4K9EH

Crystal structure of kit d4d5 fragment in complex with anti-kit antibodies fab79d
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
220
structure length
220
Chain Sequence
SEVQLVESGGGLVQPGGSLRLSCAASGFNISVYMMHWVRQAPGKGLEWVASIYPYSGYTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARYVYHALDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords light chain
publication title Structural basis for KIT receptor tyrosine kinase inhibition by antibodies targeting the D4 membrane-proximal region.
pubmed doi rcsb
source organism Mus musculus
total genus 47
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2013-04-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4k9eH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4k9eH01
4E0RB 3JZ7A 5GS1C 5BVJA 1YPZB 1K85A 2LVEA 1BQHG 1QBML 4HV8A 1IEBB 1T66C 1W0WA 1HXMB 5I19H 4KK8C 1FVCB 1HZHH 1TPXC 4CMMA 3OXRB 2X7LA 2F19H 4XC3H 4BFBD 4ELME 3P30H 2WM0A 2H45A 2ZP0T 3Q6GL 3EO1A 5B38B 5EZIH 2XG5A 1FP5A 1CXFA 2ZKHL 1AD0A 2CLZB 4IRJB 5IEHA 2LTQB 4ZUVA 3BZFA 3D0LB 3GMQA 3QXVA 4MJ5A 3KS0H 2WIIA 4YE4H 2MQCA 4KZDH 4JFXB 5D1QB 5ALBH 4XPAH 3ZKXB 3RWIB 1OAQL 2BSRA 5IM7A 4U1MA 1ITBB 5C0IA 4R97C 1KB9K 3D39E 3QDMB 3GZKA 4XB8A 5JHLH 4MAYD 5IJVA 1OTSD 4OUUA 1MCOH 3C9NB 4OD2B 1MCFA 3IDYB 4L8BA 4JFQB 4PGCB 3IDIB 4XWGL 1BM3H 5C0AB 2Q8AH 1A7QH 1WWAX 3MUHL 5EO0A 3QHTC 4JZNA 5ID0A 3AVEA 4W6XB 4D8PA 4MCYB 3RY5A 3U0PB 3PL6C 2PYEB 3TT3L 4QRSB 5F9JA 3VD4A 1TZIA 2QQKH 4NDMB 2R8SH 2R9HC 1XFPA 2EDFA 3AAZB 4LSQL 3DETC 1JGUL 4UOW0 3MLZH 1YMMB 4PLOB 1IKFL 4GMSH 3VFRA 5C0EB 1T20A 1SY6L 5F1NB 3DRTB 3LSOB 3OB8A 1D5MA 3KPNB 5K33A 3TBSA 4OLXL 1S7TB 5M94B 2XT1B 5GZNC 1Z6JT 2ERJC 3CVIL 1MCEA 2EIZB 3SDAC 4YHPB 1DDHB 1JNHA 4PFEA 4BSVB 3V79C 5E24E 3EHBD 1MVUA 4FQIL 2W0FB 5JNYB 3MV9A 4H0GA 3SCMB 2WBJB 4XNUL 5HDBF 3TPUA 3I3DA 2NYYC 1NKOA 2ADJA 4Y4HD 4DEPB 1X5ZA 4JFEB 4YLQT 1RJLB 5IMMA 4HC1A 1B0WA 1D6EA 1F45A 1A7PH 3BVNB 4Y4KA 4YHYB 4PPTA 5L2KA 3F6LA 1NFDA 4N5UA 3GMNB 4FQJL 2VAAA 4UILH 1T1ZA 1IAKA 4QRPA 1QRNA 4HJJL 2PKDA 3BAEH 2JCCF 3WFCH 3H7BB 3R1GH 1YN7A 4PJ8D 2UZIH 2JE8A 3MC0A 2OSLA 4YXLH 1FNAA 3TVMB 1A6ZB 4Y16C 2ORBL 4P23C 4OF8A 1A0QH 1HH9B 3N1FC 3OJMB 2CJUL 5A2FA 1N2RA 2BVPA 4XPBL 2DJUA 5CCKL 3DIFA 1DQDH 2X4NB 2YHGA 2J5LB 5I0DA 4Z7UA 4NQEA 3PGCB 2WMPA 2WQRA 2EXYC 1CLCA 4HIXH 1O7VA 3C60B 4MA8H 1U8JA 3NH7L 3S96A 1HHHB 4FQ2L 4KJYA 4YPGB 5DJ2A 5F3HB 4HW6A 3QO1A 4YDJB 2FEEI 3QA3B 5FCUL 4BK5A 3VDBA 4E41E 5ESAA 3HAEA 1GPOH 3ZKSD 1TVHB 4J7RA 3VI4E 4X9BA 2FDBP 3KHQA 3LKQB 1ZHKA 3EOBA 3TCXA 3V5HB 3LS4L 2VE6B 5K9QI 1MJUH 4HHAB 4GRWF 8FABB 3V95A 1RZIA 5DDHA 4RFEA 3ULUE 4I4WB 3VCLB 3U6RA 1BECA 1UEMA 4G6AD 4WW2A 3QT2A 4U1JB 2IQ9L 4MVBD 5ICYA 3BP7B 5CUSL 1LE5B 1KYOK 2YD7A 2QL1A 4UQ3A 3RZCD 4Y2OA 3QIUA 2OX5A 4N0CD 5SX4I 2VOTA 2BOCB 3CSGA 5MP6L 4LAQL 3DARA 3OKOB 1WFOA 3RHWF 3C6SB 2YK1H 4JAMA 5JORA 1XF5B 3L5XL 3DX7A 2O5YH 5F9WC 1KTDA 4HKXA 1CXEA 1E6JH 3EDEA 3B2VH 4POZD 1ZLWK 4U7KA 4JFHD 4OCSL 2X89A 5JDSB 4NN5C 5SWSD 2FIKA 1JN6B 3IXTA 4C54A 1OD7A 1RQ5A 4XNMB 2ZPKL 2OP4L 1BBJB 4QRTB 3MRHB 2X4PA 1S7SB 2V9QA 4N9GB 4Y19D 1NUNB 1UM6L 1HK6A 2EXWD 1KCUL 5DC9B 3E2HB 4EN3A 2VITA 4ZPVA 3QZWA 2BHUA 1F3JB 4ZO9A 4LIQE 4MJIB 3MCG1 2Y9RT 4AEFA 3VGEA 1V05A 2XWTA 5E56A 1U41A 5FYLD 3IJHB 4OCLC 2AK4D 4OBSA 1DBML 3FB6B 5DJYB 5F1SA 1EO8H 4R90L 1G6RA 2J12B 3STLB 4HKJA 5T1DH 3MRRA 5AEAA 2L7UA 3BUYB 5FEBA 2Z35B 3VFTB 4LVHB 1MI5D 4NQXA 4N8PA 3WN5B 5D7LE 4Y5VB 3DLQR 1JPST 3C87A 1CXHA 4U1HA 5ENWB 5L88H 3ZE2E 3O6MH 2A83B 2ENSA 2R0KL 3V0VB 1BJ1J 4X4ZA 2Z31C 4GW1B 1EZVY 5EN2A 5BMFH 4JFFD 2R1XB 3L3DA 5ITBL 3QHZL 3D6GA 4GSDH 4TPRL 1QFUH 3GNML 4KDVA 5CEYB 1I1RA 1BEYH 1OTUD 1QFWH 4XBGA 2EKSA 2YN5A 4JKWA 4ODVL 5EORH 4AENA 1Q94B 2D03H 3WUWG 4LLQA 5IQ9A 5AD0A 4ZXBD 1A1NB 4DFIA 3JBG7 5KVFH 1IZKA 4YZFE 4XXCA 1IAMA 4OUOA 1U3HD 3QI9C 1R3LB 4LQ1A 2VR5A 3SKJH 3ULUF 3RL1A 5L2JA 2XNAB 3U2SA 2A0LC 3RAJL 5IB3B 1XGRB 1MREL 4PUBL 4X98A 4PB9H 3QIWC 5K9JL 2DQFB 4KHTH 4NWTH 2D3VA 1NCAL 5J13C 2ZZUT 3K4ZA 2FJHB 4X9FA 4XNYH 1KGCD 2J88H 4G8IA 4M7KL 4JPKL 4P49A 4CVWA 4I0CC 4PS4L 5CJXC 4BUHA 4LCCC 1P4BL 1AC0A 2FHCA 1FYTB 1FQ9C 2CUIA 1SM3L 3LS5L 3L5JA 5ICZB 5HHMD 2K7PA 3RZCB 3GJFB 1RUPL 1FFNA 2F5BL 4XI5D 1AC6A 3MNWB 3GMLA 3FB8A 2DL2A 4WTWA 4G6FB 2SEBB 3MZTA 2IMMA 4NJ9L 5E4EC 4K3GA 3L95A 4OGXH 3QEUB 2ATKA 2HTLC 4PJ5E 2NY7L 2HFEA 2W91A 12E8L 2GJ6E 3B9KC 3BPOC 4LLUB 3TYFA 1UB6A 1ZHLA 2YKLL 3RWFA 5MENE 1NKRA 1AR1C 4KVNH 5CINH 3QWOA 3IS0X 1DL7H 3MJ9L 4JHBA 4OCXH 1M05A 3DNKA 4LPCA 2OJEA 4KI5F 5D93C 2DS4A 4I77H 4L1HA 5GGSB 2FZ3B 3PNWA 3NVQA 5IBTH 4P4RA 3ZL4L 4X99A 4DZBA 1NCCH 1UVQB 5CWSA 4P2OA 4WI5A 2X40A 2DKUA 1E27B 1PDKA 1VHPA 2VDNL 3B9AA 3QDHA 1IJ9A 3ILQD 3PWPA 1VADA 3DXAA 4P3WA 5T1LB 3F65A 5CD3A 4POUB 5EUKB 5T33H 3ZTJH 1HEZB 1TENA 1XMWA 1AE6L 4HKZB 5H2BA 1ACZA 4JO1L 3WFEH 1K9TA 1I8LA 1DFBL 1LDPH 2YBRB 4OD1H 3U9UB 1T1WA 4NC2B 4S2SB 5HDQL 2XZAH 2HRLA 3M07A 2HP4A 5B3JE 3QFJA 2BNQE 1ZGLB 4YEFA 3HE7B 5A3IC 1J0YA 2NXYC 1RK0B 3D85A 4L9DA 4YZFF 2QQLL 3BDXA 5DI8B 2OL3A 1DVFD 4LSUH 1XGTB 5KJRH 1TVDA 5D7IB 4ZTOH 1HCFX 5J56B 5DYOA 