1IFRA

Structure of lamin a/c globular domain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
113
structure length
113
Chain Sequence
GSHRTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAMRKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lamin A/C
publication title Structure of the globular tail of nuclear lamin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 26
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2001-04-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1260 Mainly Beta Sandwich Immunoglobulin-like Lamin Tail domain 1ifrA00
2LLLA 1UFGA 3GEFA 3UMNA 1IVTA 2KPWA 3JT0A 1IFRA
chains in the Genus database with same CATH superfamily
4N1CA 4WAFA 4WI2A 2N1TE 3VFTB 2BNRD 4MJJA 3QJTB 5I75B 3CMOL 3LHPH 3NGBC 2A0LD 1SDAB 1RVFL 3CQQA 3AS0A 3RUGF 3OGCA 5DD5H 5CJ8A 4NZTH 1G5GA 2AQSA 5K39B 2OTUB 2XI9A 4A66A 2EEBA 2IPTL 1PAMA 5F7YC 3IM1A 3WJLA 2C1PA 2MKLC 2R15A 1BZEA 4WO4B 5I6LA 4MMYA 4UNVA 4EIUA 4AE0A 1DFBH 2P42B 3S97C 4I2XB 4X8JB 4P2QB 5IVNA 4DUWA 5L2JB 5E08H 2G2PA 2B9AA 2C1OB 1I3GH 3NN8B 1OSEA 1KB9K 3IFNH 2NY4C 3JWNC 3OLGA 5DRNB 4TUJB 4JG0L 2P7TA 2XZAH 1Q9WB 1INDH 4Y1AE 1IC5H 5HYSA 4J3SA 2LAAA 1USQA 3MV01 4K3JH 3QDGE 3RRQA 3PP3H 2BS71 2CBOA 2CMRL 3IB4A 1N0LB 4PU2A 4UQDA 2DD8L 3QJFA 4UILH 3DBXA 4E0RA 5I17B 3MVSA 1HESA 1HJBC 3V6OE 4NKQB 1HCFX 2FX8L 4V2CB 3T4AA 1ONQA 3MRGA 5FYLD 3LS5H 3U30C 5CR8A 1NEUA 1HOCA 3P9MB 2R0ZH 3V4PB 4PJHF 1JYWA 3QFDA 1QBLL 1QLFB 3GB7B 2YK1L 2YQGA 1KGCE 5IJVB 3SE9H 1ZV9A 4MWFB 4DH2A 1A1OB 1JL8A 1RCYA 1DDHB 2VDQB 1A0QL 1UCTA 3VD4A 1ZSDA 5EU7C 2R1WB 3BWZA 3LH2H 4Z18A 2APTA 5F21B 1R4XA 2L0DA 4KNTA 1KDIA 2H4EA 1LNUA 5C0GB 1EJ6A 4QXVA 2RR3A 3HE6B 5ABDE 3QG7L 4IS6A 5I1KL 3MFGB 2X3BA 1VGKA 3BESR 3QVAA 3EBIA 4WNQA 2V8MA 4IYKA 4BH8B 4OZGE 3TT1L 1OKEA 1CF1A 1UFUA 3UIZA 3FB7A 3AGVA 3EGXB 4J4PC 1OV8A 5AW7B 1IAKA 5B1AB 4U3XA 1W72L 3QQDB 3QDHA 3C6SA 5F7MC 3UJIH 3T8VA 2EXYC 4RNRB 1HXYB 4N4YB 3O3EB 1BBDH 5CLYA 3MRKA 5KOMC 4Y89A 1GYUA 4GMTH 3NJXA 5AB9A 3LV3A 2DIBA 4Z7NF 2F15A 4N5UA 4ZMTA 1EHXA 1YUHB 1QVOA 1HEZA 1MI5A 2BWDA 2TAAA 4GAFB 4GAAA 4AYFA 3JVGA 1JRHI 4MNQB 2EDWA 3QEUA 4MMYB 3MYZA 5I26A 3F01A 4IRJD 1QSFD 4K9JA 4YUEH 3H7LA 4G5ZH 4R0LC 4WKXA 3ZL4L 4I2XE 2WM0A 4BK4A 2X05A 1RIHL 3K5RA 3QARA 2QSCH 3U83A 5KBPA 1LO4H 2Y07H 1T7XA 2WYIA 1G84A 5B3JE 5J1TC 3TEUA 3P73B 4RMVA 4QRPD 4K5MA 3IETA 2FQGA 3D85B 1B90A 4G9FD 3ZMNA 2R8SH 3F12B 4HALA 4F7PB 2HVBA 5TH2B 4QMEA 2AV1A 2IWFA 3LIZL 4X6CB 4BFEA 2AZAA 4AZ8B 1GRWA 5D7SH 2DI8A 3F65A 5I23A 5DQ9A 3U1PA 5EO1A 1SHSA 3WY1A 5CGTA 4RGMC 1N70A 4Z0XB 3H9HB 1QAWA 1D9KD 4KI1A 4XODA 4LCCA 4ZSOB 4WI0A 2FHFA 4FP8L 4M3KB 5I1IL 4GRMB 3W57A 1M7DA 3OXSB 3WJJC 1TPXB 1AYOA 4Z1PA 1E4HA 1K5WA 5HJBA 1ZEAL 1UH2A 1TZGH 1ZHKB 1BFSA 1JWUB 4OJDH 4UQIM 4LKXA 4D9LH 3WLBB 5L7XH 5F7BA 4PJ9D 4FTVD 3HRZA 1QQDA 4HGMA 4KXBA 4NUGH 1RERA 2CNYA 2WKOA 4J28A 5IHBA 1F56A 3QFJA 1J5OL 1MCDA 1AKJA 2APVA 1I53A 1MEXH 1JMZA 4QYOB 5TPWL 4R26H 2DTML 4XH2A 4U0RB 3S36X 2UZYB 4HUXB 3VFNB 1P6WA 3OR7B 5FYLL 1RJLB 4G1EB 2GIMA 4X4YA 4F27A 2JWYA 5KVFH 3IWVA 3DYPA 1A4CA 4UM8A 2XWDA 4HLEA 2UV3A 2VERA 1MCQA 1JV2B 1I9IH 1PG7X 5GPRA 1XXFC 3E6FA 4M1GL 5CIPB 4BKSC 4KJWC 2OKMA 4ODTH 2HZHA 4X9HA 2NDGA 5EIIA 1TO4A 1IGIH 3GIZH 5I16A 3GM8A 3R06B 4P48A 3A4DA 1DUYB 3UZVB 2GCYB 4QXTB 3PAUA 3WFEL 3REVB 3D2UD 1N4XL 2JJTA 1EQWA 1CU4H 3V0VB 1HFUA 1KYOJ 1T6BX 4AGOA 3KCPB 5B7MA 3BW9A 4HWEL 2WSKA 5C0ND 1NPJA 5IF0B 5C9JA 4K0OA 4F91B 1DZBA 2TRHA 4GLRH 2Q86B 3Q8CA 4OCNC 4U6YA 5ICZA 1QFOA 4AC4A 4JVUA 3V52H 3WY2A 1DUZA 3T4YA 1PLGH 2CLZB 1NJ9A 1OB1A 4KVCL 3TFKD 3SDYH 1A6WH 3MPCA 4TQIA 5C0JB 5D2LF 1UUNA 1XGTA 1O7DE 1I1YB 3THML 2ZF8A 3IMSA 1XF2B 3WNPA 4H1LA 4X6CE 4V1DA 2MCG1 1C5CH 3VNYA 3CFUA 4NJ9L 5FDWA 5I76A 4AUUA 5DJ2B 3TEXA 2OSWA 3EH1A 4W1TA 3IDIA 3HNSL 1E28B 4RIRB 5E2UL 2IV8A 2P5ED 1J9QA 2G2RA 4N2HA 2GFBA 5I6XB 2EH8L 3S37X 4YE0A 1PLBA 2W0FA 4ZSOE 4L3EB 2YXVA 4TSBL 1A6UL 3FO9A 5DK3A 4AH2B 5IW1B 5DEJA 1Q9OB 2X7LA 3BUYB 4UTBA 5KYWA 4ZUSA 1AFVL 1XCWA 1VAHA 3B2UD 5FX3A 3T0VA 2Z92A 3N50A 4U7SA 3HC3L 4B41A 4F8QA 4HKBB 4OBSA 1LHZA 4E9XA 4ZW3A 2YUZA 3SGKC 3A4AA 3B5TA 2JB6B 1XIWC 5KWYC 3VCLA 2A9CA 3MREB 3LKQA 2EIBA 5E4OA 5CAYB 4ZG1A 4Y5YA 4PBVC 4L8CB 3LKSA 4JJ5A 3FQXB 3H3PH 3NK3A 3DX4A 1IE5A 2RMNA 2WN2A 2IXQB 4L4VB 1TQBC 1Z6JT 3HMWL 1JN6B 3L81A 3SE4A 1ZGLB 3OKKB 3UC2A 2E46A 1R33A 3OLIA 3QXDB 4N9GB 5CJQH 1QSED 2B20A 3LZPA 3Q8FA 1UCBL 2J5LC 2AMGA 3WUZA 3CMOH 5IJKA 2D3LA 3BUTA 3LKRA 4XR8C 1RVFH 3BPOB 3CN2A 4QRRA 3D06A 2A1WH 4GPVA 3O9WA 1U3HB 1SY6L 3KYOB 4PJ8D 4WFED 4ZPTB 1JYXA 3BVVA 4HYTB 2FLRT 3UTSA 5HXMA 1OGPA 4XNXL 2IPTH 2IAMB 1OO2A 3EDEA 3L6FA 1BXAA 1P5VB 3CVHL 1G9NC 2B15A 1J9RA 2J12B 2VL5B 1JF6A 5HDBF 2OMYA 2A74C 3DX0A 2GI7A 4LLYB 4WV1C 4WJKB 4PJIF 1G87A 2JNZA 5F6IC 1KIRB 2AFNA 2BVQB 2XWBB 3G08A 3DX8A 3GTNA 4S1DC 4GS7C 5CILL 3M1CA 3TPKA 3ZKNC 4A6YB 3ARBD 3AVEA 3BH8B 4JG0H 3V95A 4MCZB 1V3KA 4QOKA 4CMHB 1ID5I 1AOZA 2FLBT 2F1EA 1CFNA 1S4IA 2QHRL 1EZSA 4HIJA 2CMRH 3MODL 4ENED 4TTGA 5F2FA 2ESVB 2DD8H 3QXVA 3FN9A 4LCYB 5IHZA 4O02L 5F1IA 2Q3ZA 1F8TH 1YRKA 4Z7WB 1O9WA 4N86A 