1IFRA

Structure of lamin a/c globular domain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
113
structure length
113
Chain Sequence
GSHRTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAMRKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lamin A/C
publication title Structure of the globular tail of nuclear lamin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 26
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2001-04-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1260 Mainly Beta Sandwich Immunoglobulin-like Lamin Tail domain 1ifrA00
3UMNA 3GEFA 2LLLA 1IVTA 3JT0A 1UFGA 2KPWA 1IFRA
chains in the Genus database with same CATH superfamily
3MOAH 1L9QA 3LRKA 4UI2A 4UTCA 3H2QA 1WA1X 2CLZA 4RNRA 4PJ8B 5TF1H 1TNNA 4PVNA 4PW4A 2XWRA 4FQ2H 4EOWL 1QSED 1UT9A 3KXFE 2FIKA 1QWHA 1OARL 3K8KA 3VGDA 3HZYA 5JZ7D 1TF4A 1NEPA 1TZ8A 4QRRE 2WIIB 5BNXD 3LVEA 3QZWG 3GSUA 3ARQA 3CUPA 1MJ7H 2D7NA 4Y4HA 5HYJD 3I6KB 1MUJB 3PABB 5A1AA 1XMEB 3RTQA 4MX7B 3LS4H 4IBTA 1VFAB 1LQBC 1ASQA 4KXAA 3US1A 2HVJB 2H3KA 3BVVA 1AHWB 3R7RA 4U6HB 1OLLA 1G6RL 1TCMA 1YJDC 3KPLB 2AEQL 3MRPA 4K7FA 4LNVA 3U1SL 1AR1D 5H4ZA 2CKNA 2X4UA 4NENB 4PLJC 4FNLL 5BVJA 2R0LL 2X4SB 2GAZB 2X4NB 3H9SD 4TOYH 3QUZA 5DJAB 5T3ZH 4ZK8A 3B8SA 5I28A 2A9DA 5ITFB 2WLJA 3RUGE 4CMHB 4UF7C 5E9DB 1BLIA 2Z34A 2EDJA 4LSRL 1J05B 5CILH 3K7UA 3B2MA 3DV6B 3Q48A 2EDXA 5A16A 5KTEH 2DWDA 3RGVA 5LN8A 3C5JB 1S3KL 3FQRB 4PD4K 1JK9A 3H56A 4JFYB 3BJ91 3BAXA 1BVKA 2JI2A 1X4YA 5LUMA 5L4FA 4HAFA 3RJDA 1VGEL 2Q20A 4GINA 3TWCL 4DP6X 4M56A 4HKZA 4PJ9C 2EDKA 1ZS2A 5L9DH 1BJMA 4B9YA 1UXSB 5E8PB 1FL3A 3L3DA 5ADPL 4PJGF 2BVTA 1N8ZA 5CN1A 1B4RA 1SEQL 2G5UA 4GQPH 2FGWL 4MNHB 1OP3K 3VD3A 3D48R 4MAZA 5GGTL 2DYPA 3X1BA 1R3JB 4MA3A 2JKRM 3O0RL 4PJ7E 3C8HA 1F4YL 2G2RA 3G5YA 4XCEA 4XX5A 1XGYH 3S34L 1URZA 4JHAL 2F0CA 2VKXA 3ZTEA 1XX9C 1K5NB 2X88A 4ZW8A 2XTJD 3NQIA 2YEZB 3AS2A 3H3PH 2V5YA 5I19H 4KTEH 3QORD 4XPFL 2WLLA 3T1FB 1KPVB 5E5RB 3L45A 4WFGD 1N70A 3KLAB 2R23B 2CO6A 2NCEA 2C7UA 2DKSA 1RUAL 1DFBH 2H4EA 4FQHB 4Z0BL 1FVDB 4HJIA 5AVZB 3LKNB 1XF3B 2YMXH 3BRFA 2OX5A 1J88A 1I1YB 4KRNA 1YECL 1MIMH 4JJOA 3UTTA 2YPVA 4DGWC 3BH4A 3FHEA 2FEEL 2NYKA 2PW2B 3IU4H 2WXQA 4GMTH 1H3VA 3RWEA 4H8PA 2VLRA 3G5WA 4S10A 5I18H 1JZ3A 3T0EA 3BVUA 4P9ML 5IEKB 1U3ZA 5JIMA 1WBYB 3PP3H 1MVFA 5PAZA 3V0VB 4PREB 4OLZL 4IU3A 4WKXA 1E43A 2XWJA 3QDJE 2FJGB 4K9EL 3LNGA 5G4MA 3I9AA 4NM8L 3MV01 4QAMB 4RSVA 5F1IA 1JF1B 4ABWA 2BSBA 5DD1L 2WXGA 1HVXA 1PD1A 5SWSA 1E6JH 1FJ1B 4MB3A 3B2UC 1FDLL 1FC2D 4OIBA 2I32A 4QPEA 1X7SA 3V4VH 1UM4L 3IFOB 5BUPA 4OJDH 4RQQA 4UBDC 4ELMF 2XXGA 4G8GA 3MLWL 4W9LC 3FQ4A 3E3QE 4PGBB 2ATKA 2YKLL 3E9TA 3FQXA 4PMEA 2V4LA 4QHKI 5I15H 4BWWA 1A6TB 2A1WH 2NXYC 2N3JA 4UUJA 4XBMA 4ANVA 4YXLH 3FOMB 4C8XA 1CGVA 1E4XH 2FEEI 3QQ4A 3UTSD 5D7LA 1JI2A 2R51A 1BV8A 3K2UH 1EEYB 3JV6B 1JG9A 3UACA 4OQTL 4OZGA 3HEIB 3ASOB 2EUWA 5EOCL 2YPLD 1CLCA 2IXQB 1BBDH 4ZOEA 2QT6A 4HIQA 3H54A 2IQ9H 3OKDB 1DSWA 2ZWKA 4JGMA 2CKBL 2BIHA 1S2EA 1UD2A 4MYWB 1GC1L 2ZOTA 3GO1H 1G9MH 4HH9A 4M5YH 4CN6A 2PPDA 2FWUA 1MRDH 4JPIA 3VVVA 1NBVL 1YQVH 3PU7A 4LB8A 4AM0Q 4F37F 3PHQA 1N67A 2GJ6E 5GIRB 2V2TA 1BQUA 4N4YB 3ZDYF 1N5AA 3WJMA 1KB3A 4QHLA 5D4QA 2X1WL 4H1LB 3WO3B 2WSPA 5JUEL 4UQ3A 1QTYT 2V0AA 1JZEA 4PLNC 4WHCA 1FO0H 2VNCA 5GSVA 1I3GL 2E59A 4FHBD 2ZE0A 1FUNA 5FYLH 1UCBL 1MI5E 1B3IA 4HLJA 2ODHA 6CGTA 1E7UA 2X3CA 3AC0A 1JS4A 1JXFA 1ONQB 4NQDA 2P5WE 1WBXA 3EH1A 2WNWA 4MAYA 2O72A 5IMMB 3FN0H 4HJ1A 3RPIB 4NJAH 4CU7A 4LCYB 4NRZB 4MNGA 3I02A 3CFNA 4ACPA 3TJEL 4NOFA 4AYSA 4I48A 1MPAH 3RWGA 4QYOB 3DYPA 1BG9A 4PY7A 1HYSC 4WSGA 3KYKL 1QI3A 1BEXA 1NLBH 2GC4C 4N0UA 2YAHA 3H7LA 1MFNA 4JE4B 4HC1H 5KJ4A 4UV7L 3VRJB 4JO5A 4UDTA 3FULA 4IRSA 3ARBC 4MVBC 3AQDA 3MKGA 4LCIL 3GBMH 4NNPL 4KMQA 5CJ8A 3TN0D 2XLLA 2H8PA 3SBPA 2XG5A 4G1MA 4L9LC 3D6GA 5EN2A 1F4XH 4NQXA 2WVVA 4S2SB 3TS8A 5D1XA 2BVQB 5GXBB 1KELL 1LO5B 3EGDA 1JYNA 4KGJA 1ZV5A 4YBHA 4AQ1C 1T6VN 3HI6L 5AW4B 5B38A 1AOHA 1R0AL 2VAJA 4MA1C 2XN9E 4OCYH 1NCCH 4GSXA 5AALA 3EO1A 4PWHA 2E74C 4ZS7H 3SE9L 3V9FA 4MCYA 5IW1A 4YFEA 1P69B 1M9SA 4F9LA 3HNSL 2V5MA 3PIQA 4XOEA 4CADB 4FXGC 2VXVH 4WCYH 1O7SA 3PJSA 3WY4A 5IJCC 4WU5A 1DHKA 1RQ5A 3MCLL 2DQTH 1TVBB 4Y16C 4HU8A 5TTRA 3HMXH 3EYVB 5F0MB 5BO0D 1FG2A 4TRPH 4HUXB 2XWTB 1SDDA 3U4AA 2QPDB 1IZJA 15C8L 4Q6IC 5KOVC 5SWQA 3IGKA 3O3EB 5I26A 3RY5A 2R69L 4LSPH 3QEGL 4QOKB 3D2TA 3KVPA 3DTXA 3ZTNL 1AG0A 3WIIL 5EBGA 1QVOA 3FFOA 4YC2C 3DGDA 2CK0H 4G43B 2HX7A 1P6FA 1E8YA 2DBLL 1QLRB 2A9NL 3F65A 4WNQB 3BPOB 3FH7A 3TPUA 3WLBA 2AJSH 2WOBA 4XVTL 1KJ3H 5JIKA 2J8UB 1BYOA 3QJFA 3VFNA 3QXWA 1W0VB 5HDBB 2EDHA 3PY9A 3FMGH 3TBYA 1J86A 4I77L 4JG1L 3X17A 3P30L 4GRWF 3L54A 2W9LA 5FOBB 3ULUE 4JDEB 1JPTL 4BFNA 4PSRA 4L48A 2CZNA 5EZJA 4FP8L 2XZQH 1D5BB 5E99L 2ITCA 1T03H 1K72A 4K3EH 4YHZH 4KQ0A 3L16A 2IH3A 3QNXA 2WLIB 4KPHL 3U4BH 5A2CA 3PP3K 1YEDB 4V1DE 1EJFA 5D93C 1HI6B 1RZFH 4BWUA 3LMJH 3W9EA 3VH8B 3IJ9A 1QPPA 3HE7C 2R4SL 5C0CB 4EAEA 5DVPA 4K8RL 4OGZA 5KBDA 4X6EA 5DEGA 4M93C 1N7ML 2UVFA 3UCRA 3NA9H 3EO9L 3VWKB 4Y4FA 3MLVL 4EQ3A 2IADB 3U36A 4FL4B 