1JPFB

Crystal structure of the lcmv peptidic epitope gp276 in complex with the murine class i mhc molecule h-2db
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, D-B ALPHA CHAIN
publication title Zooming in on the hydrophobic ridge of H-2D(b): implications for the conformational variability of bound peptides.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 15
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2001-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jpfB00
1TQBB 2CLZA 2JJSC 1F58H 4K55A 4U1IA 4IMKC 1QEWB 2P8LA 3TIEA 5F1NB 4KGLA 1JGVH 2GY7B 3NFNA 3SKNA 3RWIB 4YAQA 3G5VB 2YRZA 3G6DL 1DDHA 3N9GL 5HHMD 3MBEA 5IBUB 4N9GA 2EH8L 1XR9A 4JCMA 4NT6B 2CK2A 4IOIA 4KY1H 4YUEH 3ARGC 4CBPA 1G1CA 4NQSB 4YWGL 1DVFC 4OGXH 5ACLA 2WBJD 4D0BA 2CO6B 4DK3A 3CZFB 4KI5F 5F7UA 4YE4H 3FFDB 4R26H 2HN7B 3GHBL 3SGJC 2QLVB 3SDYL 3N1GC 3BZ4B 4TSAL 1ZT4B 3EO1B 3VCLB 1HWGB 4EEEA 2YA1A 4JFHE 2VMFA 3MTRA 1FYTD 3W5NA 1RZ7L 4F2MA 1P7QB 2D31A 1FIGL 1WITA 1U42A 2IPKA 3LSOA 4K8RD 4ZS7H 5DMKB 5EU4B 2F54A 5JIPA 1AXIB 3CSPA 2YHGA 3K81A 1A7OL 1XF5A 1B4JL 1NBZB 3PDGA 5LWYL 1D5MA 1JCKA 4H8WL 5ECJE 3BO8B 5EPMB 2LFGA 2E7MA 4KKAD 4LSDA 5ALBL 5ID0A 4J8RA 1SY6A 4D0CB 4P2OC 2VR5A 3U36B 5C3LD 4NZRH 5F8QC 5HGBB 5HI4D 3HE6B 4R97C 5IWLA 4YC2B 3EFFB 1YEIL 5HSFA 1IM9B 4KJYB 2VLJB 4HWNA 3MV9B 4UIMA 1INQA 4NHCL 3LEXA 1J1OH 5FA4B 2WQ8A 5T3XL 4N5UA 1C5DA 1YEEL 1CE6A 2GTWB 3CMOL 4Z7WE 4H1LH 4M48L 3QEQE 2WK2A 3O8XB 3O4LA 2XQBH 3CX5K 2IWGA 1ED3A 3H3PH 1BQUA 1KXVC 5KW9L 1BVZA 2PTUA 2Y07L 1SYSB 2HVJB 5I17A 3TBVB 4M8QA 4N5ED 3P0YH 4JFFA 4PJDE 3SOBL 3S97C 3BW9A 4ZNEE 3LPFA 2DTMH 5CP7A 4M6ML 1BM3H 1OF2B 1QRNB 3ECBA 3MJ9H 3GSRA 1I75A 4G80B 2J88H 3CPLB 5EU7E 4WGVB 1JNHA 1L9MA 2XACC 2G75B 3TN0C 1MQKL 4CUCA 2X4PB 5LKNA 4LQ1A 3FL7A 1JF6A 3C6LD 2QV2A 5C07D 4CKVX 3SPVA 1IE5A 1IKFL 1FE8L 4NWTH 5I18L 5I74C 1FVCB 1JWUB 4YDIH 3BEWA 1H0DA 2R0KH 3S37X 1T4KB 5FOJA 4YXKH 3IDYC 4YDLB 2H45A 1R5WB 1RZFH 4XMPH 3RKDD 4RQQB 3BIKA 1JPTH 1FO0H 2PYEE 1OAUL 4WNQA 2BK8A 1EUUA 4KROD 4C4KO 5BMFL 4C56A 5FF6B 3MRIA 3FB8A 2P4AB 4MDIA 1YEJH 1R5IB 4HJJL 1I8LC 5D7JC 3VFNB 1C16A 2XZQH 2J6EA 2O5YH 4YDVB 5DR5L 4G8FA 1JUFB 3FB5B 4JO2H 3N1PC 4HG4J 1M71B 1QSFE 3STZB 3OXSB 2DL2A 3BXNB 2HMID 4LLWA 3MFFB 3QFJA 3IB4A 5E56A 2AJYH 1JV5B 3NIDF 3MXVH 4FHBD 4HWEH 1CL7H 1RK1A 4JHWL 1KJMB 4LEOA 4PYGA 3D25B 4QRQA 1VKXA 3FO2B 4HV8A 1CFNA 1N5AB 5J9PB 3GSUA 5D6CA 3DV4B 4OLYH 1INEL 2UVFA 1UADC 3TH4T 2GJZB 3VGBA 5IV2A 3LV3A 1UGNA 2G5BA 2BC4A 1DANT 3MRGB 3VFUB 1N6QH 1V7MH 3V0VB 1I3RB 2ICES 1AFVH 3CUPA 4XH2A 2W9DH 3JBG7 3QRGH 4HEME 4K2UH 2YPLE 1FYHB 4GBXD 3MRDB 3VXPB 2LVEA 3FZUD 4LP4A 4IRJC 4WI8A 3IDNB 2DLIA 1JGLH 1FNLA 4MD5A 5DRXA 4GOSA 4DK6A 5JOPE 4YBLC 1AP2B 1OP5H 3TFKC 1F90H 5MERB 5DJCA 5EBLB 4POYA 1RZGB 1HNGA 4LCWA 3KYOA 3MBEC 3TO4D 1AGFB 1NGPL 3DXAE 5E2WL 2OQJA 1BFSA 2YD2A 1LK3H 4FFZH 4ELMB 1QSEB 1P9MC 2Y25A 4R90H 4F57H 3WNLA 1DN0A 3QEHB 3P9LA 5HYSA 4NRZB 4BSVB 4X83A 4FG6C 2BZDA 1JN6B 1TNMA 1A1NB 2ZPKL 5D1QC 3RFZC 3MJ8B 3ELAT 2QKIA 2XWBA 3MXWH 3W11D 4O9HL 3MLYH 5GSRB 3D3VE 1XCTA 4R6UA 3QEQD 1KV3A 4U33A 1KJVB 1IGCH 4QF1B 4JDTL 2E7BA 2R2HB 3AS0A 3PHOA 1YN7A 2ZOLB 4YHLL 2NXYC 2NY3D 5JOFB 3HB3C 3WUZA 2ED7A 4MGXA 32C2B 1RFDL 5JMOC 1R0AL 5FDYA 4KQ4L 2J6EH 4U6VL 2H2SD 3K8MA 4XHQA 3TH2T 3SQOL 4UU9B 4F7TB 5DWUH 2BNQE 3KR3L 4HIIB 4NRYA 4X4ME 1G7LB 5HDBF 2BVOA 3MA9L 5IWLC 3UC0L 1DLHA 5KSBE 4PGBA 1IAII 4K7PL 4G9FB 3PIQB 4HK3J 2AEQH 4OCXH 4K3GA 5T1KB 5H2BB 4PRHE 1BQLL 5DI8B 5DD1H 1AKJA 1BOGA 3V6ZB 3RVVC 3T0EE 4FFVC 5AUMA 5T3ZL 1CXFA 1JGUL 3HZMA 3NN8A 4F9LA 2XG5A 3HMWH 3JZ7A 1X5FA 4Y5XA 1DTUA 4DFHA 3ESUF 1ZHKB 4GKZB 3OV6A 4ODHL 5E99L 5L7XL 1NGYA 4HK0B 2KQNA 1PZUB 2GCYA 1LDPH 1MH5A 5J3HD 1P69B 4OFYA 3W81A 1IC1A 4BK5A 3P73A 4ZSOE 5HGHA 2JB5L 2N56A 2AXJA 1F11B 2UYLB 4DW2H 3NMEA 2X4SB 3MREA 4R2GC 3MLVL 4OF8A 3JWNC 3BGAA 4JZNB 1QSFD 3UPAA 1RUAL 5J1AB 1N3NA 2IBGA 3QEGL 4P2QB 3U9UA 5DHXB 2G2RB 1GGUA 1IBGH 4A2MA 1CLYH 4HPOH 2HJKB 2YMXL 5FYKL 1A02N 5D1ZB 5DD6B 4FP8L 1X5JA 1ZA6A 4I3GA 4Q6IA 1NLBL 3WSQH 3QUKA 4F3FA 1J1XH 4PBWD 4RZCB 1DBKL 1B0RB 2X1OA 1U8OB 2Z8RA 1Q0XH 1GOHA 3GJEA 2B0SL 2DQDL 3DYOA 2QQKL 1H8OA 1YEFH 2IPTL 3EOBA 3ILPA 1TVDA 3BT2L 4QRRB 4Z7UB 1T89A 4W4OC 1T7VA 2YPLD 3V5KA 1BZQK 3V6OE 5GGSY 4HIHA 3S96A 1I7RA 3NPSC 4NOBA 5C09A 2Q20A 5F88A 5JOPD 3DMMB 1FVEB 3QUXB 1BFOA 4X5XB 1T1XA 4OCLC 2IAMA 4MD4A 5E94A 2CJUH 4OZFG 3F7VB 3TNMB 5I71B 5E4EB 2OTPA 5DS8A 3DXAD 2JJWA 1I8KB 1Q9OB 1YY9D 4HZLA 4JKKA 2Z91A 1XH3A 4KMLB 4I8DA 4EDXB 5J0BA 3UZEA 3VFRB 4BQBA 1AO7B 5HGDA 5EOQL 1MRCH 2PCPA 5IW1B 2VKWA 3HAEB 3GSVB 2NR6C 4ZPVB 2VABB 4HPYL 3EO0B 3ZDXE 5C6TL 3KLAB 4ODVL 5T3XD 1P7QD 2ZUQB 1X5YA 5IR1B 3FOMA 5TE4L 3QZWG 4WUKL 3BP7A 4ZFFA 3C8KB 5GGVH 5EZJA 4JGUA 4HHAB 1NCAH 4KK5C 1T80A 2HT4C 3LOWA 2P24B 3MACL 1IEAB 3V9FA 4MJ5B 4DVRL 4DFIA 4G7YL 3BKYL 5FGSA 4XP5L 3H8NA 3VXME 3O3BA 3VFOB 5JZ7D 3MNVB 2BNQD 3BQUD 3IGAB 5FCUH 5DC4B 4TPRH 5JHDB 1M05B 2HLAA 1A7NH 1K4DA 3NABL 1BJ8A 2AJSH 2YA0A 2MJWA 4BQ6A 1R3KB 5DQJB 3EGSB 3OKMA 5AZEH 1KELH 3K1DA 4PTTB 