4AZUA

Crystal structure analysis of oxidized pseudomonas aeruginosa azurin at ph 5.5 and ph 9.0. a ph-induced conformational transition involves a peptide bond flip
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure analysis of oxidized Pseudomonas aeruginosa azurin at pH 5.5 and pH 9.0. A pH-induced conformational transition involves a peptide bond flip.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport(copper binding)
molecule keywords AZURIN
total genus 31
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1993-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4azuA00
2AFNA 2WO3B 1JVOA 2YAEA 3TBBA 5A7EA 2MTAA 2HLEB 4YSEA 1ADWA 2VW7A 2YXVA 2J57A 3FQYA 2BWIA 1AZNA 2Y1AA 2EIKB 2IDTA 2ZONA 3X1FA 3X1GA 1KCWA 3SQRA 3UAEA 3ZBMA 3ABLB 3ABGA 5I6PA 3OMIB 3QJQB 3SBRA 1IUZA 2A3TA 2NRDA 1PZBA 1KDIA 3T6XA 1JZJA 3QJRB 3MBWB 2IDFA 2Q9OA 4DPAX 1GY1A 4G7RB 4DP2X 4YSDA 2GHZA 4HIPA 1PAZA 2CCWA 3NJGA 1KCBA 2PPCA 5I6OA 3GXUB 2H47C 2AZAA 4QKTA 4F7KA 1SFHA 1YLBB 3TU6A 1IBYA 3CG8A 5ANHA 2FT6A 3FYEB 2FTAA 3FYIB 1AZRA 1BYPA 3AG3B 3NP4A 4G70B 1L9SA 5B1BB 3FSAA 4AKQA 1OCOB 3GYRA 2IH9A 1T5KA 1AS6A 5I6LA 1AZBA 1OCZB 2PP7A 4KOBA 1F56A 2FWLB 2IH8A 2IDSA 4A2GA 4BDVB 4A68A 4N4YB 2H5UA 1ZIBA 3FU9A 2B3IA 3NSYA 2FNWA 2PCFA 3NJHA 1BQRA 1ET5A 4M3HA 2DY2A 1PNDA 1GSKA 2XU9A 2BWDA 1SNRA 3NT0A 5I5IA 1MDAA 1OOWA 2GI0A 1JZHA 4HCGA 1IBZA 3AG2B 3HB3B 1AOZA 1EZLA 2PPAA 3T71A 1ASQA 4HHGA 4DPCX 2PCYA 3H56A 1V55B 5PCYA 4DP0X 2UX6A 3EF4A 3IN2A 4UANA 2QT6A 3WKPA 1OE2A 4FAAB 1WA0X 4YSRA 5F7AA 1BXUA 2IAAC 1JERA 2CALA 1VLXA 1IKOP 2PP9A 3FPXA 3NSDA 3X1BA 3ASNB 1V10A 1WA1X 4M4RB 1WS7A 4E9WA 2YAFA 2DWSA 3L45A 4K9JA 2W88A 4DP8X 5B7MA 1WA2X 3FSVA 3PAVA 1QLEB 5I6MA 4HCIA 4KO5A 5I6NA 1QHQA 1AG6A 5I28A 3FPYA 2CUAA 5B1KA 2XVBA 3U25A 5B1AB 2UXFA 4BXVA 2QDVA 2BW4A 4BWUA 1WS8A 2BZ7A 2VM4A 1MZYA 1X9RA 4GXFA 5E9NA 3TBCA 4CSPA 1X9UA 3OM3B 2HRHA 4NAJA 5B1JA 2IWFA 3OMNB 1J9RA 1PLBA 2XWZA 4G7QB 3QJUB 3KW7A 1E67A 2FQEA 1NIBA 2GC4C 4DP9X 1AZUA 3UGEA 4HCFA 5TK2A 1AACA 1CUOA 3DKHA 4DP1X 3AG1B 1HAUA 4GYBA 1CYWA 3JT2A 1JXGA 2PPFA 1ID2A 2FQGA 3WNIA 3T9WA 5TK4A 2W8CA 4GP5B 2DV6A 2ZOOA 4AZUA 3ZDWA 3EH5B 3ZX1A 5B7FA 1TU2A 4A2EA 2GC7C 1KBVA 2XV0A 3G5WA 1ET8A 5B3SB 4E9TA 1SFDA 4E9QA 2EILB 1BAWA 1SHWA 1TKWA 2CAKA 1SF3A 3N55A 3ASOB 9PCYA 1SF5A 5AKRA 1ASOA 2YAQA 3NSFA 4UAHA 1BXAA 5B7EA 4AX3A 3UABA 3S8GB 2VSMB 1J9QA 3ABMB 2XYBA 3PAUA 4HALA 2Y69B 4DP7X 2YAPA 4KNUA 1A3ZA 1FWXA 1NICA 1ZPUA 4NB7A 2XV3A 1HFUA 2XX1A 3RYMA 1BQKA 3PXLA 1FFTB 4HHWA 1CURA 4MFHA 4YSAA 1XB6A 4JKNA 4Q8BA 1A4CA 1HAWA 2JKWA 3ABKB 2XXFA 1SJMA 4G71B 1E30A 2BO0A 1MG3C 1UATA 3EH4B 2N0MA 4L0PB 4KNTA 1NTDA 1BQ5A 2Q5BA 1OCRB 4YSCA 1MZZA 2AZUA 1PF3A 3T6WA 2B08A 3NJLA 1M56B 2OJ1A 3FU7B 3S3BB 2UX7A 2VM3A 2GBAA 4GP8B 1A8ZA 3FQ2A 4YSPA 2QDWA 4JHUA 1SDDB 4AI7A 3TA4D 1MG2C 5B1JC 1L9PA 3FSWA 1NPJA 2RACA 1ZDQA 2CJ3A 4KO6A 1IC0A 2J55A 1JZEA 5AFAA 4HZ1A 2E86A 4E9VA 1ETJA 4A2FA 1XB8A 1ZDSA 1DYZA 1R1CA 4NERA 4AKPA 2I85A 2BHFA 3X1EA 4ZK8A 4PAZA 3PPSA 1JZFA 2YAMA 1N68A 4FA7B 4E9SA 1PLAA 4HAKA 3CDZB 1OCCB 3JTBA 4YSQA 1URIA 3C75A 5I6KA 1ILSA 3FU7A 3MX0B 3PLYA 4E9YA 5LDUA 1NZRA 3FQ1A 3QJTB 2WO2B 1AANA 1PLCA 2R7EB 3H4HA 3BVDB 2HZHA 2YARA 4BK5C 1J5DA 7PCYA 3AZUA 3S8FB 1OV8A 1J9SA 5EHFA 1JXDA 2FQFA 2I7OA 2IDUA 2AVFA 3WG7B 4CSZA 2JFCA 2BP8B 3CVDA 1I53A 3EH3B 3AG4B 2VW6A 4UF7C 2TSBA 4W9ZA 2LLNA 5D4HA 4P5SA 3UAAA 1CC3A 4G72B 4YVUA 2QPDB 3CDZA 2GB2A 1NWOA 3IEAA 2BZCA 1RZPA 1KBWA 2R7EA 1JZIA 3QQXA 3NJKA 2VMJA 4BXSV 3H4FA 4PCYA 3WI9A 3NJFA 2YAHA 4AKOA 1AAJA 2QPEB 3SBQA 4BDVA 8PAZA 3UACA 1GYCA 3OMAB 1B3IA 3IBOA 4QLWA 3QJVB 1GY2A 4TXVB 2WSDA 2UXGA 2BP8A 3T6VA 2EINB 2H3XC 1GR7A 2YAOA 2DWTA 2X88A 4G7SB 1XB3A 3IE9A 1AZCA 1JOIA 5F7BA 1CYXA 4P5RA 1W6LA 3OD3A 2IWEA 3TASA 1NIAA 1E65A 1NIEA 1GS7A 2ZWNA 2OCCB 2XLLA 3BQVA 7PAZA 3X2QB 4DPBX 3ERXA 4YSUA 1NDTA 1KYAA 2GSMB 2HX8A 1AS7A 4BWTA 2ZXWB 2X87A 1A65A 1NIFA 2BP0B 1AQ8A 1OE1A 2HXAA 1TEFA 2PPEA 4KOCA 1AR1B 2GIMA 4KO9A 3NYKA 3IN0A 2XUWA 3QPKA 4YVNA 3FS9A 4DP4X 1TEGA 2UXVA 3PAZA 2J5WA 1JXFA 1L9RA 5PAZA 3QJSB 3OQRA 3WNJA 1SHXA 2PLTA 2J56A 3FSZA 4N8UA 1L9OA 4ENZA 5IY5B 3KW8A 3FT0A 1NWPA 3DIVA 1A4AA 4YL4A 6PAZA 1BEXA 4WTQA 2PP8A 6PCYA 2XV2A 2HX7A 4DP6X 2YXWA 3NJMA 3WIAA 2VSKB 1GW0A 4KNSA 3CVCA 4JHVA 4Q89A 3AW5A 1L9QA 2HX9A 1AS8A 3NP3A 1E5ZA 2I7SA 2IDQA 1RKRA 2HRGA 1QNIA 1ZV2A 3NJNA 1PCSA 2OV0A 2XXGA 4KO7A 1ILUA 2YQBA 3S3DB 4BWWA 1RZQA 4A2HA 4RH4A 4X4KA 2UXTA 3V9CA 5D4IA 1JVLA 3S3CB 3V9EA 4WKXA 4YSOA 1M9WA 2EIJB 4GP4B 1AG0A 1L9TA 2EIMB 2VN3A 1M57B 1NINA 1KV7A 4A66A 3NJJA 2PPDA 1GS8A 4EF3A 4E9XA 1N70A 4E9RA 2FT7A 5D4JA 3CZUB 1XMEB 3UADA 3FU8A 1PY0A 1BXVA 4YSTA 2FQDA 4DP5X 1KDJA 1FA4A 2MRYA 2FJSA 4W1TA 2VW4A 1J9TA 3PCYA 1NIDA 2JXMA 1PNCA 1KGYE 1WAEA 1ASPA 2AANA 4A2DA 1OE3A 1ET7A 1V54B 3D12B 3DTUB 3NJIA 5I5MA 5I26A 3GDCA 1ZIAA 1PZCA 3WKQA 1J5CA 4F2EA 1OF0A 1W8EA 1PMYA 1BYOA 2BP0A 2P80A 4A67A 5I5JA 2CBPA 4F2FA 3ZIYA 3AY2A 1DZ0A 1AIZA 3SBPA 1PZAA 1SDDA 5FC9A 3X1NA 2DYSB 1JZGA 1E5YA 1EHKB 2XX0A 3N2JA 2TSAA 1RCYA 5AZUA 2FT8A 4YSSA 3EHBB 4GY4A 3HEIB 2IWKA 3CVBA 1A4BA 2BW5A 3T6ZA 2P80D 1NPNA 1GS6X 3NSCA 2DYRB 1W6WA