3WFDL 4EN3B 4NKOA 4MJ5B 1GMIA 4POZD 4HETA 3EJCA 3WEAA 1QSZA 3DX9A 3W82A 4KKNA 4L4VB 2W0LA 3CFMA 3R4DA 4N5UA 3Q1EA 4Y19B 3P0GB 4LKXB 4GUPA 3O2DH 4G59C 4RISH 4GW5B 4FXKB 3DDFA 1L7IH 4E41B 3AY2A 5DMIH 2VN6A 4MRBA 4YPGA 3QWQB 3WIFB 4K73A 1JV5B 4U4BA 5CCHE 2B5IB 2K6WA 2NLJB 3LRSA 5E8EA 5FF6B 3RY6C 3Q43A 2BVEA 1PYWB 3MRCB 1N0LB 2I07A 3VXPA 2ICCA 4YHPB 1U8OA 4WNJA 3L08A 1S6NA 3DOSA 3S3CB 5HVHC 2VERN 5BRZD 3BESR 1BPLB 1CFNA 1KCKA 1JVKA 4PJGB 5JHAA 3GSQA 4PHZA 1EBPA 3UMNA 1CYGA 3DVGA 1FORL 3FS9A 3TPKA 2Y7SA 5HVFB 4M7JH 5HYIA 3N0PB 1ZHLB 5FHAL 1G7JB 3SBWC 3C6EA 2O5YL 3HBQA 4LARH 4TLTA 2F7IA 3N91A 3EJYC 4LMQE 2Y06H 2YGVA 1A1OB 3MRGA 2J6EH 5C09B 2JLPA 3UPRB 3BKJH 4OF8A 3IRPX 3HPLB 3NCFB 4IMLA 1FIGH 1D5IH 1CFBA 2WJ7A 2ENJA 4KNSA 3UTQA 2XTLA 4XNXL 1QWUA 3AG4B 1JBJA 2PN5A 2RB8A 1DUYA 1BQHB 1U8KB 2G9HA 2ZJSH 3CK0H 1TYJA 5J12B 5JDSA 2BPBA 2NDGA 4DQAA 2PXYA 4P5KB 3TTSA 3D3VD 1FFRA 1KXQA 2ZSWA 3IAQA 4LSVH 3BAYA 3GUTB 3FUIA 5GGSA 3V0AC 3IMVA 1NCUA 1NFDF 3DXAA 4KX9A 3EOYG 4G6AC 4TUKL 2FD6H 3MRMA 3SO3C 1P5UC 3ZSSA 3HAEA 2GQHA 1P7BA 3JV0A 2PWFA 2FO1A 3FSWA 3FOLA 3WIHA 3I84A 1KGWA 3LZQA 4A6YA 3OKKB 3VQLA 1XB8A 1CE6B 2XVBA 4LGRB 4AKQA 2Q7AA 2BY3A 2H6PB 3DROB 3WUWB 1E5AA 2DICA 2E27L 2YEQA 2XKSA 1RUPH 2B20A 3P4OB 1AVAA 1BVLA 3A3YB 3PL6C 3G04B 3INOA 4OR1A 4UT7L 5FO8B 2EC9T 3L1OH 3O8XC 3PDOB 5DLMH 4JRYA 4QXVA 5DUPL 5E6RB 1SXBA 4MHHI 3UJJL 4ZXBD 5E56A 3VXTA 3RGHA 1WTGT 3OXRB 5D7JD 2PR4H 2CCWA 4XMLL 1EO8H 1MEXL 5FPIA 2KPNA 4BA0A 4DO4A 2EYSB 1Q0EA 1T0PB 3JYBA 1W2KT 3D33A 3M1CA 3MV9E 1JPST 2FBOJ 3TU6A 2EEAA 1X5AA 1UOLA 4DUVA 3F3HA 3OC5A 1IC1A 5E8OB 3K6FA 2FJFA 3G5VA 5ILTH 4Q56A 4KO6A 2VL5A 4ZX6A 4Q0XH 3WTWA 3ZHFA 5AL8A 3L95B 1ES0B 4GW1B 3NK3A 4NO2A 5IV2B 1Q8MA 3X1GA 1SHSA 2UY6A 2F54A 3ILPA 3KJ6L 2ZUYA 1A7NH 2FQEA 4OI9A 4W9GC 1F4WH 2VDNH 5EEVA 1UZ6F 2A4ZA 4OB5L 3AU0A 5FGBC 3ZDYB 5KW9H 1AZNA 5IHHA 4JAMB 3IVKB 1NUDA 1TZIB 3L4UA 2B59A 3BUIA 4PS8A 1HL4A 1BBJA 3RL2A 1KN2L 2BDNL 5LHDA 3OGCB 1EVTC 1HL5A 4FQXB 4AYGA 3C6LA 2KLSA 2MMXA 3EDFA 4FMVA 4XBPB 5E8DL 3SJVA 3A4AA 3JWOL 3MXWH 2JJVA 4LE8A 2A77H 4W9CC 3JTSB 3PWVB 3EXLA 3F04A 2H45A 3IMRA 3TBTA 5CFHA 5C6WH 3ISRA 2G60L 2P28B 2X7LA 1M6OA 4RGMC 4D94A 1BQLH 3CIQA 4WW1A 3NIDB 3KBEA 2MHAA 3P2BA 4PJEA 2WZPA 1MKFA 2D0HA 2IMNA 4XGZA 5EU4B 2DI8A 3VTMA 4DGYH 3BGMA 4S1DC 4MQTB 2WBJA 2K4WA 4QT5A 2VDPH 2VW6A 2HWZH 4NKDB 5KAQF 2CDFB 2Y1ZA 5EEWA 5IB5B 1F0LA 2H5UA 4PRNB 3FFCE 5KSBE 4NSKA 4I87A 2PR9A 4JFPA 3RVUC 5CR8A 3F8UB 4J3WA 3JTTB 5ITBL 1NEUA 4E0RB 2XHNA 5D9SA 5ISZA 1VCBC 3LNHA 1IEBB 3L3GB 3IBOA 3J27A 5IK3B 3Q6FB 2ZONA 3KYNB 4PJ5A 2GK0B 4GS7C 2H0JA 2L7QA 5LGYA 2Y5EA 1FZMA 2XZCL 4QXWA 4HS8L 4ZD3L 4ESKA 5C2BH 5DS2A 3FQUB 1BHGA 2QR0A 4TVUA 2J71A 4AKOA 4AUYA 4XPAH 2UXGA 2LOEA 1BDYA 3PAYA 1VF5C 5D5MA 4AV5A 1A6ZA 1RK1A 3C8KA 2ARJA 2A0LC 2NW3A 3SDDB 1INQB 3NT0A 4JZOB 4EPSA 4N9GB 2YQGA 3MOAL 3TBWB 4Q9QH 1IM9D 4Y1AE 3VGAB 3KR3L 3S7GA 4LK4A 5D2NB 3HB3C 3UX9B 4FQ2L 2GT9B 2XI9A 1ULVA 1A7QH 2CHZA 2QPEB 3CZNA 1TKWB 3EBIA 2A9ML 1A3LH 3BP6B 4XB8A 3IETA 4KKCC 3ZRSA 3KBPA 1JWMA 4MD0B 2B0SH 2R2BA 3D50A 2QZQA 1C1EH 2BJMH 3CPLA 3HRZB 1KYOJ 3W0WD 1TJHL 1WSST 3UXFA 4L1HA 1YRKA 2ZYRA 3A4FA 4WV1C 3W9DA 4R7VA 1T7VA 2XPGA 1VCAA 5F7AA 4L0ZA 5DTFA 5CBAA 1HHIB 2ZOOA 4BCZA 4PJ8D 4C54A 4BH7A 4JFEB 3AWFA 4GRWB 3R8BB 4OJYA 3J7HA 4KI1A 1TJGL 4ZPTB 4APXB 3FF7A 3BYTA 1TZHA 4I1PA 3STBA 2VRKA 4JGUA 3VI4A 1TQBB 4NQSB 3WNLA 3GTNA 3WNOA 5I0ZA 5MP6H 3LEXA 5JLZB 5KTEL 1CQKA 2Z31C 3UP6A 4KKAC 1MN4A 1BQ5A 1C7TA 4A67A 1S5IH 4ES9A 2P52A 4KXZI 3PGFL 4PJHA 1ZS8B 4JO8A 5AEAA 4AH2A 4TTDC 1DVSA 4EIZC 1S7XA 1NCWL 3AY4C 3WS6A 2RFXB 3ZE1E 2JB6A 1AY1H 4IOIA 4HZ1A 4JX0A 3CQQA 2EUZA 3DMMA 2A9AA 4LBEB 2VXTL 4S1RL 3GGWB 4K3GA 3OG4B 1PZBA 3QIWD 5E1AB 1JZ6A 4CDHA 2ED9A 1WFJA 1AO7E 4O2CB 4DCQA 2R1YA 1W6WA 5E9DD 5IFJA 1D5ZB 1Y0LA 4NNXA 2ED7A 7FABL 4DERA 3MDJA 4PLKC 4NS0A 1E28A 3NIGF 1EANA 2OMVB 3NIFF 3Q0HA 4JFWA 5DD0H 5F2FA 3Q9PA 5LGHH 3HG2A 4GB9A 2C34A 4MQ7B 3E38A 1KNOB 4L5FE 3NZHL 1X5KA 4Y5YA 5FW7A 5IBTL 3BZEA 3BVWA 4H8WC 4MA8L 1LE5B 3VD4A 2OZNA 4PJ9B 5DQDH 1VFOA 2EIDA 2ENQA 4XBGA 3SB3A 1TO5A 3H3PL 2HJKB 5I19L 1XCQA 1DYZA 2Z7WA 3FL7A 3T6ZA 2FB4H 2R0WL 3ZE2E 3EYOB 1ODAA 4E2OA 4EDXB 1N0XL 3ZKMC 1F8TH 1YNTF 2BX5A 4JDTL 2IAMC 2YMXL 1MIML 1DUZA 4L8SA 3MRDA 2IGFH 1CO1A 1PZUB 5SWZB 1FGNH 1KT2A 1ZLEA 4P2RE 4GMTL 5C0AA 4NZUH 1J10A 2L8AA 4Z3TA 1FPTL 4MBOA 1ZPUA 4F24A 2BNQE 4X8JB 1WUZA 4QO1A 3QFJB 3VXRB 1HXMB 1NC4D 2BSRA 2ZG1A 5C0BA 2WN2A 4FD0A 1MFDH 2D4DA 5DRZB 3P3SA 3UL4A 5HY9A 3I9GH 1I1AC 3K2MC 4N0FB 3ROLA 1M71A 3DRQA 4MLIA 1EZVY 5JIHA 1E6JL 3LQAH 1ZXKA 2VSMB 4PN6A 4IK7A 2JTYA 3BCDA 4IDJL 5F9JA 5CSZA 4RDBA 4B9CA 4TF4A 1S7UA 3HHMA 1J9RA 2ID5A 4J6RH 4PMFA 2F5AL 5KBKA 3NZ8B 3F12B 2JQMA 4OLXH 2NY6D 2UWEA 3CSYA 3LPFA 1XL6A 5E4IA 1FI8C 3P11H 1HZLA 5EIVA 3KM2A 5DHYA 2HSIA 1XGTA 4MAUH 1WBZA 1NFDB 2R0KL 4PRHB 4MD5A 3GJEA 2ICEC 3IWUA 1LNUA 1QO3A 2DF3A 3H9HB 5AW9B 1U3HA 4JZJC 2DMHA 4NUMA 1Q72H 1WYJA 5B8CA 2IQ9L 4I0PA 2MCPL 1USZA 4HJGB 3CBKB 3GO1L 1G9ML 2KUTA 4M5YL 1SFDA 1SN0A 2WAHA 4IGBB 5LBSH 3WXWL 3WGUB 1PZ5A 4L4JA 4W9IC 1U95A 