQA 5I17B 1MJJB 2CXGA 4MVBC 1T0NA 3QIWA 1S9XB 1SDYA 3MODH 3SE4C 4HD5A 4MS8C 2P48B 1WS7A 3FU7A 1KEMH 4HBCL 3K0WA 5DK3A 3NCXA 3DX2A 3K3QA 5BV7H 4G43B 2FVNA 4OVVA 5L6YH 5D1XA 5IW1A 3X2QB 1CICB 4KQ0A 4PJAA 1HX0A 3UTPE 2AANA 3WSQL 2ORBL 4AL8L 1CT8B 1NMBH 1R24A 3ZRCC 6CGTA 3DJSA 4PIRF 4XCCL 2DQFA 2I26N 3KJ4C 1P6FA 4KKAD 2B2XH 1DQDL 3FUKA 2R1WB 4RAUA 4P5MB 3EG9A 3FCTA 1J9TA 4HH9A 2EZ0D 2R2CA 3KCPA 3KH3A 1S6NA 2APVA 3QWRA 1RZGB 5AKTA 1L9RA 3AABA 5JIKA 3WELA 3A6CL 1HKLH 3MLZH 3FUEA 4NT6A 4K7FA 2BCMA 1Q94A 4OFIA 3FPYA 5BNXD 5D5MB 2I9TB 2DTSA 1B0GA 2XT1B 2Y7QB 1CFQA 3SZ6A 1Q9OB 4OD2A 4PB9L 3DETD 1N6UA 2FAUA 3VXRB 2OL3H 3STBA 2DL9A 3FT4A 4XP6L 5EUOA 2AERT 3QFJE 4N2KA 3JV4A 3H7LA 2VERA 3MXVL 3OPUA 3GPEA 5EEUA 4HXBH 1BWMA 3NG5A 4QLRA 4EIUA 1E43A 4G9DA 5FA4A 2HKFH 3MRRB 1YMMB 1DBJL 5E6IC 1LE9A 4YHMH 5DHYA 1ZANH 4L8SA 2VN6A 4AQEA 1RHHB 1RJZA 3VACA 3QHZH 2NOYA 4E9WA 5D1ZD 3N3EA 5FV2A 2H2SC 3COOA 1MJ8H 4KWUA 5FYLL 1J0HA 5BZDA 4TUUA 1G6VK 3L3HB 5FHAH 2ZXGA 3OKLB 1OM3L 3VW3H 5T3XL 3FS9A 3MGTB 4HJGA 5E7BA 2M8XA 4KY1H 2FEEI 2R83A 2VLRE 2EIBA 2E7CA 3D34A 3QEGH 5KVGE 5LAXA 3TGXA 5E2TH 4WF7A 5IUCA 3EJYD 5SV3A 4CKVX 2A73B 5E94B 5BJTA 4NO5A 3MVSA 5LQBL 1YEIH 4U6YA 4WFFE 1AHWB 2K78A 4Z7IA 3D4CA 2WVTA 2GHWB 4MWFB 3CSYA 3FONA 1NBCA 2PR9A 5EO9A 4TNFA 3H3PL 4NO2A 1E9PB 3SBPA 3FYEB 1M2OA 1VACA 1KPUA 4JW3A 1N4XH 1XAKA 3BAEH 5I16B 5I8KH 4Q74A 4HBQA 4Z7UB 2H32B 4FL4C 4W9ZA 1BVLB 4OGAD 3ULVE 5FHBL 1G7QB 3GMQB 4BZYA 4X9IA 1PFCA 4TSAL 2VLKD 2IXQA 3VWKC 3BMVA 4AMXA 5JPNA 3L1OH 3OKOB 1OAXH 4FQ1H 5SWSA 2C1OA 1MEXH 4Y5XC 4I9WD 4UTAL 3ULUE 3RAJH 5LGJB 4OBSA 3SOBL 3MV8A 4WIQA 1ZLVK 4B3VA 1ZTXH 5BXFA 1P5VA 1ITBB 1KB9J 2IAMA 