1GGBH 2YUVA 1MEXH 1LE9A 3EDFA 1B6UA 2BNRE 3NIFE 5JIHA 2DQJL 3MX0A 2A6JB 2HKFH 1U3HB 4K2UL 4R26H 1I9JH 4LASL 4U6VL 2ZCKL 4HAFA 1IILE 4PD4J 4Y5YC 1D5ZA 1TJGH 2BC4B 5B8CB 4A6YL 3WNMA 2NR6D 1CE6A 2EDBA 2Y4SA 2I60H 4DUVA 3NZ8A 2XKUA 4YIQA 1JHLL 4M3KB 5I8EA 1MNUH 1OARH 2EDTA 3O8XA 4ODXB 4LLVB 3P77B 2V6HA 1G7IA 4YBLB 1IC5L 3VXUA 4H1LG 1ADQH 1INQA 1F58H 3PL6D 4R4BB 2YA2A 3BN9C 3P3YA 3FO9B 3Q1SH 2A6KB 4LSSL 1F6LL 1V8HA 5T3XL 5E08L 4R6UA 3KPOA 3A6OA 3D39D 3N06B 3OX8B 4ELKB 2BVTA 5IB5B 2UYLA 3L3IA 5GJTH 3DVFA 1KN4H 1F4XH 4ZOAA 4U1LB 4ONHA 1NAMH 3DMMC 5FYKH 4N5ED 2D4DA 1VFAA 5GZND 1FL5A 3DVNA 3X17A 5INCB 4MD4A 5IFJB 2RFXA 1IEAB 3CVHL 2ADIB 3C6LB 3DX9B 4G6MH 2GK0A 3BEVB 3IGAB 2OMBA 3SDXE 2HAZA 4LCWB 4FA8A 5HHPA 2NYYD 1KPUB 2NY6B 4P3CH 2IADA 4E42A 1YECL 3PP4H 2E6JA 3PGFL 5FV1L 4OIBA 4WUUA 1IQWL 3L6FA 4JLRA 3E0GA 4UOW1 4FFYH 4QOKA 3AU1A 1BOYA 4E0RA 3VFMB 4OQTA 1YPZA 4IIQB 5DMIH 3B8SA 3BPNC 4ZAKC 1IEBA 4Q74A 5LCVL 1HXMA 3KYKH 3MV7B 3REVB 1E4XH 1HSAB 1OCWH 5EU3B 1OGAB 1Q1JH 1FVCA 4CNIB 3OXRA 3VXSE 3VXQB 3ALPA 1NANH 1YQVL 1G9MC 5B38A 2I9TB 4FFZH 4P23D 3VD3A 1HOCB 1RZ7H 3KLHC 4IJ3B 2CLZA 4IRJA 5GS1B 3D0LA 4KK9D 1YNLL 5I16B 1AXTL 2DBLH 2AJXL 2UVFA 1VFUA 5IT2L 3MRIB 4MZ2A 4JKKA 4NRYB 1TPXB 4JFXA 3GDBA 5D1QA 5FYKU 2Y25A 2Q76B 3RWIA 1HHIB 3NIFF 3K1KC 1N6QL 3QDMA 1A14H 1RIUH 2R0WH 3HR6A 3IS1X 1WQVT 3C9NA 4OD2A 3BGMB 4JFQA 4PGCA 3N1MC 3IDIA 4WV1C 1YEEL 2JCCB 5C0AA 3V0WH 2BK8A 5FUZL 5C0CE 1D5IL 4ONFH 25C8L 4MCYA 1S7VB 3U0PA 2D0HA 3KXFB 2PYEA 2Z9TA 4NQCE 4R97B 4QRSA 3K74B 1A21A 4NDMA 4W6YB 4L3EE 4FZ8H 2YD4A 3NABL 4NKDB 3DYPA 4XPGH 3AAZA 5A2JH 3TJHC 1YMMA 3L5HA 5C0EA 5F1NA 4UOJA 3DRTA 3LSOA 4E41D 3OHXB 5CIPH 3KPNA 4S1QL 5DK3A 3MA7B 4HEPG 4BFGA 3X13B 1S7TA 3NA4A 3PL6B 4A2LA 1VPOH 3VFWB 5IB4B 2EIZA 3QULB 4W6WB 3HG1B 4OLZL 4YHPA 5LXGL 1DDHA 4HWBH 4BSVA 2J6EH 1CL7H 3ULUD 5GGVH 3RWJB 2W0FA 3U82B 1UM4L 5JNYA 3SCMA 2UUDH 2WBJA 3T0EE 1MLBB 4GW5B 4D9LH 3MXWL 1QYGL 5KS9E 1D5BB 2QSCL 4M9OA 3SDXF 1FGNL 3D48R 4GRWB 4JFEA 1RJLA 3BVNA 1A7RH 5DS8B 3SDAB 3UDWA 1CLOL 3GMNA 3H2WA 1C12B 1JPTH 2VH5H 5FM4A 2VXSL 4OAWB 2A6DB 4KH2A 3G04B 3OQ3B 5HYQB 3PP3H 1OF2B 3ES6B 4OM0L 1CICC 2Q86B 3H7BA 3EDDA 3ZHKA 1Q9WB 1T0NB 5D6DA 1YEFL 4WY7L 3TVMA 5DVMA 1A6ZA 1F6AB 3MV11 5BZWB 1JRHH 1N59B 4F7TB 1N5YH 3QXTA 3BMWA 3MUZ1 1S9XB 1HH9A 3MLVH 4YJZL 4PJAE 3ZSTA 2APFA 4G7VL 4GRMB 2FHFA 1PZ5A 3V6BR 3J7HA 2VXVH 1G7QB 3V6OE 3KLAB 5CEZL 2X4NA 4ALAH 4OLUH 2VLKB 1L0QA 3PGCA 4Y16B 3S4SB 4K3EL 1HI6B 4P23B 3C60A 1U95B 5SWZE 5F7MC 1MFDL 1IC1A 5ILTH 4KI5D 1HHHA 5LGHH 5CILH 5FA3B 2AKRB 4ODTH 5EWIH 2Z31D 4YPGA 5F3HA 1UWGL 3VXPB 4YDJA 4JVUA 3QA3A 4NP4L 1CT8B 3A0OA 1CGUA 2M8XA 2J8HA 2XKNB 1WCQA 1TVHA 2AEWA 3IFLH 3W0WB 3V4UL 4LPWA 3LKQA 5T3XD 1CFVL 3SE8L 1IGCL 3BHBB 3V5HA 4MXVF 2VE6A 4HHAA 8FABA 2ZJSL 1TCMA 5ADOL 4I4WA 3VCLA 5D7LD 43CAB 3SKUD 3QI9D 4WHTB 4ODBD 3JV4B 4U1JA 3GIVB 3V7AG 4HPOH 3L7EB 1EMTL 1FSKC 3BP7A 4YQXH 5EULV 4FTVE 3WFBH 2J8UB 1LE5A 5EOCH 2OBGA 4M62H 4OSUL 4QCIB 4Y1AE 5DVLA 2BOCA 2H2SC 1G9ML 4NQTA 4KY1H 2XY2A 3OKOA 3C6SA 4G9FE 3BT2H 5HHOE 1XF5A 3VI3E 4BUGA 5I1KH 3BKYH 2PR4H 5BO1L 4XXDB 4MA3B 1JF5A 3EKCA 2IFGA 2R2HB 2C3GA 4K8RH 3P2TA 1GVIA 4XPHL 4YXKL 4EQ3A 5JDSA 3T2NL 2KQMA 3S35X 5GS0L 1IAOB 4OM1H 1JN6A 4YFLI 4JRWA 4XNMA 4M7JL 4WCYL 1BBJA 1ED3B 1LWRA 4QRTA 3MRHA 5EU6B 3O2DL 1S7SA 4KV5E 4N9GA 5HD8C 2HTLD 3PDGA 2FB4H 3RDTC 3NIDF 2R1WB 4FQHB 4XPTH 5F9WB 5JA9A 1I9IL 4GFTB 3X3FL 4H5SB 3OZ9H 1NEZG 1F3JA 5T5NF 3G6AB 4MJIA 5D2NC 4NN5B 3D87B 5C9KA 3RGVC 3IJHA 4DN4H 3AXLB 5DLML 1RPQA 4RGOH 3FB6A 5DJYA 5GXBB 3STLA 4NZTH 1IGFL 5GGUB 2XXCB 3BUYA 2Z35A 3VFTA 2B2XH 1VB9A 4G3YL 1V5JA 3WN5A 4PJ5D 4KPHH 5DMGD 4Y5VA 3GB7B 1J11A 2ED7A 3U7WH 2GJ6D 5ENWA 3N85L 4NCC1 1GGCL 5FHBL 2BY1A 1SVCP 1HYSD 2A83A 3V0VA 5D2LE 2XN9D 4GW1A 4YDKL 1C5CL 2R1XA 1IFHH 1ULVA 5CEYA 4I3RH 1FFQA 2VZSA 3QYCA 4HPYH 4A6YB 3T4AB 1S78C 4HUUB 1MFAL 3C09C 3MRJB 1Q94A 1RJYB 1A1NA 3S36L 3V52L 3C2AH 2QHRL 5CZVL 5A3ID 3DUSB 4R8WH 1MIEL 2Z31B 1R3LA 4UT6H 4AK1A 3T0DA 2I5YH 5AZEH 2XNAA 2EC8A 3MLSL 5IB3A 2PN5A 3UZQA 1XGRA 4RAVB 2FLRT 4GXUM 3RUGE 1E4KA 2DQFA 5KTEH 5FM8A 5KBNC 4Q6YA 5IUSA 5ACLA 4PRIE 2FJHA 4U49A 5ALCH 3LOWA 2DOCA 1JL8A 3QI9B 3WO3B 3HFML 3WO4C 5I6XC 1FYTA 1UJ3C 2BNQD 1MQ8A 3QCTH 4JQVC 4HUVB 5FYKE 5ICZA 3V8CA 4K7PY 3TNNB 3RZCA 3GJFA 1SBSH 2VL4A 3CVHB 3MA9L 3MFGB 3MNWA 3QIWB 2ZUVA 1BD2B 3MQIA 5J13B 2HWZL 2SEBA 1X4YA 2DDQH 2XOTA 5DUBB 1U8QB 5D72L 2R0LL 2IFFH 1DE4B 3QEUA 4U7SA 4WFHE 4CN1A 4LCCB 4P4KC 2BNRD 1PG7H 2P4AB 1BZQK 5J06A 4B41A 1P4IH 3LB6D 4LMQE 3BN9D 5DMJB 2BY0A 4KV5F 5GIRB 3OAUL 4LLUA 3LHPL 4OZIE 1T21B 3TZVC 3QDGE 5DFTA 4HDIB 3EJYC 4M6AA 2DTMH 5J1TC 1HILB 3QP3A 4U0QB 1RZGB 4YPJA 5FV2A 5E4EB 3BOVA 5CEZD 1YZZA 3P9LB 5F1IB 4PJCE 2OQJB 2DLFL 5GGSA 3GFUA 2FZ3A 1RUKL 2BFVH 1UVQA 2GY5A 3B9KB 3BPOB 4XBEL 5HHNB 1KEML 1Z5LB 1E27A 1BWWA 2GYSA 3FQXB 3U36B 4OCRH 5B39B 1BFOB 5DMKB 3NAAL 3CFBB 1HNFA 5FM5M 3ECBB 5T1LA 1DQLH 3O11B 5EUKA 5D93B 4TUKH 5HVWA 1HEZA 1I7TB 5M7QA 4HKZA 5DRXB 2AVGA 1OAZH 4JFPB 5D2LF 4XNXH 5GRUH 3V6ZB 2YBRA 3U9UA 2ZCLL 5DQ9B 4LRNL 3ARXA 4S2SA 4NFBA 2XRAH 