4BA8A 4AQEB 1ADQA 4D0DB 4FQLH 1INEH 4KU1A 5CGMA 2MCAA 3RIAF 5JO5B 4FULA 1IAIM 2VC2B 1RIUH 3IGAB 3LN9A 4KJWC 4QXGH 5ESAB 5F7DA 3KPSE 3V6ZA 3D85A 4JO2H 2DDQH 1G1YA 4GBXC 1QR1B 4ALAL 4F57L 1P5VA 5GGVY 3JZYA 1I1RA 5C7XH 4PG2C 3Q05A 1ZEAH 1MFBH 5AAMA 3CFUA 1KLFB 4APQD 4DAGH 1TU2A 3DPDA 5HD8D 3KLHC 1XSIA 3K5RA 4TNWF 4DETA 3HS8A 3FN0L 1D9KA 2BFVH 4KVNH 4FABL 2A73B 4HCRH 5DS8A 5EIIG 4HLEA 1B3JA 2W92A 4CMMA 3V9EA 1PY0A 4JO1H 3FYEB 1IARB 1JFHA 4X6DE 2I9TB 5TD4A 3PHSA 1G9NC 5LWYH 4JVWA 1NLBL 2FWOA 2FX8L 4PGDB 4R5XA 3TJHC 2X4TB 5KVDH 2Y22A 3GZPA 1RLBA 4HPOH 4EBQH 4QRQB 3GBML 3T2PA 5F0JB 1RHHB 3HG3A 5IESH 4TVPL 1F4XL 5T3XE 2CKBA 3BAEL 2VDLH 4RETB 4L0PB 4UV4H 5KN5A 3NJJA 4NIYE 4Z7NF 5FYJH 3BUQA 3Q9QA 3QI9D 5FA4A 3KPNB 1WGVA 4OCYL 3TV3L 2WHVA 2F5BH 3DUUA 3OZ9L 5E6IB 3L4CA 2AMUA 4ZS7L 1F4HA 5FGRA 3UERA 1CXIA 4ZUTB 4HBCL 1BMZA 1A9EB 4AX3A 5DRNB 4UM9B 3UAJC 5IIEB 4L9LB 5F1NB 2VXVL 4EF3A 4Y9GA 2YJLA 1BVOA 2KZBA 1RZ8B 3QNZB 4AGPA 3PLYA 2DQTL 5ICYB 1S9VA 3G3LA 4L37B 3HZMB 2XWBB 3V4PH 3PWUA 2Y0SA 3EGXB 4B0MM 5CN3A 2VXUL 4NZDA 1CGSL 3NVQA 1YNKH 3PWNA 1AD0B 5EU6E 4BQCA 2IDSA 4KUCD 1Z9LA 4NFBA 3SDYL 4FXGB 3WUZA 2LW3A 2PWDA 2YXVA 3NPZB 2DEXX 3CXHK 4LFHG 5DGRA 1I3RA 4Y16B 3VYNA 4WWID 5DJ6B 5TQ0H 3PNRB 3VFUA 3BGAA 4Q6IB 4QGTA 3FMGL 3MRLB 4HALA 5AOMA 3GQFA 4QCIA 1K2DB 4OD2B 2I27N 4X6BB 2CHNA 3BUDA 3X1FA 2VLME 5ESQB 5ABDE 5ABZA 4O4YH 4FCAA 4YC2B 2EDWA 2NRDA 5TE4H 2G75A 1T03L 5I74C 1RZQA 4YO0A 1GS7A 3A47A 1CIUA 3EJSA 4K3EL 3VD7A 3BN3B 4LFHD 2HPTA 5IHZA 5C7ZA 1RZKC 5FFLA 2XFXA 5CJQH 3T3PE 1MJUL 1RZFL 1FV1A 1R75A 4X9YA 5I1LB 2QQLH 2F18A 4KOCA 2P46B 3APDA 4KO5A 1P4LB 1EERB 4PRPB 1G7HA 5ETUB 2C4FT 3PQYB 1U8IA 1JUFA 3ME0B 1A1MA 2NQDA 3PGCB 4FYTA 4HX1A 1JDDA 1HZHH 4OU3A 4KI5E 2BC4A 3HC4H 4KTYA 3MLRH 4FFZA 4L2YA 5AVRB 1AHMA 3NEEA 4X9BA 1JK8A 2OXHB 2Q5BA 3H3KA 1F56A 4UOJA 5HGAA 1MWAB 5D93B 4K15A 3QBTB 1FNSH 1GGIH 4LLUB 5DA4A 2EDLA 4AY0A 3W38A 1YZZA 2CJUL 1L9TA 3L9RB 4JQVA 1IM3A 5L2JA 3HE7B 4RISL 1T6WA 5GRUH 5C70A 5KBLA 1KYFA 3O2VH 5EOQH 3IE9A 3RNKA 4M93B 1N5YH 1KTLA 3WS3A 5AYTA 3ECBB 4FNPA 1GW6A 3P3RA 3R06B 5DMYA 2J1ZA 3V6OC 2C9AA 2EEFA 2NT0A 3QVAA 4EI6A 1FQ9C 1KIQB 2E9BA 3PUUA 3VWKD 1R46A 5JORA 2NX5D 4EN3D 5HDQH 4B9JA 5HI4D 1GYWA 1D2PA 3DVFA 5LGJB 3ZZQA 1NDMA 2A3TA 5E2VL 2OTUA 1L0YA 4MSWB 1DLHB 1K8DA 3FZUC 3QUYC 5KYWB 4E41D 4FNQA 3V4UH 4HEPG 1L6ZA 3GPEA 1S7RA 4P5SA 3KPOA 4BH8A 3MBXH 1Y1UA 4M7JL 4ZDHB 5TQ2L 4K5OA 2EXWC 2SEBB 3NIGB 3SY0B 2X89D 3WFBL 1GVIA 3NAAH 1VZGA 1H0DA 3HG1A 4NZFA 3IT8D 4ABVA 3D69A 1D5MB 1NBQA 2HN7A 3N42F 3JTBA 2FYVA 2AANA 2H1XA 3GXNA 5HVHB 1SJMA 3SKOB 3POCA 3IJEB 1QYGH 5FO9A 4H26B 4FXLA 3IDGB 2Y7MA 4FA7B 3NRQA 4OTXH 1FIGL 4Z0XB 2WQVA 5BQDA 2ZG3A 2OCFD 1OOWA 5DFVC 5CZVH 1OLZA 1YNTB 2QLVB 4HH8A 1MCFA 1EV2E 1O7DE 3MREB 1JNHA 3DC0A 3DGCR 4UNTA 3TBSA 4DN3L 2W91A 1SXZA 2XRAH 3R1GL 3NCMA 4HBQA 1OAKH 3BWUC 4NQUA 4R7LA 3U9PH 5GRWA 2HUEA 1KV7A 5F9DC 1GIGL 1OP4A 4WTXA 3MNZA 3LNIA 3OWRA 3N3EA 3NSDA 2YD7A 4DP7X 2C7FA 2DWEB 2AK1H 2WXLA 1AZRA 5ANHA 3AREB 3LNFA 4PJFA 2ZAIA 1AGEB 3KPPA 4ODVL 5KVFL 4BWTA 5DHXB 3TEYA 2ZPKH 4BM7A 2CIKA 3RUGA 3UYPA 5DJXB 3BKYL 3TL5A 5BQ7B 5JPNA 4E5XB 1SJEB 3O3BA 3SYAA 5HGBB 4WI0A 5D1XC 2V2WA 4R90H 2DLGA 5DF0A 4R2GC 3BFWA 3BKMH 1E4KA 1XH1A 5LBGA 4G5AA 4WTZA 2MOGA 4NLHA 4OIIL 1FZOB 1KTDB 4MMZB 1FC1A 1ND0B 4FADA 1YQ2A 4MQXC 1J8KA 5L88H 3SO3B 1OAQH 4K7PX 5JOFA 3FO0L 4D8PB 1C8QA 2UV3A 4MKMA 2CBQA 4X6FA 2V17H 4HFWA 2HJFA 3QCVH 4HV8B 1B0GA 1EO8L 3RQ3A 3RX8A 4GY4A 3UGXA 3QZBA 1JWUA 2XIDA 3W57A 1AZVA 4F37K 1TTGA 2VLJD 1Q1JL 5F7EL 3FU9A 2ZUUA 1O5DT 2EDFA 3PL6B 5DYOA 5TDPA 2NR6D 1ACCA 3O8XB 4OUUA 2ZUTA 1E2WA 5CCKL 2WINB 4XVOA 4ODSL 8CGTA 3SYOA 5I6OA 2IPTH 5IB1B 5IQOA 3Q5YA 1OF2B 4Z95H 4MDRA 2YD2A 2QTEA 4MXQD 1WZ1L 4X9HA 4NC0B 5DJDA 5FYJD 3C6SB 3KLQA 4F58H 5DI8A 4W81A 3EG9A 5HTSA 1A7NL 1ZE3H 2WP3T 1KEGL 1F4WL 1G0XA 1HHHA 1QZ1A 2VDNL 4XI5C 4XHQA 1NDGB 2XWCA 5HHPB 5HI3D 2JQAA 2NDFA 3WFEH 4LOVA 4OM1H 2R9HC 1C5CL 4ABQA 6FABH 2N0MA 1HFUA 2EQDA 3CVCA 3QPQD 2HKHH 1Q9OB 4HS3B 2ZWNA 4ODUA 4EKXA 2ADJB 4Z7OF 5D6CA 4ZUSA 2FDBP 2NY4C 2IOOA 3WE6B 1JGLH 1Z7JA 4WNSA 5BW7A 5LB1A 3KCPB 5D55A 2J44A 3N55A 3GI8L 2WXFA 2NZ9D 1WJ3A 3S2AA 1GSKA 2C3GA 3P02A 3QRBA 3RWIA 5I1CL 1JNNL 1XEDA 2BIOA 4RGNC 2CU9A 2RBLA 4QHNA 3QDJA 3ZSTA 1HWHB 4AYID 4X99B 2JMRA 5D71H 3IDYC 1NH6A 3T5WA 1EFQA 3NN8B 5HHVL 2VDPL 3LPPA 4OF0A 2NY0C 5B4MD 1PJ9A 4PGEA 5ECJE 2ESVA 1FVCB 3VFMB 4U1IA 4L1TA 2XWZA 4DEWA 1BLNA 4ZG1A 3RA7H 1MCQA 2HG5A 4GLRI 4ODHH 2E3VA 3CWGA 3IRCA 4WUKL 1RZGB 3ETBF 3ARFC 1AGCA 5HYQB 5KSAA 1REIA 5E08H 2OP4L 4HUCA 4ZODA 4H7VA 4Z7NB 1VLXA 3MNVB 1VGKA 1M9WA 4K4KA 4QI3A 4KH9A 5EBMB 2AAVA 3FU7B 1J8HB 3ZDXF 2Z9TA 2VR8A 5ERWA 5F6IC 4JB9L 3ASNB 3PWPE 2E56A 4S1SH 5E8NA 4GUOA 2GG1A 4NQEB 5BO1L 2VJ8A 4H2AA 4FYQA 5GQBA 5DWUL 2I5YH 2WO2B 4PHXA 1ZKAA 2KMWA 1UD3A 1J1PL 1CI3M 1XR9B 3FQ1A 1DSYA 2QKIC 3D8MA 4GS7B 1A14L 1ORSB 4Q9QL 35C8H 1EDQA 3ZHNA 4LCWE 3M07A 2FK9A 4NUQA 4KKBC 2W9DH 1GYVA 1J9TA 5CGBA 5B39G 1CLYH 2X4OB 1A7QL 3EUUA 5IW6A 1UTDA 4L1BA 2OMXA 3DV4A 1A3LL 1TSRA 1QFPA 4L8DB 1QSEE 4URTB 5I75C 1LLAA 1DN0B 1NGZB 