chains in the Genus database with same CATH superfamily
2NW2A 3Q5TA 2Z8SA 4JQXA 3BE1H 4D0DB 4PB0H 4OIBA 4LCCA 5KYWA 2ZXEB 5AOIA 3C2SA 5FFOA 5MERA 2CJUL 4JRXB 1A9EA 3D50A 1NUDA 1DQVA 1XD1A 1CR9L 2YQ3A 5DQJB 1S7TB 4BFJA 5EO1A 4HWEH 2IGFL 1IC5L 3QJQB 3L3HB 4MDIB 4LP5A 4P9MH 4EE2A 5BS0A 3I84A 3X3GH 2VXQL 1NKOA 3MBWB 1O0VA 4OFYA 3RL2B 4XB7A 1VB9A 4HD9A 1MI5A 2R29H 4OLWL 4KROC 4AW7A 1NAML 2J1XA 4JO4H 1XT5A 5G55A 5KVGE 4NNXB 1L7IH 4ZDHB 1MREL 4E41D 1K4DB 4QKTA 5K59F 2LLGA 1XH0A 1OAQL 2QVTA 3DLQR 1TCMA 1AZRA 1H6TA 3ZGHA 43CAB 2WMPA 1IBGH 4KTEL 4A6YB 4ZTOH 3OJDB 1AC0A 5D1ZD 3MCYA 4ONOA 4TMPA 1VGEH 3NRPA 2OXGB 5E08H 4DKEH 3VCLA 5EN2B 5EC2A 2AJXL 1AS6A 2CHDA 3CFCH 4PWFA 1V3JA 5J0BA 3ECQA 3Q8FA 4F37F 4N4YB 1KACB 3D39A 2MPAL 4P5TA 3TNMB 3ZK0A 3VD5A 2Z92A 5C2BL 3VI3E 4OGXL 4PJ8B 5GZOA 1KJ2B 1XTMA 3HW7A 1E6OH 2X38A 3CC5A 1MCNA 4X9HA 2W60A 1OP4A 4FG4A 2F1AA 3WNOA 1TTAA 1SXCA 4IU3A 3AG2B 1T22A 1QR1A 1KTBA 4CNIA 4Q2ZB 2V33A 1DDHB 3H9HA 1KENL 4Y16D 1OM3L 3RVWC 3VDBA 2D3JA 1I3UA 1OE2A 1ADQL 2OAAA 3R7RA 2YPVH 4LOUD 5EF3A 1JERA 3DO4A 4GMTH 3RGHA 4A7GA 3X1BA 4B9JA 5IJCC 2DIEA 1R3HB 4AG4L 1HTYA 1FNAA 4MJ6A 1ZHLA 3D25B 3VD7A 5HXMA 1LQSR 1BMWA 2Y36L 3L5XH 3G04A 4FYRA 4L8CB 5JOFA 1H19A 1RHHB 5HHMD 1M2OA 3VXMA 1CFSB 4AQEB 1H9DA 2UXFA 3GB7B 3LQZB 2BSTA 2OYPA 4YGVA 5EU6B 4EMZA 2BZ7A 3PJSA 1R5VB 2D0FA 4Y4KB 5E9DA 3O0RH 4RMUA 3T0EE 1AYRA 2ARJQ 1KSRA 1NMBH 2EDKA 2XN2A 3H9SB 3OAYK 2JCCA 3DOSB 2GC4C 2B1AH 2VLKB 2Z9TA 3UBXB 4APQB 2W91A 3TA3B 4DP9X 3E8UL 4UDUB 1VZIA 2BSDA 2GK0A 1NUFA 4XAKE 4GYBA 1NLBH 5C3TA 3RAJH 4X6CF 5DJYB 4W6WB 2VDKH 4U1JB 5JPNC 4KX8A 5H94B 5CCKL 4XX1E 3WXWH 3BSZH 2DLEA 3X14A 4XMPH 2X2JA 1HYRC 3FN0H 2ZUQC 1QSFA 1F3RB 1U8MA 2DH2A 5D2LE 4X99A 4G6JH 3GI9L 2P8PB 3MNWB 2R23A 4FNTA 5EPMB 2VSCA 1E8WA 3HNVL 1MUJB 3FO2A 4XPHL 5ESQA 1BMGA 3RAJL 5FF6A 2A83B 5IESH 4WJG3 3KLSA 1D5MA 2HRLA 3REWB 4N6QA 1E27B 4KKPA 1GGUA 4PP2B 2AMUA 4ANXA 3E9UA 1JK9B 4MFHA 5E6UB 5L9DH 4RVBA 3NACL 2ITCB 4N20A 3SGDH 4N0UE 5CJ8A 1J5OH 1BF2A 4H2AA 4ODSL 1UZ6F 2PETA 4EDXB 1PZSA 3VFNB 4LOUC 5C0CE 1O7DE 5F3HB 4BFFA 4WGWB 4KVPA 3W1ZA 3ZE1F 3DPDA 1MXDA 4WI9A 1RSFA 1KB9J 3IJ9A 2OZ4L 4RAUA 1YY8B 4JY5H 3S3BB 1AR1C 3ZTJG 3QNFA 4PJ6A 3UTTA 1OK0A 1VKXA 1UOLA 4OM1H 1FPTL 4KV5F 3MLUH 4H1LH 5FFGA 5JXED 3U0WL 5C9KA 5IKCA 1D5IH 4DZ8B 3GXIA 4F93B 4MAYB 5C0DA 4NDMA 4XC3H 5EUOA 4GXUN 5E8EA 1HX0A 1N5AB 1BJMA 1U9KA 3GS4A 4PR5B 3ESPA 2BC4A 4M61B 5F89A 4MQXD 3T2NL 4R97C 4ZOEA 1NCDL 5GIRA 4AEHH 4F8PA 4WGKA 3L3OB 3U82B 3BVXA 1BX2B 4YFLF 5IEHA 1MJ7H 2WSPA 3D51A 4WK0B 2G3NA 3CFMA 1X4ZA 5E4AA 1BCIA 1HSAB 3GMPB 3N06B 4UYQA 4ZS6D 1E2VA 4WUUD 3L7FB 1IBBA 2KZBA 4L1SA 4KMQA 4PRPB 2BSSA 1J86A 5C08B 5HI3C 4B5EA 5E2WH 3QWRA 5CLYA 2I27N 3FDWA 1EO7A 2BRRL 2NNRA 4Q58C 3WCYA 4Z6AT 2JMRA 1EAOA 5EEZA 1XL6A 3BZ5A 4P5MA 1UM5H 3BUIA 5F9OH 3SPVA 1F1GA 1ORSB 1BFOA 3CFTA 3H4HA 3BIBX 3OMZA 1NEUA 3QZLA 5HGHA 3TX4A 5KVDE 4HX1B 3TT3L 5EV7A 3U1QA 4WO0A 4TN9A 1SYVA 2UZIL 4WHDA 3P9MA 4PRHE 1GL4B 4MCZA 3HE7B 4TNGA 1MFDH 3S0PA 4M5TA 4M7LH 5FYJL 2F15A 2V2TB 3PGDB 2C4FT 4C57C 3ARZA 4W4OC 2I9TB 4CSZA 2ADFH 2WKOF 3MRMB 3RWCB 5IB2B 3AG4B 1D5BB 2DEYX 4KDWA 4QHMA 2TSBA 2IV8A 3SBWA 4CC4A 5SX4H 3IWUA 1L9NA 1HOEA 1WEJH 2WOBA 4PH8A 3W9EB 4IMKA 2X4UA 4EN2A 5T5FL 1BEYH 3KD4A 4OJYA 1RZPA 4WW2F 5FO9B 4J6RL 4L8SA 5DQDH 2UWEB 4PCYA 4ZMPA 1HH6B 4KKBD 2ADIA 1TENA 3LN4A 3BP5A 1S3RA 3DJSA 5LUMA 3UTZB 1OL0A 4DSYA 4GW5A 4P48A 1FV1B 4UZGA 3WUWA 3EYFA 1DCEA 1KJ2L 2GUOA 4XBMA 3HR6A 2KDYA 2IAMB 1WRFA 1WZMA 2IMNA 1OLLA 4X6DA 2GYSA 4QYAA 5KJRH 4HS3B 3I3BA 3FFCD 3SDCA 2EUVA 1U93A 4TSAH 1EJOL 3CWGA 3M1OA 1KV3A 2MKLC 3HHSA 4UQ9A 5F7UA 3LNHA 2PN5A 5J6HB 3OD3A 2IWEA 1ND0A 2FBOJ 4K7PX 4PG9A 5HYJE 2B7DT 1BOGB 1UD2A 4ZD3L 1XDTT 2GSMB 5I74C 1U95A 3VXTA 4N9GB 4J4PC 4LHUD 2BNQD 4UAOC 2YRLA 5AAWC 4CJ1A 3D07A 2WYTA 1BMZA 2YGNA 3QDME 1H15A 5ANMB 1HEJC 3O45B 3MLSH 3WIFB 4NWTH 3L8QA 3QQ9D 4APQC 3W3BA 4M03A 4YN3A 2YEVB 3PWLB 5D96C 1A3QA 1ZLEA 1TG8A 3LSOA 2ZIDA 2ZXGA 3BEWB 4CSSA 1BD2B 5A2AA 4PJIE 3BQUC 3N0AA 4TNVF 5EO0B 3AFLA 5C71A 4NZTL 4ZOBA 1HXYA 1Q72H 4J2XA 1V7ML 4NN5B 3US9A 3UTQA 4HXBH 1DVFA 4CL7A 1LK2A 3UZEA 3K5RA 1NLDL 2D03H 4ZNEA 3O6FD 3CFNA 4KRPB 2VITB 1CJYA 3NPSC 5EOCL 5D1XA 1COBA 4BFIB 3BRGC 4PCKA 5CJOH 1BFTA 3CVCA 2CO7A 1OF2A 2CHZA 1N5YH 2AABH 3IS0X 4HMCA 4NZRH 3QGVA 5DWPA 1TZIB 1T89C 4Z3JA 4GFXA 4GKZB 4MBRA 4NBZB 1CG9A 2V9TA 2F8OA 2P5ED 2DD8L 5ICUA 1P7QB 3BRFA 5DVMA 1JFQH 1F58L 5K9QG 1UWXK 3CU1A 4HIHB 1BA9A 1D6EB 4LARH 1ZA3A 2W9EH 2OS7A 4PEEA 2WQWA 4HK0A 1JGEA 3AC0A 3TBVB 1G94A 3WLWC 4RNRB 3Q2LA 1Q1JH 5F88A 2X2UA 3D69B 2NQDA 5DUJA 4WO4C 1P5UB 4P46A 3GMQA 2ADYA 3TJEL 5CJXC 3RVTD 3C12A 2ICES 3O2DL 4U3SB 5DLML 3C60A 4HETA 4IOIB 4GKNA 4K3JH 3NJJA 1G7MA 1KELL 2PPDA 1GS8A 3GSNL 4HUUA 3ZYIA 3ZU8A 4H8VA 4G43A 4P0DA 3GFUA 5D4JA 5DD5L 5JHAA 3CBKB 4UT6H 4XN4A 3Q6FB 4ZPTA 2WSKA 5G4MA 2FWOA 4JM0A 4M56A 1I9EA 5C0BA 5I5RA 5DO2D 1KGYE 3VFRA 5T8IA 3B2XA 2ZP9A 1S7SA 2FYYB 3GDCA 4AM0Q 1A02N 3FCSB 1ZWIB 1QI5A 3AAZB 3RFZA 