1IFRA

Structure of lamin a/c globular domain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
113
structure length
113
Chain Sequence
GSHRTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAMRKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords Lamin A/C
publication title Structure of the globular tail of nuclear lamin.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2001-04-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1260 Mainly Beta Sandwich Immunoglobulin-like Lamin Tail domain 1ifrA00
1UFGA 3GEFA 1IVTA 2KPWA 3UMNA 3JT0A 2LLLA 1IFRA
chains in the Genus database with same CATH superfamily
3QZMA 4Z3FA 5C0RH 4YLQT 1P69B 3UG3A 1G6RL 4HLZG 2KQMA 1TF4A 4K0OA 4J23A 2Z8WC 2P5ED 3IU3A 4ETYA 5BW7A 2ZF8A 4KHTL 5E6ID 3ARQA 5AOZA 1UH3A 4PP2A 4Z0XA 1QEWB 4ZMWA 4FL4B 2GSMB 3CDGB 2ZWLT 4TTDC 3S2CA 1OF2B 1KYOJ 1RL1A 2O6PA 3EZJB 1EXUB 3B2VL 1WHPA 1A6TB 2XWBB 3MXVH 3MZTA 3K71B 2BXYA 1NLBH 3LXUX 1BD2D 2FCBA 4LSRH 3BKML 3MA9L 1YSOA 4AVKA 1S7TB 4UB0H 4GSDL 3ZPDA 1NCTA 4FE9A 5F1NA 1MUJB 1MNUH 3HI5H 3D85D 1LK2A 3APNA 4E9LA 2EDFA 4FXGA 3PGDA 1PKQE 5E1AA 4OD2A 3T0VA 1IM9D 5DEGB 4PS3A 1UH2A 2Y1ZA 3QPXL 1T0NA 3BO8A 3DUUB 3NJIA 4W70A 4YDKL 3Q05A 2FEJA 3GRWH 4WI0A 4N28A 2CLVA 3VXUE 3RLSA 4Y1AD 5AYTA 2X3AA 5EF2A 1QBAA 4M00A 2VZVA 3RIFF 2LAGB 3KW8A 1F11A 2R2CA 2AEPH 4YUEL 4R7DB 1QQDB 2IANE 4TMPA 3G6DH 3DV6A 1JGLH 4FDWA 3PXLA 4K3DH 1YQVL 4MHHG 5E8OB 3ZDZF 6PCYA 1E2ZA 3K6SB 5IOKA 5JTWA 3V5DA 3RP1A 2CIKA 1FYTD 5CZRA 4I9WE 2WUCH 3ARDC 3M1BA 5FCUH 3ZY7A 1E9QB 1WAAE 3P77A 4FNTA 1DJZA 1AP2A 4Y9BA 4D9QD 4NM4L 1VAHA 4AI7A 1HXMA 4MWFA 5M7QA 3JV5A 4LVEA 4LLUB 5GHWH 4CKVX 1ZT1A 3Q8AA 1WYJA 4R0LA 4G42A 2YPKA 5DQ9A 4MGXA 4PRIE 2KLTA 4OZIF 3LRSB 5D7IE 3V4PH 2VE6A 2D03L 3T0WA 2EH8H 1U95A 4DK6A 1JDCA 5GISH 4EBQL 1IEBB 4F7CB 4HAGA 4KUZL 3BLBA 1JZGA 5ITBL 1JI2A 3HE7C 1LEGB 4JDTL 4WQOA 5IJCC 5CHNB 4PRHB 3IGFA 5BCAA 5GRYA 5DS8B 1CTMA 5I8OL 2XN9B 4K9EC 1GGIH 4GIOA 3FT2A 3KHOA 1AE6L 1MFEH 4XXWA 4GRMB 3KPOB 5DMIL 2VH5L 2FYVA 4RSVA 3OLDA 5CU5A 3QHZL 4PGCA 1S3RA 1J5OL 1DQKA 5HY9B 1HL9A 5HGDA 1VIWA 5ICUA 5GS1C 3WIAA 1MREL 4Z7NF 1MI5A 4UAOB 3CG8A 4ICXA 3QRGL 4U7MA 4NUMA 3FB8B 3ULUD 2EDNA 3RPKA 1NAMB 4BH7B 2Q8BH 1BXXA 4NO3A 5KVFH 4PWKA 5FA4B 4BCXA 3ZE2E 3MNVA 4JGUA 4WUUE 3OAYH 1M4KA 2VISA 4P2OB 3DX6B 5FW8A 3N04A 3ZSSA 2NY5C 5HVHB 5T3ZL 4UNVA 3MV9A 4JE0A 5J1AB 3K5SA 3U1SL 4PY8J 4LCCC 1SUJA 3HKFA 3CFEA 3L1FA 5JXAH 2J1WA 3BJ91 4ZTEA 1C7TA 4D9LL 2XQYK 4QRRD 1URLA 4R96B 1GXEA 4DZBA 1SF5A 5CUSL 3TJPA 1S4IA 2XZAH 2YRPA 4GYBA 4HWNA 3QIWB 3HR5B 5DS1A 4NZUL 1KXVC 3U2SB 3CZUB 4LLAA 4KO6A 3EH4B 4H0HB 1KCWA 1NMCC 4YH6A 3SBPA 4NP4L 1JGEB 2HJLA 3FSZA 3T0XA 1IAIL 1LP9B 4RGOL 1XR8A 3RAJH 2F54B 2VL4A 2OYLA 1OCZB 3ZK0A 3VGAB 5I1DA 1XIWD 2OV0A 4LOFA 4XPAL 1CF1A 1XGRB 2ZWYA 4JJ5B 4F15B 4PUBL 2WLZA 1G5GA 2DZEA 1G9NL 3GT6A 5E1IA 4P59L 3OHXA 5FYKL 2XPZA 3VXRB 4YHZL 4HPOH 1OW0C 2IMNA 4Z6AT 3QWQB 4KPHL 4ZW8A 2K0RA 4RH4A 3CZJA 5D71H 5CEYB 1QLFA 3CFDB 3T65B 5IW1B 2J88L 2ADFL 4FQ2H 1X9QA 3P30L 3ROOB 5I1LA 2D7NA 4R4NC 1Z3RA 1O6SB 4P2RE 4UTBH 5CSGA 2X6VA 2I60L 3FRUB 1UG9A 2UZXB 2AEQH 2AS5M 2YMXH 4ELMF 3CVCA 4BEIA 1THAA 2HRGA 3F84A 4EUPA 1MPAH 2UXVA 1YUHA 5TH2B 4YDIL 2ZOOA 5JZ7C 3UCQA 1DO6A 5GGSA 3IRZA 5AWNH 1CE6B 1MI5E 1MRFL 2J8UB 4MJ6B 2WIMA 1JOIA 1WIUA 2C4FU 3DRQB 5E99L 2WXLA 1VGEL 3IDXH 3SKNB 2WOBA 3DRTB 2Q86B 3WEXB 2CAKA 4UM9D 4AMXA 3CSPA 4HIIA 5C09E 3MCKB 3B3IA 1U8QA 3FFCA 1MCHA 1KTBA 4U1IB 2BW4A 3T08A 4PRNA 4MNQD 1BZOA 3PAVA 2Q2LA 5ISZB 1T6BX 1NJ9A 4TLKA 4XP9L 2F7QA 3OXRA 5CBAB 4JGNA 2YPLA 3POCA 3R0MA 3NH7L 1UACL 2XQBH 1GZQA 2QPEB 4Z7VF 4CJ0A 1VFBA 3RL2B 4AV4A 5G5DB 5KSUB 4X5XA 4U6VH 3IPEA 4MQTB 4O5LH 3LN5B 2JQZA 5F3BA 1J10A 5C6WH 5JIKA 2FJHB 1ADQA 3I02B 1XL6A 2ERJB 5F1KC 3PABA 4PJHE 5B21A 3VVWA 2AQQA 4M1GL 2BOCB 2WTRB 4F58H 2Z35A 1EEQA 1KLFA 1OCWL 1MAMH 1S9WB 4NX0A 5LBVA 5K9OB 3LJ3A 2C1OA 5CIPB 5G4OA 3GHBL 2IOMA 3W39A 4X8JB 3M07A 2H7WA 1JFQL 2NOYA 2FQEA 4DK3A 2WXNA 5I1KH 5C08E 3B6SA 2MMXA 2C5DC 3EOAA 1KIPA 5MEPA 2VXVH 2VDLL 4A7GF 1PKOA 1TG8A 5LO7A 5LKNA 4DIXA 4Y5XA 1WBXA 3GXNA 4GT7A 4JG5A 2C3XA 5DD3H 2Z91B 3QO1A 4N0FB 4MCMA 4PY8I 3NJJA 5FYLH 1RJYB 1SQMA 1WE5A 1WICA 2JXMA 1V3LA 3NZHH 3BH8B 2G3ZA 5HYEA 2WNXA 3ERXA 4ZSOB 5BXFA 3GM0A 3O9WA 1IGCL 4ORGA 3FUHA 3QG7H 3KYAA 1K5WA 1EAQA 2G5BB 3DI2B 1WFMA 3ULVH 2VLLB 3GZOA 1NCBL 1YEJH 2LU7A 1INEH 5JHBA 4P46A 1JVLA 1U91A 1LE9A 2A9BA 1T2QH 3U0PB 2JFCA 5K9JH 2P5EA 2CCVA 4Z0BL 4K23H 1IBBA 2VDNB 5E0FA 4NQCB 5E6IA 3VXTB 4APQD 1JGVL 1S7RB 2P8MA 5D4QA 1A4KA 2H0FA 3MLVL 4QRQB 4JRXB 4JO1L 5IFJB 1EERB 1PZAA 3B2PA 2HT2D 1QR1B 3K8KA 1IBFA 1KYDA 5IMMA 4KQ4H 3UAAA 3B2DC 4HH9B 1S7QA 4H8WL 4J39A 1KMGA 3FFCE 3LKNA 4NRXB 3I75A 4N9GB 1JUFA 3MA7B 1FRGH 1A65A 1IZKA 2BVQB 4ANVA 3NUKA 3D85A 4XMXA 3HZMB 1TPXC 5DQJA 1E28B 3MR9A 5JO5B 1KJ2L 5EO0B 5HGBA 4GO9A 5KYUA 1IM9A 5FFLA 2LVEA 3KPTA 5BRZB 3RGVB 4QRUA 4OUUA 4YHOH 3RVVD 4H7VA 3QDMD 1KEGH 2YPLE 5EC1B 5FUOL 2IWFA 4N2BA 4LNRB 1DFBL 3FQ4A 2PCXA 4TSAL 1QYGL 4MMZC 3SJVE 4B60A 5CWSA 3UO8B 1EEZB 4NP9A 4S1DC 3S3BB 1NAMH 4LARH 1KLUA 1LDSA 