1MVYA 2B0SL 4Q2ZB 5C6TL 1S9XB 5FLUA 5TDOA 1C1EL 2BJML 2WLNA 3W39A 1AI1H 3QUXA 1MI5A 5G4OA 5IUSA 4P2QE 1XIWD 3CVHA 1NEZA 2GSGA 4FTVD 4QY8A 4PV8B 1HXYB 5EF3A 3AG2B 5HYJE 4B9GA 2J7LA 2P5WA 3NFSH 3RWDA 1HJCA 1JZDC 3HB3B 1A3RH 1HH6B 2J2ZB 1USQA 2X0VA 2AI0L 3CZJA 2X0UA 3VFOB 2HRPL 1DFXA 4WI9A 3QPXL 3GF8A 1WHPA 3EFOA 3H9SE 1J0YA 1OCCB 1T21A 1WAAE 2Y07H 3IE4A 2QFRA 1MHPH 3DURB 1W0YT 3B1TA 5F1SA 4WV1B 3L3KA 3IDNB 5IROA 1IBFA 2O61A 1XF2B 1IGTA 5EBLA 3TM6A 1CDUA 1EFXA 1GL4B 4YLBA 2R1XB 5AZEH 2ZCZA 4NQVA 1P7QB 1ACYL 1QFWL 1X5MA 2HT4C 1YHPA 3CSBA 4JHVA 1YY9D 1QA9B 3F84A 1NIEA 4WJKB 4A7UA 2EYRA 4GG6B 1TVDA 3KH3A 3ALXA 4HS6B 3T8XB 2XN9A 3J2PA 1TQTA 2X6UA 1WO2A 2Y2WA 5J6SA 2VB5A 4JEGB 4L1LA 3HG0A 5L2KA 5E94B 3D06A 2R39A 1GPOH 1SM3H 4M1CD 5F3BA 2DMBA 3QJSB 4DVBA 1R3HB 3CBRA 3MRHB 5EO9B 4DGIL 1CK0H 3KYAA 4KOBA 3WKML 1WWWX 3A23A 4KK5C 3HLAB 3QEHA 5DDHB 5AD0B 4M5SA 1CGWA 3ILQD 2V9TA 3GS7A 3KJ4C 1HAUA 1LGVA 4XP4H 2F7RA 2EEXA 2X2HA 3BVTA 3GS4A 3OB0H 2HYMA 4Q89A 4OZGF 4IRZA 5ANMA 3RFZB 1BFVH 4WGWB 5JOEA 1LILA 2Y5TB 2M26A 2FB4L 4AI7A 3TXAA 3J07A 1C08A 4YGAB 1F8TL 5DD6B 3ABKB 3Q8BA 4WFGE 1QFWI 3VXSB 2BIQA 1N19A 3VFGL 4JFZH 1KBGH 1NBZB 4HIHA 4I2XE 2X41A 2YSSB 3GMQB 3LS5H 2QSVA 4FFYH 4LCCB 4XCYB 5GSRB 3RJQB 1Q0XH 1LO4L 1GCFA 4NZUL 3SE6A 3CDZA 1ZE3C 5AW1B 1LK2A 4PJ6A 1M57B 1ZGLP 3U6XA 1MH5A 1W72B 3ZQXA 3MA9L 3Q8AA 2HUHA 3FCBA 3RDTC 3KYMA 2WQUA 3N42B 1MFDL 1E65A 4Y5XA 4ILDA 2IAMB 2I9LA 4FFWD 4RMUA 3I9GL 3FTVA 1SF5A 3KS0J 2JIXB 1MQKH 2H3NB 3EOAA 3MXVH 4W9ZA 3SDAC 4DZ8A 3U9WA 5HPMB 1TZGH 4V1DA 3RI5F 2HCZX 5F7NC 5GS1C 4UOQA 4O2EB 4HIEA 4AM0A 3EJJX 4FI6A 1UXWB 5SWZD 1H5BA 1OB0A 3D39B 3BH8A 1IJ9A 5TFSH 1CD9B 3GBNH 3HA0A 4U6YB 3LXAA 5FUCC 3ARGA 1NLDH 4J6RL 2AEOA 2FQDA 1MCBA 2UZXA 3GSVB 3LCYA 3VXRD 1MW2A 5DR5L 4C83A 5EF1A 3DVIA 1T2XA 5K9KA 1BOYA 4Y5VA 4LAJH 3CU7A 4LHUG 2IQAB 3RIFF 3ZU8A 2XETA 4Y4KD 1CDIA 2WBJC 1I1AB 4QRSA 1XF4A 3Q2NA 4UIMB 4MAUL 5DSCA 3H9ZA 2UZPA 1EMTH 1M3JA 1VRSA 3UTSE 1DJXA 2B9BA 1ZK9A 3APCA 5J5EA 2XWEA 3VWJC 2C1PB 4ZW7A 2EIKB 5A7BA 3FT3A 4L3EB 2BXZA 4I18C 4RH4A 2VJXA 4QRUA 2YPLE 3HKZA 3GMOB 4JHWH 1NANH 2X2JA 5JPMA 3FXIC 1PLGL 1UB6A 4BZ1A 3DETD 5EORL 4LHUD 2Q7NA 4HUUB 2CALA 1J5OH 4X42A 1F13A 5AOIA 2P43B 3CZFB 2WXPA 4TNFA 3QNYA 5TH2A 4HGMA 2WM0A 1JGDB 2Q8AH 3EBHA 4Z1PA 2ICEB 3HBZA 4JO2L 2DDQL 3S5YA 4LU5L 1JYWA 4AYFB 1U30A 3TH2T 1WPCA 4JZJB 3P73A 2G3NA 4WI5A 1BM7A 4D9RE 3GSOB 3I75B 1DR9A 3BE1H 1MCKA 1V7MH 1CGXA 1CL7H 3NG5A 3BQUA 1MFEH 4GIAA 4OFKA 5FWRA 1YDPA 3GXMA 4LOUD 3U7YL 4BYHA 4DAGL 5HHQA 4PS3A 3G6JE 3FTGA 4A2EA 4ZMPA 5IM7A 4IGBD 1QPKA 1NL0H 2BFVL 4KVNL 4M02A 4MZIA 3KG5A 4QRPB 4DFHA 4HCRL 4R7DA 2K8MA 1AYOA 2VDMB 4LT7A 5TDNB 3O9WB 5CP3A 4C58B 2AQSA 4D9LH 2DQEL 3BVDB 4N26A 1UC6A 1XAUA 3IU3B 2F8IA 1BXUA 2DQIL 4NQCD 4NO0A 1HCZA 3FH5A 3ZZSA 3D1MC 2ORBL 2X10A 3SDCD 3QDMB 3KGSA 2PW1A 1ORQA 3DPBA 1DQVA 5B3JF 2B15A 2CLZB 4M3HA 5CGYC 5GZNA 3QZMA 2OXGA 4BINA 5IESL 4U1GB 2VDLL 3BPCA 1NAMH 4FG6C 2H1PL 2VISA 1KFAL 4GEJA 1JZ8A 1HCVA 3HNVL 4OT1H 4N90D 3GSUB 1IKNA 3CUPB 3KMDA 4GT7A 2CM5A 3IJSB 4Y4HB 5IHBA 4RFEA 3RTQB 2GY7B 1CPUA 3MJ8B 2GC7C 3X2QB 1QQDA 4NFCA 4F91B 2H32H 1ZOXA 4BZ2H 4FFVD 1ECZA 4YQXH 3IAPA 2EZ0D 4K7FB 3QQ3A 3FSAA 3IS0X 1J9QA 5EU3B 2X4UB 5D8JL 1JGVH 2OMNA 5BVJB 3WS6C 2J1XA 2K78A 4PJIE 4CSSA 1IAIH 3QR1A 3IK2A 5ENWB 1PQZA 1ZXQA 2QPSA 3LEYL 2RA1A 3VXNA 1YNKL 5A16B 2DWDB 2ILLA 3RGVB 1TVHB 2PP8A 3HFMH 3IF1A 4JKPH 3WNKA 1M4KA 4OF7A 2FYYB 5E6ID 2D3JA 1NZRA 3OB0K 1JK9B 1R3LA 1G1OA 1L5GA 4YDVB 1W15A 1W80A 3NABL 4PJDA 4UM9D 3TFKD 3O6FD 1SDYA 4ONOA 4Y9BA 4ZQKA 4G3YH 4NCC1 5T3ZE 2EUVA 5EUOA 3JUYA 4HKZB 2J12B 1ZD6A 2D7MA 3LIZL 3BUPA 1J1OH 3RBSA 1GTNA 2Y5QA 2NY3C 4RRPA 4NLAA 4P5RA 2R29H 1XFPA 3HC2A 2E6JA 3QISA 4PVLA 2N59A 2ADFL 1E8XA 2IDTA 2Z91A 5EZLB 1OAXH 3ALPA 2W94A 5CKGA 1CICD 1ROWA 4IKIA 4MA3B 2WTRA 3IDMA 1YEHH 4KV5E 4LQ1A 4O5LH 2G2RB 3G5YB 4A38A 3QUHA 2DH2A 1HQ4A 2NOYA 3BSZA 5GS0C 5I2IB 4P2AA 3QUMA 1VA9A 4BFIA 5C08E 4N0YH 1BWMA 2QQLL 5KVEL 4JKKA 4TQEH 1IV8A 5GGSY 4B7IA 2APVA 4M1DH 1CQYA 3DI3B 5IMLA 3KL0A 2CO6B 1V3MA 2ZQKA 2GTZA 2CIIA 1GZPB 4E9WA 5C07B 1HZHL 3B5HA 5H2BA 2OX5B 3QIUC 2AJ3A 3QEQA 4TV3A 3MLRL 4RMBA 5I74B 1OB1A 1BZOA 3UTTB 3FB7A 3MLUH 3O3AA 1OM3H 1XBDA 1AMXA 3V5DA 4JQIH 2ALAA 3RWEB 4MDJA 5IFHL 3AB0B 2VLRB 3D30A 2PYEE 4F7PA 5LCVH 4K2UH 3WNPA 4PTTA 3O2VL 2UY7A 4D9QD 2OR8A 1T5WB 5EOQL 3P3UA 1OTTD 3MGOA 1DDTA 1EEUA 4D3CH 5HYFA 5L6YH 4IU3B 1N5YL 3VSUA 1VADA 4R4BB 3ZTJH 5EF2A 2H2PC 4ZBJA 3SKUD 5I6XB 5H8DA 3PQYD 2OR9H 5JA8B 4HMCA 5IR1A 1KYDA 2LE9A 3P4NB 1B6UA 3MTXA 3GJFA 1DQMH 5SWSB 2AKRA 4QRTA 5AOKA 1I8KA 4BFBD 5MEND 1RUKH 2Y1VA 5HDQL 3I3DA 2LFEA 2A6KA 1ADWA 3K91A 2FBJH 3MTRA 4RQQB 3R4RA 4U1LA 2IANE 5I17A 1U3HC 4AJWA 3TNNA 1ZHBB 2H47C 3VXUD 3AWEA 3V4UL 1ZANL 2FT8A 2FATL 3MBXL 4WAFA 4WI4A 4EZLA 5DC4B 1SOQA 1SYSA 4WK4B 5D7LB 1LO3H 2D03L 3VX0A 3LXUX 1R34A 3NAAL 5IMOA 2OW6A 3NCWA 5E00B 1DVXA 5CBEA 4DQOH 1CD0A 1CXFA 3FUJA 5IQLA 2FTAA 5KJRH 4Y1AA 3MSPA 4O9HH 1F1DA 5AUMA 1ETZA 3Q3GB 3EO0A 4C57C 4UCFA 3MFFA 4PI0A 3QUYB 1JZJA 1Z0NA 1OAJA 5IBUG 5DVMA 5CZVL 3SZKC 4AIZB 1CR9H 