4TTGA 2Q7NA 3HC3L 1CFSA 5SV4A 2OXHA 1HSAB 4PRHD 5DK0B 1YEGL 4LSPL 4UAOB 2A73A 3WCYA 1CLZL 4ZUTA 4ETQB 3OQ3B 1PKOA 3DVGA 2A83B 4MJIE 4PY7B 4JAMA 5SX5H 2DWDA 1QFUH 4X5WB 1M4KA 4AY0A 5ESVB 2VDLH 3WFBH 4OZGE 4F58L 4DUVA 3HNSL 3FQWA 1EAPA 2LU3A 5IB1B 4QHUB 2XKSA 1SBSL 4UB0L 2J4WL 3RPKA 5FO7B 5D7IE 5F7EH 2YXFA 1CZ8H 1E28A 5DXWA 3V5DB 4XMLL 3TV3H 1S9YA 4PRNB 4U6HA 5E5MB 2VE6A 1RUML 1I8MA 3ES6A 4KWUA 1RMFH 3SDXE 3L7FB 4FABL 1DBBL 1R3JB 4MS8D 2YUZA 1C1EH 3QUYD 3VGAB 2I26N 2PTTB 1CXHA 3H2WA 4G43A 1DLFH 1ZEAH 3Q3GB 5D2LE 1B6UA 1AE6L 3JWDL 4OFPA 2YPVH 3MGOA 4WTZG 4KTEH 2OSLA 4TYUA 1QUNA 3MGAA 4EIGB 4EN3B 4OAWA 1DANU 1YY8B 1YYMH 2OXGA 4JG1H 4JM2F 3VWKA 1T0MB 3WFEL 1LEIB 2FGWL 1ZLSH 3G04B 5BQ7A 2N1KA 1FVDA 3AC0A 5D71L 4RAUB 4Y5XC 5IB2A 5HHOB 4H25B 4GKOA 5GGQH 4QYOA 4EIZC 5KSUB 2HFFB 3SO3C 3GNMH 1Q72L 4NM4L 1LK2B 5SWZE 1FG2B 2JCCE 5KTEL 4NZTH 3QDGE 1CDYA 2BOBB 2AK1L 3VFTB 2WLZA 4ZTPH 4DN3H 3LPWA 3BRDA 3F7YA 2DMCA 3HPJB 3DYPA 1TZHB 5FDWB 5IHUL 4MAUH 2P5EB 5CJOL 4YIQB 4RWYL 3ZKNC 4LPCA 2V17L 4JN2B 5CMAA 5K9KB 3AAZA 4KXZH 5KVDL 1FL5B 5DQ9A 1KTRL 3LD8C 4LLQB 1CT8B 1QNZH 3T3MF 3O9WD 1AGCA 1B2WL 3GMNA 2A6JA 2MQ3A 4CADA 2XTJB 2GSIB 5CSZA 4I3RH 2D03L 5CHNB 2WANA 1A21A 5F7LB 5A2JH 5BS0B 5GIRB 3IU3B 5ACZA 3MLWL 3T0BA 1C08A 2EC9T 4UT9H 5GRXG 4XC3L 1A3RH 1IAOA 2A1WH 3VXNB 4TTDC 4M62L 3JTSA 2JJVA 4GRWF 1T89C 2Y7QB 3FT2A 4OZIE 1PKQB 3CFBA 3L3JB 2AV1B 4NP4L 5HVGB 4APQA 1KSRA 5KN5B 1ACYL 1YMMA 1I1AB 1JHKL 2OI9B 4J3VA 3RJQB 3GMLA 5ILTL 4X7EC 3VXMD 2HRPH 4KJPC 4OIIL 3TBTB 2X9YA 4GMTL 2CUHA 4WUUE 2NY0C 3M1BB 4NJ9H 3VI4F 1IGIL 1OAZH 1QSED 4JM4H 4EI5B 4Y0GA 4JDVA 3FN9A 1ZLVH 3D0VA 5HYEA 3LRGA 2WIIB 5F9DC 4RFOL 5TFSH 5GGTL 1S9VA 1QQDB 3RL1B 4U3HA 4XBEL 3MRPA 1I7UA 4U0RC 1J0HA 4IRZL 3TVMA 1JZ6A 3UX9B 1F13A 3NAAL 1RZKH 3K8KA 4JPKL 1WVZA 1A7QL 1DUYA 1J9CT 1KCVL 3PDOB 4PJFB 4XCYA 4MJID 3UO1H 5T3ZD 1A6VL 4EDWL 4U1NA 1XEDA 4FMKA 2O5XH 1IC5H 4KJWD 4MCYA 4NDMA 3C9NA 1JHLL 5F7MC 5ISZE 2VH5H 2X9XA 5ERWA 2K7QA 1TXKA 2I07B 1BAFH 3ZTJH 2IQ9H 3DX7B 2HT2D 1FNSL 4ZAKB 5D5MF 5ANMA 3QG7L 3KHQA 2P8PB 5LGHH 5GISH 4XPGH 3K2UH 3SCMA 5IM7A 5EWIH 3STLA 1ADQA 3TIDA 4UV7L 4OSUL 1QKZH 4OLUH 2V5MA 1S8DB 2XN9B 3W9EB 4BH8A 4XP1H 5EU5B 4K7PY 3RBGA 3T4AA 4OLWH 5E08L 1KEGH 3IRZA 1Q1JL 1N64L 4A2LA 1IC7H 2HAZA 4LVOC 2NNAB 3IFNH 4LCCB 3MRKA 3QDMA 1JJUA 1MFAL 4YHZL 3QIWD 1KB9J 3O2DA 2ZSWA 4ZXBD 5B4MD 2H6PB 5ALCL 4AEHH 4XPFH 1MFDH 3DJ9A 1P4BH 1PX3A 2EE3A 4EXPX 25C8L 3WS3A 2B5IB 4FXKA 1QYGL 5SWZD 5L2KA 3RY6A 1G6VK 3L3GB 4GRLC 2DIJA 5AAWA 3P9WB 3LKRA 1HYSC 4C57C 1WFNA 3QDGD 3GBNH 4NRXA 1WBYA 2RQ8A 1FORH 5HYIA 4M7KL 1QOKA 2CDFB 2GT9A 4L1DA 4X6DB 4YHYC 3RWEA 1FC2D 4AT6A 5ICXB 1KLUA 2DBLH 4I4WA 2ADGB 3OAZH 4GLRH 2UWEB 3QT2A 3PQYB 3BVNA 3UTSE 2KDGA 4Q97A 4GAJH 1M6OB 3Q6GH 4K7FA 8FABA 1UKSA 5GHWL 3HMXH 5L9DL 2D4DA 5HHXL 2HTKC 4F8QA 2ZG3A 3VWKC 5DUMH 1UCBL 1MQ8A 3IXAA 5CD5C 3M8OH 3SGEH 3P77B 1MAMH 1RZKC 4U1GC 1MFEL 3IU4H 4Y2DB 5JXAH 4G6FD 4MNQB 1CU4H 4FQLL 1JWMA 2Z92A 3E8UL 5BRZA 4HS8L 3G08A 3PWNB 4XNZC 4G5ZL 4UILH 5KSAD 5CBEA 5DJYB 2VZVA 3DMMD 1RPQA 1PGRB 3QWQB 2VR9A 3LN5A 4H5SB 1UWGL 2D0FA 5C0CA 4LHUA 4JQIH 1N4XL 3WDJA 5KVGH 3TT3H 4HBCH 2X7LB 4WUUD 1DP0A 4PS4L 4DGIL 4H26B 1E4XI 2V6HA 1KNOB 1PZ5A 4FRWA 1MAJA 1E0OB 4F9PA 1OW0A 2OBGA 2W91A 1PQZA 1A64A 2XKUA 1WBXA 4L4TE 2X40A 5GRUH 2VDML 3GSQB 4I48B 4JFEA 5HYJA 4E5XB 3O2DH 3L7EB 1G7IA 5J12B 2DLGA 2EDOA 3MRLA 4WIQA 4YJZL 4N0YL 3IJYB 3IETA 4MAYA 5I8CA 4ZOAA 1XGPA 3O45A 1JHTA 2NMSA 4KZDH 5GS0H 5EZLA 3IRPX 2EDLA 3MRHB 4GH7B 2XKNB 1PD6A 5I8KL 4RFNC 5DD0L 4APQC 1E6OL 1EH9A 3MLUH 4HS3B 2C1PA 2VZSA 3GBMH 1NAKH 1MCRA 3O0RH 5FKPB 3WIIH 1DUZA 4NUGH 1SJVA 4JDZA 4WI9A 3T8XA 5IVNA 1OSZB 2W92A 5TPWL 3S7GA 3BHBB 2B20A 5E6YA 3GRWA 2AV7B 4BELD 3FHAA 1ETZA 4YFEA 3I3BA 3RWGA 3S4SB 2C3WA 3IXTB 3LZFL 3RRQA 3O3AA 5C8JB 4L3EE 2ATPB 4JFYB 4OM1L 1EGJA 5FHBH 4NKDB 4FXGB 4RNRB 1X44A 2O26U 4X4XB 5IG7A 4PR5B 2FECI 4BQ9A 1AGBA 1N6VA 4XPHL 4ODBD 3MX0A 1YPZB 4RGNE 3U0WH 1UKQA 2BOCA 2VN7A 3I6LD 3QQ4B 3S37L 4WTWA 3V4PL 4PJHF 4U3CA 4PGDB 4WWKB 3VMOA 4ENEC 5EFIB 2BSSA 1T21A 3D1MC 4P59H 5LAXB 3BEVB 4WW2C 4PUBL 4GUPB 4GO6B 1MCPL 2VAAA 3CVHA 2XNAA 2NYYC 4L9DA 3SCMC 2ICCA 3HI1A 2IQAA 1DL7H 1X4YA 5AYQA 3UTSD 3GSNH 2CDGA 4PGEB 4UINL 2ORBL 1VENA 2ZOKA 4PJEA 5C0BE 4XI5D 3AREB 4I0KA 4KK8C 2G9HA 4ODWB 4URTB 2CLVB 3T0XA 1HHJA 2EDQA 4N8CH 3L5XH 1JK8A 5DJ6B 2EC9U 1R3LA 1GIGL 2NX5B 1IAIL 3L3DA 4CVZB 1FBIL 5I1AA 5IQ7L 2X4OA 3GSOA 5HHOD 2E9WA 3KPLB 2BVPB 3T65B 1NFIA 2EXYD 6FABL 3CK0H 1JPFA 3IJHB 5IB3A 3QNZA 1HH6B 4K71C 5GS0C 4HK3N 5DVNA 2Q8AH 2D7NA 3B8YA 1U93B 5DFVD 5IJKA 3Q2CA 1XGYH 3TP4A 3HZKA 1I1FA 2PW2B 1G9MH 5DLML 1XF3A 2AERT 1FL3B 1JGEB 4LQFL 4OQTL 4MXVF 4OZFB 3GRWH 4L5FL 3U0TA 1J7VR 3MRQA 3QQ3A 4ZUSB 5J6HA 5MI0C 5J13B 3BP6A 5GPRA 4OGZA 2PXYB 5L2JA 1QLEL 4PV9A 3NPZB 1JZ3A 4HC1L 5KANG 3TZVA 2XTJD 1OAKH 1EGJH 1LEKA 4B7IA 4WJ5A 2ESVE 4KFZC 2IJ0C 4LLYA 5C08A 2N7BA 2OS7A 2VXSL 1MEXL 1EHXA 2YBRA 1FYTA 2EDEA 2KH2B 4CMMA 2RHEA 2VO5A 3RIFK 4PJIE 2VDPH 1ZSDA 2JE8A 2FL5B 3OB0H 1U92A 4LAQH 1YNLL 3DIFA 3CLEL 2Y36H 