4K9EH

Crystal structure of kit d4d5 fragment in complex with anti-kit antibodies fab79d
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
220
structure length
220
Chain Sequence
SEVQLVESGGGLVQPGGSLRLSCAASGFNISVYMMHWVRQAPGKGLEWVASIYPYSGYTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARYVYHALDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords light chain
publication title Structural basis for KIT receptor tyrosine kinase inhibition by antibodies targeting the D4 membrane-proximal region.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 47
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2013-04-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4k9eH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4k9eH01
4R6UA 5DI8B 4WU7A 4S1QL 1WIUA 2ADFL 2WWKT 1FYTA 4I18C 1KN2H 2BMKB 3FQTB 3EOTH 4M03A 3U46A 4TVSa 1Y0LA 3A67L 1AGFA 35C8H 3T2NL 5CZXC 3SDXE 2P5WA 3B6SB 4W6YB 3MLVL 4EI6A 1I1FB 4FXGB 1K3ZA 1E28A 1WJ3A 5EZLA 1WEJH 3T4YA 5JNYA 1OP3K 3TO2B 3QQ9D 3TA3C 5KSUA 4WI7A 4AJ0A 2DKUA 3O3DB 4YHNA 5EU6E 3J8F7 1NEZB 1I1YB 5AAMA 1NMAH 4U1KA 4DCQB 4YAQA 2D03L 1QP1A 3QIBC 3IT8D 4JHAL 3UPRB 1S7WB 2YPLA 3CXDL 1FZOA 4XGZA 1F90L 5AUMB 2AXGB 2YHGA 2HAZA 2ZUSA 5I1JL 1N5YL 4R90H 4ZQKA 4OD3H 1YEJH 2OQJB 5HYQA 1TVBB 1LK2A 2KQNA 3EOAB 4XXDB 1HK6A 3QDAA 4EIZC 3I6KB 1N6VA 3DARA 3HPLA 3IGAA 4WV1B 3UJTH 1CDBA 1RK0A 3QUXB 4HGKC 5JR1L 2R4SL 1EHNA 5I1DB 2G5BB 2BDNL 5I1KH 1J1PL 3CFKB 2CRYA 1WTLA 1KLGB 4OFYD 2QKIA 3U79A 3GMMA 4GO6B 4LSRH 3HFML 1KN4L 1FLRH 4B41A 4CVXB 5ANMB 3TCLA 2G75A 4JFXB 4FZEL 4PLJC 4YHOH 5I16A 1R24B 1KB5A 3FB6A 1JWMB 1KJ2A 4W4OA 3KPRE 3G9AB 1XF5A 5IUSA 4K55A 4ZNEE 5ITBL 3VFRA 1OAUH 2VXQH 4HJ0C 2DQCH 2GHWB 4YHML 3QUMB 3NCMA 2FIKA 3PGCA 1IAKB 1P7KA 1WITA 4PB9H 3EAKA 1PVHA 3PIQA 1JI1A 1ERNA 5CMAA 3C6LA 1U8JB 2OR9H 3PV7A 3SGDI 2CJUL 3TWCL 1OAKL 1FDLH 3BWUC 4OTXL 3RWEA 5MHSD 4RCAA 2CDGB 4UI2A 2NW3A 1DBAH 1A6UL 1D9KD 2R2HA 4JANB 4U1SA 2QQQA 4GRLA 4CVZB 3S34L 4X99A 1SVZA 4C56D 4Z0XB 1S7TB 3O6LH 1UADC 4O9HL 5LWYL 2CD0A 3FO1A 3WO4C 4HW6A 5D1ZA 4Z7WB 5DD1L 2XWJA 4RGNE 3TZVA 4OI7A 1A02N 1BVKB 2VDQL 4NGHH 1LD9B 1PW3A 4WEUD 3B9KD 4JFDE 3L3HA 4G3YH 6FABH 3O4LD 2WBWB 2P8LB 5C70A 5AEAA 1D6EB 3ZO0A 3C5SB 3QULA 1GRWA 3RZCB 1ZHBB 4D9QD 1I9JL 3BDXA 3TP4A 1RZ8A 2D31A 5FCUL 2XV6B 4J23A 4JFPA 5CINH 4HQQL 4I3SH 4LLAA 5EZOH 5FDWA 3RY6A 3HE6B 4XX1G 3S96B 3HZMA 1Y6NR 3KYAA 3OJ2C 1J0HA 1KGCE 3LRSB 1KCUL 1V3LA 1KTLA 4K3JL 2MKLC 4ZAKD 2IMMA 4PJ7B 4Z7VA 5I17A 1TXKA 3H2WA 1IQWH 3W9EB 3DX7B 1ED3B 4XHQA 2BP3A 5FM8A 4GRMB 3S35L 5DLMH 1MSPA 3D3VD 4HWBH 2X4TA 4Y4FB 3NTCL 4I8DA 4JQIL 5DRXA 2EDEA 3AS2A 5EU4B 3QEQB 2A73B 5L2JB 1G7HA 3QUYB 5LGHH 2P8MB 3BKMH 4PB0H 2AV1A 4JKKA 5DJAB 4X83A 5IB1A 1XF4B 2PYEA 1EVTC 2C1PB 3MRRB 3WFBL 2ZUQC 1GZPA 3AC0A 2FDBP 2Y23A 4O02H 4DN4H 4AL8L 5FYKU 1QFWI 4XMLH 1AFVH 3MRIB 3QIUD 1R3IH 3MCG1 3ZKXC 5DA4A 4A6YB 1AKJD 3UPAA 3L1OL 4HS6B 5ESAB 4KWUA 4X9FA 4KJPC 2ICEB 4WFED 4TNVF 3V5DA 1W0WB 3H42H 5I15H 1RIVH 2CDEA 3DVFA 3CSYB 1IGJB 1XH3B 1IGCH 3UTSD 3GHEH 3Q6FA 5F89A 1JGDA 1X7QB 4LVNB 4C83A 4UOJA 4JHWH 3ZDZF 1JGVL 3P30L 3QDMB 4PJCB 1A7BA 4XPBH 4P4RA 3ZKQD 4PTTA 3G5YA 1H3PH 1IGFH 2KZWA 2RIKA 3HN3A 1AGEB 4UT7H 3EO9H 4Z7VF 3D9AH 2A74B 2F8XC 4TUKH 4Y4HD 4WFGD 1AXSB 1FG2B 1MCLA 4LHUD 3DXAB 4KRPB 5DUBB 3P0YH 3BEVA 1E4KA 4PJIA 4FG6D 4IRZH 3SJVA 4NHCL 1JGUH 4Q9BA 2FBJL 3G6AB 4OD1L 4Z7VE 3S3SA 5E1AA 4LLYA 3VWJA 4QHLB 2XI9A 1MFDL 2V5YA 5CBEB 4F7MA 3QIWB 2YK1H 4OLWH 3UYPA 4DAGH 1RZ7L 1YNKH 2ED8A 4JRXE 2UWEB 4ZXBC 4EN3A 1WIPA 4CUCA 4RMQA 5L88H 4F8QA 2PYEE 2VLJA 3S36H 3G5ZA 1FNSL 3QP3A 1WT5C 1CLZH 5T3XD 3DRQA 2NY0B 1J12A 4NO5A 3V0WH 3PWLB 5I8EA 3QZWG 2XQBL 4HWZA 3QEHA 3RBGA 4G8EB 1I75A 3UTZB 1BM3H 2YN5A 1L0XA 1JPFA 2IAMC 1BEYH 4PV9A 3BKYL 1WZMA 4HIXL 1SY6A 5BVJA 4WY7L 4JGJA 3FKUS 1Q0YH 2V17H 4NM4L 1FRGL 4WFFE 5HHVH 5L2KB 1MF2L 2Z92B 4PJBF 4PJIF 4CW1A 2L7UA 5DC4B 1YPZA 4MA3B 4MJIE 3QCVH 4GW5A 2MSPA 4K8RD 3I3DA 3O9WD 5C0GA 1NC4B 4W70A 4KKBC 2NTSP 4JZNB 2RFXB 3GGWB 5DEZA 3WSQH 4YDJB 3RWDB 1AY1H 2I07A 5IROA 3MOBL 3O6MH 1NCBL 2ITDA 2MCPL 3C08L 3TBWA 4PGEA 3QEGL 2OSLB 2A38A 2QTEA 5DD5H 4PJBE 4PJIE 2XZQH 1KTDB 4HPOL 2NCMA 2XKNB 1FAIL 3M07A 2IPUG 3V8OA 4ETQA 1AO7E 2H1PH 2J5LB 1A5FH 3NOIA 1UEYA 2CLZB 3EW3B 3SPVB 2EXWC 1VFMA 2B5IB 1CDGA 4G80A 2PETA 1ZANL 5BVPL 5CSZA 3QWOB 5C0AE 1L6ZA 5C09E 3CVHL 3L5XH 4AY0A 3VRLF 2HFFB 1FZKB 3VWKB 3AREB 1CXIA 1T21A 3GIVA 4IRSB 2VLME 4RAVA 2VLJE 2Z31A 5DYOB 4LQ1A 3PGDA 4JZJB 4GKSB 5BRZD 2F9BT 3ZYZA 2BSED 3OX8A 3P11H 4M6ML 4P4KC 5GGQL 5MEND 3E6FB 5IJVA 4JLRB 1Q94B 1YPZF 4X7SL 5A3IC 3N9GL 1J8KA 1QQDA 5IFJB 5BS0E 4YGVB 5CGYC 3CFDA 5DRZA 2E7LC 1J8HA 4X5XA 3V2AR 5EG6C 1T2JA 3K74B 1A6ZA 3GJEA 3T4AB 3QAZC 