1X5MA 3BPCA 3O11A 4N2NA 1CF8H 3VD3A 1F18A 4HJUA 4BZ2L 5DRNA 5BOJA 3UEZA 3BD4A 5EOCJ 1R3IH 3CFKA 3LRMA 4LE8A 5AVXB 1IM3A 3SQRA 3C2SA 4XGZB 2A6DA 2WKOA 1F41A 1PG7L 3HRZC 3WIIL 2AGJL 4FG6C 4Y9GA 1AY1H 1DR9A 3WHE0 1FYTA 2M1KA 1YZZA 1JZ4A 3L1EA 2OZ4A 2OYPA 1BYOA 1JXJA 5E8EB 2V9UA 4P23D 1FZJB 4DTGH 2BVYA 2C9UA 3FHAA 2AABL 3RWFA 4OZHA 1I9IL 1UD4A 4NQED 4XVJL 4WKZB 2AXHA 4N6QA 1E42A 2ALAA 2C9XA 2OXGB 3L4ZA 3QORC 1B9ZA 3OG6B 4H2CA 4M4RB 2BOBB 2YKLL 5CSZB 2ZKYA 3W5NA 2DQTL 2NZIA 1O7DC 4N86A 4WEBL 4LB8A 1P7KB 2VWEE 3K6DA 1JERA 2PTTA 4OLEA 3MO1B 4R2GC 5F71A 5D4HA 3LRLA 1C16B 3L5IA 4ZMPA 4DQOH 2V2XA 2V3FA 2NYYC 1PCSA 3EBAA 1PLAA 4XAWL 5D7LE 7CGTA 1QPKA 2P5EE 2X9WA 4PP1D 4P05A 3AS2A 4KX9A 4AL8H 3WMSA 2NT0A 1FCCA 1VCBC 3D2UA 2C34A 4DP1X 3AADB 3SDDB 1TTAA 1K6QH 3ZE0F 3QGVA 2A74B 4V2BA 4IBTA 1KG0A 1HHIB 2EYRA 4JDVA 4OZGF 5DFVC 5AQ0A 3NCYP 3H9SD 3Q3GA 3KW7A 1BD2E 4W9LC 4OCWL 4NDMB 4HKBA 4P5KB 3BEVB 4HOXA 5EBGA 4HP5A 1HN1A 2QKSA 3U79A 3S4SA 2GG1A 2HCZX 4M48L 1SEQL 3S8FB 5E70A 4KJYB 4P9HH 3B5TA 2X05A 5F0PB 3QYNA 4KKNA 1T5WA 1HILB 2V5SA 3LHAA 3ULSA 5C0RL 2P45B 4EDXB 2VIRB 1ND0B 4W4NA 1Z9SA 3ECUA 2DQIH 4KRMB 2PETA 4Y1AE 1YCSA 2WPGA 3KM1A 4CC4C 3Q7JA 3MXWH 3FN0H 4H2AA 3CHSA 1ORQB 3PXJA 5AALA 3BISA 1UOKA 3AU1A 4QCIA 3LD8B 3GKWL 5JHDB 1I8KB 3NSYA 3PHOA 4U1NB 5HDQH 4PJ7B 5GS0C 3MXVL 4FNSA 3HKZA 2FECI 3I9GL 5I5JA 4ZNCD 2GEEA 1NLBL 3BP5B 2CG9X 4QMEA 5JIHA 4QRRA 1CDUA 4RX4D 4LKCA 4WW1A 2BERA 4UB0L 5KVGL 3UYPB 3TOPA 1MNUL 1MHEA 1E40A 4OSUH 1BZQK 4XVTL 4AV5A 5FKPB 4BBWA 2FX9L 5GQBA 1KJ3H 1AGBB 1QEXA 1FYTE 5TGBA 3VWKA 3CQQA 3H1ZA 5GJTL 4HXAH 2A6KB 5DHXB 2EP6A 2IGFL 4PGZA 4D9QE 4KY1H 3OR7B 1G7LB 1D7BA 2EINB 3GRWL 2OR7A 4YDZA 1XIWA 1CDHA 1UXSA 3ZRCC 3MYZA 2HTKC 5DJ6A 4P8QA 3QQDA 1I75A 2E7DA 2WBJD 5FYLD 3LKSA 2UWEB 4ZMYA 3S48A 1C5BH 2IO5A 3ILQD 1I3GH 1QR4A 4CBPA 1RZ7H 4G70B 2AJ3B 1U8NA 2AEPL 4G6MH 5CMAB 2OBGA 4NQXA 3RWEA 3WY3A 1ZJBA 3BCDA 4U1MB 3VI3A 3GXMA 1JGLL 1OP4A 1R3HA 4MQXD 4BFKA 1CU4H 4Z78A 1IJ9A 1FFPA 4K3DL 3OMNB 4JY6A 3RZCC 1H3PL 4YZFE 5BZZA 4ODTH 2XKSA 5CIPH 4WUKH 2ED7A 3BIBX 5I18H 4JFZL 3S5LB 3TVMD 5DJ0B 4GO6B 1X3DA 1WA2X 4F33B 4YHIB 3TCLA 2WCPA 2AXWA 2Z34A 4UIMB 4Y4FD 4PRHD 1BBJA 1SF3A 3MLSH 5F1IB 4JM2C 4AQZA 1KZYA 4NCC1 4XZ4A 5GHWL 2P28B 2Y7OA 1FNEB 3KWWB 5GGQH 2I07B 4MS8C 3O41B 4DCQA 4KKBD 3V4PL 2X2HA 1GGUA 5TK2A 2EH8L 5EBMB 1YN6B 1Z7JA 4AK1A 2VITA 4GPVA 5GISL 1AQMA 4MKMA 5HYJD 3UX9B 1EVTC 2BIHA 2WYIA 1JZ2A 5INDA 1KDIA 3GRWA 3ULUE 1MNNA 4UM9A 1JE6A 3EADA 4JO3H 4KMLB 1WEJH 1WIPA 3FU9A 4MJHA 4PRDA 3ALPA 2ENPA 3ATBA 1GGIL 1S7XA 4MNGB 1QVOA 4AKPA 2APBA 2VDNH 3GSVB 3NPZB 3MJ6A 1XGTB 3BZ4B 1DVFA 1YN7B 2E56A 4MNQA 5EBWA 5IHBA 5DA4A 5E08H 5EC2A 2OXHB 1R0AL 3A5VA 2D0FA 2CHDA 2UV3A 1E7UA 3UTTD 4P2OD 4Q97A 3V5HA 3KJ6H 1JDDA 3ARYA 1Q9WB 4IGBC 1IIIA 2ZCLL 2QLVB 5E5MB 3TN0D 3UEQA 2JI2A 4M62H 4PJEF 4QRRE 3PP3H 8FABB 1FHNA 4XVSL 2D7TL 4OGQC 1TZIA 2F74B 3HIZA 4PGJA 4J3XA 4C4BA 4UQ2B 2AJUH 5I76A 3EG9A 1AG0A 1JNNH 2Q8BL 1JHKL 5HYQB 3V6OA 3ZHLA 5KVFL 4WSJA 3DX8A 1BLIA 3AWGA 1FVEA 4AIOA 3EOYG 1CD1A 4G8IB 3V4PA 3MBEC 3WMQA 4KZEH 2FSDA 1JGUH 2AV1A 3DSFH 4YAQB 2HPTA 4ZPVB 4AEIH 4YZFF 5DYFA 4YDNA 1CVSC 3IDGB 4GQRA 3QWOA 2WVUA 3F62A 4PJCF 1ET5A 5ACZA 4UNUA 2WZ6A 2X4SA 3BX7C 5IGXH 3QI9D 3H8NA 4D8PB 2MCMA 4X4YA 2EXYC 2NT1A 4L8DA 4WZ9A 2XZAL 2YSSB 3T4YA 5C0BB 4YHKL 3IB4A 1J8HB 4NM8H 5IKCA 3ATFA 4NO0A 4TNVF 2NMSA 4CGTA 2X40A 3V5KA 1E0OB 5J6HB 5F0JB 3JV6B 1QSVA 3FFDB 2SODB 4FNLH 3HNSH 1IGIH 3OAUH 4XPGH 4P2AA 2NY3B 4F8PA 3HPLB 4R8WH 3DIFA 15C8H 4Q74A 3IBOA 2ED9A 1A3LL 3ZHKA 1XF2A 4HPOL 4A63A 4W9KC 4X6BB 2MNUA 4APQA 1F3DH 4Q6YA 4YFDB 2R0WL 4P07A 1JZ3A 3SIKA 2QKIB 3B43A 2Y7QB 2Y7SA 4ZI8A 3Q6FB 3HMXL 3N42F 5D71L 1UYWH 5DZVA 4ZOCA 4JGMA 3VM7A 2LGNA 5MENE 2V7NA 4FQ2L 3HE6C 1VFAB 3D7PA 3MRIB 3W11C 4OFYD 2NSQA 3QB7C 4FLSA 1XXDC 2NY7H 4ZTOH 2ISDA 2EDQA 3QZWA 2AEQL 4MNQE 5DF0A 4R6UA 2YMXL 5IB2B 2H6UA 3K2KA 1HSBA 2ITCB 3QC6X 2X7LB 1U8HB 2NY6C 2XG5B 4P3WA 5ES4B 4NFBA 4MAYD 3VMNA 1MPAL 3QDMA 4GW5B 5TDPB 5EDXA 5A7EA 3K81A 5A3IC 1F2XK 2XG4B 5TDOA 3BAEH 4AQ1C 4K3EH 1OAUH 2BSTB 4LVNB 1JZHA 1M6UA 1N19A 1SDYA 2C1PB 4MJ2A 2BC4A 4M8UA 2VERA 6PAZA 3PL6D 2NNCA 1MEXH 5LBSH 3V6OE 2JKTM 1EX0A 4LF3B 2CDEA 1RK1B 5EORL 5CFHA 3ZU8A 3OGOE 1FVDB 1VCAA 1U8MA 1YPZA 2X89A 4W4OC 3NQIA 3CPLB 2V9RA 1QPPA 1KOAA 2D3LA 3E2HC 3OC5A 3QQ4B 1JZFA 3H2PA 3WKPA 3TF4A 5EU5B 5C0IB 3LEVL 2FL5A 1HQRA 4P23A 4EZJA 2FIRT 2NY2C 2DIJA 3MJ7B 3DGGB 4WEMB 3CSGA 5E8NB 4NQEA 3K4AA 1LO4H 3FQNA 4EVNB 5J13B 4XCYA 4U6VL 3L4CA 3N44F 3V52H 4UTBA 2E27L 3SE9H 1I1YA 3N6YA 4GMSH 3TT3H 2B59B 3VSQA 3UBXI 3GEWB 4LPXA 4Y2DB 1JZJA 5KYXA 1HOEA 3PWJA 4J1UB 1NCDH 1XCXA 3C2AL 4YSOA 2Y5EA 1CGTA 1MFUA 3NCFB 4JM4H 4NN7B 1W8OA 2FVNA 1MAML 5D7JB 4URTB 2R2BB 2C7UB 1MQ8A 1FORH 1UD3A 1XF4B 3KPSA 1KENL 4R4BB 3QIBC 1BYPA 2WNGA 1BJ1H 5I1KL 3LX9A 5JUEL 2VJXA 4ICWA 4W9JC 1MJ8H 1IGJB 2JELH 2VXVL 3S8WA 3NEOA 4OIIH 4NKOB 3TBYB 1LO5B 1ZSDB 3BPOB 1BDYA 3RUGE 1PEZA 1QFUH 4N3UA 4FJYA 1HVXA 2R15A 5DD3L 4F57H 4NQCD 5FYLL 1QEWA 4LSUH 5I16B 1TVBB 4KK9D 4X6CF 3CDGA 4JRXD 1OF2A 1G7HB 3AY4C 4WKXA 