3L2LA 3QUKA 4JPIB 3GIZL 2DJMA 2VMEA 4Y0GA 2V2TB 2XX1A 5HHNA 5F1KC 3WJMB 1JRHL 4RAHA 3NK4A 3U9PL 1HSBA 1JFQL 1ILUA 5IP4A 1A21A 1OW0A 2DL9A 1OGAB 1BWWA 1N6UA 2WWMC 4KO9A 4Y2LA 5GSVB 4EI5D 6PAZA 2AK1L 3O4LB 3D3VE 3ROOA 2Z8VC 1Z5LB 4NQDB 3ZJAA 1WBXB 4TPRL 3SIKA 4A2MA 4MAYB 5FUZL 5JOPE 3I6KA 2OMWA 5L8KB 3IEAA 4QGYA 1VFAA 1EX0A 3V0IA 4I48B 4PJEF 3A24A 5GGRY 5HGHA 1F6AB 3MA7B 3BKML 3GRWH 3RWGB 1OAZH 1DZBA 1KXHA 4PY7B 4N2IA 1J1XL 5FYLE 2GUOA 3L7EB 4NENA 3HG5A 4ZO7A 4BSJA 2GAZA 4GQ9L 2FIRT 4UDTB 2ZUSA 1F1GA 1OY3B 3ARED 2H8PB 4ZT1A 2XG5B 3OQ3B 3IPBA 4MB4A 1JRHI 3HE6D 4G1MB 1JTTA 5EN2B 3QCVL 3WFCL 1J05A 1AO7A 1NM9A 3DV6A 2ZP8A 4OKVA 2XKNA 5D1XB 1OE3A 3B6SB 1F3JA 2AEIT 2FSEA 3DBXA 1X9LA 3EGDB 2DQCH 3FRUB 1RFDL 3LB6C 3LKSA 4G7VL 4GSQA 2FGZA 4JFHD 4JHBA 9CGTA 2IDCA 4YBQC 1HEZA 5SX5H 1KPRB 3RIAK 3I6GA 1U33A 2DQFB 4MCYB 1XXDC 5IW1B 3T4YA 4QTHB 4R96A 4XBEH 1DVFC 1M1SA 3PIQB 3BP5B 2V5RA 4Z95L 1CYWA 1ML0A 5D5MF 3PJSB 5DLLA 4HGKC 1UXSA 5C71A 3QCUH 1MRFH 1T66D 3QH3A 1MCPH 4WU5B 3RP1A 4G7RB 4WWPA 4J8QA 4P4KA 1MCJA 4AEEA 5D1ZC 4TNWK 5JHLL 4QUOA 3A67H 5TJWK 3RPBA 4WW2C 1PTZA 5BOJA 3RKPA 2HKHL 1L6PA 1SDDB 5SWQB 3NTCH 4Q14A 2F58L 1QBBA 2J88H 4PGZA 1XSKA 2LQRA 5GZOC 2BFGA 3DTXB 1PD0A 4NI3A 1WZMA 4P2RA 4OLWH 1QVOB 3UO1H 3T2LA 2AV7B 4H0LC 5CEZD 4IIQA 4S1QL 1ZLUK 1CFQA 2BNQA 3FT4A 4JRFA 2YJQA 4QWWC 4RESB 4XCFL 3T1FA 3TPUB 1NPJA 3WLBB 3ZN6A 1S7VA 3BAJA 3RG1C 3FRPG 1RZJC 3KLAA 1BYPA 4KNUA 4YH6A 4NERA 5I9QC 1GZHA 4KMLB 4P9HC 3QJFB 5D2LE 1DBMH 3V4LA 3JXAA 4CN1A 1QNIA 4FQHA 4P5TD 1FVDA 3CN1A 4R4FH 4PY8J 2YAOA 1I1YA 1GS6X 2NY4B 3DYMA 5JHDD 2V2XA 3LKQB 1EEZB 3BYYA 3QYCA 2JNZA 4JDVB 5EZJB 2I69A 1RSYA 4OGXH 3VI4F 2IOIA 3CLWA 3RA7L 2ITCB 5IBLC 3OHXC 2DIEA 3H2WA 1WBYA 2H3XC 4AQ8A 2IH3B 4RGNB 5CLYA 2IWFA 3V0VA 2CUHA 3H6JA 2D7OA 2NYYD 4PJHF 4Q74A 2OJEA 2VC2L 1I85A 3PF2A 4XVJL 3IDYB 3W9EB 2VXQH 3CFIC 2EO9A 2NSMA 2F15A 2F19H 1JF1A 3AZUA 3TASA 3IKCB 4GAGH 4LLMB 4X6EB 3Q06A 5DEGB 2MIZA 1N8OE 2CR6A 2LHAA 4Y4FB 3PDGA 5CZRA 1RZ7H 3D4CA 4NKOB 3ARFB 2I5YL 2J20A 1W0WA 2BSEA 3BKCH 3IGFA 4OLUH 3E6FA 3DX9B 4X4MA 3U2SB 5F96L 5I8CB 3ZTJG 4F80A 4OCNC 2OMZA 1A6TA 3LQMA 4HXAL 35C8L 1KCUH 3FOMA 4XHJC 2Q9OA 2XTSA 2W9DL 1J5DA 2YD6A 3M8OL 5MEPB 2VYRE 4CL7A 5BS0D 3ZYOA 3LN5A 4DH2A 3JV6A 3OKNA 3KPSA 3RVVC 2N0KA 3JBG7 1T4KB 5DC0A 1SYVA 2IXQA 3LRSB 3R0MA 3QG7H 5E8EB 1A4CA 1E2ZA 4XNQB 2DB8A 2OMTA 3OKDA 4AWJC 2I07B 3VFTA 1T2JA 2BY1A 3A6OA 2QKIB 1P7HL 1YEEL 3DOSB 3G9VA 3LRLA 1QOKA 2ZXDA 5E6YA 3OPZH 1RAMA 1A3RL 3NMEA 12E8H 1CFNB 4DKEH 3FO2B 1YMMD 2Q7YB 2O5ZH 2M1KA 3GSQB 4KQ3L 1RJYA 2E5EA 1K85A 2X44D 1PKQE 5FR3A 3DVGB 4OD1H 3GKWL 3SHSA 4OLVH 4E9VA 1MW3A 5I75B 4X6DA 3MJ9L 4U6VL 5MHSE 5E4OA 3GUFA 1T5XA 5B1BB 3NJIA 1X3DA 3UDWC 1TQSA 5GRJL 4JG9A 2XICA 1I75A 5IJKC 2AHIA 5EO0A 1KB5B 3QRLA 3REWA 4ZQTA 4UILL 3B5GA 5DC2A 2OJZL 5LKNA 2FWLB 3MRGB 4PPTA 1GGTA 2X12A 3MGAA 43CAB 3C8DA 1FRGH 4P23C 4LL4A 3FN3A 3M7FB 2QQNH 3GDBA 3WLWC 2OMBA 1CN4A 3TVMD 1DUYB 4XNZB 2G9HB 4M8RA 5JPNC 1HWWA 1ZT1B 1GPOL 1SM3L 1EAJA 2PWHA 4WY7H 3VRJA 2J73A 4RSYA 5JDSB 4XMKH 4OM0L 2UWEF 2VLKE 1CK0L 4I3GA 2QHRH 2ZSWB 1J8RA 4ZYKB 4HYTB 2Q8BH 1ZJBA 5GGSB 3VB8A 3DXAB 1MFVA 3D07A 4GO9A 4S2SA 4XP4L 4ZNCD 1UKQA 2A9BA 4KAQH 3MRMB 1RHFA 1LO5A 4RLDA 3QWRD 2DMGA 1OANA 3HAEB 5I1KH 1B2WH 4Y88A 3CDGA 3FOLB 4NZ8A 4YDIH 6PCYA 1BFVL 4A6YB 3LXCA 5SX5K 3F7YB 4JG0L 4TYUA 1Q1PA 4NI6A 2YRPA 4P3CH 5ICUA 4ZAKA 4B9ZA 4TXVB 1SHWA 1UT2A 2K4AA 1DQIA 3BQVA 3O6ML 1ZTMA 4KKAD 5DFTA 3DX3A 4Z76B 3BZDA 1THAA 3KJ4B 4KDWA 4HUMB 2QADB 4JRYB 1TVBA 3OJMB 4JFZL 2ZUWA 1KBGL 2HT3C 2WTPA 3EYVA 5G5DB 3FUDA 4FFYL 3VXTB 4HUXA 1Q0XL 2XQBL 2KT6A 3ZKND 1UJTA 2V9QA 2ZWSA 2PETA 1YEKL 4XO4A 4E68A 1A7BA 4JM4L 4MASA 1T89A 4PB9L 1LO2H 3SPGA 4CVXA 3DHMA 4AEIH 1QHQA 4M5ZH 3SOBH 2YPVH 3UTPD 2O6CA 3ISYA 1MWAL 2E7CA 2XZAL 4G43A 2FJFB 3G5VB 2COQA 4WNQA 1QLRA 1ICTA 1TETH 3ZKXC 4G9FE 3KE0A 4PLKD 4U7SA 1KENL 1X9UA 1JGUH 1QRND 2YARA 2J8UA 3MXVL 1ODUA 2HVBA 4NO2B 4OGYH 1TZOA 2JELH 3GMPA 4PAZA 5EU7E 1W0VA 4EIUA 2FH6A 1BEYH 2HG0A 4BD4A 1A0QH 3KVDD 2C9XA 2C1OB 1FYTE 5FOBA 4MMYA 1NLDL 3B83A 3ARDA 1YYML 2XFGB 1C5DA 1H6EA 1BBJB 1L3WA 1PEWA 1QG3A 3IWVA 3RL2B 1FE8H 2PKDA 1J87A 3UC2A 2IAMD 3S98A 3C6LB 1IC7H 1UEMA 2R2EA 3SDAB 4ORGA 3SJVB 2ZNWA 1EMTL 1T7YA 2JIXD 5IVXE 4WVRA 1I8LA 5C0CA 1IT9L 3VB9A 2Z4TA 2X7LB 1M6OB 3E3QC 1BCIA 4URKA 1JAEA 4IJ3C 4WW1B 2AMGA 5DU7A 4PJEB 4HD9A 4XGZB 1BX2A 3T2OA 3BGMB 2K8QA 1AGDB 3K81A 1P4BH 2IADA 3UEQA 2WBJB 3QRFM 5AVWB 1M2VA 1U36A 4MJIE 1J5OL 5D7KE 5K9JH 5C0NC 1BW8A 1I1AD 1Y07A 5HBBA 4L4VA 3Q8FA 4NSKB 2CDEB 1YO4A 4LKXA 1LP9E 3S5LA 3VWJB 5IGXH 5BOPA 4IHBA 5HHMB 3MJ7B 2H2SC 3BE1L 5D9SB 3GM0A 4OCWH 4P3DA 5GGRB 2MKWA 5BXFB 2KH2B 4L3ED 4WWKC 5CFAA 3TURA 3CFCH 2CMRH 4PJ5B 2YAEA 3QZPA 3UH8A 4HJEA 2NLJA 1FZMB 5FF6A 1PYWA 3KD4A 2KZWA 3MRCA 3L4ZA 4MJ4A 3VSTA 1EAPB 2ED8A 2QR0B 3E1ZA 4CBPA 3NJVA 4RZKA 1CVRA 4XN2A 3WHXB 1C7SA 3GHEH 3S37H 5D5MB 1A6ZB 3TA3C 3BEWB 5FV2A 1ZGLM 3WXVL 2FR4B 1T3FB 3SE3C 4Q6YA 3QQDB 2EH8L 1ZHLA 3D18B 4HISA 2PCYA 2WK2A 3SQRA 1G7JA 3BUBA 2IGTA 3EYSL 2YRBA 5CWSA 1FZJA 1T1XB 2CUMA 3I50L 4FZ8L 4BE5A 