1ZGLP 4KC3B 4N1EA 5MENA 1MCBA 2Q6WA 3FONA 1TZGL 4JB9H 3NFSH 3BN9C 3JVGA 1E27B 3CVHH 2Z31A 5T5NF 2Y1VA 2HH0H 5SV3A 2P5WE 4Y8DC 4WU7B 3QR2A 3IDXL 1OGAB 1TENA 3RZCD 3LQAL 4PRAB 4PJXB 1EK3A 1BLNB 1RIHH 5I16B 4L3ED 5BO1H 2PO6B 4XZUB 4HDIA 4HKXB 3BH8B 4JPIB 4ZFOB 2IBZY 1NUDA 1IKNA 3BD3A 5CKGA 4QXUL 3FT3A 4R4BA 5I1KH 3DV6B 3V4VL 3FFCA 3VRJA 4ZPTB 3CLFL 2YEZA 5ABDE 3CDCA 1J88A 4N0RA 4OLVH 1IEHA 1OAYH 4N90E 3VJ6B 5HD8D 4PGZA 3NIGF 4HQQH 4ZAKD 5INCA 3TJHD 1TDQA 4GMSL 5I6XB 2DYPD 5M94B 2XA3A 5BJTB 4U7KA 5AWNL 1KPUA 1TVHB 4WI4A 3K4DA 4F37K 1A0QH 4M5ZH 3FN0H 5C07A 3C6LA 3QUMA 4ZFOL 5IROA 3LEYL 1K6QH 5FK9A 3RKPA 3WIHL 4DKFH 2WINB 3ARDD 1WBZB 2QQLL 2ILLA 5HHNB 1EHLL 4WFEE 4LLMB 3RBSA 4KMQA 3BP5B 5TDOA 4LU5H 1F2XK 4P46D 1XFPA 4F80A 2DQHH 1LO2L 3OL2A 5FYKU 3U0PB 2BP3A 4H0GA 1RUPL 3OPZL 4LRIC 4PJBB 5DHYB 3STBA 3RP1A 3OJDB 3WXWL 1UYWL 3ZYOA 5FV1L 3T77B 2E6JA 4OKVA 3BI9X 2Y06H 9CGTA 1KTDA 4NQCE 3RA7L 2AJVL 2B1AH 4OV5B 3MRNA 2MTPA 3LKQB 4AL8L 1CICC 2X4TB 1YNKH 4NHUA 3VMNA 3S6CA 1WFOA 4YBHA 4ZDHB 3VDCA 3NIFF 4M1CC 3O3DB 3SDAB 4P23A 2UY7A 3ALXA 2NY6D 3B2VL 4G9DB 4Y4FB 2ZUVA 5KS9F 5A40E 1A9BB 2YD4A 4XNQA 4UOW1 4Z0XB 3V8OA 3ZKMD 2GI7A 4QXGL 3X3GL 2P8MB 2GFBA 5B8CB 2ESVD 2WUCH 3CXHJ 3RX7A 2YD9A 3T0EB 2IADA 4Q9CA 3WFCL 3B4NA 4U6XB 3AU1A 1HN1A 1TVBA 3ZHKA 1D6EB 4DTGL 3QB7C 3RX8A 3V6FA 1HQ4B 1OLLA 4IRSB 3U7YL 1NL0H 5CZVH 4WVRA 4D2NA 3RUGA 3BE1H 1WTGT 4GG6E 4CDGC 3GIVA 1UACL 2X4RB 1U9KA 1XZ0A 4YLQT 4YGVA 4XNMA 1JNLH 4V1DB 3JWOH 1J12A 3O2VL 3TO4A 1LVEA 4JKWA 3PL6D 4GS7B 4J6RH 1IGYB 5FECB 3U30C 4ZOEA 3EFDL 2P5WD 3C60B 3O2WL 4KRMB 3UJTH 1NDMB 2VLMD 5BVPL 2MCPH 3MRFB 3MYJB 2QSVA 5I1EL 3RWFB 3U4BL 3C09C 4NKQB 1WZKA 4ELMF 3H0TB 2J8OA 4XCNB 4BZ1L 1MRFL 3ULUE 1I7ZA 3CFEB 4ORGB 4F7EB 2K7PA 1JRHI 2W65A 1ZHLB 1CGSL 3QIBB 1PYWB 2XI9A 2BSTA 4K8RC 3WDHA 4G42A 4Y4HB 1EPFA 5IIEB 1LHZA 3QI9B 3WNNA 4PJ7F 4M03A 4ISVB 4HGWA 2CIKB 1AQDB 5F3BB 5EOTB 1IGFL 1BPVA 2FHFA 3SDCA 4AIXA 3SJVB 4PTUA 2RCSH 1MCOH 1EJOH 3KWWB 1YUHA 3LDBB 2XG4A 4N90D 4LNRB 5H37G 3PHSA 2R1YB 1A7RL 3INUL 5DK3A 1S7XA 3JVGC 3OHXA 5DTFA 4PJCE 4QTIL 4UQ2A 2KZ1B 3I2CH 3HR6A 1MWAA 5C7XH 4PJGB 2NTSP 5HI4C 1CGXA 1D5ZB 2AJZA 1CDJA 3HRZA 3FQTA 3HC0A 3WFZA 1A2YB 4JRXD 1TPXC 1LO0L 3BPCA 4PGCA 4MHHI 4TSCH 3QO1A 2FYYA 3JV4B 2LVCA 2CSPA 1MLCB 4U05A 2H32A 4K3DL 1GHFL 1QLRA 3EYSL 3D87B 5KVFL 4NFCA 4FTVE 3CFDB 1IKNC 1SEQL 5C0JA 4WFED 3HZVB 4PJHA 5IVXE 5HI5C 3D39E 1F4YH 5D96B 5EUOA 2GJ6A 3TWCL 1VEMA 4HJGB 2OJEA 2LAAA 1J8HB 1GGBL 1KTLB 3MNZB 1I9EA 1T6VN 2A38A 2FBJH 4YHML 4N5EC 1IGMH 3DLQR 1FZMA 4K3EL 2P44B 1NKOA 4NQCD 3MZGB 1T7ZA 1NGQH 1F4XL 1VGKB 4NN6C 1R3HA 4OZHE 4HSQA 1CS6A 1A6ZB 4S1DD 4LLAA 3JWOC 4Z95L 5IEKB 4K94L 4AM0B 4U1KA 1RULH 4LSUH 4OD2A 3A6CH 4XC1L 4HXAL 4QRUA 3C6LC 3O3UN 4NOFA 4U1SB 2B1HL 3U9PH 1ND0A 5DEGB 5IROC 4ZUWA 4MZ3A 4HIJA 3ARPA 1WZ1L 2IALB 1EERB 3GMOB 4DKEH 5T1DH 4L8CB 3W5MA 2Q3ZA 1NCCL 3O41B 1KLGB 1RZ8B 4HJ0D 4GSDH 3LMJL 5JO5A 1RJYB 4ONGL 2NW3A 43CAB 3RKDC 3UTTE 1GAFL 2EDWA 4DZ8A 4A6YB 1A4KB 1PG7W 4U6YB 4M6NL 4KROC 2PYFB 3IKCA 5IUSA 1H15B 5GS1A 1CTOA 2KPNA 2V9RA 2YPLA 5IMLB 3OKKB 1QEWA 4O5LL 5IHZB 5F1NA 1LE5B 2W9LA 3RWIA 5CJQL 3G5VA 4Z7UF 1G84A 1KJ2B 2HMIC 4P23C 4N9OB 4NT6A 4U1HB 4LIQE 3RL2B 1QO3B 4P5KB 1BZ9B 1R3IL 4J3SA 4WW2F 4NQSA 2D0HA 2EIZB 5DUPH 3PXJA 3GGWA 3CDGA 1DBML 3CZFA 2H32H 3FFDA 5KAQF 2JK5B 2HN7A 5FUOL 2NY2B 3BZ4A 3MOAH 3U7WH 1ZT4A 3EO1A 3VCLA 3WNMA 4A6YL 4G3YL 3EYFA 3U48A 3ULUD 5E8DH 3TYGL 3IVKB 1I3GH 2P1YA 1VPOH 3IFPA 1P7QA 4JGJA 4WO4B 2NY4B 4WWID 5DMKA 5EU4A 2VDKH 4X0KB 1JF5A 2VITA 1HHGB 1AD0B 1KC5H 3NCEB 1FN4B 4MA8H 3RVWC 3FZUC 5FO8B 5CJXA 1NBZA 3BGMA 2CMRL 3BO8A 5EPMA 2E9JA 4Z8FL 3FOLA 4OM0L 5TQ0L 3KNBB 3U36A 3BISA 3ULSB 2OTWB 1VHPA 3TO4C 5HGBA 4LGRB 1C7TA 4Y5VB 5D7LB 1RJZA 1T0NB 4XPTL 3HE6A 2DQIL 2R29L 4IOFD 3ZL4L 4S1RH 5HJ3B 1VFMA 3GMQB 4KJYA 2PW1B 2VLJA 3ROLB 3MV9A 2EH8H 4D9QD 1DSFL 3TA3D 3HZYB 5IFHL 3VXSE 4Z7NF 5A1AA 1LO4L 4YWGH 3EW3B 4UUJB 1E4XL 4NO0B 4NN5B 4Z7VB 4FTVD 3VRIB 3W11C 3SDDD 4IIQB 3GHBH 2X4QB 3O8XA 3D39D 3F7PC 3G6JE 2FHCA 1DE4B 2GQHA 3MODL 2BCKB 4NM8H 1J87A 5B39B 1SYSA 2FR4B 2NY3C 2HVJA 3TBVA 3KPSE 4U1MB 3PWPB 3DBXB 3GO1L 1UCTA 4OCSH 1H3TA 2XIDA 2H2SC 1A7OH 3RAJL 1QRNA 1OF2A 1B4JH 3QYCA 2B39A 1G6RA 5LWYH 3QUYA 3LKPB 3DUSB 4H8WH 5I1LB 4XWGH 4G80A 5EZIL 2OZ4H 1FFPA 3CPLA 1FH5H 3RTQD 1T2JA 5MEQB 5ALBH 3EYUL 4NCC2 1JF1A 3MMEB 2Y9RT 4CN6A 1W72B 3MRRB 4ELKB 4X9IA 4XCEB 3VRLF 3C5ZD 1FVCA 1JWUA 4MNGE 1L6ZA 1IC4L 4Z7OE 5JW4M 2HRLA 1IGTB 1G7QB 2NZ9D 2AK4B 4NHCH 4OD1L 3WIFA 1T4KA 4R0LA 1ZHBB 3RVXD 5E2TL 3NA4A 1R5WA 5AG8A 5T3XH 1HIML 1T83C 1OSPL 1YEEH 4KDTC 3UTTD 4M4PA 5INDB 5MHSD 3EDDA 4LNVA 2V7HB 3KJ6L 2ITCA 5DEZA 4OCMC 3RHWK 5FF6A 4JO3L 4MMZC 5J3HC 4YZFF 3V6OA 1R5IA 4U0QB 3VFNA 5CGTA 2FEEI 1AQKL 4ODSL 4YDVA 1ZLWK 1MI5B 4BH7A 2AEWA 1JUFA 4QNPF 3DUHA 3FB5A 1K8DB 1Y18B 4MA7L 3SOBH 2ZUYA 2R2EB 1W72L 1TTUA 3BXNA 1D9KD 2B4CL 4PB9L 2V5YA 4M6MH 1OAXL 3MFFA 1JV5A 2ADJB 1TLKA 1KCSH 1FLTX 4XVSL 1F8TL 3QP3A 1KCRL 1MQKH 1KJMA 1D7FA 3FO2A 2J3SA 1QBML 5J9PA 4NQEB 1J10A 1FE8H 3DV4A 5I18H 