5IFHH 1ZGLA 2AP2A 3HE7A 4GKSB 1IRAY 1RK0A 3W11D 2XN9B 3THMH 3BIKB 4LL9A 1AGCB 3H3BC 3HC3H 3OAYK 5DI8A 3MBED 3V4PH 1A02N 5DJZB 1XGTA 4X4ME 5I30H 2ZUWA 4P99A 4TSAH 5D7IA 4YX2H 4PJ9C 4W81A 4K3DH 1JI1A 1I85A 1U8MB 3W39B 1FN4B 5AAMA 3E1F1 4XP1L 3QCUL 2A6JA 3PWJB 4GRLD 1SY6A 1U3HA 2NXYB 4AG4H 2C26A 2RCSL 3RBGA 3LPFA 3O9WC 3LIZH 3VXSD 2BC4A 5B8CA 1GRWA 3ZE1E 1UZ6F 1KLUB 4IMKA 4XVJL 2UUDK 4A2MA 5LQBH 4Q9RH 4UT7H 1MHCA 1Z0NA 1FE8L 3V8OA 2B1AH 3DV6B 2ZUTA 4ODXA 4LLVA 3P77A 5JW4Q 1PG7X 1JGVL 3ILPB 3O6LH 1D6VL 4DZ8B 1MY7A 4Y5YB 3QO0B 4R4BA 1BQLL 3PQYE 1AKJD 4U31A 3FO9A 4Y5XC 2A6KA 4QO1A 4P2RD 5CFHA 2B39A 3F6IA 3OKYA 3QUXC 2HT3C 3OX8A 4ELKA 1Q72L 2MTPA 3LRHA 4MMXC 5FUCE 1FG9C 5IB5A 4R2GD 4F8QA 2AJSL 3JVGA 4M4RA 4CUCA 4U1LA 1OW0A 4ZS7H 5TF1H 4N9OB 1F4WH 1INEH 1LO4L 2PCPB 4GOSA 4V2BA 1JNNL 5INCA 2YXFA 4DTGL 5F7KC 3VFSB 1BFSA 5EU7C 1IEAA 3UJJL 4NQCD 3C6LA 3DX9A 3OJDB 3BEVA 3IGAA 1NC4B 3MCLL 4LCWA 3D3VE 4I2XE 1MHEB 4LAJH 1KPUA 1LVEA 5I8OL 4KQ4H 3DMMB 1WZLA 2B1HH 4G8GB 2AABH 3FFCD 4ZDHB 3UTTB 4MNHB 5H37H 3VFMA 4MD0B 3BKCL 3KPRB 4IIQA 4PREB 4G6KL 5E8NB 3UJTL 3AROA 3MV7A 3REVA 1HSAA 2WK2A 5EU3A 1OGAA 3WS6A 4CNIA 3MTRA 1T2QL 2KZ1B 3VXQA 3NOIA 3HC4L 4XVSH 3T0ED 1BBDH 4L4TB 2FBJL 1A7OH 2I9TA 4QTIL 1NCTA 2JJSC 2Y5TB 1HOCA 4ODSH 4PP1C 2FRGP 1I4FB 2EDNA 5GS1A 5JOFB 2W9LA 4ZAKB 5I16A 3BPNB 1Z9LA 3SOBL 4ZPTB 4C56B 1T7VA 3MRIA 1UM5H 5EOTB 5C09E 4NRYA 1QLEL 4W70A 5JQHC 4S0TD 1EEQA 2Q76A 1HHIA 1BVZA 5E6IC 1AR2A 1MAML 4X6DA 5AYUL 2P5WE 4HUXB 3O3UN 5JIIA 1KC5L 3BGMA 4LHUB 3ZE1F 4FXKB 2JCCA 5DK2B 3G08B 2Y36H 4FP8L 3CH1B 4NQDB 1TZGH 4IOIB 1S7VA 1QSEE 3KXFA 4LEOB 2CGRH 5C0RH 2CPCA 5I1LB 3PWNB 1FBIH 4NKDA 2ICWB 4WDIB 4U6XB 5SWZD 3BWAB 2MKLC 2WLYA 4HMCA 1X3DA 4WV1B 3IFNL 3LMJH 4LHQB 5IVXB 5D96C 3BZDA 3OHXA 4U3CA 3TCLB 4URTB 3MA7A 1L7TH 1NMCC 1JHTB 2H2SD 3X13A 3PL6A 3VFWA 1N0XH 4R0LC 5DUMH 5IB4A 3QULA 3ZT6A 3HG1A 3TBTB 4P2RB 3SPVB 3RWJA 2BSTB 1X5IA 5E00B 3NA9H 3ZKND 2CK2A 1MLBA 3TFKC 3GHEH 3CLEL 4GW5A 3QUZC 2CDEB 1D5BA 5TFSL 5ICXB 5TPWH 3C5JB 4X7SL 1S9YB 4KC3B 4Y1AD 3N0PB 3O2VH 1J5OH 1E0OB 4TUJB 2DQHL 5D7JC 5DS8A 3SDAA 4O2EB 4LEXH 1C12A 1H0DB 2FX9H 2P5EB 4ZSOE 3S37X 4RZCB 4OAWA 2A6DA 3G04A 2R69H 1GIGL 4PJIE 1OF2A 1OTTC 3ES6A 4G9FD 5HHOD 2Q86A 2VSDA 4KK5C 5L7XH 1UH3A 1H3UA 1Q9WA 3T3PE 2Z8WC 1T0NA 1F6AA 3ARBC 5BZWA 1N59A 4F7TA 3HC0B 4OIIL 1S9XA 3NACL 3RGVD 1C5DB 4MCZB 2FNBA 4OLVL 2A1WL 4GT7A 4V1DE 4M6OL 4GRMA 1J8HE 1VGEH 1I9RH 3RU8L 4NUGL 1CICB 3AGVA 2XZQL 1G7QA 5D5ME 1LGVA 3KLAA 4OZGE 3UMTA 2VLKA 1LNUB 5JO5B 4Y16A 4IRZL 3S4SA 2VXTH 1HI6A 4P23A 1U95A 4QXTB 2BJML 4Q0XL 5GZOC 3U4AA 1H3PL 5FA3A 2AKRA 3QDJB 3HPLB 3VXPA 1CT8A 2XKNA 3W0WA 1JWUB 2AK1H 2I07B 4H0IA 3I50H 3ZYIA 1KFAL 3W9EB 3QPQC 5MHSD 3VJ6B 1CDUA 1G7JB 5E9DB 4OB5H 4F15C 4XMKH 1B2WH 43CAA 4WHTA 1TETL 3JV4A 4NZUL 3GIVA 1I3GH 1C5BH 3L7EA 2AJYL 2J8UA 1KELL 3U46B 1NCDL 4JDTH 2W92A 1QOKA 3EBAA 4QCIA 2GSIB 1YJDC 5JQ6H 4KUCD 1D9KD 4N8VG 3N1QC 4OCWL 3K2UL 3H9SB 5HHVH 4PBXA 4OGZA 4LHJB 2G5RA 4IS6B 3MJ9A 3OV6A 3SDDD 2HVKB 4NOFA 1O5DT 4X7DC 2KL6A 4LPVA 1LEKB 3M1BB 4XXDA 4MA3A 3RVTD 1QHPA 3AM8C 1FSKB 1MCDA 2R2HA 2IQAB 4NQUA 3GBML 3B43A 5HYJE 1QKZL 4WFED 1TJHH 3DX8B 4OV6F 1BQHB 2QQNH 5CSGA 1IAOA 1AI1H 1I1AC 4EI5C 1EJOL 3CFCH 4JVPA 3WXVL 4F7PB 1WC7B 1ED3A 5EU6A 4MDIB 5EZOL 5TDNB 3T3ME 1RURH 4Q6IC 4UTBH 2R1WA 4FQHA 2EH8L 4YBQC 1S9KC 1YEIH 1MCSA 4JR9H 5ADPL 3CZFB 2FJFB 4H5SA 1RIHH 2CR6A 3G6AA 3NCFB 2UWEE 5D71H 3EJYD 3T3PF 1YN6B 4KJWD 4ODHH 5EZJB 3WYRA 4NUJB 3AXLA 4Z8FL 4HJGB 4PGJA 1UACH 1WAAA 2BDNL 1D5XB 3RI5K 5GGUA 3QG6B 1QSFB 3RDTB 3O2WL 4WFHD 3TA3C 4JFDE 4K07A 3GB7A 5D2NB 1ERNA 5D5MF 4QWWD 4OZGF 3K8KA 1AFVH 1GOHA 3RGVB 4MB4A 1NCBH 3MSPA 1I3RB 2P42B 4XTRD 1ZOXA 5LG1A 1R5WB 3LKNB 5CHNB 4YWGH 1N4XH 3WIIL 5BV7C 4AMKH 1FDLL 4A6YA 1Q9OB 3T4AA 1QFPA 2YZ8A 3C5SB 3NZHL 4HUUA 4JO3H 1FIGH 3MRJA 1X5GA 1RJYA 3BD5A 4LPTA 5AZ2H 1IM9B 1OPGH 3NCMA 4W68A 2VN4A 3HN3A 3DUSA 3BH8B 1X4XA 2Z31A 4OD3H 3H9YA 2YPLE 3GK8L 1NMBL 2FO4B 2MCG1 2NY0C 3TNMB 1OLZA 1DQMH 4RAVA 2RB8A 3C09B 2FATH 1HNGA 5I18H 3UYPA 2ITCB 3QI9A 4HUVA 2OJZH 2DQDH 5F8RC 2FWOB 3TNNA 3ARWA 3MRMB 1UENA 4P46D 3CVHA 1N6UA 3QIWA 1EZVX 1G9EA 1BD2A 3OKNB 3U0WL 3A67H 1DQQB 3AS3A 1IC4L 5BS0E 5DUBA 1U8QA 4XX1G 1DE4A 5CJXA 4LCCA 5B4MD 4F80A 1UKSA 4HQQL 3WO4B 2DM2A 1UJ3B 5I6XB 3O4LD 3HAEH 3MGTB 4H25B 1MCLA 5GIRA 3WKML 3LEVL 2UZYB 2YD3A 1T21A 3T2QA 3QUXD 4MZ3A 3UXFA 2XWJB 4HDIA 5CGMA 1FNLA 1HILA 4JREC 4UI2A 2WUCL 1RZGA 2K9UA 4O4YH 4NO0B 4P9HC 3P9LA 5DD5H 1TZHB 5F1IA 2DLIA 2UWEF 4H20H 2OQJA 4P4KB 3VFVA 5F3BB 4KKNA 4MSWB 5ISZD 2P8LB 1F02I 5I1HH 1NAKL 1L7IL 3B83A 3B9KA 1LMKA 5HHNA 1YJDL 1IAII 1Z5LA 3TZVB 1KB5L 1WICA 3FQXA 2O5ZL 3ESUF 3RPKA 3U36A 5DFWH 1BFOA 5B39A 4XGZB 5DMKA 4N1CA 3RTQD 1JTTA 1S3KH 2HLFC 4WUKL 2E6PA 5JUEH 3WD5L 2VLJE 3CFBA 3SE9H 3ECBA 3WBDA 3O11A 1F4HA 2YSSB 4ONGL 1FNFA 3R8BB 2MFNA 1I7TA 1QG3A 3CCHB 5DRXA 1NMAL 4JFPA 1UXWB 3V5DB 1KJ3H 2MHAB 1ZANL 3V6ZA 3CK0H 3UTOA 1F00I 5DQ9A 4Q58C 5D7KD 3H7LA 3WL9B 3DV4B 2OMNA 5JZ7C 4GKSA 3MRQB 2VZVA 1W8NA 2XN9A 5JXAH 3BIKA 3OKDB 2NW2B 1AGCA 3D3VD 1BGXL 4JRXB 1DZBA 5EC1B 