5FW7A 4F9PC 2AVGA 5MI0B 1D5XB 4JW3A 4LHUG 2V2WB 1ND0A 4L3EE 4XVOA 3ILDA 3ZMRA 3EYUL 1UA7A 3CSFA 4ZYKA 4E68A 2PO6A 1QBLH 1HCYA 2YK1H 1HN1A 4ZMZA 4PJBA 4DW2L 1EHNA 3IRCA 3KJ6L 3T1WA 1CBVL 3WJMB 1T1XB 4I88A 4Q4EA 1A0QH 2ZWNA 3VXUB 3IMRA 2WBJD 3D50A 3W39A 1VACA 2VABB 2ZSWB 2AK1L 1HHHA 3BOVA 2QTEA 3HHSA 1T66C 4JQVA 1XSKA 5I1GL 1YDPA 5H94B 1A02N 3QG7H 5EC2A 5I1KH 1KWGA 4LEXL 1LQBC 3OG6B 4AQAA 4L4VE 3BZEA 4XO5A 4YFLF 3S5LB 3UADA 5FO7A 3TA3D 2BSSB 3TT1H 5DK0B 2X4NA 1KTKE 1UT2A 2G4EA 1A4KB 4W93A 1GCYA 1RZKC 4W9ZA 3ZUCA 1AMXA 1F3DH 1W72H 3NCWA 1H6TA 3ZHFA 2EILB 5J57B 4WU5B 3PHQB 3UTQA 4Z5RB 4JPVL 3FUIA 1FVCA 4MCYA 1BQHA 4HCGA 5GRXG 4LCUB 5KW9L 1LO0L 2W95A 4LPVA 6FABL 2FNBA 5AL0A 2ENQA 1Y0LB 3HR5A 3HZYA 3F5WB 3MRHA 2HLFD 1GSKA 5T1KA 4G80A 4NP4L 3GNML 3ZL4H 1NGQL 3MDJA 4KI5E 3QIUC 4WGKA 3MSPA 5AEAA 1R3KA 2HRGA 1RIHH 3SDCB 3PWUA 4DIXA 1FA4A 3LKPB 5KYXB 4GRLC 1BECA 1U8IA 2UY6B 2Y5EA 5FWQA 1U4FA 1LXMA 2K0RA 3CXHK 5ETUA 2JKXA 3F6IA 5IMKA 5I5RA 4AM0Q 2J56A 4PRDA 5GS0D 3SJVD 1KMGA 5L2KD 4WRLA 2ESVE 1OTSD 3MYJB 4MQ7A 2IV9A 3G6JA 3TF4A 1AMYA 1AZCA 4AJWA 4Z7WE 1AZVA 2JF1A 1WUNT 2W0PA 5GRWA 3LIZH 3TT3L 1P2CB 5ECJE 3QIBD 5E9DD 3IN2A 3VFVB 3WL9B 2VMCA 1DVYA 1C08A 1NIDA 4LASL 4HK0A 2FWOB 2NYYC 2OYLA 4JFSA 3S96A 2AW2A 1GZQA 1VACB 4LL4A 2D73A 5C08A 4M7KL 4OBRA 3VXUE 4B97A 2F7RA 4FP8H 2QQNL 5I1IH 2X2HA 3K72B 2ZPKL 3SKOA 2X4PA 4KTGA 3T0BA 1T5XB 1ZEAH 1QATA 2G0KA 2GY5A 4ZX5A 3C6EA 1T4KB 2QQKL 5CJXC 2E9IA 4BSVB 2VR6A 1M1SA 2XRAL 2YRBA 4PGDB 3EBGA 1VESA 1HCVA 2IPUK 3O81A 1RUAL 3AS3A 1J5OH 3LKOB 2HP4A 4XCYA 5TPWH 1PNDA 4P23B 2DTMH 3UC0L 5KYYB 5IT2L 3BEVA 4LBAA 5FYLH 1V05A 2Y7LA 4WCYL 4TMPA 2ZOKA 3PHSA 1FZKA 1NWOA 5ERWA 2ZYRA 3P69A 2D31A 4W9IC 1IGTB 1SJHB 1TVBA 2AITA 2PW2A 5CFHA 5HYEA 3AREC 4ES8A 4KK6C 1EEYA 4M1GH 4H25A 2H3NA 3FTGA 3QIWD 5KJRL 5DF0A 4AQ8C 1KXTA 4P2RD 3EBAA 3IKCB 5EPMB 3WFEH 1N4XH 1IX2A 2FO8A 3MV11 4F2EA 3ZYZA 4WW2F 4YL9A 4HWEH 3NCBB 1TLKA 1SYVA 3CSPA 3VGEA 4IEFB 3IRZA 1I1AA 1INEL 3V9EA 2OSXA 2G30A 3C60B 2UVFA 4KVCH 2YZ1A 3EF7A 4BXSV 2VM9A 3BIKA 4YDLB 5HI5D 3HHRB 2CRIA 2ED7A 3MX0A 5HDRA 1KXQA 2A99A 1HXKA 1BLNB 4U1NA 4EUPB 2JLLA 3FRPG 1WAAF 1QLEL 1G7IB 4GUOA 3THMH 3T3PE 1WT5A 1X6LA 1MFCL 5F9OL 5BVPL 1T20A 4HCFA 4G8AC 3D69A 1XB8A 3QUXD 4NUMA 2DMGA 4U05A 4ZO6A 4NJ9H 4XC1L 1IAMA 5CKAA 2AXHA 4N22A 3JSSA 5EU6A 3BVNA 3PCYA 4XI5D 3OKDB 1SRDA 1ZT1B 3HNSH 3ARDD 5E2UH 5C09B 1LWRA 4F33B 4PHXA 2EH8H 3KVQA 2WHVA 5FS5A 4HFWB 3TBSB 2X0VA 4TSBH 1A6UH 1DSYA 1R47A 4KXZI 5ILTL 1DYZA 3OXRA 3FHAA 3IGLA 1AFVH 2R4RL 4UQBA 2X4TB 3HC3H 4IRSD 4H8VA 3NZSA 3VMPA 1H3WM 2B59B 4XCYB 3P4MB 4L4TB 4XXDB 3QJRB 3DX9A 3H55A 4PGZA 4UAHA 3NIGF 4NYLB 3RWGB 2HB0A 4GSQA 1LYQA 3HRPA 4ODUB 4KVPA 2A6DA 1AS6A 4HX1B 1CLZL 3C5SB 3HMWH 5GJSH 5CBAB 2R1YB 1UOKA 2X89D 4L23A 1E4XI 1NMAL 4A39A 4WHYG 3RNQA 1UCBH 5HJ3B 4HIQA 4FQLL 4X7DC 4WKZA 2N3JA 4ZAKC 2OZ4L 5HI3D 1SEQL 4LEEA 1BD2D 3HLAA 1NZRA 1OTUC 1SY6H 1YMMA 1SUJA 4YWGL 3ZUNC 3KPNA 4C55A 1RKRA 4JFZL 2O6EA 3FQTA 3L9EA 4XNXH 2YD8A 3ZE1F 4PRHA 4PS3A 2E7MA 4AYSA 1YEDA 3CVHH 5GGQL 2CHDA 5DZAA 4OF3A 2CA4A 1IGYB 4NO0A 4XNQA 3MKKA 4GINA 2E86A 2FJHA 5CILH 1JGEB 5KYUA 4EI5B 4WI4A 3OHXA 1EFXD 4YAQB 3KJ4C 1Y18B 2J8UF 3L5HA 5DJ8A 4L3CA 5LBSL 1XGPB 3BT2L 2QHRH 4L0PB 1SLUA 1OE2A 1SPDA 2JV6A 4XO8A 3MBEC 3O11A 2DYPA 1VFBB 1DEEB 1FBIL 3MA9H 4O02H 1XD0A 5I8CB 1W9XA 3QEQB 5GS1A 5JOPE 3WU1A 5D2NB 1HINL 4ZUWB 5C09E 3P3RA 1U8CA 1KGWA 5F89B 5LAXA 3GS7A 5JHAA 1NGXA 3EYUH 5DMGD 1O5PA 1A1MA 3QQXA 2PYFA 1PCSA 2R2HB 5GGVY 3UDWC 3CFCL 2EDBA 3QUYA 3VXTA 2AJYL 4DW2H 3BAIA 4YO0A 1WC7B 2F58L 3KJ6H 1CBVH 4IIZA 3H7BB 5FF6A 3H54A 1N59A 3NFPA 5C6PB 4XVSL 3BQUB 1I7TA 2AK1H 4L4TE 4N26A 1GGIL 4DN3L 3NK4A 3GT6A 2JJSA 4MKMA 5B1KA 1GZHC 4BQCA 5I1GH 4XC3L 1KBBA 3RKPA 5JXEA 3QUMB 2R69L 3HUJF 4OLWL 4XHJC 5CO1A 3VXNB 1DBKL 1TQWA 3PIQA 4LEXH 5DFVC 1MCWW 1FNLA 4XVJL 4I89A 1TJIL 3L9YA 4X50A 5KAQG 4LK4A 3ECQA 2WNKA 3GJEB 1PD6A 1C1EL 5J6HB 4FYRA 1YMMB 2GABA 2NY0C 1TFPA 4JPVH 3CDZB 4EDWL 2BHYA 3SCMD 2GITB 3NIFF 1WS8A 3K4AA 5D5MA 1LO0H 3Q6FA 4HA1A 5LDSA 1OF0A 6FABH 3MCKA 1SVZA 4WUKL 2F7PA 5E8EB 3TN0B 1WBZA 3D12B 5F1NA 4OLXL 3BP4A 2DKUA 4LQFL 1TZIA 3GNMH 5EORL 5KVEH 1NGQH 4CSPA 1QACA 4L9LB 1ZD6A 3SZKC 2PYEB 3O6KH 3IDJA 4EI6B 1MRFL 3RY4A 4EIBA 4D9RD 3IAQA 1BM3L 4B0MB 2AANA 3ZJAA 4BSWB 5DWUL 2D7MA 1KY6A 4X83A 4YLBA 1Q0EA 4RAUB 4Y16D 1FLTX 2BSBA 4NT6B 1FHGA 3HFFA 4LP8A 3QEQE 1QPKA 1OGAD 5D2NE 4AQ1B 1YPZF 1BFOA 5FPIA 4GXUN 3TT3H 2WCGA 2PYFB 5BQDA 3J27A 1X7QB 4PJCA 3VXTB 3G5XA 3I3BA 1QFWL 4NHUB 4ZZKA 2GJRA 1CYWA 2ZAGA 4IGBA 4NNYA 3SOBL 4LASH 1FYTD 3FZUC 4BCYA 1BDYA 1CC3A 5AW6B 5CZVL 4TLUA 4OZFA 1X44A 4IBVA 4M7KH 4JDZA 3D39D 4CGUB 1XHHA 2QQNH 2RQEA 4CN4A 4DHLA 4WWNA 2ADIA 4FLSA 4UQAA 4LFHG 4MMZC 2DLHA 2NRDA 3MR9A 3OB0K 1TU2B 4JKPL 3VXSA 3WNNA 4QHMA 3G5ZB 2NNFA 2QQKH 1XD1A 3N85L 4F7CB 2XRAH 4ZX4A 1JVKA 4ELKA 4LZKA 3TONA 2V6HA 1RUAH 4M4RB 1KWKA 3L13A 1E8WA 3NGBB 1FGNL 4ZBJA 3WTYA 1MUJA 5IB4A 2FSEB 3UC0H 4AQEB 5IT2H 3BGAA 5GSVA 4JQXA 3APNA 4S11A 5F88A 3UEZA 4WCYH 3QORC 1YMME 1SF5A 3CXDL 1HSAA 4KRPD 4G7QB 4I9WE 1VA9A 5AVXB 5IWLC 