2EACA 2P80A 4OIFA 4OBSA 3RI5F 4IK6A 3VXNB 1MFCL 2OXHA 2X4TB 4DKDC 4OAWB 1E4WH 2CDEA 4WI5A 4TRPH 4BQ6A 5CU5A 4HIQA 1IAOB 5ACMA 3RX5A 5DSCB 2PWEA 2F8VA 2GUYA 4JY5L 3SGJA 1AGFB 1RCYA 3BKCL 3GLEA 5JW3L 1QPKA 1BM3L 5C0EB 2J72A 3CVIL 1PU0A 3HCVB 3CMOL 3VFMB 3NEEA 4Y1AB 1RIHL 3EH2A 1ZANL 2JI2A 2QVKA 1U8OB 1SM3L 3OAZH 3QG7H 3QWOB 3CSYA 4M7ZB 4Q9BA 2X4PA 5HGGS 1SQMA 3ALWA 2O5NA 2VC2H 4P9HL 3BJLA 1WO2A 2BWIA 3MXWL 1HJCA 1J1XH 1IGFL 1M2VA 3S36X 3X1FA 4F27A 3ZE0F 1NCCL 1TEYA 2GHWB 1VFAA 3P9LA 4YHOL 2UUDK 3U9UA 1R0AL 3V7MA 4JFDA 2K7QA 4EUPA 4QLRA 1IUZA 1MAML 1YJDL 2WBWB 4XPHH 2VH5H 4GAFB 5E99L 4U31A 2IOOA 5IESL 1IC5H 5IQNA 2C3VA 3ULUH 3BD3A 4PRHD 4QHUB 3V6BR 2M26A 2R29A 1YQ2A 3QB7C 4F7PB 2LU4A 3T09A 4K23L 3P1VA 3VQ1C 2IADB 2VISB 2X7LB 4PIBA 2ZCHH 1UB6A 3VI4E 1ULVA 2YD6A 3UTSB 1G9EA 3W2DL 4UOW1 3TU6A 2JF1A 1BQHA 1FAIH 3OKKA 4JJ5A 4RZCA 4XXCC 1HZHL 2EDWA 3E3QC 3O2VL 1HXKA 4CSTA 1A7QL 1HYSD 5DR5H 2XBDA 3PNWA 1A66A 1MAMH 3IRZA 2OMUB 2PCXA 3U7YH 1DVYA 3B7YA 4N2NA 4TUUA 4WO4A 2FZ3B 4ONGL 3RE0A 1VGKA 1DN0B 4PJFE 2DQUL 2HT2D 5GGRB 5T3ZD 1MAJA 3B2MA 3TFBA 1KJ3L 1EEYA 5AOMA 4HF5L 3SYPA 3NRQA 3W81A 4NZFA 4NJAH 5A2JH 3KVDD 5L2KD 1ZT4A 1PDKA 4OBRA 5C70A 4NN5C 3NT0A 4HQQH 4A7UA 4HIJB 1OOWA 1QEWB 2BVPA 3WY1A 5HY9B 1N7MH 3FK3A 4A63A 2HLFD 3KWUA 4DPCX 4J39A 3V0HA 3H56A 2NY0C 5DS1A 3KPMA 2UWEF 2YMXL 4P4KD 1I8KB 1J9CT 2F61A 2CK2A 3HR5A 3DSFH 5DWUL 3R8BB 1YAIA 3E8VA 1RURL 3HUJA 1CFQB 2VL5A 2JWYA 1DEEB 3SDYH 1N0LA 3LRSA 5JXEA 3OZ9H 1AY1H 3ZKSD 4NRXB 1T0NA 5BRPA 1PG7W 1U3HB 4TNWK 4AYID 1LE5A 5D6CA 5JYMA 4LSRH 1XCQA 2L7QA 3D2UD 3WLBB 3B7TA 1OKEA 5K9JL 3WIFA 1Z9SA 2DWEA 2HFEA 4TQPA 4UT9H 3DIDA 3RI5K 4AENB 5KYYA 1E6OL 1A2YA 1FO0B 4MBOA 1MCEA 2AEPL 1LE9B 4FC3E 4UQ3B 4C56D 5DDHB 5CKGA 2BRQA 4F7TB 1VPOL 4R2GC 3ME0B 3EXJA 3D4GA 3GIVB 3MRFA 4YUEH 3KHQA 2H1PL 5I18L 2CRIA 3LN5B 1RSYA 2CZNA 1RERA 3OKDA 3PGFH 4Y2LA 5D7IA 5HHME 4X8CA 2OMYB 3GHBL 2CR0A 1L0YA 5IUSA 2EE0A 4DEWA 1YNKL 4PGBA 4DP1X 1NKGA 2NR6C 3LZQA 4X5LA 2DYPB 5ADOL 4ANUA 1JXGA 1PZDA 5JHDE 5CJXA 1BGXL 1S7QA 3WNIA 3SKOB 5F9DC 2ZWZA 4DCQB 4IK7A 3FTYA 1QA9B 5CWSB 2FHBA 1DQLL 1F5WA 1KGUA 3MV9D 1T5WA 2E9WA 5GQBA 3FB6A 3CU7A 3JWOC 3K2KA 5I66B 4MTMA 3ZDWA 4DHLA 1BBJA 4RQQB 5GZNA 4JZJA 1NC2D 4JAMB 3WKML 3KPTA 3LN4B 4P2RB 1N18A 2CU9A 3N6YA 3QUZA 5SWSB 1E4JA 3MVSA 2J1YA 1KTDB 4MZ2A 4NM4L 1YMMD 2X70B 4RA3A 4HD5A 2BVEA 4N5ED 3MFFB 2XZQH 2BIMA 1TQSA 3LRGA 3LD8C 3ZRSA 3MYJB 1CFQA 2CMRL 3H2PA 3HUJB 4WWKC 3D18A 4OIIH 1R19A 1XAUA 3OKNB 3W2DH 4ZODA 3NEXA 1A7PL 3VRJB 2XV6B 4PRNB 3ARED 3UYRH 4C47A 2ZCHL 2WANA 1KLGB 1HL9A 4DK5A 1B2WL 2HTKC 3N50A 4OJFL 1OIOA 2MNUA 4MCZB 3P9MB 3BWAB 4LFHG 9CGTA 4B60A 3LH2H 1CFBA 3N9GH 25C8H 2VQ1A 3TIDB 3HE6A 2JKJA 1A6ZA 1ZVNA 4ISVB 2CO4A 4JFSA 4AL8H 3NJLA 5JA8B 1R33A 4WFHD 1W16A 2EE6A 4JN2A 4M6AA 1T7WA 4O9HH 5IMMB 4X8JB 3VYPA 2GBAA 3QIWA 4DO4A 4AYGA 1N0XL 4IBVA 2G75B 4G80A 4ZX3A 3MRGA 1XX9C 2XZAH 2QPUA 3BFOA 1ZANH 4PLKC 5DC0A 1NPJA 4AE1A 4HISA 2R59A 3RWGB 2YKLH 4PVLA 4Y7OC 2ZNWA 4JQIL 4PLNC 2MH4A 4ZO6A 5GIRB 3F58L 4HZ1A 2GSIA 4AVHA 2RR3A 5E2VL 1ZDSA 3FUIA 3WEMA 4JK0D 5LAPA 2QGCA 3QZWG 3KGTA 4MZIA 4M93B 3L3GB 1CDJA 4UT9A 1OAYL 3C6LA 2GTZA 1U8IB 4TRPL 4RA0C 1GOFA 1Q1PA 4NQCB 4O02A 4F7PA 4E9SA 4BKLA 3HOGA 3G6JA 3KDMA 5CMAB 2C3VB 3GSWA 3C5SA 1KTJA 4GT0A 4I1NB 4OIIL 5SWZB 4KH9A 2VXQA 3BN9D 2FVNA 3ZHKA 2ICEC 4J6RH 3P3UA 1HSBB 2Y6SC 5GHWL 2X4RA 3CX5K 3BXNA 1J5DA 3U2SB 4EDXA 1OCWH 1IGYA 1MDTA 1J9SA 3AXLA 3MUJA 3N0PB 1A21A 1YEDB 3NFSL 4C56A 2VLJA 4YXLL 3V6FB 2EKJA 2ARJA 5I8CB 3ZT6A 2JB5H 2X4RB 3GQFA 3FB5B 4NN7B 2JFCA 3GRBA 3CVDA 1QP1A 4HC1H 4ELMA 1IO4C 1XFPA 2EXWD 1UT2A 1XIWD 2LLNA 2E0PA 1AGFA 1CE6B 3ZZ1A 5HGBB 3MR9B 1BGXH 4HDIB 4TTGA 1KGWA 4RGNB 2R7EA 1D2OA 1Z9LA 2R39A 1IAII 3IVKA 3ZDXB 4XAWH 3O9WB 3WN6A 4LLWB 1O75A 4AKOA 4D0BB 2Z8VC 3GUFA 2ZSWB 4PJ7B 1I7UB 4P23D 5C7XL 2F68X 4EIUA 3L2NA 3WY3A 1FGVH 2LTQB 1UZ8A 1NL0H 3AWEA 1GTFA 1RD6A 3CPUA 4XNZB 1BF5A 2IBZY 2DD8H 4LOEA 1RZ7H 2ZOWA 2W07B 4Z7UA 2CRZA 1E4KA 3AJ7A 3IE9A 3WIIH 5HJDA 4I2XB 4GQ9L 2ZWNA 3WTXA 1NIEA 5J11C 5EZPA 3HI1A 5EZLB 1ACYH 3BAXA 3P2DA 5HJ3A 4YSUA 5EU3B 2IPUK 2Y5TA 4ZUUA 2HRPL 2N59A 2D9CA 3TYFA 1KIPA 2JJVA 2VQ1B 3TIDA 2BP0B 3IE4A 3SDCD 2BSTB 4GO9A 2E7BA 3CMGA 4UTBH 1QPPA 3B3IB 4M02A 4RZKA 4AWJC 1BVNP 3RX7A 5L88L 5MEOB 1PYWB 3TM6A 3TEWA 3FS9A 2W38A 5IBLC 3EHBD 1MCCA 3PAZA 2DWXA 1O9VA 5JIQA 4HJ0D 2XWDA 4N0UB 2MCG1 2YN5A 3EO0B 4HIHA 3L4VA 1P7QD 2V3EA 3LPFA 2V5YA 4NJAL 4LP8A 3TGXA 5I15L 1L9OA 5EU5A 1P7QA 2FEDD 4G6AC 2EVJA 4GXVH 4C4KO 4EJ1C 1BEXA 1NCWL 2F2HA 2OMWA 2HX7A 5FR3A 5BZDB 3ETTA 4ZD3H 1ID5I 1QR1B 4JAMA 5JO5B 1EDHA 1KXVC 4OCRH 4Z77B 3R0MA 4HFUL 4RRPM 4Z7NE 2YFOA 2ZPKH 2HX9A 4EI6A 1OTUD 4PGEB 3NP3A 4HUXA 3S37X 2R4SH 4G1EB 5E1AB 3LH2L 3UBXI 4PJXF 1M7XA 1CTOA 1DVFB 4PYGA 3QXTA 1ZV2A 2OV0A 3EO1B 4LLQA 5F70A 5T3ZH 3VRLF 1UC6A 3KPLB 1JXKA 1Z9OA 4MA7H 4BWWA 4UQ2B 5SWQA 3WN5C 4ADJA 3RHWK 3QUGA 1Q0XL 4NQXA 3M1CA 3ILQC 2J8UB 4Y2OB 2P5EE 3E38A 3IVKB 4WIQA 1RI8A 1UEMA 5D70H 4JFZH 3KVPA 3HN3A 2DLTA 4LIQH 1GJIA 3AGWA 2BNQB 2JELH 5DJXA 3QHZH 3BW9A 2K8MA 1A2YB 1FO0A 