4HUWB 1CXLA 5DJZA 5EA0H 2I27N 3EO9H 5DT1L 1A6VL 4FFVD 3BDYL 4K3JL 3KPPB 3MZGB 2VLME 35C8L 4HS3B 2FJGB 4LOUC 4ZFFB 2CRIA 1QFOA 1U8MA 1FN4A 2GW5A 3W39A 4X8JB 2VDPH 3PWJA 1G6RH 4LCIL 2J8OA 3BZ4B 5LJYH 4GXVL 1MFEH 4GMTH 3FN0H 4K55A 5I1CH 3T0BA 3HRZB 3F58L 1CDBA 4HFUH 2FGWL 4DAGH 1KLUA 1HHKB 1DBJL 3PJSB 1S5IL 1G7MB 5I74B 5J6HB 1C8PA 5EH1A 4PJ9B 4B7LA 2VLRE 4BFIB 4YGVB 4YHIB 3DV6A 3PXJA 1WTLA 1NLBH 4M1GH 2VKWA 1FRGH 3ILPA 4PJFF 5HVHC 5BW7C 3MRBB 5C09D 4DZ8A 3O9WB 4Y5YA 3QO0A 5BV7L 2JIXD 3JV5A 5I71C 4QHLB 3BRGC 3MV8B 4WEBL 4HS8L 1A7BA 1GZQB 2GCYB 3T08A 5BJTB 1CVRA 5KSBE 4F9PC 2EDHA 4WFGE 1D3CA 1IAIM 1KEGH 3OKMB 5A1AA 3ARGD 1K8IB 1PX4A 3FZUC 5FGBC 4JO2H 3QH3B 3O4LB 2IBZY 4JPWL 4K8RD 3GI8L 3NFPB 2PCPA 4RQQB 4Y5XB 3VFSA 1QSED 4LSVH 4C83B 4DKEH 4Z7VF 3OJDA 4JG1L 3QUXB 2AEQH 1NC4A 4HGKC 3K46A 5GISH 3MRKB 5DEGB 1TNNA 1MHEA 3TFKD 4NO3B 1IL1B 3WUWB 3DMMA 5JIKA 1IGIL 4G8GA 3VGDA 5ISZB 4PG2C 2BRRL 4ZDHA 3UTTA 1UXSB 5J3HD 4M6NL 4MNHA 4MD0A 1FAKT 2ADFL 4PREA 3KPRA 5E8NA 1U36A 3TWCL 4FOMA 4YHMH 5DD1L 1A1OB 3MJ8B 2CUMA 4L4TA 4PD4K 3I75B 2Y23A 5AWNL 5JW4M 2Y5TA 2CXGA 4Y4FD 4LSTH 4GW4B 2N4IA 4UV7L 3C5ZD 3TT1L 1I4FA 5JOFA 2VR4A 4ZAKA 2YMXL 3GIZH 4HH8A 1RY7B 4LCYB 4HK3N 4RMRA 2Z92B 5FYJH 4ZPTA 4U6HB 4C56A 3EYSL 5A2LH 4G43B 5EOTA 1XGQB 4P9MH 2LABA 3FTGB 4P9HL 4KKLD 5IHUH 5I8CB 1A1MB 2AEPL 2H32B 5TQ0H 2GI7A 1REIA 5I73C 2WWMD 2BVOB 1O0VA 1BQUA 4HUXA 5T1KB 4Z7NF 1LDSA 2O5XH 2W9EL 2DQTH 2PTTB 4LHUA 1CE1H 4FXKA 5DK2A 4I9WE 4GBXC 3MRGB 4V1DD 3G08A 3UTPE 2HT2C 3CH1A 4NQDA 1UWXH 2FBOJ 4K71C 1YYML 1HXYB 4IOIA 1PSKH 4L5FL 1C1EH 4LEOA 5E6IB 4HLZG 5I1LA 3PWNA 1IBGH 4W4OC 4FMFA 2ICWA 4XP9L 4JG0L 2VZ3A 2FSEB 4WDIA 4U6XA 3O2DA 3BWAA 1JYNA 1K5NB 3CU1A 4WV1A 3OR6B 1RIVH 1TXKA 2DJ4A 3CMOL 5IVXA 2FD6L 4ELMB 1HZHL 2V7NB 4PLKC 4XCNB 1F11B 5KSBF 3GJEB 4GAGL 2OL3H 1JHTA 5TE6L 4D3CL 5EZIL 3TIDB 1YDPB 2WBWB 3TBTA 4P2RA 3SPVA 4Z78B 2FR4B 3KHOA 2BSTA 2EEDA 1BFVL 3BP6B 4ZOCA 5FYJU 5E00A 4JGJA 4YE4L 3VXMB 1QLFB 2CDEA 5D96B 1LO5B 4D0BB 1SYVB 2GAZB 4HJ0D 5ICXA 3BP5B 4F57H 1CXKA 4XPAL 3C5JA 1ZEAL 2OI9C 1I1AD 2FX7H 1NMCB 3IDGB 4R0LB 2IJ0C 4WIQA 5IESH 3UBXG 4TUJA 1CGYA 3QUKB 4QXWA 4RGMC 4O2EA 2AQ2A 1H0DA 2P5EA 4KJPC 4RZCA 1UKQA 3E3QE 3MV9E 5MI0B 2YPVH 3QUZB 3S88H 1TNMA 5DQDL 3LZFH 1EIBA 2AJVH 2GQHA 3HC0A 4OJFL 2FYYB 2ZUUA 4PRHD 3TV3L 5L2KE 5D7JB 4MCZA 1NFDE 3ARFC 3EYUH 4FZEH 3MUY1 4X6BB 4QRPE 4RISH 3P4LA 1Y6KR 1KCVH 3MLZL 1H9VA 4M8QB 1UWEH 4O51B 1CICA 1T03L 2DICA 5IBLD 4Z7WB 1LNUA 3B2UC 5JO5A 4HUNB 3OXSB 3ARBB 2GK2A 4CVXB 2JF1A 1TVBB 5DHVB 4QXTA 1H3VA 4DOHE 4KKBD 4H1LB 3FQNB 3QDJA 4FN0A 3HPLA 4NKMB 1LO0H 1AY1H 1JWUA 4P2CG 1V7ML 2I07A 4KHXH 2XQBL 1QFWI 2JB5H 4NC0B 4Z7UE 4NQEE 1J88A 1KYOJ 1KCLA 3W9EA 2ARWA 1JYWA 4PY7B 4AL8L 2I24N 1HCVA 3VJ6A 1G7JA 3QJHB 5E9DA 4OQTH 2I25N 1ZHBB 4S1DC 1RUAH 4LNRB 1ZT7B 1EFQA 3U46A 3BAEL 2Y07L 3R1GL 2GSIA 2UZIL 5LWYL 3P9WB 1FYHB 4YXLL 1RVFH 3H9SA 1RAMA 4IS6A 4TRPL 2AJZB 2HVKA 5FKAB 4ZOEA 4AEIL 3GM8A 4F15B 4GAJH 3B3IB 4NKIL 1GGUA 4NJAL 1LEKA 3M1BA 1CYGA 4OCYH 1CGWA 2IQAA 1GC1H 1QHOA 3LN5B 2XYCA 4KMLB 3DX8A 1I3VA 1BQHA 4DKDC 3DYMA 1KB5B 2BY2A 5ITFB 4WHYH 5EOQH 2DD8L 4FXLA 2J7LA 2AJUH 4MS8C 5TE7H 2NY1D 4F7PA 1H3GA 1WC7A 4RDQG 3QQNA 1UZ8B 3AC0A 1NBQA 1YEGL 4ONOA 4NM4L 4MDIA 5E8OB 5TDNA 2QADD 5JDJA 1DBAH 2FJFA 3CZFA 2F15A 3UC0H 4X6EB 1MJUL 1I1AB 4EI5B 1YN6A 3L1OH 5EZJA 4FABL 4NUJA 2YR3A 4HJGA 4D9RD 1NEUA 3X3GL 4WFFE 5AAWA 1DQTA 1D5XA 4WENB 5BS0D 3QG6A 1QSFA 4OZ4B 5DUPH 1WVZA 5D1XD 4Q6IB 3RDTA 2ZUYA 1NFDF 1GGYA 3B5HA 1YEKL 3P0YL 5D2NA 2Q3AA 3IDJB 4KZEH 2HLFD 1T5WB 3IVKB 3RGVA 2OTPA 3L9RB 4XPFL 2W0PA 1T3FB 1R5IB 1I3RA 3JTSB 3IJYB 4JY5H 5KVGL 4K7PH 3VFGH 1R5WA 3BFOA 3JWNC 5E2TH 3LKNA 3D2UB 5CHNA 3HZMB 2LFGA 4HEME 3TA3B 1OB1B 1Q9OA 4N0RA 3BUTA 3B2VL 3C5SA 1ZXQA 2QR0B 3T0AA 3KPLB 3R4DA 1IM9A 4B0MM 5JZ7D 3S9DB 1IC7H 3BH8A 4OLYH 1SJEB 2VQ1B 2UY7A 1DLFH 2FO4A 1TDQA 1Y18B 5BV7B 3TNMA 4XP5H 3UTSB 3AREC 5E70A 1Q8MA 2HA1A 1WZ1L 3GSNL 4J23A 1J1PL 3HLAB 3FT3B 1A47A 5DA0B 1P53A 4XP6H 4CBPA 2HLAB 1K6QL 2ITCA 3HNVH 4JM2D 1BZ7B 5IVZB 3WHE0 3RY6C 4KTEL 3T4YB 5DQJB 2VDOH 2NY0B 2FWOA 5I15L 1LK3L 4WW2F 3MRMA 3UO1H 1E4WH 3CU7A 4GQPH 3G5ZB 3WE6B 3GGWB 1LILA 3OKNA 3MRCB 1KENL 1RZKH 4Y2DC 1G0DA 1H8OA 5DD6B 1DQQA 4E9LA 2VLMD 3S5LG 4PLJD 1W72L 1XIWC 4LU5H 4RGND 1UJ3A 2EDQA 4JQVA 3MGTA 5IMKB 1LEIB 1T7WA 4H25A 5E5UB 1KPRB 1I75A 4UT9H 4GSDL 2D7TL 4ZUTB 3C8KB 3WLBB 4Z7QE 5TQ2H 3MLYL 2HFGL 5EORL 4PJGB 2XWJA 2D03L 5DSCB 4DGVH 5KVFL 4DGYL 5FO9B 4NO0A 3RKDC 3CUPB 1A4JB 3VA6A 1TZHA 2VLRD 2WUBH 3KPQA 4P4KA 5F3BA 1EJ6A 1OSPH 4MSWA 2NZIA 2P8LA 3ZO0A 2OLDA 2MOVA 5KVDL 5FAAA 4M02A 1KPVB 3TZVA 4XGZA 5CKGA 1MCWM 1R6VA 4JREB 4LPUA 1WV7T 5FYJE 4Z9KB 2YSSA 1XR9B 2AQ3A 3P11H 3IDXH 5HPOA 1JF6A 4PJFB 4UBDD 3CCHA 3FFDB 4LMQI 1E6OL 1UXWA 3V5DA 2MHAA 1F97A 4OF7A 3GSXB 4P59H 4JN2B 4JE4B 1N5AB 3SN6N 1VEPA 4DN3L 3WL9A 3NCJL 4OLWH 1E4XI 2YZ1A 3PWPE 4APQC 2P44B 4YXHL 1F6FB 3DXAE 3MRQA 4KMTL 4Q9QH 5C0BE 3OKDA 2NW2A 5IROC 5C3LD 1GXEA 4ZD3H 2V5SA 1NANI 4JRXA 2P8MB 3I3EA 5EC1A 4XAWH 4HUWA 3OG6B 2CR3A 2CLVB 1U9KA 1WBXB 2OR7A 3NTCL 1K4CB 1I8KB 