1A6TA 2XWBA 3F6JA 3FFOA 3K71A 3QG7L 3O81A 3KNBB 5IVNA 3BWUC 5CGTA 1F3RB 4OFVA 2QSTA 3ULVL 4FYQA 5IZ7A 3APMA 1S7TA 3AREC 4H1LB 3GSNL 5IROD 2DOCA 3TZVB 1MUJA 3K80A 3QRFM 1SHSA 5T1MB 1A02N 3AB0C 3DMMB 1HYSD 1T2QL 5K9JL 5F9AC 1TLKA 5DEGA 3L3DB 1KGCD 3V0AC 4ZMAT 1PFOA 4ATWA 4OLUH 2A77L 3DUUA 3WGVB 2X6BA 4P3CH 5ABDE 4NWUH 3WFEH 4B6ZA 5HHQB 4NZRL 3PJLA 5AOKA 4KQ4L 4OF6A 2ARJB 2B3RA 3SEPA 3U9UA 4DN4H 3MV7B 4CBZA 3OKOB 3VTAA 3P2DA 2EEAA 4RX4A 3QDGB 1C08B 4Z8FL 5C8JB 1XMEB 2EDBA 1A21A 3BUYB 4O58H 4FQJL 4LASH 1YPZE 1R3JB 3FW6A 4R7DA 5DURD 7FABH 3EXJA 2G5UA 1CLVA 2J1ZA 3DJRA 3CFCH 3MACH 2IQ9L 4HEMA 1KBKA 1DJYA 3TPKA 5E8OA 3UADA 4YHOL 5ICYB 2W07B 3K6SA 1HOCB 3D8MA 2HPOA 4P5RA 1OAZH 3SBQA 3ZZ1A 1SY6H 3KWXA 1E9QA 1N0LB 3O6FC 3ABZA 4JMXA 4LARL 1ITBB 3PPEA 3KLAA 4GMTL 2UZIH 3VWJC 1CF8L 3S36H 3QEGL 4LLUA 5E1GA 1NOLA 2K78A 2KPWA 4U6TA 1EEYB 1JK9B 2GTZB 3BSGA 3LRSA 3HA0A 4LPYA 1AAJA 1AY1L 3LXBA 3TVMA 1CICC 3OKDB 4F7CA 3QYMA 3CK0H 1CWVA 4G6KH 4F9LC 3HC4L 4TOYH 1LEGA 4HZ1A 4W9GC 5CHNA 4PRHA 5DS8A 1HH9B 1DCLA 2XN9A 2RA1A 3C60B 1IAMA 1IBYA 2NQCA 4WI3A 1KBWA 1XD1A 5FYJL 3U7YL 4GP4B 3H9SE 1R24B 2AAVA 4GRMA 3KPOA 2WC7A 4RNRB 4LCYB 2DLEA 1PAMA 2YD2A 3TCXA 3HHRB 2FWSA 2I26N 5I73C 5HYJA 1JNLL 2NW3B 5KJ7E 3MGAA 1CJYA 1RSYA 5HY9A 5FWRA 1JRHH 4OB5L 4IOIB 2OI9B 4UANA 2NY1D 2E8ZA 3KM2A 3D07A 1MDAA 3FHEA 1FA4A 4HA1A 3ZOAA 3HAEB 1IQDB 3FB8A 4I88A 1NAMA 3CXFA 2KERA 4BH7A 4AL8L 5FA4A 4HXBH 2A6IB 1GVIA 1WD8A 1K6QL 4P2OA 3DX6A 3ZTEA 4WFGD 4YC2C 4CDHA 1J0HA 2B20A 1N6UA 4TVPD 5K9QI 1YNLL 4AYFA 2HX8A 5J1AA 5I1JL 5JHDD 1I85A 3I74A 4PJ9B 1VPOH 2NY4B 1V3MA 4FMFA 4P9HL 4UF7C 4R96A 4FCAA 2AF2A 4O00A 5B1JC 3QIWA 3HR5A 5D72H 5DZAA 2I25N 4JPWH 4L8SB 3U2SA 2DQIL 2NW2B 3LN4B 4Y4KB 3WOVA 2G30A 1HFUA 3MRRB 1W8EA 4RGNC 3MXWL 1X5IA 1LP9A 3MLXL 4M1CC 5TJWK 2F54A 4XNUL 4WI2A 4L48A 5D5MF 2XPGB 3U1QA 5HDQL 2WQWA 1FZMB 4JM2F 4QJ4B 1XGRA 4CAGA 3AS1A 4JJ5A 2H1XA 1CD0A 3ZDYB 2OTUA 1XL4A 2UXGA 3VXRA 5JHLH 2ARWA 1ASQA 1F90L 2R0LL 3X3FH 2AVGA 5CEYA 4ONFH 4HXAL 4PD4J 1UJ3C 2APTA 2IWGA 3CFDA 1L7IH 1M9SA 4HWBL 4KY1L 1OP3H 3T65A 5IW1A 2I9TB 3IDYC 3ROOA 2CGYA 5G4MA 4H88H 1YYLH 4OJAA 5TDNB 1O6SA 4J3BA 5KSBF 4S2SB 1NC4D 3T4AC 3FRUA 1C5BL 3O6MH 1E27B 4N2EA 4NWTH 2UZXA 2E7HA 5EULV 3ZDXF 5IMKA 4C4KT 1UWEL 4G6ML 1L0PA 2J21A 3KYNB 4TUKH 3KS0J 4I0PC 1YC7A 3I3BA 4LMQI 5HYJE 3D3VD 3QDJD 4JVPA 4KX7A 5E5LA 3VD5A 5TH2A 3SY6A 1OAXL 1KBBA 5BW7C 4CDGC 3V0WL 4ODTL 1CE6A 1VZGA 2J8UA 4MJ6A 4OLWH 3DRQA 4IMKA 4OFYA 3PFQA 2Q7YB 4QXVA 5G55A 4MRBA 2ZXWB 3MLPA 4M61B 3B9VA 5DJXB 3L3JA 1WC7B 3SKNA 4BE5A 3DRTA 3V4VB 2Q86A 3WEXA 3QQ3B 3ETTA 4LOVA 3MCKA 4Q9QL 1CDGA 3O0RH 2GAZB 2ZIDA 4U1IA 3TBTB 1BBDL 2EXTA 3UTTE 2VW4A 4HT1L 1CBVL 3SPJA 4FXGC 4HGWB 3CX2A 5I0YA 5GGQL 5KAQF 5ISZA 2QMKA 2DEYX 2D7MA 3WXVH 2XTLA 4HIJB 4IHBA 4PW4A 3S36X 1BVKB 2NXZC 3MODH 4GOSA 2QFRA 4QPEA 4GY4A 2RCSL 4Z95H 5CBAA 4AIXA 1J1PH 5HDOA 4H1LH 3RL2A 2XJLA 2YAQA 5G5DA 5KSUA 1R17A 4H44C 3LN5A 4PJXB 2K70A 4BINA 1OD7A 5CEXB 3I02A 1K85A 2X42A 4UQDA 2B39A 3EYQC 4JHVA 5DUMH 1WQVT 2I85A 4LRNH 1LP9E 2OLDA 2MPVA 5C0CB 4Q6IC 2BOCA 2WTRA 1YEWA 3SY0B 2F1EA 1FIGH 2J5WA 1S9WA 3HC3H 3LYRA 2K1MA 4UI2A 5K9OA 5CIPA 1DTUA 4AEHH 4M62L 4JDZB 5B7FA 3OZKA 1OXYA 1TZAA 4OQ1A 4X8JA 4UQEA 5D70H 1AS6A 4ZO8A 5M94B 1RQ5A 1FCGA 2QVIA 4M7LL 2QZQA 2AJUL 3NZ8B 1UA6H 4PLJC 3K1DA 4R0LC 5T1DL 3L5WB 3NCYS 2Z91A 5C0BD 4N0FA 1RJYA 4HJGB 1TTUA 3BH8A 3KBPA 3HMWH 1Z9PA 5CF3A 4E41D 3SZ6A 5LVEA 3DK2A 4CW1B 3CD4A 4ZSOA 1UD2A 3DSFL 3FZUD 1RZIB 2EADA 1O9WA 5KG9B 4K5PA 4EIBA 4JPQA 4U7SA 2VLLA 4LP5A 4EXPX 5KYNA 1T80A 1T1ZB 3VYPA 5GZND 1RU9L 1V54B 5ERWB 1PEWA 2AC0A 2BINA 2BWDA 3U0PA 1AYRA 3HBQA 1NCJA 4F24A 4DKTA 3JV0A 4NQCA 3SYAA 1XD0A 1S7RA 1SVCP 1MJUH 4QRQA 1NFDF 4JRXA 1QR1A 3CIQA 2VDQL 4HH9A 4LCUB 5BV7B 1ZLVK 4NRXA 2I9LA 4N9GA 3MA7A 3TWCH 2GITB 5AAWA 1FH5H 5CLZA 1IGIL 5IROA 2BVQA 3OAUL 4XPGL 4AVIA 5JXEC 1EZVX 3HZMA 2AK4B 4R8WL 1E28A 5JO5A 15C8L 2NR6C 5EO0A 5KSAB 4HKJB 3EFDL 4Y7MA 1V5JA 2Z93B 4ZUWB 3R06B 4TUOB 1D7CA 1JCKA 5K9KB 5BRZA 3RGVA 4FFYH 3LNHA 2PMZA 3WY4A 2TSBA 3FRPG 3NIGB 1PMYA 5EC1A 1UYWL 2N56A 3ZTCC 2H32B 3CVBA 1IVLA 3V6ZB 1Q1PA 3P4NB 3RVWC 1JDAA 3HAEH 4EN3B 2QEJA 5ANHA 5IV2B 2WQUA 2NY7L 4KZCA 4ZTOL 1T83C 5I66B 1KULA 4FQPA 5D7HA 4X80L 3JWNC 4FTVB 3FCBA 4JREB 2BSBA 2F8XC 3TNMB 4WEEA 1NGZB 2AI0L 2Y22A 3CZNA 4D9RD 5CGYC 5FF6B 5BUGA 3B7SA 2M2DA 3BAEL 3GMQB 4K3EL 2Y1AA 3DXAD 4N5ED 3RY4A 5E8EA 1OPOA 1FZJA 4PJAF 4R26H 5LDUA 3K5RA 4WI8A 4WKZA 4AQOA 1USQA 3N1PC 1WBYB 3OHXC 2A7BA 1AR1B 4KJQD 2OXGA 4KI5C 2BZ7A 3LHPH 4LVOC 2BVUA 4M4RA 5CLXA 5B8CB 5CZKA 5CSZA 1XH0A 4XP6H 3MLZL 4DUXA 3SOBH 4LVHB 1P7KA 1GS7A 1WT5A 4LSVL 3MO1A 3B83A 3BWUF 2OA9A 1JYWA 4HV8B 2DMBA 1C16A 3ARPA 2YGNA 2ATKB 3L1OH 4YSTA 4FFVC 5D7JD 3RJQB 1LO4L 5GSRB 4D94A 1A5FH 1E3ZA 3V52L 2QMJA 4TVSa 5EUKB 3F7VB 3SE9L 4X4YB 4DAGL 2WB7A 1IV8A 1ZXKA 3EW3B 4K3JL 4LLVB 3TT3L 3SDDA 3IMVA 4O2EB 2A74A 3BH9B 4HIEA 1HHIA 1NCDL 3S5ZA 2MSPA 4K8RH 3ARXA 3DETC 3TYGH 1DJSA 3MBWA 2F53B 3VACA 4QKXB 4BK4A 3HZYB 4NDMA 3TPUB 4P5KA 3BEVA 3O3DB 3TBCA 1KCLA 1DHKA 2O4EA 3HZ3A 3BYTA 3J07A 4KU1A 