2YSSA 1DVFC 1H9VA 1BJ1H 3L3IB 4YDKL 4C4KO 4QCIB 3QI9D 4APQD 2VKXA 4KXAA 1CI3M 5KJRH 2FL5B 2MHAA 1H8SA 3SB3A 1T2JA 3QW9A 1GAFL 4QPEA 3K6SB 2NY4B 1GOFA 3DOSA 2ISDA 4CMMB 4HKXA 2EXWC 4N0FA 4EQ3A 3I6GB 1TEFA 1WH0A 2H9GA 3TH3T 3AAZA 3O2WH 3CZFB 2PYEE 2YZ8A 3B56A 4FADA 1OPGL 3FQ2A 1INEH 4NO2A 5I73C 1UD2A 4CKVX 5GGRA 2HFGL 5D7KE 1RHHA 5AQ0A 1HTYA 1X5KA 4WI5A 5BUAA 4DP4X 4HLZH 4H13C 2WXGA 4Y9CA 4GIOA 4J3VA 3U30B 1OAXL 3EFOB 1IVTA 1QLEH 4TVPE 3K4DA 5F9OH 1MFCH 5BVPH 2K8MA 3IGUA 3ZDYB 1JG9A 5CHNB 4WZ9A 1JK8B 3LB6C 4YFLI 2QVTA 1QI4A 1YC7A 2Z8SA 2HVJB 4F3FB 1I8MB 4I48A 4UINL 4XC1H 2YKLL 4UTCA 3EOTL 1SDYA 3HVNA 4D94A 4PLNC 3U2SB 2Q7YA 2NSQA 4J2XA 1XF3B 1Z1WA 4XOBA 4XNDA 1AO7B 2I60L 4PV9A 3U79A 5G5DB 3HR6A 4FJ6A 4LHQB 1S7WB 1B4RA 2VDOL 4AGPA 4ANUA 4TSAL 4HBCL 2CQVA 1FZMB 3HG1B 4Z3TA 5ILTH 3MMEB 5CUSL 2R4RH 5HGHB 2ZTBA 5SWQB 3MJ8B 4NUQA 4QI3A 4F15C 3ARFA 4LMQE 3AG2B 5DUJA 1ZK5A 4ELMA 3U9PL 4A7TA 2NR6A 1R34A 4JO5A 2ATAA 2CPUA 2VLMD 3MLXL 1PLAA 3FAXA 1T89A 3K5SA 5ESVB 3OKEA 1KELH 3MJWA 2OULB 3RDTA 3FKUS 4OZGF 2BHZA 3CDFA 5CBEA 1CLZH 3ARPA 1X7TA 1NAMB 5DTFA 1I1FB 5A2LH 2VISB 2CALA 4YSAA 3DXAA 4MQTB 4G72B 4F7TB 1LP9A 1E2VA 1NMAH 4KNQA 5B38G 1BMZA 4E42B 4LSVL 4MSWB 1I7UA 1UHVA 3DOIA 4FQLH 4R0LB 1UTDA 4NSKB 2OZ4H 1SEQH 2WKLA 2NZ9D 3ETSA 4YHIB 5DEFA 4YWGH 3JWNE 5K9QI 3KPLA 1FUNA 3ML9A 5FCSH 2Z8WC 1YNTF 4JFZH 1ZDQA 3OVUB 1W72A 2XN2A 4Z7OB 5CKGA 4TXVB 3ZGHA 5GGQH 1EO7A 4BD4A 3TVMA 3QUZC 4XMTA 4NBYB 2HAZA 5K9OB 3D9AL 5IQLA 5KVMC 2QPUA 2DQTL 2WXIA 5D1ZD 3VRIA 4FAAB 5IROD 2WLKA 3KW7A 5B3JF 5IZ7A 4KV5E 3QJSB 3ZDYE 3PUCA 3EO9L 5LBSH 3JWOC 4RGMB 1LO3L 3UJJL 3FULA 1UOLA 1UA6L 4N5ED 3VXRD 3IPBA 5JDJA 1HXMB 4Z7UA 1FBIH 3X14B 5EU7E 4KDWA 1HINH 3BRGC 4OUUA 4M1CC 1PZAA 3DJ9A 2B16A 2BNRA 3T6XA 4FFZA 3T2PA 2XWEA 2JXMB 4I5BA 4LRIA 3BZ4A 3L7EB 3HG1E 4IDLA 4PB0L 4XCEB 3KPSB 3VXSE 4JHUA 4PJAA 4HOWA 4OD2A 3CFCH 2AJYH 1SJEB 3QR0A 2F58H 4Z77B 2EVIA 4N2BA 3LIZA 4HC1L 2RH0A 1KZQA 1XTMA 3APMA 3EZ8A 4X7SL 3SY0B 4AYEC 3DTUB 3FQ1A 4XVSH 4FOMA 4W9JC 3VMNA 1GGIH 4DN3H 5E5MA 5B1JC 2WLIB 2HRHA 4XC3H 1TEGA 1G1CA 3UTTD 5AOMA 2R69H 4OLWH 1EIBA 2BP3A 1MHEB 1U8LB 2ZSVB 3RVUD 1DBKH 4ZW6A 2RHEA 4PJEB 2BIOA 2XIBA 2EDTA 3NEOA 4MMXC 3NJKA 4XVJH 5E1IA 4Z7QB 1TJIH 1GL4B 5CCHE 1L0QA 5CZXC 5EF2A 2GSGA 3IK2A 1C1EH 1S9VA 3DVFA 3VFMA 3B2DC 3U6XA 1K4DB 1LD9A 3CLWA 1C16B 4W9LC 3LZFL 4ZUTA 1V3LA 2EEDA 4DOHB 1IL1A 1U8MA 1EZVX 2GEEA 1S7TA 4EDWH 2D7PA 1J48A 3X17A 4I0PA 1CPUA 5C0EA 1DQML 4KK5C 2WNWA 1UG9A 2PCFB 1S78C 2ICWB 1P5UA 1YYLL 3DTDA 3BRDA 3EJRA 4WUKH 1NCDH 2X0WA 3QJHB 5FM4A 1R0AL 1UEYA 2UXGA 4XP5L 4Z7OE 3PL6A 2ZWYA 1VFAA 3HA0A 4OLXH 4OGZA 5GGVL 3IAGC 3MRFB 4LQFH 1MVUB 4KUCF 4OV5B 5EORH 3F00A 4ZMLA 4RMTA 1ETA1 3O6FC 4A68A 3U46A 2GB2A 5ESAA 1MRFH 1AHWC 1NGWB 3GRWL 4N0YH 1BM3H 1I7RA 2CM6A 5ENWB 3BO8A 3ILQC 1DJIA 1KT2A 2X4SB 2XN9D 5D7IB 2UVEA 2XICA 3FUHA 4P9ML 5DWUH 2FJSA 1NGZA 3IDMA 4YEFA 5F96L 3MV8D 2ZKMX 3SKNB 2GC7C 1DN0A 5C97A 3I6SA 3VWKA 2ICEA 1IMHC 2Z34A 1AQDB 4ONHB 3M17B 2ITFA 1GS7A 4W9EC 4OUUB 4X6CF 5JOFB 4WTWA 3NJHA 1FCCA 5LGJA 5E56A 5EO9B 3KXFB 2FQDA 2P80D 4GAYB 3C6LC 4CVWA 4G8EB 3BZFA 1OZTG 3RVTC 3T0XA 4Z7VB 1PDKB 1QFWH 1JZEA 3SOBH 4A2DA 3F7LA 1QO3A 2X38A 3KPSE 4ZK8A 1IV8A 2DJSA 5CZVH 4ZXBD 1XIWB 2AQ3A 4BIKA 1J11A 4P06A 1KIPA 4HH8A 4UQ3A 4XNYL 3TYFB 3TLRA 2A2QT 3ASWA 5DHVB 5A2FA 4NWUL 4A7UA 1O5DT 1IIKA 1TFHA 3QA3B 5EZLB 2F8OA 1J9TA 3CFKA 1TQBB 3HI5L 2NXZC 3TV3L 4JKPH 3VFOB 2K3HA 3RZWA 3N85H 3JQOB 3ILEA 3NZHL 4IKKA 3C5ZD 5TDOA 4PJEE 4Y4FD 2AJVH 4YE4L 3DXAE 2OJEA 4NQED 5D6CB 4M7ZC 1X5GA 2J5LB 5E6RB 1FGNH 4Z7QE 4U1MA 3GYRA 1LEKA 3V5DA 1JBJA 2QBWA 3RAJL 1T21B 1EXHA 3V4VL 3FN3A 5F9WB 1LJMA 1OK0A 3CXDH 2GAZA 4K3DH 4NBZB 4QRPA 4DOHE 1ADQL 1JDDA 3QZWB 5HPMA 4YDKH 1ACZA 4UT6L 1JS4A 1UWYA 2A74B 4WV1B 4HIIB 1CL7L 3TBVB 4Z7IA 4PGBB 1QA9B 1NTDA 5F6IB 2Y7MA 2EDOA 2EDQA 2HX7A 4BZYA 4GS7B 1GAFH 1REIA 4M6NL 3Q1EA 1A6PA 4GOSA 4ZNCD 4YJZL 4M9PA 3PJSA 1JTPA 4PV1C 1E5YA 1D9KA 3AT9A 3KW8A 3NCXA 3BWAA 3QS2A 4EIGB 4X5LA 3FB8A 2O93L 5TGBA 2UWEA 4P49A 1OPGH 2XN1A 4YSOA 1MCFA 4QIRA 3JTTA 2F1BA 5EC1A 1EZUA 2DQCL 5D7IE 1NOLA 2HFGH 2Z7YA 2GQHA 3LRGA 4X6EB 5DRXA 3BH9A 2Z31C 1FVDA 3IGKA 5HHPA 5ESQB 1M53A 1OAXH 4LLDA 4R4FH 2Y24A 3CVHA 2WLLB 2VQTA 5F97E 3IMWA 2ETWA 4LOFA 4M48L 3KYKL 1AP2A 5IEHB 1K3ZA 3KXFE 4FN0A 4NZUL 3GXNA 3TZVD 1FN4A 4D2NA 1MCIA 5I28A 3MXVL 5MENB 3C5JA 4UINH 1R3LB 2GBAA 2YKLH 3QWRD 2XPZA 4P5SA 4Z7VE 2A73B 4GEJA 5I15L 3EOTH 3NSYA 4GO9A 2F74A 5CN1A 5IQMA 2EDYA 2EIZA 3G7TA 2O61A 2I60H 3B8YA 3NACL 2DQIL 4NWTL 2WUBL 3ATEA 4IOFC 2EO1A 2VDOH 3OR6A 4QHKJ 4TSAH 4HBCH 4S10A 3EYFA 4UOW0 2V5MA 5ADPL 1MH5B 1MG3C 2VZSA 1IM9D 1WTGT 5AVVB 5CUSH 1BXUA 3D2UA 3IN0A 2HLAA 3LPFA 3ARXA 5I6OA 5E23A 1A6TB 3QE5A 3MA7B 4JG9A 1XAUA 4OSUL 3U9PH 3JV6A 4FG6C 4ACPA 3KEHA 1N8ZA 4QJ3B 2H2SC 3NUKA 3MLXH 3ULUF 4AIXA 1Q94B 4JRXD 4CSZA 4YIQB 5E99L 4C47A 3IJYB 1JZJA 2MH4A 2Y69B 1PZ2A 4LSUL 4HPYL 2YD6A 2WC7A 3HZMB 3CFDB 4JZJA 1KBWA 2MNUA 5BOZG 2WCSA 2J6EA 3QQ9C 5DS2A 2WP3T 2BWQA 2IALB 2GUOB 1T5WA 1KIQB 4LSVH 3IE4A 2CJUL 1HWHB 2CO1A 3QIUB 4OM0L 1JZ6A 2E5EA 5FV2A 1LVEA 