4Z7VB 3KPPA 3NIGE 4HS3A 2FJGA 1CGSL 5DWUH 4ZFFA 2YUXA 5T3ZH 1IGYB 3T8XB 3QFJE 5L6YL 4X8JA 4KUZL 1K8DB 2V9TA 2H9GB 1ETZB 2DMKA 3I6KB 4I77L 3BZ4A 1OVZA 5A16B 5DFVD 1FNSH 3HRZA 4NWUL 4MNGB 3BDBA 3DROB 1HHKA 3PJSA 3F12B 3C8DA 1G7MA 4X80L 5J6HA 7CGTA 4PJ9A 2A9NL 3WDHA 3FT2B 4BFIA 4YGVA 4F9LC 5DA4A 3RVXC 4YHIA 4WNQB 1N6VA 3MXVL 1H8NA 1NEZB 1A6WL 1AD9B 3MRBA 1LP9B 3O9WA 5J8OA 3FT4B 3WFEL 4QHLA 3FN3A 4HMDA 3MV8A 1GGIH 4HBQA 1GZQA 2GCYA 2APTA 1ZLVH 3D0VB 4OGAD 5BJTA 2C3XA 2B7DT 2VR9A 3OKMA 4OFVA 1V3LA 1VFBB 1K2DB 1K8IA 5HVHB 4I9WD 3VXUE 3QH3A 3WSQL 1VA9A 1NUGA 3O4LA 4KFZC 3E6HB 4R4FL 3NFPA 4RQQA 5I71B 2E9WA 5KJRL 4PGZA 4Y5XA 3CLFH 4C83A 1MJ7H 4FQQB 1CL7I 2IMNA 3QUXA 5CP7A 3ZDYF 4RAHA 3OMZA 1ZK9A 4YEEA 3MRKA 5DEGA 3RZWA 1RU9H 4L4JA 4NO3A 4M7LL 1IL1A 3TH4T 2V9RA 3WUWA 5FUOH 3WV0A 2C1PB 3EO0B 4OT1L 1DJSA 2O26U 5ISZA 2ICWJ 4KDTC 4C4KT 4PV9B 1HIMH 3GJFH 1UXSA 3I84A 4KK6C 3ORJA 1BMGA 3OJVC 1WEJH 1BF8A 2N7AA 1OARL 1MF2L 1ORQB 4PRPB 2VTFA 4JKPH 3RIFK 1A1OA 1VEMA 3MJ8A 3S34H 3I75A 1JRHI 1N64H 4WUUE 1SJVA 2MNUA 4GW4A 4QOKE 5CBAB 5JTWA 1PVHA 1DN0B 3FN9A 1QBMH 2HFTA 1YPZE 4EUPB 1AP2B 4CVUA 4LCYA 2Z92A 1T0PB 4U6HA 4JPVL 5CZXD 5BOPA 2ZSWB 4G43A 1A2YB 1XGQA 3NIGF 3FTGA 4TOYL 3L3KB 1F4XL 1N8ZB 5I8CA 1BVKB 1A1MA 1IGJB 3HPJB 3MV9D 3Q6GH 4ODWB 1JZ5A 1TCRB 2H32A 1ZA6B 4HKBB 2ZKHH 2BVOA 2JJSA 2CH8A 5T1KA 4AZ8A 3WS3B 3DUHA 1FNGB 3TEUA 2PTTA 4Y4KD 1JYXA 3EFFB 1XF4B 5IP4A 5AG8A 4MD5B 5FYLH 3MRGA 1RZFH 3SO3C 3GEWB 4PRAB 4QRPD 1QRND 1HXYA 4N90E 5K9QG 1OAQH 5C6PB 2HJFB 1TQBC 3RVWD 5E6IA 1P9MC 2VXUH 3MACL 5F7DB 3QDME 1P69B 1EGJL 4RCAA 2FSEA 1T4KB 1K5NA 4XWGH 2YC1B 1WCBB 3BPLC 4JY6B 1OHQA 3OR6A 1OCWL 4GBXB 5C0AE 1HWHB 1MPAL 1Q1JL 4ELMA 2V7NA 4XCNA 1F11A 4K71B 3GJEA 4M5YH 2NX5B 5D70L 2EE9A 2CXKA 3TT3H 5GPRA 4DVRH 2PYEE 3TIDA 1YDPA 4N0FB 1RZ7L 2XZCH 3B9VA 4LSQH 4Z78A 2FR4A 1JGUH 3QSKB 3BP6A 4MAUL 1HN1A 4ZNCD 3BD3A 1IKFH 1YMME 3HNSL 1SY6H 3FRPG 3VXMA 3X11B 1QLFA 3WHXB 3QXUA 1LO5A 4D0BA 1SYVA 2GAZA 4OLXH 3BP5A 5INDB 2EEBA 4O58L 3CVIH 3IDGA 4R0LA 1RIUL 3QUKA 3GHBL 3V6FB 4ERSL 3PHOB 2ESVB 4FQIH 1OP5H 2GIYA 4XNUH 5I1EH 5IK3B 4IM8A 5C0CB 1UFUA 2HT4C 3QUZA 1T89C 4HLJA 2WLZA 2ZG3A 4IDJL 4M1CD 4P57B 4Z0XB 1CLZL 2AV1B 2OI9B 5GGRB 4I8DA 4JFEE 3CDFA 2FYYA 1X5AA 2OTUB 4L3EB 4YHLL 1QSZA 4GXUN 5D7JA 4FQJH 4RGMB 4NC1E 3RIFF 4X6BA 1DBBL 1ZS8B 3H8NA 4M8QA 1YQ2A 2E3VA 4O51A 4Z7WA 2N1KA 2ORBH 3OXSA 3ARBA 1N3NB 2HJKB 4CVXA 3GSNB 1TVBA 1T20B 5DHVA 5GHWL 3U1SH 5E6ZA 2X89D 4BQ8A 4H1LA 3FQNA 5DXWA 5GGTL 3ARFB 3CPLB 1AIFB 4NGHL 5GGVL 3T0XA 4XPBH 5CCKH 2LU3A 4WFFD 1FLTX 5D6CB 2C3VB 4WO4C 3LDBC 5C7XL 5KS9B 4LRIC 3H9HB 4OF3A 1L0YA 3UPRB 1X6NA 1A5FL 3C08L 3S35L 3NH7H 4PY7A 4EN3D 3QJHA 5IB1B 2VNCA 4FQ2H 2YUZA 1K3ZA 3IT8D 1ZHBA 4FMKA 1W72B 4LNRA 2VH5L 1ZT7A 5GRWA 1ORSB 4U1NB 1BZ9B 1PBYA 2VQUA 5BVPH 3MFFB 1WBYB 5CSBA 1SJXA 4IRSC 2AJZA 4LARH 5FKAA 2E8YA 4ORZC 2EE3A 3B3IA 4LGRB 4QNPE 2IQ9H 3H0TB 4JGUA 5CUSH 3DI3B 1G1YA 1FGVL 1KTLB 3LN5A 2CMRL 5MP6H 1KB5A 5ITFA 2FCBA 1U8NB 4LAQH 5AUMA 4GJTB 1F90L 2X05A 3QQ4B 1UZ8A 4ODTL 5E8OA 1EVTC 3DHMA 1FL3B 3AM8A 3T65B 3IFLL 4QGTA 1M7XA 4D0CB 4X6EA 3GSWB 2X44D 1I1AA 4EI5A 1JFQL 3WHE1 1MIML 2ZPKH 3HNTL 2OP4H 1MAJA 3J8F7 4KKCD 3EJZC 4ZFGL 4FTVB 3IKKA 1WIPA 3I2CL 4OZ4A 4Q6IA 2X70B 1X5KA 3BSZL 3IAGC 4Z0BL 1T04B 3QIBC 4MJIE 3IDJA 4YHOL 3N1GC 2JELH 1T5WA 3IVKA 2GJJA 3L9RA 5T3ZE 1DBMH 3BE1L 4J3WA 1T3FA 1R5IA 3JTSA 3OBAA 3IJYA 4R90H 4AT6B 3GRWL 4FQXC 4KTDH 3NCYS 3D2UA 3HZMA 2GSGB 1SYSB 1IGML 4LGPB 3U83A 4K94C 3TA3A 7FABH 1OB1A 5IB2B 4X7EC 1Q9KB 4GRWH 2QR0A 3SJVD 3N50A 3KPLA 1ONQB 4RWYL 4OM1L 2R0KH 2VLLB 1Z9MA 2E9BA 1SJEA 3GO1L 4HWEL 2VQ1A 3O0RL 5ITBH 3QHZH 4RBPK 5FYJD 2FB4L 3GNMH 5HTSA 3UTSA 2NY2C 3ARZA 4ODVH 3LKPB 1NDMB 2IAMC 3ISWA 4P2OD 3HLAA 3FT3A 2HLAA 1BZ7A 5IVZA 3UAJD 5I1GL 4NZTL 3MODL 3T4YA 3PWPD 4M8VA 3DXAD 5DQJA 3RAJH 3VWKC 1ZLSL 4QNPF 1MREH 5F89B 2R1YB 3E8UL 3G5ZA 3WE6A 3GGWA 3TH2T 1NCAH 3MRCA 2C9AA 2Q1EA 3OKLB 5DD6A 5E2VH 2PUQT 4EBQL 1QUNA 4M7KH 4JPKH 4WGVB 4PS4H 3MREB 2AJ3B 1P4BH 4U1HB 1SM3H 3LS5H 3KJ6L 3QFJD 5IMKA 1LEIA 2Z8VC 1KPRA 4ZUTA 1RUPH 3C8KA 3WLBA 3Q2CA 2F5BH 3T1WA 4PJGA 4XHJD 2FIRT 3ULVC 5DSCA 3EZ8A 3K80A 5DJ8B 4Y2DB 5EIVA 1E28B 4NJ9H 4R7NB 4XC1L 3W2DL 5FO9A 3OF6D 1U8LB 3CUPA 1A4JA 1TITA 3RWDB 4UT6L 2NY7H 5GRYA 3Q5TA 12E8H 1B6DA 3SBWA 5FHAH 2CQVA 4I0KA 4MX7B 3RUGB 4NN7C 1KPVA 5HY9B 4JFHE 3BXNB 4PRIB 3MJ9H 3ZTNL 3FO0L 3DO3A 1XR9A 3WNOA 4PJFA 2Q7NA 3P0VL 4M3JA 3FFDA 3ZL4H 3O8XD 3G6DH 1C7TA 3LEYL 1U0QA 4Y19E 1RULL 4I5BB 3VXUD 4HWZB 2D7QA 3GSXA 3U30C 4JN2A 1N5AA 2VISB 3CZJA 3UTZB 3GBNL 5B38G 5FXCH 2DDQL 4M4PA 3VGFA 4PJEB 5FYLE 2VL5B 4N8VB 1RV6X 1PG7L 2Z0BA 2P8MA 3JUZA 4JO1H 3CIQA 2IF7A 1DFBH 4P2YA 2H26B 2CLVA 1WBXA 4N0UB 3HHRB 4HZAA 2VXQL 3QDGB 3KDMB 3BMVA 1K4CA 1I8KA 4Z7VA 1S5HB 2NXZC 3FHAA 4PJ7F 5HDQH 3SJVB 5DJ0B 2C4FU 4G7YL 1IGYA 1CDJA 4JFZL 3T8XA 1JI2A 5GJSL 4APQB 1K8DA 2H9GA 4BH8B 2E7LC 1ETZA 3I6KA 5MEQB 2QQLH 5A16A 2LQRA 4L4VB 4GG6E 1PD6A 3AS1A 3RIAK 4MNGA 4JM4L 3DROA 5D7IE 3F12A 4WUUD 3GSUB 3FT2A 4QOKD 3SDCD 2DQJH 4HXBL 4WNQA 1BREA 1MWAL 4AJ0A 4K2UH 1NEZA 2R15A 1RJCA 3VH8G 