3D2UB 4OLZL 4ZSOE 5EC1B 3MV9D 1YHPA 3F00A 4CN1A 3CLFL 1I8MA 2JJUA 2ITFA 3GK8H 3VXMD 4M5ZL 4UUJA 3LH8A 1IAOB 5I19L 2NY3B 1KFGA 5SWQA 1S7VB 3KL5A 4HFUL 4S1QH 2WV3A 3BD4A 3WLWC 4FEMA 1MIEH 2AGJH 4FA7B 2WTRA 1L6PA 2G9HA 4EI5C 4MMZA 3U0TB 5KVDH 5D1XE 4PJAE 3L3JB 2C1PA 2EUVA 1MFAH 4O58L 1IAIL 1H3GA 3NFNB 3AQZA 2NNRA 3QS3A 5D2LE 1PLCA 2E7MA 5I1EH 5AVXB 5CLWA 3ZLQC 4I77H 2B1HL 4FYRA 5I18L 3KR3L 4LQFL 1X6NA 1XGQB 3DX0A 3OZ9L 1DN2A 4KK8D 2V5TA 4L0ZA 5F8RC 4YZFF 3DC0A 3GXTA 3U0PA 3ARRA 2AI0L 3NIFE 4NKMB 5I6LA 4MJID 2RMNA 3QDME 3EFDL 2EUWA 1TQCC 1JZ2A 3BPCB 4A2LA 3FB5B 3GTNA 4K9EL 1BMGA 4HKXA 1NCJA 3QAZB 3L2NA 4MYWB 4WV1C 3QG7H 4GQQA 5C7XH 1J8HE 1SNRA 1TMQA 4B5EA 5HHXH 1YEFH 2CO6B 4HUCA 3NAAL 3O3EA 5EUOE 4ZW6A 1J12A 5JW5A 5IJBC 3U0WH 3JQOB 1TTUA 4LASH 1GGBL 4OM1L 1U3HD 2YK1L 4IBYA 4TKWA 2GT9B 2NY6B 3ATAA 5IQMA 1YAIA 3IAPA 4GYBA 3T3ME 5ISZD 1KULA 2O6CA 1MFBH 5GIRA 4O5LH 4U4IA 3ROLA 2CJTA 1HAUA 3MX0A 5CHNB 1UWXK 2YMXL 3MJ9A 3BDYH 1D5RA 1W0VB 4LLMA 4XE0A 3VDCA 5JXEA 2FWOB 3GYRA 3FQXA 1KCLA 2NX5D 3D51A 5A2JH 5IV2A 1A7RH 4XNXH 1GHFH 4BFIA 5C0IA 1EGJA 3R4RA 4G9FA 4ELME 4RISH 4LL9A 2ZYSA 5ITFB 1AYOA 4WU7B 4KK9C 4Z0XA 5AAPA 5EOTB 1MIML 2YEZB 4OLYL 2Y07H 2MFNA 1AO7B 1KEGH 2A9NL 1AGDB 2XRAH 3NEOA 2BP8B 3PNWB 3X1GA 1T22B 3CXFA 4AUUA 1C8PA 3OLDA 1AOHA 2BNRA 3MLVH 2IWFA 3OZLA 4FQXA 5B21A 3DUSA 2W95A 2FX7L 2GSMB 3MNVB 3TEXA 3TOPA 2ZOUA 3IN2A 3HN5A 3GSVA 3LHPL 3O6LH 4H1LH 2Y0SA 3VFTB 4YFEA 3PY9A 4FMKA 3T2PA 1JGUH 4NJAH 5D93B 3P2BA 3QCUH 1A14L 4JN2B 4I3SH 5F7FA 1RH8A 3SKNB 3ZXAC 3B9KB 3RL1A 3OGOE 4WWPA 3GUTB 4O2FA 4AG4H 3QUYB 2F1EA 5AB0A 3J7HA 4WENB 4RZCA 4JGUA 2YBRB 3FQNA 1R3IH 4WW1B 5AZ2H 5KYYB 3ZBMA 4ZDHA 