3MRJA 3Q1SL 5CIPH 4WHTB 3VI4F 1FVCA 2XQ0A 5HI5D 3OKEA 3MV11 4OKDA 2C9XA 4BFGA 2WXNA 3HN8A 2WLIB 4HP5A 1XR8B 1KN4L 4U6HB 1XMEB 1YEGL 3MBWA 4WEBL 2DQGL 4MD4A 5IOKA 2FQDA 1FC1A 3MOBH 2WGXA 4XCFH 2X28A 1HSBA 4LPWA 1CF1A 4M93C 2ZX6A 2ZKXA 2F74B 1MWAH 3FT4B 4YDJB 4ELKB 3NJIA 1R5WA 3IKKA 3QUXC 4X9IA 1DBMH 5IQLA 3IK2A 3HG1A 2OJZL 4JFOB 4DFHA 3I50H 3WKQA 4IEFA 3ZDYF 1TTBA 1QEWA 3MRQA 1QBMH 5BZDA 5T3XL 3VTAA 5IB5A 1ZOXA 1AIZA 1BAFL 4FI8A 1PZAA 3BZFB 3CUPB 1WAAE 2R2BB 1A14H 1U8CB 2P7TA 3M86A 3OXRB 4GRWE 2XX0A 4ODWA 4HH9A 3T1FB 1T3FB 1DN0A 2E56A 4YK4B 3H9ZA 2X89A 1YJDC 5C0NC 2NUPA 4Y1SA 5E2UH 3QFJD 3RZCA 2ATKA 2P80D 2QLVB 4JFWA 2IPTH 4QRRE 5HJBA 4MB1A 3RGVC 3TBWB 3FN9A 3HG0A 4DZBB 1FE8L 2B59A 3OAUL 4I9XA 1AJ7H 1C5BL 3QXDB 4MD0A 5IGXL 1IIIA 1J18A 1G7JB 1W0WA 3ETSA 2VDMH 4XPGH 1JHKH 2G60L 2ZAHA 3A5VA 4TNVK 4U1GB 4BA0A 4N2EA 5DD6A 1QLFA 1WBXB 3RL1B 3QXDA 2EXSA 3T0WA 4XVJL 4J1UA 2CPCA 3R1GL 1JGDA 2IFGA 3PWVA 3FUEA 4PBXA 1KC5H 4QHUA 5E8DH 4K8RH 1UFGA 4PJDB 4G7RB 4G7YL 4DP2X 5DYOA 5BO0D 5LBVA 4YMPA 4LIQE 3U0TB 5BRZB 1WISA 3RZCB 2PPCA 2HT2C 1IV8A 1BD2E 4MAUL 2AZAA 3LJ3A 4Z78B 2JJSC 3ZDZF 5MENA 1UM6H 1GGCL 1IBYA 1EFXD 3ZE2F 3CG8A 4HHAA 5LWYH 2RFXA 1GZQA 3VB8A 2G2RA 2QKSA 3ZR5A 4BQ8A 1I8LC 3SJVA 4HK3J 1BYPA 1K5NA 3PL6B 4XNQA 2LVCA 4U3HA 4X8XA 2P7TB 1A6AB 3O2DA 1ZLUH 2I5YH 4OY9A 4KY2A 2GEQA 2CM5A 4ATTA 1N5YL 1A1OA 5SWSA 1DO6A 1ZLVH 3F5WB 1B6DA 5CINL 1F56A 2MCAA 3SKJH 3OPZH 3GMOB 4YDMA 1B4TA 2DKSA 8FABA 3L4XA 3UTTB 3FAWA 4A2GA 1JK8B 1JZ8A 2VXTL 1VRSA 5FV2A 4MA7L 4KTDL 3ZMEA 3UTPD 1IVLA 1R34A 1UQSA 2F74A 1JPEA 3L9BA 2C7UB 3F00A 1PNDA 3QNYB 1KEGH 2QBWA 2Y24A 4ZAKC 2IAMD 3LIZH 3WE6B 2YMOA 4OD2B 2I5YL 3NIGB 3HB3B 3F7PC 1GGBL 3S35X 5I1HH 3RUGF 5F6IB 2ZYRA 3T65B 3CLWA 1NCCH 5DFTA 4XRCA 3CUPA 2AEQH 1J1XL 1B0RA 1IGFH 1LL1A 4GSDH 4OKVA 5FYLH 5PCYA 5I17B 1WC7A 5BMFL 5IB3A 4WFGD 5DFAA 1H6FA 1JE6A 2GT9B 4F7TA 3EYVB 3KYMA 4ZAKB 3S4SG 1WA1X 1PZ2A 2NX5A 3QZMA 5E6IA 1U8KA 4Z0BH 1Z9SB 2DWEB 2HFEB 2W1NA 3QZWA 4RBPH 4K8RL 2GVYA 5FHBL 4LK4A 1ACZA 5EMYA 5E8DL 4F8OA 5C97A 4HCIA 1G5AA 1MEXH 1OSZB 3VFVB 4X4MA 2HFGL 1E8XA 3QFDB 4X4YB 5I1LA 3C2AL 1N2RB 2B16A 3V4PL 3WXVL 3MV9B 1QQDA 5CEZD 2DDQL 4CADB 3ASWA 1I3VA 3H3PL 4PJAE 5IBLD 4AJYV 1WS8A 4ERSL 1F11A 4IJ3B 3OKEB 4J23A 1WFMA 3TBCA 2YFNA 1MCKA 1X9UA 1MFCH 3J7HA 2X1WL 2IH3A 5E8NB 1EZVY 1PLBA 4NQUA 3VTTA 3WTWA 3UTPE 1P0SE 2L7UA 3IGUA 4GW4B 3IMVA 4FQ1H 1NFDF 3MJGX 4MQ7B 4AQ1C 4N2OA 3TA3A 2A9CA 3Q13A 5E6YA 3TO2A 4C55A 4YX2H 5D5MB 4O2FB 3WJJA 1TCRA 3RA7L 3D1MC 4IBUA 5C7ZA 3LB6C 3AU1B 5JIPA 4B96A 4RMVA 5GGTA 1KJMB 4J8RA 5DU7A 2FSEB 2RH0A 1CVSC 1E5UI 3H54A 3IDJB 2PCFB 3D52A 2ZOOA 4OGXH 4O2FA 1PJ9A 1UA6H 1EWHA 5HI3D 3EH5B 2A6KB 3ILDA 1XSOA 3IGKA 1CFSA 3M1BA 5IK3B 3BGMA 1CGVA 1FGVL 5T3XH 3VW3L 4FQCL 3LS5H 5DK3A 3AQDA 1XGYL 4L23A 5JUEL 3NQIA 5FYJH 1Y6KR 3H0TB 2BNRD 3D18B 3WL9A 1PZUB 5GXBB 1AKJD 4DKEL 3UTQB 1VSCA 2AEIT 3H6JA 4A55A 4YHZL 4Z7VA 4HALA 3R0NA 3EFOA 1XGZA 1DANT 4OZHE 1QBLL 4U33A 3PV7A 3MOBL 3VFWB 5I1AA 2XV3A 3ULVD 1HNGA 4QXTB 5FB8B 4S1DC 1WHPA 2W9EL 1L7IL 2KERA 3VB9A 1UACL 3PXJA 4P3CL 3F64A 1I9JL 1KJVA 32C2A 4HLZG 3BDBA 1CPUA 2H3NA 3EZJB 2GG1A 3KJ4B 2PUQT 2FIRT 1JPGA 5AW3B 5CCJA 2ESVA 4J3WA 4DKFL 1P5VA 4ZXBC 4IRJB 2ZJSL 3NVQA 1T2QL 3DV6A 4L8SC 4OQTA 4JO2H 3CFBA 1M2VB 4HWEL 3WKYA 2H2SD 1XF5A 3KL5A 2YGVA 1MIEL 3DXAA 4KFMA 5LCVL 4PJIF 4N0YL 3O41B 5CO1A 1CDCA 2K3HA 4N26A 1Q0XH 3RZWA 4CMMA 3P3RA 4LLWA 4XMUA 1SDDB 4OGAD 1UYWH 2VR4A 3TYFB 3ZO0A 2Z3FA 4L29B 5HJ3B 1EPFA 3MA9L 2IBBA 4I2XA 4FF9A 4AIEA 2VR6A 4JY6B 1FV1A 3HZ3A 2Y7OA 1GIGL 4H26A 4O51A 3H8NA 3I9IA 1TJIL 2GSGB 4E9VA 4ELME 1IAIL 3F5WA 4OLEA 3THMH 2DM3A 2JCWA 2NNAA 4Q6YA 3AABA 4UINH 2XKUA 1Y7VA 5ECJE 3VFUA 3ZKXB 3GJEA 3RPKA 2ARJB 1QFPA 2O5YL 2YUXA 3DETC 2ZCKL 1ACCA 1W0VA 3CFDB 1G4RA 2Z31A 3CDZB 2EDFA 1E28A 3ARDB 1MH5A 1URIA 4KQ3H 1SVCP 3VXUA 3PLYA 2VLLA 3RGVD 2NTFA 2FYYA 4H44C 3D3VB 3Q9PA 4AEIH 3NCMA 2BXZA 1PLCA 5CLXA 1XD0A 5GGSY 4AGNA 4NUQA 2OSLA 5HGDB 4Y2DB 5D2NB 3VXMD 2OL3A 4FEMA 3DV4B 3KEDA 4WQOA 4DK6A 1GGIH 1A6WH 2ENPA 4TSAL 4NQCA 1EJ8A 4O02B 2OA9A 1U2YA 1T20A 1GYVA 1XGRB 3EOBB 4JNXA 3O6FA 5E8OB 5MEND 1NC4D 2EDJA 3WFBH 2NY4C 4WI7A 5F2FA 4M7ZC 5GGRA 5ITFB 4G72B 1Q9OA 3F6LA 5LXVA 2M83A 5FUCE 3I75A 1JI1A 4NUPA 4P04A 3L7FA 3ECVA 1SJHB 3RNKB 4F92B 2MPVA 4LSQH 5HHVL 1IEBA 5F7LB 2ATKB 4G9FE 1OHZA 1S8DB 1ZE3C 3DTDA 3QC5X 4RDQG 4PJCE 2AAAA 2AGJL 2B14A 2ITDB 2XTJE 3BAWA 1UM6L 1NL0L 4JJ5B 4LESA 1ZTXE 5T1MA 2PTUA 4D9RD 2R0KH 1GY2A 3SPJA 1QKZH 3ZXAC 3JXAA 3S97C 4KXZH 1NBCA 2A9NL 3HC4L 4J3OC 4U7SA 3T6VA 4DOHE 4X6DE 4HV8A 3A6CH 4FRWA 3GWJA 4HJSA 5TTRA 1SUJA 2CGYA 4M48L 1DVSA 3IDYB 4M62H 5JW4N 4W9DC 3INUL 3U6RA 3ET9F 3TASA 1FN4B 4KK6D 3L5XL 7PAZA 3FONB 4FD0A 4WSKA 1DE4A 2ZF8A 4WUUE 4FQQB 4D9LL 4UIKL 3VGEA 2VLLB 3EJSA 4NENA 4AK2A 3UPRA 1THAA 1ICTA 3MSPA 2WN2A 1BZ8A 1AMYA 2GJ6B 3OAWA 3PP3H 3TBSA 3CZEA 2Z91A 2PPEA 4I87A 2CDFA 4G82A 4WKZA 3QCVH 2N3JA 2VZUA 4PGJA 3A67L 4BFEA 4EXKA 3RGVA 2NNAB 2LE9A 5EO9B 1LO5B 2XUWA 3GLDA 4YVNA 2ZXAA 3L1OH 4QGTA 4XWGL 5F7KC 1B0GB 2IALB 3H7LA 1A3RL 2G5UA 3UTSE 2E7LC 