1JPFB

Crystal structure of the lcmv peptidic epitope gp276 in complex with the murine class i mhc molecule h-2db
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, D-B ALPHA CHAIN
publication title Zooming in on the hydrophobic ridge of H-2D(b): implications for the conformational variability of bound peptides.
pubmed doi rcsb
source organism Mus musculus
total genus 15
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2001-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jpfB00
4NO5A 1EFXD 1OM3L 3VFVB 1WSST 2XPGB 4QY8A 3RRQA 3IYLW 3BO8A 1U8HA 4XPHH 1IBGH 2OR7A 3O2DH 1MCRA 4MAYD 1HINH 2AXFB 1FHGA 3TA3C 3NABL 1FH5L 4TNWK 4JFEE 1S7RA 3LKSB 3ME0A 4WCYH 3GHEL 4TSCL 4B53A 2CRMA 3CK0L 1UGNA 3DYOA 2EKJA 3W2DL 3U4AA 4YZFF 3ZE0F 3RL1A 3WJLA 1JVKA 2EDLA 4FZEL 1BVZA 2VYRE 2DQGL 2W65A 4D3CH 4DVBA 1I9JH 1KV3A 4JM4H 2AJSL 3ARBB 2WINB 5D4QA 3NA9L 1FRGH 1NANH 1DL7L 2XY1A 3TJHD 3QCVH 3T65A 2QQLL 2CLZA 5E95B 1Y0LB 1A7OL 1IAMA 5F7MC 1DQLL 2XV6B 1VHPA 2GSGB 5H35B 5TE7H 2VWEE 4FXGB 1RZGA 2GTWB 4ZXBB 4GJTB 4Z7UE 1S7VB 4R7NA 3TNNA 2WBKA 4PRPA 4U33A 3SQOL 4L3AA 3GBMH 2NY2D 4ORGA 2BRRL 2J5LB 4JM2A 2EH7H 5LQBH 2KBGA 1AKJD 5BMFL 3DBXA 4APQA 5C9JB 3SDCD 3TPKA 2QQNL 1JNNH 5K9KB 5H94A 5E2VH 3IFPA 3QDMB 2R56L 5F1SA 3L95A 4M7JL 1KCUH 5IBUG 4HFUH 1MCOH 3MLZL 4ETQA 1ZGLB 1BBDL 5F7KC 4UNVA 3TGXA 1E6JH 3JV4B 2X4SB 4OZHE 1QR4A 2BNQE 4HIIA 5GS2H 3FMGH 3QZWA 4YR6B 3N0PB 3JWNC 3GO1H 2RJMA 4OGXH 5DMKB 2HAZA 4G43B 4TSBH 2FHFA 3QI9B 4OT1L 2IPUK 1XF2A 1IM3A 5C0FA 4NNPH 2NY1B 3VFOA 2V2TA 3OGCB 2ED8A 1W0VB 3VJ6A 2D7OA 1CL7L 5TF1L 3STZB 4HJGA 4P9MH 2UYLA 2BJMH 4ZS6C 1FAKT 1CYGA 1ZHBA 2IFGA 4P3DA 4BH7A 2HLAA 1GGCH 2NZIA 4ZTOH 4YXKL 3MUY1 3U6RA 3ULVH 1E4XI 5F1IB 3FO1B 3HNTH 1J87A 2E7CA 4Y5VB 2P5WA 4MB3A 3VG0L 3P9LB 1H3PL 3BZ4B 4BA8A 4EXPX 2AXHA 3S3SA 2Q6WB 4LK4A 2HMID 3STBA 2IAMD 4LSTH 1YEKL 1DBKH 2A77L 4FFVD 4K3JL 3TCLB 1OQXA 5H37H 4F58L 4YK4C 4UUJB 4Y19B 5K93A 5I6XC 4ERSH 5GS0C 3MV11 3MBEB 3KXFB 4EUPA 5K59F 5JDSB 1J12A 1NFDA 2JIXA 1BHGA 5GS1A 2ZUSA 4BFGA 1YNTA 4FG6D 3S35L 1XZ0A 1MLBA 1H15A 2VLKE 1IM9B 1FC1A 4UDUB 3C09B 4NRYB 4DGIL 1P7HL 2VLJA 4F7TB 4YFLF 4KHXL 3ULUD 3WIHA 3SDXB 5D1QB 2G9HB 4WEUD 3MJ9H 5BW7C 3ULUL 4PJ7B 3X11B 2ORBH 2ITCB 4YC2B 4GQ9L 4CU7A 2VXVL 3I85A 4DK6A 5I1GH 3GIZH 1G6VK 4AIOA 2WIIB 1MPAH 3P30L 4LKXB 4ODTH 4QOKB 3JWDC 4O4YL 1ZHLB 5ESVA 4Y8AA 2OL3H 1AGFA 4OFIA 2IQAB 1ORSB 1HI6A 4X6FA 1FO0B 4MWFB 1RUQL 3MRIA 2LTQC 4JHAH 3BZFA 3K2MC 3ZHDA 2RQ8A 4UINL 1UM6L 3BPNC 2W0PA 3U0TA 3OR7A 4M5ZH 4M7ZC 4NRXB 1U92B 1MWAL 2D7TH 4KHTH 1NFIA 3KPRD 5LAXB 2P43B 4YLQT 4RA3A 3R06A 3U46B 3X3FH 1WBXA 4YDJA 3PWPA 1FN4A 3VXNA 1WCBA 1CQKA 4GAGH 4KPHH 4QXUL 3O41A 5JORB 4PGJA 3PWUB 3QXAB 1ETZB 4PFEA 2IH1A 3KLSA 4Y4KB 2O5ZL 1QLEL 4Z0XA 3HI1B 3S7GA 2H6PA 4HUKB 4TSAH 4XNQA 3LQAC 1Q1JH 4MA1C 1B0GA 4L3CA 4N1CA 1JMZA 3QULA 5ACLA 3B3IA 4PJHF 1YNLH 1YMMB 4NWUL 1FYHB 5CINL 5GGTH 5EU3A 3DTXA 2WMPA 3OWEA 5J56B 1I8KB 3CFCH 3MOAL 3D0VA 3I2CH 3E3QC 3G5ZA 5SWSA 2VE6A 5IVXE 3PWVA 2X42A 1J9CT 1P5VA 2WWMC 3VRLE 4GXVL 2EDBA 4MA7H 5EUOF 1WBZB 4IOFC 5DC0A 32C2A 5DDHA 4TVPE 5BRZE 1MFCL 3LPFA 3HZVB 4ELMB 4KROC 3LPGA 3ZDYF 3VFGL 1NLBL 3QDGD 4HKXA 1ZT4A 4U1SA 4JN2B 3L3KB 2F53E 2RB8A 3MJ8A 4LMQE 2CQVA 5JHDA 5D2LA 3MRMA 3TFKD 4LGRB 1F8TH 4LARL 2HJKB 4AEEA 5JO5A 1NC2D 4XNXL 3NIGE 4P4RB 1D6VH 1FGNH 4EN3B 4DGYL 2FX9H 5IOPA 4Y4FC 1ZLSH 3QUXB 4LLQA 3OKDB 4YEEA 1MFDL 5IR1A 3CDFA 5E1HB 1IAOA 1GOHA 3G5YA 3BWAB 1DVFB 4Y1AA 1G84A 5FOBA 4UT9L 1HWHB 1U36A 2BOCB 4JO2L 4XB7A 1R3KA 2BSTB 2YD3A 1S7SA 4NM4H 1RZKH 4EEEA 1HSAB 3VCLB 3KJ6L 2NY6B 3MACH 2OI9C 3B9AA 25C8H 4KTEH 2A6KA 2NW2B 2W9DL 4IDJH 4WFHE 4HWEH 4YDIH 5CEXA 1A5FL 4D0CA 1MJ7L 3QHTC 2E7MA 3GHBH 1VADA 2Q8BH 1INDL 1MRCH 4ZTPL 5I71C 1I9EA 2DQTH 4DAGH 5DXWA 3EFDL 3FT3B 4QWWD 5FYLE 4YX2L 4M3KB 2OR9H 2YBRA 3CAFA 3OJMB 1F11B 3HE6C 1R3LA 3RI5K 1HHHA 1UM4L 3IKCB 4NDMA 4DZBA 2KZ1B 4GUPB 2P5EE 3K0WA 3WNOA 4M1DL 4W81A 3ARDC 5EU6D 1BQUA 1C12B 1N0XL 3PDOA 2R8SH 1IC1A 4P2OA 4HBCL 3FQNB 5E7BA 3GKWL 2Y07L 3PP4L 3QFJE 3TV3H 1J5OL 5EU5B 2VLKD 2CIKA 1HN1A 4JRXB 3SKNB 3UTZB 3SOBH 4FQ2H 1D5BA 5L8LB 1MOEA 2OS7A 4GT7A 3U82B 1PSKH 3MNWA 3VMOA 1QFOA 2WBWB 4PJDE 1JPTL 4FTVE 5L2KB 2JELL 3NCCB 3PXHA 4JDVA 2ZKHH 4I0CC 43CAB 3VXOB 1U8JA 3CFJB 5IP4A 2W0FA 1TVDA 5T33L 3DO7B 4NO0A 3LDBB 4G9DB 4U4BA 1S7WA 4X4XB 2HFFB 4PTTB 4UBDD 2VDNL 5EH1A 5IHZB 3JTTB 4NQUA 1D5IL 4P9HL 3X3GH 3QXDB 1QFWH 4WO4A 1MIMH 3H42H 5F7FA 2VQTA 1PZ5B 3QDJE 1ZVSB 4FQLH 5DR5H 4RMWA 3SY0B 4J8RB 1QBBA 1KENH 3RGVB 5TF0A 1XMWA 5D1XC 1U3JA 5JXED 4LLWB 4BH8B 5FM5M 3FQTA 1VSCA 3WUWA 5BQ7B 3ARZA 1T21B 5DUPL 1NKRA 3MLUL 3VH8G 2XQYK 4OSUL 5E0QA 4G8FA 4BFIA 2A9MH 1RK0B 4ZPVB 4CADB 3WIIL 4IOIA 2N56A 3FFDB 4R0LC 3T3PF 4TULL 3OMZA 4NFCA 5IWLC 2CJUL 1HKLL 2XZCH 2D9CA 3AROA 1MNUL 4XVJH 5A16B 5T3ZE 1NGPL 5F97E 4KJYA 3G6AB 5BV7L 2EDRA 1SMOA 3QHFL 2OTPA 3QIBD 4JQIH 1FYTA 3QUMB 4PLNC 4YEFA 3O3BB 3BDXA 1FFOB 2X4OB 4QRRA 5JW3H 1Z3GH 4PJAE 3HPJB 4LAJH 1FGVL 5F7YC 1I1YA 4JPIB 3TNMB 3ARWA 5TDPB 3WJJC 4WRLA 5SX4H 2A9NL 2MCPH 3PG2A 3UTTD 