4LASH 1AD9A 4U6VH 4TUKL 3MRDB 1P6AB 2BVUA 2ZCKH 1LP9A 3FT4A 4LSRH 1VKXB 2JKXA 4K94L 4A6YH 1PY4A 1JHLH 1ND0B 3UTQB 5CKAA 3D0VA 1CF8L 5IV2B 4KVCL 4IRJD 1GSMA 2DYPB 1IC5H 2EYRB 1KGCE 1K2DA 4ZODA 5BW7A 3HC3L 1MY5A 5JHDB 3E6HA 3RRQA 3K7UA 4LSSH 1MJ8L 5D1QD 5E08H 5T3XH 4BELD 5I30L 5GQBA 1RSFA 4FQQA 1RZJC 1NC2B 1JZ3A 3QDMD 3D9AH 3DECA 4X7CC 1WFUA 3IRPX 4CU7A 4F9PA 3SGEH 9CGTA 2EDLA 5FGBA 2C1PA 3EO0A 4JO4L 4B7IA 4PV9A 4RDQF 1YNKL 2UV3A 3CVHH 2PYED 2Q3ZA 3O4OC 1EAPB 4FFWC 1OAKL 1DEDA 1ORQA 1WK0A 4LCWE 4PRPA 5CD5D 1UH2A 4YHZL 4Z95L 4JCMA 1A3LL 4JHZA 2HMIC 3PGFH 1IQWH 5JXEC 4PG2A 1JZ7A 1MELA 2CDGB 5CBAA 1Z3GL 3CFIC 3N9GL 1DN0A 1JGLH 1Z2KA 2XKSA 1AP2A 5ECJE 5C6TL 5LCVH 3ULVL 4MA7L 2DI9A 2IBZX 5T5FL 3MV7E 2ZSWA 1A2YA 3VW3L 5D9SB 3L3KA 1OGAE 1N8ZA 1BVKA 4KI1A 1IGJA 3SCMD 3HPJA 4ODWA 4X6CB 3H42L 4EXPX 1F4WL 1TCRA 3IDMB 5J9PB 1ZA6A 4HKBA 2FECI 1YNLH 4JFED 3WS3A 1AXTH 1FNGA 2AJXH 3EFFA 1PJ9A 1XF4A 4MD5A 5IT2H 5HDBE 5DD3L 4KDWA 5D7IF 4WW1B 4HUMB 4PRAA 5IW6B 1U3ZA 2WSKA 3O45B 3RIAF 4F3FB 2WNGA 2HJFA 5ACMA 2AXGB 1KLGB 1JHKH 1N6QH 2ZSVB 1CR9H 3G5XB 4WTZG 2Y6SD 4RA0C 2D4FA 2HRPL 3EAKA 3V9FA 3B8YA 4ZNEA 1T4KA 4JRYD 3S37L 2YC1A 1WCBA 1YEEH 3SDCB 2FEDD 3QCVL 4JY6A 5E2JA 2JCCE 4GBXA 3SO3B 5FUZH 3QUML 1D5IH 3D69B 2DRUA 2NX5A 4F8TA 1TQBB 1GOFA 4DFHA 4N0FA 3RWEB 3NABH 4W4OA 1VDGA 4FG6D 3C60D 3BQUC 1CD9B 1XGUB 4H8WC 4MQSB 3BPLB 4Z76B 3X11A 1NGPH 3WHXA 5D7SL 1LQSR 1B0RB 3TBVB 5INDA 4KTYA 4S1QH 1U92B 3U7AA 3IU4L 2P5WB 4L29B 1N7ML 4OLZH 4P2QB 2P24B 3V6FA 3RVVD 1BWMA 4TTDC 2EDDA 2QJDA 3PHOA 1BVLB 2ESVA 1UM4H 2W9DH 4BKLB 1IKNC 2XACC 3WFDL 4YH6A 5IK3A 5C0CA 4DQOL 2Y36L 3MXWH 1QYGH 2QSCH 5C3TA 1TZGL 4P57A 4J3XA 4Z0XA 2AV1A 1MCPL 2APXA 4GRWE 5GGRA 2CGRL 4MJ4A 5C0RL 2OTUA 4L3EA 2KBGA 1V3KA 2FH6A 4TN9A 2L4OA 3WFZA 3PHQB 2VIRB 5F9OL 4NYLB 5CZKA 4OM0H 1ZS8A 5I17B 3B6SB 2ICES 4KRMB 1JUFB 3UZEA 3MYJB 2DB8A 4U1KB 1DANT 1P7QB 3JV6B 1BPVA 1N3NA 1NL0L 2HJKA 2VB5A 3GSNA 2WAHA 3M8OL 4KRNA 3MLRL 1NCWL 5IQ7L 3ARFA 1RZJL 3GKWH 3V0AC 1AO7D 3CPLA 4FQXD 3E3QC 1AIFA 4G7VH 1G84A 5D6CA 2C3VA 5CEZH 5KS9A 3H9HA 2GKIA 3UPRA 3KVQA 4K3EH 1MFDH 4PRBB 2V17H 3KPSB 5IB1A 2DQEL 4MJID 4LEXL 1HHJB 1ROWA 1W72A 2FX9L 3IDNB 4PTTB 4NP4H 3Q0HA 3TO4C 5T3ZD 4X6DF 1ORSA 4JJHA 4U1NA 1BZ9A 1OSZA 4XCYB 3MOBL 3V4UH 3W0WE 5HHQB 4WO4B 3LDBB 3SE8H 2AQ1A 1QZ1A 2F8XC 3MFFA 1FV1B 2IAMD 2ZJSH 1WBYA 3HUJF 1BJMA 5IGXL 1MFBL 1DEEB 1SEQL 5KW9L 3H0TA 1EMTH 1CLYL 4JRYB 1SVZA 5J57B 5E99L 1KTLA 4R7DB 2J8UE 2MSPA 2YRLA 4OSUH 1NGXB 2V2XB 3F5WB 1PZ5B 3I85A 1U8NA 2VN7A 1G9MH 1HINH 5IG7B 4IRSB 1FJ1B 3U0TB 4X5XB 3VFNB 1MCQA 3QQ4A 2JLLA 4HAGA 3NGBC 1A7NH 4XP4L 1S7RB 4MQ7B 1FL3A 3BZEB 3WLWD 3T65A 3F7QA 4XPHH 5HYFA 3SDYL 4YXKH 3KYNB 3MRLB 3T2NH 1JJUA 4D0CA 1EO5A 3GSWA 3BIAX 4R3SB 2AGJL 1NPUA 4LLWB 4M7JH 4WCYH 3TH3T 1AGDB 1B2WL 2AI0L 3O2DH 4LPYA 4DVBB 5EU6E 2DQUL 2X1PA 4FTVA 3TGXA 2X70A 1I9IH 1J1OH 1FYTD 5JQ6L 3RNQB 1OGTB 4XNZC 1T04A 5C0FB 5KAQF 2CK0H 4OZFG 5DLMH 5E94B 4AT6A 4MNQD 5GRZA 5KSAC 2EH7H 4LKXB 2DLGA 1IGFH 1FCCA 3BX7C 1WAAE 4G6FD 4H8WL 5DZOA 2GSGA 5IR1B 3H9ZA 1SYSA 3FCTB 3ABZA 5HYJB 5CMAB 4G3YH 5IB2A 3M45A 5DF0A 3SQBA 1TJHL 1Q9KA 2RQ8A 5D4QA 1RMFH 1AXIB 1ONQA 3QIBB 1CZ8H 3N85H 1GGCH 2PW1B 1RD6A 2XTJC 5FDYA 3CX2A 2VLLA 1MWAB 2WQ8A 4YDKH 1C5CH 1AO7B 4FQXB 3S3SA 1DUZB 4Z18A 1RURL 4OBRA 4UTBL 4WWKC 4J3OC 1YEIL 4JR9L 4MB3A 1QBLL 2BVEA 5F71A 1R5VB 3LKPA 1VFMA 1NDMA 4DW2L 4KKAC 3V2AR 2NXZD 2I9LB 3S36H 3IXAB 3V52H 4JQIL 2QHRH 5CZVH 1MIEH 1Z9SA 4KI5E 2A2QT 2FL5B 2I26N 3DRQB 3MLSH 3UBXB 5T1LD 1WWBX 3JXAA 4WI8A 4F7EB 2NY2B 2WV3A 3CDCA 4R4NC 5F89A 4WU7B 2R1YA 3RL2B 5F1OB 5T3XE 2IAMB 1EV2E 2J8UF 2BY3A 3A6BL 3QUYC 3OKLA 1AFVL 1GYAA 4DGIL 1YEHL 3MREA 2AJ3A 2EDXA 3HFMH 4WGWB 5JR1L 3RY6A 4YWGL 1QSVA 3HE7D 1F8TL 4JFYB 3VWKB 3V4VL 4TQEL 3RVUD 3K1DA 3VFPB 1XCTB 5JOEA 4ZS6C 3MA9H 4PJ7B 4X9GA 1T5XB 4ZO7A 5DJ8A 1BD2E 3FONB 2HWZH 2C3WA 4Y2DA 5JW4N 1XF2B 1E28A 3WMSA 4R7NA 1U8LA 5GGRY 2E6QA 3M17B 2HH0L 2R0LH 3GBLA 3RWDA 2X9YA 5FO8B 3HMWL 1XIWA 1FZJB 5C07B 4MXWL 4OFKA 2BMKB 4OZHF 2HKHL 2RR3A 1JZ2A 3OAUH 2WWKO 3RUGA 2IGFL 3FOLB 4MX7A 5FGCE 5F6HJ 5HY9A 4HZLB 5FK9B 2WP3O 1KCRL 3BXNA 1G6VK 4PRIA 5C0GB 2W0KA 4RFNC 2GEEA 2D7MA 1HQ4B 3OL2A 5DO2C 5DR5L 4NCDA 2GUOB 3WNLA 1T7YA 2F58L 3KPMB 3PIQB 4I5BA 4XBEH 4HWZA 1KEMH 1WAAF 3FJTA 2C4FT 5KVEL 4NN7B 2VISA 3NAAH 3UTZA 1PAMA 4DK3A 2YXMA 4G6JL 4F58H 4PJEA 2VL5A 4N8VA 4MNQB 3K4AA 5GGQL 5E1AB 1OT2A 4HBCH 5DRNB 2DLHA 3HI1B 4LVNC 1TJIL 2H26A 3MROB 1EGJA 4N0UA 3MUJA 3QDGA 1WFNA 2FEEL 3KDMA 3U30B 1ACYH 4LRNH 5K59F 1S5HA 3SJVA 3PF2A 3U4BL 1P2CA 2YD8A 5DJ0A 3ZKMD 4APQA 3C6LD 3QUMB 4J6RH 4BH8A 4TVPL 2X4RB 4YC2C 5ESQB 5MEQA 2XN9E 5IROA 1J0KA 4ZO6A 4LCWD 1J0IA 1NH6A 2E9JA 4L4VA 3VGGA 2NY6D 5HHXL 4D0DB 5JW4R 5F7WC 1EHAA 1YEJH 1VFOA 3GSUA 1CD0A 2NXZB 3ESVF 4HCRL 2G75B 4XVUD 1KN2L 1S3KL 4ZO8A 3BI9X 1YC8A 1ZHNB 3ALXA 4XP1H 1MVFA 4ZTPL 3MRDA 3C8HA 5HGGS 3MV7D 1X9QA 4LCUB 1OGAD 1VKXA 5F93C 4XVJH 1T83C 1ND0A 2EZ0D 3UTQA 2BSSB 1FE8H 2IANB 5IV2A 4F9LA 2VDQH 2DYPA 1JGVH 2RHEA 2EYRA 1AHWC 1I9EA 2EC9T 1T66D 3ULSB 5L8JB 1D6VH 1KTKE 4HIEB 5JHDA 1BQLH 4KK8D 5EA0L 