4LCYB 2PYFB 4HHAA 1H5BB 3LZFL 1NBZA 5J13B 1T2QH 1QSED 3MC0A 3WEXA 3ZKMD 5CILL 1T7XA 4WWKD 1YPZE 2ZOKA 1BZQK 4ZTOH 4P57A 3Q5YA 5TQ2H 1IM9B 4KV5F 3HAEG 4XCYB 1A3QA 2QSTA 1IGMH 4M48L 2EIBA 2GJ6B 1R5VA 1I1CA 2M8XA 4IJ3B 5FGBA 3CD4A 2R1XA 1F58L 2EE3A 1U3HA 4X8JA 4G5ZH 5ICYB 3IFOB 5IIEA 5C0JA 3ULUL 3VA6A 4ISVA 3QG6B 4V1DA 4WWID 4NZUL 1C16B 3RQ3A 4JFHD 1CS6A 1I8KA 1JGLH 3IJYB 4RZCB 4OZFH 3BI9X 4Q2ZA 4UQ3B 4LVEA 4HMEA 4Q74A 5BXFB 1JE6A 3V6FA 3VG0H 4J12A 3QRGH 1SEBA 1PY4A 1XGTB 1AQKH 5F6IB 3GKWH 3L7EB 4K71B 4ORGA 2HMIC 3HCVB 3OR7A 4U1NA 2DDQH 2UYLA 5MP6H 5ID1B 2IADA 3JTSA 4EUPB 1U8LB 2NZIA 5DXWA 4WI5A 2V2XB 4F3FA 2DLTA 4YHPB 4KZDH 2FEEL 4NZTL 2ZP0T 3VXUB 4M43L 3ARQA 1KUMA 2OR8A 4OZIB 1BD2B 3PQYA 4XPAH 2R2BB 4GS7C 3KPOA 4RX4A 3VFUB 3DX8B 1KEMH 2X1OA 3FT2A 5D5MB 3RTQB 5B21A 2X5PA 4ETYA 1FV1A 5IB5A 1I4FA 5FO9B 5C0CD 1LP9B 4XB7A 4HUWA 4ODXA 4NC1C 5DZLA 1IC1A 3ARBC 1TQCB 3C2AH 1DSFL 1RZIA 3O3EB 1FNLA 3BYYA 3FO2A 4L9LA 4MNGA 4QTHB 3ORJA 1UACL 4U6XA 3EDJA 3QDJD 4GBXA 2CKBB 1KJMB 1WQVT 3S5LA 2Y5TA 2VH5L 1CDIA 3OKOA 5DRNA 4NOFA 1OGAB 4RMSA 2VTFA 5B38G 3O2DA 2PXYD 1OTUD 1QBMH 5DJ0A 3IAPA 4ODHL 2GSGB 3I75B 4XMKL 1AR1D 4MMXC 3MLRL 3IDNA 4NPYA 3MYJA 1XR9B 4DGIL 1ZWIA 3WXWL 5J57B 1UWEH 4D9LH 3CFCL 3LVEA 1RU9H 3UTTB 5LQBH 2DQHL 1BZ9A 2E8ZA 2Z0BA 1UVQB 1VFUA 1RIUH 4I3GA 4FQIL 3WLWC 2ARJB 3GJFK 3CFEA 3BKCL 5GGSA 3QNYA 3O3AB 2J2ZA 4HG4K 1N59B 1V3KA 4P46B 4P9HC 3WFDH 2UV3A 1KYOK 1JYXA 4PJFB 4KH2A 1CU4H 1UH2A 2DQTH 1JRHL 2HTKD 3BZFB 1ZXQA 4KVCH 3PABA 4ZOBA 5TQ0L 4MNQB 2X42A 3DJ9A 1FG9C 1S9KC 4NZRH 4GRWB 2MQ0A 2QHLA 1BQHA 2NY6B 4R2GB 4YBLC 3VJ6B 2ZG3A 3GIZL 2RCSH 5T1LB 2VQ1B 4V2CB 2BNRB 5EBWB 5EOQH 4JE4B 3OB8A 5EO1B 3BQUD 3MRJA 1CL7I 2I9LA 1DANU 1WBYB 3BHBB 3B6SA 4KI5C 4TRPH 4KPHH 5I1GL 1I1FA 1C5BL 5E9DD 1ZT1A 2FIRT 2VAJA 1S7UB 5D8JL 3I2CL 1DFBL 5FV2A 3AY4C 4S1SL 1AH1A 3T0VA 1F4WL 4D0DB 3KLHD 3IS0X 5F8QC 2BSTB 4MNGE 1I1YA 3WN5C 2YD8A 4OT1H 4APQA 1KLUA 1YMHB 3ZYJA 5DMJB 4Q9CA 4WDIB 4Q6IB 3DVGB 5AUMA 4D3CL 1HZHH 2AXGA 3IFNH 1DE4B 5CD3A 3LKQA 1Q1JH 4P99A 1TVBA 4LNRA 4M9OA 1F11B 2HKFH 2E27H 3UO1H 3OGOE 4QOKB 1F6AA 4PUBL 3MRBA 2EICA 5I1EL 4U31A 5IT2H 3F7VA 1EDQA 4NKDA 1Y6MR 1XGUA 4XNZB 2AJZA 3MMEB 3A0OA 5F21B 4EQ2A 3CFKA 3S6CA 4F7PB 1IKNC 1AJ7L 4YBQD 1NSNL 3KPSD 4TVPE 1XGRB 1WWCA 1VPOL 3T04D 1T1XB 2WK2A 1BFOB 1Q72L 3E0GA 3T0ED 3V6BR 5C6PB 3VFOB 1R24A 4G6FD 1KN2L 1JZ5A 3S8WA 3JWDH 2CXGA 1CFSA 1NLDH 2BNQB 2HT2C 4DKDC 1WZLA 3RDTB 2KDGA 5GJSH 3O4OC 3VD3A 4DQOL 1WEJL 4IMKC 5CJOH 3U7AA 3ULVF 4F9LC 4PJ8B 3QUMA 3WFCL 5E6ZA 1D5BB 4MVBC 4ZUSA 4PJ9A 4JGMA 1RUAH 4QWWD 1AE6H 2A9ML 1FCCA 4M9PA 4Z77B 3QQNA 2YUZA 1E4XH 2UZXB 3B83A 3PL6D 4UIMB 5D1QD 3QI9B 4ZDHB 3KHOA 1AC6A 3KJ6H 5KG9B 4R90L 4OD3L 1VDGA 1KIPB 3ULVE 4JANA 1ZVHA 1J1OL 3IDMB 3DSFH 4LLQB 1FL5B 2VDPH 4PLNC 5GZNC 4DGVH 3U9UA 4QRQA 1F97A 4LHQB 5AZ2H 1BVKA 5ICXB 3RVVC 1QLEH 3PDOB 5I1KL 1BHGA 3LB6C 1CD1B 4XH2A 3R8BB 4KTEH 4NQXB 2P8LA 4LSRL 5T33H 1QKZH 3C5SA 3DETD 3IJSB 4XNQA 1EJ6A 4ZUUA 1FLRL 4G43A 5HI5D 5BZWA 1ZHBA 3VU2A 1IC4H 4DUWA 5DGQA 4YHOL 2HT4D 2Z35B 2YPVH 3HB3C 5CP3A 1P53A 3CJJA 3T3MF 1P84J 3SEPA 4CVUA 2W1NA 1XZ0A 3LRSA 4HCRA 4R7NB 1OAUL 3LOWA 2VXQL 2J6EH 2NY3B 2DQCL 5E7FA 3BPOC 5T1DH 4IRJD 4PP2B 5ANME 1NQBA 4PB9L 1ED3A 2XFXA 1IILE 4Q97A 4GKOA 4BYHA 4QHMA 1XCQB 4Y4FA 4NKOA 4LEOA 3FT3A 3AXLA 3SDDD 3T3ME 1FDLL 1KPVB 1ZGLM 1UH4A 4PJ5B 4Y16A 3IDXL 1XAUA 5CS7A 3ULUD 2ESVB 4Q9QH 3OBAA 1YYLH 3UPCA 3UEZA 3HA0A 5DJAA 4ODUB 3FRPA 1QRNA 1CE1H 3O6LL 1YYML 1LEIA 2ZG1A 2G60H 1QHPA 4LL9A 4R26H 4DKFH 2B39A 1X9QA 2BCKA 4XP1H 3GMRB 1A7RL 4Z95H 3VXTB 1LVEA 1EBPA 1DN0A 4NGHL 2I5YH 1J0ZA 3T1FB 1QPXA 1B6UA 1T0NA 4CJ0A 4G3YL 4XC3L 4ALAH 6FABL 4ZSOB 8CGTA 5T5FH 2ICEA 1F13A 2H26B 2ILLA 3SO3C 1NC2B 3ES6B 1ZLUH 1NL0H 1XH3A 5D1XD 3O3BA 4RDQF 5JIIA 1X7QA 4KZEH 3PP3H 2VLRB 3QZWB 3EDKA 3OAYH 5D7JA 5CINL 4I3SL 5EZOL 2X4NB 3C60A 4HLZG 4K8RC 4X6CA 1MCFA 5E8OA 3LN4B 1M1SA 4YLQT 4PJ7F 2JB6A 2DQUH 1N7MH 1EXUA 1KIQB 2HJLB 1G84A 3K3QA 1OLZA 1AXSA 4DKAA 5DLML 1QG3A 3PHOB 4HWBL 2NXYD 4RA3A 4PJAA 4FFWC 2IH3B 1YECL 4LCIH 5T1MA 3MBED 5LGHL 4HAFA 2IG2H 2XY1A 3Q2CA 3BKML 4KHTH 4PB0L 4PJ7E 5EA0L 5FYKL 3HTLX 3PWUB 4PS4H 1ZT7B 5I76B 2RHEA 3MZGB 1FSKB 5INDB 5DDHB 2BVYA 3TO4C 1T3FB 4YO0B 2AGJL 4ZS7H 3RP1A 4O02L 3QIWA 4DN4L 4MJ6A 3QEQE 3VDBA 3GSUB 4XMLL 1AFVL 5EO9B 1S9VB 4N8VB 1R3IL 1TTGA 1R6VA 3MFFA 4K3GA 5CP7B 5F9WB 5BJTA 3DX6A 3LPWA 1QRNE 1MHPH 4XRCB 4S2SB 1DN2A 4JPVL 4J1UB 5I15L 1RIVL 4MCZB 1A0QH 2ATKA 3T08A 4WFHE 1TCRB 3GHEL 1XFPA 3KVQA 4JHWL 4IIQC 4PJCF 1QFPA 4UNUA 4XPBL 1BF8A 4YEFA 2XA3A 1H3PL 1IGFL 4JRWA 5KBNC 4R0LC 3MUZ1 4UT7L 3EO9L 1KJ3H 1PYWA 3SGEI 3S37X 3DUUB 1JPGB 5F9OH 4TUKL 3ARWA 2J8UB 1AD0B 5F88B 3QDME 3P0YL 4PJCE 3VFPA 1R3JA 