4M7LT 4HG4K 4KFMA 4QRPD 1TQVA 4OT1L 4P46D 4RMWA 2B3RA 3O9WD 3IMBA 2NSXA 1LJMA 2GJPA 1OTUC 3CPLB 4GQZA 5C09A 4XZUA 4M9PA 1SGKA 4TNVF 3QDAA 1KCVL 3P2DA 2Z92A 1PVHA 4B53A 4HXBL 4BZ2L 5CIPB 2XJLA 3W9DB 5IY5B 2NNAA 3PCYA 2MCG1 2EP6A 5IROC 4HWZA 1MNNA 5DTFB 3O6KL 5I1AA 1BQHA 2J72A 4U3XA 3KLHD 5C92A 4BH7B 2HRGA 2WANA 2J5WA 3K0WA 3THML 2OL3A 3INUL 5CEZL 1U8NA 1FN4A 2FRGP 1TZHB 5CR1A 4WI2A 3VI4B 2CBMA 3FN9A 3ZKSD 3GUTA 1UURA 1A7OH 2WQXA 3LEXB 4YHIA 4HWBL 4MB1A 4DP8X 5T1DH 4IW4C 3QGVA 4Y4HD 3SCMC 3ECVA 3BHBA 3VQMA 1CT8B 3RTQD 3W2DH 4PJHB 1U8JA 5JR1H 5GRZA 5DZ9A 4LPVA 3OKKA 1S7XB 3RVWD 2NUPA 3IJ7A 2JB6B 4G3YL 4IOIB 4KK9C 1P9MC 3DROA 5I6PA 3DMMB 1SY6H 3CLEL 1UENA 4P5MB 4UT6A 3P4OA 3OAYH 3QUZD 1PJWA 3CFBA 3GSNA 4MMXC 1ZGLA 4AG4H 3PDOA 4DCQB 5IFJB 1PD6A 4KTDH 3ATEA 2ZXWB 2WQWA 5A43C 4NNXB 1EZLA 1IGYA 3RGVD 1OAXL 1THCA 3FHQA 3OXRA 1KGJA 1VKXB 1YEHL 3QO1A 5GGVL 1EGJA 4Y5YB 5ALBL 4OF3A 4J4PC 5T5FA 2CNZA 2AV1A 3MACH 1AMYA 3CVBA 5EWIL 4XBGB 5CKAA 2NY3B 2YBRB 1ID2A 3L5XH 4NUGL 1EXHA 2QEJA 4QHMA 1KGYE 2ZKXA 3QDGD 5AKSA 2B1HH 5EN3A 2Y3AA 3R7QA 2YAQA 1ES0A 4GW1A 3ULUC 2VDKH 1RVFL 3SYCA 4AGMA 4L29B 3CXDL 3N1FC 2XN2A 4WO4A 5C0RH 4Y5XC 1M42A 1O0VA 4AYEC 3MV8E 4IU2A 4UZSA 4QEGA 3V7AG 5CM1A 5HDWA 2ICWJ 2HTKC 2DYPD 1DUZB 4TSBH 4L8SB 1ZT7A 2OZ4A 2GPZA 4JAMA 1TZIA 1QSFB 4NP4H 3ZUCA 1AIZA 3NACL 5I6MA 5B21A 3P4MA 2Z4QA 4KROC 1JPFA 4FQXA 4PJFF 3ULVH 2HH0L 4JFSA 5KSUA 4A37A 2HB0A 4UT9A 2BSRB 3UG4A 2BNRB 3SGKA 3MOBL 3BD5A 3NCJL 4FN0A 3RUGF 3VDCA 1IAOA 2CQVA 4JHUA 4YHYB 3QIUB 4Y5VC 2OTPA 3PV6A 5DMGD 4DKAA 4OUOA 3ZDZE 3QIBC 1UB5B 2JJSC 1XQ4A 4N2CA 3ROLB 3SGDI 1M71B 3DRQB 4HT1L 1DQML 1I9RL 2OQJB 3DX7A 4LRNL 2DQMA 4DSYA 5J6HA 2ZTBA 5EU4A 4IBWA 1NGPL 3ZR5A 2Z7ZA 2NX5E 5CSZB 3Q1SL 4L1DA 1S7UB 3OQRA 2YD1A 2VLRD 3T0ED 3UJIL 2GHWB 4PRBA 4BK5C 1QTPA 4PRNA 2E9IA 4UQ2B 2UWEB 3CSYB 4FS0A 3AGVA 4E41E 5DEFA 1XGTB 1XBRA 4N25A 4CC4C 5LDUA 1F00I 1QLEH 3SKJH 4JJ5A 5KVGH 1MSPA 3L3GA 4AE0A 4DQOL 2FQFA 4IRJC 4PJ7F 5SWSD 1K8IA 4O9HL 4LCWA 5F7UA 5I66A 3MUZ1 1U3HB 1JXJA 5B8CB 1B0IA 1CLZL 4I0PB 2ZYSA 4CC1A 3FU5A 4G8GD 4MQSB 4AEHL 3GDCA 4XO8A 3GWJA 5IZ7A 1CR9L 1KGXA 1HKFA 2BVUA 1PZ5B 1B6DA 1YVLA 4TVSa 3SDDA 1INQA 1U95B 4CSPA 1RU9H 4NBXB 1DDHB 4P2QA 3MN8A 4X8GA 1LL1A 5D7LD 5F7DB 4KZDH 5HYJA 3C75A 3V6ZB 2GIYA 1XB3A 1A9BA 4AYBA 1A64A 1QNZH 3VE0A 1OCZB 1P5VB 2VAAA 2FT7A 3RI5K 5LXVA 4PWJA 4DO6A 1PNCA 3VM5A 1TKWA 1XAKA 5H37H 3L3OA 5DZVA 5KYNA 3BP6A 2ZOWA 3TTYA 4IBUA 1A6UH 2OJ1A 1TU2B 3O6LH 5E5MA 3L3IB 2VR5A 1JPGB 3BLBA 4MD0A 4W9EC 3ZO0A 5F7KC 1NOLA 4XPHL 5BJTA 1D9KB 5DS8B 4NWTH 5F7WC 1BZEA 4CMMB 3U2IA 4KHTL 3QZWA 1G1KA 4ZMWA 3VD2A 1IKNC 4TULL 1BIHA 4JY4A 1EA9C 4FX5A 3B3BA 4JUSA 3MBEC 3UBGA 2H41A 3IFPB 2A4EA 3B34A 4JFEA 4CU6A 4JFFE 4APXA 2XXCB 4HJUA 5DFVD 1E90A 2RQ8A 1NA8A 3AABA 4NQDD 4E9TA 5HHXH 5I0XA 4MAYD 1TMQA 1PU0A 2CG9X 5D7IE 2J55A 4H8WL 4P48A 3TYGL 2ZD0A 3KPRB 5FA4B 2EXTA 1WAPA 5D72H 5B38G 1H3WM 5KUKA 3SGEH 2IWEA 2VLJE 3DUUB 1PF3A 5KVDE 2BMKA 3NUKA 1KXVC 1RULH 1A7RH 4KY1L 4AOFA 2Z8SA 3SPJA 4UNVA 4UZGA 4ZUVA 3IXTA 1RIHL 4A7TA 3DJ9A 1X4ZA 4IRSD 5D70H 1ED3B 4FYRA 5E1AA 4ELME 1MRFL 3OAYK 1MCPL 5FYJE 1S9VB 4JM0A 2NZIA 3IDXL 4R8WL 1QLFB 3PWUB 5E4EC 4L05A 2OMVA 2AJUH 3PWNB 3K6IA 1GCYA 4CGTA 5LN4A 1KNOA 1D5XA 1DVFB 2DQUH 4MS8C 1AS7A 4PJ9A 4LAQL 5DHVB 5EDXA 1CE1H 1FH2A 3M88A 2HJKA 5FA3A 3VD1A 3A22A 3EFFB 1KCRH 4YHNA 3T65A 4G1EA 3HS0C 4RMVA 3HFFA 5EMYA 2X0WA 1DBML 1Z3GL 2CA3A 4KJYA 3VFUB 1C8PA 4K7PY 3WNJA 4R4FL 4OZFH 3U79A 4LVOC 2L04A 4CSTA 5I30H 2WLMA 1I7UA 4JVUA 3ECQA 4QCIB 4WEBH 3K71A 5CNHA 1AGFB 3ESNA 1AACA 2F6AA 3N44F 1OAYL 3WU1A 2WQRA 3RNQB 1SBSL 1KBVA 2K3HA 4M61B 3T6VA 1HX0A 3D2UA 4YO0B 5B1CA 3PFQA 5LG6A 3Q2WA 1UOWA 3QFJA 4KGLA 4DK6A 4ELKA 4FKHA 2LU5A 3DLQR 4MNQB 3W5NA 1YAZA 5E2WH 2E6PA 4K3HA 1KCSL 4JPSA 5DRZA 3ULVC 2VXQL 3QHZL 2XU9A 3H3BC 1KN4L 2E76C 2X53A 3K72A 4U6XA 4UIKL 3VNYA 2F19L 3TBVA 5JHLA 1AQKL 1G7HB 3COOA 4TSAL 1U8IB 1FYHB 2ALWA 1A1MB 4HX1B 3L9YA 4G6JH 1LO0H 4NO5A 2XV3A 3FW6A 3U7WL 4F1ZA 2VZUA 2BC4B 2NY2C 2X6AA 3OHXB 3ARYA 4OJAA 4DKFH 2PF6A 3TO4C 5BZWA 1PAMA 7TAAA 4OLUL 4Z77A 2YPLA 2MJWA 4X7FC 5HGAB 5KYUB 2ZKMX 3NZ8A 2VDML 3F12A 4RGND 4B0MB 4RMSA 5L2JB 2P45B 2E46A 4UQ9A 3VGGA 3UBXB 4GMSH 3QXVA 2BCKA 2CHDA 2J57A 1DBJH 3S36L 3RNKB 4K07A 4WO0A 1KTLB 4PRHA 2J4WL 3PREA 3WS3B 3GBLA 5DT1L 3EHBC 4EI6B 4EE2A 1AQDB 2ZUXA 3H9HA 4FNUA 4F7EB 3LAFA 3CVIH 4Y4FD 4QJ5B 4XC1H 2ZOUA 1PY4A 3O3DA 3CH1A 4L4TB 4F5CE 4YJZL 1HZKA 5J0BA 1FP5A 1ZHKB 1KJ2A 1R47A 3G6JA 3KPMA 4MKTA 1NDMB 4FTVE 1G9NL 5CP7A 3OPZL 2APFA 2IC2A 3EFDH 3LNDA 3X1NA 4AQEA 2N56A 1JHLH 1F3DH 5FYKH 4ONFL 5JO5A 3DRTB 5JXAH 4PRIB 1H8SA 3BWSA 3OWEA 3OR7B 4OLVL 3EZJB 3KPOB 1QR1A 1PMYA 3IB4A 1I8IA 4ADIA 3IFNL 5BCAA 3RRQA 1T83A 4NB7A 3HG1B 4TL5A 2QVIA 4PJAE 1B90A 4GP8B 1E9PB 3F7LA 2DIAA 1QZNA 4B97A 3MLPA 1S9WB 4K23L 5CD3A 4TUJB 4RFNB 3TCXA 4ZNEE 2YPKA 4O02H 1MW1A 4KKRA 3M17A 2J1YA 2HT2D 2B2XH 3GHBH 3EOTH 3KXFB 4NRYB 5FO9B 3BDYH 2A73A 1QTSA 3QAZB 4ANXA 3RKDD 2EH7L 3W37A 1DANU 5CD5C 4HK3J 1JMZA 3GRBA 4HHAA 3TYFA 1RPKA 4QRRB 4EN2A 2QQNL 2I9TA 3STLB 4OVUA 2X2YA 3V6FA 