2CU9A 4KJYA 2DQEH 5AFAA 1KGCE 1HILA 4C58B 1MJ8L 5ICZB 1HKLL 1IGMH 5LBSA 4EDXA 3WBDA 1G9NC 2VIRA 1ND0A 4PG2C 4TLUA 1W80A 3N0AA 3BVUA 4PHXA 3DTUB 4FGMA 2DW5A 1VEPA 3B7YA 4NQDD 1KEMH 3W2DH 1ZDSA 1OEZW 3QUGA 5AL8A 3V4VH 2FH6A 2WP3O 5JHDA 4O2CB 1I8KA 1M42A 2ITEA 4U1NA 5EU6B 4PJ7A 4F8OA 4UQBA 4KWUA 1UC6A 4BCYA 3VVVA 5FYKU 4EDWL 3BP5A 3MV7D 1R33A 1ZIAA 4H8VA 2X1XR 1MFVA 1BZ7A 1HHGB 1UFUA 3UYPA 2EE6A 5AOMA 1SOKA 3QXUA 5BS0B 3FB6B 5D2LE 3SDCB 2EVIA 4IM8A 5FKPA 1LK3L 1AGBA 3WN5B 4TXVB 3DX7B 1C5CH 3LPOA 5EUOE 2FO1A 2A6KA 4OLUL 2RMNA 2BHYA 3PWPD 5T1KB 3OR7A 1G7LA 4P3CL 3BRGC 3WFEL 1FFNB 4YDVB 4R4FL 2HLFD 5I1EL 2D31B 2UWEA 4DN4L 2E86A 5DZ9A 1N18A 2KBGA 2KZ1B 3UPCA 2AJ3A 4O58L 3TJHD 4XI5D 2PYEB 2F2HA 5JPNB 4ALAH 2XIDA 4U1MA 3C09B 1P9MA 3DDGA 5AW9B 4Y5XC 1E9PB 1OGPA 3CFCL 4GI6A 3WO4C 4CILA 4X6DE 1QBMH 1OTUD 3JXAA 2JV6A 3W9EB 4OF5A 4X9GA 3EH3B 3VXNB 4JANB 2DQDH 2WWMD 2J20A 4NZFA 3B8YA 5DJ0A 4BE6A 3KJ4C 3A24A 4F33A 5J9PB 2BRQA 4YHIA 1SY6L 2ZG1A 4MD5B 3RPBA 3R4DA 4LAJH 4MRCA 1TR7A 4NT6B 5EEVA 4AIZB 4J3OH 4G8GB 3GI8L 4GBXD 4UIMA 3UTQA 3T1WA 4R9HA 2UZIL 5F1IA 1EFXB 1QABA 4W9ZA 5HBBA 1ZVYA 4P46C 3RDTB 2ZKMX 2WZAA 4PJGB 3S88H 1PTZA 1FNEA 3CBKB 3KWWA 1AOZA 2OL3B 5DEJA 4GS7C 3SKJL 2I07A 1EHXA 3O41A 1IGFH 3PG2A 5EBMA 1YN6A 2J1KA 5ENWA 4MZRA 4G6KL 2B2XH 4P2CG 4W9CC 5AAMC 3VFPB 3C6EA 2NNAB 3WD5H 1GGCH 1JCVA 4MNGA 4WFGE 3MV8B 5EOCH 3QA3B 5B4MC 3GSVA 4MB5A 1XGTA 3BZ4A 4TVPE 1YN7A 4G1EB 5EZJB 2OXHA 3BVWA 4FERA 4OIBA 2R1XB 2XQ0A 1I82A 1QUNB 3M1OA 5EIQA 5IVOA 4L5FL 3WHE1 2VMJA 4MJIB 5JHDE 3LY6A 5BV7H 2BY2A 1Z1WA 1DSYA 1JRHL 1Q9WA 5GPRA 3S5YA 5E5MA 2YD3A 5BJTB 5F6IC 1B3IA 1XGPB 3HFFA 3SYCA 8FABA 3Q1SH 5IQLA 2F74A 4X7TB 1SY6A 1Q9KB 3FQ1A 2GK0B 4UQ2A 4XWOC 3VRJB 5CN1A 4F9PA 5HYQA 2EJ1A 5IVXF 2ZYIA 1CS6A 4RGMB 3QJRB 2H32H 5KBKA 1J1XL 3GB7B 5CP7B 3FJTA 2C3VB 4GFTB 3STLB 3FS9A 4G8IA 3RTLA 3CCHB 4KH2A 2QGBA 3ASOB 2PCFA 1RP8A 5CINH 1CDIA 4YAQA 3BKYL 4B9FA 3NCEB 5JIMA 3R1GL 4R5VA 1M7XA 4KO5A 1SN2A 4H8WC 1VPOL 3IDGA 2ESVD 5E00B 4HUNB 2R59A 4XNMA 3O4LB 1DBAH 1OB0A 4D8PA 3D34A 4KNQA 4KKAC 3FQUB 1M1XB 1RZQA 2E6JA 2YSSA 1QD0A 1RLBA 2WN3A 5C0BA 3IGLA 4JPWL 4ZAKD 1J8HA 2N1KA 3P4LA 4HK3J 2GPZA 1R46A 2OSXA 3WXWH 3A6CH 2P5WD 1CQYA 3IXTB 5J6HA 4J3VA 2IFFH 3AM8A 4HAFA 3JV6A 5FLUA 1JPSH 1Z0NA 3C5XA 2B0SH 4K8RD 3FFDA 5K59E 4Q2ZB 2H0EA 1ZHNB 4R84A 5TQ0L 5GZNA 3D3VE 3QDJE 1S3KL 5D9SB 5IBUB 2Z8RA 1Q94B 2P5PA 3HPLA 3IWUA 2IPTH 4NJ9H 4PM1A 4FXKC 5IJDC 4V2CB 2DQCH 4X6BA 3VJ6B 1AD9B 5JHLL 3T8XB 2CR3A 3LMJH 2Y7QA 1S9YB 1OIOA 4GAGH 3QPQC 3Q6FA 2VZ3A 3X3FL 4KDVA 5A2BA 2IJ0C 1T20B 1Z66A 1L7IL 4W6YB 4J3TA 3NIFB 4KC3B 2O6CA 1J5DA 1KDJA 1VFAA 2Y1YA 3MRIA 5JDSB 3R18A 3N43B 4H88L 1XH2A 5JOPD 3P3RA 4MNGE 4FRWA 4IOSD 3O6ML 4M6AA 1CVRA 4NWTL 1JXDA 4L3EB 4B95C 5IB2A 4KTEL 2ITCA 4I13B 4R3SB 5D1ZC 2X7LA 3G5YB 2EDOA 3MC0A 2XG5A 2X38A 4TUKL 4HFUL 4U6YB 4GW5A 5TDPA 3IE9A 1UQSB 2OMXB 3LIUA 1O7VA 4HDIB 5CEZE 1NANH 1TT6A 1W72B 2IWKA 2JLPA 3REWB 3V9EA 4RMSA 2XG4A 5GZOD 3UJTH 2BSTA 4WY7L 2Q87A 5SX4I 5DJ8B 1PD6A 2UYLB 2C1PA 3BVVA 4HK3N 4EIGB 4WENB 2EDXA 2WXIA 5HI5D 2FEEI 4LOEA 4JZJB 4PPTA 4LF3A 4S0TD 3BYYA 1EHAA 5E5RB 1RK1A 2R1WB 4AM0Q 3Q8CA 4RFOH 1FVDA 4WJ5B 5CLWA 4L23A 3MTXA 3CPLA 3VWKC 2HAZA 4E0RB 3QQ4A 5JHLA 4I9XA 2HSIA 5KOVC 1MCPH 1JV2B 4ZMNA 1U92B 2E7LC 3WXVL 2LU4A 5EU5A 5C0IA 1XIWC 3HS0C 1H6EA 3MODL 2X3CA 4LEOB 4NB7A 1XZWA 3DGGA 3MJ7A 1MIEH 5E8NA 3AQDA 2VN7A 2BP0B 5IREA 4EVNA 1KY6A 3TJEH 1IAIM 2WANA 4W9HC 2C9SA 5AW7B 5K59F 1S7WB 4J3OD 2B59A 4GRWB 3X1BA 1LO0H 4E41E 4F7EA 4Y2DA 5EU3B 5G4NA 4J1UA 5EIIG 4LRNL 3WE6B 2Y06H 4HF5H 1QSEB 2QBWA 3EO9H 4AM0B 5DTFB 5HPMB 2GSIB 1FIGL 1QRND 1I9RH 1DE4B 1INQB 1H15B 5D7JA 2DYSB 2R2BA 1YEFL 3DGCR 2C7UA 4N0YH 5LNEA 5DZNA 1BW8A 1SHWA 1NIDA 4AEHL 1XF4A 5D70L 4R4BA 3PWVA 4G6JH 1NCCH 3UIYA 5ID0A 2FZ3B 3MRNB 1IGJA 2R0ZH 4M7JH 2XWJB 1UA6L 2DLTA 4NKOA 1LO5A 1ZSDA 3TBYA 4QNPF 4YDLB 5K1JA 3LZQA 1MY5A 2E8YA 5T3XL 3O3AB 5BZXA 1PNDA 2ZTBA 3OZ9H 1FNAA 1U4FA 1TVBA 3EBHA 3KVDD 3F3HA 4KKCC 4QYOB 5I16A 1WWWX 1G7HA 3X3GH 3V0FA 5AOIA 1E5UI 4Z7QF 1GOHA 2E4FA 2EZ0D 2N59A 3APCA 3KNBA 5E2TH 2Z0UA 3IKCB 2GEQA 3MOQA 1TCRA 3G6JB 3RZWA 4QXGL 3T0BA 3TZVA 2OL3H 4DP4X 1B6UA 1F13A 1XSKA 5T1MA 3DMMA 1Q0YH 1F1GA 1DVFC 5KSAD 2WZ5A 2WYTA 5IJVB 3K0YA 3L3DA 3UG5A 2ZX6A 3F7RA 4A2MA 1MJUL 2X44D 4W93A 2X4TB 1D7DA 2CJTA 4ACPA 3H6AA 2ATPB 2DD8H 4A37A 1X9UA 3MV7A 3T2PA 3OKOA 1I8UA 3N1GC 3QDGA 1C08A 4KI5F 3TWCL 4GUQA 5DMGD 4EN3D 1OSZB 5AW5B 1I3RB 1FH5L 2F68X 3BUYA 2XSKA 1ZLUK 5C8JA 1R3JA 4D9RE 1D9KB 5EZPA 2XXFA 4RVBA 2FBJL 4X5PA 3SPIA 4IOFD 4IBQA 3E1ZA 2XXCB 4OLVH 1MZYA 1YJDH 3DXAE 4FFYL 1B88A 3P11H 5ICYA 2W07A 2K8QA 3BW9B 2CRMA 2BSEA 5C86A 2OW7A 1A3RL 5D2NE 4IRJC 3P0VH 1FIEA 2XACC 2I7SA 3MMEB 1B0RB 1IILE 1N0LA 3GFUA 2NX5B 2VDPB 3EF7A 5K5YA 4IJ3C 5KBPA 1NGQL 3QR1A 5DFTA 2ENJA 3GUTB 4UTCA 3U6XA 5L9DH 1Z32X 3H54A 4FQXD 5C0AB 3CSBA 1ZGLP 4FKEA 1EEYA 5ADPL 1YY8B 3MJ9L 1JK9A 2GTZA 4HMEA 4PJ8C 4YNYB 1D2PA 3I85A 1YEDB 2RB8A 2WXJA 2WBWB 1SJMA 2AAAA 4YLBA 1B4LA 3OKDA 4FNPA 3US0A 1JFHA 4OJFL 1BV8A 4B9ZA 4I8DA 3EJQA 3HS9A 4U33A 3V0VB 1UWXK 