4PRHA 1DVFD 3PJNA 3B4NA 3FUHA 3OLEA 4GAJL 4GUOA 2F18A 1QA9A 4KI1A 1KB9K 2B5IC 4DKAA 2ZCLL 3NBNA 3KNBA 4I3SL 3SKUD 1WG3A 2OCFD 3GMNA 4R7NA 1HCVA 4TVSa 5DZVA 1A6TB 3LDBC 4LCUB 4OZIA 3KAAA 4U6VL 5JPMB 5FECA 5KBKA 2YA2A 3RDTA 3X14B 3B1UA 4Y4FB 4OCLC 3DV6B 3LQMA 4RGNC 1VA9A 4ZTOL 3BUPA 3TV3H 4PWHA 3QXAB 3MRFB 4S1QH 4AUUA 4Z3EA 2ESVB 5F97E 3TN0D 4B9IA 1BPVA 3QQ9C 2WCSA 3FAXA 4X6DB 4BZYA 4KO7A 3TVMA 1RIVH 3DJTA 1XCXA 3QEQE 1RZQA 5B8CC 2O6DA 3I2CH 4N8VA 3WELA 2DQUH 4XR8C 1XBDA 3OAYH 2R29L 2IGTA 3CFUA 2WP3T 2H6PB 2XZCH 4L8SB 5C0ND 2IOMA 4QXTA 5FB8A 5FCUL 5D6CB 3WSQH 4GRWH 1SN0A 4ZXBB 5HVFB 2WP3O 3DHPA 3KGRA 5FK9B 2R15A 4UV7L 3LB6D 1JHLL 3FQNA 5JPMA 4K5PA 3D0AA 1ORQB 4H0HB 1BREA 1S7XA 3BQUD 5INDB 5F1SA 4FYSA 5ILTL 5GS2D 4PJEF 1SBSH 3ZTCC 3KPMB 3UC0H 1RPUA 3GIVA 2F54B 2YC1A 2FT7A 2HKFL 1R3HA 1KIUA 3D9AL 3HLKA 4ZW6A 4NOBA 2WXKA 3DGGB 1ZLUK 3VE0B 4ELMF 4ZOAA 1B2YA 4PS3A 1JNNL 2AEWA 4L3ED 1J9TA 3IJ7A 3PCYA 1XR9A 2A9ML 4BSWA 2X0UA 3FH7A 4OQ1A 4Y4FD 1OSPL 1KB5B 4S1RH 3D12B 5IHUH 1MRCL 4QAMB 1KFGA 4P57A 3CZLA 3HI1B 3HS8A 4B9YA 3UGUA 1T22B 1OF2B 1J5CA 1RJLA 4OI7A 1R24B 1PX3A 5SX4I 1M7IB 4XNXH 2VTFA 4JG9A 3JV0A 5I5JA 4QRAA 3CSTA 5D1QB 3P4MA 4Y2DC 5D2NC 3SBPA 3VD9A 4G9DB 4MA3A 2F19H 1L7TL 3L4CA 3RUGE 2NY0D 3FL7A 2FDBP 2MCPH 1HXYB 3Q1EA 3R1GH 2XN9B 1HDMA 4XODA 5C92A 2QQLH 2VQ4A 2V9UA 3MUGA 3T2LA 2XPGA 4YSSA 3DJZA 4FG6C 5FGCB 4CVZA 5IW1A 3HEIB 3SIKA 4P2RE 2Y36H 1EXHA 2QELA 1YNKH 4U6YB 3ULUE 2ZKWA 4NDMB 5IBTL 1H5BB 5I82A 5GISH 1CZ8L 2KBGA 5AVSB 4X9GA 3B9EA 4F7KA 1DJSA 5J13C 3JTSB 1FE8H 1K3IA 3OAUH 4O02H 7FABL 3PWJB 5DURD 2X6MA 4GXUM 2F53E 5HHPA 4H7VA 1ADQH 1CL7I 1KNOB 2NCMA 4W70A 1HEHC 3WUWG 1AZNA 4E42B 3US0A 5E8NA 3TBYA 12E8L 5L4FA 4OZHF 3SQRA 4UDTB 2A9AA 5FOBB 1WSST 1B0RB 5FCSH 3AU0A 2ICEA 2OYMA 2PXYD 3CXDL 4NSKA 5CXPA 4TVPD 2D7PA 3SBRA 1RUPH 1ND0B 1JGVH 5JQIB 5F7YC 1ZGLM 4JZOA 1J5HA 2MOGA 1C12B 3BDYL 2A77L 3L95A 3VGDA 1X4XA 1R17A 3LPOA 3U2SA 1HHKA 4I5BB 3AQYA 3DUSB 3E0GA 3QFDA 1AY1L 3VU1A 4LSSH 4KUZL 1NC4A 1CB4A 1DVXA 3B5HA 3MCLH 3APDA 4MJ2A 4XB8A 2AJSL 2A99A 2Q3XA 1YLBB 2G4GA 3CQQA 1YPZA 4PW4A 3VFPB 3CNKA 4UQEA 1MFNA 4FL4C 4Z7VE 2DTSA 2BXYA 3O2DH 5DLMH 3IS1X 1DBML 4U2YA 4MMXC 2XY1A 2EH8H 4WHYG 1N7ML 3P3SA 4OKVB 5IB3B 4HAFA 5E4EC 2MJWA 5TFSH 2X4TA 2Z1KA 4W9KC 4A7VA 4IGBC 2CGRL 2OTPA 2Z31B 1GVIA 4Y4HC 2ATPB 4P05A 1LJMA 4HJUA 3FCSA 3T8MA 5MENB 1KCVL 3I9GH 2ED9A 1TF4A 2B4CH 2H32B 1GYUA 1NFIA 2ZX7A 4HK3N 3VSVA 1UQSB 3ZN6A 2CCLA 5C0BB 2PR9A 5C8JB 3V0AC 1S9YB 5DA0B 4NX0A 1BQUA 4L4VD 1AR2A 4HCGA 4JRYD 5H37G 1SYVB 5FYLE 2FO4B 4GKLA 4PRBA 5AW4B 2PCYA 4WNQA 2CDEB 2I24N 1ZPLA 1GA2A 2NYKA 2H8PB 1PFCA 4FAAB 2XTLA 4TLTA 4GKNB 1A6AA 3GJFK 4FXGC 3SYAA 5AAPA 1AKPA 3P0YH 1N59B 4FP8H 4HIEA 3NIGF 3IXAB 2BOBB 1W80A 5DTFB 5KAQF 1F97A 2EQDA 4YBLB 2HTLD 1IZKA 4E9WA 2ZOUA 3UJJH 1G7HA 4YDZA 4NKIH 3VXRE 4NZTH 1S7UA 3PIQA 3CN1A 4LRIA 4LLMA 5DT1L 5C07A 2HJFA 5EIIG 3HN5A 3OSVA 2H2PD 2V9QA 2CUAA 3FOLA 2J6WA 3L3OA 4FFYA 3ULSA 3ZT5A 1TNNA 3PGCA 3KE0A 5ADPH 2B1HL 2BC4B 4QXWA 5F9JA 3O4LB 4BZ2H 1OAUH 2HVJB 4ADGA 2R0LH 1MZYA 4HUUB 5ICXB 5B21A 4BHUI 3OM3B 2D31A 3IJEA 1Z0NA 2NTSP 3FMGL 2GIYA 2HUEA 4MD0B 2APXA 4EDWH 2ZP0T 1EDQA 4AXWA 1FDLL 3MRDB 1AVAA 3LYRA 1ADQA 1MRFL 2ZZUT 4X6EB 1ZT7A 3UEZA 3WL9B 2DQJH 3D85A 2H1XA 1IM9B 2IQAB 3BKCH 4AV4A 1H3PH 1ID2A 4OM0L 4OUOA 4JPSA 1T2JA 2VSDA 4MJIA 1RUKL 1KN2H 4FQIH 3HE6C 4XP1H 1GGTA 1HNYA 4FABH 2DV6A 1NDGB 3GSQA 3BH4A 4FZ8H 3IM1A 1S7WA 1QHPA 2A6KA 2DEWX 5B7FA 3PGCB 5TQ2H 1AQDA 1KGCE 1TU2A 2FUQA 3NRFA 4Z7OB 4TUOA 2CDGB 2P52A 2E4FA 4N90E 4QRPA 3WN5A 1EH9A 1NJ9A 4M1DL 5JQHC 2P48B 4XPTH 5EC2B 3T3MB 4ZFGH 4Y16C 3ASOB 5LCVA 2KMWA 3R7QA 4EOWH 5AG9A 2YAQA 1TCRB 4PGCA 4JGNA 4G3YL 4FNSA 3QJHA 2X4SA 3OAZK 5I75C 1C5DB 1MFAL 3D0VB 4DP7X 5DTFA 4E9LA 1U3ZA 4JO3H 5SWZE 4AITA 1HIMH 1QABA 1HFUA 1O6TA 3O6MH 3FT4A 3VXRB 2X2IA 4KKLD 3WLBA 1OAZL 2DQCH 2EP6A 2F7PA 2YLKA 4NQVA 4PCSA 2J8UA 5LNDA 3K7UA 4MCYB 1MWOA 2EICA 2XXFA 2P1YA 4ONFH 4ZFFB 4G71B 2E7CA 3UIZA 4N5EC 4JJOA 4ZUSB 2VR3A 3PHOA 2H2SC 5KOVC 1OP9A 3A6BL 4MMYA 3HR5B 2VMFA 4QHNA 4XVUD 1ECZA 4HUXB 4OVUA 4X80H 3GSUB 4ONHB 1KTLB 2XWXA 4NO0D 4X6FA 5CP7B 3RDTC 2ATPA 3H9SD 1MFVA 4L1BA 4XOBA 4J4PA 2NZ9C 4JREB 4KTYA 2ZWSA 1Y1UA 4MNHA 4FFWD 1QHOA 5IF0B 3OTTA 3SDCC 4NQDD 4HWZB 2Q76B 3QJFB 3EJYC 1DQDH 2NY5L 4PTUB 4DGYH 1BOGA 3POCA 3JV6A 4BFKA 4BZ1H 4YBQC 1DBJH 1ZDQA 2PW1B 3GXTA 3QI9B 4GUPB 1IE5A 1XHHA 4OZGE 3UTTE 5IMOA 3SE9H 3L5HA 3FHAA 2NXZC 4CU8A 3SO5A 3PDOA 5I2IA 4LFHD 3N40F 1MCFA 1IC7H 3VWJC 2VDKB 3W82A 4AKPA 4B95C 5IB2A 4ODXA 2BHFA 4XCCH 3BUDA 4OFQA 4B7LA 5F7WC 4JY4A 5KVEE 4F8LA 1ZHLB 3D25A 3L3DB 4X4XA 3GIZL 4PUBL 2ENYA 2E47A 2GBUA 4IU2B 1SGKA 1ZT7B 3SDYL 2V5SA 4XPFL 1HNFA 4F20A 1TTUA 3AT0A 4YSQA 3T04D 3FFDA 4DGVL 3TA3D 4ZW5A 2R4RL 1G6VK 2WVVA 4FXTA 4IGBA 3WXVH 5CLTA 4DVRL 3APNA 2XICA 4H8WL 5CEXA 4KDTA 1XXDC 3LPWA 3QNXA 5AVYB 3SJVB 3OKOA 5F44A 3CSFA 3UJTH 3DPBA 5CEYB 4FE9A 2AXFB 2IDUA 2Z31C 4Y4HB 4QPEA 5D7JB 2QKIC 1HQRA 4X7TB 5MEOA 4AM0B 4JFDB 3VMNA 1ZGLA 2HFTA 1HQ4B 3EH3B 4G8IB 5DI8A 2W0LA 2GCYB 3ECBB 4P5KA 4PJIB 2J2ZA 5I71B 