4MA3A 4IRZL 3TJEL 5E4IA 3LQZA 1MLBA 4PYHA 2CR6A 1NC4A 2H2PD 1JGUL 4NP4H 1J05A 2RFXA 4NWTH 4Y5VA 1Y18A 2AI0H 1T4KB 3DV6A 4NBXB 5EOCJ 3IVKB 1N3NB 1QBBA 3LSOA 4QRPD 5GS1A 1G9MH 43CAA 1EZVX 3DXAE 3TLRA 2BOBB 4HEME 1Z0MA 3QIBA 2YK1L 4DAGL 4RFOH 5FOJA 2XKNA 1J18A 3HAEB 2DTML 3MJ9H 1YNKL 5IMOB 1JNNH 2FATH 2UWEF 3GSXA 4P2RB 3B9KB 5C0BD 4XNMB 1I8LC 3RHWK 5IOPB 1SEQL 3OAZK 2H9GB 4BUHA 3SPVA 3S36L 2PCPB 3VMPA 4HAGA 1NAMB 1CLZL 5FYJH 3QWOA 5C9JB 4AG4L 3V0WL 1QBLH 3RIFF 5E6IA 4NJAH 5I73B 1MCJA 2DJ4A 3C5ZB 2ORBH 2UWEE 4JREC 1BM3L 1FZKA 4YXLH 3VWKA 1BEYL 4Y4KC 2DM3A 2E3VA 4NHUB 5FYJU 3QG7H 1EO8H 4ZAKB 4JZJA 1X4ZA 1Q0YL 1QR1B 5HHVL 4ELKA 2ERJC 4N5ED 4JLRA 4HWEH 4DTGH 1BF2A 1YC8A 4OF0A 1IT9H 1HIMH 5D2LA 3TCXA 2DMBA 1A47A 4X0KA 3ULVH 1AY1L 2R23A 1KJVA 3VXQA 1TPXC 3NCFB 4LPVA 3T4AA 3O6ML 2PYFA 3BP7B 5L2KE 3P3YA 3QPQD 1YN6B 4FABH 4AM0A 4Y2DC 2XZQL 4YXKH 1QD0A 3NCJH 4DEPC 3HLAA 1IM9A 5CJ5A 2C7UB 4XCYA 1VSCA 4F7CB 4PP1D 1INQB 2H1PL 3FCTB 1I3UA 2R56H 3QIUB 5I9QC 3WV0A 5E94A 1A5FL 4LVOB 5IK3A 3O2WH 2EEBA 1U8IB 1QEWB 3IFOA 3PXHA 1FH5H 3T77B 2P42B 4PGCB 2P8PB 3PWVB 1NMBH 1C16A 5HYSA 1PG7W 3L5XL 4MB3A 3OGCA 4M1DH 3IJYA 3UTSB 4WNQA 5F1IA 3LKRB 5HI4C 4XBEH 4E5XA 5B38B 5F72S 5B3NA 2GK2A 5BXFA 1W2KT 1KCSH 4X4MA 5E7BA 4L8CA 3P4OB 4YHZH 3IETB 1R3KA 1HQ4B 5D7LD 2CKNA 5ID1A 4HX1B 4EUPA 2LABA 3P11L 1N6QL 4QNPF 5EC2A 3LV3A 4WW2B 4Y4HB 1MCCA 4LHUB 4OLVH 2X1WL 4O5LH 1ORQA 4GAFB 3W39A 1WV7T 1RZGB 5CSGA 5FHAH 1LNUA 2OLDA 4E9LA 5L7XL 4GUPA 2BZDA 2VZ3A 2J88H 1U95B 2R0WH 2VABB 1UB5B 1CLYH 4TUOB 3VXSD 3DURA 4MJ4A 2B4CH 1T2QL 1D5MA 5AYUH 2XZAL 4QNPE 4Y1AB 1CGWA 2DQEH 4H88H 4ZTOL 1FVCA 1TMCB 1B6DA 1T0MA 4U1LA 1IGML 2GY5A 4XPTL 2A6DA 5F7NC 5K93A 3KLHC 3CFIC 3EFFB 1FORH 4JFFD 4NFDA 4QTHA 5HGDB 4G5ZL 1CDCA 2D7TH 2JJUA 4Z18A 4ZUTA 2CKBA 1IFHH 1LDSA 4OGYH 4NQED 4U6YB 3MV7D 1J0JA 1JGLL 3V7AE 3LAFA 1OGAA 3QHZH 2D4DA 4JVUA 2D2OA 2GJ6E 4KI1A 1U93B 4GG6A 3VG0L 1RJYA 2GSGA 1XIWC 1AQKL 4OCNC 1N6UA 1U8NB 3MRDB 1VHPA 3GKWL 3OKMB 1IGYB 5MP6L 4U1HB 4NRYB 3JBG7 4F9PC 4LSUH 1UVQA 5CP3H 3H9SD 1YZZA 2W0PA 1IKFH 4WW1B 3ZDXF 1I3VA 3K4DA 4LQFL 4X4ME 4OZIF 3G08B 4XPAL 1MLCB 1N59A 4P46A 3OG4B 3MLUH 1KEML 3LIZH 3T0EC 4PJFA 5B4MC 1N0LA 1GGBH 2WBJC 2APWA 2Y4SA 2BY1A 3EHBD 4D9RD 2XTJD 5D5MF 4KAQH 3U6RA 1YA5A 3DIFB 5EBLB 4N9GB 4X7TA 2HFGH 4JDVA 5AYQA 5AD0A 3VXUE 1S3KH 5L0QB 1HHIA 2MKWA 5C0ND 3ZDXE 2CIIB 5E95B 1BD2E 3FRUB 3C2AL 1D6VH 1PX4A 3KPLB 3IDYC 3F62A 4W68A 4LK4A 5I0ZA 5T1LA 2ZJSH 5CHNB 1KBGH 3IXAA 5D5ME 1WBYA 5FYKD 3BHBA 4ZO8A 5JOPD 4KGLA 1WWBX 3RNKB 1V5JA 5ALCH 4GG6F 4A6YH 1QBML 5GSRB 4D0DA 3OF6D 5JW4N 3NH7H 4XVSH 4ZOEA 5DJXA 5HXMA 1YMHA 4LCWA 4WDIA 1X5IA 5TE4H 3P9WB 1VADB 3CAFA 5T3ZH 3O81A 1B2WH 2BSRB 1ROWA 4PRAA 1UWEL 4K9EC 5BRZB 1RU9L 1WT5A 1DE4A 1YEDA 1OGAE 1RIUL 5SWZD 1CXHA 4GG6E 3MA9H 1F11A 4CMHB 1VFAB 3DGGB 3NIDF 1T6WA 3WIIH 4OIBA 4PBVC 3WFDL 2HLFD 3HS0B 4PJFF 1DVFC 2HT4C 2DQTL 1QNZH 3GB7A 4KVCL 2CR3A 4CDGC 5IJKA 3QSKB 2V2TB 4MX7B 1QSZA 1QSEB 4KMQA 3MODH 5HVWA 4P59H 2VZTA 3EYSH 4WWKB 4DVRH 4BH8A 3NIDE 1T1XA 4GRWF 4NZRL 4Q9RH 5IW6B 4YPGB 3TN0C 3L3KB 1INDH 5KAQG 4PJFE 2RCSL 3QJHB 5EOQL 3UYOD 3N1FC 5I1LA 1P9MA 2FHFA 3FN3A 4PRNA 4HK0B 1DBBH 2YKLH 4MNQE 4NO3B 4RAUB 4ZG1A 4TRPL 4KPHL 3VFSB 3U0TB 3QXDB 4OF7A 3ZT5A 3V5HB 3UBXB 1HQRB 2DQDH 4GRWE 4M3JA 3VRIB 1T04A 1AGCB 1IAOB 4AEIH 1OD9A 4OT1L 2AQ3A 4Q0XH 2EDYA 2BNRE 5A2LH 1T20B 2UUDH 1AGBB 1RI8A 4UIMA 4JJHA 1HZHL 3EOYG 4MDJA 1JPTH 4U7SA 3IFNL 3MGOA 3S37H 1NCWH 1Q1JL 1Z5LB 5EO0A 4YBHA 3FONB 4YWGH 5HY9A 3B5GA 1Q9LA 2PR4H 2HKFL 2E27L 3UO1L 4LLQA 2O5YL 2BNUA 1F42A 1U58B 3T0DA 2BVPA 3BRFA 5DUMH 2Y07H 5D1XC 5IT2L 3UZVB 1W0VA 3IFPB 1DDHA 4NO0B 3MLZH 2W60B 1NAKH 1F8TL 4R7DB 3PDOA 3QFJA 5GXBB 4WRLA 1CD1A 4G6KH 4NQXA 1O7SA 4U6HB 5EU6D 3BEWB 4IBLT 5C0CB 4QOKE 4YE4H 5FDYA 3NZ8B 4H26B 4LDOB 1R5WB 4YDVB 1QYGL 3C9NA 5CEXA 4AIZB 2SEBB 5EZJB 3JWDL 1RJZB 4F80A 1NLDL 2GITB 3WNKA 1I1RA 3MBEC 5GJSL 3QDJB 4R7NA 3NBNA 4XZUB 4FQXA 3LY6A 2R1YB 1JNJA 3X3GH 5CJOL 4MNHB 3RIAF 4J8RB 4PP2A 1T66D 2OI9C 1NFKA 1AR2A 5DHYA 1RUAL 3X11A 3WIHL 1JZ3A 2O5XH 3RVTD 2VKWA 2X4SB 2VLLB 1BLNB 1E4XL 2BNQE 3OKLA 4L8BA 1KPVA 5A40E 5CFHA 2H2SC 1KCVH 2K7QA 1WZKA 3QH3B 4ONGH 2IQ9H 4UB0H 3DSFL 1XR8A 4U1JB 3WD5H 4XVJH 2EYTB 2BX5A 5E2UH 2V7HA 4DGVL 1D5ZB 1JV5A 4A2LA 3VXTA 1V7NL 1SJVA 3GSNA 5AZ2L 3T1FA 1QLEL 3BD3A 1UENA 4QHKJ 4N1HB 5H8DA 2VE6B 4ZSOA 1FFPB 4KTEL 2Z8SA 4MQ7B 1J1XH 1E6OH 2QADB 2LU3A 1QKZL 4I2XB 4HULB 1NC2A 4CU8A 5EU3B 4OM1H 4U1GC 1IC4L 3L5JA 3E1F1 4LCCB 5HDLA 3QZWA 3HG1B 2F5BL 3SDCD 4U33A 2X4NA 2YPVL 3L95A 1MCNA 4PRIB 5GISL 4U0QB 2LVCA 4ZS6D 1XT5A 2GQHA 2J6EL 5CIPA 1MI5D 4LLUA 3SY0B 5T1DL 4OQTA 4GSDL 3SKMB 2HJLA 4F57H 3GHBH 1MHEB 5DMKB 3WUWG 3VD7A 4JG1H 5F7HA 3O8XC 