2A0LD 2AGJL 2ADIB 3I84A 3IFOB 1X3DA 3BMVA 2DOCA 3MRGA 3VFUA 3V0VA 2X1QA 4WHCA 5FO9B 1I3RA 2ZUTA 4QOKB 1HZHL 4IRSD 5GS1C 4G8GE 2OR9L 3VXPA 2NY1B 4QXTB 4WFFE 5HDOA 5FEBA 1N0XL 3IDNA 5JW3L 3D18A 3NOIA 1BMGA 1H3GA 2XXMB 3MV7B 1U8JB 4HKJA 5BMFH 1QP1A 3NZ8B 4GQPH 5CZKA 4OCYL 1G6RH 3OAUH 3F6LA 5DJ2B 1RZGA 5E1HB 4HJJH 1CDIA 5C3TA 2IGFL 3VXMA 3OKLB 4ERSL 4H8WC 3P4NA 1AGFA 2W9EL 5DR5H 1T04B 3VFVA 1NCTA 3WFDH 1QSEA 3MR9B 5HGAB 4AEIL 4ZS6D 1YY9C 2GY5A 5L0QC 5K59F 4BSJA 4LFHG 3QEHA 4CN4A 2AXFB 3D85B 4BSVA 1AGDB 1NUGA 3TBSB 1BBDH 1OAQH 1FSKC 1JN6A 3VXSD 3QPQD 1A1NA 1WAAA 4JHWH 5E1AB 4EBQL 2Q3AA 3FHQA 1P2CB 1NCDL 3LH2H 3DSNA 3CX5J 4D3CH 3VD7A 4JY6B 3N0PB 5GSRA 1I9RH 4EUPG 1INEH 1AXTL 2ZCLL 1KPRB 4DKAA 2C26A 1KJVA 2OL3B 4QF1A 3K2MC 3MCKB 2R2HA 3CXDH 2ZOLA 1MY5A 2AQ2A 5DMIL 1JGDB 2QHRH 5JW4N 5JOFA 3ZT5A 4KHTL 1X6NA 3RIFF 1NSNH 32C2A 1S3KH 3KPSD 5CJXC 5HHQB 1ZGLB 1LP9B 5GRVL 2VZTA 3FRPA 4LSVH 4GW4B 2QSCL 2Z8WC 3BYTA 5CKAA 1V3MA 4UU9A 4F7TA 4RBPK 2F54E 3BN3B 5HVHB 4HIIA 5JZ7C 4LLUB 3BQUC 1RZIB 4YQXL 5M7QA 4PJAB 4YC2C 3QG6B 4G9FA 3PIQA 4DQOL 1AIFB 5E2WH 5T1KA 3MUJA 1A1MB 1EEZB 5DI8A 2ERJB 4IBLT 4XNYL 4L9LB 3U4EB 3V6ZA 1XIWB 3KPQB 2OL3L 3QIWA 2XWTB 1X6LA 1YC7A 4L4TB 2CQVA 5DF0A 3TN0D 2ZPKH 5E9DB 1U2CA 3TF7C 4OCRL 1ZHKA 4LKXB 4GKZA 3SHSA 4O9HH 5GRJL 2OLDA 2ZSVB 1U8IB 2J12B 4HK0A 3S9DB 2NLJB 4PP1D 3L5WB 5E00A 4JDTH 4X6CE 1U36A 2BNRB 5I30H 4MB5A 5FA3B 1Z5LB 1F11A 1FCGA 1RFDH 2UYLA 3O4LE 4P4KB 4NWUL 4MS8C 1R0AH 2X4SA 3QUYC 4U6VH 4JZNA 3KXFB 5J1AA 1PEZA 4P2QA 3QUZB 5KVEL 4CGTA 4L4VB 5SX4H 2Y5TB 2HJKA 4OF3A 4JFFE 5D1ZA 2FX8L 5DD6A 3DOSA 4O00A 3HUJB 3MA9H 3UC0H 4U6TA 1J1PL 2QR0B 1CTNA 4K7PH 2VDOL 4RZCA 1WT5A 3O6LL 5EZOL 1B0RA 1RK0A 4R0LC 1U8OA 3PP4L 3SE8L 2C3XA 1BQLH 5MP6H 1HKLL 1FFNA 3GK8L 3UTOA 4U2YA 1KIRB 5T3ZH 5B3JE 3EZ8A 4YPGB 1JGUH 1MRDL 1Q94A 5JTWA 1D5BA 2ARJB 4DZBB 1NEZB 2DDQL 2YD3A 2E8YA 5EC1B 4MCZB 4Z7UA 5F7WC 1YEKL 4ODHH 2BX5A 4WFFD 5E99H 3V6OC 5HDQL 4CNIB 5ENWB 1O5DT 3DMMA 3ULVF 4KGJA 1FVEA 1NBYB 1JPGB 2OCFD 3W0WB 3F7VA 3Q0HA 4R7DA 3TNMA 1FGVH 4NCC1 2QBWA 3AS1A 5GZOD 3SY0A 4FQJL 1H3VA 1I8KA 4JZJC 4C56E 3MLVH 4OLXL 1RUAH 4HFWA 3ZE1F 3QEGH 4MD0B 4EDXA 3O9WC 3VFRA 1AO7A 3OG6B 2UY6A 4OGAD 3MO1B 5C0BB 2YMXH 5FYKH 1FAIL 4NGHL 5IW1A 4FP8H 2V5RA 1NLBH 3GSVA 1NLDL 4ZPVA 2VABA 4LSQL 4QRSB 5I1JL 3OJVC 3EO0A 1ZKAA 5FGBC 3QFJE 1DBKH 3T2OA 2RR3A 4NKMB 3QDHA 4I0PD 4KTYA 4FQ1L 4EI6B 2IH3A 5IR1A 2Q86B 3LN9A 3C8KA 4LHQB 4FQXB 4JO1L 2QQKH 3DUUB 4CVWA 4HHAA 4FG6D 2IPTH 4CMHB 1N6UA 1EFXB 4GRMB 3EDKA 1DQJB 2AEPH 3BT2H 2P24A 4ONHB 1IEAA 4MJ5A 2VWEC 5C86A 4J1UB 3CIQA 1NPUA 3O6KH 4N0FB 2ATKB 3VFOA 5GSVB 3MNVA 3IGAA 4ETYA 4K9EH 5D7LD 5JHDA 1M05A 5FYLL 4HUVB 2XA8L 3MJGX 3HG1B 5C92A 5DQJA 3EGSA 1PAMA 4PTTA 1QRKA 2FATL 5D4QA 1HSAA 2YWZA 4M93C 4P2YA 5DK0A 1NAML 4LCWE 4KK6D 3RWJA 3NCYP 2A6IB 1HKFA 1AHWC 3Q1SL 1RVFH 4PY7A 2ITDB 3WKML 4X5WA 2Q76B 4GW5B 5ESVA 4HUKB 5C6TH 5B3NA 4ODVH 3UMTA 4KJWC 4PJIB 5IB1A 1MJUH 1JRHL 4M9PA 4QHUA 5T1MA 5TE4H 3RVVD 4OI7A 5FO7A 2DICA 1YPZF 1CGUA 3L5JA 3V5DA 2EO9A 2HT2C 4PRNA 5E5MA 5F1IB 1NANH 3L7FA 4M5YL 3MACH 1R3JA 2KBGA 5GGUA 5HGGS 3O4LD 4RIRB 1U58B 3PE9A 2PTTA 3H7BB 1OM3L 3Q3GA 4CN1A 5DUBB 4G6JL 2V2XA 4G7YH 1GC1H 4MB4A 3FT4B 2DQGH 2YOCA 1I9JL 1SQ2N 3W9DB 1AY1L 5DSCB 5IEHB 2A6DA 2R1WB 1T2XA 3NABH 4EN3A 3GMPB 2JJTA 1YY8A 5CWSA 1EEQA 1M7DB 4RAVB 1T0MA 3HC3H 1LEIA 3GKZA 1TQCB 3QIWC 1ZHNB 3G04A 4QRPB 1ZA3B 1S7QA 2BFVL 3NA9H 4RAUA 4AIZA 2ZCKL 1YEGH 3CH8A 4ZXBC 5HHOA 5B4MC 1CLZH 5CEZL 4YHPB 1KB5H 3CFJB 3P4LA 4Q7DA 2QL1A 2HFFA 3DX9B 4HUNB 5DURD 3BZEB 1QSVA 1BJ1H 1LK2A 1UZ6E 2DQCH 4NSKB 2Q8BL 4OBRA 5DHVH 4P9HL 4UT6L 4Z7WF 4F58H 4POUB 3OKYA 2DLHA 3VFTA 1MAKA 2J8UB 2BVEA 3HPJA 4XNXH 2DRUA 2J4WH 3QJHB 4JFPA 4NZJA 1TZHA 3H9SE 5B22A 3NCFB 2P5EA 4XMLH 4YIQA 3QFDB 1RUMH 4JN2A 4G6KL 1EMTL 4K9EC 5K9KA 4FABH 1DBBH 5GRVK 2XY1A 1FL5A 1J5OL 4NQVB 1T6WA 3I6KB 4C56D 4LLQA 5D1ZC 5C9JA 2R4SL 3RY5A 4TUOB 1AE6H 1CL7I 5I19L 2GSIA 4P49A 4X6FB 2GITB 1WT5C 3EDEA 5CHNA 5TGBB 5TH2B 3E0GA 1A7PL 2JELL 7FABL 5BS0A 1CBVL 5GGTA 4LOUD 1HWHB 3EOAA 3IU3A 3QFJD 4HKZA 3WFEH 1AGEB 4S2SB 3D2UB 5ESAB 2Z8VC 5LG1A 1S78D 1T03L 5D71H 3OF6D 4YDJB 5FUCE 3VXNA 3D9AL 1K9TA 5I1DB 2Y7QA 1KIPB 1P4IL 1PKQA 1JPSL 1PFCA 3PJSB 1F2QA 1OARH 3L3JA 2AV1A 1Q72H 5C0AB 4NM4H 4UDTA 5KSAC 5KN5A 2R8SL 1CYGA 3MUZ1 1I1AA 1KJ3L 1KPVB 15C8L 1XGTA 5KTEH 3DMMC 4L8DA 1G9NC 3HE7B 3KDMB 4MA1C 2GAZB 2AK1H 3HR5A 3TBTA 3I50L 5DRNB 5FUZL 3M1BA 5D72L 1GC1C 4QLRA 5TF1H 1ORSA 1NMBH 4EI5A 1UJ3B 3T0DA 4CVUA 2FGZA 5CJOH 4RWYH 1OPGL 3RZCA 2V17H 3I75B 5C09E 4HF5L 1LDSA 2WIIA 4KUZL 5KVDH 2BERA 4NUJB 3RL1A 1B2WH 2VTFA 4LCWD 1WZMA 3S34L 3VG9C 4TVPL 5JPMB 1S7UB 2X1XR 3U79A 3PDOA 4PJFA 3WN5B 3CFKB 1II4E 1NC2B 2YK1L 2EDTA 4RMSA 43C9B 5I9QC 1Q9KB 12E8L 5EN2B 3UJJL 2I07A 3BIBX 3D69B 3ZYJA 5C1MB 5C9KA 3PGCB 4M62H 3DX7A 2EDXA 4FZEL 4JFDB 1A5FL 4JLRB 4ZAKA 3CFCH 2HT3D 5K93A 4OT1L 4NP4H 2P8PA 3QIUB 1JHKH 4KKLD 4EVNB 2EIEA 4EQ2A 2V2WB 5F9OL 1WFTA 4M6OL 4ZUUB 5E8EB 5ILTH 3OX8B 2DIAA 5BCAA 3QDJB 5LBSL 1CFQB 2XN9A 2QHLA 4GMTH 3W9EA 5EU5A 