4QLRA 2ITDB 4J2QA 1BCIA 2EQDA 5ALCL 4MAZA 3VFVB 1HH9A 4W9EC 1N26A 3C60A 1MAJA 1QFWM 3VRIB 4QXUH 3VNZA 3LHPL 3BIKB 1FGVH 4L4VD 1R24A 1R5WB 1J5CA 4APQC 1DJHA 1ML0A 4RNRA 1O75A 1RIVH 4LCYA 3MFGB 4UT9H 1WIOA 1IKNC 1TMCB 2EXWC 2NW3A 3MLWH 3SOBL 4I18B 2V5MA 4Y89A 4FFYA 5I9QB 5ABAA 3TWYA 5I6NA 4YSQA 5J1TC 3DO7B 4IOIA 1GSKA 2F53D 3FN3A 5HI3D 2GQHA 5FV1L 3P2BA 1UWFA 2LV4A 3L1OL 1B3JA 3HAEA 4BELD 1IQDA 2V5RA 1A5FL 4NQDE 1Q9OB 1WWCA 4WV1B 5F6HJ 4PTUB 2EDEA 2BNUB 1FE8H 1W6LA 3ARGC 5CJ8A 3BFQG 2A6IA 2JJSA 2HA1A 4NNPH 1U8LB 1TNMA 3WJMB 2ZUSA 5B1KA 2HUHA 2YA1A 4K8RL 5HHVH 4FA8A 3TYGL 3JUYA 2B15A 3MV7E 3RI5F 3ZDWA 2YN3A 1E4XL 4P5SA 4GW1B 3UIZA 4M93C 1I9EA 2X4PA 5EU6D 2QTVA 4PJ9A 4WU7B 3S35H 2BHUA 1FNSH 4NPKA 4WWNA 1W72H 3NGBB 3PWPE 4M9OA 1JPFA 3HS8A 2VO8A 1EZLA 1S2EA 4G7SB 4L8SA 2NW2A 3QIUB 3KDPB 3LN4A 3MUUA 4Y4KA 3MRRA 2PO6B 1KEML 4MAUH 4YHYB 8CGTA 4G80B 2DTSA 3V4VL 3P4OB 4AZUA 2XPGA 1X5ZA 4HULB 1FZMA 1P2CB 3GO1H 1U3HB 3EHBB 3G5VB 4F7TB 3WUWB 1A7OH 1JWUB 4XNYH 3WLBB 2Q0ZX 1BMZA 4M7ZB 4KROC 2RQ8A 3GPEA 4JVUA 4ZAKA 5DUBB 1FJ1B 4Y16B 4XOBA 1SZNA 1TVHB 2VR3A 5EEWA 3AS0A 1C5CL 3P69A 4HIPA 5GGUB 2I9TA 3LVTA 1KGIA 3IJYB 1AGFA 4AGQA 3APFA 5E23A 3CXDH 1XSIA 2OR8A 2YQBA 5TDNA 3OZLA 3JWDL 2YUVA 4S2SA 2Q2EB 3RWCB 3I6SA 3WFDL 1E27A 4TUJB 3QS3A 5DUPH 1YYCA 1OK8A 4G8GD 4GRWH 3KDMB 2JWYA 1CXHA 2N7BA 2ZKHH 3TT1L 3KYNA 1EFXD 3QT2A 3F12B 5D1QD 3LB6C 1IBGH 4WK4B 3RDTD 5JPMC 1LWJA 5AW3B 3ZR6A 3EFFB 4L9LB 4X50A 3DX4A 1KYAA 3E3QC 4FL4C 2FE0A 4JO2L 3O4OC 3Q48A 2DRUA 2W60B 2DQDL 4XNZB 3GGWB 4JO4H 2BM3A 2Q7YA 4HCFA 4EKJA 3QUYB 2YEQA 2W9LA 4M61A 1USZA 2ICEB 5DJXA 1WC7A 3BRFA 4Q9RH 3V4VA 5AAPA 4GKNA 3FYIB 2Q8AH 2YC1B 1I8MB 2FO4B 1U6AH 2H6OA 3QQ3A 3WENA 4DKFL 1G7IB 4Z7OB 1L3WA 3GZPA 1PZCA 5AOLA 2J44A 3TBTA 1B2WH 3C5JB 2EO7A 3D4CA 3MV8D 4HH8A 2EUVA 4HGWA 5GZOA 1IC5H 5HD8C 1QWNA 1SXZA 3D39D 1EEUA 4HIJA 1SNRA 4R7VA 3RVTC 4FYSA 1BVKA 5BNXD 1M05B 2B2XL 3KLQA 4OZHF 4HCIA 4JFVA 2WMPB 1DJIA 5G2NA 3EUDA 4BFGA 3WD5L 5C0NC 1KSRA 1GGCL 2HKAA 5JHMA 1MRDH 1NWOA 4I3RL 5ADOL 1LMIA 2I24N 4PJXA 4XCFH 2VDMB 3ARBD 2YUZA 4PYHA 4N24A 2DQJH 2IFGA 3O8XB 4YVUA 2Z6FA 4GAJL 1G84A 1LE5B 4NGHH 4N90E 2EICA 4TNFA 1CFMA 2XQYA 2C4XA 4PAZA 3SY0A 3VRLF 4JN1H 2ESVE 2KYIA 3RHWF 1TTCA 2YXMA 4QRSB 3VB8A 5F6HI 3SDAB 3ZDYE 1CG9B 3Q1SL 4P04A 3KPRD 5IHZA 4NZ8A 4HHWA 1BXVA 2FLRT 4OTXH 1DEEB 2CHZA 2TSAA 3ULVC 2UZYB 3NZ8A 4RWYL 2P5WE 4H8PA 4MVBD 2XOTA 3L5WA 2VSKB 5BUAA 3H55A 4TUUA 4LIQH 3ZO9A 4HJGA 1IBHA 2KKQA 4XHQA 4DZ8B 2YRBA 5E6UB 1CXLA 5JMOC 4XN8A 4Y5VB 4CW1A 5CINL 1ILUA 2VDPH 1RZIA 3UPAA 4RMQA 1T4WA 5KG9A 1HZLA 4P0DA 4R5XA 1PVHA 1JPGB 4LBEB 1ROCA 2J4WH 3AS3A 2WIIB 1T1ZA 1OAQL 1SLXA 4AT6B 1M7IB 4O9HH 5HYSB 2A6JB 5DJAA 2W65B 1E9OB 1SRDA 2CWRA 4N0CD 5CCGE 1HI6B 4KV5F 3NEXA 3IGAA 5JOPE 1HIMH 1U2YA 3OPZL 3WXWL 2L7UA 3A6CL 2VLKE 1OCRB 1PLGH 2B5IC 4LCUA 4UAOC 1FF5A 4PJDF 1JPSL 5HHNB 2B0SL 4Y0GA 1P6WA 2GITA 3VH8B 4Z5RB 1HZKA 3PNWB 4DHLA 4QGYA 3S97C 2AK4A 1DQMH 4NQVB 5KSAA 1OY3B 1Q90A 1V7MH 4HKJA 4UNIA 4CSZA 3SYQA 1JZ6A 2Z93A 5JOEA 1QP1A 3NRQA 3R06A 4TUOA 4Y9CA 1X4ZA 1EAOA 4NJAH 1D3CA 5K9KA 4J27A 1GZHA 3LMJL 3RGHA 4P2OC 3SHSA 4GAGL 1NEZB 4U31A 2KZWA 1A0QL 3N41B 3GD1C 4P5TC 1CLYL 2H32A 2ZOTA 2DQUH 3OJDB 3V6ZA 3P4NA 4O02L 4MFHA 5HVHC 4POZD 2H0PA 3SPVB 4HS3B 4LHUB 1LILA 4EN3A 4HCGA 2X2JA 3VFWB 3MRQB 5IV2A 3MZGB 1TITA 4ZTPH 3GMNB 1U0QA 5I66A 3M7OA 2NY0B 4GKSB 2X70A 3EH2A 5FOJA 2V8LA 3QIWC 3TNMA 1VDGA 4WWKB 3TGXA 1NGZA 2EDYA 5MEQB 1B0IA 3BDYL 4XAKD 5FF6A 3GMQA 3UJTL 5I74B 1R75A 1BIHA 2CNZA 5E7FA 5AKRA 4FJZA 2GHZA 3VGAC 3WS6A 5DJ2B 3FU8A 1YC8A 4PJIB 3MJWA 5CJXA 4PMEA 1CC3A 5DO2D 4NCC2 5FYJU 1H3VA 1V7NL 3WAJA 2FK9A 1HAWA 4FQXA 1WBYA 1ODAA 3KS0H 1ID5I 5B8CA 5GRWA 3FO1B 4RFOL 1QW9A 3B2UD 2F5BH 4AL8C 1CFSB 1QRNE 3OQRA 4CU8A 4TVUA 4L8CB 3T8VA 1EMTL 4N87A 5GRUH 1WCBB 4FZEL 1OTSD 2CDGB 1QSED 3AQZA 4S1SL 4R90H 2IEPA 3D09A 1U3YA 1LM8V 3MLUH 4HV8A 1NPUA 5TPWH 3QZPA 4WO4B 2ATKA 3SDXE 4WI9A 2OMBA 5ANME 2DKUA 2EH7L 3C8HA 1FPTH 5GSRA 3GINA 5DHVB 3APDA 4G7QB 5CJOL 5D1XB 5EUKA 2WWNA 2QSVA 3ECBB 3F7VA 4PJFB 4W9FC 3MBXH 5CSBA 4P9HC 3JBG7 1VADB 4ODBD 4FI6A 5AB0A 4LLVA 5BMFL 4O2EA 4HEPA 1LO0L 1Y1DA 1I8IB 1KTRL 3BH9A 4LL1A 4LLWB 4WHDA 4XTRD 3VXMB 3UPRB 2Y06L 2PPDA 3MUZ1 5FPIA 2LLGA 1OHZA 3GKZA 2CR6A 4PI2A 2F53A 1RIUH 1V55B 2FAUA 3HZYA 1WCQA 3F7LA 3TPUA 2A38A 3O3DA 2XFGB 1RZFH 1HC1A 2JCWA 4N0YL 5GS3A 1TJIH 4HQQH 5ALBH 4XO5A 5IESH 2BS71 3JYBA 3O3BB 2ZUXA 2W5PA 2ODHA 4G6JL 4H26B 1NCCL 1J9RA 2IGLA 5ICZA 3EJUA 2R0ZL 3T6WA 4KK8D 1I1FA 4JB9H 1T89C 1C5DB 3OQ3B 3IS1X 4HS6B 4FULA 5GJSH 3O2DL 1S7SB 3OZ9L 1ORSB 2BIQA 2AXFB 1DBMH 3VXSB 3X3GL 5EU6A 2B9BA 1A1OB 2YLHA 4JFED 5F3FA 4JQIL 4KXAA 3D9AH 43CAB 1FNGB 2XA3A 4KOCA 3BKCH 1HHGA 2OL3L 4NQSB 4Z3JA 5DRWB 3JWNG 3FB6A 3SDCA 2ERJC 4KO7A 5IBTH 1FFOB 1Q8MA 4ZODA 3AROA 3WN5A 4IU2B 4RBPK 3DX7A 2AK1H 5T1KA 5IHWA 2OMUB 4JPKL 2JKWA 3L4XA 2YD1A 4YDVA 5IM7B 5C92A 2D31A 3GLDA 1AMXA 2DD8L 4M6ML 3IMSA 4WK2B 4XP4L 1JZ8A 1KN4H 1AHMA 4QDGA 3CHXA 2E9GA 2NX5D 2VDMH 1CUOA 5IK3B 1EFQA 2PYEA 5JPNA 1RUQH 2D9QB 1OKEA 1MW1A 5EU7C 2P80A 3WIHH 2ZUUA 