1AI1H 1A9BA 3PHOA 1WBZB 1HEZB 3ILQD 4JFDD 3INUH 4I18B 1B0WA 2ZOLB 3NACH 3HRZB 2IH3A 4U1MB 1NEUA 4NBZB 1CBVH 3PWUA 1YYLL 4O51B 4NKMA 2VDOH 5DMGC 5JLZA 1CE1L 4ZUWB 4R26L 2G60L 1KPRB 1S5HB 5DFVD 2NY4C 5HHNA 1CT8A 2BOCB 4MDIA 4YO0A 4XP1L 4QGYA 4Z95L 4ZOAA 3RVWC 4ZNCD 1I7RA 4EUPH 3F7QA 4PJ5E 1WGOA 2A2QT 4P5TC 2FX9H 3CZFB 4C54A 4XHJD 4JFOB 4OGZA 4IOFD 5T5FL 1A6TB 3CH1A 1CICC 3MLYH 2VLKB 4OFYA 3UJJH 1NDGA 1G7IB 4NZDA 4J1UA 3V6ZA 1NL0L 4MCZA 1DQLH 1YNLL 3QBTB 5F7KC 4KZEL 3NCBB 3LRHA 5I8CA 2HP4A 3RWJB 3WDHA 1UZ8A 2N1KA 2DKSA 3O6FC 4G6FB 5GS0L 3E6HA 3PHQB 1CYGA 1Q9OB 2IQAA 4ZSOE 3BRDA 2VN7A 3FFDB 3AS0A 4LHJB 2DQUL 1N7ML 4MGXA 4QHUB 3R1GH 4BZ1H 4DVBB 4X6DB 2EC9U 3EYQC 1I1AC 4CADB 4EVNB 1U6AL 4AMKL 5F9JA 2J8UA 3F7RA 5DJCB 3X17A 3VFWA 4LCIL 3JV0A 3PL6B 5D1QB 5MEPB 5FAAA 1N64H 2IG2L 3AMLA 4DFIA 3DTXA 2MFNA 3G9VA 3MRCB 4PS4L 1NGWA 4FQ2H 1D9KA 3PE9A 2Q6WA 1I3RA 3AY4A 4XP6L 4C56A 1QLRA 4ZS7L 1FVEB 2BOBA 3RUGA 5JPNA 1UWGH 3CVHB 3WN5A 4EI5B 3DYMA 1U8PA 3I85A 5I1HH 1IL1B 4CN6A 3HAEA 3CGTA 2FEEI 3QEUB 3B9KA 4L3EB 5EBMB 1Q9WB 3V8CA 4YFEA 2JIXD 2EDBA 5IOPA 3O4LA 1OGTB 1MHPL 3REWB 1A0QL 2PCPA 4F15C 3B8YA 4KQ3L 4KKLC 3WO4B 2XQYG 1GGIH 4NYLA 1LO5A 3SN6N 3ELAT 4P23D 3JUYA 4LBEA 5DHVA 3CMOH 5EOCH 4ZAKA 1BX2A 3VFMA 2NX5B 2X1PA 4GRWH 5EU7E 3C8KB 5F9OL 1WC7A 4IRJB 1CVRA 2J8UF 4J2XA 4JHZA 4JRXD 5HSFA 2I26N 3RGVC 3D3VA 5FUOH 4KK5D 2IJ0C 3QDGB 4NP4L 3SDDB 2JKXA 1J88A 1WFUA 1RSFA 4NWTL 4YDIH 4YXHH 3D18B 2AI0L 2ADJA 4IMKA 2OJEB 2OZ4A 3BP7A 3MNZB 1KPUA 4QKXB 5D7SL 2J8UE 1L4IA 4IS6B 2WANA 1YN6A 4LSQH 5ADOH 3DO7A 4OGAD 1WCBB 1YMMA 3T0XA 1E27B 1QBAA 2VRAA 2YXMA 3JXAA 4RFOL 3FO9A 2C1OB 3F5WB 3MJ9L 4MZ2A 3L3JB 2WINB 1JNNL 4X9GA 2FATL 3T65B 2YMXH 3FCTA 4HUUB 3QIUA 2NTFB 3BDYL 3KS0J 3SOBH 1AKJA 2NY1D 4POUB 2L0DA 4PGCA 2P8PA 4JRYD 1JRHI 5JORA 5FYJL 1BGXH 2QSCH 2NMSA 5C9KA 1CF8H 3FTGA 4NJAL 3UTSA 2ORBL 5B38A 4P2RE 4YXLL 5GZOD 3S4SB 3P0GB 3PV6B 3ZKXB 3LQAH 4LLDA 5E5RB 4IOSD 1BECA 5IVZB 3TYFB 1VFOA 2HA1A 3MV11 3IETA 1KNOB 3FB7B 2YD3A 3IDGA 5GS3A 2EDTA 3LKPA 2OXGA 5DEFB 2VISB 3EHBC 1NGZB 3ECBB 4D9QE 3DVNB 4Y4HA 4HWEL 3WHXB 4LHUA 1AO7D 4DTGL 1TDQA 1IT9L 1RZGA 1B0RA 4MJ2A 2QEJA 1HIML 1MVUA 4UOW0 2GAZA 5E2VH 3ULVL 3WIFB 3LN9A 1U95A 1ZTXL 3GMPB 5C0AD 2E9WA 3MLSH 4FABL 5AZEH 1JIBA 4YXKL 3NCJL 3ZDYF 1MQ8A 3BH8B 2R56L 2VLMD 4H25B 5SX4H 3O2WL 2HFTA 1FH5L 2H41A 3CX5J 3GSWB 4XTRC 5T1KD 4ZFFA 1NMBL 2IGFH 5L9DH 1I7UA 1EJOH 5I8OH 5J12C 4M1DL 5BS0D 4XBEL 3QISA 3ZDYE 1F00I 3VCLB 1TCMA 1KCSL 4GG8B 2Y6SC 4L8SA 4I5BB 2JLLA 5HVHB 1V3MA 4YQXH 2EDWA 4YHZL 1U8NA 3SE4C 4RGOH 2HLFC 2YC1A 4NRYA 3HNTL 5BV7C 2MQ3A 3UAJD 3UTSE 1MFEH 1IEAB 2IPKB 5DS8A 5HHOB 4O5LL 2XNAA 5CAYB 4MD4B 5SWQB 3TEUA 5FHAL 1OP5K 1A64A 2VDLH 3G08A 2IAMB 3O9WA 2J88L 4RFNC 1A1NB 2R0WL 4BELD 1CLYL 5IHZB 1HINH 1U8MB 4P0DA 4AENA 4P2CG 2B4CL 5AYUL 1MWAB 1QFUH 2EEAA 3DIFA 3RWIA 4N9GA 3JV4A 3GI9H 4H88L 4OZFG 4G6ML 5C92A 5INCB 5DJ6B 4ZYKB 3BVNB 3KPLA 3WS6C 3MROB 3N1GC 1FORL 3AU1A 5CHNA 5DQJA 1MRDH 3CXHK 1MVFA 2D7TL 1N2RB 1NCTA 2APVA 7FABH 1IFHL 4OGYL 3C6SA 4YC2B 4HMDA 3G5VA 3QHZL 3U0PA 5DK2A 3BSZH 4M6NH 3RNKA 2IAND 4OF3A 2ZZUT 1CGVA 1JUFB 3MUGB 4JO1H 1LWRA 5DK0B 3F58H 4ONHB 3N1MC 5LBSH 5TFSH 1VADA 1DBJH 8FABB 3FOMB 4I0PD 2WUCH 5BRZA 3K4AA 3OXRB 5T3XE 3BZ4B 4LSUL 4I1NB 2PO6C 4IIQA 5MENA 1IKFL 1BBJA 3HE7B 1UGNA 1GAFH 3LIZL 1MJUH 3SDAC 5GS0D 1C7TA 1H9VA 4C58B 1GGBL 4Z6AT 1QHOA 4KAQL 1KELH 2V2TA 2HFGL 4MX7A 1QSEA 4P4KB 1S3KL 1OAQH 3VMOA 4UDUB 4WWKA 5E8EA 4PLKD 5E8PA 4FQHA 3ARFC 3MNWB 5IHLB 5KS9B 1D6VL 1EEZB 1GOFA 5IW6A 1BQSA 1U3JA 4MJ5A 3TNNB 3L3KA 5DURD 5KJRL 4Y8AA 4DUXA 2ZJSL 3QJHA 4N90E 1KBGL 5DJ2B 4QXGH 4HK0A 4RAUA 4FHBD 5D6CB 3VFSA 1BPVA 4PJDA 3V5HA 2HVJB 5ALCL 3TIEB 4A6YL 1OY3B 2FJFB 2C26A 4PRDB 1IAOA 3NH7L 4XVSL 3RVXC 3OV6A 2CLVA 2BRQA 1T20A 1AGBA 1QVOB 1UB6A 5TE4L 5T3ZL 5D6DC 1B2WL 4LGSB 1NCCH 2H32B 2P1YA 5HI3D 4OD2B 5SV3A 1OW0C 2P24B 5L6YL 3P4NB 4WJ5A 4HIIA 1A4JB 4BM7A 4WHTB 3DNKA 3MA9L 2X09A 1N5AA 2ZUWA 4RRPG 3WIIL 4C4KO 5EB9A 1SQ2N 1MY7A 1Q38A 2R69H 1MJ8H 1C5DA 1QNZL 2UVEA 3KXFD 4KKNA 3OJMB 3SDCC 5BRZE 4R7DA 4NNPH 2IH1B 2GI7A 1KV3A 3MODL 3Q3GA 3EYOB 4ZS6C 4H5SB 4P59L 3BEWA 3VFTB 3MREA 2Y7QA 1U9KA 3LS5L 5JOEA 4Q9RL 1ZHNB 3NZ8A 4RGNC 2A0LC 4H26A 2ZCHH 5ELIA 1INDL 3TVMD 1I8MB 4R8WH 1A8JH 3H9HB 4PG9B 4JFFB 1UJ3A 2CK0H 3NVQA 5KSBA 1DBBL 2YKLL 2GEEA 1QSEE 3QDJA 1KLFA 5E5MB 5K9QG 4ZFZA 3SKUD 4BKLA 3RA7H 1PZUB 3GSOB 4YDLC 3WUWB 2PXYA 4AEIL 4Q0XL 1SYVA 1F3JA 2VLLA 1C5CH 1XGQB 1NAMH 4M93B 1K8IA 1JPTL 4GLRH 3S37L 3V6OE 5TJWK 3EDEA 3VE0B 4JFHE 4XHJC 1K2DA 2DIAA 4YWGL 2FR4A 1HOCB 2PR4L 5FYJD 1G7MA 1BJMA 5BQ7B 1ZA6B 2EYTA 2Y07L 1JTOA 1D5ZA 4K94H 5KSAB 3MLZL 3RZWA 1NAKL 4BQ9A 4TQEH 1SYSB 3GMNB 4M6OH 2XTJB 1FFPA 4OKDA 4G6KL 