4GH7B 4F15C 3QWOA 3U7WL 3DWTA 3WJLC 4KXZH 5DI8B 3BEWA 4U1HB 4V1DD 1H3WM 4XAKE 2BSRB 1D9KB 2FRGP 1CXFA 2J8OA 3CUPA 4LPUA 1CGSH 3SO3B 1KB5A 1HHJB 2PXYA 3MLWH 4OJFH 1J18A 4Z7NE 2K7PA 4DCQB 1K8IA 4L8CA 4OFVA 4JLRB 2OX5A 1JBJA 4TRPL 4FXLA 3WIFB 4J1UB 5HI4D 5HGAA 4UZGA 3VFNB 4Y2DB 5HI3C 4Z0BL 5C0AB 1AQDB 4LFHG 5E5UB 3ARTA 2VDPL 4M03A 1IKFH 1JF6A 4ALAL 5KSBF 1I8LA 4BSVB 4JM2C 3D25B 5BO1L 1AGCA 4QRPE 1MJJB 1P2CB 3MRGB 1BQLL 2VLRA 4APQC 1N4XL 2JCCB 4HWZA 4UDTB 4ZFGL 4L9DA 1H3TA 4KAQL 3ZYOA 4JZNB 4PJIE 3SE4A 4L4VB 5AZ2L 4MQ7A 2FEEL 3Q6FB 2X4UB 3N85L 3ZKQD 1CFTB 3VFSB 2ZSWA 1ZAGA 4NQDA 1Q72H 4RFNB 4WFGE 3ARED 2YR3A 4X6CA 2PW1A 3P0GB 1I3RB 1RIHH 3OSKA 3O2WL 1JPSL 5EO0B 4WTZG 2AXGA 4CU8A 2EDQA 4XVSH 5E6IA 4H1LB 4RAVA 4XH2B 1K3ZA 2P5ED 4ZUWB 4QF1A 1IGCL 4IEFB 2PO6C 1AXSA 2HTKD 1IZKA 3M8OH 1MI5E 3WLWD 5B38A 5CHNA 1A0QL 4PB0H 1AGDB 1X4XA 1D3CA 2D0FA 3EDJA 3C08H 2D7NA 2AXJA 1FPTH 4OLVH 4X6EB 4RAUB 1WWWX 3F12B 5E8NB 4ZUUA 3BMVA 3KPSD 4NUGL 4JFDD 1MFEH 4OZFG 3HE7A 1Q0YL 5F9OL 2W92A 2GSIA 5C08A 3TBSA 3TH4T 1G0YR 1LO2H 1UJ3C 2X44D 5BZDB 2AEPH 1PKQA 1CIUA 3ZO0A 3UBXG 1BECA 2R4RH 6FABH 1ED3B 1YY8B 2CKBA 3IGAA 1MVFA 5K9JH 2EH8H 2HRLA 1B0RB 4Q0XH 2GK2A 1E6OH 1R5VA 4EQ3A 3LEYH 4L8BA 1RK1A 1BF2A 1QSFA 4TUJB 1SY6A 4ZAKA 2GY7B 2VDOH 3GSVB 3MTRA 1P4LA 5J6GA 1KT2A 4WV1C 2WV3A 4LCWA 4I8DA 5CILL 3T1FA 4JY5H 1RZ7H 4OZGF 1B4JL 2P8PB 5GS1C 2VDLH 4LHUA 1WZLA 3A6OA 2VB5A 3O9WB 3OJVC 4LAQH 4R6UA 1U8IB 3VFWB 4ODWA 5KSUB 4DFIA 2GK0A 3O2VL 4GG6A 1XGQA 1YYMH 1PFCA 3GSQB 3IU3A 5ALBL 1CFBA 4YZFE 5EU7C 4PYHA 5KSAD 2R0KL 3GUTA 4BSWB 1F42A 3OV6A 4JANA 4PJGF 4YO0A 4FA8A 1QBLH 4PGZA 5D2NC 4NN7C 1DLFH 5AD0B 4OCSH 4PPTA 3RWFA 3UMTA 5AWNL 4QHMA 4NQCA 1QBMH 4OGZA 3VG9C 1JWMB 2ZCKL 4X5WB 5KTEH 3H3PL 3AREC 2IJ0C 4QRQA 5I8KL 4W68A 1T5WB 2VL5A 4N0UA 4QHUA 3IDNB 1IAIL 3KYMA 2PYEA 2BVUA 3K74B 4K9EH 3Q0HA 4G8IA 1IGJA 4EBQH 4HMEA 1TTGA 4JN1L 3F7VB 4KQ3H 1V5JA 3HG1B 2DKUA 3QJFB 4YPGA 5D70H 2ZUYA 5FCUH 3ZE1F 3REVB 1TJGH 2CDFB 4LVHB 3V4PH 3V9FA 3QA3A 4YXHH 4M7KL 2ZPKH 3H9SB 4NP4H 1FO0H 1QHPA 3LKNA 4XP6H 4NQXB 4AT6A 1MCJA 4KJWC 1C7SA 5DC4B 2R2CA 4ISVA 4KKCC 4Y16D 1J8KA 5GIRA 5MHSD 2CDEB 1R6VA 3BP6B 1L7TH 1UCBL 1PY4A 3RVVD 2HKHH 1LO0H 5DD3L 1Z9LA 4OFYA 4P5KA 4NHUA 5GSVB 5ENWA 3PWLA 1NC4D 4K23L 3K46A 5DO2D 1A6AA 2X10A 2CDGB 5J4MA 2I60L 2IADB 1BGXH 4HC1A 2WZPD 3UC0L 3HHRB 3VGHA 1FVDA 4N8VA 4A6YB 1FV1B 1T1YA 4HKBB 3VA2C 1EHXA 3IF1B 2IQ9L 4WHCA 1YNKL 3NZ8B 4MCZA 4YWGL 4PRDB 3MGOB 2WAHA 1MIEL 1VGKB 1IC4L 5K9OA 4E5XB 4ZYKA 1EXUB 4PTUB 4Z8FL 1PZUB 4U1KB 5C09A 3VWKD 2AEWA 5DYOA 1JI2A 1KJMB 3KPQB 4OV6F 3WSQH 1G7PA 3U36A 5B4MC 4XHJD 2R29L 1PEWA 3ARXA 4N5EC 5F9WB 2XN9B 4CVXA 1A6PA 4JJ5B 1A6UH 5JPMA 1FNEB 3ULVE 5KSAC 1F4XL 4JVPA 1SYVB 3HAEB 1EX0A 4PLOB 4EVNB 5H2BB 1MI5D 5DK0B 4ZUSB 4Y4HB 1VGEL 1G9MC 1FJ1B 4P5TD 4PR5B 2G60H 4HSQA 4X6DF 3DVFA 5JIHA 1RURH 5DQDL 5HYQB 1JWUA 3PQYD 3WNMA 3ARVA 5C0GB 4G42A 4NUJB 3DI3B 3MCLH 3Q3GA 4D9LL 4XWGL 5EC1B 5SWZB 4CL7A 2IF7A 4G6KH 1JGUH 3NCYS 3TJEL 1IFHL 1G6RB 1HXMB 4NKMA 1MREL 5KJRL 3HZKA 5C6WH 1T1XA 5IB5A 1EGJA 3ZSTA 1X5ZA 4ZFOB 3ULSB 2X4NA 2YXMA 3KPPA 1NBVL 2DWEB 3QG7L 5FA4A 4IRZL 2V2WA 4R2GC 5HGDA 5CSZB 5D96C 1S9VA 2VDKL 3O6KL 3TH3T 1EPFA 2Y36L 4FQQA 1AKJA 1CIDA 1H3GA 2B1HL 4JFOA 4GRLB 3QPQD 1RHHB 1C5DA 3EFFA 5J12C 5IW6A 4KUCD 3DMMA 4PGDB 1T7VA 4MQXD 1GGBH 1I7TB 3WNKA 4PP1C 2AAVA 2GAZA 5CGMA 2V5TA 4HS6A 1ZT1B 1UA6H 2ZUQC 4HPOL 1MEXH 3IAGC 1DZBA 3EYFB 4LLYA 3KPTA 3CLFH 3T0EE 3ETBF 3P40A 4OD1H 4XPHL 1QUNA 1FG2B 1QFUH 1HK6A 1RU9L 3O2DL 2H2PD 3LMJH 2HJFB 1GZPA 4CRPA 4XMKH 4PJEB 3S34H 3VD9A 1BAFL 2XKUA 1J1PH 2VQ1A 2UWEA 3VD4A 3LN4B 4WCYL 3WFBL 4DUXA 2P8MA 1T66D 1LD9B 2OJEB 4UU9B 3LKPB 5HYJB 2BHZA 1GHFH 3DX8B 4BQ8A 5MEQA 5EUOB 5JTWA 2P24A 3S5LB 2YMXH 4JDTL 1FRGL 2X4PA 2UZYB 3KDMA 3LEVH 4PJHE 5C0IB 4WO4C 4M1GH 1T3FB 5EZLB 3JZ7A 4RISH 2HVKA 2AJZA 3GBML 4KKLD 5LQBL 5IB1A 3DUUB 1IGTA 2J8UF 3FZUD 2I24N 2NY3C 1J05B 3TBWB 3SE8H 1KGCD 2X70A 3O45A 3DURB 2KUTA 1JNNL 4I0PD 5E2VL 3ZDYE 1I4FA 4BUHA 1GH7A 3IJHA 1JHKH 5HD8D 3BPOC 1KCUL 2DIAA 2BCKB 2NX5B 1YEEH 4QTIH 3W39A 3CVIH 2MQ3A 4B5EA 5GS2D 5IM7B 1W2KT 2O5YL 5FYKH 1MCFA 1WVZA 2Z31D 3FMGL 1RIVL 1MH5A 1BX2A 5C0BB 3MLYH 3UYRL 2ZOLB 4OGXL 1T0MB 5FAAA 3UPRB 4O02H 5GHWH 4Z7WE 3PL6C 1F3DJ 2F58H 3RGHA 2G5BB 4F57H 4NNPL 3AS0A 5CKAA 2X89A 3FL7A 2GIYA 5DEGA 5DT1H 4RZCB 5D7SL 1W72B 3OKNB 1VFMA 3QNZA 1A64A 3QUMH 4P9ML 1N3NA 3MRJB 3W5MA 2BOBB 2BJML 4JFEA 1RV6X 3REWB 2PXYC 3T4YB 5CEYA 5FEBA 1NCUA 3ULVD 1MWAA 4MJID 1XGPB 4ZTOL 2FWOA 3RBGA 1N5YH 4XMLL 3ULVL 1JNHB 4XNUH 5JW4M 1J8HD 3HNTL 1A6ZB 4I48B 4JREC 1NEZA 4NIKB 5FM4A 2C7UB 4MXVF 3EGSA 4RNRA 4N8PA 1B3JA 2VN7A 5EU4A 2Y5TB 1I8LC 1VKXB 3PIQB 4LSTL 4KKBD 5C6TL 4PGCA 3ZT6A 1LEKB 3WE6A 2YA0A 1XGTA 2AK1L 2JK5B 4IMLA 3BQUB 2AI0H 1S9XB 2ATKB 4ERSL 4Z7UA 3FCTB 5KVGH 3SE4C 3MC0A 1DQJB 2XTJE 3MV8D 3BKCL 3VXSD 3BW9B 3PGDA 3TZVD 4ZDHB 4HUXA 2C1OA 2XQBH 1NDMA 4GKNA 3T08A 1MRDH 3BXNA 4RGMB 5DHVA 3MLXH 2R2BB 2HRPL 5E6IC 1D7FA 3MJ9L 2F5AH 1X4YA 4MZ2A 4HHAB 4HS8H 3K1DA 1QSEE 4R3SB 5GJSL 1T20B 4UV4H 5I1GL 