2PUQT 2V5SA 2YXWA 3D18B 3QNFA 4KX8A 4GRLB 4M6ML 1T03L 4G11A 4IKJA 1AD0A 5LWYL 2X28A 5F7NC 1W8NA 3PF2A 1I1RA 4WNSA 4ZTPL 4Z3GA 4PS4L 4C83B 4FQQA 4QEGA 5FYJD 1TMQA 1RL1A 3RTQA 1CDHA 3MBWB 1XB6A 3PQYB 4I1RA 1AG6A 2X3CA 3ZTEA 4MXWL 4KI5F 1MDAA 2HA1A 4JDTL 1IB5A 2HMID 2Y2WA 1FF5A 2XIDA 1U93A 5INCB 3IXTA 3LQZB 4JJHA 4G9DB 1IEBA 3D9AH 5E5LA 5DFWH 2D0GA 2DQTH 1EZVY 1IEAA 3PWVB 1ZHBB 3U0TA 3TURA 1G1KA 2YBRB 3EO9H 1LO3H 2WINA 4I87A 4FFTA 2PLTA 3UJJH 2G3XA 5MENE 5D7JD 1UA6H 2UYLB 3IDNB 4MJIA 4FLRA 4X4XA 5CWSA 5LGYA 2AEOA 1M9WA 2HPOA 4DSYA 4NZJA 5EO0A 4JFEA 3IVKB 2O26U 3GMQB 1OCWL 2WLMA 3TBTA 5KBNC 2C34A 4PB0H 5I1LB 4D0DA 1T0MB 1UYWL 2B0SH 3MV9B 4LCWB 3KE0A 4R7DB 4UM9D 5JW5A 4PJ8A 4H20H 5SV4A 2QZ5A 2CIIA 3UXFA 4HC1H 3BMWA 4X7SH 3K1KC 5CSZA 3QNZA 3WDJA 5MERB 1FNEB 2O4EA 1HL8A 3WKML 4MRCA 5GRJL 1OAZL 3AREB 5DRZB 1CFQB 4D0CB 4OGQC 1SOXA 3FTVA 2I7SA 3QT2A 3T6WA 1CGXA 1URZA 4Q4IA 3ZKXC 4J8RB 5DO2C 1JYVA 2NNXA 1HWWA 2XWTA 3ARBA 3NCCB 1NM4A 4GAJL 2VDKL 4JPIB 3B3IB 4PJ7B 1S7XA 2WSDA 1ETZB 1KB5A 3FT2A 3FONB 2BXZA 3A6CL 3LZFH 2CUHA 2YOAA 2LVEA 3S2AA 3T0AA 2DWXA 1JGDB 1IKOP 1J87A 1DQMH 4AVJA 5EU4A 3VO0A 5FKPB 3K2KA 1YYLH 4NO3A 1PKQB 2HN7A 2GBUA 4BGDA 3P2TA 1R0AH 3TWCL 3T77A 2XY2A 4XP5H 1CO1A 3OKLA 1M9SA 4AW7A 3E3QC 1PS3A 4ZT1A 5DVNA 5GGVH 5IMMA 2YS4A 4M43L 3RFZC 2YARA 3WHXA 4OFPA 5BS0A 5ACMA 3ATDA 1Z2KA 3OKOA 4YDVA 5SX4H 5A7BA 3D25B 5C07B 5JW4R 2CBMA 4KK9C 4W9HC 3GRWH 3POHA 4X7FC 3W37A 1QNIA 3MNZA 4HWZA 4JR9L 2D7TL 4XGZA 4P9MH 3TBCA 1NPUA 5F96H 5K9QG 1F45A 4XB8A 4JFFA 4DWHA 3WXWL 2JKLA 4TTDD 2VDPL 3WFBH 1QW9A 1XGRA 5T5FA 2GJPA 4MA8L 2Q3XA 3DPBB 4GBXC 2I9LA 5BCAA 4FXLA 2H32H 2DWSA 3PV6A 3LY6A 4HAGA 1NC4B 4YNYB 5FYJL 3DX6B 3PFQA 4JFHE 3MV9E 4LCWE 2C7UA 1DJWA 2Z7UA 1MJ8L 4Q6IC 1DQIA 2ZCKL 2BSDA 4R97C 4XNYH 4TL4A 4NWUH 3IFLL 4HETA 5L9DL 3TEZA 4PLJC 3ZZQA 2H0EA 3H2WA 4BK5A 5F7UA 1KJ2B 1AGFA 3HI5H 4RDBA 5JHDD 3FHEA 1RJZB 3GIVA 3TV3H 3WKPA 1KYFA 1WBXB 1GXEA 1UFGA 1AKPA 4D0BA 4WHDA 5DMKB 3NZHH 2LLGA 3WTVA 1M2VA 4YE4H 3K71B 4OD3L 3BCDA 2YQ3A 4ZAKB 3D30A 1EO8L 2AF2A 4PJ7E 1IGJB 3GLEA 1KBVA 2DZEA 2G5BA 2R2BA 2YO3A 3ZT7A 5JMRA 4HU2A 3RAJH 2JQZA 3V4VH 2ROYA 3BYYA 4UIMA 3VFRB 3L2LA 1ADQH 1BFTA 1LE5B 1NGYA 2VZ1A 5I8EB 2ZXDA 3VFGL 2BSTB 3PDOA 4AWJC 1HZHL 2ED6A 4HZLB 4UT6H 4G6FD 5DJAB 1E6OH 2ZX9A 1CL7H 1I3VA 1PKQE 3D52A 3ZHLA 5IMMB 2OMZB 4FNSA 2BZ7A 5IEKA 5I5JA 2VN4A 4CC1A 1KTDB 5KSAD 4M6NH 4H0LC 2XTSA 2FIKA 1B0GA 1S7UA 5C0DA 3KJ4B 4PJFB 3I9IA 3P1VA 5HHNB 4YSEA 3BPLB 3QXAB 3AZUA 5C07E 1YYCA 1LGVA 2OZ4A 3OC8A 3MBEB 1VFOA 2UY7B 3ZYOA 2VN6A 2BSCA 3NCYP 4G6KL 4DQOL 2DQCH 1XO8A 1EWHA 4KJPC 4N3UA 4URKA 1F2XK 1KPRA 4HUUA 5JPNA 4PH8A 2ICCA 3H0TB 4P5TD 3UYRL 1JPEA 1P9MA 1S9YA 4O58L 5KSBA 1YC8A 2EYSB 1J12A 4M48H 1YN7B 3KYKH 4Y2OA 5DYOB 4NZUH 1YLBB 5C86A 3D33A 3L08A 3MXVH 3VH8A 4JZNA 3GJFB 1WPCA 2DMBA 1BQSA 3VJ6A 4PVMA 5I15H 1YQVL 3NP4A 1HE7A 3P77A 4RAHA 1WHPA 3EHBD 4W9DC 1D5ZA 1XT5A 2MOQA 4HEPA 3VXQA 3NACH 2HFFB 3WUWG 2DQIH 4NWTH 2WUBH 3TASA 3L3GB 2AJ3B 3AJ7A 3LN4A 2XBTA 1A3QA 2Y3NA 1CTNA 1XGQA 1ZVHA 5IBUG 1B3JA 1C12B 1OHQA 5A2CA 5ADPH 4WHTA 4I1PA 2OZNA 5L4IA 1GZPB 4NAJA 2ZUQC 5DA4A 3X11B 3EOYG 2EO7A 4OSUH 2DW5A 4AMWA 5L8LB 5LGHL 1T1WA 1IARB 3IPFA 4OQ1A 5C1MB 3TEYA 2WSPA 3GKWH 3OWEA 2ODIA 5E99H 3GTVA 4LRIC 2NY0B 2VERN 4U1SA 2A0LC 2XKNB 1S9XA 4RX4D 4PGEA 4LSUH 4HPYH 4N2MA 4MJ2A 5T33L 2J7LA 5EIQA 3CNKA 3L5XL 1R17A 4DKDC 4KY1L 3O3BB 4HMDA 3QQ4A 4E41B 2GJ6A 2ALWA 1ZDSA 2Z91B 4FFYL 3D0LA 2JK5B 4ABVA 1NC2B 1NFAA 3QUXA 2R69A 3KYAA 3CHQA 3H9YA 2CJUH 5IIEA 5I1DB 3JV5A 3E9TA 1UM5L 4OM0H 4UQCA 4YDNA 1AAJA 1EO5A 4H5SA 4M6MH 3NFSL 1T03H 1YECL 4UMGA 32C2B 5LWYH 3SO3B 3ZYIA 4PJFE 4ZTPH 4PS4H 2XQYK 4HH9B 1X5JA 3LEYL 4J1UB 1RK1A 2OXHB 4MXWH 5JTWA 1SN5A 4JDTH 1DJGA 2H1XA 3B1UA 1GYAA 4PWFA 5D93C 3ZR6A 2F8IA 3RPKA 3RWIB 1RUQL 4AKPA 7PAZA 5JNYB 4IW4C 4XO9A 3H42L 3MLYL 4YSQA 1J8HB 7PCYA 4PRID 5IFHL 2R23B 3CBRA 5CP3H 2ZCLL 1D7FA 5E00A 1NCJA 3DVGB 2VDMB 1E4KA 2IEPA 3HG5A 3QPXL 4JE4B 2OMTB 2WMPA 3L3HB 3MLVL 3QNXB 4W6WB 4X6DA 1BQKA 1DE4A 1NA8A 5E6IA 4DGWC 1G7PA 1U8JA 4M8VA 1ZHNA 9CGTA 3WTWA 1ANUA 5AW3B 2N7AA 4KKAD 1T6VN 2X89A 3DURA 2DF3A 3FRUA 3ROLA 4MMZB 5EWIL 5I6PA 2IMNA 3FFCB 5E4EC 3ZZ1A 3HZVB 4NX0A 3K91A 1OCWH 1A2YB 5DMYA 4LGSB 1ZHLB 1UYWH 3LZNA 5JIKA 4CVZB 2YMXL 4CRPA 1IVLA 2AV7A 4O2CB 3WKNA 3HS9A 5DJDA 3TV8A 4YDJB 4BKLA 2ZG1A 4Y4KD 2QKIA 2TSAA 2QPEB 2VLRD 4MQSB 4M5YL 1ES0A 1PSKL 2SEBA 4Z3EA 4GT7A 3WKMH 1AACA 2YD7A 2J21A 3QORB 4Q7DA 5DRWA 4RMWA 3VYNA 3PNWA 4Z3HA 5GRJH 1D7DA 1HL9A 4S2SB 1OAZH 1DVFB 2KLSA 3RWHA 2E76C 5IMOA 5DVKA 1M1XA 4E41E 1EFXA 4JVPA 1UB6A 4GAJH 1KNOB 2VDKH 3D05A 2VXQA 2WANA 4NPYB 3V9CA 4FQJL 4IRJC 5IOPA 3KH3A 2E7CA 3A6CH 4W70A 4ONGL 1P4LB 2C9QA 2W91A 2OL3B 2G60L 1DANT 1KJMB 1A4BA 1KLGB 1JHKL 2D0FA 2K1MA 5J3HD 3RKDD 2EE0A 2VDLL 5I73B 1R5WA 3HHMA 3ISRA 2V9RA 3SKJL 3TWCH 1XFPA 3HG0A 2AKRB 2H26A 2AQRA 4M43H 5DZ9A 1NBVL 2FEDD 5I8OL 1BIHA 2IOOA 2OR8A 1IC4L 5KZCD 4GSXA 4X4MA 1SXZA 1KULA 1J8HE 3SYAA 3FT3B 2B1HL 2EKSA 1BZ9A 1NFDA 2VTFA 1ZA3A 5G2NA 4FD0A 2D7TH 4JR9H 4JM2D 2NX5A 4MZ2A 1E9OB 1LDSA 1BA9A 4JPSA 