3MLXL 3GIZL 1IGIH 2E9BA 1L7IL 4GXVL 1YMHB 3ARDA 2X70A 4UAOC 2NNAA 4I9WE 4TULH 1K4CB 4J3UA 2DM7A 2R0LL 4RFOH 3KPPA 1OLZA 2H6PA 4XBEH 1WCQA 1QSZA 4X8JB 3BWUC 4RMUA 1RIUH 4DJMA 4JPKH 4Z76A 5C0FB 3CSYB 3QA3B 1EX0A 4FQ2L 1CXLA 1Q9LB 4EDWH 5FKAB 3L3GA 2WV3A 2YKLH 5DJ0B 5DRZB 3T04D 3H9HB 1JHLH 2APBA 2WWKT 2CDFA 4X6DA 3NACL 2HKHH 4PJBF 3T1FB 4RGOL 5CGYD 3THMH 3VFSB 2ADGA 3H9SD 2QSQA 3OKNB 1MHEB 4YX2L 1LO5A 5C71A 2DKMA 1MCDA 2FJGB 2UWEA 4PP2B 4W6XB 3PQYA 3R1GL 4PJCB 4N8VG 4UV4L 3OGCB 1M6OA 3TO2A 5J1SC 2HG5B 2WWMD 2GIYA 4XI5C 4M7JL 3QAZB 5AD0B 1J0KA 4OFYD 4UV7H 1KYOK 4OSUH 3RNQB 2PNDA 4MX7B 1PG7X 1GPOH 1S7RB 2D7PA 4KKBC 3MLRL 3WMSA 2ESVA 4O02L 5E08H 1T3FB 3N1MC 3P77A 5KSBF 1BQSA 3MLSL 4Z5RB 4GW1B 1IILE 4X7CC 4MNQA 1MFAH 4UOW0 4RSVA 5HBBA 1Z2KA 2EXYC 1HK6A 4W6YB 4Y16D 3PWNA 2VZ3A 4LLDA 4LPWA 1U8QB 4J3WA 5DFVC 25C8H 5DJYA 1L0QA 1QYGH 4FXLA 1EBPA 4KPHH 4LARL 1WEJL 3WLBA 4H5SA 4CW1B 1B0GB 4PJ8B 3W0WD 5DVLA 5GGVY 3ZDZE 3FTGB 1LEGA 4LASL 5J11C 4OZHB 1CFBA 1ZANL 2X7LA 2FEEL 4FS0A 4B5EA 3HA0A 1KNOA 1SM3L 3SKUD 3RDTB 4N1HB 2XTJC 3ARBB 3OBAA 3TJEL 2HTLD 3GSQA 4I48A 2FH6A 1A9EB 3BZFB 2IAMD 1F6FB 4K3HA 4E5XA 3L7EA 3MV01 4NN7B 5GHWH 5L9DH 2FRGP 1UCBH 4KJQD 3SE3A 2QADB 1KCLA 3DX6B 5A2IH 4EUPB 3BP4B 3HPLB 1FL6B 3C6SB 4QHKJ 1FC1A 1EFXD 2R1XB 4OB5L 4FQLH 5IMKB 3P4MB 1CXIA 4HLZG 4L3CB 4LDLB 1A6UL 1NQBA 1JP5A 4MQ7A 3E8UH 2A9NL 4HS8H 2GEEA 4G5ZH 3U46B 3BUYB 4WV1C 1CF8L 3SGKA 1OSZA 1AR1D 5T5NG 3SQBA 3OMZA 4WDIB 3BHBA 1YQ2A 4JRXA 2AV7A 3BGFC 1N4XH 2H9GA 3RZCC 1YMME 1A6WH 3S4SA 4M7LL 3IXTA 1YC8A 4YXHL 1E4JA 2ATPA 5ID1B 3P30L 5FHAH 3RPIB 4JFYA 4P3CL 4I9WD 4FXGA 4WENB 4YO0B 4X4XA 4PR5A 2VDMH 3TC9A 5IT2H 2D2OA 3AS3A 3L95B 1YPZA 3FQUB 5F96L 1ZK9A 5KZCB 4HD9A 4YDKL 1FJ1B 4R96B 3ARGB 3QQ4A 5J7CC 4YFLF 3OKDB 4JKLA 1U95B 2Y72A 3PXHA 4J4PD 4WWKA 5E24E 1IM3A 5HD8C 1U8NB 5LAXA 3BEVA 4LAJH 4Z7QF 4NQTA 4ZAKC 3TJHC 5I8KH 5DD0H 1Q9WB 3G9AB 4QGTA 1E4KA 5KJRL 4GUPA 4S1QL 2E27H 4BZ2L 2XYCA 4JGMA 4OFKA 1GSMA 3CU1A 2F5AH 4P3WA 3V4UL 3RU8L 4PGEA 2H8PB 2BY3A 3VFWB 3AREA 4OQTA 2CLVA 5A2FA 1T1WB 3PWUB 5DJ6A 3ARDC 5ANME 4X9BA 2NX5A 2CKBB 4CVZA 3LZFH 4YR6B 1ES0B 4HWZB 2NTFB 2E7LA 4HC1A 4KV5E 4OM1H 4JM2B 2GYSA 4OV6F 4P46C 4R97B 3KPLA 2BVPA 3T65A 1EFQA 2HFEB 3RQ3A 1BJ1J 2H3NB 3IJHA 3UTZB 1J86A 3IJSB 3ISWA 4XPHH 3ROOB 5JPNA 3G5XA 5F6IC 4OD3L 2XZCL 3QDME 4UT7L 3MOQA 5CIPB 1U93A 3ILQD 3S37H 5JLZB 5E8PB 4FZ8L 5H35B 2C3VA 2PW2A 3KYKL 5HYQB 5E4IA 4GG6A 3MSPA 1UEYA 1S9WB 4OZGF 2EIBA 4U3XA 1FL3A 2A9MH 4NZUL 4KKCD 2NY6C 4PUBH 2YD8A 2APWA 4OZFA 4NNPL 4J7RA 5D7IF 4AZ8A 4R3SB 1UXWA 3S88L 3ZKMC 4XP6L 2CKBL 4ZODA 2C4FU 3SDXF 1Y0LB 2M1KA 3AROA 2BMKB 2IH1B 1F3RB 4JQVA 1UG9A 5A2KH 3GDBA 4MNGB 2IMNA 1NCWL 4H88H 2I5YL 1GIGH 1TNNA 4C83B 5IMOB 2MWCA 2UUDK 5IQ7H 5A43C 4F7MA 4WU5B 4Y1AB 5CSGA 4WW1B 2FL5A 1U8HB 4HZAA 3QZWA 1H3PL 5I74B 1IZJA 5B38B 1QBLH 2C3GA 3KYNB 3J7HA 4J3OC 5JIKA 2ADFL 3VI3E 3V7AG 1KN2L 4AG4H 4GRWB 3IDYB 3HE7D 5D7SL 3RJDA 3VGEA 3N85L 5M95B 3LB6D 2E8ZA 3PL6C 2JCCF 1T22B 1F00I 5BRZE 4MJ2A 4WU7A 1OGAA 4LQFH 4YFDB 4LCYB 4OQTH 2AXGB 4PRAA 4XVUD 4PJXA 3G5ZB 1YMMD 1BLNA 5I16A 4PG2A 2PO6A 4XZUA 4XP4L 5C0CE 1QLEH 4JPIA 4ZFOA 2YD6A 4JVPA 4HC1H 3TBYB 4OIBA 5DDHA 5K9JH 3SDDA 4LPYA 4KY1L 4LRNL 4YUEL 3SE3C 3ZYIA 2DQFB 2P7TB 2HVKB 4OGXL 3DV6A 1EAJA 2DQJL 2FIRT 1KCUL 4PY8J 3LY6A 4YE4L 4ZPTA 4JFEE 2EDNA 4XP9L 5HYJE 3GMMA 4PJ9D 4PREB 2R23B 3TVMD 1A6TB 1N8ZB 3VJ6A 2D0GA 4LMQE 2Z93B 4IEFB 5EBWB 4ZS7L 2I9TA 4KVNL 5BJTA 4OZIF 1TZGH 2HJFB 4OZFH 1TVHA 3VFMB 3KPOB 5D5MB 2DAVA 3MUY1 2CLZB 2FEDD 1FG9C 2VXVH 2CDEA 5I75C 4IRJB 1E6JL 3IDXH 2WINA 3O6ML 1WBZA 4YBLB 1T5XB 3I9GL 5MEPB 4NZRL 5J6GB 2XWJB 2AVGA 5F7YC 5DT1L 4LLMA 2NYYD 1CD1B 1DDHB 4HKBB 3BP5A 1WIPA 1PDKA 3V79C 3MBEB 1BF8A 2OM5A 1A22B 5IFJB 1XR9B 1J1OL 4QXUH 4Q9RH 1MREH 3U0PA 4PJBA 5DHYA 4QWWD 1N59B 1PSKL 2CR3A 3OJDA 5GGRB 3V4VH 3X11B 3QDMD 5DJ8A 5IP4A 5D1QB 5ETUB 4BA8A 4OV5A 1CN4A 3LKQA 4PJ5B 4XHJD 2XZAH 4ZDHA 2VL5B 1S7WA 3O3DA 1EUTA 1WJ3A 2J8HA 4S1DC 1D9KA 2IPKB 3LSOB 4OTXL 1SJHB 4GMSH 4G9DA 4ODUB 1REIA 2F54B 1SMOA 5GS0D 1XF1A 1R24B 1A9BA 1FO0B 3PNWB 4PBXA 4XBGB 2W60B 2I9LB 5DZLA 1YN6B 5IHBA 1RUKL 1B4RA 5I1GL 1LQSR 3MJ9L 1D5MB 4JVUA 5CP3A 2P8MA 5B8CA 4HJ0C 2A6KB 5FCSH 3DGGA 2QQLH 4PD4K 4U6XA 4X6EB 3SGEI 2ZKHL 1GCFA 1MJ7H 4KDWA 2FD6H 1D6EA 4PJEE 4X99B 5EA0L 3GUTA 4YDIL 1B0WA 2DS4A 2HWZH 1HINL 4IRSA 1DEEB 3DO7B 3LEXB 2ZUUA 2AQ1A 5JOEA 2D3VA 2UZXB 1RZFL 4XMPL 3UTPE 4JREC 3OPZH 3JUYA 2YA2A 1UYWH 2DM2A 2AQ3A 1O7SA 1FO0L 1QFPA 4V1DA 5GRZA 3RA7H 5J8OA 1JZ5A 1IGYA 5FECA 1SMAA 5D70H 1ED3B 5BRZD 2YRLA 5J13C 1NDMA 3B2VH 1KEMH 5KOVC 3FB6B 2X4UB 3MYJA 4RWHA 1AI1H 4JFFB 3ARBD 4LFHD 4JQVC 4R4FL 4HIEB 3H0TA 4R4ND 4AEFA 4XCNA 1SYVB 3CSBA 5KAQG 1JZ7A 3CFEA 4ORGA 2NCMA 3W39B 3GSRB 4FFWD 4LHUD 3MXVL 4R2GB 1ZHLA 4HWEL 1PYWA 2EDYA 1CL7L 3AS2A 2YRPA 4IMLB 3G6JA 1BVLB 3WFCH 3LQZA 2L7JA 4NJAH 3QI9A 4ISVA 4OFIA 3HAEG 2CIKA 5EOTA 4RCAA 4NKIH 5C08E 4JFED 5HYJD 4FQCH 4IDJH 3SJVA 3MROB 3S3JA 3KWWA 5ITFB 2FIKB 3W2DL 2R1YA 1JIBA 4MNHB 4MAYD 1HHKA 4M3KB 3LKSB 4PJGA 4K2UL 5A2LH 3BIKB 1D5ZA 