3GIZL 2P44B 3RKPA 1MPAL 1AGBA 2J2ZA 4OZHA 1RUPH 4WJ5B 1N8ZA 4KI1A 3ARGD 4LIQH 1OAQL 1FAIL 2YZ1A 3BKMH 4H1LH 3OXRB 4Z6AT 3HE7C 4U0RC 5DRZA 1LK2B 5F6HI 3HFMH 2EC8A 4O5LH 1KC5H 4F33A 2IALA 4DOHE 4PGEB 3ARRA 4M5ZL 3VGAC 4FQHA 2D7TL 4KK5D 5C07D 4Z7OF 3PUCA 1RZJH 1U3HC 2VJXA 4MNHB 5HY9A 5JUEH 4RMSA 4S10A 4Y5XB 3X3FL 1NSNH 5DJZA 1XR8B 4RMVA 3MV9E 5D7LD 5IF0A 5F3BB 5E8OA 3V95A 4FQJH 1MLCB 2EDKA 1EZVX 4GAGL 4XBPA 3SDDD 4KPHL 3PGCA 4ZAKC 3KAAA 2YPLD 3EYQC 1JRHL 1A7PH 3FT2B 2W0KA 1KCRH 1Q1JL 4X80H 3VXUE 1UC6A 3G6JB 2UVEA 4PJXF 5JLZB 4WY7H 1YNLL 5KS9B 4XTRD 3WFEH 4JB9H 5GGTL 1AXIB 5ACZB 1MAML 2VZOA 3CFCL 1LMKA 1A6VH 3I2CL 5C0JB 4C4KT 5FK9A 1U8QB 3B9KB 4MA7L 3E1F1 3R1GL 4ZS7H 5JZ7C 3RY6A 3HNSH 4KDTC 3W11D 5FYJU 5CD5D 1XF4A 4O51B 1Q9WB 1GXEA 5ALCL 1RJYB 3NCFB 4GKOA 2VLKA 2WWKT 3UTSD 2VXTL 3TZVC 4R96A 4U1JA 5DJ0B 4PIRF 4JFZL 1KTLB 1FVEB 1Y18B 3KPNB 4NQVA 2CIIA 4RIRB 2E8YA 3LKQB 4JFFD 4L3EE 1LE9A 4HWBA 1AIFB 2E27H 1QRND 3QNXB 5I1DB 4YHIB 5KSBE 3C2AH 1D6VL 1J0YA 1FGNL 2GCYB 1P4IH 4B50A 1XIWB 2FX9L 1DN2A 2WQRA 3QG6A 1KIRB 2BDNL 1LE5A 2FB4H 1UM5H 4W70A 5HGGS 3F5WA 2FJGA 1OGAD 3C5JB 3FOLB 4YHLH 4KTYA 4NM4L 1PKOA 1RZKL 3T2QA 4K71B 3MACL 4F3FB 5DJ8B 4KTEL 4IDJL 4HWEL 2VISB 3D85B 4Y5YC 3OB8A 3I6KB 1SJVA 2CMRL 4G6FB 2VKWA 1SJHB 5JXEA 4AQOA 4NZRH 4XCCH 2Q8BL 1MRCL 1JL8A 5DC9B 4DAGL 4KK5C 3AS3A 1DQMH 2FIKB 2OR9L 1O5DT 5JNYB 1HDMA 1A4JB 3D18B 3U4EA 1WC7B 3WBDA 1OAUL 5EFIB 3BP7B 5F6HJ 4JO1H 5SV3A 2DQIH 3SDDC 2FATL 5DVOA 1S9YB 1A4KA 3UO1H 3L3OA 3SKOA 3CU1A 4MX7B 2VRAA 2XTJD 1FZOB 3WS6A 2YPVL 2Z4QA 1MJUL 4AQ1B 3RTQB 3BZDA 2G2RA 3TV3L 4G8GE 4CN6A 3T0XA 3EDDA 1T83C 4R8WL 1S9WB 4CGTA 3FTGB 4ODUB 3EYOB 5IVXA 1KEMH 3DVNB 5D7JD 3SOBL 4FQ2L 4OZGB 1G7LA 1UXWA 4A6YH 4PJ9B 4WW1B 4ETYA 3MRDB 3MNZB 4YHMH 4CW1A 5F9JA 3UTTA 1FL6A 4D0BB 5BRZA 2BHUA 5FF6B 4V1DA 2ZKHL 5L2JB 3R0MA 1PVHA 2YPKB 2F53A 1A1MB 4JO4H 2OMBA 3DV4B 4NQTA 3MV7D 4UILL 2OQJA 3QJHA 4GRWE 1FE8H 4ZPTB 1HE7A 3X3GL 3D39B 4U1MA 4WUUD 4NBYB 3HNVH 4ONGL 4U1LB 1LO5A 1QFWL 4KWUA 1MIML 5T1DL 5I8CB 3HAEH 3NCBB 4FQLL 5DJCB 5D7IB 4HMDA 3IFOB 3H9HB 4X5LA 1KENL 5I1JH 3MJ6A 4AM0B 1C16A 4JKKA 4PRAA 4Q7DA 2QKIA 5CGYC 5DSCA 2RHEA 2Y7QA 1CLOL 2DKSA 4UTAH 2WBJB 5EIQA 1GVIA 2FHCA 2Z93A 4BQCA 3PWJB 1G6RH 3DMMC 3VXTB 4N90E 5IBLC 5TDOB 3W9DB 5DFVC 2XZCL 3ARFB 4XVJL 1R5IB 3C9NA 2F54E 5JPNA 3DROA 4OF8A 4HT1H 4U7MA 4JQIL 2HG5B 5I2IA 3SKJL 5DQ9A 1X5HA 1XCQB 2EE3A 5CCKH 3V4UL 4WWKB 2P5EA 4TUKH 4P46D 1CDHA 5ICZA 1CG9B 3ZE1E 1A3QA 3RHWF 1YEHH 4WHYH 1HOCA 4H20H 3QFJA 4KKNA 1IQWH 1QSVA 3FO9A 5MERB 3DHJA 1SYSB 2D7PA 3O4LB 1TZGL 4RMTA 3ECBB 4OCYH 3U48A 3OXSA 3TBTA 3TA3B 2IFFH 5IB2B 1KFAH 1U42A 5F7UA 3MLWL 4OJFL 2ATPA 3SDAC 2W9LA 3G5XA 4MD5A 4H8WH 4PJDA 3OPZH 1N6VA 5HGHB 2CLVA 4FTVA 1AO7B 4QKXB 4TTGA 4NN6C 5T1MA 4J12A 2EE6A 4Z7VB 2B4CL 3UPAA 2NPLX 3DXAE 3VFTB 3DJ9A 4MDIB 4XCYB 2ICWB 1P53A 4YGVA 3U30C 2A6DB 1NGWB 1IKFL 3ARBD 5C0RL 5ISZB 2F74B 1G7IA 2DM4A 5ESAB 3EHBD 3IAPA 4HIJB 4HW6A 1NFDF 3EYSH 3QDJA 1IJ9A 4OKVA 2GHWB 5DJDA 4CBPA 2MQ0A 4OIIH 4HG4J 3FN3A 4P57A 2HTLC 1F5WA 1A9BB 5MP6L 4WEBH 4EOWH 1Q72L 2R9HC 4P0DA 2Y72A 2L0DA 3FQWB 4KDWA 3D3VB 5F88B 4QNPF 4X6DE 3SQBA 3QDMD 3CFEA 3QUYA 2MTPA 3JV5A 5DLMH 3O0RL 4PJFF 3SEPA 4XZUA 2Z9TA 3M8OL 4TQEH 4PP2A 3SJVE 3N1PC 4ZOAA 4HWUA 1FLRH 5IQ9A 3LHPL 2IG2H 5I17A 5DWUH 3MUJA 3OX8B 4G9FE 3STLA 1FPTL 5BVPH 3L5WA 4HXAH 3MRBA 5IGXH 4E41E 3NACH 3OJDA 4PJAA 4OAWB 3QI9D 1XAUA 4P46C 4ZSOB 2IMMA 2NY1D 1X5AA 4RMQA 1UVQB 1U2CA 2AEPL 3TBVB 2AS5M 2GT9A 4I77L 2I27N 2R4RL 6FABL 1T22A 4KU1A 1SEQH 1W72H 4D2NA 2JB5L 2D7MA 4ODSH 1ES0B 3VDCA 1ONQB 1I1CA 2VDQL 4OUUA 1E6OL 3DSFH 4K7PH 1OY3B 4LDEB 3LEYL 1V3LA 4TPRH 3IVKA 3KLAA 1AR2A 2C3VA 5SWQB 1JMXA 2VDOL 1U6AH 5HVHC 2BFVH 1AD0B 4LKCA 4MD4B 1FFPB 4CNIB 3ZKND 4XXDA 4PJ8A 2DQHH 4JY5L 1NC4A 3BN9C 1ZA6B 1I1FA 1TMCB 2VDLL 4URTB 4QRPA 1U95B 5KG9B 2EEDA 4KRLB 2ZG2A 4CU6A 1YYML 1WICA 2C3XA 2DM2A 4MNGB 3CFDA 4XBEH 4YK4B 4FN0A 3NZHL 4PUBH 5CAYB 2IANE 3MBED 5I6XB 3KXFD 1FCGA 3H7BA 1I7ZA 4MSWB 2GJ6E 1FP5A 3V5DA 3VXPB 3IETB 2J8UB 1G1CA 4ZXBC 4OCSL 5F1NB 1X5IA 2SEBA 3VWKA 1BIIB 5IESH 1DE4A 5D2LF 1Q94A 1IM9D 1QBML 5KTEL 1R3JA 2XWJB 5D1QD 3AU1B 5GGSA 3MLRL 3TT3H 1MI5A 3BPLC 5EOTB 2HH0H 5L2KE 2FHBA 1OPGH 4EBQL 4P5TA 3VGEA 2OSLB 2UY7A 4G3YL 4QOKD 4PJ5E 3BYYA 4N68A 1Q9OA 5CSGA 5J6HB 1HH9B 1YY9D 2GITA 4RSVA 3LS4H 2ZSVB 5FCUL 1JPGA 1TJGL 3ESVF 1NCWH 3V4PL 3DI2B 4YXHL 1MUJA 4WGVB 1TENA 4NP4L 4ZFZB 1FO0L 4XP6L 5EIIB 1RI8A 5HHNA 1JGDB 4M6NL 5EBWA 5IFJB 2ERJC 1DJSA 3CU7A 3ROLA 3BPNB 1FVCB 2J1KA 4M7ZB 4C56B 3CXDL 1T4KA 2HKHL 3BISA 5JQ6H 5F7EH 2NLJB 1LO0L 3GI8H 2DQJH 1EZVY 1NBZA 2WUBH 1MFBH 3RU8H 1VFBA 4JVWA 2NY0C 4K3DH 5FO7B 4W6WB 3VXRB 3MR9B 4PLKC 4S1DD 1WZ1H 3IDUA 2HYMA 4PLJC 2NZ9D 4OD3H 1BGXL 3C60A 1YMHB 5DQJB 1II4E 4Y4KD 4YDVB 4HIHA 8CGTA 1FL3A 1W0WA 3MRQA 2RGSA 5CIPB 5FA3B 5FECA 3RY6C 4PS4H 3TIEA 4MA1B 4G5ZH 1RULH 1YMMD 2LFGA 5DJAA 3PF2A 2FGWL 4OUOA 1KLGB 3TVMA 4HWNA 4WEMB 4LSPH 1E4JA 3A67H 1OCWL 3NN8B 2HFGH 1KNOA 5B39A 1KLFA 5HPMA 3F58L 4GLRH 5HHOB 4G7VH 1A6UL 4JHBA 4MXVE 3QQNA 3ZHLA 