2IQAA 1G6RA 4WDIB 2B8OT 3MU3A 4EO5A 4KRNA 3APDA 3BUDA 2Y72A 3ES6A 2OXGB 3MGOA 4NBXB 4KDTA 2P8PB 4FNTA 4QRTB 2VDPH 2ZCZA 2CGZA 3GSNB 3TS8A 1IE4A 4MA8H 5J9PA 1Z9SA 1WZKA 3WS6A 3ROOA 3FFCE 5K9KA 3KGRA 4HKZB 3Q6GL 4JQIL 2VB5A 5FYJH 5C71A 5EFIB 4X98A 2FUQA 4OTXL 1P7QA 3O41A 4PJ9C 4J27A 1AC0A 4ODXB 2ZCKH 2CKNA 2XFXB 5HYJB 5MEOA 4LHUB 1GOGA 1D5MB 3AXIA 5FAAA 2YA1A 4J3OD 2IAND 4PRNA 4PJDB 4WFFD 1ZTXE 3UBXA 3IFLH 4QHUB 5F3BB 3H9SD 5L9DH 1U8HB 4ZUVA 3VFSB 3TNMA 4AENB 5E2VL 3RWJA 1KFAL 4B50A 5I1AA 3T9WA 4OIFA 4JO3H 4XB3A 3VW3L 3C8DA 3FF7A 5AVSB 4NIKB 4UNUA 3B43A 3DKHA 4OD3H 1AYRA 2KI6A 5AOZA 2GHZA 4ODHL 4JRYD 3MV7A 1BAWA 4PRPB 1BQRA 1EO8H 1INQB 1B2WL 4MVBD 1OPOA 3FH7A 1ZLUH 2H0FA 4GSUA 4MZ3A 5IHUL 1TETL 1JI1A 1FV1A 2DEWX 4P3DA 4ZFFB 3GSQB 3WE6A 1QABA 4Y5VA 2BIHA 5C0NC 3C09C 3VFGH 3DGGB 4K2UL 4HG4K 1HZHH 1Y1UA 2G0LA 3U82B 4FULA 3QUZB 5K1JA 4CKQA 2IC2A 1ZXKA 3LRSB 2IH3B 3QUGA 1HI6A 2BVTA 2WO3B 3QRLA 4YFDB 3TFKC 4ALAL 4BCZA 5CJ5A 2GC4C 1BOGB 1FYTA 4BFIA 4KZCA 5HHMD 1OP3K 4Q74A 1RIUL 5LO7A 1NLDL 1FNAA 5KN5A 4K5OA 2A6JB 1SHXA 3QQ3B 4ELDA 3K0YA 5IVZB 2YLKA 3PABB 4YC2C 3DK0A 3UTPD 4IBWA 3QO1A 4G6KH 4PVLA 2P26A 4DQOH 3FU7A 5D4IA 3MLTB 5FO2A 2F53D 3DVIA 4P46D 3L7FB 2OYPA 4N1EA 4KV5F 4IK6A 4PJ5D 4QWWD 3UYRH 1H15A 3ZDYF 4HEMA 3GHBL 1IFGA 2XDHA 3NT0A 4O58H 2EIDA 1ZPUA 1BVLB 3EUDA 4Y5XC 2QV4A 1UOVA 3RY6C 5HYQA 1QHPA 2RJMA 1VF5C 4LBEA 4QO1B 1PCXA 5DHEA 1ZLDA 2AK4B 4KO5A 1TQTA 2WTRA 3HFML 4KXDA 5D7HA 3S5ZA 4C4BA 3B2UC 4JFXA 3LEVL 3FB6A 1YQVH 5FGBA 4XBGA 3EO1A 4HP5A 2DM7A 3SQRA 1MCSA 5A6LA 4ZFOB 3RX7A 5HYJE 2EABA 1HHGA 1TVHA 4PJDE 2AS5M 1E3ZA 5MEQB 3RIAK 5DFAA 4XN4A 1ITBB 3NFNA 3HI6L 4ODBD 3ZRSA 5DYFA 4GIAA 4MMXB 1CGWA 5E03A 4MLSA 4KKZA 2WQUA 5T1JA 2WQXA 2CHNA 3Q2LA 4PHZA 3I6KA 5LGHH 3MGTA 2BSRB 4OFIA 4HOXA 3GMNB 5I2IB 4B7IA 3CLFL 3PHOB 5EN3A 2HG5B 3FSZA 4LLQB 4HC1A 3T0DA 2YPLD 3HZ3A 5T33H 4EZJA 3L5XH 1SLWA 3ELQA 2ZXCA 4S1QL 1Z32X 3C2AL 4KY1H 2A6KA 4PJXB 1BCIA 1UD3A 3HAEH 1ZS8A 4HHGA 3GUTB 9PCYA 4RBPH 5TE7L 4FFYH 1B88A 4XMXA 5BZWB 2VWEE 2WQRA 3U6XS 4HMEA 1NDTA 2X1QA 4PLKD 4NS0A 1UM5H 5FM5O 1G7LA 3O6FB 4ZMYA 4LKCA 2ZWLT 2BW4A 1AHWB 3BXNA 4CJ0A 3NFSH 5EEZA 1YECH 4NNXB 4X4ME 3GRGA 3VB9A 3UP1A 5KSVA 2F54D 3GMPB 5CCGE 1NFDE 2XPGB 4Y1TA 1T4WA 5C0AB 3ZMEA 3BP7B 5EZOL 1B6UA 2ITCA 2KYIA 3FU7B 3LEYH 1ZLWH 3ESOA 3HZKB 2HX9A 3A4EA 3EJTA 4ENEC 3EYQD 4Y8AA 5IM7A 5D1XC 2YAHA 1BG1A 1RUQH 2JJWA 3H42H 3MLYH 4JPKL 1XH3A 3C6LB 4F2ME 1TTGA 5IFHH 2DJ4A 4K71C 4GRWE 1X5MA 3A47A 4BE5A 4XRCA 2ZCLH 1U8QB 2K6WA 2BOCB 3OWRA 2V7NA 2AK4E 3ASOB 1CGTA 3ARGC 3K46A 2GSIA 2ICES 3QPXH 5JORB 2CO7B 4UAOC 3FRPB 3MLVH 4HSAC 4F9LC 5I1EL 4KRMB 1VERA 3GRWA 3M7FB 2WBJC 1HH9B 4GKZB 2ATKB 5EWIH 4PN6A 2NXZB 1FO0B 4Y19B 4P59L 5CGBA 2YMXH 2WIIB 5DEGB 2Y7QA 1J9SA 4M7ZB 1EEZA 2V9UA 2HTLC 1KN2L 2RALA 2H2PD 4YHNB 1KV3A 5SWSA 1RPKA 3VXMA 1FNHA 3TA3C 3AXLB 4M5YH 5GGSB 1PSKH 4MAUL 4XCCL 2VITB 4WW1B 1GIGL 1WZ1L 3GJFK 1N6VA 3FQNB 1N5AA 1VB9A 3ZKMD 1T6WA 1JXFA 4PJEF 1UWXK 2NUTA 1NAKL 5T3XD 4FQCL 3UG5A 2F0CA 2VRQA 5E9NA 4YXKL 3WAKA 1OAJA 4U3CA 4Z7QF 2AGJL 4OIBA 1AGCA 3UAEA 5J1SC 4PJXE 5IROA 5EN2B 3T0ED 2VUKA 4F20A 3L4ZA 2XG5B 5BRZD 3ATFA 4HHAA 3HC0A 4FQJH 2BXYA 2ZT9C 4XBPA 5INDA 3RB7A 3W0WA 4BK8A 4ONGH 4UQ9A 4HKJB 2G60H 4YGVA 1BVOA 3CFEA 4G8IA 5FUCC 1OP4A 2MIZA 2BW5A 4JBSA 5HHOA 3DMMD 1JHKH 1WE5A 5C0IB 3CFJA 2VDLH 3CX5K 1KIUA 4O2FB 3WENA 3MTXA 3SKJH 5C0AE 2Z31B 1JNHB 1ORSA 3W5MA 4E9SA 4FQ2L 1MZYA 4IMKC 4JFDB 2E9JA 3FUMA 5GS0C 1SOKA 1NBVH 1FC1A 5I8OH 1IC4H 5C6TH 1XMEB 1OTSC 4JDEB 1QI5A 4FQ1L 4IOIA 1XCQA 1P1VA 1MFBL 2ZCHL 2BNQA 1IQDA 2B1HH 4A7GA 4JREC 1NUNB 3PGDB 1IKNA 2EDFA 5FKAA 2R51A 3WO3B 5LNEA 3HS0A 3QIBC 1M57B 5K9JL 3MNVB 3LQMA 1FORL 3UAJD 3PXJA 3AG4B 3D34A 3S98A 4W4OC 4OI8A 1E5BA 1DJXA 3ME0A 4LNRA 1A9EA 4LESA 3S3BB 4Z7VF 3ULAB 4KK8D 2YGOA 5K59E 2CBTA 3PYCA 2DQEL 4QHKI 3WDIA 5GZOA 4JQIH 3Q6GH 4U6VL 1CFTA 2CHWA 1J0IA 1FFNB 2YC1B 1UD6A 4PRBB 4Y19E 4B9CA 3LPPA 5ISZD 4OTXH 1U8OA 4IIQC 2CLVA 4KRLB 2CIKB 3CC1A 3OKMA 4PRAA 1OM3L 2N0MA 2NYZA 4LLMB 1FFPA 4JFWA 3DUUB 1VFUA 1LO2L 4G7YL 2GT9B 1DLHB 4HWUA 1MXGA 5CSGA 2ENJA 3S8GB 4QHNB 4ZUUB 2NUTB 2QPSA 3T2OA 5E2VH 2HWZL 2KQMA 5BRQA 3U7YL 1KFAH 4CSSA 5C0CD 4G6JL 4L29B 1KLFA 3VW3H 3DTXA 4RLDA 4F7EB 5LVEA 2ZF9A 4H2AA 1XSOA 1NEPA 1AQKL 4NQXB 3GMRA 3QIWC 4ODHH 1H3PL 1CICA 1RLBA 3VQ2C 2BPBA 2YEZB 3KPRA 1B2WH 3SZ6A 4QHPA 4M93C 2BOBB 1F3JB 2XVBA 1JPFA 5C2UB 5IHUH 1TETH 1PY9A 2HRPL 2J55A 3UYPB 2FNWA 25C8L 4LPUA 1E6JL 5F7KC 2Q3AA 4PWGA 4MZIA 4K2UH 2JIXB 1IQWL 2ITDB 3EYVA 4K07A 3II2A 2AABL 4ACTA 3EGSA 1D5BB 2WIMA 5BMFL 1KGCD 5IK3A 4ALAH 5HI5C 1NL0L 4JFDE 4X6BB 1RZFL 3CCHB 4P07A 4OF8A 5DJZA 3ATBA 3I02A 4ZXBA 5F44A 1RIUH 3L48A 1D6VL 1NLDH 3EGDB 3L3KA 5T3XL 4TM9A 3B9KD 4UV4L 2CBQA 2VJ0A 3QEHA 3GC3A 4RQQB 3O3AB 4YBQC 3UP6A 4GMSL 4UIKL 3WXWH 4G71B 3IDYC 1HQRB 1T1YA 4DCQA 4QTHB 3V5KA 3P0YL 4XI5C 3RZCD 4JFQA 3ARDC 1FFRA 3GHBH 5C3IA 5IKCB 4HCRL 1ORQA 4MJ4A 4OF7A 4BV1A 1ED3A 1JERA 3CHXA 4FJYA 3VWJA 4HJGA 3MLWL 4ADGA 3NSDA 3HFMH 5FYKD 3RVWD 1R24A 1ZA6B 1ZLSL 3LEVH 1N5YL 4IRSC 1MFUA 1JPTH 3DRTB 2R59A 5B4MD 3F7RA 1A7NL 