3BFOA 4NC1E 4FADA 3TEZA 5FUCE 3VX0A 5DMYA 3DO3A 2Q7AA 3P11L 3W9EA 1H5BB 2RH0A 3ILPB 4B5EA 5IW3A 4JANA 3ZRFC 2AJYH 2V3EA 5AZEL 3KG5A 3P0VL 4HOZA 1KT2B 3OV6A 5J9PA 2RGSA 3UBXA 4MD5A 5DRXB 2HG5B 3L7EB 2IIJA 4FQHB 4NT6A 2GIYA 1GYVA 2CGRH 4L4VE 4XN2A 4AIZA 4G8GA 4YR6A 5AVVB 4LSTH 2EDDA 2YAOA 1EFXA 1K3IA 4RLDA 3RDTA 4JY4B 4XX1E 1B0WA 1IUZA 4YHPB 3T3PE 4PJGA 2F18A 2X9XA 2MNWA 3FU7B 4EUPG 2OL3A 1KPUB 2F53E 2XXGA 3F01A 3QHTC 3GUFA 2XYCA 3H9HB 3NQKA 1ZLDA 2XV3A 4F3FB 4U0RC 1A6VH 1XGQB 1EJOH 3VFPA 1THCA 1U21A 4K7PH 3K2UH 1O0VA 1OCCB 2NNAA 3L2NA 2AVFA 2XYBA 3LIZH 4GLRI 5AAWC 3QAZB 1JPTH 1KWGA 5CLYA 3MV8A 3QA3A 4QXUL 5INCB 1E2VA 4L1SA 4G1EA 5EZJA 4F7PB 3RGVC 1RIVL 3FN9A 2F19L 3D39A 4KZ0A 2R1XA 4MD0B 4N0RA 1QUNA 3FUDA 5I6MA 3LNDA 4MJIA 3VYNA 3MLWL 2GTWB 3UBFA 4XP1L 1WZKA 2V5YA 1HTYA 2VRAA 3RVXD 1YAIA 1WGVA 5BJTA 1E5YA 1XGPA 3DX3A 4X7TA 3T2NH 1MVYA 1Q9KA 2ZOLB 2GK0A 2NXYB 3ZDZB 2ICWJ 1BG1A 3ARBA 3VRJA 2W0KA 1NCNA 1E43A 2JCCE 1VLXA 1QWHA 3DV4B 1L7TL 2BCMA 2EIKB 1MJJB 3BE1L 4NNPL 4IRSD 2E9IA 1DVXA 3GB7A 5CP7A 2C3VA 3QIUD 3STLA 3UAJD 2PYFB 2BPBA 1H8LA 4HSAC 1BVZA 3CCHA 5D93B 1EBPA 4ABQA 5HGGS 2CRIA 3A67H 1S8DB 4KK6D 3KPRA 1NBVL 4EZKA 2DMCA 3S35L 1FO0L 1MRCL 1E3FA 4D0CB 3A4EA 1FNSL 1ZDQA 1U3HD 3O4LA 3FQXB 1CYXA 3FQUA 4N2FA 3SO5A 1M1XA 1KBVA 5IT2H 1I7RB 1E4KA 5JW4R 4DVBA 1YNTB 4JHWL 4MDRA 4UT9A 3LQMA 4Q0XH 3IXAB 1AQDB 4G8GE 5FKAB 1SPDA 4Q2ZA 1ZHNA 5D1QE 4JKMA 2EDTA 1HL8A 2R7EB 3HHSB 1P6FA 1QLEB 2IBBA 5D9SA 1ZTXE 3UXFA 2CR0A 1Q94A 1A7OL 1E4JA 1N4XH 3C8KB 5AW6B 5ILTH 4XNYL 1P7HL 3BN3B 4UUJB 3ARFB 2FX8H 3VJ6A 1AD9A 1PKQB 2COQA 3SDDC 3VYOA 4BIKA 3T8XA 4DNLA 3QFJB 1S9YA 2RHEA 1HHKB 1B9KA 1CLZL 2ZUQB 2BSSB 5LXVA 2AJZB 1HEHC 3V0JA 2Q3ZA 5B3SB 5CD5C 3BZ5A 2O93L 4U6XB 2CQVA 3D52A 3ECVA 1HNGA 3D18B 4XB7A 5JDSA 4N1CA 1UXLA 5DHVH 1NIFA 4HS8H 4F1SA 3LQZB 2Y6TE 1BG9A 1X5AA 4Y5YB 4O4YL 1F8TH 5DUPL 3AXIA 5MP6H 4L3EA 2QSCH 5SWZB 3ZZSA 5HYIA 2IANB 1AZCA 4R3SA 3D39E 2AFNA 2ZKHL 3G5YA 4U6YA 3KLHC 1PSKH 1UQSA 2OMXA 4HDIA 4MMYB 4OH2A 1W72A 2CGZA 4PJBE 1CGUA 1X7TA 1KCRH 1LGVA 4OCNC 3REWA 3IGKA 1UOVA 5H37H 5C71A 3WNMA 1IFRA 4XXDB 3EKCA 3H0TB 4ZOBA 3L4TA 5DJ8A 3LD8C 4JO4L 1W0YT 2UYLA 2O5ZH 1AYOA 3M46A 3ZQXA 4Q9RL 4N5UA 3ULVF 3VW3L 2Y6SD 1U6AL 3I6GB 4Y9FA 2XNAB 3CIAA 1ZLSH 4H20H 2HZHA 4JZJA 1ZLVH 2R1WA 5C2UB 1B2WL 1EHLH 3NCMA 4PRIB 5ESAB 5D7IB 3O8XD 4E0RA 3MCG1 4MXWL 3FXIC 1J0YA 1KGWA 1JV2A 4JZOB 1U92A 4FMVA 3VG9C 2WLYA 1K8DB 3KPRE 4J3SA 4JQVA 2N3JA 2HX9A 4LEOA 1FZOB 1F4XH 3TLRA 5DD5H 5KN5B 3AQXA 5KVEL 1MVUB 2BP0A 5SX4H 3T0ED 1KN2L 4XPHL 4XXCA 4XCFL 1S7WA 5L4FA 2CO3A 6FABL 1AKJB 2DQJL 3ZW3A 5EU3A 4K7PX 1N3NB 4KGJA 4NGHL 1QSEA 3MU3A 1KLGB 4AM0A 5DTFA 5HPMA 2HG0A 4IBYA 4DO5A 4ZFFB 2ICWI 3LQAH 5HXMA 5T1LD 1DE4A 3BQVA 1INQA 1H15A 4J3UA 4DWHA 4ELMB 2F5AH 1N5YH 3S3PA 1MH5B 3WS3B 2FD6H 2PP9A 4FQQB 5GRVK 3CBJB 1W16A 1CK0H 2P43B 2FZ3A 3FTUA 1CR9H 4BK8A 5FM4A 2XWJA 4A6YB 5L7XL 3ZE2B 3WY2A 4WUUB 1MCQA 3OLGA 4G9FE 2CLVB 3U82B 2IC2A 3MRPB 3O3AA 4NLAA 4HPHA 4QYOA 4JFXB 3L2LA 1I53A 5SX5K 1WLHA 2VDPL 5JQHC 2XI9A 5J1SC 4OIFA 2ZWZA 3S4SG 3F6LA 5CILL 2J4WL 3FQRB 4NLHA 3G6JA 3FDWA 4XO4A 5HTSA 5CCHE 3CFNA 1ZK5A 5F7YC 4WO0A 3V5DB 1ED3B 5I6OA 3ZLQC 5IJVA 1QA9B 5FA3B 1TQWA 4ZMZA 2Q10A 4Z7VB 1X7QB 3WLWD 1J12A 3OHMB 4R5TA 5GGVH 3MRHB 1OTTD 2X4TA 3ZKQD 2OK0L 4OZ4B 1ETZA 2BWIA 4ZFQA 3TO2B 1KGYE 2ATPA 4JFEA 4NKIH 5D6CB 1RULH 4OZFB 2E59A 3EYVB 4WI7A 4LHUD 1OSZA 1ZT1B 1I3RA 3GJFK 2R56H 1D9KA 1U33A 3H4HA 4XC3L 2ZUWA 1UA7A 4XAKE 1DQML 1ZVHA 1V7ML 1Y6NR 3G3LA 4IU3B 4NJAL 3UTSD 4DUWA 1GMIA 2PWHA 3LH2L 4WWKD 1A6WH 1NCOA 3BW9A 1ACYH 1MW2A 1C8QA 2A1WH 5DGQA 2H2SD 5E4IA 3RA7H 5FO9B 2O30A 1U8CB 1HZHL 2EECA 2OR9H 1MFCL 3G5XB 5B3JE 5GGRB 1U42A 3MMEA 4NXSA 1B0RA 2EVJA 1UB5B 1MJ7L 3HJ0A 4YXLH 4P2RB 2NX5A 1UADC 2NDFA 1QSFB 4KUCF 3LEYH 3TCTA 4BGLA 3SPGA 2IPKB 1GIGH 3QQNA 3VSVA 4Z7WF 4TLTA 1RMFH 4YSDA 1QSEE 5E0QA 1YY8A 3ALXA 2E9BA 1T1YB 4LL4A 4YNYA 1YEDA 1TTFA 3H42L 2QQLH 1GMEA 2ALWA 3VNYA 3CMGA 3RX9A 5BO1H 4E68A 3IS0X 4JRYD 5KVDE 3L9RB 5TF1H 3FZUC 1N6QH 3DROB 1AD0B 2D4DA 1DL7L 3AM8C 3LZNA 3OJ2C 3V0VA 2P4AB 2CBQA 3EGDB 5FLVA 2ITDA 2YK1L 3KBFA 1W15A 2JKRM 3STZB 4MA3B 4NO3B 5C09B 5CXPA 4BWUA 3VFVA 1G7MB 2NY3C 4F7KA 2BWQA 2YUXA 4QHNB 4RESB 3RBSA 5C70A 3VRIA 1RK0B 4QWWD 5D1XD 3BIKA 1R5WA 4KTDH 2QKIC 5DR5H 1KF9B 1T6VN 2L7EA 4OT1H 2ZXAA 4BFRA 4LMQE 4Y4HD 4I18A 3AWFA 3IM1A 5IW6B 3DO7A 1NL0H 4R90L 2YN5A 4ADJA 1P4BH 3MLUL 1QLEH 4HWEH 1JWSB 1ETJA 1J05B 4JO8A 3WJLC 1L9SA 3G6JE 1ET8A 1FAIH 3QUZB 2R4SL 3T04D 1FPTL 1QFPA 3WHXB 5B39B 4A2LA 4KQ3L 5JR1H 4WV1A 3TBWB 1ZLWK 4PTUA 5CCJA 3MBXL 2BNUA 2ZX8A 3KWVA 4MSWB 1TU2B 2TRYA 3GJEB 1ZMYA 4PJHB 5IQNA 1U8LA 3PAZA 3WJMA 2ZG3A 4N1EA 3FTGB 5F7DA 4JFEE 4M8RA 5FGBA 2FEDD 1VZIA 2VB5A 4LVNC 4AUYA 4Y88A 1VEOA 1II4E 3DSNB 4F5CA 1O6VA 3I3EA 3NABH 3QUXB 1RZFL 1PZ2A 3DDFA 4WU7A 4HJ0D 5IESL 3ET9F 4PV9B 5C08B 1G7QB 2WUBL 1BM3H 1QATA 4PFEA 4EAEA 3RFZB 5E1QA 3VO0A 5JQIB 3ZE1E 5JYLA 5F7AA 4IRSA 2IAMD 1U30A 3QIUA 4UQAA 2BJMH 3KE0A 4LOUD 5F1SA 4LIQE 4AWJC 4J6IA 1BQHG 4X7SL 2PO6A 5GJSL 4U49A 5I1LB 1JTTA 1FV1B 3ISRA 2VSMB 1T1XB 