1S7TB 4PRIE 4R4NC 2XKNB 4XPGH 1QPXA 3CFKB 2G60L 4KROB 4JFYA 3VH8A 3MBXH 1YDPA 5J1AA 4YHKH 4P9HC 1SJXA 3MCLL 3X17A 4XPBH 3C09C 3MJ7B 3BRDA 4E41D 2ZZUT 3EO1B 3NPSC 1JGUL 1XF3B 4S0TD 1K5NA 4EN3D 4K9EC 4HZLB 4U1GB 3G5VA 1TCMA 5C0AE 3QUXD 4Y4FB 3GBNH 2I5YL 1QO3B 2FJHA 2NQCA 2JTDA 2OJZH 3GSUB 3KLDA 3GIVB 2BZDA 1DVFD 3HRZA 4NGHH 1YY9C 3DX7A 2DQEH 4KMTH 2I07B 3BDYH 3UZVB 1DQQA 4J6RL 5GRUH 1X7QB 4GMSL 4N9GA 2A73A 2G75B 5DZLA 2BNRB 2OI9B 2AV1A 3MO1B 2N7BA 2OLDA 1ZVHA 3FB6A 2MMXA 1K8DB 2HT2C 1KG0A 3L3DA 1KLUA 4XAWL 5C0ND 4AH2A 3WMSA 1GGBL 3HN3A 1M6OA 1PX3A 3HPLB 4LNRA 1EJOH 3S98A 5CJQL 1MHHB 1S7XA 1OGTA 4P3CH 1UA6L 3WFDH 1MEXL 4MAUH 3WS6C 1H8SA 3S3JA 3CLFL 2D03H 3UDWA 4OD1L 2DLFH 5J89A 5E9DB 3HE6B 2BVOA 3NBNA 3LMJL 3A6CH 1LO4H 1W0YT 1CDIA 4XMKL 5AUMB 1B4RA 3O6FB 1J1PL 4PJXB 2BVQB 2EDJA 4Z7OE 3KS0J 1HILB 3VMPA 3FRUA 2DKMA 4Y4KC 4PRNA 3ARDB 1LEIB 4HV8B 1IGML 1HIMH 2EICA 4LMQI 2DOCA 1KBGH 1CE6B 5JXAH 1GHFL 1CDBA 2QSVA 3BKYH 3I9GL 4LLVB 5H8DA 2XXMB 4JRXD 5E6ZA 3TN0C 1ZSDA 3MQIA 5CUSH 2GKIA 2YMXL 2DL9A 2GFBB 2XZAH 5AYUH 3DLQR 1P84J 43C9B 4HLZH 3S8WA 5L2KD 3CVHB 2EDYA 4M1GL 3FONA 4PRBA 4ZODA 1XCTB 1CT8A 4JPVH 1ZHKB 5I75C 1ZT7A 5BZWA 3K4AA 1IE5A 2FEEI 4WTZA 4LPTA 2FDBP 1YEGH 5I0ZA 1RVFH 5FHAH 1U93A 4GKZA 5I66B 5MENB 4AG4H 1R3HB 3BZEB 1PG7L 4GW1B 2XZZA 1VACA 2GTZA 4X6CF 1TFHA 5I1CL 4LEXH 1JHKL 1RZ8B 3RGVD 5FB8B 3PHQB 1KPRA 4JFPA 5C1MB 2DYPB 3QUXC 1A7QH 4QTIL 2NTSP 2FO4A 4HPYH 1WBYB 3CVIL 1X44A 4NJ9H 1NMCC 1DVFC 5HHXH 2N4IA 3W0WB 3ZHKA 4OZFA 3MJ9A 3NCJL 5LBSH 4AJ0A 4FABH 3VDBA 4PBWD 4NOBA 3KWWB 3QCUH 1N2RA 4Q9CA 2NY6C 4R0LB 3IFNH 1MHEA 1P7KB 1JYNA 3MLSH 2OCFD 3NFNB 5M95B 4J7RA 4O02L 5BS0B 4GRMA 2DWDA 1GRWA 2F58L 5CJ8A 3CGTA 4NO5B 2BNUB 2ZCHL 4KVCH 4OCRH 3NFPA 3T0EA 5DFTA 3BO8B 4KK6D 1JGEA 2E3VA 1U8HB 2B0SH 4PB9H 3IU4H 4OQTH 3ARGA 2RBLA 5DT1L 4Q6IC 3Q6GH 1A2YA 1N26A 3QUML 1AQKL 3B9DA 5ERWA 4XI5D 3BVNB 3MGTB 4F7CA 2FR4A 1C5CL 1S7RB 5TJWK 3B6SA 4R4FH 1BD2B 4L8DA 1GAFH 3V6OE 3HG1E 2R1WA 2HN7A 3FJTA 4MB4A 4AENA 4F15B 3HB3C 1HWGB 3I75A 1T03L 2E9WA 1NDGA 3F7YA 1D9KD 3GZKA 2W65B 5D7LA 4DVBB 4LASH 4OCNC 1D5ZA 1OARH 4NPYB 2NY5H 3T65B 1CI5A 3R8QA 2YPLA 4KZDL 4U7KA 1NBYA 2AI0L 4MA3A 4Y2DD 3NIFE 1RZGB 3M45A 5C0AD 5KVGL 3VFMA 2DQFA 3RZCA 4GG6F 1RUAH 1BFOA 4R7NB 3RPIA 4PRPB 1T1ZA 2XQBL 4MQTB 4ORGB 4JM2B 1M7IA 1MRDL 3RL2A 1PEZA 3MLXL 3RHWK 1CDJA 5IIEA 3I6LE 4MJ4A 5C0DA 5TE4L 3DBXB 1IKNC 2FH8A 4F9PA 4APQB 2Q7NA 3X13A 2F8XC 5A1AA 5H94B 3QUYC 2F5AL 4ZD3H 4JR9L 3IFPB 4HS8L 3L95B 4L4VD 4C57C 2CUHA 1IAII 4OCMC 1NUDA 4UIMA 1R3IL 5F93C 4N1EA 5CMAA 5B8CA 1X6LA 1RSFA 4HIIB 1B90A 3QZWB 5IHUH 4K8RC 1ZMYA 3BP4A 3PXJA 1HEZA 4LIQL 5A3ID 1JF1A 4E0RB 1U58A 5KVFH 1UFUA 4Z7WA 1KN2L 4UT7H 2PO6B 1T2JA 1XF2B 3R0NA 4KJQD 1A7RH 1IM3B 3HFML 4NNYB 3H2WA 1KC5L 1U8MB 5C0FB 1HH6A 3INUH 5C2BH 5I16A 1HQ4B 2YD9A 1V8HA 3VFOB 4XBGA 1RZJL 5JUEL 4I3GA 3HZYA 4WW2A 1OGAA 4LSUL 4HJGB 1BLNA 3O3EA 3VDAA 2UYLB 5L0QC 1T1WA 4MYWB 4FQJL 1ZHBB 4JRWA 2JF1A 1JN6A 4JGMA 4BH7B 2HLAB 1LP9E 1NMBH 2AK4E 2EXWC 1UJ3B 3U6RB 1A7PL 4PJ8C 3RNKA 3KPOA 4GAJH 1YN6A 4X80L 5DMIH 3FB7A 4P4KC 1NGQH 5I1HH 4JB9L 1FDLL 1ZK9A 2VAJA 4RMUA 3RKDD 3JVGA 4FFWD 4GBXA 4E42A 2CRIA 2R0WH 5GRVK 5KN5A 1BFVL 4LLUA 4WV1B 3S96B 4YDKH 1KJVA 1N64H 1S78D 1A3LL 2BRQA 3DRQA 3AS1A 3HNSL 4EUPB 3FO0L 3SHSA 2FEDC 4QRUA 4WFEE 5JW5A 1NFDB 2IBGA 5GS1B 2P5WE 1BZ7A 1HHKA 2C3GA 1YNTB 1XZ0B 1MLBB 4DN4L 4X7DC 1H15B 4G8EA 4PJEE 5D7JA 2XXCB 1J88A 2DQCH 4JQVA 5I19L 4YAQA 4TOYH 2VLJB 4O2FA 1YEJL 4KI5F 1U91A 5DZOA 4Y2OA 1EAPB 1C1EH 2NXZC 3WO4B 5GS0H 4NO3A 5DEFA 3MLTA 4NN7B 3BJ91 5HYJE 3C2AL 2VC2H 1R0AH 1CDCA 1YYLL 5DVMA 1P4IL 1A1OA 1MHCA 1EEYA 1IAKB 3HI6L 4YIQA 3VG9B 1AGFB 4RFNC 3V6ZA 3QEGH 5D6DA 1HI6B 4QYOA 4N8CH 4X6FB 2R4SH 2NTFB 4OF7A 4HK3J 2LAAA 2V5MA 4YHLL 1T0NA 3MRIB 1JF5A 5EZJA 2BMKA 3QIWD 3CSGA 3BZFB 4I18A 2VUOA 5CZVH 1JV5B 1YN7A 3I84A 2F19H 4R26L 4KJQC 3S36X 3ZDXF 4ODBD 3HG1D 3OR7B 3HRPA 4MD0A 5ADOH 5GZNC 4NZRL 1M05A 3JWDH 1NFIB 4QNPE 5JHLH 3RWIB 5FUZH 1EK3A 1WBXB 3TPUA 4YDJB 3H9SD 2CH8A 3PWPB 4PJFE 2IBBA 4I3SH 3U0WH 12E8H 4PRHB 1T6WA 1GC1C 5T5FL 3C60C 4K55A 3O41B 2Y1VA 4KJPC 4NQEB 1LWRA 2DQIL 4Q9QH 1TZIA 2IH1B 2DICA 4M9PA 3B4NA 4LVEA 2H6PB 4NFDA 1CD8A 3VXUA 4FRWA 4XNQB 3RVWC 35C8H 4YQXH 1B0GB 3EJJX 4WI8A 3ZZ1A 5JR1H 5HHPA 1KCVH 3QULB 5C0CB 3B3IB 3L3HB 3TVMC 1Q0XH 3DUSA 3DTXB 1ZV5A 1KEML 1DTUA 5SWSB 3G5ZB 3BUTA 1LILA 3PWVB 4A6YL 2QQQA 4RQQA 3GK8H 3VFVA 4LU5L 2F8OA 4YHML 4M5YH 5CSBA 3JV6B 5DDHB 2JJTA 4S1SH 4Z95H 3MODL 4J3VA 1L0XA 4L29B 4FQPA 4C58B 4CN1A 1I7RA 2DDQL 1I9RH 3O9WC 4U6XB 5IMLA 1UZ6F 4U1SB 4HKXB 1ZT4B 1LNUB 2XN9D 4JO4L 3MJ8B 2G5RA 3L3GA 5EDXA 3HC4H 4L3EA 5T3XE 1FE8L 5D2LB 3MRMB 3MGAA 2ICCA 3VWJC 1G9NL 5F70A 5JO5B 1EJ6A 1E0OB 1CS6A 2OR8A 3BE1H 3CCHA 4RBPK 4Y4HD 2CLRB 1EBAA 4LLQB 5F7DA 5I1JL 5IR1B 2WINA 3M1BA 1IAOB 3G5YB 4M02A 4Y1AB 3EO9L 5E4EC 3RVXD 5I74C 5FOBB 5SWZD 1BM3L 4JHWH 2VZ3A 4TUOA 4UTAL 3QEHA 1R3KB 3J8F7 4ZO7A 1S7SB 5E99H 4OLEA 3RP1A 3BX7C 4FXGA 3DETD 5JHDE 1GPOH 2A6KB 3IDJA 4K2UH 4ZFOL 1S7VA 2E7HA 2K1MA 1E28B 4D0CB 3F6IA 1YEFL 3ULUF 