2WZ5A 3QZNA 2AQ1A 1FG9C 1QUNA 4HXBL 5ECGA 1B0WA 1UKSA 3CC5B 1I3RB 2NOYA 2XWXA 5FB8B 3BZDA 4H8HA 3MQIA 5SWZB 3ZKXB 3M88A 3NSFA 5CEYB 4XCNA 3HI6H 4NFDA 4Z76A 2VLJA 1UXWB 4TNGA 1S8DB 4K7FB 2OYKA 3NEXA 1AVAA 5A2AA 3AQXA 5CEZD 1FG2A 4J8QA 2AQQA 1BFVL 1BEYL 1EANA 1G7MB 2YD5A 3RL2B 1CICB 4JFUA 4HPOL 3CLFH 5CMAA 4OJYA 4X5PA 2DN7A 1EX0A 5HI3C 1T83A 1H3VA 5I18L 3BGMA 3KDMB 5C0BD 2G9HA 3HPJA 3MRPA 4S1QH 3C2AH 5KSUA 1T04A 5A1AA 1W91A 1Y6NR 5DURB 3TL5A 2AXJA 2GUYA 5CP7A 5B7EA 5TE7H 1EDHA 5J0BA 3WSQL 3RFZB 3TZVA 3VVWA 4J3OH 2XTJD 5I0ZA 4WU7B 3QWRA 4DFIA 1CGVA 2V33A 5A6IA 4X5WA 2EECA 3J8F7 3FU5A 2GK0A 1R75A 1SXBA 3DX3A 3II3A 2XBDA 3AS1A 2CKBB 2EICA 3L17A 4IBZA 2Y5TA 2WVVA 5GGUB 5KVFE 3VFUA 5EZOH 1LEIA 2WZ0A 3EDKA 1EGJL 3ARTA 5FUOH 2Y6SD 1K2DA 1NLBL 1MHPL 3MRJA 2V5YA 3FMGL 1U95B 4GBXB 1D5RA 2ZAHA 4JPKH 1WFMA 3MTRA 4GP8B 3C5XA 4GI6A 2GJJA 1O75A 3P2DA 5E1HB 3UZQB 3MUGA 5ANMA 1S9WA 5ID0B 3LSOB 3I75A 4JRXA 5E6SB 1N8OE 3OV6A 4U6HB 3FCTA 4YPGB 1FC2D 4Q6IB 4IHOB 4BWTA 3MRIA 1E9QB 4R97B 2RIKA 1YEIL 5I1EH 5L0QC 3EFFB 4X99A 3VUAA 5IW6A 1EHAA 1VPOL 4R3SA 4QRUB 4QXUL 4DP6X 1UUSA 3F04A 3DROB 1KPVA 4ZPVA 2OMWB 4WUUB 1E7UA 3ZN6A 3DHJA 3BPNC 3OC5A 4WTQA 4HUNB 3QG6A 5T1LB 2H0JA 5SWZE 5A2KH 3WNOA 4PJHA 3FOLA 2WBKA 1DQJA 4POZD 4RFEB 3DUSA 3S5LG 4QYAA 2X42A 1RZGB 1JGIA 4IBYA 4GW5B 1FVEB 3CIQA 4MAUH 3TBYA 4FL4C 4GXUM 3WS6C 1GIGH 1WZ1H 2YPKB 3RILA 2P24A 1FL5B 2B4CL 5HVFB 1CGUA 4BDVB 1UM6L 2KERA 3HW7A 1NAKH 2WLYA 3KPMB 1F5WA 3SGEH 4FQCH 3OJDA 4YXKH 1PZ3A 4Y1SA 2AGJH 3SCMC 1WBYA 1AZBA 2CD0A 2YD9A 4PJ7F 2OMVA 5JLZA 5LQBL 4E2OA 1W2KT 1ICTA 2E6PA 5GRUL 3E3QE 4R7NA 5JIQA 4H7VA 4P2OA 5FOJA 5KTEL 5I6MA 5IBLC 2FDBP 3CFIC 4TQHA 2RTTA 1JFHA 3RUGB 2OM5A 5EUKB 4RAVB 3ISYA 1CDUA 3RVVD 2AEWA 3GMMA 5B38B 1YEKL 1KLUA 4L1BA 4ZTOL 2GW5A 3QPQD 3FSOA 5CEZL 2ADFL 1FL3B 3K2UL 3NYKA 5D96C 5DSCB 4FQ2H 3WV0A 4N2KA 4ANKA 4Y16C 4FXGA 4K3EL 2NUPB 1IBGH 4WFHD 3IF1B 1I8AA 5F0PB 5SX5K 3BDBA 3ENEA 5BXFB 4FQ1H 4JY6A 3QDMA 3NIDB 1MFBH 2LU5A 3RGBA 2ZCHH 2N7SA 3MOBL 4FI6A 1K5NB 5E8NB 5EOCJ 3VD3A 4DK5A 3VYPA 2FGWL 2J2ZB 2QV2A 2I32A 3G04B 3H9ZA 4G8FB 2Z0BA 4HUVB 3DO4A 5FXCH 2JE8A 4DP9X 1FORH 3QR2A 3V4PL 2V2XB 4BFJA 3TA4D 4JO2L 3PDGA 3FCBA 2BY0A 1MI5D 1UVQA 3MACL 2NY5L 2P5WB 4D7BA 3DSNB 1MSPA 2FIRT 3EXLA 2IIJA 1SDDA 1TJXA 2P8MB 2XSKA 4M5TA 1EAQA 3E0GA 4HVBA 2DQEH 4WUUE 3WMPA 8FABB 4U6VH 1JZ7A 2X6AA 1SF3A 2ZUQB 3OKNB 1R9FA 2XZCL 4P4RA 3PGCA 5ACLA 4UYQA 4LL9A 1O6VA 2BNUB 1K8DB 1OQOA 3FQUA 1OM3H 4A55A 4UTAL 2YMTA 4G7YH 1LO2H 1PMYA 4NAMA 1E8YA 3S5YA 4XWOC 2VMDA 3DHPA 5AVQB 5C7ZA 3STZB 3KNBB 2A83B 2HWZH 4M02A 3U7YH 2X4RA 5TDNA 5GZNA 4G6JH 4HDIA 1ZV5A 4UWQB 3GGWA 3O8XA 1X4XA 4KRPC 4C57C 2VOTA 4OR1A 5JIPA 2BIQA 1AQKH 2R1XB 3QI9C 1G7JB 4HV8A 4APQC 3UPRB 3W38A 1H3PH 2RACA 1VLXA 1FH2A 4U1HB 2K7QA 2ARJB 2NCEA 1MLCB 3O2DA 3HVDA 4KZDL 4XPAL 1ZVSB 3QDAA 1HE8A 5BOJA 2P28B 4O5LL 1VZGA 2HRPH 3BE1L 3P2BA 3RUGE 25C8H 4YSCA 1E6JH 3PWJA 4MDIA 2L04A 3BFQG 2KLTA 1IQWH 3SSGA 3RYMA 5C0FB 2Y7SA 2AABH 1MF2L 3LN5B 3M8OL 1D6EA 4HUWA 4P5RA 1DL7L 3IFPA 2EUXA 4XNAA 5D93B 1ZPLA 4KGJA 5FC9A 5BMFH 2C3GA 2A77L 2CLRB 4KTEL 2HPTA 1YEHL 1NL0H 3HAEA 4PJFF 3VDBA 2QSVA 1RZFH 2J71A 1KN4L 1IAIH 5T3XH 1D6VH 4OFDA 1R5VA 4Y9GA 1UZ8B 4UV4H 4BH7A 3CFBA 3NIDE 3LJ3A 4H26B 5ADOL 5EU3A 5TK4A 1AGDA 4YEEA 1NPNA 3S35L 4GMSH 3L2MA 4ZFQA 2ZOLB 1MHHB 1HSBA 5IB2B 3KYMB 4OAWB 4XNMA 3P0YH 1F1DA 1NANI 5E4EB 3QSKB 5D2LA 5ALCL 4HCRH 2P5WE 3FS9A 4JAMB 3PRZA 4HJUA 1E67A 1MFDL 4TNWK 1CFSB 1FHNA 3MLWH 2WAHA 4DT2A 3M1BB 4FA7B 1ZLSH 2JKWA 1N5YH 2JKNA 2NT1A 3QULA 3R1GH 3BSGA 5E51A 3U7AA 2YJLA 1A7NH 3K80A 3PP4L 4P5MA 5JUEL 4N24A 4RMRA 5IUSA 3RWDB 4HXBH 4L8SA 1L7IL 2H6PA 2VSCA 43C9A 1AXSB 2QSTA 5FK9A 1OSZB 1B0RA 2OMXA 1N7ML 4OQTL 1RJYB 1I8UA 1NGPL 3SKMA 2C4FT 4WI8A 2DQUL 3HEIB 4NKDA 3L3OA 1MNNA 2B2XL 1L4IA 3ABMB 4HCIA 4TUKL 4D8OA 3IS1X 5GSRA 3X1GA 1BFVH 5EOTB 5EF3A 3OKYA 4V1DD 3B4NA 1YA5A 4IRJB 1QSFB 2DLIA 4LF3B 3VFPA 4HPOH 3RWEB 3ZKSD 5AG8A 2WKOF 2FBJL 4MYPA 3SGJC 2ESVD 2NZ9C 5I18H 5G4OA 5LJYH 2WXQA 2GHWB 3KBFA 3BD4A 1BJMA 3TO4A 2EYTB 2QGCA 3DVNB 3FXIC 1W6WA 2PPAA 2AJXL 3SDAB 3W9EB 2EDXA 2VW4A 3ECBB 5DJYA 3WSQH 1BZ7B 1MY5A 4EN3A 1KTBA 4QRQB 2Q7AA 4G7RB 4G9FB 2BCKB 3T5WA 3O4OC 3CSGA 3NSJA 1RQ5A 2QT6A 4U1LA 1QR1A 4DKFL 4K3GA 1ZT4A 3U7WL 4AVKA 4QLWA 5F7HA 4ANXA 1EVTC 3NZ8A 2VZ3A 1P7KB 5D1ZC 3DDFA 3HG4A 5J13C 2F5AL 3DSFL 4CN1A 4ZI8A 4QAMB 4JY5L 2WWKT 3VRJA 1U6AL 5FFOA 3L5WB 3RGVB 1EGJH 2ADGA 4N5EC 1NLBH 2F9BT 2FH8A 2JSFA 1MHPH 2K4WA 2VSDA 3FT4B 4HIEB 3S4SA 7FABL 1ZMYA 3FMGH 4HD5A 2O5ZL 2J88L 5HD8D 1WJ3A 5DUML 1Q9LB 3CN4A 5HVHC 1QRNA 5FO8A 4QRRD 3LEXA 4FNUA 4BZ1L 3O9WD 4PJ9B 4FTVB 4JKMA 3S3CB 2Z93A 4BA0A 3VD0A 2FATL 4HK3J 5T1MA 1YEIH 3X13B 2VN3A 1WIOA 5E6ZA 2R29L 2G75B 4P99A 1F0LA 4ZS6D 2NNAA 4JCMA 4K15A 1VPOH 3ZE0B 3X2QB 1HHKB 4QXUH 2XYCA 3SYPA 3QZOA 2F8XC 1R6VA 1Z7JA 2C26A 4PCSA 3G6AA 4OF6A 3PWNB 5E95B 4MFHA 1IAIM 1WWCA 4U1KA 3MUZ1 3HNTL 3U4KA 5F6HI 4FQIL 3RVUC 5AENA 4AIZB 4MTMA 3SDCD 4AGQA 1DJHA 4QOKD 1S7VA 3C8KA 3Q3GB 4PG9B 3PWPA 3ARYA 2X2IA 2CE6A 4LNVA 4EZMA 4O02B 1HAWA 4U1JA 4HS3A 2H47C 1QSFE 