5K5YA 1JNHB 1JMXA 2X4RB 3TBSB 4PGDA 2NNCA 2X4TA 2R56L 4MCMA 1QEWB 2NY1C 4WY7L 4LO9A 2AK4E 4YHOH 5H37G 1ZHNB 4QRQA 4WK2B 1XT5A 3MNZB 1ECYA 2J5LC 1NGQL 2QHRL 2OYKA 2EE6A 4EOWH 5T1LB 5ICZA 3KPPB 5C9KA 1OARH 4P23B 5AYUH 4PJIA 1EH9A 1J48A 3RUGB 1IBDA 3IYLW 3UYPB 1B2WL 5I1KL 3AXIA 3A0OA 1ZTXL 4QDGA 1WC7A 4LZKA 1JZGA 5CJOL 2QQKH 5JPNB 3VFVA 4YAQA 4YHYC 1F90H 4WI0B 3ARBA 2BS9A 2BERA 1A9EA 2PLTA 5JW5A 3OAZH 4L9LA 3U1SH 2PXYD 3QNZA 2DJUA 2XDHA 1RJCA 4FNLH 1NMAH 1MCNA 2APWA 2EXYC 1U3NA 1CDHA 3CCHB 5DRXA 5MI0C 3PXLA 1WD9A 3DXAD 4AQ1A 5TPWL 4IDLA 3EGXA 1F6FB 4IYKA 2XYBA 4LSRH 4HFWB 1B0GB 3FQTA 1AD0A 4I3RL 1HL8A 2WWNA 4XNBA 3Q2LA 1JWUB 4R84A 1S3KH 2CA4A 5KANG 2WB1A 3OF6A 1LO2L 4YR6A 1A7PH 2LAAA 5CU9A 4YXKH 2YPVL 3EF7A 5DYOB 5TDPB 3WDJA 1N10A 4PJ7B 1GXEA 3S0PA 2FT6A 4OD3L 1VGEH 1S7SA 4Y16A 3TWCH 4DK5A 3L1EA 2HTLD 4BCXA 25C8L 4HAKA 1GZQA 2N01B 2QADD 4JRYD 2JELL 4MDIA 4P99A 1BEYL 2VO5A 4Q6IA 5C08A 5DI8B 3EG9B 3M45A 3MRLA 2JK5B 5ADPH 4LLYA 1HHHB 1SEQH 3OM3B 3OZLA 4PYGA 3OG6B 1J0HA 3P77B 1CFMA 4A7QA 3CMOL 1CU4H 1QRKA 5GGTH 4ODUB 4J3UA 2P49B 4WFHD 2VITA 4IKNA 3JWDC 1F4YH 1FE8L 5D6CB 4ZUSB 3VXRE 3C60A 3S34H 2ZUQC 4JHAH 2GBVA 3G08B 2DEYX 5IJVB 5E5UB 1VIWA 3CQFA 2D0GA 1KDJA 3CV5A 1HCYA 1E5YA 4XPFH 2PYEA 3EDEA 5J9PB 3ZL2A 3RWIB 4LLDA 2F54D 1N6QH 2Z8RA 4AQ8C 1P4LA 2YN5A 1LMKA 3AMLA 3EH5B 4H20H 5ETUA 4QHNB 5GISH 3QDJB 4Z0BH 2EADA 4JN1L 5EV7A 5LAXA 5BV7C 3U6RA 4O00A 1IRAY 1KGUA 4Y1TA 2P42B 3CFEA 3C6LD 2VQTA 4FJ6A 3L9RA 2HG5B 4QRAA 3HE7A 3SJVD 5IGXL 2F7QA 2IANA 3JQOB 2P8LB 5FUCE 1ADQH 1XVSA 4OLZH 4W4OC 3DO7A 4K9EH 3RVTC 1WP6A 4ZOCA 4NM8H 4FI7A 4PJDF 1KIQA 2WZPD 5B3SB 3VUAA 5E1HB 2XIBA 4H0HB 5DD1H 5ERWB 3U0TB 2ZWLT 4HGWB 4ZMTA 2GY5A 3ZQ9A 5EUOF 1FDLH 3V4VA 3TV8A 5E8NB 3S37L 5LGJA 5EC1A 4YSRA 3K2IA 1FVEA 3MLWH 3W1ZA 4NXKA 4BK4A 1CXKA 3RURA 3QQXA 2WZ6A 2Q87A 4MSWA 4WWKB 2XJKA 4FYSA 1GAFL 3CH8A 5ISZD 4NQCE 3LH8A 5I6KA 3X13A 2GJ6B 3RY6A 1OHQA 4PJ5D 2K7QA 3N9GH 4N1CA 4GFXA 5IOKA 5J6GB 3JWNH 4PCKA 4XWOD 1ACZA 4ZX4A 1JGEA 1Q38A 2QDWA 3CMGA 3I3EA 5MERA 5LXGH 3DV4B 5KYYB 3AAZA 1JZHA 4OQTH 5EOCH 1KIPA 1N4XH 1QHPA 2Q2EB 1UFUA 3OL2A 1I1FA 5CU5A 5TDOB 4ZO9A 3IJEA 3TA3B 3W39B 4QTFA 4JFQA 3OPUA 2FSDA 4H26A 4WHDA 1MI5B 2CKBH 4YK4C 3WJLA 4Z0XA 3CVHB 1WVZA 1NEZB 2GSGB 1GC1H 1OTSC 2ZSVA 4LOFA 5CMAA 1QACA 1MY7A 4XN4A 2P5WB 4XXCC 3RWDB 1NBVH 4MCZB 1IU1A 2VUKA 5C09E 3MREA 3DGGA 4MXVF 2K7PA 3ISWA 3GXIA 4FE9A 1UZ6E 4CSZA 4ZJ9A 1IILE 4WUUE 5JUEH 2OSYA 5D1QC 2IFFH 2GHZA 5AKVA 5IKCA 3N44B 3EFOB 1FO0A 2A83A 4GIPD 4NKQB 1I3GH 2DWEA 1T21B 3QQ9C 1NOFA 1BAWA 4UB0H 1WFIA 2ZXQA 5DEZA 5FYKD 3W2DL 5KSBF 3L3KB 5DVKA 1AKPA 4YVNA 2O61B 1IGTB 5EBLB 3QQNA 3EADA 3S48A 5LNDA 4XZ4A 5IVOA 3KWTA 8FABB 4ZXBA 5CGYD 1SJEA 4PUBH 2HFTA 4R4ND 1WFUA 1V7NL 2MQ3A 3HNTL 1U8CB 2EYRB 1UVQB 1MDAA 4CNIB 2XN9B 3OAZK 4K71C 3PWLB 5KS9E 4LEOA 4LEXH 1INDL 1KCWA 2RACA 4HC1A 2WB7A 3TIDA 1Q9KA 1V5JA 3K5SA 1JDAA 1P5UA 4LCIH 1NFAA 4ZAKC 5I6LA 4D8PA 4JDZA 3QEHB 4LXFA 2OBGA 2W65B 2WW8A 3QS3A 2X1XR 4WFED 1HWGB 5GGQL 4LKCA 3HI6H 1UUNA 2AXJA 2IEPA 1R0AH 5FB8A 3PL6A 4MMXB 1I8AA 3DMMD 1DQLL 5BVPH 2FEDD 3O8XA 3L5XL 2EIBA 3ZT7A 4E9XA 3IAGC 3SE9H 3QO0B 1F6LL 1R9FA 4KVCH 2GEEA 3EJRA 5IB1A 3RWJB 1HT6A 3GNML 1C08B 3V0FA 2N1TE 2VDKL 3KLDA 4Z7QF 5F7BA 3MCLH 3ZE0F 5JMOC 3HMXA 4TSBL 1A5FH 3TONA 3K6DA 4PTUB 5D2LA 2ZXAA 3UC0H 1Q9OA 15C8H 2B8OT 1FFTB 7PCYA 4TKWA 1LK2B 3BAWA 3ZZ1A 2R69H 3QEGH 3WE6A 3NSJA 2CO2A 1MH5B 2QL1A 4GIOA 4XOAA 3IDIB 3WIIH 1TTBA 1DJGA 4Y5XB 2DBLH 3LNEA 4NP9A 2I9LB 2HX8A 3GINA 1M7DA 5FGBA 1N3NA 4FLHA 4P2CG 4XVTH 3EOAB 3BC9A 1A1NA 4Z8FL 4V1DB 4KROB 2WYIA 4HIEB 1P4IH 2DQDL 2Y7LA 4I77H 3STZA 3P0VL 4JG1H 3AS0A 5F0LB 3U1PA 2YC1A 3P30H 5MENE 3NN8A 5C0AD 3ZE1F 4WFFD 3ARGB 1JPTH 1FVCA 1X9QA 4ONGL 3BAKA 2UZXB 2CCVA 2W0PA 4C83B 1A02N 4FP8H 2EVFA 4YDJA 5K9KB 3R18A 5E99H 5C0BD 4Y5VB 3D05A 4LASH 4GXUM 2Y9RT 2FJHA 3QIBB 3VXUE 4HUWA 3MV7E 3KLLA 4QRSB 5DUJA 5DSCB 3DX8A 4N0CD 2VWEE 3PPEA 5ID0B 3MNVA 1D5RA 1HSAB 4J5VA 2R4SH 4FLSA 2O6FA 2VQUA 5EBMA 5E5LA 1S78D 3OV6A 1J8HA 4K8RH 4U0QB 1MELA 3SODB 3TEXA 4ZW5A 4JJHA 4W4NA 1N7MH 3ZHLA 1YA5A 4K9EC 5KVMC 3EO9H 2W59A 4DO5A 2HLFC 5JPMB 3MLVH 5F71A 4X0NA 4NQEA 3WFDH 3EXJA 5EBWA 2H1LM 5DURB 4X7SL 3UG3A 2A9CA 2KI6A 3VGHA 5TH2B 4Q97A 3D7PA 3O2DA 4IRJB 2BNUA 5CF3A 1ORSA 3NIFE 1AHKA 3MLZL 1L3NA 2HLAA 1Q9LA 4R6UA 4B41A 4RWYH 5CHNB 1U3HD 2YXMA 3FUMA 1X7TA 3GMLA 4ENZA 1GGBL 4LVHB 2JKSA 4I0PD 5DFWH 4L8DA 2DLEA 1LD9A 2DQ6A 4OFQA 1DN0A 5HHQB 3M7OA 3FO1A 4YZFF 3FTGB 5CZXC 5LAPA 4YFLF 2HKFL 3U48A 4B9PA 1E3XA 1SQ2N 2H26A 3VXQB 4ANKA 4MZRA 1TFPA 4R7DB 5B1JA 5A2AA 3IFLH 1KYUA 3FB8A 5JXEC 5E24E 4XPGL 4U3SB 1KJVA 1ZVSB 1C5BL 4YBLC 1UYWL 1JZ7A 1KOAA 1PW3A 1SRDA 3QAQA 3WIHL 4ZMLA 3D85D 3PS6A 5GS2D 4A6YL 4W1TA 3JWNG 1GC1C 1HQRB 3EGSA 1FORH 1G43A 2PW1B 2MPAL 3DPBB 4QIRA 4UNIA 1ACXA 4FZEH 3MAWA 1DJWA 3HZ3A 3BN9D 4PBXA 2I24N 2OXGB 4A63A 4H13C 3OR6A 5AW5B 5HHOE 5IOPB 2O5YH 1JE6A 3BPCB 3RHWF 4YSEA 1D9KD 2VISB 5T33L 3UZEA 3QIWA 2BS71 2DEWX 1HIML 2VLKA 2Y1AA 5EA0H 2OCCB 4JFDE 2J6EA 3K6SA 4KJQC 3CHSA 5D72L 3MBEB 1TEYA 4RFEB 4BFKA 1G9EA 2N4IA 1P7QA 