1VADB 5K33A 3DYMA 4R2GB 1IEBA 3HA0A 4M6OH 5D96B 5I1IH 1SVZA 4F37F 4PV9B 2L4OA 3HS0B 4LVHC 2YBRB 5C9JA 3UDWC 5INCA 4GRLD 1A7NH 4HT1L 4R97C 4NJAL 5HHMB 2Q87A 1S3KH 5J12B 1AH1A 1HHHB 1QKZH 2Q7YB 5CCKL 4NDMB 1DLHB 1U8LA 4TUKL 3JWOC 2XOTA 5CWSA 1NJ9A 3GSNB 3RZWA 4IMKA 1ZGLA 1J86A 1MAJA 4G6AC 3M07A 1NLDH 3PDOB 5EC2B 1RZIA 2QQKH 3JV4A 1AR1C 4KFZC 2X1WL 4L9LC 2AJVH 4P2OB 2ZUQB 5B38G 1DUYA 4WI3A 4OLWL 4G8GA 2MHAA 5ITBH 2CUIA 5HDQH 4YR6A 3GJFA 4DKFH 3RAJL 4OGYL 4G43A 1CBVL 3ALPA 3QUZA 3QI9A 2FX8H 2IFFL 2Y06L 4XPTH 1EO5A 1D5BB 1KFAL 5HHVH 4EI5A 3K1KC 3KLHC 4H8WL 3MNWB 2DLEA 3OPZL 2R69H 1OB1A 3ES6A 3OGCA 5HYJD 4AEIH 5I73C 3WNPA 2X40A 5BOPA 4LGSB 3F7RA 4JDVB 4XHQA 1U8JB 3LRSB 4X9GA 1CICA 1UH4A 2W0FB 4NO0B 4QHLA 1S7WB 5C70A 3EYVA 4HZAA 4YFLI 4XP9H 2PR4H 2E5EA 5HYSG 1DUZA 1XF1A 5EWIH 3U4BH 2Q1EA 2XZQH 3EYSL 3FO1A 2ADGA 1C08B 4WO4B 5GRYA 1OSPH 4YXLH 1EO8H 3GEWB 3P0VH 3CVHH 3QH3A 3P9LA 3V4VH 5F9DC 2Q6WA 1L7IH 1FZMA 4WU7A 2A74A 4Y4HC 1EEZA 4I9WD 4RGOH 1FZKB 5KS9E 2H26A 4EOWL 1N6QH 4J3WA 1P1ZA 3FQTB 3B5HA 3WUWB 3GM0A 2AP2A 2YHGA 3RVXC 1FZJB 4NRZA 4BFIB 2NY3B 4YPJA 3VGGA 3MBEA 2ADIA 5LWYH 4IOIB 2JJSC 1F4YL 2P47B 3ZT5A 4OZHF 5LCVL 3P4NB 1R5WA 3NPZB 3BPOB 3GMNA 2NX5D 3BAEH 4TQEL 1WF5A 3ZTJH 2F54A 2FCBA 1SM3H 2X1QA 3JSSA 4KJYB 5CEZE 3E6FA 4UDUA 1FLRL 5EBLB 4L4TB 3T0EC 1I85A 2IG2L 2J4WH 4F7TA 5L9DH 5GRJH 5D1QA 4Z78A 1FYTB 1HHGB 5C0BD 4OCXL 3WO3B 5IGXL 1ZVYA 3X11A 3NACL 4QRRB 4KGLA 5J11C 1I1YB 3G9VA 5FDYA 3PL6B 4HJ0C 5CJ5A 4LKXA 2B7DT 2VAAA 1MCBA 1ZHLA 3H9YA 1B6DA 2IQAA 3SCMA 3QWOB 1JRHI 4OCWL 3BEWB 1AHWA 2CO6B 3IDXL 1JPFA 1SEQL 3BFOA 1W72L 4ODXB 3CUPB 3RDTA 1YEDA 5FO8A 5EOCH 3DX9A 5GISH 4NCC2 2PXYB 3DSFL 4XVTH 1TJHH 4TPRL 1NUFA 3L5IA 1K8IB 1PAMA 1U92A 4L8CB 3P73B 3L1OL 1MCDA 3CZFB 5DJXA 1U6AL 4LOUC 1ZANH 2BFVL 3OKYA 5LAXA 5IBTH 5HGAB 3DXAA 3UJIH 3RZCC 2DQHL 4K7FA 2ZNWA 5IHLB 1I7UA 5DD6A 4ZOCA 1XGUA 4LCYB 1NL0H 1L0QA 3CFIC 1AGCB 4M1CC 4ENEC 3BD4A 1YUHB 2E7BA 2VLRB 3HI1A 2ESVE 3BQUD 3IS1X 4OFDA 4P2QE 1B0WA 4FNLH 4HWZB 5K9QI 5HI5D 5JMRA 4PUBL 4HF5H 4F9LA 4MJ6A 2ZSWB 3S6CA 4NQDB 5IESL 5TQ2H 1JUFA 3WEXA 2PW1B 1E4WL 3BI9X 4KY1L 2JLLA 3B83A 5B8CC 4OB5L 4PREB 3S9DB 3MYZA 3OKKB 3WHXA 4X6DA 2AXGB 2DQUL 4MVBC 1OSZB 1WBZA 5DJYA 5E6IB 4RWYH 4RAVB 1VA9A 3I3EA 1RJZB 3TT3L 4D9QE 4HUUB 4QF1B 1AXSB 4ORZC 2HH0L 1V7MH 1OPGL 3SJVA 2BVPA 3ZL4L 3HMXL 4JN2A 1WGOA 3L3KA 4G9FA 3LB6D 1CK0L 3QQ9C 3SDYL 1KXVC 3LS4L 1I8IA 1GZQA 4X6CE 1NCWL 4E41A 4ZUUB 3QUKB 2P49B 4M6ML 1NEUA 5L7XH 1U3YA 3JUZA 3UTPE 4RX4D 3HE7B 4U0RB 5D7IE 3IDMA 1DN0B 3OKDA 4MS8D 1JFQH 1TQCC 2GSIB 5C08B 3TBSB 2YEZA 1MCIA 3VGAB 3BWAA 4X6BA 5FYJE 5JQ6L 3GI8L 2Z92A 1A14H 3M17A 4KK9D 5F44A 1U3HB 3RU8L 3IGAB 2R0ZL 3CDGA 2ZCLH 3D9AH 3MRPA 3C6LA 1X4ZA 3JXAA 4MQSB 1WZ1L 4OD2B 1R5VB 2V17H 2IH3A 3MFGB 3NTCH 4GBXC 1RK1B 1QSFB 4L8BB 4L1HA 5MI0C 1PY9A 1U0QA 4ZAKB 5E8PB 1JCKA 3UJJH 5J6GB 1KT2B 4LCWB 3OF6A 5ANME 3FT3A 4PS4L 3BUYA 3T1FB 1PKQE 1F11A 1UZ8B 1Y6NR 5KVDH 3VRLF 2GEEA 4G5ZL 4DW2H 4EKXA 4LHUB 4IOSD 2RR3A 4ODWB 5E1AA 4LSPL 4M9OA 3A67L 1EUUA 2EDXA 4GG6B 1JTPA 1XGQB 2VXSL 2HFGL 3IXAA 1C12A 4P2YA 1ZTXH 1DCLA 3B9KD 3N50A 4JANB 4YO0B 2GJ6A 4OF3A 5TPWL 2X1XR 3FQNA 3AMKA 5IEHA 1KJ3H 3O8XA 4EUPH 4C4KO 3RWFB 4XPGL 3R4DA 3O4LE 5GZOD 4UOJA 3QRGL 5E00A 4NQCB 3OBAA 1G7JB 4LRIC 2CUMA 3KHOA 4MNQB 2DQDH 4XPBL 4QRQB 3RVTC 2NY7L 2WWKO 5GSRA 3WIHH 4N0UB 2VL5B 4QHUB 3CDCA 5L2KA 4I18C 2NR6D 4WFFD 2CR3A 4G8IB 1IGJB 5IK3A 1XIWD 3CFJA 1C5BH 3FQRB 4PJ5A 1MHPH 2EYRA 1WFTA 3L7EA 4NM8L 4G9DA 2FGZA 2OJZL 3VXQB 2HFEB 4X4YA 5ETUA 4YPGB 4NGHL 3CXHJ 3JTTA 3ZDZF 2DQEL 3LB6C 3BDYL 3CSBA 3QA3B 5DVNA 3QXDA 2P45B 5EA0L 3EYUL 3GBLA 4FFZH 5GRUL 3LKNB 3CPLA 2D9QB 2Z91A 2H32A 2V7NA 4XVUD 4ISVB 4J8RA 3D85D 5GIRB 5M94B 3U0PA 3TO2B 1OTUC 4OLXL 2VR9A 4Y5YB 2PYEE 3KR3H 2CSPA 4G6FD 4KKAD 4QGTA 3MPCA 1LGVA 3MA7A 1I9IL 4P3CL 1S7UA 3WFDL 4KK9C 4P5KB 4NHUB 5ENWB 3PWLB 2D03L 2YSSA 5ITFA 4CADA 2DLFL 3HMWL 2HLFD 3B2UD 4KXZI 3VRJA 3FFDA 4LCIH 2R1XA 3BIBX 1NMAH 4GQPH 1FVDB 4N8VB 5EN2B 5I8EB 1VEPA 4LLDB 4HG4K 5GGQH 3MRRA 1T1YB 3G6AA 2JJTC 5DJ2A 1XGRA 3RTQD 1KBGL 5JXAL 5K9OB 3BWUC 4ZYKB 2A0LD 5GGRY 5C09B 5DYOB 1G7PB 3U36B 3HPJA 3O81A 1EAJA 4PJ9D 4WI5A 4J4PD 2XZAL 1I3GH 5AYUL 4PRIA 5JPMB 4D9QD 1RUKL 4IM8A 2B1AL 1CGWA 3AVEA 3IDGA 4S2SB 4FP8H 2A83A 4I5BB 3CIQA 5HBBA 4JPVL 5EORH 3C5SA 1DBBL 1JWUB 4G42B 1EBPA 1YEGL 3Q3GB 5FHAL 1FFRA 1INQA 1K4CB 3D39D 3WIFA 1JWSB 3QFDA 4NKMB 4WI2A 4F7EB 3HZKB 3VFNA 4XNZC 4Y2DA 1T1XB 3HLAB 4S11A 5C0AA 3IT8D 4O58H 1XIWC 1G9MH 5FA4B 2QR0A 5FYJD 4OTXH 4X98A 1FBIH 1A7QL 5HGDB 3D25A 5FYJL 1S9VB 4HPYL 4FQQB 1JJUA 1NGXA 3OKOA 5HHXL 2WBJD 2CK0H 2OTWA 3UEZA 4U2ZA 2FD6L 4JFOB 4X7SH 5F8RC 3BJLA 5LBSL 1VB9A 2Q76B 2BC4B 2R2EA 1SBBA 5IB3B 1CLYL 2PUQT 3P9WB 3EFFB 3QCUL 5IW6B 4K71C 3DMMB 4X0KA 3IFNL 5HYIA 3Q6FA 4IMKC 5EOQH 1K4DA 3ARFD 4OCRL 3U1SH 2GAZB 2MSPA 5FGRA 4D0DB 2B2XH 4HULB 1I3RA 1QOKA 2ADFH 5A2FA 3OL2A 4PJAF 2YWYA 3C8KA 3PV6B 3L9RA 3PDGA 4U05A 3IU4L 3HUJE 3Q6GL 4GOSA 4WWKD 1F3DH 1GZPB 1NCTA 3QUZC 5D93C 4XB8A 4HX1B 4OM0H 2VQ1B 2UWEB 4RBPH 4EI5C 4R4FL 