3TV3H 1RUMH 5F7EH 3EDDA 5EUKB 1GGCH 2CRMA 3LKNB 1UEMA 5EU3A 4PGBA 4FQ1L 4K3DH 1Z9MA 3ARGD 1GGUA 3C6LC 3RAJH 5LXGH 2H45A 4PG2C 1CD0A 3BN9C 3D2UD 4CJ1A 3ULVD 3BQUA 4GRLC 4PD4J 4X6BA 3QQ4B 3X3GL 1RZJC 5C0CE 3KPTA 1QA9A 2R0KH 5E9DA 3G6JB 1MNUH 1A6PA 5DFWH 1MHEA 3TZVC 3T0BA 4J3SA 2O5XL 4YBLB 3RY4A 4XNYH 1ORSA 2ZOLA 4CNIB 3L9RA 4YEEA 3QDJE 3I6LD 1BQLL 1VESA 4U1MA 4WUKH 1KCVL 1TZGL 3LHPH 4HUVB 1G0YR 1Z9OA 3VXNB 4NQDB 2HJFB 1CFTA 4ONGL 2IQ9L 4UB0L 5F7FA 3QUXD 3WD5L 1S5HA 2A6KB 4XVJL 2YOCA 5J7CC 4U3XA 4FQCH 1JHLL 1TENA 4HH9B 3JV6B 3X12A 5DVOA 4JY4B 1M7DB 5BZDB 2PTTB 4RMTA 2E6PA 5F3HA 3FB5A 4JFOA 4XAWH 1E6OL 4F9PA 4RQQB 1KENH 5FF6A 3U30B 1CN4A 3KPSA 4JFYB 4N0CD 2MWCA 4R4NC 4PY7B 2VUYA 2CMRH 1EUUA 3FQRB 3T0EA 5IW1B 5MEQB 5JTWA 5FUZH 1Q9OA 4M7ZB 4PYGA 1INEH 4KK5C 3BO8A 4NN7B 2IALA 3PXJA 1J0IA 1PKQB 4MD5A 5GGSY 4EVNA 3EYVB 3HG1E 4X5WB 4Z7UB 1AI1L 3B9VA 3QXAB 1CE6B 3INUL 5DJCA 2K1MA 4PRIE 1UXWB 3NACL 3CCHB 3NPSC 2O93L 4MWFB 3PL6A 2O61A 2QR0B 4FNLH 4Y0GA 2V9QA 1CBVL 3MRCA 1G7PB 4PJEB 2VDOL 2NY1C 3HMWH 2APFA 2BVUA 4M3KB 3RKPA 5AG9A 4P2YA 3VGAC 5JW5B 3D85D 4F33B 2FLRT 3CVHA 5DTFB 5HHQA 1J11A 2DN7A 3TNMA 1HHHA 4BSWB 3KPMA 3BP6A 2FX9L 1KF9B 4GT7A 3CPLA 4G9FB 3S88H 1DUZB 4XPHH 1ZT4B 3UJJL 2CIKB 1OGTA 3X14A 4MS8D 1MH5A 4HKXB 3M45A 5HD8C 2ADFH 1E4KC 5DVLA 3HE6D 3MLTA 3THMH 5M94B 1FC2D 4PV8B 3O0RL 3PGFH 3T2NH 1NPUA 5ID0A 1DQDH 3NA4A 3ZTJH 1OB1B 2VLKE 3W81A 3VWJC 4OCYL 4UTBH 3R1GL 4BZ1L 3IU3A 2NR6D 4X6DF 3C8KA 3MPCA 3O45B 3KLSA 5GGRA 4P2OD 3CXDH 3QUYD 4F7TA 4ENEC 4NRZA 1Q8MA 4EN3C 2ICWI 2GSIA 1GGTA 3SDDA 1N64L 2E7BA 3ULSB 4OBSA 2X4UA 4OBRA 1FL6B 4FQ2L 2YD2A 5A2JH 4KJQD 2W0FB 4LFHD 1FGNH 1S9YB 4NSKB 1H8NA 1JGEA 2W65A 1ADQH 5I1HL 2CRIA 3L5IA 3HUJA 5HVGB 5E2JA 2X4RB 1K85A 3QUZB 4PJXB 3IDJA 1CDUA 3RX7A 5T3ZD 1R0AH 4YHYC 3ALXA 4FFVC 4EIGB 4XCFL 1KACB 5HGBB 3L3IB 2DICA 3QDMD 1UWXK 4GXVH 2APXA 3MUY1 4NRXB 5CJBA 1EPFA 1GGIL 2CLRB 2VL5B 1L7TL 5D1XA 4AK1A 1S7SB 1PX3A 3VXMD 3P4LA 5MEOB 3PV6A 4L3EE 2X9YA 3BUYA 4LLWB 3CMOL 4QHNA 2AJYH 5EOCL 3CK0L 5KSVB 5HGGS 1KNOA 5IQ9A 4KGJA 3FB7A 5DJDB 5K9OA 3DXAD 2E7CA 1MFAH 2VISA 4KTYA 2KPNA 1B4JH 1E0OB 1S78C 5L8LB 4LCUB 3WHXA 5J6HB 5FUOL 4K7PH 4ZFGH 1SM3H 3O41B 3SKJH 3MBEA 3VFNB 4YDIL 5DT1L 4YXHL 3WIFA 5M7QA 1WTGT 5EZIL 5J89A 3ULUF 3D39B 1ETZB 5D2NA 5DD1H 4HJJH 4KK9C 4LSQL 5ADOL 3AROA 5E70A 4OI9A 3QJFB 4KRLB 3CFJA 4MMZC 5E8NA 2VDQH 5HJ3B 4ELMB 1RHHB 4OZFB 2ICWB 4I13B 3AAZA 4JM4H 3NN8A 3QDGE 1O5DT 5JDSB 2YMXL 4K7PY 3BH8A 3MXWH 1CZ8H 1XF3A 2Z31C 1OL0A 5F93C 4RNRA 3SOBL 2I60H 3ULUE 2HWZH 3EO1B 3GSWA 3BGMB 2XT1B 4GFTB 1K4DB 2YWZA 3UP1A 3EKCA 1BGXL 2QSCL 1CF8L 3OKKB 3TO4B 4I0PC 4KKCD 1MUJB 1HDMA 2FSEB 4NN6C 2FO4B 2A83B 5DO2C 3VRJB 1EFXB 3KJ4C 3ARDC 3FT4B 3LQAL 1FFNA 3BDBA 4WGWB 4HJGA 2FBOJ 5L2KD 4MXVF 4HD9A 2YD6A 5IBLD 1NEZG 4UV7H 4IMLB 2M2DA 2G2RB 2VITB 4LP4A 1RV6X 4QTIH 32C2A 1IEAA 2IPKA 4QO1A 5FGBC 5SWQA 3LD8C 3HR6A 3GEWB 5EU5B 3JWNC 1U3HC 1P1ZB 4RIRB 5E2VL 4MXVE 4R0LB 3LEYH 1ODAA 5D7IA 3TBSB 5IHZA 2ZKHH 5CD5C 3MLSL 5FGRA 2VZUA 3TBTB 1IQDB 2VUOA 1OARH 4QRPA 4AL8H 4Z78B 3TBYA 3O8XA 1RY7B 5K9QI 3MRLB 5EH1A 2VR9A 3KDMB 5INCA 5GRJH 4DZBA 5CEZH 2J4WH 2CH8A 3MROA 5C0BA 3N0PB 4WUUA 2WNGA 2JIXB 4JFZL 1B88A 4Q58C 1N2RA 2EE6A 1DLHB 1ITCA 3KPPA 5L9DL 1A6WH 4NWUH 4JZOA 5HI3C 1EJOL 2R2CA 3P30H 5I8OL 3MJ7B 5F3BB 3ARED 4L29A 5GQBA 3RWCA 2RAMA 4OV5B 4IRSD 4RWYH 1W72B 2PTUA 4M4RA 3MUGA 4X7EC 1N4XH 5DK0A 4P23B 3U7YH 1T0PB 5DMYA 1H0DB 4FXKB 1FNHA 5FA3A 3QA3B 3WJJC 1SJXA 2WLYA 1C1EL 2H6PA 3QHTC 1HHKA 1JI2A 3BZ4A 4R9HA 1MFEL 4DOHB 2VXSL 3MRGB 1MCIA 1F4AA 1R3HB 2VDLL 5CWSA 4Y4KB 5F9DC 1WAAA 2NZ9C 2B1HH 1HINL 4HDIA 1HSAB 2Z4QA 2Q86A 3ARTA 4KROD 3ZL4H 1MFDH 3E2HB 4YHLL 2YEZB 1E4XI 2HRLA 2GJZA 1QFUL 5E0QA 3OB0H 4HC1H 3WS3A 4G8IA 4UQ2B 5HHOE 2GJ6D 2VDMH 3EZJB 5C07B 4P2QD 4QXTB 4UDUA 4HUXA 1IM3B 3KYKH 5ABDE 2Y1VA 5ISZD 2MQCA 1G9MC 3L7FA 1EEZA 4QRSB 1BVZA 3TNNA 1PGRB 3BT2H 2X4PB 3U4AA 4E41D 4B7LA 2H8PB 1TPXB 1Z0NA 5DJ2A 5HHPB 4LPTA 7FABL 4KFZC 4RDQG 2E7HA 4QRPE 4JRYB 3DROA 5D6CA 1BOGA 5IMKA 3GKZA 1OSZA 1UYWH 5GIRB 5TPWL 5J06A 2HLAB 1GHFH 2BHZA 1EZVY 2FJFA 2GTWA 3FQUB 3ZKND 4PRDA 4WO4B 2FO1A 2NLJA 4JO1L 3F58L 3LKSB 3RL1B 4NUJA 3MV8D 1CFVH 1DBJL 3D5OF 4HS8H 5DRWB 1MCSA 2WUCL 2J12B 5D7LA 3VXUD 2P24A 3FFCB 3D0VB 2FL5B 3P4NA 3MR9A 3MGTB 1C8PA 1BD2D 1FO0B 2DBLH 2YRPA 4LGRB 3F65A 2ZUVA 3EFDH 1EAPB 3EIFA 5F96H 4HIEB 4TTDC 1WAAF 3GBMH 1GAFL 3WNNA 4MA8H 3KNBB 3RTQD 2MCPH 4Y2OA 2AK4B 4OCRH 5ILTH 1UA6H 3VXSA 1KELL 5ESVA 4LFHG 5IB4B 2IH1A 2WWMC 3ULVC 3DBXB 5IB3B 1MREH 4H5SA 2D3VA 3QT2A 2F53B 1T1WA 4KMTH 1ZVSB 5B3JF 3NCCB 5FO8B 5KS9F 1ZHNA 5GGVY 1WAAE 1I8MA 1UXSA 4B5EA 4EDXB 5LAXA 3MRFB 4JFFA 3F7PC 4Q7DA 4QXGL 5DA0B 1GC1H 1SMAA 2LFGA 4NQEA 1NANH 