4M6MH 1UJ3C 3D39B 4PJ9B 5B38A 5KBDA 2XN9A 4JDVB 2H1LM 3MDJA 2AITA 2HSIA 2WQXA 4XN9A 5GPRA 3VNZA 5GSRB 4LKCA 3K71B 1AGCB 1YN6A 2F5AL 3NA9H 1EO8L 1QW9A 1DN2A 5CN1A 3ARGC 3MV8D 3OJDA 2N1KA 3VH8B 3HAEA 2GABA 4GRWB 4UZUA 5A43C 1DSFL 2QL1A 4QRPD 1ZV5A 2R56L 4OLZL 4PG2C 1KJ2H 2Z7WA 4X5WB 4IMLA 2I60L 1Y07A 2D7TL 5F7DB 3ML9A 3RZCC 3DI2B 1MOEA 2Y0SA 2HB0A 3CXHK 2V7HB 3OWRA 3ULUF 3MUUA 1TTCA 1NMAL 2LT9A 3ULUL 4ODWB 3VMPA 1E5BA 4AZ8B 4F7CA 4XCYA 1MCQA 2OCCB 2XLLA 5H35A 4MHHG 5KYUA 2YC1B 2XZCL 3W11D 1DSWA 1DVTA 4AQ8C 4BUHA 2ZXWB 4H20H 5SWZA 1S7RB 3S7GA 5JLZB 5DHDA 4PRIB 4CILA 3SOBL 4FULA 3VVWA 2A5UA 4LVHB 4AOFA 4GFTB 5F1NB 1SM3H 3FQNB 3RWHA 3QK0A 2UZYB 3MYZA 3NH7H 4KOCA 3MO1B 3UO1L 4YR6B 5DHXB 3L3GA 2DJUA 3IN0A 1OW0A 1FL6B 1G7MB 2DQIH 5D2LA 5TD4A 5H8DA 3TC9A 2LFEA 4MMZA 4QY8A 4TKWA 5EIQA 3POHA 4I3RH 2CD0A 3QDMA 1TTFA 3U4AA 1AD9B 3UDWC 4DUWA 2B9AA 1GRWA 1WV7T 4GUQA 2BRRH 3FQWB 1U42A 4FLOA 3OJVC 2WJ7A 2C9VA 4U3CA 5C0FA 2BERA 4IOFD 4U1JA 2EEBA 1PG7X 3AWGA 3APCA 3N04A 1SLXA 4I0PC 5GZND 2J6EH 3T4YB 2NY4B 2ZX5A 4UDUA 2A4EA 5AYUL 1WD8A 4ORGB 4KNSA 1YUKB 1P4IH 4FLHA 2JCCB 3DOSA 4N86A 4JFFD 5BZXA 2QGBA 4IRSB 2ETWA 5J1SC 4KKQA 5D7IF 5C0RH 1DUZA 4Y2DD 3ARSA 3A67H 3GMLB 1G6RH 3B3BA 1W72H 1EJFA 1HJBC 1EO5A 1C08A 3NESA 2Q7NA 3JWDH 1F4YH 3D39D 2WAHA 3UBHA 3HC3H 3V9CA 3MRGB 4FMFA 1ZHNB 3KLQA 3FQXB 5AENA 3RTLA 2VE6B 2BMKA 5TQ0L 4D8PA 3UH8A 3W0WD 5EG6C 2J6EA 3EZ8A 4EI6B 3TNNA 1CFMA 2IC2A 3CN0A 4OVVA 1U2HA 4HXAL 3FTWA 1RZJC 2ZAGA 3AVEA 5E6IC 3VGHA 1HXMA 1IBGL 2NLJB 3STZA 4HJ0C 1HL5A 4PP1C 2AJVL 4BCXA 1QPXA 2OPCA 3DROA 4A6YH 3QJOA 1G6RA 3V6ZB 3WIHL 1A7NH 1DDHA 3H9HB 1N70A 4LARL 4KI5C 3GJFB 1Q8MA 3GBMH 3ESOA 5I1JH 2COQA 2V3DA 1SMDA 4FFZL 4DP5X 4JKPL 5KJ4A 5DHVB 4NRYA 4NZDA 2VXQH 3QRBA 4YO0B 3TFKD 3VRJA 3PE9A 5DJ8B 3A4FA 2EDRA 4NQQA 1V54B 5AW6B 4K9EC 5INDA 1GMIA 1ZIAA 4P5TB 4UOJA 4Z3TA 1M7DB 5CZVH 3EIFA 1FAIL 1CT8B 1D9KC 4ORGA 1W8EA 1EEZB 2BP0A 2VWEE 3F04A 3A47A 3SDXA 3QULA 2EIEA 2Z7YA 1DZ0A 4DFIA 2OXGA 3QUZB 4ABVA 5EZLA 4BIKA 4LPYA 3KCWA 5CUSH 4UQ3A 1QSVA 5AW5B 1AD9A 3ZHDA 2DQFB 2LAGB 5ID0B 2E5EA 3BZEB 1YJDH 1EZUA 2CRMA 3QCTH 5D2LB 5B39G 3ZYZA 4AEIL 2WZPA 5GGRY 5DZ9A 4I18C 3MJ7B 4YQXL 3CJJA 1QZ1A 1U58B 2I26N 5I1KL 3FO1A 5I1DB 4QWWC 4ODTL 4JFEE 2CCVA 2HLEB 4UTCA 4PRIA 3GMNB 4R7NB 3WEAA 5T1KB 1A6VL 4QHMB 5K1JA 3SGDI 4B0MM 5IVXF 1SOKA 4E5XB 4XP9L 1JUFB 2FO8A 4WDIA 2NRDA 1AKJA 2GY5A 1WDAA 1NBQA 1R75A 4FI6A 5T1LA 2XPYA 2IDFA 1W0VB 4I77H 2H3KA 3KLAA 3QQ3A 1E2ZA 2D3NA 2KLTA 1UG9A 2CXGA 5D7KD 3S3SA 3FSOA 1G1KA 1D5XA 2ADJB 5TPWH 1SFHA 3ESUF 2VUYA 1OSEA 4KJYB 3AXLB 4KRNA 5D7JD 4RWYL 5AWNL 3RY4A 2NMSA 2WXOA 4JPQA 2Z6FA 4G70B 5GRJL 4JB9H 1LNUA 2ZYSA 5AW2B 1QFWH 1OCOB 3MLXL 3JVFC 4RAHA 4RFOL 4DKFH 5D7LE 4L9LA 1OGSA 1A9EB 1BEYL 4J2QA 43C9B 2IH8A 3B5TA 1OAJA 5D7EA 2BNUA 4OUUA 1KXHA 4ZS7H 1WFTA 2KPNA 5DUML 5HSFA 3DRTB 2RQ8A 1PG7H 3SBWC 4PJ5B 2LVEA 5KSBE 2EZ0C 2EXYC 2HWZH 1YEIL 4DESA 1XZ0B 3TT1L 4WK2B 5IKCB 3O3DB 5DHVA 1SNRA 2OZNA 2VLRB 5FW6A 2FB4L 1URZA 3WDJA 1P4BH 5AW9B 3HNSH 4GAAA 3TT3H 4AIXA 4PJFA 5AKVA 5HYQA 3LY6A 3A6BH 4KY1L 5DMGD 1TZAA 1HKFA 4PLJD 4HHGA 3V4UH 3G6JF 3Q8CA 4LQ1A 1V55B 3QI9D 4KDTC 4QXUH 1SEQH 2G30A 4Y8AA 1UJTA 5JUEH 1QVOB 2F7RA 3H6AA 2CUIA 1MCJA 4MB3A 5FO8A 4JFED 2XQBL 4NO5A 3VDAA 2JB6A 4ZTPL 4GRWF 2CALA 4PD4J 2XG5B 2EDHA 1S5IH 3EFOB 4JN2B 5AUMA 3PG2A 5K69A 1CWVA 3RBGA 3P30L 4I3GA 4NO0B 3TTYA 5EIVA 4HS6A 5A2IH 4E0RB 1DQML 2X6CA 2ZXBA 4F91B 4K55A 5I6MA 2NY0B 1KPVA 5EU4A 4JCWA 3K2UL 2P9RA 5C0EA 3UJIL 4OFDA 1NKRA 3US1A 5B1AB 3F7VA 1SJVA 3DJ9A 4PMFA 5EOCH 2DRUA 4N2GA 3GLAA 1J0ZA 3IDMB 1G6RB 3V6ZA 3GMLA 1U8QA 2Y7QA 1VFAB 1KBBA 3P9LB 5CF3A 3B7SA 4NAJA 2R23B 5K1NA 1EHXA 4Y19D 1I31A 2XWZA 3VXUB 4I0CC 3V4VL 4XTRD 4XWOC 5KVDH 1JF5A 3PS6A 2X3CA 3L5IA 4NXKA 3NDZE 4UILH 5C0AE 4PW9A 1OP5K 4X6FB 4C8XA 1RZKC 3P77B 4ZMTA 2C1OA 1RLBA 5E24E 4ODVH 3QXVA 4KQ4H 2EIDA 4S2SA 5AVVB 5FOJA 4BH8B 2K78A 1RZJH 3NUKA 4N2FA 5KVFE 5INCA 2J8OA 3PWNA 4LSVH 1J5OL 1UH3A 1ONQB 3DX6A 4I1RA 3F7LA 3QJZA 2MOVA 3LQAL 4A2EA 3TEZA 2Q2EB 2E9JA 2WLLA 2EDXA 3TJHD 5I76B 4POZD 5BOZG 4E9QA 1TKWA 2AEQL 3DYMA 4GSDL 4L1LA 3NIDE 2QGEA 3CBJB 4KNQA 5I19L 3IFNL 2OXHB 1CTNA 1Q9LA 4I18A 2VZSA 5FW7A 3LPGA 4QXVA 4EN3A 3QG6A 4PGBB 1T1ZA 1J9QA 3OQ3B 3PAUA 3D0VA 2PR4L 4WWPA 4H8QA 4WW1A 2RTTA 3WNPA 1OVZA 4L1TA 5T1KD 1S7SB 4Y16B 3CFEB 3CZFB 3TLRA 5T5FA 1NUNB 2C1PA 1JGEB 2QQKH 1HKLL 1A4CA 4XRCB 1MI5E 1ZV9A 3C5JB 3OG4B 4RMBA 3WN5B 1E9QA 4LHUA 1KJVB 5JZ7C 4JFQB 3HAEG 5A7BA 3SPIA 1DVFC 2C5DC 4MWFB 1E5AA 3T3PB 2UY6A 4KNTA 1AOHA 1NTDA 3UP6A 4DQAA 2Q5BA 5CZRA 2LGNA 2E59A 1V3MA 4H2CA 2A0LD 4YR6A 5I1AB 1U3HC 4F33A 1AGBA 2HLFC 3MNVA 3QDGE 1AE6L 3QUMB 5FAAA 4Z7VB 5FYKD 1LTXA 2DQDL 2X40A 5DJ0A 3VSTA 1MLCA 1Y1DA 5KS9A 1D9KD 1A8ZA 2R0ZH 4QOKB 4YSPA 2B4CL 5F1KC 3BAEH 1CFNA 2W92A 1YY9D 5J5EA 2ZTBA 5FA3B 4S2SB 1UVQB 5IP4A 2DLIA 3OLGA 1PL3A 3AB0C 3P77A 3K8KA 2ZICA 3K71A 3TVMC 5ALBL 2RAMA 1F4WL 3BAIA 3M1BB 3V0DA 1CXHA 3OGOE 3S5YA 1GW6A 2DJSA 2R0WH 4JDEA 4AMKH 3BEWA 1OGAA 1XF4B 3BIAX 5F7DA 1K4CB 2VDML 3L4YA 2EO9A 4ZK8A 4PAZA 4AYFB 2AXFA 1G7QB 3RURA 5D1QC 