4N5EC 2NX5E 4G80A 5AG9A 2J8HA 1DBML 3P4OA 2I27N 4YGAB 1XTMA 1LNUB 1CL7L 4OJEH 2SEBB 3F00A 5CS7A 1P2CA 3MRGB 1U3HA 3G5VA 4DKDC 4F7TA 3D9AL 1U2HA 2QQNH 3JV4B 3WUWA 2HMIC 1JWUA 4OCRL 3WLBA 1OSPH 2A73B 1NGXB 1X5KA 5IB1B 1A9EB 2F7IA 5I71B 3NCBB 4EO5A 1GY2A 3GNMH 2A9MH 1TOXA 2BDNL 4Y2DC 1BAWA 5DUBA 1FJ1A 1E5ZA 4Y16A 1TVHA 3B5HA 1XQ4A 3B56A 3G9AB 2AK1L 2FGWH 5GGUA 1OANA 4NN7C 1AS7A 3IJYA 5DLMH 3WEMA 4GQ9H 2AQRA 3GSWB 3RWCA 1KN4L 1QASA 4PWJA 3DVGB 4XNBA 1NC2D 4TUJA 1LVEA 3QISA 4NC2B 3KDMA 3F12A 4DGYH 2H1PH 4ZFGL 4PSRA 3WIHL 3BPOC 4U1HB 5F9WB 3SPHA 4PVLA 3EFFA 3IE4A 1VERA 4L9LA 3UO1H 1KV3A 2XKNB 4GSQA 3VMOA 4F37F 1MFMA 4PLNC 5D96B 1SJHB 2A83B 2W60A 2ZCKH 3GGWA 3DX0A 1BZ9B 3O45B 4NRYB 1JZEA 2QADB 3RURA 3SJVB 2QDWA 3CQFA 1H9VA 3HFMH 4AYGA 2EDWA 2W9DH 4CMMB 3VE0B 4WFED 5TFSH 2YC1A 1I8MA 2FO4A 3BEWB 3LZFH 3VFTB 1G7IA 3QZWG 4A6YH 4CN1A 2DQ6A 2LE9A 2GABA 2VKWA 3TZVC 4PCYA 1LQBC 3C5JA 3DMMC 4GINA 2EUZA 4L0PB 1WFIA 1WAPA 4WWID 1JHLL 3VI4F 1KLFB 5IFHH 5F7MC 1ILSA 3DARA 2YPVH 4GSRA 1GY1A 1UT9A 3GQFA 2Z31B 5HHOB 1M05A 1R34A 1S9XB 1ZS8B 2WMPA 1EJOL 4BK5A 2C9QA 5LDSA 3WTUA 1JMZA 3QXDB 3K2UL 4FLOA 4EI5D 1LWHA 1I8AA 4NXKA 4G5ZL 4LFHG 1JPTL 1X5YA 5GS2D 2C9PA 5KW9H 3QO1B 1VA9A 5MERB 4XMTA 4NUJB 2JXMB 2Y2YA 3O8XA 4X9YA 1LE5A 2EE3A 3DPDA 1Y6MR 3U9WA 2VSCA 5FR3A 4IRZH 2CE6A 3LDBB 3VFUB 4GRLD 4OZFH 4GSXA 4NRZB 3EYUL 2A4ZA 4QRSA 3SDAA 1J87A 3BWAB 1CG9A 4JJOA 1SLUA 2DWDB 3HUJA 1RHHB 3TJHC 2MHAB 4Q89A 5D7LB 3ELAT 5DEZA 1DEEA 2P5EB 3MFFB 5GS1B 2YRZA 2IVFC 2UZYA 4RRPA 4Y2NA 4YSUA 4PR5B 5FW6A 3OAZK 4RQQB 3IDIB 4NUQA 1O5DT 1ZANH 1CGWA 2VQ1B 2KH2B 4DZ8A 5F7UA 4ZO7A 1BD2B 1MFDH 2IV9A 3HLAB 4Y5VA 3TH4T 3IAQA 2CDFB 2DM2A 3SE3A 2VL5B 2CJUH 4FFWD 2QPDB 4ZXBB 5DI8B 4AE1A 1JPGA 4LBEA 1L0XA 2WIIA 4AT6A 3C60C 3EFOB 1M7IA 5HYSA 1N8ZB 3LIZA 2A6JA 3MPCA 1HCFX 2BLFA 3KXFB 1KTLB 1AHWB 2W65A 1L4IA 4OM0H 2EEXA 3WO3B 1E9OA 4OCSH 3ARFD 2IPUG 2K7QA 3LCYA 4Y1AB 2CD0A 1DBJH 1CDCA 1HI6A 2AQTA 1MVFA 3QFJD 4MXVE 4PJ7F 1JD9A 1MCNA 1NDMB 2BW5A 4LCWB 3ZYIA 3D87B 3CFJB 4LAQL 3BOVA 2OI9C 1QNZH 1YRKA 2RTTA 2NRDA 2R69L 1UCBH 5HHNA 2X41A 4RFEB 1O5PA 3VH8A 4Z5RA 3PNWA 1YDPB 2ITFA 2UXFA 3RNKB 4E9RA 4JBSA 4NQVA 2D2CC 5SWZD 4ZOAA 2IAND 1MLCB 3QYCA 3KR3H 4HK0B 2FX8L 5T33H 1NBZB 1DDHB 4QRAA 3GWJA 4PJEB 3WELA 5LG6A 1NEZA 3BLPX 3R8QA 4G8FA 1WK0A 2UWEF 3WTWA 3NTCL 4P4KC 3OJDA 5C9JB 4N85A 4XN5A 1B2YA 25C8L 3SPVA 3VB9A 3HG4A 4HS3A 4LHUA 4DW2L 2JJVA 1ECZA 4PJ9C 2NY4C 3X17A 3VFWA 3MRQA 4HS8L 3IJ8A 1IL1B 1T7YA 3GMNA 1NEUA 4F8NA 5MP6L 4GKSA 2QSCL 4KKLC 5DMKB 3BIAX 3H9ZA 4WWKA 2MTPA 2GY5A 2PTTB 4Y4KC 1AJ7H 5MEQA 4Q56A 4KXDA 1AXIB 4NBZB 2PP7A 3T0EE 3ZQ9A 5AUMB 3EOTL 3QZOA 4ZUVB 3HUJE 5I23A 4N2HA 4OUOA 2QHLA 4PWEA 5DJ2A 2VC2B 4AQ8A 3W1ZA 3T09A 2MQ3A 4PJIA 4Z3GA 1HNFA 1F5WA 4AG4L 2XBZA 4TULH 2HVJA 1ZLSL 4H20L 5H2BB 1DQLH 3N9GH 2Y9RT 1KG0B 3C08H 3FO1A 1EHLL 2CH8A 1CFSA 5LUMA 4L8CA 3CAFA 4JRYA 4HKBB 1A9BB 4K7FB 2CDGA 3QCVH 3O2WH 3SE4A 3HC0B 3L5XH 4K8RC 4PB0H 3IMRA 1NLDH 4WO4A 3CSYB 1S9KC 5DD5L 3VDCA 2UX7A 4G1MB 3H3PH 5GGTH 3P73B 3E9UA 3TV3H 4BA0A 4GIPD 5DHVA 4FC3E 5D1XA 4HOMA 3TEUA 2H41A 3ECBA 2V17H 4PJFA 2JJTC 1VADA 3FSVA 2VSDA 4FQCH 4MQ7B 1I8IA 4LLWA 4Y4HA 3VXMA 2ADJB 2MNJB 3UPRA 5DCCA 1JPEA 4CN4A 3LQAL 5H37A 1CZ8L 3FONB 1YNKH 4QRRB 1QPXA 1YMMB 1B90A 1N5YL 4YK4C 4JL2A 2C9VA 2FD6L 2LW3A 1E6OH 1UWXH 4WI6A 1UXMA 5MEOB 3BDBA 4ODUA 4R7LA 3MUY1 4H26A 4MCYB 1CK0L 1CR9L 3ALWA 1ICTA 1AZUA 3KPQB 4A7QA 5J57B 2WXOA 3WU1A 4KQ0A 3HRPA 3GK8H 4XOAA 5FIEA 3D1MC 2QVFB 2C9RA 5GZOC 1C5DA 3EDFA 4HS6A 1C8PA 4JM0A 2HTLD 1EANA 3FT1A 3WEBA 5A2CA 3DIVA 2ZE0A 1XTLA 1QACA 3V9FA 1S7SA 3TH3T 3ZZLA 1XMWA 1ORSA 1WO2A 2AXFA 1NMBL 2BNQD 3BQUC 3VXSA 2X88A 2NUPB 3KCPB 3V95A 1A1OA 1M3JA 3UABA 4X9HA 5IF0A 3X13B 3JWDC 5J3HC 3RKDC 3UTSE 1FNGA 43CAA 4BUHA 2VJ8A 3UOAB 4NQSA 3TS8A 5DRWA 3ML8A 3NIDE 3GMLB 5EB9A 3PGFH 1FFOA 4P06A 4YHMH 3UP6A 1DVZA 2NZ9C 4IU2A 4HBQA 4QLWA 3CMOH 1E30A 1IQWH 1OGAD 1OK0A 3DHPA 5HHMB 1GGBH 2XETA 2OMUA 5GGVL 1S6NA 1OM9A 3N44B 4AGNA 5IM7A 5F0LB 3HBPA 4ONHB 1TZOA 2E9JA 3EGXB 4HUUB 4E5XB 1T7WA 2WJ5A 5DZLA 1QSFD 5IK3A 3HZKB 3NA4A 1T7VA 4S0SD 2E75C 5KS9E 5I76B 2R56L 4PWHA 5ID1B 4ECNA 4JRYE 1PIFA 1ZHBB 5J6SA 1TZGH 4MASA 5IB4B 3ZMRA 2KL6A 2J55A 3OKLB 4MDJB 1A6WL 1H5BA 1TPXB 1X6LA 2G2RB 3ILPA 4FI8A 2AHIA 1MN4A 2A1WL 2CXKA 3RA7L 3DWTA 3T0DA 5I75B 5MENB 1Z3GL 4KMTH 1PY9A 2O6DA 4UCFA 5DRXA 2HG5A 3L7EA 4P2QB 4FQHA 4YXLL 3ZKMC 4PJFE 3LEYL 4KO9A 3J27A 2HFTA 4DOHB 4MMZB 4JY4A 4OF8A 1OOWA 5I82A 3TTSA 3TO4C 4YHPA 2VXQH 4X6CB 5C0JB 2WQ8A 4B0MM 3FU7A 4J3WA 1XCQB 4L8BB 1F6AB 1KPUA 4UNTA 4PS7A 3V4UH 5BZDB 4P3DA 3H9HA 1RUKH 3FMGH 1NGPH 4GB9A 5CZVH 4HJEA 4UIKH 5TF1L 3PJNA 4EI0A 5BQ7B 4AYDC 3WDHA 35C8H 4F3FA 3RJOA 3PYCA 3AG1B 2F7OA 1XGQA 1C12B 2QGDA 3QSKB 5EU4B 3X1FA 2NY5H 3SYOA 4EIZC 3QQ9C 1HX0A 3QEQD 4KDTA 3ZGHA 3MRLB 3JZYA 3QUZD 1KYOK 2DQMA 5KSAC 2ZX7A 5DHYB 5INCA 3E7JA 4YHNB 3GMOB 2H3XC 4F7PA 4KTDL 1GZHC 4WTXA 3FPXA 1SDAB 3QUKB 4MD0A 1UZ6E 4OT1L 2PR4H 3CVHB 3FL7A 2GTWA 3QORB 1PPIA 1TETL 4GXVL 3A4DA 4YHLH 1N59B 1WH0A 5ACZB 4HWEL 3U4AA 3Q2LA 4E9TA 2PW2A 1FAIL 1UFGA 