2H41A 5DC0A 4DGYL 3HN3A 4IOFC 4Z77B 4AEEA 4WNQB 4YXLH 1JGLL 1FFQA 3O2VH 5EDXA 5EO0A 3TA3C 3E2HC 5MENE 2DMKA 1F90L 1U91B 3JV4A 1ODAA 3NPSB 3VI4E 5CP3H 4PJAF 1MLCA 1MCQA 4PG2C 3VXUB 5GS2H 5BVPH 1QG3A 4G8FB 3CFDA 2JJUA 5I1EH 3U4BH 1LK3L 1X5IA 2FSEB 35C8L 5D93B 4FFZL 5D2NE 3SDDC 3L6FA 3F12B 1EA9C 4F57L 4BZ1H 1MRFH 2K3TA 3AVEA 4PB0L 1PVHA 1S5IL 1P7HL 1J8HA 3QEUA 1KTLA 1MLBA 3MNZA 3QHZH 3MLYL 3BPNC 4MYWB 2Z8SA 1IGFH 5CLWA 3FMGL 4ACPA 1VGKA 3LV3B 3DX8B 1V3LA 2R39A 3FFCE 5LCVH 1YZZA 4NFDA 3INUH 4C59B 1PY4A 2Y6SD 4QTIH 5E7BA 1CG9A 1W2KT 2J6EL 5ACMA 5DEGA 3VWJB 2EE9A 2RBLA 3C5ZC 2F19L 1EHAA 2JIXD 1HH9B 4LVHC 2NW2B 2VSCA 2APFA 2IALA 5DRXB 2NZ9C 3DTXB 3GMOA 5F9WC 4L8CA 2BHUA 4MVBC 5DJCB 5JQ6L 3O41A 3X12B 3RVXC 1RZ8A 4JEGB 1IMHC 2F58H 1RJYA 3KYOB 4I0CC 3CDYA 2DL9A 4P5MB 3MRMA 4K3DH 43CAA 3EYSH 4OCXL 2OQJB 4LMQI 5C07E 5C0IB 3SKJL 2CIIB 1SEQH 4DOHE 4E42B 4A6YA 1A4KA 1FZJB 5DD1L 4U6YA 1H15A 5I2IB 2VL4A 5HYSB 3TWCH 5IMLA 3OKKA 1VADB 5IHZA 1I9IH 1LE5A 3KPRB 5IBLC 1MUJB 4V2BA 4XAWL 3UTPD 4YHMH 3KAAA 1X5KA 4X7DC 4FNLH 1Z3GH 4K3EH 4M7ZB 1D9KC 1LDPL 4J3TA 2NPLX 4U1HA 3RL2A 1QO3A 3T08A 1BZ9A 1PX4A 4PRPB 3FQNA 5TDPB 3NTCH 4Z95H 2EIZA 4K94H 1U3ZA 4DEPB 4LBEB 4PRDB 3BRFA 3PV6B 2B1HH 2JK5A 2A0LC 2C1OB 5B8CC 3P9MB 1WZ1H 1IBGL 2CXGA 4GJTB 3LS5L 3IVKA 4HPOL 1U8PB 4YK4C 4I0PA 4NRYB 4WO4A 1WSST 5LJYH 1NCCH 4RX4D 3WSQL 3N1FC 4X0KA 1W0WB 2GK0B 3CX2A 3EOTL 4CDHA 4Y1AD 3CH1B 5IQ9B 1JTOA 1GAFH 2FCBA 4IRSC 1AD0A 4NO2B 3TZVD 1FN4A 4XXCC 5FYJL 5FO8A 4M6NH 4JZOA 5C08D 1V8HA 3OKEA 5BV7L 3C2SA 4RBPH 5AUMB 3C2AH 3UZVB 1YEFL 1A4JA 2WBKA 4J12A 5BZWB 3KNBA 3ULSA 2ICWI 2OTWA 1NH6A 5T33H 3MNWB 4Y5VA 5D7LA 1T0NA 5CJQH 3H42L 3SO3B 1NCBL 3P4OB 4WHTB 3FRUB 1KULA 3A6OA 4OIAA 3GMQA 4ZS6C 2JB6B 2KL6A 2PW1A 3ROLA 3RUGE 3VXOA 3UPRA 3VXRB 3HZYA 5MEND 4O4YL 1R3IH 1UVQB 1ZT1B 3QPQC 1XT5A 3P73B 1CGYA 5HGHB 4UUJA 2Z31D 3VRIA 4Z7VA 4ZFZB 2EE6A 2X4QA 4NBYB 4QHMB 3LKNB 2RIKA 4A6YH 4G3YH 1NGXB 1DE4A 4JFZH 3VW3H 2BCKA 2FR4A 1XGRB 1ZA6B 1H5BA 3IAQA 5AZ2L 4IM8A 3EHBD 4U1MA 2DM3A 3QUKB 3PWPA 5DYOB 4KRNA 3WO3B 4E41B 2A2QT 4X6CA 1J05B 2LTQC 3WE6B 5HI5D 4LP5A 4PJIF 1J0IA 3OJMB 3ZSTA 5DJZB 3LKPA 2XRAL 3DUSA 5HVWA 1FZKA 3QCTH 2CMRH 3MJ7B 3C08H 3DYMA 2XFXB 5MEQA 3FFCD 2G5RA 5TE7L 4B0MM 1NCUA 1MF2H 3MMEA 1W72A 4Y2OA 4ELKA 4XPTH 4XCEA 3G6AB 4WCYL 4K94C 2R29H 3CSGA 1T5WB 1VEPA 3H9YA 1Z0NA 2AK4A 2PF6A 1DSFH 5F88B 3UBXI 4PRIB 4TPRL 1ZHBA 5JMRA 1LO4H 5AZEL 3RWHB 1E4XH 2NY0B 4ZD3L 1U8KB 3JTTB 2VNCA 4RISL 5JW5B 2ENSA 1PG7L 3QQ9D 4HZLB 2V7HA 5I76B 2Z91B 5T1LB 3UBXG 3OR6A 4PP1C 1I4FB 1PY9A 3MODH 1RURL 2L4OA 1RU9H 3OGOE 1ZWIA 1QFUL 4G6AD 5CEXB 4U7MA 4PJHE 4RMQA 4U0RB 4PJ5D 1MI5A 3B9EA 4ONFL 4L3AA 3WKNA 1K8DA 1Y18A 3GO1H 3WFBL 2VZUA 2CLRB 5EUOE 2GJ6E 1B6DA 3I02B 2RFXB 3RAJH 5K9OB 1SEBB 1WK0A 2J8UF 5DJXB 2CXKA 2V5TA 4UNUA 2JLLA 3QCUL 5EZIH 5F7EL 1CZ8L 5GJSH 5E8NA 5EZJB 3S36X 4DKDC 2IANE 1V3JA 3GJFB 2O5ZH 3EYUH 5KS9B 3FJTA 1C1EL 4NQEA 4X98B 4HFUL 1SY6H 1DLFL 1I85A 1U3JA 3Q5OA 4JRYB 1ZS8B 2DI8A 1IC4H 1HQRB 3IFOA 4YHKH 2FWOA 4P23D 2VUOA 4ZO9A 3SBWA 4OD1H 2F74B 1QPPA 3B9KD 4JO4L 4P2RB 4KTEL 2FJHA 5FO9A 1EIBA 4G8IB 3OF6A 2BNUB 4QOKA 1HIMH 1F4WL 1C12A 4BYHA 1T1ZB 4QXTA 1ZLSL 4BQCA 3U6RB 3L9RA 8CGTA 4LVOB 3MV7A 1U8JA 2A73B 3KJ6H 3NZ8A 1HHHA 5GGQL 4ZUTB 4JO3H 4GAGL 5DJ2A 3GNML 3LHPH 3ZE0F 3OKLA 4LF3A 4I3SL 2DWDB 5HVFB 5H8DA 4ODSH 2X6MA 3BWAA 5GZOC 1A8JH 1IAMA 4RDQF 2YC1B 3MR9A 1W72H 5HGAA 3RVWD 4ZTPL 3OJ2C 5GS3A 1OAXH 2D7QA 2CRIA 4GRLB 4UI2A 2AXFA 1X4XA 3D85A 1AGDA 4OGAC 3TBSA 1E28B 5MEOB 1SJEA 4MAUL 1FV1B 2MPAL 1F8TH 1KCRH 4YHYB 3IAGC 1P2CA 1QBMH 2CR6A 3ZKSD 2R56H 4G43B 4HMCA 5C70A 4I0PC 1QNZL 2AGJH 2WWKO 4WO4C 2NY4C 2OL3A 2J5LC 5C0RH 3MCKA 3MGOB 2F53B 4MLSA 1JGDA 4Q9QH 1E4WL 3BKJH 1UQSB 4MWFB 4I2XB 2AXHA 5HHQA 2CK0L 1ZGLA 3W82A 3X3FH 1LP9A 1HZHH 2OR9H 3OR7A 4GW4A 4PJ7B 4P2CG 5T3XE 4UT9L 5BQ7B 1N0XH 3LRSA 4AYFA 4U1GB 2NQCA 1ZAGA 1A3RL 1NJ9A 1UENA 2F5BL 3KGRA 3NCJL 4LLUA 1DQML 4OCYH 4P5TD 3QG6A 2IGFH 4HX1A 4HUMB 4D9LL 2W9EH 3SDCD 2H2PD 4PGJA 1A1MA 1EEZA 5FV2A 3DARA 4L9LA 1WCBB 4AEIH 3U4EA 4BK4A 2HRPL 1XIWA 4XNUL 2AJUL 3KYAA 4KK6C 2XWTA 1S5HA 3BPOC 5E9DA 1MCKA 4KMTH 2VLJE 1JYXA 3AB0B 3MV9E 5CMAB 4LKXA 3S4SG 1NCDH 4ODTL 5SWSB 5TFSL 5DQ9B 2N7AA 5TQ2L 2VSDA 2WZPD 2Q7YB 3VXTB 1AXTH 3OWEA 2ZCLH 4EOWL 1H5BC 2NLJA 1AGCB 5FFLA 3L5WA 3ULUF 1RZKL 3RWDB 5DMIH 2BNRA 4R8WH 3UO1L 4KHTH 5FA3A 2ZJSH 2O5XL 3H9SA 4XVTL 3VMPA 2GJ6D 5BW7A 2OK0H 3QUZA 4AH2A 2QSCH 4P57B 4L4VA 1C08B 1T0PB 1BAFL 2Y5TA 1KIUA 2VLRB 3VWJD 3HUJA 1NFDA 2IAND 2PKDA 3CU7A 3K7UA 2QR0A 1QHPA 1X7QA 4RFNB 1QRNE 3K80A 3UCRA 4PJCF 4APQB 5GISL 4KHXL 3QXUA 3K2UL 5J06A 5C2UB 2DJSA 4NC1E 4W70A 4XNYH 4AENB 4KRPB 1QKZL 4C4KT 1KIRA 1EBAA 4YPGA 2C4XA 2OL3H 2ARJA 4OLWL 3WNOA 1NEZA 2NXZD 4DZBA 5EC1A 1KEGL 4N0UB 1MY7A 1NMCC 3FO9B 4MCZA 4JDVB 3IFNL 4Y16A 5IOPA 4FA8A 4AIOA 5GRJH 1EZVY 2WMPA 3MRPB 1I7UB 5ENWA 1T1YB 4CAGA 1CDGA 3RVUD 1JPGA 5FYJD 5F7HA 1DUYB 3W0WA 3DRQB 2DBJA 2ED9A 1FNEB 3R06B 5LXGL 4NWUH 1AJ7L 3FQXB 1KT2A 4BFGA 3GBNL 3V6BR 4MD0A 5FGCE 5KVEH 5DJAA 3MO1A 4OZHF 4Y88A 