1GSMA 2DWYA 4NHUA 4MZ3A 3ZE2B 2YPVL 4CU7A 1OOAA 1ZSHA 2YRPA 3MAWA 5I6KA 1TQUA 2MMXA 5DVPA 3FU7A 3L3OC 3MX0B 3L08A 1IGTA 4L9LC 1IBFA 5EZJB 1T4WA 4MCNA 5EDSA 3U0PA 5E2UL 3WS3A 2EEDA 1PKQA 2HG0A 5JW5B 4N5UA 1AHWB 1N3NA 4QT5A 1MI5B 3SEPA 2Q8BH 2OZ4A 1NCDH 1PVHA 3RU8L 4XP5H 2B59B 1F2QA 1RPKA 1BQHB 3NN8A 3OKKB 4NJ9H 5AYUH 12E8H 4WFEE 3FT1A 1QMUA 4XPBH 4LF3A 4JY4B 4R3SA 1ZGLB 1SVBA 3SE4A 1FFPA 2WIIB 4N8CL 3AM8C 3L3IA 1ZXQA 4FMVA 1MFEH 5DQJA 3VO0A 5IOPA 5I8EB 4KAQH 3LV3B 4OF8A 4XE5B 2V9RA 5LBSH 4EIZC 1XZ0A 3B6SB 3MBEB 4FNPA 5GGVY 3E1F1 4OZFB 3RWDA 1JG9A 1KXQE 4BXSV 4XCFL 3IB4A 1CBJA 3WI9A 5ALBH 4MKTA 3K72B 4YDLC 4J3VA 4L8DB 5IMLA 1AZVA 2QSVA 3L9RB 1B3IA 4H8HA 4M8RA 5KSVB 5FGBA 3SDCB 1ZK5A 3TTSA 3VXSA 1TR7A 3VXSE 5CGTA 4CDHA 5FYLL 3QPQD 4D0CB 4LASH 2BS8A 5FDWA 1RK0B 3L9RA 3X3GL 1HHKB 4I5BA 4KKAD 4P9ML 3KXFD 1P4LB 3DMMB 1E4XH 4JZOB 1SY6A 2R69A 5JA9A 3HNVH 3EYQC 1SMOA 2A9MH 4GUPA 4MYPA 1GS7A 3PAYA 1H8SA 2WQ8A 4JFZL 5B22A 5FO9A 3U7WL 4HLJA 4FX5A 3MFGB 3VFOB 5AEAA 1JV5B 1YA5A 4QRUB 2YIHA 3TYGL 4BWTA 1B4JL 3MX0A 4BUGA 2DB8A 3VGAC 5J7CC 5TGBA 1NIFA 4GAYB 2E9BA 1DSFH 2XOTA 3E6FB 3E7JA 4HS8L 4H1LG 2BNQA 3NJVA 3MJWA 2D3VA 5CZVL 1ETZA 1D5ZB 1R3KB 2VJ0A 2FWUA 1E9PA 1T03H 4L3AA 2V5TA 4AQAB 5I74B 2N0KA 4X7SL 3MRMA 3RWCA 5BVPH 1K4CA 4R3SB 3I3EA 3U9PL 4LDCA 1XF2A 4TUJA 1PKOA 1NJ9B 2DJ4A 2EC8A 3DX2A 1OY3B 3WFEL 3G3LA 4IHBA 1TJXA 2KKQA 2VDLB 2YZ8A 3VXOB 5I19H 2B1AL 5J6GA 2E4TA 3EFFA 3OB8A 4FGMA 3PQYD 2AS5M 4L37A 3EJZC 4K5OA 5CR8A 4M6ML 5I1JL 1JNHB 4ENZA 5IG7A 1YMME 3QCUL 3WS3B 5IQOA 4L1HA 3K6IA 3QEUB 4WW2B 2WV3A 2J5LB 1S4IA 3MLRL 5BUPA 5IFAL 1WF5A 4MXQD 1OT1A 3QFGA 4QTIH 2WXRA 4YE4H 4BZ1A 3V5KB 5IQ7H 1G7QA 3GMRA 3DBXB 3R4RA 4XMZA 1QYGL 3T2OA 4KJPC 5E9DE 2XNAB 4UILL 3UP1A 2HRGA 5AW7B 4PJ8D 4PJAA 1DQTA 2LABA 1TU2B 3V4LA 2BSEA 3N85L 5TH2A 2BHYA 2ATAA 1FJ1A 3IJSB 5DJAB 1AGEA 4PUBH 4XE0A 4ZO9A 5C07E 1NGWB 1YYLH 3UX9B 1T89A 3MLWH 4PWIA 3G5ZA 3QJXA 3MLYL 3S5LG 4YSOA 2QEJA 4NO2A 4TQIA 1YUHA 2DI8A 2Q8BL 4XNZC 4UUJB 1AG0A 4IEFB 3DUUB 2Q6WA 1U8NA 3GJFA 1F00I 3GRGA 2EYSA 3ML8A 1Q9LB 1A14L 4P8QA 5CS7A 5EPMA 4HJ1A 4P5TC 4ALAC 3K6NA 5TDNB 3FB7B 4KGLA 4OSUL 1QTSA 4L18A 1PW3A 2HCZX 2XQBH 3IKCB 5CZXC 3UAJC 2WTPA 3MRCA 5KVGL 1WZLA 3FU8A 1FSKB 4XCNB 5E1HB 4WFFE 1XV8A 5BCAA 2W07A 4HJJL 4KZ0A 2MRYA 3STLA 2BMKB 4JFVA 1YMMB 4D8PB 3MV7A 3BO8B 3O4LD 3A0OA 1MWAL 3PIQB 4FHBD 4G11A 1ZVHA 3DGDA 4PP2A 1MHEB 4TNWF 4LPXA 3DTUB 3N1FC 3EGXA 4F37K 1Y0LA 4MKMA 3D39E 1JZ2A 2D7QA 3MRJB 1EAPA 3CVHL 4UM8B 4XN8A 1OF0A 2ZSWA 4LGRB 4PJ7A 4QF1A 5B39B 4G83A 1OWRM 1IX2A 3MBED 4HZAA 4HC1L 5J9PA 3QORA 4B9GA 4K94C 3ULVL 1HHHB 4NQDA 2DQDH 3IDMA 3BAKA 5JXAL 1TZOA 2VIRB 4YGVB 5HGBA 2OMXA 1A8JH 3TCLA 1HWGB 3UXFA 2AXJA 5AZUA 4ANKA 5DJDB 3T4YA 5FYLD 2VOTA 4GY4A 5KVFL 2B20A 2IWKA 4Z5RB 3BO8A 3WMQA 5TE4L 4P2QD 1NPNA 4I9WE 4YFDB 1IILE 4N9OB 4JMXA 1EA9C 1W6WA 4FKEA 4X9YA 4C56B 4XGZB 1YEDA 5DC2A 4ZZFA 1GC1L 3FUMA 1HKLH 4OT1H 3QDGA 5F7EH 2VRQA 4PVBA 4YK4C 4LZKA 1B90A 5DZNA 1AFVH 1NGZB 1A6WL 2ZUXA 1SRDA 4PLJC 3X1GA 4Y4KA 1G9ML 1U8QB 1RL1A 2EUWA 4YXKL 2VKXA 1MCWW 4QEGA 1I8LA 4PRIE 4XMKL 1PZBA 2R1WA 4XP9H 2JI1A 2KZWA 3JVGC 3B7RL 2D9QB 4JVWA 2BY0A 2Q9OA 1PAMA 4BKLB 4FXLA 4A7SA 1FDLH 4U7KA 1N8OE 3O3DA 2GHZA 1X5ZA 1D5BA 3C60D 3MMEA 1PAZA 2WD0A 4OFPA 4PS4H 1C5CH 4RFEB 1INEH 3QDJE 4GXVL 3BC9A 4ZTEA 5AB0A 5IT2L 1NDMB 3MNMA 1KGXA 2MCMA 1VHPA 4M6NH 3ZE0B 3OHMB 3THML 3OF6A 1IU1A 5D72L 2E75C 5FO8B 3WEXA 2VR7A 4F1ZA 1MVUA 2OLDA 3A24A 1TZGL 3MV7D 2ZUYA 1WFUA 1PBYA 5HYFA 4WUKH 4ECNA 3MC0A 1MFUA 3B1TA 4LRIC 4CN6A 1P9MA 3ILPA 3TO4C 4FNLL 1F1AA 2APFA 3EADA 4A68A 4PRPA 4GRMA 4XXCA 5LAXB 1ZLWK 4J4PD 4R5VA 3LVTA 2FNWA 3LZNA 2K4WA 2Z0UA 1CL7L 3NJHA 1ZA6A 3T08A 2DY2A 1PD6A 2GJRA 3UMNA 2K3TA 1DJZA 4XP4L 3TNMA 2OI9C 4RGMC 2Z34A 2E27H 4XO9A 3W9DB 1ED3B 1I3RA 2ORBL 4I13B 4MLSA 3ECBA 2GCYA 3R06A 4XHQA 3K0YA 2OR8A 3QAZC 4MA3B 3GHPA 4AM0A 3EF4A 3G5XB 3VXQA 3PHQB 1PZ5A 5IFHH 5AB9A 4YSRA 3VG0L 2Q0ZX 1KFAL 2D7MA 5E4IA 4L1DA 2O6EA 1QR4A 3MA7A 4CN4A 1MKFA 2J8HA 3L5WA 4YHIB 3QUMA 3OZKA 3MFFA 3FO1B 5I1DA 2KYIA 5I0DA 1K4DA 2R8SL 2ADJA 3IF1A 4FFTA 5C0IB 3IAQA 3PAVA 3N1PC 3QRGH 2R1XA 2CA4A 4ZPVB 5I6NA 4JFDD 1JV2A 4MWFA 1DO5A 4N22A 3K74B 1FZJB 2W9DH 1E9QB 3RVUD 1MY7A 2EKSA 3BXNB 4X4XB 3QYNA 1T5WB 2QVFB 1UT1A 5GS1C 2FX8L 4XO4A 1FVDA 4WVRA 1YEJH 5KTEH 1ZTMA 4F7MB 4KVCH 5ICYA 4CMMB 4N1HB 5DMYA 4EZKA 5TJWK 2P5WA 3TCLB 1QTPA 1TPXC 3LEYL 2WINB 3JWNG 1CGSH 1KCUL 2VIRA 4LSUH 4NLHA 2NW2B 1WK0A 1TVDA 4GNKB 4NN7C 3RFZC 1FFNA 4D9QE 5L6YH 2X6VA 4PTUA 1I1YB 5JQ6L 1FHNA 4GKOA 5AWNH 4GSUA 5F96H 4JFHD 3A22A 1ZLSL 2XBZA 2PYEB 1EFXB 4LVOB 1G1CA 4LGPB 3L3IB 5B3SB 4RISH 4CMHB 4FQXD 1OAYH 2KZ1B 2XG4B 2YMXH 2Z93B 1ZT1B 3VNYA 1QO3A 3HMXH 3S37L 2WLNA 3SDXB 2HP4A 2DMKA 3B43A 2EH7L 3NN8B 4R4NC 4XCNA 1NSNL 1OLZA 4PCTA 5BV7H 2YS4A 5KYXA 1J48A 2NSQA 3OJ2C 2HTKD 2VLKA 1N8ZA 4APQA 3RKDD 1ZPUA 1AHWA 3BMVA 3RYMA 2XX1A 2XY2A 2GY7B 3NIDF 1RZKH 3IGFA 4G7VL 2AQRA 3HG4A 5EZJA 3U0PB 4Z7WF 4JHZA 1VFMA 1ZHNA 4NRYB 1CMOA 1Z3GH 1G9HA 4XNXL 1UT9A 3BGMB 3GB7A 2JQZA 1HCFX 5C0JA 1JZ4A 4MXWH 4LSTL 1R3JB 3EJZD 