3EOTL 1S7XB 3EO9L 2FLBT 4GUPB 2D9QB 1NC2A 4Y7MA 4XCFH 1Q72H 3BQUD 4TYUA 5SWQB 2AJSH 1IVLA 5FDWB 5DJXB 4QHMB 1T2XA 3OF6A 4UV4L 4UB0L 1J1XH 4FQPA 1LO4H 2E5EA 3VU2A 3OTTA 1JNNH 5F44A 4RMQA 3UZVB 1ODAA 2A9MH 4HFUL 3UJJH 3DSFL 4TTDD 3KXFD 5GGTA 3SGKC 5AG9A 3B9DA 1EAPA 2MWCA 3MCLH 2MQ3A 2BHYA 4U2ZA 2EDYA 2PO6C 4WI7A 4XBPB 3KR3L 1MHCB 4HD9A 5CEZE 5HI4C 1BIIB 4AIZB 3CXHJ 4KDTA 4G8GE 1EHLL 2CDGA 1CFQB 3UTTE 2Z8SA 1OQXA 1INDH 3BKCH 4G6KH 2WZPD 3ZDZF 3KPRE 5I0ZA 3O4OB 1XZ0B 2CKBL 4HGWB 3UJTH 3HG1D 4UMGA 2R9HD 3BPCB 3NCEB 1T2QH 5D9SA 5C0NC 3DETD 5CSZB 1L6ZA 1JZ4A 32C2B 4C4KO 2FBJH 4X6CA 1MOEA 4QTIH 3IDMA 2J4WL 4L4TE 5J9PA 1R0AL 2ED8A 3HI6L 3MBXL 3N1PC 4Z7OF 5ANMB 3S5LB 3RWGB 4TTGA 5I1IL 4LKCB 2EE2A 4BZ2L 3SOBH 4JZOB 3SDAD 4WW1A 1QLEH 5IW6A 4XWOC 4CADB 3UJIH 4L9LC 3O45A 4F3FA 1MFCL 4IOFC 4JKMA 4EOWH 2AXGA 1KLGA 2ZSVA 3UP1A 3NFSH 3G5XA 3LQAH 4QHKI 1SEBB 1MAMH 3IAPA 1MRFL 2V2WB 1TQCB 4M6MH 1AQKL 2CLRB 5DD0L 1F2XK 2IPUK 5EIQA 2DMCA 5GRJL 3QEQD 3SDCA 5EU4B 3EYVB 5D1ZC 5EC2B 2HTKC 2D31B 3LEXB 4NQDE 1P5VA 3D69A 4MMZC 1EA9C 2Q20A 5T1MB 1P9MA 5IWLC 3BO8B 4XVTH 3RWEA 2VLKD 3IFPB 4Y16D 3CFKB 2XXMB 5E8EB 1XGUA 2R29H 1RFDL 2OTWB 3HCVB 3QQ9C 4PYHA 3IFNH 3U9PL 4Z76A 4P9ML 5IVXE 1B0RA 3PWVB 1R3KB 3TBVA 8CGTA 3T0WA 1U92A 5BOZG 3W0WD 1F13A 2P5WA 4L29A 4DKFL 3WKNA 4P2QA 4Q2ZB 2P24A 5GS0C 4WWID 4P2RE 3QEGH 1BVLA 1EEYB 2EXYD 3GRWA 5E8DL 5FOBB 1J8KA 4BKLA 4IMLB 3BQUB 5DGRA 4X6DB 5F7UA 3BJ91 1H5BC 1MRDH 5CGTA 4MQXC 3RQ3A 3CLEH 3KNBB 5TFSH 4LVOC 2M1KA 4X7SH 4MXVE 5C08D 2CD0A 4TSBL 1RK1B 3HUJB 4J8RB 2DQHH 4PJDF 3KGRA 2X41A 4C57C 3WNPA 3IAQA 3PHQA 1YEDB 2VIRA 2DQGL 1GIGH 4HIJB 3QXDB 4NYLA 3OAYH 5HYSG 4KJQC 2G5BB 5I17A 3B6SA 2QKIB 2EDOA 3QG7L 1JUFA 4CJ0A 1QR4A 1T89A 1WT5C 3MYJA 4U1KA 5C1MB 1WF5A 1ZE3C 1P7QA 3JV6A 4OIIH 4Q9CA 3NACH 1HE7A 3BKML 3FFCE 4OLVH 5KSAD 4M6OH 3ARDC 1P7KB 4QRQB 4NUGH 1FVEB 2IPTL 3OPZL 5EU6D 4XH2B 1NUDA 4NZRL 1AGEB 3QXWA 5M95B 4IRZH 5DJ6B 1HKFA 4PRBA 2BJMH 3KPSA 1U2CA 4ZQKB 2V5MA 3VDAA 4IBLT 1HHJA 4PTTA 3IDNA 3QDJE 1FNEB 2ERJB 4MXQC 1WWWX 4XCYA 3NIDE 2B0SL 1PLGL 5HHQA 1KV3A 4WO4A 1CTNA 3SKMB 4LRIA 1FV1A 5I9QC 1MRCL 4KAQL 3LZFL 4KKAD 4MYWB 2RAMA 2Q8BL 3OB0H 3L5IA 1T80A 1DEEA 1U2HA 4NBYB 1KULA 4OCMC 5E9DE 3PV6B 1TETH 1YC7A 2AJYH 1KBGL 2WANA 3BGFC 4JRYA 3QEQB 3TO4B 1KELH 4PBWD 4R7DA 1UWEL 3QFDB 4XCEB 1NGXA 2V2XA 1XGPB 3F5WA 3K2UH 4JN1L 5I2IB 2H32H 3H9SE 5IVXF 5IG7A 2Y06L 1JIBA 4IRSA 4ISVB 1FJ1A 3X12B 3U0TA 4X5XA 3VFNA 1UC6A 2HJLB 3RPIB 1CK0L 1S7RA 4MQ7A 2NPLX 5LBSL 4NRZB 5L0QC 3BZEA 4XMLL 1QKZH 5FF6B 1F4AA 5IEKB 3KYNA 3MRLA 4ZS6D 3GI9L 1JP5A 4U1SB 3CFDB 2D0FA 4R3SA 3U7YH 3WXVH 4LLWA 4MAYC 3NCBB 1AGDA 3MRNB 4DVBA 1BOGB 2ED9A 3NGBB 2E7HA 5F7NC 2EH8H 4Y88A 4KQ3L 5MEOB 5ADPH 3FL7A 1UYWL 3Q48A 4ESKA 3RNQA 1OGTA 3HI5L 2A0LD 5C08B 5C0FA 1OOAA 1U8IB 2X4UB 4OCNC 5E94A 4Z8FH 5DO2D 3G5YB 3CX5J 2CKNA 1H15B 3QIWD 1BD2D 1FO0L 2BDNH 3QWRA 4LKXA 5EUOB 1R3IL 3O2WH 5IR1A 1MQKL 3FCTA 5HYJA 1QSFE 5KANI 5CMAA 1U8KB 1FZMB 4I48A 1E4JA 2F5AL 1U6AH 3EOAB 3BEWB 4XNZB 4WU5B 1WBZB 3QIBA 4YHNB 2PW1A 2XA8L 1EDQA 1LO2L 4EDXB 1MWAA 4AYFA 3O3DB 1X5FA 5KSAB 2GFBB 1AO7A 4FQXA 1DUZA 3WIIH 4OZHB 1FDLH 2NZ9C 4UZGA 2UZXB 3NPZB 5FGSA 1R5VA 3NZHH 4Y4HC 4RMTA 3UC0L 1HHGB 2I9LA 3IXAA 3B9KD 2XTJB 1CDGA 2A73B 2PETA 4HUKB 1AR1D 4HXAL 4PYGA 1NBVL 2FL5A 2G2RB 1KACB 3GK8H 1NMBH 3DRQA 3UBXA 2W38A 5DUPL 3H3KA 4F7EA 4WWKB 4PJ8C 4G80B 3LV3B 4WU7A 3RL2A 1CD1B 2IAMA 2X09A 4Q7DA 5DHVH 3CXDL 5HGAB 1JF1B 5MHSE 4H1LH 4QLRA 1CDYA 5HI5C 2ADGB 4JY5L 5F7YC 1JNLL 3ARYA 3GKZA 3MRPB 5FKPB 5L9DH 4JFYA 3VWKA 3KYAA 3VFPA 2RJMA 1XCTA 5IHLB 1CBVH 1IARB 1J9CT 4PJ7A 1UCBL 3U0WH 1T5XA 3FONA 3QUYB 1XF2A 3ELAT 4ZYKA 3VDCA 5LKNA 1F4YL 3M17A 1NFKA 5FO8A 4OLYL 4HQQH 2NY5C 1FZJA 5C07A 4KRPC 2BMKA 5BRZB 3SE3C 2NXYD 5IJKC 4XP5L 4PGDB 3LKRB 3FOLA 4WFEE 2A38A 4K23L 4HZLA 5FK9A 6CGTA 2CKBB 5C0GA 1ZTXL 2AAVA 1EHXA 2WUCH 1CVSC 1HQ4A 4G6AC 2GUOA 3WJLC 3FOMB 4YFLF 5DGQA 3DTXB 3KPMA 1NAKH 2VDOL 3PIQA 3RZCC 1L7IH 3RBSA 4GQ9H 2ARJQ 1LK2B 3FB5B 1UZ6E 1KB5H 3KJ4C 2O5ZH 1E4WL 4OLEA 4OGYH 4WUKH 3VD5A 3DJ9A 4RFNB 2XWBB 3GMOB 3JWDC 4MNQA 3ZE0F 4YK4C 1LO3L 2B4CC 5E1AA 1ZANH 4LSPL 5DRNA 3HI1A 4JB9L 4LFHD 4XAKD 3MROA 3HZKB 4POZC 4HK0B 3HA0A 3FRUB 1OAUH 4MLSA 3QUMA 2X4RA 5ESQA 2WUBL 1NC4D 1EERB 1BGXH 1PW3A 2RBLA 4X7TB 2EXWC 4JRXE 3ZT7A 3GMPB 5FECB 2OXHA 4LVNB 5DT1H 1A6VH 2VDML 5KVMC 3BDYH 3DMMD 4D0DA 3VFVB 4K3JH 4NO2B 3VG0L 1HDMB 35C8H 4G8GD 1IT9L 4M48L 2HVJB 4EQ2A 3UTTD 2G75A 2B5IC 3BN3B 1T1YB 1ZHNA 1P5UA 2VZ1A 3KPRD 2D0GA 4XMPH 4UIKH 4LCIH 4YC2B 2E7LA 4GXVH 3O3AB 4LCUA 4PJBB 4I0PC 5DVNA 1IGTB 3F58H 4RMVA 1OY3B 1X44A 2JTDA 2FGWH 1FH5L 3MLTB 1DBJH 4L4TD 4P59L 3MJ7B 1QD0A 1BF2A 3MJ6A 2BSSA 2IANA 3TO2B 2VDLL 3VXRB 2DM4A 2MCPL 3IETB 2AW2A 3LY6A 4ZAKD 5C0BB 5A40E 1FFPA 2JJUA 3TJEH 4RIRB 3ULSA 2DJSA 2DQCL 2X4TB 4C56D 4HIEA 4LF3B 5BV7H 3QPXL 2YRZA 1OTUC 1SMAA 1S7XA 3BWUC 3JV0A 2QSQA 4HG4J 4WEBH 4PJXF 3DUUB 3MV8E 4GUPA 3OAZK 1VEOA 5EBLB 4ZXBC 5SWQA 3KLHD 5FDWA 5DJXA 3LH2L 1T7ZA 4FQCH 4QHMA 1AHWB 4LHUD 5I1AB 2EDRA 4JPWH 3GI8H 3O4LE 1CIDA 4NQDD 4YUEL 5GS0D 4UINH 2J2ZA 4JG1H 2YPKB 