2P8MB 3WFHA 5CZXC 4FQXA 3V5HA 2DJSA 4OF6A 1WIPA 3QEQE 5E8NA 3HZMA 3O4LD 4F7MB 4Z7NF 2VL4A 4P2RB 2MKWA 1LEGB 1CICC 3ILPA 5MEQB 1IQDB 4XNMA 4K3HA 1KEGH 1I1AA 3TA3D 4DUVA 3P11H 1CU4H 1VERA 2NXYB 4LASL 4DUWA 3FT4A 4KRPC 1OARL 3SDAB 4PJ9C 5BZDA 2WANA 3SGJA 1AO7D 3G6DH 4B7LA 3K8LA 1NCCL 5T1LB 2DMCA 3N9GH 1ED3A 4F37K 4NN6B 5D1ZA 3QXUA 4AMKH 2EKSA 1RUAL 1A1NA 5ISZD 3U30B 4NCDA 4KRMB 5IB1B 2YKLH 1IGTB 3GSVA 1OAZH 2X70B 2EEBA 4NKOB 3O45B 4D9RD 3T0BA 1KUMA 1OP5K 4ZD3L 1I4FB 1WLHA 4U7SA 3IJHB 1UZ6E 2AJXH 5HVWA 5FV2A 5BJTA 1QBAA 3VFWA 4GXUM 5KSUA 3W39B 4LEOA 3NGBC 3GSQA 3PWNA 1X5FA 4DFHA 1IC7H 3KPLA 3D3VD 3QIUC 1V3JA 5GGUA 5IHUL 1BX2B 4PJBE 2YRLA 3DPBA 4V2BA 4X8JA 2X9YA 4H88L 1BQHB 1NGZB 1U8PA 5AD0A 3UAJC 4YDLC 1CD0A 1OP3K 3INUL 2H2SC 2FBJH 5DMGC 1F00I 5D8JL 5JOPD 3GMRB 3SCMC 3BT2L 1AHWC 5DEGB 3IDYC 2ITDA 1T5WA 3GMLB 3QNZB 4OBSA 4XC1H 1N3NB 3QIWA 3V52H 4HD9A 3ULUE 3K2UH 4JFEB 2WP3T 1OQOA 2KKQA 3LOWA 4M7LT 5CEYB 4L8SA 5D71L 1TJIH 4B7IA 1MWAB 1ACYH 4UQ2A 3GI9H 2FWOB 1RFDH 3V6OA 3HG1A 3MXVL 4OLYH 5TGBB 3REVA 1NEZB 1LO3H 9CGTA 4GAJL 2GJJA 4LDOB 4WDIB 5GGRB 2PF6A 4RNRB 5DMIL 1S5HA 4ZS6D 3QPXH 5EU4B 5I1HL 1OTTC 4BFEA 4PGCB 3WE6B 1UXSA 2NY5C 1AD9A 1XGTB 3RWJA 3LRHA 4X99B 2R0WL 2XWBB 1AI1H 4IMLB 1XF5A 4F7PA 3SBWC 4C55A 1HKFA 5HVHB 4F80A 3FQXA 4YDKL 4Z7UB 3QHZH 5C8JA 4QLRA 1MCKA 3KPRE 4MLSA 3FB8A 3KPMB 3PGDB 1DBJH 1YQVH 2C1OB 1NDMB 3SGKA 1A47A 4GKNB 5DJ6A 1QQDA 2I26N 4A6YA 3O6MH 4XCFH 2MJWA 4TOYL 5HDBF 1P4BH 1FV1A 1KACB 3IF1A 5GS0D 5IW1A 1C1EL 1MCWW 3LEXA 5GS0L 1VGKA 1Y6KR 5EUKA 3KHQA 5I1EL 4E5XA 5JIPA 5TE6H 2VC2L 4DK3A 4U1KA 3KPQA 4LSVH 4M61A 1KXQE 1ODAA 2RAMA 2W59A 1AGBB 3T0WA 4OZHB 1BREA 2BNQB 4F8QA 3FQUA 3QEGL 1N8ZB 4N8CL 1FNEA 2R4SL 1MCLA 1SYVA 2J7LA 5HSFA 4ZUSA 5DRZB 1CF8H 3BPLB 4PD4J 4PR5A 4F33B 2IALB 4NT6A 3VD3A 3RWHA 1QZ1A 4DKAA 3BPCA 4FQHB 4NUJA 3QEQD 3JWDL 3MSPA 3E2HC 5HY9B 1OD7A 4GMTL 5SWZA 3EZ8A 3QDGE 5ELIA 5DJZB 1HXMA 4I3SL 5CP3H 4JE4B 5IF0B 5E8OB 1P84K 1MFNA 1BMGA 1WJ3A 4ZFOA 4XBPB 1LP9A 4M48H 3QWRD 3AGVA 2ERJB 3PGCB 2AK4A 1E4KC 3C5ZC 4LPWA 3S4SG 4C56D 3U9UA 5GJTH 3TF7C 4GW4A 4HAFA 5DRNA 3BH8A 4YQXL 4LCCA 3LKRA 5JR1L 1KCVL 3VXRD 1XGYH 2NY0B 1BQSA 1RHHA 5FDWA 2FYYA 3WL9A 4Q74A 1UQSA 1Q0XL 4HQQH 4PGDA 5J57B 3BKJL 2YA2A 2M1KA 4XX1G 2MKLC 4N0FA 4DN3H 2VITA 1SY6H 5FK9B 1TCRA 3QO1A 4M5YL 1QNZH 4S1SL 2Y6SC 3X12A 3LQAL 1WEJH 3O8XC 1XF4B 1FG2A 5JIKA 4OZ4A 4BSJA 4ZOEA 5EZIH 3ULVF 4OF5A 5IJVB 3GGWA 2VLKB 2BHYA 1P5UA 1YC8A 4PJEA 4HFWB 4R96B 4PJCB 4AEHH 4UIKH 4IJ3C 5TFSH 2RIKA 3LN4A 4DWHA 3QSKB 2WWMD 5HHOD 3EDKA 4NQVB 5LKNA 2CIIB 3MX0A 3NAAL 4FFYH 1EO7A 1LD9A 1BD2E 3IS0X 3HC4L 4F2MB 4IOFD 3CMOH 3LKPA 1LE9B 5HYJA 4LF3A 4Q9RH 5EU6E 2YS4A 5F6IC 5FGBC 4HCRL 4ODHH 4KROD 5L6YH 5JW4R 1O0VA 2V9QA 1MRFH 3IAQA 2EXYC 1LE5B 1WT5A 1X3DA 3WCYA 4FQCL 3F5WB 2FJGB 4JHWL 3VGDA 1VESA 3NPSB 5C0IA 5E99L 5GS3A 1TETH 4EI6B 4WI4A 3TO4A 1GPOL 1T3FA 3D1MC 4Y4FD 4K2UL 3CX2A 2QSCH 5C92A 2V2XA 3LPWA 4LBEA 4M6OL 4M93C 3ABZA 4PJFA 1CXKA 1KJ2A 5KANG 2YN5A 3RX5A 2YOCA 3TBWA 1MSPA 3RA7H 1A7NL 1HDMB 3MROB 3U4EB 2BNRD 2YRPA 1S3KL 2D3VA 2BXYA 2XYCA 5D5ME 2FL5A 2H41A 2EDTA 5FCSH 1DBAH 4HGMA 2BSSB 4QCIA 4NZTH 1A4KB 1KB9J 3SKOB 2AJVL 4MXWH 2GUOB 5FFLA 5E9DD 2G2RB 3HE6D 5ITBL 5HDQL 1UG9A 1X5GA 4WHTB 4DKFL 3FN0H 3UJTL 5ADPH 1T0MA 4RFOL 4O2CA 4GFTB 5IVXB 3QEUB 3W9EA 4HC1H 1G7LB 2LABA 4H25A 1F6AA 3ARDD 5HHVL 1OM3H 1IARB 4JG0H 4CW1B 4V2CB 2FZ3B 5F9JB 5F3HA 4HH9A 1FL6B 4PY8I 4FMKA 5BRZB 4AEIL 4HIXL 5J7CC 4P59H 4YBQC 4K7PX 1W72A 4W4NA 1P69B 4CMMA 4K07A 5I1AA 3TN0B 2F53B 5KW9H 5EO1A 3AC0A 3REWA 3RWGA 5IV2A 2OQJB 4XP9L 3QJHB 3CK0H 4OLZH 3UX9B 3CZJA 4U1MB 5EWIL 3U4BL 1CD1A 1JNHA 2XZQL 1LO5B 5IBUB 1BVKA 3IDIB 1OSPL 3IB4A 4X9BA 3DIFA 3CVHL 4FZEH 2DF3A 3MCKA 3UTTE 2DQGH 1L7IL 2EZ0D 4U31A 5F72S 1OTSC 2DM7A 5I75B 2AJSH 1JHTA 1F58H 3ARUA 4PRAB 4V1DE 2QKIB 5BVJA 1L6XA 1JZ5A 4U6VL 5FYKU 5DSCB 1N6QL 1JK8A 5JMOC 4UNUA 1LEKA 3KYNB 2QQLH 3MFFA 1EEUA 5MEND 1NGYB 2Y7QB 1A7OH 2JK5A 3EJYC 3UTQA 5CBEA 2DIJA 2Z93B 3MUGB 4KRNA 2ATKA 2ENYA 2J6EA 3FCTA 3H0TB 1DQJA 1EGJH 4BQBA 4U1GC 3BW9A 5CFHA 2VZTA 5D1XD 3BAEL 1HNFA 3TT1H 2BRRH 1V05A 1WZMA 3C9NB 3AM8C 2R2BA 3LZFH 3OZ9L 5JPNB 3DROB 1NMCB 3W0WD 4Z7WF 2J4WL 5L9DL 2QLVB 1T04B 3UXFA 5I2IB 3L5HA 3G08A 4HHAA 5DQ9B 2R56H 1YECH 4ELKB 5IMOA 3SGDH 1N59A 2AKRA 3NVQA 1JZ8A 2YWZA 4HGWA 5D2NE 5ICZB 5BS0D 1AXTH 1ZHNA 3MLZH 2O5XH 3ZSSA 5JA9A 3HMXA 3ZDZE 2D2OA 4WW2F 3B8YA 1ADQA 3WKMH 3DX6A 4FQXC 1HOCB 3P3YA 2QSTA 4BM7A 3QFJB 3FO9B 2WW8A 2A1WL 5T1KB 4UB0L 3PJSA 5INDA 2V6HA 4I1NB 1T0PB 4Q6IB 3SE3C 3TBTB 4OT1H 3TYGH 4H0IA 1UWEH 4XX1E 5EOCL 1CCZA 4IRJA 2VH5H 3O6FC 1BD2D 2DLIA 4XVTL 1TJHL 2ATPB 1YEIH 3G5XB 4MD5B 5E8DH 4PJDB 3SGJC 2CLVB 4FTVB 2NY4C 3V0WL 5DUBB 1YPZE 5IBTL 2ID5A 2VSDA 5T1MB 5C3TA 4ONFH 4JFHD 2P46B 1BJ1J 3UJIL 2AEQL 1MF2L 4DVRH 3BD3A 2PW2B 4YGVB 5F3BA 2ZJSH 3BOVA 4PRHE 3DARA 3KPSE 1G7IB 4ONHA 1EV2E 4JFDE 4U1IB 1FNGA 4CDHA 1JZ7A 5DVKA 2Y5EA 1BEYL 4JEGB 3QDJB 1Z5LA 1GOFA 4PY8J 4OKVB 2DJ4A 2UY6A 4HF5L 1A3RL 5DJDB 4I13B 2H3NB 3PHSA 5HI3D 3G6JA 4A2LA 2H9GA 3PABA 4P57B 