1MG3C 2B1HH 4L0PB 4YZFF 3ATDA 2AQ3A 1LEGB 1XF4A 4QIRA 1CDBA 2BCMA 1E7VA 2PABA 2BY3A 2AK4D 4JDEB 4GG6F 4WKZB 1M56B 3BKJH 3HZYB 4WRLA 1TETH 5GS0H 3CXFA 3Q2WA 1HINL 3HPLA 4U4BA 2R9HC 1CBVL 4UOW0 3FT3A 2QDWA 2DH3A 4ZAKD 3ZUNC 1UCBH 5DVNA 3BMWA 2VXTH 3FOMB 1NCTA 1KXQA 4MJJA 3UYRL 1DE4B 5C0FB 5IR1A 4GAGH 3G08B 4CNIB 1I1RA 3CFIC 5LDSA 1DBKH 5IJDC 1CLZL 1T0MB 5AKTA 4JQVA 4AXWB 4PM1A 4MX7A 1JZEA 4F33B 3TF7C 5I1LB 3ABZA 4MAYD 1MHPL 1ZEAL 3C6SB 2FBJH 4U0RB 1JWUA 1GTNA 2BM3A 4YFEA 1JZFA 2AEOA 4PWKA 3T0AA 4K7PY 3SE6A 2IWGA 4GBXA 1A7BA 1D6VH 2FGWH 1WHOA 3GEFA 4JKLA 1RJYA 4PLKD 3FU5A 5HGDA 3HI6L 2J88L 4CW1A 1QUNB 2OMZA 3DX3A 4N2AA 1IEBB 4DVBA 1OW0C 3CZNA 5KUKA 2RGSA 1Y6NR 5CBAB 4K2UL 2O5XH 5CKAA 4XPAL 1WD9A 3WDIA 1AR1D 3FU6A 5G4NA 1YDPB 1HU8A 4XPGL 3U79A 5EHFA 2AC0A 1MF2L 1VESA 2F58H 4MJID 3HRZA 5IGXH 1HK6A 1E4WL 4LBAA 1E4HA 2VZ1A 5I18H 1I53A 3CK0L 2APBA 1CIDA 1VPOH 4UNIA 3RL2A 3OR6B 3BT0A 5IB4B 1JK8A 4B41A 4KRPC 4ACTA 1WCQA 1AKJB 3ALXA 4NUMA 5JQ6H 3MRNA 4R2GB 3FQTA 2IG2H 4ZW7A 4YH6A 3R4DA 1JZIA 4F8TA 3HZVA 4NLAA 1RVFH 4QO1B 2NY2D 1DBJL 4U3XA 2J6EL 1FAKT 3TO4D 1XGPB 3OMAB 3CK0H 2J2ZB 5HDWA 1YN7A 4NCC2 3WS6C 2XACC 2WSDA 3DX7B 2XKNA 1QSED 4NIYE 3CDGB 2YAOA 2DF3A 2D4FA 1SHSA 3DRQA 3SCMA 5F7BA 4P5RA 3PWVB 3WFCL 4L4TD 1RULH 5IOPB 3OKMA 2MCPL 3CCHA 5EU4B 1KPVB 3QARA 4L29A 4IGBB 4HLZH 1NBYB 2ERJC 1LD9B 2BSRA 3KM1A 3MLRH 1I85C 4HF5H 3WNLA 4ONFL 3SSGA 3QR2A 4NGHL 4JFPA 4U3SA 3SOBH 1ZHKA 2WTOA 2YK1H 3PUCA 3JWNC 3T3MF 2WWMD 2HMID 1S7VB 4DEPC 1C1EL 1LD9A 2BSRB 3S88L 4XX1G 1HQ4A 1QZNA 2XTJC 4PJ7F 4QYOA 4MD5A 4ENED 3O2WH 4JE0A 1SXNA 1NMAH 1TQCB 2F9BT 3ZDZB 4UT7L 3MUHL 4JX0A 4K07A 1Z0MA 3QVAA 3FSZA 4OF0A 3BVVA 5DC4B 1S46A 4LPTA 4EUPB 1HILB 4ZNCD 4MJIE 1MIMH 4N1CA 1A4AA 5H37A 4JBSA 2VAAB 3MGAA 1B4JH 2QQKL 4U6YA 2D73A 2B8OT 4FZ8L 1RZ8B 5AALA 1N4XL 1ZLDA 4HKZB 5DHYA 1KEMH 1NAKL 3H53A 4JO1H 4WWKB 1JNLL 4C4KT 1P7KA 2YRZA 5JIHA 3ULVE 3QUYB 2ED6A 4XGZA 4QOKE 5I75B 3AUWB 4OQTH 4NAQA 1JHLH 1C16A 2Z64C 3H0TA 5DJ2A 1MVYA 3PQYA 4JPKH 3DX9B 4LASL 5DZOA 3F65A 2B2XH 4DQOL 2P42B 5IK3A 5L8KB 3EYUH 2WPGA 4NFDA 2B3RA 2OMXB 3I2CL 3ARPA 1KIQA 4MHHI 4A2HA 2JE8A 1AMXA 4RH4A 1TTRA 2UXTA 4G7VH 1DANU 4XNUH 1RZKL 3ZGIA 4BSWB 1DHKA 4B9KC 2QLYA 3O6KL 4YWGL 4U1NB 3FCTB 3BJ91 2CJSA 5EOQH 4UM8A 3BW9B 5DJXB 4DVRH 4YIQA 3SE8H 1QLRA 2OR9H 2VN3A 5ISZD 1NINA 4N2KA 3WEBA 4A66A 3W57A 4QRQA 4RISL 1T4KB 3UEQA 4WEUD 5D1XC 1UWEH 3M7OA 1LO2H 2QADC 3GIZH 4JEGB 4XVOA 3MRCB 4V1DD 3FO0H 4ZO8A 3QG6B 1Z5LA 3HMWH 2H6UA 4YSTA 5E94B 3U2IA 1A3RH 5BOPA 4JQVC 3QNYA 4JM4H 3NCEB 4KROD 1ASPA 2WLHA 1DFBH 1IM9A 2IQAA 4XXWA 1OGPA 5BV7C 5HHMB 1SEBA 5E5MA 3EYSL 5CILH 5EBLB 3VXUE 2GUOB 4D3CH 3BQUB 3R18A 5F1NA 3GMQB 4PBVC 3BUTA 5D7KE 3KXFE 4QTHB 4NWUL 4G59C 1MW2A 2C7FA 4R2GD 4M1CC 2X4QA 3UDWA 2L8AA 3Q48A 5C0GA 1E0OB 5KYUB 5ICXA 15C8L 3SQBB 4PJ7E 1EHKB 3F7KA 3O4LA 5TFSL 3L4UA 1FJ1B 1UGNA 1A25A 1B9ZA 4UMSA 1J88A 4ZSOA 3A4AA 4WCYL 2AVGA 3U9WA 4W9LC 4R4BB 3DXAD 5EC1A 3BHBB 4AGPA 2D8KA 3T6ZA 5BRZA 4BELD 3MZTA 2CBTA 4XN2A 3QHFH 4HFWA 4HU2A 2CO7B 1I7ZA 2AJSH 1UJ3B 4YLBA 5E5UB 5KBPA 4YSEA 1P2CB 2CO6A 4OZHB 4FJZA 4R7LA 3P2BA 4IGBD 2VZTA 4KTGA 2X4OB 4NFBA 2YEZA 2WVTA 3SPCA 5HJGA 4RBPK 4WJKB 2EVFA 4N24A 4OJEH 1OSYA 2QTVA 4OGYH 4AYMC 2C3GA 3C08H 3VX0A 4XNMA 5D93C 3BKMH 1YNTF 4OF5A 1F3JB 1GPOH 3RWIB 2ODIA 2VJXA 1AXTH 3FO0L 3JZYA 4U1GC 4WNJA 2WC7A 2WAQA 2WXFA 2DQHL 2JH2A 3U0WH 3TO4A 3FONA 3GXUB 5L8JB 5HVHB 3PWPE 2H32H 2NQ3A 3SYQA 4K7PL 4XCEA 4P4RB 1G43A 3FYIB 4NEHB 2OX5B 4R26H 3NJXA 2OR9L 2VN7A 5EU6D 1QLFB 1WBXA 4K3DL 4Z7WA 3RL1A 1OQOA 2G9KA 3DECA 1PIGA 2P28B 1YNLL 5EUOF 3TEUA 5J3HC 3ZZLA 3H3KA 1OWWA 3IDGA 4PU2A 2I07B 3IRCA 4PWGA 5E56A 1T1WA 3FMGH 2P5WB 4KQ3L 4NS0A 4PS7A 4EDWL 3N41F 4IU2A 5KWYC 1RK0A 2B3IA 3NSYA 3OBAA 3MZGB 5BZZA 3QCUH 4L2LA 4QWWD 5L9DL 4ZNEE 4HKJB 3JWNH 3V4PA 5DUBB 3KL3A 1IEAA 2UVEA 5F93C 1TJGL 3V6FA 3BUYA 2V17H 3VMOA 4LHUG 1EVTC 2LU7A 4M3KB 2ZXQA 3LIZL 1KLUB 5AL0A 5M94B 3D34A 3ARRA 2ADGA 3JV6B 5MI0B 1EEQA 4QRTA 3N1GC 1HWHB 1U3NA 2BWQA 2XIDA 3NIDB 2NY3D 1U36A 2VMCA 4UDTA 3PABA 3VWKA 1WA0X 2L7JA 2BP5M 3IDXH 4N1EA 3IDIA 4FP8L 2GFBB 3O8XA 3P0YL 3MROB 1I1AD 3ASNB 5CP7A 1Z1WA 2DICA 3KR3L 3VWJA 1WS7A 3DDFA 1AXTL 4QMEA 2NY2C 4L8BA 2V8MA 4ELKA 3C6LB 1E42A 5I0ZA 5CCKH 1F4XH 3HRZC 1FG2A 4Q7DA 2CJTA 3CHOA 3FSVA 1NC4B 3GF8A 3UJIH 1IQWH 2ED8A 2J12B 3K2UH 4KO5A 1UD4A 4NPYB 1AG6A 1DVQA 1UKTA 3DUSA 1GKEA 3U25A 4UYPA 3BUQA 1WTGT 3SDAD 2D7NA 5FCUH 4APXB 3S9DB 4ZFZA 1QSFB 2NY1C 4F7EA 4P2AA 1U58A 3VU2A 4YHKH 4OW6A 4ENEC 1FCGA 1I9JH 3ATBA 4M1CD 1ORSA 2WB1A 5C2UB 2CO1A 1XGTA 4GMSH 5FOBA 5GRXG 1BV8A 3AREB 1OARL 5IZ7A 4IMLB 4UWQB 4K7FB 2CGRH 5DJYA 2NY6B 4E42A 4C58B 1CLYH 2QSCL 1CLOH 4G6MH 4H26B 4ZW8A 2JIXA 3DTXA 1C5DA 3TV3L 2BSSB 4G8AC 2XZZA 2JIXD 3VVVA 4JHBA 4KXZI 4K0OA 4NBXB 3Q6GL 4WCYH 1HSAA 1BZEA 3GMPA 3GS7A 5D1ZA 1H5BA 4JMNA 3B7UX 4DUXA 1AGCA 2UYLA 4DW2H 3TT1H 4FFWC 1IL1A 4DN4H 4HWBL 3SGJC 4U1LB 5MEQB 4EBQH 2ZUSA 5AOKA 4K94H 4PJBA 3FO9A 3QIBA 3GPSA 4OLVL 5DI8B 2K8QA 2F54A 1SHWA 2P43B 1ZJBA 5IVNA 2K4AA 1PCXA 1UWGH 4FTVE 1WP6A 4X6CE 5B7EA 4RFO