1KCKA 3CPLB 1J05B 4L4VA 3EOAA 1QSFA 3ECQA 2A99A 4TN9A 5SWSE 3IBOA 1AXTH 2W91A 3DBXA 3VFUA 1L0PA 1QBLH 3C60A 5F1NB 2VB5A 5CN2A 2ZPKH 1S78C 1QTYT 2VW4A 1U2CA 3LXCA 3VFRA 4NENB 3RIAK 3MZTA 2CDEB 1WRFA 2BERA 3S37H 5C6WH 1J9QA 1NDGB 2EECA 4CL7A 1FIEA 2JK5A 5IW3A 4DKFL 3VXSD 1XT5A 4P9HL 1NMBL 1F4XL 3GHEL 3L4TA 1A6PA 4EN2A 4RDQG 3WLBA 3CXHJ 4MB1A 3RWJA 1JYXA 3VWJA 2B2XL 5EZLA 3G08B 4PRHB 4UQ3B 2BP5M 2EABA 5DMGD 4HIXH 2NY4B 1T83C 1N5YH 4M93C 3WEBA 1RLBA 5HJBA 4Y4KB 1ROCA 1A4KB 2BVYA 2L0DA 5INDA 1J48A 3UOAB 1WO2A 3A67H 4XC3H 8FABB 3VD7A 4KI5C 5HPMA 3S5LA 2WUBH 3R1GH 4FL4B 1NCDL 5GSVB 1ZKAA 5DMJB 1RUMH 3ZE2B 2CCVA 5FYJU 2E7LC 2W65A 3WUWG 2Z7WA 1C08A 4LOUD 3FO0H 4MCMA 4YIQB 1E65A 3LN5B 4MCYB 2LFEA 4WI4A 1OCZB 3PL6A 5EEWA 4JO4H 4PJFF 2EDMA 3PWJA 2X1XR 4N0CD 5IB5B 4NKOB 3OB8A 4PPTA 1FNEA 4F33B 4AV4A 3IF1A 2XYCA 3L6FA 3H8NA 4K3HA 4WVRA 5CINL 3QHZL 1QNZH 2VLLA 3NACH 3UZEA 1LEKB 2BCKB 4A7UA 2XWJA 1E27A 2WB7A 3W39B 2OMVB 3TEUA 5ANMA 1BBDH 1FIGL 4XE5B 5FDWA 2Q3XA 3WHXA 3G04B 2CRYA 4BRVA 5B8CC 4KY1L 5B39A 4XHJD 1A66A 5DJXA 4EI5B 3CSTA 4E9TA 1T7XA 2J43A 3EOTL 3EJZD 3OAUH 4IBQA 3KBEA 4KZEL 3VQLA 3BD5A 4NZUL 2CMRH 4XVUD 3GIVB 5TDPA 1S3RA 1A7NH 2H3KA 2X44D 2DIJA 4HWZB 5F9WB 4AYSA 1PX3A 3QO0A 4G9FE 5KUMA 2Y1VA 5JNYA 3RTLA 1WBYB 4PLKC 5DC4B 4KAQH 1ZK9A 3JV6A 2J6EA 4MQTB 1LQSR 3UTTD 4HU8A 1Z5LA 2Q20A 3O41A 5FFOA 1QW9A 3QPKA 1I9EA 3BPOB 4FG6D 1MDTA 8PAZA 1JCKA 3FTXA 4AEIH 4LGRB 4E5XB 2PCFB 4QRUB 1OAXL 4FQ1L 5KTEH 4M3JA 4UT6A 1RUQH 1IBFA 1MEXL 3MLTA 4BFKA 5LBSH 3ZDZF 5I1JH 3L5JA 1U42A 2NYZA 1ZHBB 2E56A 1AGBA 1W91A 2WKGA 4YSUA 4P2OA 5KVFE 3VRJA 1CLYH 1HIML 2VLJE 1JSYA 3ARZA 3O6FA 1OTUC 4O2EA 3KGSA 1IUZA 1P7KA