4WWKA 4F1ZA 5C7XL 1V3JA 2X6UA 2YEVB 3MRLB 4MDJB 2B4CH 4PPTA 3FDWA 2R7EA 4JZOB 5IFJA 2F7QA 4EQ2A 1UM6H 2X1XR 1G0DA 2CAKA 4EVNA 5I30L 3C09B 3CUPA 4NGHL 3QO0B 3TO4B 5HDLA 1MVFA 1IAOA 2QMJA 3FO0L 5LQBH 1T7YA 4PRIA 1CLYL 1BXXA 5GRUH 1C8PA 1Q9KA 2Z1PA 2PO6D 3G6DL 5KTEH 2X4OB 4OVVA 3LS4L 2GTWA 3CSYA 4G9FE 4NRXB 4QAWA 1LK2B 4KJQD 3BUIA 4P0DA 1VADA 4YC2B 1YEKH 2ADJA 4ZTOH 3W3BA 3RX8A 4CW1A 2NLJA 4A6YL 4MCNA 2ADFH 3ZTJG 1T1ZA 3K2UH 5GHWH 4OGAD 2OCCB 1DBBL 1F86A 4JANB 3RI5K 4Y5XB 2P5EB 4PJIB 4K3EH 3T08A 1YSOA 4V33A 3S6CA 1DQQB 2EIMB 2F7IA 2YN3A 4Y4KA 5IOKA 2OBGA 1OARL 3RX5A 4IOSA 1RI8A 2VLRA 2X09A 3JBG7 3BGFC 5GIRA 3MOBH 4P23D 4QJ5B 5IMLA 4OU3A 2FGWH 5FO9B 1XF5A 4LVOB 4I3RL 3CK0L 1JYNA 5KVDL 1LWHA 4UTBL 1X3DA 3HCVA 1PYWA 2OK0L 3V4PH 3N40P 3GKZA 5I24A 3FQWB 3O4LA 4JO2H 4ZXBC 5J11C 1ACYH 3MACH 2NY5H 3BYTA 3SDDA 1KBKA 1J5HA 4F8NA 1PW3A 2M2DA 4QJ4B 3WELA 5LBVA 1KCSL 2YIHA 2QL1A 5T1KD 4KHTL 4NZDA 3V6FB 4NZRL 4N2NA 4HISA 4ZQKB 2XZCH 2L3BA 5IHLB 4A1RA 4HAFA 3W82A 4BUHA 1QSEB 1EDYA 4NQCA 3C5ZC 3DDGA 4Y4FC 4UTAH 2WQAA 5F3HB 1WFNA 4KXCA 2E7BA 5CCKL 3GSOB 4Q0XL 2FR4B 3GPEA 5A7EA 3TJEL 4Q89A 2OI9B 1GR7A 3CDGB 2ZKHL 4HZAA 1F02I 4GG6B 1F6AB 2FGZA 2DWDA 3E6HB 1N2RB 3B6SA 1UOWA 5C8JA 3KS0J 1G7HB 4OZ4B 4EZKA 1IM3A 3NCJL 4GW4B 2R83A 4Y4HA 1RSFA 3AM8A 4DZBA 2CDGB 3DX7A 4JL2A 3CSBA 1WF5A 5EMYA 4KZDH 1BAFL 4XPAH 3TNNA 1NDMA 2H8PA 3J7HA 2GJZB 4O5LH 3BE1H 5C08D 1F13A 4EAEA 5C09D 5KANI 1Z9LA 2BOLA 3B9VA 3GDCA 2A9AA 4MJ6A 3REWA 4ZTEA 2JCCB 2CA3A 1I8IB 1MF2H 3M8OH 2XKUA 1DL7H 2YJQA 3ZKQD 3DIFB 1CZ8L 3E8VA 5E6YA 1KJ3L 2A77H 2GIXA 2Y36L 4KTEH 4NRYB 5D1XB 1L0PA 3R7QA 1YEHH 3BP6A 4FQXA 2X1WL 3FTYA 4PVBA 1H8LA 1CD1B 4Z0BL 2P5EE 4PJIE 2ZKXA 4IU2A 4K71B 4IMLB 3H4HA 2AJZB 4HUKB 1KN4H 1JD7A 4NN7C 5DHYA 1EERB 1U8PB 3ULSB 4WW2A 4G1MB 5JO5A 3ASNB 4AUYA 2VDNL 4G43A 4ZJ9A 5ADOH 1S5HB 3ARGB 4J12A 4R7XA 3S35H 3SD5A 4UAOB 4JFPA 4PR5B 4ZMXA 4Y9BA 2YN5A 4NC0B 1WWWX 2J1ZA 1H6UA 2WBJB 2RQ8A 4YSRA 2NW2B 3KGTA 2VAAA 5ALCH 1DR9A 5IHWA 5I0VA 1E27B 1WAAA 2DRUA 1MFDH 4BQBA 3TJHD 3L9RA 4LEOB 5AAMC 4R84A 3IDGB 2RBLA 3KPOA 4NQCB 3TA3B 1MHCA 3DRQA 3Q8AA 1IGCL 4N85A 5DJCB 1XH2A 1BREA 1QSEE 1ESOA 1FPTL 1I1AD 3PP4H 5HP5A 2JJUA 2CDEB 5JUEH 4PV8B 2IADA 2BINA 1L7IH 2IQ9L 4AGLA 1XH0A 5IY5B 4XZUB 1QLEB 2WW8A 4F80A 2K45A 2DLTA 4OQTH 4WFEE 1TCRB 3WCYA 2AMUA 1CLOL 2EJ1A 4GG6E 3WIIL 3BISA 2DQUH 2B2XH 3WUWA 4TUKH 3NJLA 1FFOA 2VQ1A 4KPHL 1K8IB 4JN1L 3PWLB 3JTSB 4M6OL 3D3VB 5BW7C 2FBJH 3K6DA 4X4KA 5EU6D 3WEXB 3SPVA 2WUCL 5AFAA 5IB3B 4LPWA 1ETB1 4PJXF 3WNLA 1NFKA 1AIFB 4YHPA 5EZJB 3UH8A 1JXJA 1J10A 3VXPB 4IK7A 4PJ5A 4UDUB 4NI3A 2CWRA 4HZ1A 5F93C 1TNNA 1N26A 4K8RD 2AJXH 1ACCA 5DHXB 2JCCE 1K72A 3JV4B 2Q8AL 5IW3A 4YZFE 3SJVB 5L2KB 2NPLX 3GHEL 2QGDA 3RL1B 2HMIC 5D1XE 4M4PA 4APXB 4FKKA 4PP2B 4DKFH 1T3FB 1Z5LB 4LLUA 2PCPB 1Y07A 1ZT7B 3GS4A 4OCXL 3OBAA 4JREB 4MGXA 4AKOA 1E43A 1JHTB 2BC4B 1H5BC 2F5AH 3DSFH 4HIXL 3QIBB 4JY5H 1HX0A 5E9DB 2YQBA 4X8GA 1U6AH 2LU4A 1U8NB 1YEFL 1PD1A 3VGHA 1TXKA 1FLRL 3FO1A 5D7JC 2F61A 4LSTL 1JFQL 3UMNA 7FABH 2YGNA 4MKTA 3P9LB 5FIEA 3O4LE 4XVUD 1NSNH 1MLBB 3QDJB 3QP3A 3B34A 4IU3B 2O5ZH 2GBTA 3GSVB 3O6ML 1ACXA 2J88H 4KHXL 3UACA 4AT6A 1ZLVH 3ABGA 3BEWA 1KG0B 5DUMH 2DL2A 5KBDA 1CDIA 2WVSA 3V79C 3FN0L 2PMZA 2WXLA 1Y6MR 1J88A 2J8UA 5DC0A 4BZ1H 1YMMD 4IIQB 1E5UI 2FATH 4U4IA 3GWJA 1D7BA 5HI4D 5GGRY 4I9WD 4JLRB 1XGUA 2ZUTA 1CE6A 3MNWB 1Q1JL 2EC9U 4NQCE 5E5UB 2R29H 3WTSA 4P3CH 4PRHD 5K59F 3EG9B 1Z66A 3RNKB 5MHSE 1GS6X 1HEHC 1KXVC 3FB5B 1JWSB 1OW0A 5TDPB 2A6IB 4L8DB 4F7MB 4R9HA 1ZWIB 1P4IL 3HNTH 4AJ0A 1A9BB 2OMUA 4FQIH 4GEIA 2BS8A 1IGML 1WD9A 4LE8A 5DUPL 3L3JA 2B14A 3QIWB 1AXIB 1FZJA 2G9KA 3KVDD 4NAQA 4P2RB 1AOHA 4UT9A 3FTUA 3DYOA 2JB5H 1GTNA 3HB3D 1BVNP 2I7OA 3CAFA 3OX8A 1OGTB 2OLDA 3NIGB 4M93B 4UMSA 5H2BA 3SGDI 1Q0XL 5C7XH 1JK9B 5BVJB 1ECZA 2CO6A 3D3VE 2HJKA 3ZZLA 5IG7A 1J0JA 3E2HC 5I6KA 1S6NA 5I30H 4NGHH 2PPFA 5E8OA 1ILUA 4FEMA 3HUJA 1DFXA 4RSVA 2I9TA 3P0VL 1F3DJ 1JWMA 4PW9A 5F7EL 5AZEL 5EEWA 1N68A 1PZCA 3FO0H 3GSWB 3PG2A 4U0QB 5HHVL 3B37A 5JW3H 2WQVA 1CLYH 3QK0A 1DTUA 3LHPL 5TQ2L 2PXYC 1K4CB 1CD0A 3G6DH 5KG9A 1EH9A 2OX5A 3QUYD 3SJVE 3LS4H 5B8CB 1K85A 3NA4A 2DIEA 2RA1A 1S7SA 3QJZA 4ZFZB 5CEXB 5F0JB 4MS8D 3D08A 2BJML 4R96A 1VCBC 4XP1L 1NBQA 5GRVL 1I8KA 4G70B 3UBGA 3NG5A 1HHJB 3LQAC 4TS6A 1CT8A 3IDYB 5E9DE 5F8QC 3NVQA 3S3DB 4A6YH 4H1LH 2F08A 3KR3H 3MC0A 2Y0SA 1B3IA 4DO6A 3QCVL 1DBBH 3SBWC 3BJLA 1WGOA 3NRFA 1BF2A 3ARDB 1MW2A 4TTDC 2C9AA 2JI2A 3OB0H 1OARH 3QDJE 2ZWZA 5DHDA 3ECUA 3F62A 5EU5A 3NA9L 2DQ6A 5FECB 3RURA 5FOBB 1L9QA 3N06B 4FZEH 3S8WA 2EVHA 4K8RL 3ILPB 4I3RH 4NN6C 3L95A 3BH4A 4IRSB 5KVDH 1S3RA 2DQFB 4JFTA 4FDWA 4UTBH 1Z5YD 4LAQL 2OK0H 3BP5B 3VE0A 5F7DA 3WEAA 4OKDA 2EE2A 3NEEA 2N0KA 3GSXA 1S46A 1AZUA 2W65B 1IBHA 5FA4B 4KNUA 1NBCA 1KCSH 3VI4B 5I19L 3LXUX 4KHTH 4NZRH 4GT0A 4ZW8A 2NY4D 3EOBA 3TPUA 1T2XA 3WIFB 3S2CA 4I1NB 4PI2A 4HCRA 4BHUI 2BP0A 3SE3C 1PQZA 1G0XA 4LOEA 1XR8A 3DMMA 4Z7AA 3BVXA 2DWEB 5E8PA 4P2RE 4XXWA 4Q0XH 5FFGA 2LLNA 3PS6A 5CCKH 3TJEH 5JW4M 4X6FA 3EJQA 2ZX8A 3RLSA 1UWEL 1BD2B 3NIGE 1IZJA 1UB5A 1A6ZB 