3MV7A 1XGYH 1AQDA 4P3DA 5B3JE 1U8OA 1OOAA 4JB9H 5E4EB 2F74B 4WV1C 5KS9E 1KG0A 4FQQB 1H15B 5EN2A 3WUWA 4XI5D 2NYYD 2D9QB 4LLVA 2XXCB 5FXCH 3UTTD 4RA0C 3MBXH 4GMSL 4JAMB 5D93B 1JHTA 2R29H 4GKZA 2NPLX 3VE0A 2AEPH 3N9GH 1UG9A 4Z7NF 3DSNA 2Z91B 1QOKA 2LQRA 2KKQA 3H9SA 3SHSA 1A9EB 5BQ7A 2QSVA 1OF2B 1X5HA 2GIYA 3L5HA 5IKCB 1XIWB 1MRCH 1E6JH 4XWOC 2R69L 4JPWH 4DGYH 4MNQD 2Q7NA 4N8PA 4ODSH 3RWFA 1YY8B 1DEEB 3GMNA 5D7LE 4NNPL 3L3OA 4G9DB 2AABH 3H3BC 5ACZB 2XICA 1VFBA 3GSVB 4Z7NE 4PJ9C 4NQSB 1H3TA 2FWOB 2B4CC 2BNRD 5FFLA 3MOAH 1ZLWH 1HYRC 2XIDA 1HH9A 3F12A 3QQ3B 2ZCHL 1URLA 4HWBA 4LF3B 4R8WL 5IFHH 2KBGA 3U2SB 7CGTA 1BIIA 3OKEB 1MAKA 2CK0L 2RJMA 2ZNWA 3A6OA 4M1CD 1ZLVH 4LAJH 5JW4R 1P4IH 4JDZA 5C0DB 5EOTB 5FB8B 2JJSA 2IANB 1MHHB 4O4YH 2DYPB 1XF1A 4QYOA 4KJWC 3OF6A 2DWDB 1AP2A 4GKNA 4JFFE 5JMRA 1C5CL 1NAML 3MO1B 3VMNA 2YUVA 3WNPA 4OAWA 1EBAA 4NQEE 4HUVA 3X3FL 4QOKD 1F3RB 4KXZH 3VXNA 2HJFA 1TVHB 2ICWJ 4RBPH 3RZCC 2CPCA 2QLVB 5ERWB 5D1ZD 3VXOA 4HZLA 4PTUB 2MTPA 5HGAB 5SWZA 1UM4H 1RD6A 2IPTH 2DLFH 3W11C 3RKDD 3JSSA 2IPUK 2A6KA 1HH6B 3H3PH 2GTZA 4WI8A 2EDKA 1NCNA 4K94L 3WHE0 5T5NG 1XGPA 2EYSB 4MA7H 4TQEL 4HH9A 3JV6A 1VACB 4M6OL 4QLRA 5BZDA 1JK8B 2PTTA 5C0FA 4OZ4A 1OPGH 3SE8L 1J87A 3TV3L 1RUML 5F7EL 3B9DA 5HYFA 1GGCL 5J4MA 1DZBA 3V0VB 2X7LB 1I7ZA 4JPIB 5EWIH 5IVXB 4I9WD 4K3DL 2YBRA 4Y4FC 3RAJL 5LXGL 2BNQD 2W59A 3RDTD 1RMFH 4G8GD 3EOBA 3QUYC 1DVFB 1M71B 5DURB 4OKVB 2F58H 4Y16C 2CDFA 2EDXA 2XTJE 4WTWA 4PJ8D 5C6TH 3BPNB 4QRUB 1PLGH 3V95A 5JOFB 4NDMB 2RQ8A 2R0KL 3G6JF 2WIIB 3N85H 3FHAA 1CTNA 4X6FA 3WLBB 5FIEA 3QI9D 5FUCC 4Z7UA 1JWSA 4FFZH 5E1HB 1CE6A 5J3HD 4XNYL 1BZ7B 2O5ZH 3MRMA 4EJ1C 2L7JA 5I75B 5C0IB 4WUKL 5D70H 5FYKE 2QR0A 3LHPL 4KI5F 3BFOA 4RFEB 1F6LL 5JOPE 3G6JE 4PJEA 2MJWA 3ZTNH 4X4ZA 4L1HA 3TH2T 1IAIH 5D7JC 5EC1B 5JW5A 1FN4A 4UU9A 3DUSB 1RZKC 3SKNB 1E4JA 4FQCL 4EKXA 3S36X 3SDXA 3KXFB 1NMCC 4KI5E 1FPTH 4XAWL 3BIAX 5FKAA 4M8QB 1KENL 2HJKA 4ZO6A 4YHIB 5SWZE 3G04B 2D0GA 3U4EB 5EU6A 4HKXA 4OFVA 4KRPC 1PQZB 1W8OA 2FYYB 2Y9RT 4JN2A 2CMRL 3QUKB 1G7QB 1RJLA 1X5FA 3TVMB 1S9WB 4BQ6A 1MWAH 5FUZL 3P73A 3P77B 1INEL 3ET9F 1OAXL 2A6IB 1OB1A 3ALWA 4HKJB 1WSST 1F4WH 1AHWB 3O45A 1HN1A 3SO5A 3QIWC 4Z7UF 2GYSA 2ENYA 3BN3B 1HHGA 2R0ZH 2DWEB 2AJSH 4EUPG 2ESVD 3C2SA 4ODWA 4FNLL 3ULSA 4LOUD 4GW1A 1CXEA 1FL6A 5JHDB 2A6JB 5EUOB 2BVTA 2DLEA 4PJEF 1PKQE 3HMWL 1CCZA 2NY0C 2OI9B 2EXYC 2VAAB 4FZ8H 4D0CB 4NZJA 4Z7UE 1JF1A 4NNYB 1NDMB 1JYVA 4ZNEA 5D6DA 2PTVA 3MUHL 2BVOB 5KOVC 2EZ0D 3ZT7A 2X4RA 2YPKB 4PJXA 1OW0A 3S88L 3CDGA 1CFQA 5FECA 1ZHKB 4XPHL 4PJEE 1X5ZA 3OR6B 3MJ8A 2YA2A 2VLRD 1Q72H 2AEWA 3NCEB 3BKJL 5HGBA 1JZ8A 3BPLC 3BYTA 3RL2A 5D96B 3G5XB 3THML 3ARGB 2VL5A 5I66B 5IP4A 5LVEA 3PGFL 4GQ9H 4UBDD 5MEOA 3D2UB 4N8CH 1LO3H 1Z2KA 3S3PA 3SDCA 4Y5VC 1BWMA 4POZC 1DQDL 4G9FE 4LVHB 4DQOH 4S1RH 4DN3L 2DBJA 1U0QA 1F6FB 3MRPB 3TBVB 3WFCH 5KSVA 4UTBL 5DUPH 5GS1C 1MI5A 4U1IA 3NFPB 4U1GB 1LO4L 1PDKA 2WSKA 2A9MH 2XN9D 4MXWH 2XWBA 4NBYB 2J5LC 3IB4A 2E9IA 4JFDA 4NO2B 1T22B 4NM8H 3TIDB 3IKCA 2R0LL 1P69B 3VFNA 5JQHC 1J1OH 1AD9B 4YNYB 3WCYA 1FGNL 5E6IC 4QEGA 5I2IB 3TF7C 3MRKB 1ADQL 3VWKC 4OZFA 2ICWA 4NKIH 1IE5A 2H32H 3BE1H 4UINH 1X5YA 2W9EH 4PJXF 5JZ7D 2XACC 4JZJC 2ICCA 4FTVB 5JXAH 1R0AL 4HBCH 5CBAB 2AS5M 3DWTA 3OKDB 1K4DA 5C8JB 2EIZA 2HT3C 1M6OB 3AFLA 1MJJB 3NCYS 4GXVL 3WE6A 4O2FB 2NY4B 2IBZY 4P5MB 3VFVB 2FSEA 1G1YA 3Q5TA 1Z9SA 2R2EB 4WU5B 4PREB 4ONFH 5I8KH 1U91B 1IEBB 1CD8A 4GMTH 4KJYB 4PJXE 3FT4A 3NPZB 3HC0A 5IEHB 5JPMB 2AJYL 2WQRA 4LLMA 4U3CA 4IEFB 3U9PL 4U7MA 1I85A 1MFAL 1UFUA 5ALBH 4IMLA 2DQFB 1B4JL 4XCNB 4BH7B 5FCSH 1Q9KA 3UTPE 5ICZB 1AGDB 1U92A 4PG2A 4IDJL 4K7PL 4IJ3C 5CUSL 4ZFGL 3U83A 4PRHD 3IDXH 1SM3L 2GKIA 3SKJL 2AV7A 4GAYB 5DD6B 1T7WA 5J8OA 3STZA 2KZ1B 3LPGA 1MI5E 1YYMH 3MJGX 1YUHA 4J4PD 1A7RH 4HJJL 1I1AB 5IHUH 3TBTA 1IQDA 3Q48A 5HYJD 2BERA 1KIUA 4ELMF 4P2RD 4FN0A 3D85B 5CJXA 4JM4L 5GGTH 4XC3H 1RURH 4LDLB 3HZYA 3MXWL 2K3TA 2A1WH 1CZ8L 3IFLH 5F6IC 4XMPH 1PZ5B 3HI6H 3CMGA 4V1DD 2I60L 3TJHD 1CGXA 2HWZL 4HKZB 1HNFA 2JIXA 4XBPA 3BESR 2BXZA 3C5ZD 2R8SH 2X4QA 3FOLB 4ELME 4FXLA 3MJ7A 2VERN 2MHAB 4AEHL 4OV5A 2VIRA 1MCOH 1M05A 1ZSDA 2EIEA 2LE9A 1S7VB 5DEGB 1U8KA 2ATPB 3CC5A 2X9XA 4P23A 5HDOA 43C9B 3RTQC 2X41A 1NGYA 4FXKA 4UV7L 1VCAA 4W81A 2YUXA 1YNTB 2NY2D 4QTIL 1XF2A 1YECH 4P2OB 4XT1C 1TQCC 4JRXA 3MRGA 4YX2H 4RRPA 3MCKA 4FQPA 5FYKH 5EA0H 4Z76B 1SBBA 3BGFB 2XA8L 3LEYL 1HSAA 4KK8C 1CG9B 2ZKHL 3WL9B 4MYWB 5SX5K 2AGJH 4UAOB 3OL2A 1JZ4A 1OARL 5TE7H 3R06B 2ADGB 1KT2B 3RGVB 1FZMB 2OTUB 5GRJL 5IM7A 4LKCB 4QRSA 2J4WL 5CEZL 4NC2B 2IFGA 4JPVH 4AH2A 1RK1B 2OMNA 5FOBA 1GZQA 5J9PB 1MIMH 3GSQB 5H37H 1A6WL 4NWUL 5HPOA 4JRYA 1P2CB 1S7QA 4MJIA 4OB5H 3ROLB 1J5OL 1XCTB 2HLAA 4P46C 3VXMB 