2DBLL 4BKLA 2FX8H 4WW2B 2QEJA 4QRSA 1J1PH 4LSSH 4GAJL 4LOUC 1S7SB 3U1SL 1NAMA 1NBVH 3Q6GL 1LNUB 5EZOH 3SCMB 5CBAB 3SE8H 4EI6A 1GZQB 2FZ3B 2Q86A 1S78C 2VIRA 3HMXL 3OB8A 5IW6B 3GK8H 3L3HA 3ZMRA 4FQXA 1OCWL 1IL1B 2QQNL 3DUUA 5DZOA 1EFXA 4GRMA 1DQJA 2EKSB 3GZKA 4ONHA 1L6XA 3O81A 3MRKB 1IQWL 1IFHL 2X41A 5JXAL 1CU4L 1XGUB 1YEKH 3MV8B 1UWXK 4N0FA 2ZSWB 3S5LG 5HDQH 4TRPH 1QBBA 3V7MA 2P42B 1U0QA 5CSBA 1KGCE 5SX5K 1L0XA 2R4RL 5C0EB 4K71B 4OCNC 3ET9F 3NFPB 3WS3B 5L2KB 2LE9A 4LHJB 1BD2B 2VWEE 1EVUA 4FQJH 4PG9B 5JORB 2B8OT 1YDPB 1FLRH 4KQ3L 5TDNB 3BPLB 5KVGL 3TT3L 4HBCL 1KLUB 2ARWA 1FAIH 4NGHH 5DO2D 3HE6D 4ELME 1QSEE 2Q76A 4GW5A 1IM9D 3BVNB 3PGFL 4ZFGH 5I1CH 4LSQH 5I1JH 2VLJD 3BDYH 3RVTD 3MV9D 4X4ZA 4FQ1H 5GRUL 2MOVA 4K7FB 8FABB 1WAAE 3ARYA 2WAHA 4QCIB 4J4PA 5CZXD 4G7VL 4MA3B 3TCLB 1QACA 2B7DT 5F1IA 3QXDB 2HT3C 5T3ZE 3O8XD 3H7BA 4KKLC 3MRJA 5DUBA 1KN4H 5HYFA 3TH3T 3M07A 2R1WA 5FYLH 1NAKL 2XA8H 1Z9SA 3WIIL 2VLKB 1M7DA 3GJFK 4NUGL 4YH6A 5DJDB 4RAVA 1QRND 4BFIA 4XX1G 1RUQL 3U2SB 1ZHNA 4QRPA 1NAMH 5C0CB 4RFEB 5DD3L 4YHPA 4G9FE 3CFJA 1F4HA 2R15A 3DX9A 4LKCB 3BZEA 2CUIA 1IAIM 3Q1SH 3GSNB 1Y6MR 3L3IB 4NSKA 2F8VA 3GSXB 5J1TC 5FYKE 4NQDB 1PQZB 2YZ8A 4UBDD 4P9MH 2J8UA 3WHXB 1JRHH 4TNVF 4F9LC 1CWVA 3PWLB 3QJHA 5CEYB 5CGYC 5H37H 1N2RB 2XOTA 3MRLB 3QFDA 5BW7C 5LVEA 5I8CB 2BRRL 1FNAA 1BBJB 3HI5H 1XCQB 4NQVA 3I6KA 2BVQB 1U8MB 1OM3H 4P59L 4G6JH 1ROWA 4TUOA 2WWMC 1EEYA 5K9QI 4GAFB 3F62A 3V8CA 2GITA 1AY1H 5JR1H 2C1PB 5TGBA 5F7FA 4P2QE 2C5DC 3GSNL 4NQXB 1AC6A 4JDZB 3Q5YA 3R0MA 4S2SA 3EJJX 5K9QG 3D2UA 5ESAA 4Z7OF 2LV4A 4OZ4B 5E2VL 4YDJA 2R69H 1EEUA 1DQQB 2ZCKH 4CJ0A 4Q6IC 5FUCC 1KIPA 4Y16C 1ZVHA 3RWGB 1FAKT 4JG0H 1NC4B 1CFVL 5C0AA 1ZLVK 4JY5H 3B3IA 4NKOB 2BVUA 2E5EA 1PW3A 2Q8BH 4WY7H 4P9HH 3OZ9L 4UT6H 5DK2B 3CK0L 1EVTC 3HE7A 3KDMA 2GAZA 4RRPA 5DRNA 1UB6A 2D9CA 4Z7UE 5EU6B 1G7JA 1HDMB 1XR8A 1KGCD 1UJ3A 3GM0A 4O58L 2BOCB 1OHQA 4AJ0A 3I75A 1EMTH 1J5OH 2DJUA 2JKXA 4HBQA 2HTLC 1T21B 1F02I 2R4SH 4Y19B 1GGCH 2OR8A 1CICB 1DR9A 2IAMC 2ICWB 1V3KA 2GUOB 1S7UA 3GRWL 5L6YL 3HRPA 1DQLH 4KJQC 2VAAB 3MLTB 1J0YA 1VACB 5F1SA 1A7PH 1MIEL 1CIUA 1NC2A 2JELH 2CUMA 5CFHA 1CBVH 2FB4H 2CDGB 1AO7E 2VQ1B 3OG4B 3VG0L 1UM4L 2Z35B 5DZNA 5EN2A 1T03H 1I1CA 4PJ9A 2VXUL 3D69A 1JZ4A 3PGCA 1WFUA 2E6QA 1CDHA 3LQMA 4JFDA 1OD7A 5FM5O 1JPSH 4JLRA 3KJ4C 4L29A 1KIQB 2R0WH 3UPCA 3B8SA 2SEBB 3FB7B 2R8SH 3QIUA 4L8SB 4YEEA 15C8H 1QR1B 5EBGA 2V2WA 1EJ6A 1AR1C 2G60L 4LAQL 1GOGA 2X4NB 3GM8A 4ZUUA 5E8EA 1JPFB 3OX8A 2Y36L 4GG8A 3QDJA 3V5HB 1DJSA 3I50H 5E5UB 3HNTL 5FUZH 1YNTB 5KG9A 1KXTB 5JA9A 4JB9L 4NNYB 1YMHA 3EZJB 3BUTA 1OPGH 4IS6B 1MPAL 2W0PA 1K4CA 3QPXH 4HF5H 3WNKA 4X4YB 3MJ6A 3JXAA 5JHDE 4YFLI 3VFPA 4Z7NE 1XF3B 5DVOA 5HHMB 2CGRL 3S34H 1MSPA 1BGXL 1I3VA 3U30B 4LSRL 4YBQD 3R8QA 4G9FD 3QQ3B 4AQOA 4Q2ZB 5J6HB 3CSYA 1I7TB 1RIHL 5T1KD 5BO1L 3SKOB 3F58H 3SKMA 1Q9LA 2OTUB 2WBJB 3K8LA 5FKAA 3BMWA 4J4PC 5DRZA 5FYKD 3C09B 1KLFA 4TUKL 3UBXB 3H9HA 1PLGL 4LLYB 2AKRB 2BXYA 1UH4A 3T1FA 3UJJH 5C0DB 1FRGL 4P9HC 3OKNA 1FYTB 3FKUS 4FZEH 3CD4A 2W0FB 4KU1A 2HFGH 1A5FH 4PP2A 2H26B 3A6BL 3I6LE 3QXVA 4JFOA 1UJTA 4OT1H 1JI1A 3OGCA 5IGXL 2MSPA 5SX4I 5F9OH 1T2QH 1RHHB 1WWWX 5FOBB 4WI2A 5LBSH 3RNQA 4MX7A 4U2ZA 4Y7MA 2EICA 3I3EA 5D7KE 1S7RA 2Q6WB 3MLXH 1T3FA 1ZVSB 2UUDH 4P2QD 4MQTB 3NZHL 4HGMA 5F7KC 3FN0L 4Z5RA 4KRPD 5HHPB 4NYLB 2R0LH 4D0DB 3JUZA 3LN4A 4MQXD 5D1ZD 1I1RA 1TPXB 2OR7A 4MXQD 5EUKA 4XPBL 3VD9A 3PF2A 5CILL 3EYOB 3ILQC 1A3LH 2E3VA 4CVXA 5IK3A 5J4MA 3BKML 4K8RL 5HHOE 4YZFE 4CW1A 1B0GA 4PJ8A 4RMTA 4W6WB 3QHFH 3FTGA 4Q0XL 4G6ML 3BKCL 1RJLB 4KKCC 4QRRD 4KZEL 3NACH 4RGOH 4JJ5A 1INDH 2Y06L 4I77L 3DPBA 2YEZB 1JZ8A 3R1GH 5A3ID 1UFUA 5FYJU 3ARBA 4HUWA 4MSWA 3QUXD 1UWEH 4M7JH 2P5EE 3MBXL 3UAJD 3KS0H 4NN6B 1ADQH 5CINL 4M4RA 3IF1A 1KPUB 3GI9H 4O02H 3DX6A 4KTDL 4EUPA 3BP4A 3MLSH 1HHIB 5C07B 3C6LB 5F71A 1FL6A 1AO7D 2XTJE 3C6SA 3F5WB 5IMMA 4LSTL 1ZXQA 2R1XA 2Q1EA 4NFBA 2VYRE 3HI6L 1MJ8L 5IMKA 3P4MA 4X9GA 4L3CA 5BS0E 3G5YB 5B3JF 5E6ZA 3ULVL 4OLZH 3HE7C 3U46A 5I0DA 3LB6C 3R8BB 1NL0L 3EJZD 1PKQE 4WDIA 1QFWI 1UJ3C 4KROB 1QPXA 3VE0B 4LASH 3VFGL 4ESKA 5I73C 3B9VA 1ZANH 4XVUC 4DVBB 3NCCB 1FFOA 4GAYA 4OKVB 4F7CB 4FQHA 4ZO6A 5ID1A 1SVZA 1FFRA 1TETL 3MRNB 1SM3H 2VISA 3GHEL 2DLTA 3TJEH 3NCBB 4YO0A 2V2TB 5JHDD 1B88A 3D48R 2EKJA 3ORJA 3I3DA 2WP3T 3L95A 4GKSB 3FQUA 2VXQL 5E5RB 3F7RA 1FJ1A 3I6GB 1MCSA 2XT1B 3OKDA 4PJ9C 3PGDB 4J2XA 4M1DL 1C5CL 5IB5B 3TVMC 3SGJA 2HJLB 1FZOA 2OMBA 4PJFE 4OB5H 4N68A 1G7PB 1HILA 5BVJB 3CVIL 5AG9A 1A6UH 3KLSA 1NANI 1CFTB 5B39G 3D0LA 4JHZA 2A9NH 1CI5A 4O2FB 4X7TA 3O11A 2H8PA 3V6FB 1MIML 3IDGB 2RCSL 1FHGA 1CF8H 1KYOJ 1QLFA 4M43H 2AP2A 2BDNL 2FEDC 4GBXB 3T4YB 2JIXA 1T1WA 3PWUA 5C7XL 5D7KD 2W38A 2CKBA 4M7LH 4YR6A 4FOMA 1ES0A 1MCHA 4HWZA 2NTFA 3P0VH 4XNMB 3P30H 3S36L 4JM2A 1CGWA 3TO4B 5IJVB 4P3CH 4KUCF 2LQRA 2XN9E 2HFEA 2H3NA 3UTZA 3IJSA 4EN3D 5HI3D 4JFXB 3ROOA 2YD7A 4QWWC 5F96H 4AK1A 1CR9H 5CIPA 4YDKH 2D9QB 4KKBD 3ARFB 5JLZA 1A14L 4UNVA 5H35A 1YQVL 3JSSA 1F4YL 5HYQA 4XHJC 1OTSD 1S9WA 4PIRF 4ZOCA 4Z7WB 2VERN 1G0YR 3QEQB 