4I2XE 5KS9A 4PRPD 1A22B 2EZ0C 1AJ7L 4K3JH 1DBML 4JM2D 2DL2A 3G04A 5C0JA 2X09A 4F58H 2DI8A 4APQD 1KCLA 4NC1E 5F96H 3BRGC 3CFEB 3QUYB 3TBYB 5B39G 4JFXB 4LRNL 2EIDA 4XC3H 2VZVA 4X7TA 4XZUB 1V7ML 1VFOA 1WK0A 3QDAA 3GRWL 4W6YB 4OZIE 3Q5TA 1CXEA 5DJ0A 3LD8C 3K81A 5IQ9B 4P23A 4DGIH 2YUWA 3STLB 4RIRA 4K3EL 3S36H 3MRBB 5EZOL 3OJDB 2RCSH 4PJAB 3FO2A 4QXTB 5L7XL 5I1DA 4YHIA 2PO6D 5CD3B 1A6TA 1DFBL 2GCYA 3V6FA 4BJLA 4L8SC 5I8OL 1JFQL 3V6OC 2HVJA 4O4YH 1DQDL 2ARJA 2GT9B 3ZKMC 4JKPL 1A14L 3QBTB 4NKIL 5DD5H 1T22B 4E9LA 4OI9A 2IPKA 3D9AL 3Q1SL 4F3FA 1F4WH 3MRCB 5L0QB 1VENA 3DUHA 4HGKC 2VXQH 5DJ8A 1J0JA 3WHE1 4OUUB 1OP5H 4X7FC 5C2UB 2V17L 4HDIA 1CR9H 3IVKB 3KLAB 4N0RA 4H5SA 1SJHA 2X4TB 1MWAH 1NCBH 1MQKH 2HP4A 4S1QL 3LKOA 3UJJL 2MWCA 4LKCB 4PJ8B 5ID1A 4JQXA 2E8ZA 2XA8L 1A4JA 3D18A 1I3VA 4P4KB 4MB5A 3MRFA 1I1FB 4OFPA 3AMLA 4MMZC 2YD7A 5IFHL 4QRPB 3SGKC 15C8H 2ESVA 4P2QA 2V9TA 3CFDB 5MHSE 5E03A 2FJFA 5IMMA 3VW3H 4G80A 4PJIB 4OLUH 3HC3H 5HPOA 3V5DB 1KJ3L 4X9FA 3MXWL 4NQSA 1MCQA 4NWUH 5DF0A 5J06A 1F4HA 2Z0BA 4Z76B 2SEBB 4LSQL 4ODUA 4PV8A 1DE4B 5CJOH 1Q94B 3DVNA 5FM5O 3MOAH 1R3JB 2VLJD 2VXUL 1G9NC 4XPFH 4Y88A 5IT2L 5EIVA 3S37H 5KVEH 3GJEA 2KQNA 1UT9A 3Q48A 4D0BA 1W8NA 5GGSB 2NXZB 1D5MA 1MFCH 2DTMH 4OM1H 1EIBA 5L2JA 3RQ3A 4IRSA 4P5TB 5JOEA 3VFGH 2GITB 4NHCH 2AABL 2VSCA 3RUGE 3T09A 1JPGB 3GMOA 4RGNC 3THMH 2LV4A 1MUJB 5GXBB 3N06B 4FFZL 1P7QA 4XNXH 5H37G 1CXIA 2K9UA 5DJCA 5D7IA 3GMPA 3LH2H 5HHNB 3U2SA 3WLBB 4DGYH 4I0KA 1Q9LA 4TNWF 1O7VA 5EBWB 5GGVY 3NCYP 4AM0A 1MFDH 1FSKC 3IJSA 1T4KB 4QXGH 4UT9H 5D72H 1NBZB 3PQYE 2VQUA 4G6MH 2WBJA 1VFBB 3PWPD 4J3OC 1QSZA 2P7TB 4PRHD 1FC2D 4KJWD 3SPVA 2W9DH 5HJ3A 4KKCD 3O3UN 4NQED 3C60B 1NMAL 3LIZH 1MJ7H 1I3UA 5TDOA 4HIHB 1DR9A 1FL3B 3MZGB 4F8TA 1W0WB 3VGBA 5ANMA 3MRQB 5GGQL 3EFDH 1PLGH 5FECB 3EJZC 4NSKB 1OP9A 3TIEB 1FIGL 5C0CD 2NW3B 4D94A 2QADC 1VPOL 2HG5A 4M00A 5DJAB 4LQFL 1CLCA 1ORQA 3CD4A 3TVMB 1MVUA 5HYSA 1F45A 3GB7B 4EIGB 1AC0A 2C1PB 2W91A 3D2UA 4L4JA 2MPAL 1X5LA 2KPNA 5HPMB 1BOGA 2GW5A 4HBCH 3QQ3A 3VXMB 3FFCE 2Y07H 2EIBA 3O4LA 4GRWF 1QFHA 1Q8MA 4R7DA 3DYPA 4JFYB 3UP1A 3GSWB 3VH8B 4XP4H 5EORL 5B4MD 3TYFA 4ODVH 4Z5RA 4PY7A 1WT5C 4N5ED 2HT3C 5DD1H 1B6UA 2O61B 5DA0B 5HGHA 4LDLB 5E5MA 2J88H 3VWJB 2Z35B 2DMKA 4HWBH 1G7QA 3WO4C 2LE9A 3G5VB 1NAML 1GGTA 2QSQA 4XCYA 3VFTA 4UV7L 1EHAA 1CE1H 4O58L 1G9ML 1QRKA 2FJHB 1KN4H 5HDBE 2F74A 3I50L 3O6LL 4Y1AD 3BH9A 1BZ9A 5A40E 5E4EB 3DX7B 5I74B 1D5IH 4P9HH 1DQQB 2KL6A 4N9GB 2A73B 2Y23A 5FUCE 4D8PA 3QAZC 4XGZB 1TDQA 2AV1B 2HT4C 1HZHH 3FB6B 1KG0B 3L3DB 1KLUB 5ICXA 4AH2B 1IGIH 3SDXF 5EOQL 3ZT7A 5FGCB 4MJ2A 1M6OB 4R2GD 4LNRB 2P42B 4PJ7F 5E2TH 1S7XB 3MLUH 4BZ2H 2ADFL 2CO7B 3FQWA 4NNXB 3EW3B 5F88A 5K9QG 4R97B 5HHMD 2ZUUA 2BVOB 4YH6A 5EBMA 3OKEA 4JPWL 1KGCE 4Q2ZA 4TULH 4QRSA 4OCLC 1HKLH 4AL8H 4PP1D 3GSNL 4K94C 4P2OD 3IXTA 4L9LB 3B5GA 4QEGA 2B5IC 3CMGA 5F71A 4I3RH 4GAYA 3EOYG 1ZSDB 1KEGL 5IFAH 3P11L 1KIPB 1U41A 1CU4L 3EOTL 1CGXA 2EDNA 4K7PY 2A9NH 2QBWA 1DSFL 2OXHA 1PQZB 5FKAB 3TBVA 1EFXA 3G6DL 4TVPH 3U7WH 5I73B 3N9GL 4TTDD 3FONB 4PRBB 4AMKL 1ZS8A 3VFRA 1CT8B 5DRXA 5E7FA 4NO0D 4HKZA 1ZT7B 3PGFL 5CZKA 3MRHB 4MAYA 3VE0B 2KZWA 1U93B 4DZ8A 3OG4B 4GKZB 2YKLL 3A0OA 3WDJA 5JDJA 2CR6A 4WO4D 1AD0A 1SMAA 2R2HB 1FFPA 3AB0C 4MJIE 4NCC1 4GW5A 1UWGH 2GTZB 5TDNA 2QTEA 3AAZA 1J8HE 2AJXL 2PNDA 1KPRB 4JFPB 1HQRA 1FQ9C 3BGMA 4XPAL 4QHNA 5BO1H 1OL0A 5LJYH 4OIAA 2R23A 5F89A 4MNGA 4L5FH 1IC7L 2NY3D 4OZFB 2UVFA 1WIUA 4ZFGH 1B9ZA 4GG8A 1J1XL 1N2RB 4MSWA 3V2AR 1MHEB 1CDUA 1FL5A 4CAGA 5EG6C 2L7JA 1WFNA 3VFPA 4NKDA 4GRMB 3UBXB 1BIIA 1J10A 4BFBD 2E9JA 3MV8E 3VXSE 2K7QA 4L4TD 5FYLH 2XWJA 3GDBA 3T0EB 2AJUL 4MNQE 1JGEB 3EO0A 1FYTD 3HUJA 3AU1A 3VRIA 5BW7A 1AFVH 1A2YB 4KUZL 1EA9C 4QRRD 3SDCA 4R90H 3BSZH 5KSVA 3V52L 3K2UL 4QGYA 3H7LA 2APVA 4F7CB 5J11B 3PL6D 2M26A 1T6VN 4L8DB 1WISA 3GI9L 3FFCD 1RFDL 4OLYL 2CD0A 1SJEA 2R1WB 3QEQA 4P2OC 4AENB 2H8PA 1REIA 3I75B 1LO3L 1NDGB 3F7YB 4GO6B 4NUGH 4PYGA 1GGUA 3QPXL 1IBGL 5CGTA 1HINL 2PXYD 2DJUA 3LVEA 3QWRA 5ABDE 1FVCA 4PJHB 1AI1L 4YFDB 1NBYB 1WCQA 3GFUA 4MA3B 3WNLA 3VFMB 2DQFB 3RZCB 4TTDC 5C07E 3CXHK 2OK0H 1BFOB 3MR9A 1UYWH 3RPIB 2P8LB 2X4QA 1T1ZB 2GJZA 4D3CL 3VI4E 1I9JL 1M7IB 4JM4L 2DIBA 4KMLB 4LQ1A 4YDVA 5D7LE 5IMKA 4ZUVA 3RL2B 4POZD 2VLRD 3O6ML 4XCFL 5IIEB 5C0DB 1P4BL 3QCVL 1F90H 5CIPA 3X13B 3C87A 4LSSH 5FA3A 5IEKA 2YPLE 1TPXC 5IW3A 5TE7L 4Q9BA 5TE6L 4UIMB 4NQDD 1ND0A 2W60B 3O2VH 4KC3B 3OKLB 2X05A 5IROA 3U79A 4P23C 2IAMA 4YE4H 5CMAB 3QO0A 5D6CA 5B8CB 2EH7L 5IKCA 2JB6A 4LVNC 4PJBA 5E6ID 3FRPA 3BP4B 3KGRA 3RI5F 3FN9A 4OGAC 3WXWH 1U58B 2XKNA 4HCRA 2XNAB 4Z7WB 2IPTH 5GRWA 3MRLA 2I9LA 5T3ZH 1HH6B 1Y6MR 4HFUL 2ICES 1T5XA 1MCOL 4R4BA 1BJMA 3H3PH 3AXLA 1S9KC 4XBGB 4LPVA 3UTSE 1E6JL 1IGYA 1UB5A 3HZYB 1SQ2N 1P6AB 1BLNB 3O3EB 4K8RH 4JRYB 3N1QC 1XF3A 1T1WB 3HE7D 3GO1L 4JFFE 2PN5A 4TSBL 1JN6B 4Y4FA 4M48L 1QRNE 5C08D 2QJDA 1TQCB 1KF9B 4NC2B 2WSKA 1G7MA 1TTFA 5GJTL 2V7HA 3L7FA 1U3HD 3P77A 4HUMB 3RNKB 3MRKA 3KPOB 1NUNB 4CUCA 3FB7B 1XGYL 1LDSA 1OGAE 3MO1A 4HQQL 1QSFD 1UCBH 4JY4A 2EE2A 4GBXB 4LCUA 