4LKXB 2GCYA 4RWYL 5DVKA 4X4XA 4MAYD 4E42B 1N4XL 3U7YL 4AIOA 3RL1A 2DQJL 2RBLA 4GW4B 3NGBB 3C09B 4Y7MA 5FA4B 1T5XA 2F8VA 4PJBA 1HILA 2D7PA 3ZDZE 2Z8WC 4XBGB 3RNQB 2FL5A 3BZEA 1N26A 5SWSD 2VYRE 4R97B 3TJEH 3IRPX 1AO7A 1HXYA 2NY6C 3DRTA 4R2GC 1KYOJ 4HXAH 1TZHB 4P5KB 4MSWA 1QSFB 4U2ZA 3IU4H 3KHQA 4UTAL 3P9LB 2B1HL 2P4AB 4Y1AD 4LU5H 5E08H 3ZL4L 5HPMA 5C0AA 4PJHA 5ENWA 4HC1L 5C09A 3LDBB 4DOHE 1YY9D 3VFGH 5IB3A 4LIQE 2J7LA 5HGHB 2DTMH 2VDML 3WDIA 4J3OC 5J1AB 5IF0A 3KYKL 3M1BA 3EJZD 5F7WC 4FQLL 2Z93A 1MCPH 2NY7H 2VDKH 1SEQH 3BT2L 4EXPX 4Q6IC 1G7JB 3O11B 4EDXA 3MRFA 4AG4H 4YK4B 3CX5K 4UILH 2AXHA 3AM8A 5T1KA 1UQSA 1P7QB 2VXTH 5C07E 4F8TA 2GK0B 4R4FH 1UYWL 3AB0C 5K9KA 5BS0A 4M00A 3K4ZA 1GHFL 2F74A 4QF1B 5IMLB 1R3LB 2ZG2A 5IEKA 5H2BB 1D3CA 5IJKC 1CFVL 5F9AC 3PWPB 4HS8L 3UZEA 4JRYE 5I1AB 3HI1A 4JO3H 5J12B 5E00B 3PHSA 4KKAD 4LSPH 3PUCA 4YFDB 2DBLL 1P5VA 5D9SA 3PWNB 1A9EA 3MNVA 4N90D 3EFDL 1MHCB 5F96L 5GSVB 1GL4B 3GBML 5B8CB 4MA8L 1P9MC 2R9HD 2GT9B 4M1GL 4O00A 2P7TB 1B0GB 4OCRL 3MRHB 5ILTL 1S5IL 1UA6L 3RDTC 1LEKB 2DM2A 1YY8A 4ONOA 1OP3H 3CDCA 3CFBA 4PJHF 1ITBB 3FFCE 1MREL 2J6EA 5ACZA 4F58H 4L4TB 4N8VG 4P48A 3QCTL 4PJGA 5LCVL 1T5WB 4KMTL 2FWOA 5IMMB 3ZZ1A 4N0UB 4MZ3A 3QQ3A 3STLA 4U3HA 4Y19B 2AK4E 1CK0H 3D25B 5DJ8B 3U2SA 1HYSD 3IRZA 5LGKA 3H0TB 4PJHE 3UTQB 1GC1L 1DBMH 1EH9A 1YEEH 2BFVH 3QFDB 5B39B 2F53E 1XGYL 3LKOA 1EEYA 4JM2D 4OUUB 5EOTA 1JHKH 5FB8A 2X2YA 1UZ6F 4Y5XB 4JB9L 5KVGL 5C1MB 2IANA 1MHHA 2FCBA 1A2YB 4R3SA 3IAGC 1LE5B 2HFEB 3H9YA 4BSVB 3MBXL 5IR1B 2R29L 4RAHA 1N6QH 4H1LH 5GRVL 3VRLE 4I0PA 2AEPL 3QO1B 5DVNA 2YSSB 4J7RA 4ACPA 4Y5YB 1TVHA 5DZNA 1UZ6E 5L7XH 4L3AA 3B2UD 4KK6D 2ZUTA 3ARDA 2HVKA 5FM5M 2X4OB 1I8IA 4L8DB 4IOIB 1MRCL 1E6JL 3DMMB 4JPWL 4DGYL 5IFAL 3WYRA 4ODSL 2XZAH 4OLYH 4KROB 4FQXC 4TN9A 3TFKC 2BC4A 2NY3C 2AABL 2VB5A 4IHOB 1G0XA 1VGKB 1LE9B 3RI5F 3KLAB 3PWJB 4PJGF 2PO6B 3V0VA 4JPIA 5DJZB 4XPTH 3FB8A 1SJHA 4P2QB 4QRRB 5IVXA 3MOAL 4Z8FL 5ISZB 5I6XB 1UKTA 2B7DT 5DMIH 5TGBB 4FFYH 5IFHL 5H35A 5EFIB 4E41B 4I0CC 1ZA3B 4TUJB 1CGUA 1A7QH 3VH8B 2P45B 4KV5E 2EDFA 1P4IL 4PJGE 4LOUC 3RPIB 3OKNA 4M6AA 2DD8H 3IF1A 3GBLA 4O4YL 3WLBA 3DX9B 5GRYA 4CBPA 1RVFH 3KPNB 4NIKB 4DZ8A 3TPUB 5F6HI 5H94B 5IESH 3K8LA 4YGAB 3MV8B 3OJVC 4MXQD 4OZHA 5DZOA 2HN7A 4RFEA 4ZPTA 5ADPH 1LO0H 4LQFH 4WEBH 3UTOA 1J0KA 2XTLA 5EIIB 1UM4L 2IANE 2IPTL 2DLFL 4JPKH 3PJSA 4NO0D 3V5KA 2WV3A 1KIRB 1R5IB 3H3PL 3H8NA 4OM0H 4WI4A 4U05A 1ZEAH 3KR3H 4MA7L 1G7LB 4O2EB 5I0DA 3WJJA 4UBDC 1S9XA 3KXFA 2B8OT 1OPGL 3SCMD 2W0LA 1EX0A 3QQ9C 5IVXF 4NC0B 5EWIL 2H3NB 4J3XA 4WU7B 1TJHL 2FYYA 1FYTB 1G7QA 4OLXH 1ACZA 1RMFL 3TVMA 1S9WA 4JFED 1MFCH 3U46B 5C2BL 1AGFB 4P3CL 2F58L 1CDYA 3P77A 1A1OA 2P5WB 1MEXL 3AVEA 5EZLB 1E28B 2ZPKH 5C6TL 1PLGL 3T4YB 5JNYB 1FSKC 1A4KA 5KSUB 4HIHA 4I48A 5BMFH 1JPST 5IVXE 2JTDA 3N85L 2HRPL 2AVGA 1AHWA 1MIEL 1GOHA 4U1KB 4U4BA 4YAQB 5I74B 2WP3O 2E9BA 1SMOA 2YPLB 4XGZB 4FFZL 2BVQA 2G9HA 3TYGH 1GYAA 3MJ9A 1K8DB 2O5ZL 4G6AD 1WCQA 3T3PF 5CEZD 4ZQKB 4OZHF 5D70L 4LHUG 5F44A 3PNWB 1LK2B 2A6JA 2X1QA 4HFWA 3ZTNL 1YEHH 5CLTA 1OHQA 1W72H 3HZKA 3SE3C 3DV4B 3IGAB 4S10A 1RK0B 1IAIL 3B2VH 4JN1H 1OTTD 3LMJH 4ODBD 5JW4M 3N06B 5LGJA 4OIIH 2UY7A 4RMUA 3ARZA 4NQCD 3T3PE 2AXFA 2QADD 3BW9B 4K7FA 5DWUH 2BVOA 4OZHE 4G42A 2YPKA 1ZVYA 2BY0A 2QHRH 4LIQH 1FPTL 1ZGLP 3QNZA 1SHMA 5E2WL 3TCLB 5DI8A 3HG1D 2G75B 3GMLB 3MLPA 1Y6KR 5I16B 4XP9H 4PRID 2Y72A 1KB5B 2BMKA 3ARGA 3FQTA 1XF5B 1XMWA 3GBNL 1MWAL 4L1DA 1L7IH 3D2UA 3KXFE 3VFRB 4FXGA 2WMPA 1B4RA 2IFFH 2YD5A 1D9KC 3TO2A 5SX4I 1KCRH 3BISA 2FIKB 3O3DA 1P7KB 1NEZA 1KB9K 2FGZA 3BZDA 3PIQB 4DCQA 1TFHA 3UPRA 3RU8H 1S7WA 5CMAB 2R0ZL 2DLIA 2AJSL 2W07A 5CZXD 3B9KC 3RWEB 4NO2A 1T22A 4K3EH 2OQJA 2VSDA 4U1SB 3TA3D 4AEFA 4X99B 5EUOF 3EOAA 4XXDA 4R96B 5EULV 3MA7B 2O5YH 4YNYA 3I6KA 2DI7A 3FO1B 4WV1A 5D1ZB 4ZFOL 4FZ8L 5I73C 1EGJH 3QUXA 3C5ZC 3TZVB 2Z8VC 4H0GA 1DUYB 1H3WM 2G5BA 2PW1B 5I1DA 2WWKO 3QWQB 5CCKL 1F8TH 1MOEA 3L3HB 1KLGA 2BSSB 2VLKD 1EEUA 3NABH 4ZAKC 3ZTJG 5JHDE 5EUOE 4DUVA 4K94C 1FO0H 3QULB 4CVXA 5ANMA 1VB9A 4HXBH 4JFXA 5FYJE 3UJIH 4WTXA 5C8JA 1C08B 1RZ8B 1QYGH 2D31B 4KHXH 4O58H 4JFPB 3REVB 1G6RH 1JWMA 4HS3B 5FDWB 3LPFA 3HZMB 4GQ9L 1HWGB 4G8GB 4N8CL 1LO3L 1KTLB 4S1RL 5J56B 5IEHA 3MFGB 2QQKH 4HUMB 3BP5B 4PRPD 5GHWH 5DUPL 1IAKA 4UV4H 4PLJD 3WIHH 2M1KA 4R4BB 2ICES 3R0NA 4K2UH 1PAMA 2X4TB 1U8JA 1MFBH 1UCTA 4H8WH 4MXWL 5DRXB 2P46B 4F7EB 4DK3A 1G7HB 4WI6A 3QIUC 2CDGA 4P3WA 4NM8L 4BK5A 2NY5C 4LVOC 2AXJA 3ROOB 3VD9A 2EH8H 3VW3H 4CVZA 3GRWH 2DMKA 2MPAH 5IB1B 3KYOB 4Z0XA 1S7TA 4EI5D 2CXKA 3V52H 1GZPB 4UIKH 4Z7WA 1V7NH 1CLOH 4P49A 3VG9C 1LD9A 3O2VL 3D85A 1AIFB 4L3ED 4NKIL 4UINL 3BE1L 2W9EL 5C0EB 1T83A 3KPQB 3LH2H 1D6EA 3I6LE 3I02B 3V5DB 5JXAL 4HBCL 