1AZZC 3QEUB 1HC1A 1XO8A 5FW8A 1VEMA 1QA9A 3VAEA 5IF0A 2NXZC 2CR0A 1XGUB 3ELAT 2PYFB 4GG6A 4N0RA 3ZRFC 3QQ3B 3X3GH 4LHQB 1F86A 2P44B 3L5WB 2Z31A 4IBLT 3NESA 1T04A 4JRWA 2YZ8A 1MF2L 3IS1X 3MRHA 5LNEA 5EO9A 1WIUA 5I5RA 3N1PC 2JV6A 2WZ5A 3MRRA 5AD0A 3HLAA 3RJOA 2OSWA 3AY4A 3VXNB 2AJUL 3AITA 1J0IA 4TUKH 5DK0A 2DD8H 3T4AC 4BIKA 4KTGA 1FCGA 2ZIDA 4N8PA 4M62H 3TT3L 5L7XL 4RMQA 3T0DA 1L5GB 1XH3B 4B95C 3X14A 2QV4A 2HAZA 5IHLB 2EE3A 1HL9A 3WNMA 1T20B 3OX8A 4XX1G 4JO4L 4ZQKB 3LX9A 3ARWA 4OAWB 1YMHA 2E27H 3WFHB 4OFIA 5EUOB 1Z6JT 5DD6A 5E4EB 1HH9A 4UT7H 1D6VH 2WCSA 4G9FA 2ZCHH 5B22A 4CVUA 5I30L 5DUPH 2CGRL 3N85H 1NBZA 4WEBL 4X5LA 4YDLC 2YSSA 3UJJH 2PTTA 2EE0A 2L4OA 4MB5A 4X6DF 1W8NA 3CSTA 1P84J 5IQ9B 4ZSOE 2WCGA 3WBDA 4WO4C 2WOYA 2Y72A 4G8EB 1MEXH 2WTRB 3IDMB 1Y7VA 4ZFOB 1FYTA 1HQ4B 2VZ1A 1W72A 4RZCB 3G6DL 1UWGL 2BIMA 2VR3A 3QJHB 2MQ0A 4TSCH 3S5LB 1E5ZA 3QUMB 5E6SB 4BFIB 4PRDB 5E2WL 2VXSL 4MJ6A 3WY1A 4LVOB 2IV8A 2G3MA 4HWEL 3CFJA 2H3NA 1BD2E 3HPJA 4LIQL 4AIOA 1NICA 3SGKC 3ABZA 2CIIB 4WJ5B 2FJUB 2QV2A 5IVXA 4YIQA 2XUWA 3N04A 5L8LB 1UXWA 3EJUA 3D39A 2AJ3B 2AQQA 5H2BB 3CLFL 4OB5H 4WLCA 3QJVB 2W07A 3FB7B 3O3AB 3HHRB 4IJTA 3GSVA 1RJLA 3FCTA 4KXBA 2H0PA 3EYUL 2V6HA 4MDJB 1KN2H 2BDNH 4XT1C 1U58A 4EUPB 1Z9NA 2IQAA 4N5ED 4PTTB 1DBJL 2UY7B 4MJIA 1G9HA 4XNUL 2RMNA 3JWOH 1ZWIA 1AZUA 4QXUL 5EZIL 5KEZA 3J8F7 4AW7A 4X5QA 5KSBB 3ZVVA 4WI8A 5BS0E 1LP9A 2C1PA 3RIKA 2G60H 3I85A 4I9WE 1PLBA 2P24B 5IBLD 4XMPL 3GJFB 4CRPA 3MPCA 2AKRB 4QRTB 4KKQA 1I8KB 3GMOA 4PJCE 4J8RA 2A6KB 1H3UA 4QF1A 4C59B 2OS7A 3EH4B 3NP3A 4U1LB 5I17B 4K8RC 2R1WA 4HUUA 3EFDL 1IM3D 1GHFL 1M2OA 5K59F 1TTFA 1JHLL 5FYKL 1LK3H 5AYQA 5JXAL 5I0VA 1FAIL 1JGDA 2HKAA 3EHBB 1HHJA 2ICEA 1P1VA 5T1JA 4JY6A 4C4KT 1YMME 3BIKB 3QCTL 1IGML 1NMCB 5JZ7C 4WDIA 5ITBH 1SYSB 4M4RA 5AW2B 5D6DA 1R1CA 2XKUA 3WO4C 2D2OA 3GMRB 4PJXE 2CCLA 3OMNB 4Y1AB 5AUMB 2NY5C 2XZCH 3EO0B 2FNWA 2YRLA 4NYLA 3MFFB 1QFWM 1AXIB 4XHJD 4HZLB 5FK9A 1TPXB 5TDNA 2Q3XA 5FEBA 4AVJA 3L3OC 2EDDA 4PR5A 4GBXA 4P49A 3QUKB 2YAFA 3O41A 4ODXB 2VDRB 2IPKA 5EIIA 4QHKJ 3QXUA 4PG2A 5M95B 3B9AA 3BEVB 4A2LA 1I9JL 1R24A 4OKDA 3TX4A 4UU9A 4JPWL 3QDMA 4BDVA 5EULV 2D2CC 3HG1D 4R5VA 4KI5F 5GHWH 3KR3H 1IAKB 1AC6A 4KXZH 2OR7A 3EBGA 3WG7B 4PG9B 3NRPA 4X8CA 2R83A 3ROOB 1MFAH 5AYUL 2A9MH 3L3JA 2RCSL 5F3HA 3I2CL 4FFTA 4QJ4B 1I9IL 3TJPA 1SFHA 1WE5A 3IJSA 4HCGA 4L18A 2AP2A 3RWFA 2OMWB 4WGVB 2QQKL 1EHKB 1TJHH 2CO1A 1MZYA 3H6AA 3MJ8A 1F90L 3S96A 1SOKA 1ZIAA 2AJXH 2OYPA 5HGHB 1AG6A 1DSFH 4YL4A 1AGBA 2OSXA 5FIEA 1AXTH 2GUOB 2BZDA 4WTZG 1MNUL 1T1YB 5EU3A 1NMAL 4H8UA 3L4WA 3ZE1B 4F33A 4PWFA 4YLQT 1TJGH 4BHUA 2X4QB 5A7EA 1DQJA 3AADB 2KS0A 4YOKA 5ENWA 2EXSA 4DPBX 2F68X 4KVPA 1AO7B 4HFUL 4OKVB 2XTJC 2XKNB 4M6MH 1TVHA 5DYFA 4UINL 1F3JB 2FSEB 1CLVA 3DBXB 3LKSB 1A7PL 2FYYA 3QORC 4YXKL 3UAJA 3PGFH 5EOCJ 1HEZB 2YUXA 4YE0A 3MJGX 4YDVA 4MHHG 3I6GB 4EQ2A 1NCWH 2FNBA 4W9JC 1JCVA 3RY4A 5JHBA 4LF3A 3FPYA 5MI0B 3T4YB 2WXIA 4R96B 3C5ZA 4W9HC 2F74A 4FKEA 2VXTH 4S1RH 3RU8H 1ASPA 4BXVA 4YHML 1QRNE 3QH3B 3ZE2B 1X5LA 1I1CA 3NJKA 4P4KB 3O4OB 1MHEB 1QBMH 5CJXC 1XSOA 1U92B 2X9YA 5EZLA 4Z3FA 1CU4L 7FABH 1JNJA 4F2ME 2L7EA 3MV8A 2WTOA 2WSDA 2IALB 5IBTH 3NZHH 2FX7H 5I2IA 3L4TA 2XACC 2CO3A 1QI5A 4MA8H 4PGCA 2DAVA 2V3EA 1BGXH 3EW3B 2XA3A 3PAUA 4P2RB 4TLUA 5LBVA 5J3HD 2O6PA 5EO1A 4F20A 2YIHA 4IIQB 2QMJA 1CFQB 1H8OA 4F2EA 2BNQB 3FT4B 1DZ0A 2R0WH 3ESMA 1N6QL 3ILDA 1S7VB 2QPUA 1OV8A 1Q9WB 4RFOL 3VFSA 1N0XH 4H20L 1AR2A 5GISL 4JDTH 1KC5H 1GZPA 1WEJL 1V3JA 5ACZA 4PW3A 5F88A 5C07A 4BFJA 4AJYV 1T0NA 1X6NA 2DMKA 4GEIA 4OLYL 1XSJA 2ZUQB 2Z1KA 1M05A 2AF2A 2AQTA 1G94A 2V2XB 3JZ7A 2WC7A 1A4AA 4PP1D 3NJXA 2VCOA 1FPTH 4AUUA 1VZIA 2XXMB 4K3DH 1GOHA 2HX9A 3CIAA 3S35L 1RLWA 3MYJA 1ADQL 1T5WA 4CW1B 3SPHA 4JFTA 1EZUA 1RUMH 4R4BA 2OJEB 4C56E 1QUPA 5F9OH 5BV7B 1FWXA 1L9MA 3F62A 4J12A 1TDQA 4L3EE 3P4NA 3ZT6A 1I7RA 3K8LA 4NZJA 3MNWB 4ZS6D 4IDJH 2ESVD 5KWYC 1LVEA 3CVDA 2UZIH 1CGTA 3BZ4A 3VJ6A 3RZCD 1FA4A 3KWVA 3RPKA 2FLMA 4G6FB 4QJ3B 1R6VA 1W0WB 2D7PA 1ZHBA 2F5AH 3E6FB 3MR9B 4Z7IA 3C09C 2JJUA 5CP3H 5LGKA 2EIMB 5KSAD 3V6OA 1PZSA 2R8SH 1KTBA 1XXFC 2OMZB 3CX5J 4ZMQA 3O2WL 3N9GL 2NTSP 4U1KA 4HEPA 2R0KH 3LN5B 4DJMA 2P26A 4EDWH 5E00A 4Y7MA 5LXGL 3OKNB 3KPSB 3CN4A 4JQXC 3DSFL 1WZAA 1N4XL 3Q3GA 3GM8A 1SYVB 2JVUA 1MIEL 2C3VA 3FT9A 4G7QB 4WHTA 5FCUL 1AP2A 4HJTA 2OMTB 5I1EL 3ARTA 1T83C 3L9EA 3QUYA 1UKSA 3VFTB 2MCPH 2QVMA 4J3OF 1VACA 1IIIA 3WXWH 4AIZA 2CLRB 3UABA 3LPGA 3MZGB 3L2NA 3L4YA 1IAMA 5G2NA 4ZUWA 3TN0C 3RB7A 1CGYA 1TZAA 1RJYB 3ZKQD 3FB6B 7CGTA 2GUYA 4H8HA 4O58H 1U0QA 2IFFL 4G5ZH 4X6DB 4ALAH 4F57H 1OGAA 4KX8A 4QNPE 4Z7OE 3ATAA 1T5XB 2CR3A 3O4LA 4FQCL 1I7ZA 4YK4B 3QXTA 5F7HA 3TT1H 1XZWA 1NGYB 4UB0L 1IGFL 3FCSA 4JFFA 3QUXD 2BWDA 1MI5D 1SXSA 1Z5LA 2AVGA 4KK8D 4MD4A 4XTRD 5EO0B 3REWB 4HSQA 3VG9C 3MGTA 3VXOB 2P5WD 2ZXGA 1ESOA 1QI4A 1RY7B 4FABH 1L0PA 4PUBL 3NIDF 4P04A 5D7IA 3V7MA 4XP9L 2WAQA 1T7XA 5FCSH 1F6AA 3MA7A 1B4LA 1LWHA 1R5VB 3MRIA 3WNIA 1ET8A 3NSXA 4HIJA 4LL9A 3N40P 4LPWA 4PV1C 4LEXL 4TL4A 3L7EA 2FX8H 3D52A 3KH4A 4NHCH 1HNFA 1GS8A 4XAKD 3CC5A 3IGLA 4WJG3 2RJMA