2D9CA 1EEUA 5JMOC 1TMCB 4P5KB 5E4IA 3VRIB 2F54B 2C5DC 4XBPA 3FHQA 1G9NC 1I3UA 3RGHA 1BIIA 1IGIH 3O81A 5J4MA 2VDKL 4AIZA 2BRRH 5ISZE 5SV4A 5IMOB 4M6NH 1HYRC 5FO7B 1CFQA 2ADFH 1FFRA 4XI5C 5EU7E 1FNHA 1XZ0A 4HGWA 3TWCH 4KJQD 5DD1H 3SGJC 3S3PA 3ZLQC 3BPCA 4NNPL 4YHKL 2PO6B 2X2YA 4LNVA 5CSZA 3OB0K 32C2A 3TJHD 2NY5L 1KF9B 1U8OB 5MERB 3HMXL 3WXWL 5JXEA 1R24B 2BVYA 5ANMA 3S5LA 2DLTA 3RWGA 4LKCA 3CLFL 2H1PL 1VERA 1BFTA 2YMXH 5CP3A 2BX5A 5T5NG 5D7KE 4JZOA 3EYSH 1WUNT 1FORH 4HF5H 3I6LE 2P5ED 4RFOL 2EIDA 5C92A 1QLRB 4CADA 2AEPH 1ZGLM 4TULL 4Y0GA 3ARTA 1SEBA 3L7FB 3RWHB 2V2WA 4PJDB 1MFNA 5DRWB 4NBXB 2W9EH 3MR9B 2CLRA 4QKXB 1NLDH 1WEJL 5DVOA 4AIOA 2AXJA 1GAFL 1VGKB 2C7UB 1PY9A 5EU4A 3ILQC 3EYVA 5EC2A 3H3PL 2D31A 4QXUL 3LEXA 1I7ZB 3JWDL 4L9LB 4L5FH 2OK0H 1CICD 2B4CL 5DEFB 5T1MA 3BO8A 1DSFH 4XP9H 3IFPA 4QGYA 1BJ1H 3CFKA 5E8EA 3STZB 1B9ZA 2AS5M 3HCVA 2OTWA 2V2TB 4O00A 3CMOH 3HZYB 3QDJD 2FD6H 5D1ZB 1U3JA 5C71A 3PWVA 4GAGH 4PV8B 1R3KA 2NY3C 3G6JF 5TE6H 5TE4L 4D3CH 1DVFC 5AYQA 4PY8J 1KCSL 3MNZB 4Q2ZA 5E6YA 2W07A 1EEYA 1FO0B 5FOBA 1BFVH 2VWEC 4IMLA 3BQUA 3AS0A 2XZZA 5E9DD 3B5GA 2AERT 3ZT5A 5FYLL 1KIQB 4NM8H 1BHGA 1RZFL 3KNBA 3VXME 2EECA 3WIHH 1UA6L 1ZEAH 1RK1A 2ZCHL 3HUJA 4J8RA 2P46B 2VXUL 3QHFL 4R9HA 5LGJB 2NR6C 1ZV5A 2BHZA 5E5RB 3H9SD 1YEDA 5HDLA 3NCYP 1EUTA 2R4RL 4HIJA 3QXDA 5IFAL 1IKNA 2G5BA 1H5BB 2QKIA 2EIEA 3VFUB 5KG9B 5DQDH 1VSCA 4Y8AA 4LVOB 4M5YL 4F37K 5F72S 1NDGB 4OJFH 4DVRL 1KCKA 1F42A 3TV3H 3QXAB 3TESA 3ARPA 2G9HB 2XZCL 3VH8B 3RJQB 2BSED 4M5ZL 1OP9A 1P7KA 2RGSA 3ZTJG 2E7CA 4QRQA 5GGSY 3RHWK 1T03H 2DQIL 1FVEA 3OGCB 4XH2A 3MLUL 1NGYB 2GITB 3CFEB 4N5EC 1AGEA 4Z7WE 2P45B 5DJ6A 4D9QD 2IBBA 1HKLH 4ZQKA 2H41A 1QNZL 1FL6B 4MB5A 3ARDB 1FNEA 1A4KB 5I1EL 1KJMB 4UU9B 5ERWB 3TN0C 4G5ZH 2NZ9D 5J1AB 3P73B 1V7MH 2XG4A 2XQBH 5HD8D 3PWLB 3SKMA 3BRDA 2O93L 1QSFD 3QQ3B 3RDTD 1G9NL 4X7FC 5KN5B 5DC0A 1PKQB 4AL8H 1QRKA 1FFOB 3CFJB 3PV6A 1OP3H 2OXGA 5CJOL 2R2BB 4HT1L 5EO1B 4EUPH 1J87A 1AJ7L 1KSRA 3RX7A 2A77L 3TO4A 3QEQA 1AGFB 2Y07H 1JZ6A 5K9OB 2GTWB 3QFDA 4XCEA 5LWYH 1XGPA 3FAWA 5I9QB 2GY7B 5I2IA 1OAYL 5C9JB 1WTGT 2EDEA 1MH5B 4UIMB 4GKOA 4NFCA 4TRPH 2AEIT 2GJZB 4ELMF 5SX5K 4ISVA 3STBA 3U1SL 4AEIH 3X12A 5HI5D 4KK9C 4NKIH 4NJAH 1IM9D 3S98A 2HJLA 3RPIA 1NBZB 1NSNH 4NRZA 3BGFB 5FF6A 3HKFA 2V5RA 3LKSB 1I8IB 5IEKA 3UYRL 4FQ1L 4ZOBA 1P1ZB 4U1SA 3CFDA 2DD8H 4HIHB 2APWA 2VC2L 1S78D 4RNRB 5KSUB 2K1MA 5CEXB 1QQDB 3MRNA 1YEGH 3NMEA 4NM4H 1JZ8A 1KJ2L 1BOGA 2F74B 4QEGA 2W59A 1MHHB 4KRPD 4EXKA 5CGYC 5L0QB 3T2PA 3MMEB 5MEOA 1A6UL 1OAXH 3JWOH 5BVPL 4YDVB 5C08A 2ITDB 1TTUA 1EBAA 4N8CL 2ENYA 4FABH 2EDKA 1U8IA 3IJSB 2X4UA 4QRRD 4MAYB 4AM0B 4LARL 3G5YA 3X3GH 1H15A 1S9WB 1CCZA 1EXUB 5EUOA 4F37F 1YEKH 1A6TB 2ZG1A 3P0YH 1U8KA 1FZMA 1B0GB 4UDUB 3EOAA 3BEWA 3DX6B 4UTAL 4WU5A 1WBZA 4DCQB 4MLIA 4YHNA 2UVEA 4HCRA 5I1DB 4XPFH 3DBXB 4EDXA 1SJHB 4Z7WF 2XPGB 4CN4A 3O3DA 4JKLA 4PRHE 5KVGH 3ULUC 1A64A 2GFBA 5KSAA 4LDLB 3EFDL 4OZHA 4NO0D 4FHBD 4G9DB 3A6CL 4P4KD 3RKPA 2APVA 3SQOL 4BYHA 3TIEB 5DMYA 1T22B 1HHGA 4FNLL 4WI3A 3O6FC 1CS6A 3FRPA 5DJAB 3TZVD 2A73A 1Y6MR 2OR9H 2F53D 2MPAL 1DCLA 5JW3L 3OG4B 3IKCB 2G2RA 3O41B 1WJ3A 2R56L 5CJQL 4AH2B 4WI9A 4WWKA 3MO1B 4G80A 3UTSE 3LV3A 1CD1A 1GGTA 3EZJB 4Y4HB 3VD9A 1RI8A 1WZ1H 2LV4A 3GSNH 1J1PH 4F2MB 4MGXA 4YDIL 5HGAA 2JELL 1JF1A 3LKOB 1K6QH 3RY4A 2ICCA 2ADGA 5F1KC 1H3WM 4PTUB 4X5LA 3O3BB 1BJ8A 4KTEH 4KTDL 4XCCL 4AY0A 4I0PD 3MRPA 5FKPA 4CU6A 5I15H 1LK3H 4PJ8B 7FABL 4U7MA 1XF3B 4JRXD 3K8LA 1KENH 4H88L 1V3MA 3QUYA 1CFBA 1UT9A 1YA5A 2Q87A 3ZHLA 1CFNB 4KI5C 5TJWK 3MLXL 1A3RH 1W72H 1NCUA 2JJTC 4HC1H 1BQSA 3OKEB 1HSBB 4W4NA 5BRZA 2D7TH 4PGDA 2VDRH 3LKRA 1JPSL 5I1JL 3MLYH 3I9GH 2HFGH 4JDVB 3VI4F 4NZJA 4PJGE 1JTPA 2CKBA 4S1RL 3EYQC 5EDXA 2R4SL 4DGYH 2RIKA 1N26A 3CJJA 3INUL 3GMRB 3SGEI 5IMLB 4PJ9D 2P8PB 2DLEA 3FOMA 4XB7A 4LQFL 4JY4B 2XV6B 4KRPB 3DTXA 4EDWL 2KUTA 5KVDH 4J1UB 4LK4A 1LK2A 3FB5A 2IALB 3O9WD 3GSQB 1FZOB 1MLCB 4TSCL 1S7QB 3MV8D 5E2VL 2XWBA 4PJHB 4QRRB 1YY9C 1NGZB 3P4NB 3GMOA 5HPMB 4PBVC 3QBTB 4PJFE 4D9RE 2G60L 2BXZA 1E6OH 2NTSP 4YNYB 1MCIA 2DBJA 3HZKA 4PJXB 3KJ4B 4HK0A 3V7AE 2VABB 4DN3H 3Q3GB 3NCJH 5F6IC 2NNAB 3FRUA 1QR1B 1G7HB 4YXHH 4KMTH 2DAVA 2HT3D 4YK4B 5HGHB 2WW8A 4X7TA 5GSVB 4AEHH 3GMPA 5FECA 1XGYL 2OZ4L 3KPQB 5FHAL 4G8EB 1QACA 3NTCH 4OTXL 4NO2A 1HDMA 4O2CB 4Z7VE 5SWSB 4NHUB 1CGSH 2HVJA 1L4IA 1T1YA 4O02H 5L6YH 2E27L 4KUZH 1J0HA 5C2BL 3FMGH 2F53B 5DRZB 5DZNA 3RI5F 4UQ2B 3O3AA 1BAFL 4PJBA 4Y19B 1IGTA 3G6DL 1M1SA 2P43B 1I7UB 4NWUH 1X5LA 3MLTA 4X80H 5DMGC 3ZYZA 4MNGE 3MJ7A 1C7SA 2A9NH 3L3GB 2R0ZL 3TO2A 3VXRA 2B5IB 1HYSC 3MXVH 4JQXC 3SY0B 2AK4B 3IETA 3BKJL 5C0BA 1A6WH 4QXGL 3ULUL 4RIRA 4BQBA 1CGTA 2X4TA 3I6LD 4LF3A 2M2DA 3ZE2F 3TLRA 4F7CB 4I0PB 1LP9E 4OZFB 1MI5B 4M1DL 1H8SA 2ZWLT 1T83A 2EO1A 3DUUA 1YYLL 5EBLA 5E2WL 1V7NL 1B4JL 4OFYD 4PP1D 2WINB 5T1KD 4PJGF 1AHWA 5I1AA 3WSQH 1CDCA 4JFFB 3G9AB 2NY3D 4R4FH 4RGNE 3DOSA 4GG6B 2NLJB 3D1MC 1P6FA 1IM3B 4Z7NE 2YPKA 5E6ID 5FB8B 2IEPA 4ZXBB 4P5KA 3VRIA 2F54A 1JGDB 4JHWL 1GHFH 4M7LH 3TP4A 1BIHA 4OT1H 1SBBA 4LSRL 4YFDB 5IMOA 4BZ1H 5FO7A 1C08B