4ZAKD 5MI0B 4E42B 3HPLA 3EYQD 4JHZA 5J9PA 1GGCL 1SY6L 5KN5B 4LLUB 4LCWD 5DD3H 1NAKH 1S8DA 1KJVB 4Y7MA 1MCCA 3DRQB 3KPRA 3E6HA 4K23H 3SE9H 1WEJL 2JJVA 4QRUB 1HYSC 5JW5B 3OTTA 4LHUD 1YC7A 1BZ7B 1HHKB 5EZIL 2FECL 4NWTH 3I6GA 1SEBA 3LQMA 3T1WA 5AUMA 5IG7A 4G8EB 1IL1A 1M4KA 4YHPA 2A2QT 4AEHL 1DBKL 2ZOKA 4YAQB 5TFSL 5C86A 1LEIA 4N0CC 2XG4A 4HV8A 3HCVA 4POZC 1U91B 4FFYL 4ZQKA 1YNKH 2XICA 1PGRB 3CMOL 3P4OA 5JZ7D 1QSEB 1G0DA 4Q9RL 1RUMH 5DEFB 1IC4H 1FNLA 2IWGA 5AAMA 3T2NH 1MHCB 2IEPA 1EEYB 4P48A 3QXTA 4NQCD 5L6YL 4YIQB 4MNQD 1MRFL 1YJDC 3V6ZB 3NH7H 3OR6A 7CGTA 4QYOB 4CDGC 5A2IH 2XWTA 43C9A 1TIUA 1JNLH 3IKKA 2AQ1A 1T0NB 3WS3A 1TETL 3CVHA 5EZJB 3ILQC 2BMKB 3JTSA 1E27A 4I18B 4DOHB 4M6AA 2DD8H 2ORBL 2JCCF 2LAGB 4MD0B 4ODTL 1M05B 4D9LH 4XWGH 3QDGA 4HK0A 3ROOA 3K8MA 5I15H 5DS8B 2OL3L 3TJEH 4Y0GA 3MV9B 2EYSA 3MV7E 3IJYA 2HKFH 4GW1A 3PNWA 2EYTA 2X1OA 3L5XH 4Z77A 3NOIA 4M7LH 1NBVH 1NC2A 3MUZ1 4JHAL 4WUUE 1JZ2A 4KQ4H 4YUEH 1K2DA 3W5NA 4XMPH 1TZIB 5D1XA 1DBAL 4U1NB 2KQMA 3O6KH 1WBYA 4NZTL 2Y36H 4ZO8A 4WI6A 3VXUB 1KIQA 5C6PB 3Q5YA 4KHTL 4OFYD 3W0WA 5ESQA 1HYRC 4XCEB 5HHPB 4H26A 3R8BB 1KTRL 3CSYB 5ADPL 3DUSB 3WN5A 1UKQA 3NFNA 1GC1H 1X6NA 2XTLA 1TVBA 2AEIT 1WAAE 4HC1L 5IB4B 2BNUA 1ZWIA 2YD6A 4RQQB 5LVEA 4LLAA 4JG0L 2YC1A 4HPOH 2ZG3A 3RVUC 1IC5H 4UAOC 4TSAL 4P59L 4ZMAT 1RU9H 5C09D 1I7RB 2W1NA 3T3MF 3OAUH 1BAFH 5DHXB 5IMLB 5KW9L 3BVNA 3MGTA 2ICWI 3WFBH 3L3GB 1BD2A 2IBZX 3WJJA 2ED7A 4YHOH 2HJLB 4OIBA 4OLZL 4L3EB 1IAIM 3EDEA 5EU6A 5JOFB 5KSBB 4MXQC 3CCHB 2AV7A 5DMYA 4KI5D 5E94A 5GRZA 2HA1A 2ICEA 5F7DB 3ZYZA 2RFXA 1QA9A 3KYOA 2JKXA 3EOBA 1F58L 3M1BB 4JDTH 4CVUA 5DTFA 5F7NC 1MELA 2VIRA 5F21B 4NPYA 3U7AA 3GJFK 4TUOB 3QEHB 5J0BA 3FOMB 2X41A 1J7VR 1F8TL 4XNZB 5DRWA 1TITA 1ZEAH 3IDJB 1EGJL 3T4AA 4JVUA 1ZLSL 5CGYD 5CP7A 3TT1L 1IEBB 5I1LA 3LZFL 4X4ME 3P9MA 3LSOA 4MMXC 5INCB 3O11B 3OHXB 3LN5A 3RBSA 5D5MA 1FORH 4X5XB 3DMMD 1U8LB 1YECL 1FNSH 1VFAB 5IBLD 2EEAA 25C8L 1AXTL 5CWSB 1NJ9B 3GRWA 4IS6A 2O5XL 1U8OA 5DFVD 1RHFA 1YA5A 4YDIL 2PTTA 3WKML 1RZIB 3D87B 3GHBL 3NA4A 1DEEB 4WU5A 2O5YH 3NFSH 1DUYB 1XEDA 2DQTL 4NOFA 3RWCA 1RIVH 2MHAB 4G8GB 2CXGA 4M4PA 3GJFB 3HKFA 3UYRH 4MA8H 1XT5A 4E0RA 3QUZB 3TYGL 5D93B 2PO6A 1UWEL 4NNYA 1U8MA 3QDME 4MZ3A 3JWOH 2VH5L 3FB5A 4EI5B 3MOBH 1YEIL 1QLFA 5E8DL 1HQ4A 4QHKI 1OB1B 3ES6B 5EO9A 2R8SL 4WIQA 3K4ZA 4JCMA 5D7SH 4P2RD 4ONFL 2VLMD 3CC5B 5E8EA 2X7LA 3QIBA 5DFWH 4EDXA 1CICB 3DVGA 4DVRL 2ZJSL 4QHLB 2NXYD 2OP4H 4MAYC 3NIFF 2DB8A 3EYVB 3OJ2C 4GRWB 1JHLH 4KRPB 2FH6A 3SDAD 1Z0MA 1DUZB 4PD4K 4XMLH 3LV3A 4FMFA 4JG1H 1UJ3A 4LP4A 5T1LD 4LP5A 2ADGB 1PSKL 1OAXH 3QH3B 5TQ0H 3ZTNH 4LSRH 5IVOA 1CFQA 4H0HB 3RWDB 1FZMB 4WU7B 2A74B 4KI5C 3VFUA 1FFNA 1EEZB 4PJGB 3L3JB 2H26B 5C6TH 1P1ZB 2ICWJ 2Z8RA 4HUNB 4XWOD 3JUYA 2AK1H 3I3BA 1RQ5A 4NRZB 3TJHC 3U7YH 3GSRA 2E6PA 4WV1A 3S96A 5F96L 2ADIB 3H42L 1GYAA 1R5WB 3BKCH 5DR5L 2HTLD 3GMNB 4HXBH 4XC3L 4YHZH 5DHYB 5J13C 4Z9KB 2F54B 1CXHA 5ID0A 2R9HD 4HUVA 4AZ8A 3E6FB 2HRPH 3NGBB 2NY2C 4PJCE 3OKMB 4Z78B 3QIUB 4OZFH 5DD0H 3S36L 1XR9B 1EAPA 2A9ML 3SDCC 5D2NA 4Y19E 2RCSL 3S4SA 5DA4A 5E5RB 5GGVH 5GJSH 4YDLB 1XH3A 3KXFE 2D0GA 5LGJB 1IAKA 3ZYIA 3WFZA 2A6IA 2VAAB 2X89D 1EDQA 2F5BH 4IHOA 3SCMB 1EVTC 3AREA 2WIMA 1URLA 1LP9F 2NTFA 1M7DA 1AHWB 1WTLA 4HIEB 5DD5L 3IDYB 1OAQH 1FAIH 4WNQB 3IFLH 1JPFB 1QP1A 2VDRH 3SDXE 5C0EB 3RDTB 1YEDB 4JFED 5FO8B 5MEOA 1CL7I 3DX9B 1F4WL 5KBNC 1JV5A 2VXQL 4PJ7E 1N6UA 5JW3L 1Z3GL 4BQ9A 3QXWA 1J0IA 1HXYA 1CR9L 1I75A 1N5AA 1NCBL 1YPZA 4DGVH 1MQKL 5DJXB 2WP3O 3RWIA 2Z8SA 2MCPL 4QOKE 3DXAB 5TH2A 4X83A 4K7FB 3BP5B 2UZIH 1I7UB 4PRHA 5DD6B 2D31A 2XRAH 3KPSA 1XGUB 4JFDA 4NQEA 1CGSL 2NXYC 15C8L 1ACZA 1EFQA 1JRHH 1G7HA 4QHKJ 3EDFA 4QT5B 1A02N 4PJEF 3VW3L 1H5BA 4OLUL 3HC3L 3VA6A 5C0CA 4I2XA 3L3HA 4MJ6B 3BN9D 2ADJA 2HMIC 2VOTA 1MAMH 3FHQA 5IROC 5CJOL 1JUFB 3WEXB 2IAMC 1EHNA 4FFVC 3N1MC 3D5OF 3WHXB 4XWOC 4X6DB 4XPFL 3R1GH 5DJYB 3S37L 3JV6A 5KVEL 1KB9K 2DTML 4L29A 4OM1L 5ALCH 1CVSC 4ZXBD 3SJVB 2BVPB 4OZIA 1F3JA 1NQBA 2VXTH 2YN3A 1QEWA 1VEMA 1BIHA 4U6XA 2XQYG 4FG6C 1LNUA 3QXVA 1YMME 4JFZH 3DVIA 2BNQD 3ISWA 3OAZK 4G9FB 4NHCL 5BXFA 4IBLT 1TVHA 1I8IB 1GZQB 1RIHL 4JFQA 1JTOA 3O3DB 1CQYA 4E41B 3THML 5KSAA 3ULUC 4Z7QF 4XVSL 1NAMA 3VI3E 3LH2L 4XP5H 3T8XA 2CLRA 1WWAX 2R39A 3IDMB 3I02A 4MDJB 8FABB 5KVMC 2YEZB 1K85A 5F7WC 2BDNH 3PV7A 3QWQB 4ELME 4PB0L 4X6BB 5A2LH 4QXGL 4M8QB 2Z92B 3M17B 3E2HB 5D72L 4YHNA 4G6ML 1F4AA 3AFLA 3C08L 3BHBA 4OLVL 3CDGB 2OTUA 3HC0A 3MRPB 3C6LB 1KIUA 3E8UH 2Z8VC 1MFEL 5AG9A 1KYOJ 4YBLC 2IH3B 5L8JB 4XT1C 2CMRH 5E2JA 1E28A 1LHZA 3LIZL 3C5ZB 1LO2L 2VTFA 2C4XA 1PLGL 4PV9A 3HS0A 1F97A 2WLZA 3BUYB 2VUYA 3DSNA 4FQIH 2NY0D 1UWXK 3L5JA 4CJ0A 1CTNA 4JZOA 1OAUH 5ICYB 1BVLA 1VCAA 4PLKD 1QPPA 2Q7YA 5K9JL 2EH8L 1DLHA 4PLJD 5E1AB 4Q0XL 4H1LG 3GSNA 4Y16A 3FKUS 2FATH 2IANB 3IXAB 2W9EH 5EC2A 4OI7A 5I1KH 2GJ6B 2VWEC 3C6SA 3MNVA 2YPVH 1MJUH 3SGEI 5IEHB 3O8XB 1X5KA 1DDHB 1H0DA 1EUTA 4R8WH 1RZ7L 3BESR 1AGEA 1KPUA 5E00B 4XP4L 4P5MA 5C3LD 4ODVL 4LAQL 1D5XA 4IJ3B 4QRTB 5DD1L 5GSRB 4Y19D 2J88L 4R4ND 4HS3A 4GS7C 1QBLL