4P57A 2CK0L 2ZKHH 1A6AB 3IRPX 5H4YA 4P4KA 1S7RA 2R56L 3ZR5A 3QZWG 3VU2A 3HOGA 1B9KA 1CLCA 4EN2A 3TP4A 3NCJH 1XL4A 5IGXL 5I74C 4WI3A 2LR4A 3Q5TA 5HGDB 2VSKB 1OF2A 4IGBD 5TE4L 4NO5A 1BBDL 2Z1KA 1UATA 4K5LA 1BAFH 3P54A 5E8DL 4G8GA 5KSAC 4R90L 1K3IA 5D7LA 1HHIB 1OM9A 2ZXAA 3ZBMA 5B22A 3X1FA 3UTZA 4LRNL 3GO1L 1PJ9A 1RPUA 5GRYA 1XBDA 2M8XA 1Z5HA 2PR4L 3QXWA 1W0WB 5ID1A 3VXSD 5EBLB 1CZ8H 1KJ3H 2Y36H 2G2NA 2YKKA 4BQ9A 1ZGLM 4NDMB 4Z0BH 2VLLA 3BHBA 4LLAA 1KGUA 3M1OA 4P5TC 3ZVVA 2E7DA 4NXSA 4PTUB 3NDYE 4M5SA 2VDNH 2EXYD 4KZEL 1JV5B 3GBML 4KO9A 3FUDA 5L0QB 2X70B 4LU5L 4I0CC 5KUKA 3BN9D 2X41A 3HLKA 4N6RA 3EFDL 4Y1AA 1O6TA 2C9XA 2CNZA 3LRMA 3BPNB 1EGJA 1YPZB 2W38A 4GXVL 3QDGA 2WXPA 2ZUYA 3VI4E 3FNKA 5LKNA 3TIDA 3WGUB 1BVKA 3ZYJA 4ODWA 2AXGA 5HGAB 2HJLA 5DD6A 4MX7B 4B9IA 1GCFA 3AU1A 4FL4B 1J0KA 1E4JA 1FPTH 3WFHA 2A9NL 2FYYA 4GG8A 4WEEA 4WI6A 1JMXA 3PU7A 4MAYA 4DK6A 3RHWK 1SMDA 2IQ9H 2VR3A 1U58A 3KL5A 3D0VB 2W60B 4NIYE 3V6ZA 2W9LA 1H9DA 1EXUB 3SCMB 5DC2A 1SHWA 4O51A 1CLOH 4QGTA 1TKWB 3WIIH 3FU9A 2P45B 3CPLB 1FNGA 1BBJB 2APFA 1JCKA 2UUDK 4HGWA 4XCFL 1XZ0A 4KPHH 3MCLL 5JHBA 4TOYL 4KC3B 3VGDA 4JN1H 4M6OH 5JDSB 2IPKB 3L3DB 3BPCA 5EEUA 5I9QC 1SOSA 1L9SA 2IDTA 2WUCH 1XCXA 2PPEA 2TSBA 2PP8A 3RI5F 2VDOB 3TX4A 1KJVB 1I9IL 2H3XC 3HPLA 4A2EA 1G1YA 4OZGA 1LILA 3F7VA 2DWYA 2YUWA 5D96B 5DJXB 3BVUA 3KHOA 3N0AA 4L37B 3VFTA 4HFUL 2Q8AH 2C9PA 1AZZC 2F19L 4Y16B 3VD7A 3AWFA 4PWIA 2NR6D 5T5NF 1OGAB 4JMNA 5FM8A 2C3VB 4OCXH 5K39A 2OTUA 35C8L 4TUUA 1OE3A 4NC1C 1CXFA 1H6FA 4RSYA 4HIXH 3T65B 4EUPH 1UH3A 4HJIA 4AEHH 4DZ8B 5DUBB 4DFHA 3RDTD 4WO4A 4B5ZA 3SDYL 5TTRA 1YEFH 1KTRL 2JKIS 4E9LA 2KC0A 3W1ZA 5IUCA 4UOW1 1FLRH 3INUL 4I2XA 2XX0A 4X8JA 2DYSB 4LSTH 1JFQH 4FYQA 4P2QA 4QT5B 4EOWH 5KANG 1L9MA 5L2JA 4PWEA 1T7WA 1ZRUA 2C1OA 3DXAD 3NN8A 3D39B 5DRNA 2HCZX 3O6MH 1BX2B 4KHXH 1SMOA 4KKAC 4TUJA 2E7LA 1S3KL 1Q9WA 5L8KB 2J1XA 1WWBX 4I18C 3T2LA 1YPZE 3FN0H 4B9YA 4NKOB 1R46A 1A6VL 1N0LA 1UWFA 5DC4B 5DMIL 5I17A 1W6LA 1Q1JH 1MELA 2YAPA 1AQ8A 2QADD 3K7UA 4HLJA 4J3UA 2ZUXA 5J8OA 4S0TD 3OG4B 2Y1VA 4ALAC 3A6BL 3TVMD 1L9OA 3P9MA 5LN8A 2XT1B 3V4PA 1G7QB 4PMEA 4M8QB 2YBGA 1P4IH 1QLFA 3GB7A 3PNRB 4KRPB 2NSXA 5IJVA 1I85C 3AG3B 4MWFA 4ONFL 3QI9B 1IGMH 1A1OA 5DUPH 5EH1A 1DDHA 4U6XB 4APQB 1TO5A 3EYOA 3SQOL 1A9VA 2R1WA 2YRZA 3OJ2C 4TN9A 2FEJA 3EOAB 3VG0L 1Q0XH 4ETQB 1F00I 5C0GA 2J1KA 1IFRA 2AQPA 1U2HA 3HE6A 4G8GE 4B9FA 4HOMA 5IQ7L 3VVVA 5IR1B 4UTAA 4GW1B 4AQOA 5FWRA 2VKWA 3OSVA 3P0VH 3WNIA 4QF1B 5F7EH 1JXGA 5AZEH 5J3HC 4BH8A 1A8ZA 2NY1D 4JO1L 3RKDC 5HHVH 3MKGA 3EGXA 4B3VA 3P0GB 1E9PB 1YY8B 2BVPB 5TQ2H 2ZP9A 2ZXBA 3QQDA 2A1WL 3GD1C 2LVCA 4DEPC 4EKJA 4RNRA 4WENB 1HXYA 4JKWA 4MBRA 5D7EA 4OF0A 3O3EA 2FEDC 2DB8A 2BJMH 1OGAE 4XP1H 4CBZA 1YNTB 3BCFA 5LAPA 5DZLA 4BQ8A 1YUHA 3EKCA 4A2LA 2BS9A 1YJDH 2R2EB 1WZMA 3D09A 4MNQA 1CK0L 3AWGA 4JM2C 3FJTA 3BVTA 4GQZA 3QCVH 3WNKA 3QHFL 4BQ6A 3JUZA 2ZE0A 4CC4C 3MUJA 3NIDF 2BVOB 3T3MB 5JYMA 3CFNA 1A8JH 1WA2X 3D39E 4UQ2B 2BMKB 1SJVA 4LSPL 4AG4L 1DZ0A 3NA9H 4N2IA 5DD0L 4PY7B 1TMCB 4OI7A 1EZLA 4K8RH 1ASPA 3P73A 4GKNB 1F8TL 4LAQH 3DGCR 3NQKA 4I0PD 2FB4L 3D85A 3F12A 4U1GC 4F7PA 3FTZA 5TH2A 3IWUA 4NRZB 2Q76B 3IPEA 3PL6D 4J3OC 4Z7UF 4X6CA 3LVEA 1SOQA 4AZ8A 5I19H 2Z64C 3Q2NA 2AP2A 2CJTA 5CU5A 2Y2YA 1EBPA 1ZIBA 1F4AA 2APBA 4Z0XA 3EYOB 3H9HA 2EUWA 2VW7A 1SXCA 4ZSOA 4H0IA 5JPMC 1AI1L 4GRMA 3CH8A 4PM1A 1KYOK 3OXSA 2P49B 3CFMA 1UWEH 3VWKD 3W9DB 1QEWB 5DGQA 1ZHKA 4MVBC 1JWUA 3KBEA 3TU6A 2CK0H 3WLBA 4XMPL 1ZE3C 2H32B 2WD0A 5D1QC 4M62H 2R56H 3IJSB 2UZXB 3AB0C 1VZHA 3CVBA 3VRLF 5L4JA 4QYOA 2CHZA 5IGXH 3CU1A 3JVFC 3O4OB 4S1RH 2UZYA 4HUXA 4OQTA 4PREB 3VFNA 5MEND 3OR7A 5I1JL 1RJLA 3QNYB 4G1EA 1BJ1J 5TE4H 4ZNEE 3LZOA 5E8DH 3ZIYA 1DBML 5D1ZB 1F4WL 4R90H 5J13B 4K7PL 1MIEL 1JV2A 1GPOL 1MY7A 3ESVF 2QFRA 5DJ0B 5CIPA 4LRNH 1D5IH 2A9ML 2D2OA 3GO1H 5IQ9B 4PTTB 5HHQB 2OP4L 5IV2B 2FECI 3STLB 3VXRB 2PR4H 2KL6A 3R06A 1D7CA 1DUYA 3RB5A 2GCYA 3UZVA 2N01B 4QXTA 3REVA 4P2QE 1BGXL 2VIRB 3QXTA 4P46C 3V0VA 4EE2A 2QVKA 3KCPA 3QCUL 3WLWD 1GOHA 4C59B 4QWWC 4PWHA 1BV8A 4MRBA 3T3ME 4KDVA 5HVHB 5IF0A 3V4VB 2Q86A 3US9A 2GVYA 4KZEH 1DO6A 2HSIA 3GBMH 4UOJA 3FQRB 2CLZA 4FFZL 1K6QL 4NQVB 3WN5C 4LU5H 2HRLA 3V5HB 5C0JA 3NAAL 3UYOD 4XXCA 4IBLT 1I1YA 3FC8A 3PGFL 2P47B 2JJVA 3EFDH 2VLME 2Y1YA 2QEJA 3GUFA 4DP5X 1XF2A 3SDXB 4GAGL 3HE7C 4GXVH 1EFQA 3UTTB 3GI9L 5DJ2A 4DPBX 3P4NB 5I1HH 1L5GB 1C5DB 1E7VA 1E28A 4RIRA 1G9ML 5AVZB 4PG2A 4DJMA 2A9NH 3ML8A 4ODVL 5AAWC 3NTCL 4L3EA 3TCLB 4BZ1A 4UB0L 4AH2A 4DPCX 5IW1A 3W56A 3D87B 1Q9OA 3BUYA 5AVRB 3UGXA 1J05B 3HJ0A 1TQVA 2R29A 2X4UB 3VAEA 2ENYA 4HKBA 4B7LA 4XCFH 2JB6A 4WLCA 3MRDB 5DJ6B 5FR3A 2VRKA 5AUMB 3MCLH 4TOYH 4TULL 1X4YA 3KS0H 3MREA 4XNUL 3GEFA 1G9NL 5B39B 3ARVA 4L8CA 4EZLA 1TR7A 3FQXA 1TDQA 4PLKC 5E70A 3X1EA 2YD3A 1R5IB 3UZEC 4L4VA 2IXQA 3WIHA 2FX9L 1OTTD 2AVFA 5D70L 1JN6A 3JWNH 1ZGLA 4WHCA 4Z3JA 3OKKA 3QXDA 4N9GA 1XF1A 4FCAA 4NFCA 1G6VK 2XN9B 4IM8A 4RETB 2CUAA 3NZUA 3L4WA 4MNQE 3RGHA 5ICXB 3RG1C 4YHYC 1GC1C 2MTPA 1KEML 3MV8B 4HFUH 4NQSB 1TLMA 2F19H 1LO5B 4LCWD 2JI1A 5DS8B 3NPSC 1U3HA 4PI0A 3EYQC 3IS0X