1A7QH 1KB3A 3OKKB 4L8DB 2ZOLA 5SV4A 5EA0H 3QVAA 1E6JH 5JR1L 2ZP0T 4JREC 2GIXA 3DV4A 2X4RB 1Z0MA 5ITFB 1A7BA 1MJJA 2HLEB 5KS9F 1JVOA 3V5KB 3UZVA 2DLHA 2PYFA 1QTSA 4GRLA 4GT0A 2HFEB 3MOAH 1BAGA 2DIEA 2WXKA 4K2UH 2EVGA 3ATEA 1CIDA 5F7BA 3HW7A 3WS6C 1RIHH 1NOAA 1J7VR 1S8DA 3KYOB 5CJXC 3EYFB 3F2LA 5LG1A 3W81A 4D0CA 3C9NB 1BIIB 1GC1L 5C2BH 1F4WL 1VHPA 4K73A 4TTDD 3R4RA 1AR1C 3FQXA 3C75A 3KH4A 4PJ5E 5B8CC 2FRGP 2WQSA 3R0NA 1GPOH 3RVUC 3FK3A 4OI7A 3I50H 3RUGB 4EI6B 3T3ME 3RWJB 2J7LA 4ZO9A 4YSAA 2HJKB 1YNTA 4UWQB 5ICXA 3CDYA 2VC2H 3HCVB 4QRTB 3WKMH 5LNGA 4JG1H 3O6KH 3IXAA 1AQDA 5FKAA 3UJJH 1NOFA 1A7NH 4JFQB 4WU5B 3PWUB 2LR4A 3NZUA 4XMLH 3RB7A 2R7EA 3HHSA 3V7AG 2WJ7A 2O26U 2QQNL 5A2LH 1OSPL 2HT3C 3H4FA 3QXWA 4JG0H 4ZMXA 3BSHA 4UUJA 1MOEA 3ARFA 4XC1L 1PKQA 4Z1PA 3FTSA 2A9ML 3QFJA 3AUWB 2O5YH 1HHKA 1NPNA 2AQ2A 2ORBH 2BSSA 1JGDB 1U9KA 2AJZA 2FGWL 2HWZH 3FT4B 3Q8FA 4WFEE 2PW1B 3ARTA 4IBZA 4U6XA 2OMNA 3N3EA 3CSTA 3D18A 2BMKB 5E94B 2CDEB 3DI3B 3IU4H 1S7UA 5EV7A 3LQZA 4Y5YA 1F0LA 1YQ2A 4JQXA 5SWZA 2IANA 3IN2A 1WP6A 4UOW0 2YD9A 4HGMA 3BRDA 4DGYL 2H1PL 3ARDD 3NOIA 3U30C 4MMYA 2VN3A 4FKHA 2VCOA 4CU7A 3DVNB 3L3OC 1E65A 4JFDB 3UO1L 4XXDA 1M2OA 4L3CB 4YL9A 4O9HL 4BWWA 3OVUB 3RTQC 3FQNB 4PIBA 5IQMA 3MYJB 5HHOD 5KSVB 3HFML 3ZDZE 4B9JA 2W9DL 1I1YB 3RHWK 2MPAL 5TFSL 1F1DA 3I6GA 4UMSA 3LZFL 1MELA 4M5ZH 3O3EB 1G1OA 5J12C 4A6YL 2X1WL 4LSSH 3SDCC 3EYSH 1FFRA 4X8XA 4JRLA 4PRIA 1I7UA 5ESAA 3WN5C 5D7IA 2ZSWB 2YA2A 4JM2B 4JZOA 4L1HA 3S3DB 1SXAA 5CGMA 1ET7A 1LHZA 1K8DA 2YPVL 3NFPB 3SYPA 3RWIB 1CFBA 3JZ7A 3CGTA 2ZD0A 4YPGB 3IETB 1FZOA 2VZOA 4WI5A 4BFBD 4OZIE 1CXFA 1KB9K 2EKSB 1RAMA 1R5IB 2B14A 3BKJH 1AOHA 5KN5A 1MVUA 4U1KB 4A7TA 2VJ0A 4XMZA 1U58A 3JWOH 2GYSA 2FNWA 1KYFA 5D7LD 4MA1B 5JPNC 4YWGL 4NO2B 3LZPA 5KBMA 3ZKNC 3H9SB 1OAYH 3C09C 2V7HB 4OI9A 5KW9L 1AKJA 5EWIL 2AANA 4KVPA 3K2MC 1CFQB 1N3NA 3NP3A 4WTWA 1JXKA 4MMXC 1BVNT 1KLGA 4IRZL 1NINA 3L3KA 2EACA 4ZFFA 1NDGB 1MCRA 3TBBA 1MCLA 4ELMA 2JH2A 5I0WA 1MH5A 4LSPL 1SM3H 4M1DH 3WS3A 4FQQA 4ZXBD 3SGKA 1OP9A 2VRKA 1JZ5A 4XZUB 4FQIH 5F93C 3W9DB 2Y07H 1I1RA 2XX1A 3RDTC 4Z7NE 3QFJE 5M95B 4A6YA 1IVTA 5IWLA 3EJYC 3KXFD 4WUUA 4JKPH 4Z18A 1RPKA 3I6LE 4N8VB 3MRPA 1ZANL 4YZWA 3U9UB 3KGRA 4CSPA 3CVIL 2APSA 1MFDL 4JFXA 5L8JB 1FFQA 4ZMVA 5IHHA 4LCWD 4IKLA 2DTMH 2YPVA 2CJUL 4LDLB 3EJZC 3K2IA 2EYSB 2B1AL 4Z7UF 3EZ8A 3BPLB 3SOTA 1XXFC 5SWZE 3FCTB 1MCIA 4K94L 3CC5B 2JNZA 3MBEB 2E6QA 3FQRA 5KWYC 1DLHB 4KNUA 2OJZH 4M29A 5E1HB 4QHUB 4U0QB 5FFOA 2XWZA 1EJ8A 4HUWB 1TJGL 3MRDB 4OM0L 4MX7B 8PAZA 4HYTB 1ED3A 1PX4A 3FKUS 1QA9A 5FA3A 3ESMA 2WBJB 4Z7VA 1X7QA 5I8CB 1RZKL 3MRHA 4AW4A 2XY2A 3K46A 4OZ4A 4AMKH 3RG1C 4IRZA 3KLAB 1AGEB 3TO2A 5D6CA 4JFSA 2WNWA 3FU6A 3P54A 1UCBL 4QEGA 4XOEA 3PDOB 4OZFA 3EYVA 3F04A 4JY5L 1RKRA 4N2KA 2WZPD 3GXDA 3VFMB 3OAWA 2WNKA 4R4ND 4XBGB 3CVHH 5SWSD 1OGAA 4RGMC 4IU3A 3TVMB 5T33L 5K69A 5JQ6H 4G59C 4XB3A 2ZCHL 3DOSB 3I2CH 5FO9A 1U8CA 1L9TA 3G5XA 4Y4FB 2ZNXA 5GGRA 4MBRA 2NZ1A 1UB5A 3TIDB 1DN2A 4P2RA 1PDKB 2D4FA 1H8NA 1QSFA 3MNDA 4CVUA 2HKHH 5F70A 5JZ7D 4FKKA 2IPKA 2AQSA 2DM4A 4X8GA 4N2MA 2O6FA 4XBEH 3UFIA 3RWDB 4GW4B 3BT2L 3WI9A 1RFDH 5HYJB 1T1YA 4BQCA 1BJ8A 5F1OB 1AJ7L 2P3YA 3TH2T 4ELME 2IOOA 3OMZA 3L9RA 4GAYB 5DVOA 3AGWA 4RBPH 3R7RA 2WXHA 3DROA 1AD0A 3S5LG 3GSQB 1F58H 1BF5A 1UGNA 3EGDA 4RWHA 3K91A 5FHBL 5IHUL 3BVXA 3STZA 1IKOP 3VMPA 4QRPD 4AQ1B 1BOYA 2PF6A 4MA3A 5C09A 1KC5L 3NSJA 1G7MA 1HQ4B 3E38A 3TEWA 3D6GA 4QHNA 4TULL 1JAEA 1IKFH 1DQLL 2EIZB 1RK0A 3N9GL 4IK7A 5DJCB 3UTTB 3C08L 1MCDA 5KJRL 1OZUA 1PW3A 3LXCA 4PW3A 3X1NA 4AC4A 3TN0B 3HG1B 5F7EL 4AUJA 4ODSH 5L4IA 4AYFB 1AQHA 3L1GA 1XBDA 2QR0B 3VGDA 5TK4A 5IW6A 1AGCB 3O2WL 3Q06A 1PIGA 2H0JA 3L5XL 3T9WA 1WPCA 1UOLA 3D0LB 4PB0L 5DWPA 1NLDL 1JWSA 1J05A 2VGLM 4HGKC 4PJXF 3KVQA 2VDKB 3QEQA 1YMMD 3QUZA 5GS0H 5GGTL 4H8UA 1D5IL 1RVFH 2V0AA 3WHXA 1BGXH 5B39A 1NM9A 2X1OA 2W8CA 1KB9J 3TBWA 5J0BA 5JIQA 2BVEA 1DBKL 2V17L 3ABMB 1J5HA 4MSWA 4Z7VE 1TU2A 2BNQE 3GJEA 1SXNA 4PJHA 5KTEH 1R5VB 5B3NA 3QXVA 3ESNA 3N5AA 4GSUA 1DZ0A 3FTGA 4BJLA 2IAAC 4PEEA 4CGUB 3QJOA 3MOBH 3RX5A 3NPSB 3VD4A 5C07E 4E2OA 3DSNA 1YNKL 3QI9B 1MY7A 2VAAB 4ZD3H 2OTUB 3QUXA 3AG4B 1TDQA 3ETBF 5E6YA 3FQTB 4PV9A 5C08A 1G7QA 2MOQA 3RFZA 4JZJC 3UC2A 3DHMA 1OGAE 2DBLH 4TPRH 2F6AA 5CP3H 3IJEB 1PU0A 2IADB 3GK8L 5DD6B 1X9LA 2RIKA 2Q6WB 4LLQB 3QIBB 2WINB 5HVGB 3GJFB 4XNQB 3UMNA 5A16B 4G43B 4NKQB 3GSUB 1FV1A 3B9DA 2EUXA 4XNXH 1WFTA 5HHMD 1T1XA 3BVNB 5F96H 4JQVC 1QSFE 1NCHA 3I9PA 1TQVA 3IFNL 3HNVH 1JIBA 1LNUA 1ADQL 3BP4B 2HH0H 2SEBA 4QAWA 3T6VA 5IMKB 3CN2A 1H8OA 3MRGA 2EO9A 2OAAA 1HL5A 2NPLX 1IC4H 2VABB 4RZCB 2AJVL 4XXCC 3JV4A 3FNKA 2A73A 1NGXA 5GGTA 1CGSH 5IB1A 1A9EA 1SBSH 4K5OA 1SMOA 1RZJH 3PGFL 3CQPA 4IHOB 5I1HH 1HS6A 4YHML 2ODIA 3AREB 2CKNA 3CMOL 1IQWL 2YUWA 4U3XA 3CX5J 3P0YH 4TSBH 4CSTA 1GGBL 1NCWH 2KI6A 4M7KH 3L3JB 5J8OA 3AB0B 1QOKA 2GT9B 4FLHA 1MF2L 5MEND 3GSWA 4UILL 2Y1VA 2A2QT 2QQKH 4L4TD 4HBCH 3DVGA 4P2QD 4MAYB 3VD7A 3DA0A 3ZKXB 4HG4J 4CNIB 2ROYA 2YFNA 3CFUA 5CR1A 4I2XB 1VZHA 2YAEA 1HESA 4RAHA 3NIGF 2BCKB 1TZGL 4U1HA 4YDLC 2CHNA 3GBMH 32