4WEUD 4TUJB 3TT1H 4G42B 1A1OB 5KJRH 1IGML 5E2UL 4GKNB 3RY6C 5E2JA 4R7NB 1Y0LA 1NGQL 3V4UH 4X6DE 2BMKA 2IH1A 4PJDB 3UROR 1YUHB 1KG0B 2UWEE 1U41A 4K3JH 2HA1A 2P5ED 4LSUL 3PQYE 4M1GL 5DTFB 2MQ0A 3D5OF 2PR4L 3PV7A 4UOJA 2AJZB 4RX4A 3HRZB 3FQTB 1EV2E 1ZV5A 4WU5A 4Y1AA 3BPCB 4WW1A 3QXWA 1TITA 3IYLW 1U8HA 2YUVA 1HEZB 1EXUB 3ARTA 1HCFX 1NC4D 5B38A 3V52L 4WFGE 5BS0D 4YNYB 4OD3H 1V7NH 4UT7H 4MNQE 4XVJH 4X80H 3WHE1 5EC2B 1UZ6F 3VD3A 3WL9B 3S5LB 5JW4Q 5EUOB 1IGJB 2YS4A 5F21B 3DETD 2OJEB 1X4ZA 2PYEB 1BIHA 4LCYA 2AXGA 3T2NL 3G5ZA 3RY4A 1I1AD 4XXDB 3ARBC 1FZMB 4NPYA 4W4NA 3S88H 4XP6H 4D9RE 4R4NC 5GGSB 4LCUB 5IB4B 3HCVA 1ONQB 3TBYA 3SE9L 4FFWC 1QSFB 5D2NA 1MCWW 3QNYB 2DQFA 2P7TA 2HVKA 1LWRA 2GTZB 4EI5D 1QBAA 4U1KB 3F65A 2VLME 2RGSA 4GQ9H 3TPUA 1ZT7B 1WF5A 2I5YH 1P7KB 4G8EA 1ND0B 1A6PA 4F9PC 1OW0C 3DVIA 4ZG1A 2XPGB 5CIPH 2GK2A 2VXTH 3MOAL 4ZUWB 4HIJB 1D6VL 4PREA 2R23A 1A6TA 1N8ZA 3BH9A 1VPOL 4W81A 2Z93A 1VA9A 5F6HI 4FN0A 4MAYC 2B2XH 4TOYL 3WXVH 2ADFH 1KN2H 1F42A 2DLFL 2HJFA 2EXWD 3KPOA 1BF2A 3NH7L 1P4LB 5D7SH 5D5MA 4ZO7A 4MDJB 5E8OB 3DURB 4LVNC 5GS1B 1JNNL 2YPLB 1FNGB 3V0WH 4IRJA 3IDMA 1FIEA 1T5XA 2X10A 5MEPA 1U6AL 5I15L 2XWJA 5J6GA 1G9MC 3JV5A 1CD1A 4S1RL 4HKBA 3MJ9A 3DSFH 1CQYA 4XP4H 2VZ1A 4JRXE 1XMWA 1A6AA 5IFJA 3DXAB 2O61B 4IDLA 5SWQB 2XN9D 3E6FA 4ZO8A 1P9MA 4ZOBA 1N26A 4LRNH 5L0QB 1CCZA 1WIOA 1N59A 2DQJH 3GGWB 1KCUH 5GGRA 3CDGB 3X11A 1FSKB 5D1QA 5ETUA 4GRWH 3FO0H 4JY4B 4F8TA 1JFQL 4I18B 4PJ5A 4XP9H 4P4RA 1TJIH 3EYFB 1YPZE 1XGQB 2VL5A 3IFPB 4NM8L 4ODXB 1T7WA 2VDRL 2AW2A 1Z9OA 3D3VB 1MNUH 3T3PE 2HLFD 1SJHA 4FQPA 4ODUA 1R24A 2Y6SC 1IAKB 4KVNH 1FO0A 3QWOB 2VITB 4OCSL 4PV8A 3PNWA 1QZ1A 4XBGA 2W60A 2I9LA 1YN6A 4FFYH 3ABZA 1UZ8A 1NBQA 3BGMB 4JPVL 4XWGL 4JPWL 2OZ4L 1GXEA 1FH5L 2MQCA 1TCRB 3OSKA 3FOLB 4NIKB 5FM4A 1KENL 1AXSA 2R2BB 4L1HA 2LAGB 3MOBH 2A6KA 1E6JH 3O6MH 3PQYD 3I9GH 4JM2C 4X6EA 3B9KA 2BNQB 3BQUB 1RJZB 4QT5B 5DT1H 4QXWA 4X99A 2BY0A 5KSBB 1DEEA 3DO7A 1YEHL 1BEYL 3TM6A 3MA7B 2NX5E 4PRHB 1NGZB 2X05A 4FMFA 5I1IH 1PSKH 4QGYA 1WLHA 4YHNB 4WFGD 1W8OA 1NEZG 1TJHL 4Y2DD 5EORH 4MNQD 1WICA 3DI2B 3ZDYF 4TQEH 5EOCL 2AI0H 4WHYG 2BJML 2BSED 2WIMA 3ULVD 1N7MH 3QISA 1QVOA 3GEWB 3LS4L 2EDBA 2RJMA 4OTXH 2EZ0D 3FB6A 2X4UA 5IJKC 1P84K 2VDNL 3CJJA 4HIEA 2CO7B 5EH1A 1SYVA 4D9RD 4ZSOB 1RUKH 5I1GH 3KS0J 1U3HB 1G6RB 3W39A 3QUYB 1VGEL 4U1LB 1KCSL 1ERNA 1FFPB 5CJ8A 4FQIL 3VU2A 2DWEB 4IMLA 5E95B 3QUMH 2R2CA 1BVLA 2BHYA 4KKNA 1JF1B 1GZPB 3AXLB 1WV7T 2ZKHH 3PHQA 3TZVC 5EA0H 4YHOH 4ZUVB 3IDJB 4QY8B 2ZCHL 4F7PB 3UYOD 4WTXA 3MROA 1HINH 5DQDL 4KVCH 5ITFA 3WIFB 1LD9B 2FIKA 4R0LB 1MHHA 3LIZL 4MNHA 5JDSB 3BAEL 4TNWF 2VC2L 1CVSC 3LKSA 4BQ8A 5EO9A 1YECH 4OJFL 3UZQA 4P5TA 4QRTB 2EEDA 4UIKL 2O93L 4Z77A 5DA0B 1T66D 5HPMB 2ZNXA 2ITCB 4W4OA 4JJHA 1U91A 1G6RL 3OAUL 2DB8A 5FGCB 3NVQA 1M1SA 3ZDZF 3VXUA 3EBAA 4BH7B 2Z31C 4WFHE 3WFDL 1EO8L 2FSEA 4TN9A 1ACZA 4R4FH 1BQHB 5D2NC 3F12A 2XTLA 1OGAE 4D9QE 3HC4H 5KBNC 4JZJB 4PJXE 1TZIB 1BBDL 5IFAL 1OAQL 2UZIL 4JANB 1WC7B 2J7LA 3O9WB 3ZHDA 3EHBC 5CJBA 4QHLB 3LH2L 4D3CL 1ZGLM 1I9RL 2W59A 1TJGH 1P5UA 4NBZB 2XV6B 3J8F7 2J1KA 4MHHG 3FCTA 3CXDL 3DX8A 4JFHD 2UVEA 4I5BA 2QHRL 3W2DH 4J3XA 4XRCB 2I27N 2A77H 1NSNL 1S3KL 1DBJH 3ZSSA 3E3QC 5DD5L 4ALAL 4WWKD 2OYPA 4OF6A 4LSVL 4N8VA 3VWJA 4DGYH 2IANA 1H3XA 1WIUA 1S7VA 1BWMA 1HH9A 2NW2A 3D18B 2DF3A 2P49B 3DTXA 4HKJB 4BUHA 1I8IB 2NY7L 3OKOA 4PD4J 2P45B 3DRTB 3ETBF 1NGWB 5IESH 1GGIH 3X12A 4XX1E 4P5MA 3VXMB 3P4NB 5I66B 2YUWA 1RV6X 3VA2C 4JHAH 3VFVB 5C0IA 2YR3A 1CXKA 4DAGL 2CIIA 35C8H 4E42A 1FZJA 3ARED 3QQ9C 5I2IA 3A67L 4OCWL 5JXED 5A16A 2FNBA 4M93B 4MJ6A 1G7MB 1VADA 4PB0H 1S5IH 5I0ZA 3ARFD 2NX5D 3QO0B 1PBYA 3KPRA 1MUJA 4G6AC 1OP3K 5EU3B 5AYUL 1UM5L 4OF5A 3BD4A 4RGMB 1AHWB 1YYLL 3GB7B 4LLVA 4ZTOL 2F8XC 4MJIB 1Q8MA 5MHSE 5E6IB 3FMGH 1Z9LA 4PJBE 4PRPA 3S35H 4OZGB 5TDPA 4KI1A 5I30L 1BIIB 1H8SA 4LBEA 4PRDA 3B2UD 2R0ZH 3Q6FB 3PV6A 5D7IB 5JHLH 4UTBL 4B7LA 2MKWA 2C1OA 2F19H 1MWAH 3P9MA 2FX7H 3SDXB 3GI8L 5JDJA 1U8PA 1LGVA 4POZC 3B9KC 2WUBL 5JQ6H 5HHVL 4P0DA 5D2LB 3VA6A 3MV11 1W0WA 2GK0A 2PXYD 3CH1A 1EO5A 2ED8A 5IQ9A 4NO2A 3SKJH 5MP6L 1UM6H 2KUTA 4KV5F 3OAYK 3CFIC 3QXTA 5KVMC 3QIWB 3R0NA 5BZWA 5F3HB 3REVB 3ZTNH 3O4OC 5I8EB 3EDFA 4H0IA 4ZXBB 5JNYB 3MNWA 1UT9A 4M02A 4XAWH 3BJLA 3P4OA 4WHTA 3FRUA 4E0RB 2PYED 4HWBL 2JB6A 3BFOA 2EYSB 3LEVL 4RDQG 5SWZB 2MFNA 3VXRA 3B43A 4DUXA 5LQBL 1KJ2L 3BSZL 5E00B 3MQIA 2JCCB 1UVQA 4O51B 3QDGB 3QCVL 1QTYT 1ZT1A 3EYQD 4RRPG 4V1DE 1FGVL 4D0CA 4HT1L 4WFHD 4ZFZA 4TSBL 3G6DH 4K23L 3EFFA 1IM9A 4QHMA 3LKNA 3N9GH 1NGXA 1OGAD 3LS5H 3PABB 1H3WM 3ZYZA 1XGRA 4HCRL 4RAHA 1G9EA 5FA4A 3MCLL 2AAVA 2PO6D 3EOTH 4Y5YB 5DYOA 5BXFB 1JYNA 4LPUA 3NCYS 2GTWA 1ORQB 2QQQA 4E41A 1J05A 3SGDI 1RK0B 3WUWG 5FYJH 3WE6A 3SDYH 1HXMB 4TSAH 1FFNB 1MHPL 5DJZA 5BV7H 5CD3B 1TIUA 3MJ7A 4G6FB 4LGSB 3NCMA 1Q94B 2XFXA 3UXFA 1D5BB 1RZ7H 4P5TC 4ZNCD 1FIGH 2AEPL 3C87A 3NGBC 3SJVE 3VH8B 3VI3F 3G6AA 3SDCC 2H2PC 4OZIB 3H42H 1NCBH 3O6KL 1BFVL 1T5WA 5F72S 3L5IA 5KSAB 5EO1B 1IJ9A 1QFWL 4PRIA 4K9EL 2J2ZA 4O4YH 3DVNB 4PJGE 5D93C 5BZDB 4MA1B