3VDCA 4LSVL 2CDEB 3RZCA 4HKZA 3SBWC 1U3YA 1S8DB 3Q6FB 4Y4HC 5F89B 2GFBB 4HF5H 4C83B 3FOLA 3ARUA 3I3EA 2F5BH 4XP5H 3DOSA 3RGHA 2CUIA 3HE6A 4P4RB 3S96A 4FG6C 5GISH 3TT3L 3KWWB 3K81A 4ONFL 4PTTB 5I8KL 3G5YB 4GMTL 1BVLB 2NX5D 1OM3H 4FTVE 4D0BB 4PJ7A 4GSDH 5J0BA 3UBXG 3W9EA 1QFOA 3DX7A 4Y89A 4KU1A 5ALBL 4GRMA 2B2XH 2VMFA 3QDGD 5EU4A 3QEQA 1YY9C 2A73A 2EKJA 5L2JA 4P2OA 3QUYA 3SJVB 2P8MA 3JWOC 2X89D 4F37K 15C8L 1XF4A 2DI8A 4LSDA 1UJTA 2C1PA 3MRRA 1CG9A 4Z7WF 2VKXA 3VGEA 1C7SA 5IHUL 1TTUA 4F7MB 2AEIT 2VO5A 4M5YH 2LU4A 3MRIA 1MCRA 5GGTL 1RURL 1FZMA 2OTUA 4A6YA 4EN3B 4L8SC 2A1WL 4HS6A 5ESAA 1J7VR 3IFLL 4XMPL 1W0WA 3HI6L 3W0WD 1Z9LA 4NFCA 4HEPG 2DTSA 3G5ZB 3CSYA 3MXVH 4M4PA 1IGJA 4Z7WE 1A3RL 1NBVH 1YNLH 3DRQB 4K07A 2R8SL 5I8EB 5JUEH 3K1KC 1P2CA 3QDMA 4HWZB 4PJCA 2F15A 1TZIB 3QEHB 5GS0H 3ROLA 2GUOB 1JPFB 1XCTA 3O9WC 4PV9B 1AGEA 1MCOL 4KJPD 3VXMA 1MAMH 4TSAH 2A74A 2IBGA 1K9TA 2VC2H 2ZUXA 1U6AH 4AMKH 4MA1B 1FG2A 3LN5B 4GW4A 25C8L 3DXAA 5DUBA 4CW1B 4ZOCA 1EVUA 1H3UA 2XN9B 3E3QC 4YX2L 4PGZA 3G6AA 3Q0HA 1I3GH 4P5KA 2I07B 2J8OA 2B0SH 2BJMH 3P9LA 4FQJH 2ITDB 1YDPB 4XP6H 3TBWB 4PGEB 4QHLA 5CBEA 1F4YH 4GLRI 5TE7L 3H3KA 4ETQB 2UWEA 1ND0B 3NIGF 2F5AH 1LMKA 2VR4A 4OFKA 2AQ2A 2LAAA 4G80B 1T7YA 2B1AH 3BP4B 1MIML 5IGXH 3GJFH 4KQ3H 3PWLA 5GGRY 3ZKSD 1TJGH 5DF0A 2VDNL 5MI0C 4G8EA 4OB5L 4ZXBD 3UTZA 1G1CA 2KH2B 2GK0A 2R15A 4CMHC 3U82B 3NIGE 3EYUH 1T21B 3HRPA 1NJ9B 3GIVB 5IMLA 4KK6C 2V5TA 4RAVB 5F7YC 5T3ZE 5ETUB 2WBKA 5JMOC 3SQBA 5I19H 5L2KA 2Z92A 2YA0A 1RUQH 5HHOD 3ZKMC 1BREA 2UY6A 5I1AA 5IW3A 4I77H 4WWKC 4LRIA 5F6HJ 3HC4H 1QQDB 2IAMD 3K46A 3WFHB 4PGJA 3CFDB 2D7NA 4JZNA 3VXME 3GGWA 5DRZB 3PWNA 4HXAL 4YDJA 1J8HB 3RWDA 4PRHB 3IU4L 5B8CA 2GT9A 5EORH 2P7TA 4HHAB 4LU5L 5D7SH 1B0GA 5CLWA 1NBZB 3MRHA 5E08L 2OSLA 1LEKA 4QHKI 3V6OC 3E8UL 5EBGA 1KTDA 3VFGL 1OTSD 4P57B 5HYJB 4KKBD 1T5WA 1R5VB 3MTRA 5IMMA 1MCPL 2NY7L 3BDYH 2VDKL 1QSFE 5HDBF 3HMXH 1WK0A 2CLZA 5IIEB 5C0JB 3D25A 2W38A 4ISVB 4V1DB 3RHWF 1X5XA 3H0TA 3FN9A 4LDEB 4UILL 3UTQA 2FX7L 3QFDA 3VA2C 2HFFA 1KCKA 2VXTL 4MXQC 1AXTH 1HKFA 4R4FL 3AREA 3V6FB 5BOZG 4CL7A 5HDBE 3WNMA 4Z5RB 4IRSA 1SEBB 5DYOA 2EXWD 4GKSA 1FGVH 3QNXB 4ORGB 4U1NB 3OR7B 2UYLB 2IADB 4WEMB 2YRLA 5IR1A 2E9JA 3E6FA 5IWLA 1UC6A 1Q94A 5ECJE 4JO3L 3HE7D 2YSSA 5IFJA 2NY2B 2X05A 4YGVA 4LSPL 2VL4A 4OF8A 3PQYB 3OXSB 2FRGP 1PY9A 5A16B 1ZTXH 2X4OA 1K6QH 1UJ3C 4BFEA 4LCYA 2YD4A 5T5NF 1H5BA 3FT2B 3PWPE 1S7XB 4P4KD 5IB5B 2ENSA 3BPCB 5A3ID 1I4FB 5EPMB 4IHOA 4HUWB 4NCC2 4ODXB 4F58L 5CGYD 3PWJA 1FVDB 2XQYK 2GJ6A 5GS2H 1FNFA 3B3IB 2PXYC 3OWEA 1OTUC 4P2QA 1RZIB 1JFQH 5ISZA 2YRZA 1L9NA 4LPUA 3FO2B 4L9LB 5ICYA 1AR1C 4U6XB 1T1ZB 1CK0L 4YFLF 3QG6A 2ZSVB 3GNMH 4GBXB 5CKAA 3CLEH 4E41A 3S5LB 4TUJA 4G6AC 1DBML 1YEEL 2AEQL 2BFVL 2YZ1A 3OKOB 4RZCA 5DRNB 4L4TE 4X8XA 3FAXA 4UQ3A 2ZSWB 1JHKL 3KAAA 5DJ0B 4D8PB 5IV2B 4LMQE 3LCYA 1XGTA 3IDNB 4NPYB 3MYJB 3L7EA 1OTTC 3HCVA 1ZWIB 4MAYB 4DW2H 1A14L 5KOMC 5H94A 3HNTH 2HTKC 3S3JA 1U8LA 1BZ9B 4UDTB 2RB8A 3MV8A 2V2XA 2VZSA 4YHPA 3QXVA 3M17B 3VXUA 3CFEB 3C87A 5SWSB 1V3JA 5GGSB 5EIIA 4OZIA 1BD2A 2R2BA 5DHXB 3VFUA 3DX8A 1R5IA 4NOBA 5E2TH 2HMID 1VEOA 2VSCA 4CVWA 4AEEA 3BQUC 3OAUH 5D5MA 4OLYL 3RTQA 3FZUD 3PABB 3NCYP 5FO9A 1LP9A 4G6MH 2DIBA 4QXUH 3RFZC 1QTYT 4KDWA 1BQHB 2H3NA 3O3EA 3BAEH 5DMIL 4FFYL 2LVEA 3MRJB 2I9LB 1Z6JT 1KJMA 4W6WB 3HNSH 1A7QL 5J11C 2AJVL 2OM5A 1ZT1B 1EK3A 1FIEA 5LG1A 1CQKA 2BHUA 2NXZB 1BMGA 3ARBD 3S4SG 1LK3H 4P2QE 4QRRE 5ISZE 4LASH 2FJHB 3I75A 5CSBA 2DD8L 4APQB 1CTOA 1KLUB 3C8DA 3IXTB 1XR9A 2WM0A 1RVFL 4E41E 1K8DA 3UTTA 5CD3B 5IESL 1N0XH 3LKQB 5D4QA 3EZ8A 1GXEA 3PNWA 4YBQC 2ARJA 1KFAL 4YH6A 5ADPL 3BJ91 4LNRB 1LO0L 4PPTA 4LSSH 4WEBL 1F6AB 3O3AA 4JPKL 3GO1H 1PEZA 3MRBB 5KSAD 3DV4A 3F7VB 4OM0L 1OSPH 2D0FA 1ZEAL 3HHRB 1ONQB 2XWTB 4NKDB 3S7GA 1XGUB 3OMZA 3KR3L 2AJZB 3BZFA 1J86A 4MCYB 2ARJQ 2C3VB 3BW9A 3MV8E 4MNQA 5EIVA 3WLWD 1LP9F 4JY6B 1BFVH 1HWHB 3V4VH 3UBXI 4OZIE 1NFDB 1U41A 3GMLA 5KJRH 3VJ6A 2C3HA 2VQ1A 4QWWC 3D87B 2BNRA 5EBWA 4OLXL 1FJ1B 2ED9A 5EO1A 1MFCL 1CFSB 1IARB 3PL6C 5D1QC 2AQ1A 2A77H 4CN1A 4JG0L 3P0VH 3N1QC 3RY5A 3CVIH 1LP9E 2ZPKL 4UT6H 1S7UA 2E6JA 2XZCL 2OL3H 5BMFL 4ZUSB 3U7WH 4PJ9B 4JM2B 2BSTA 2NW2B 4EI5C 1FYTE 1GC1C 4WIQA 3BMWA 4Q6IA 3DVGA 3TYGL 4L3CB 3MGAA 2P5WE 4KI5D 2P5ED 4NQDD 1OWRM 5L6YH 3ESVF 2VOTA 1TITA 3DETC 4R96A 4QOKA 3MA7A 1YEHL 5HHMD 5HI5C 1W72L 1NBYB 5KVEL 3B2VL 3CSGA 2YPLE 4JN1L 3LMJL 3U9UB 4QRQB 4HK3J 1PSKH 2ADIB 4OIIL 4BJLA 2DQIH 1DUYA 1DQQB 3U4BH 4JO2H 2PW1A 3MMEA 3UTTE 3OG6B 3WDJA 4F7PA 2BSSA 4XH2B 5DWUL 2XG4A 3J7HA 2EDJA 2QHRL 4LIQL 4OJFL 5CJQH 4WENB 1XGRA 4XNQB 4ZUUB 4IRJC 3C5JB 4G43B 3QXTA 1H3XA 3LS5H 5BZWB 1BFOA 2XY2A 4FP8H 1C08A 2IWGA 3VFOA 4XP9L 3REVA 3O6KL 3W9DB 3BWAB 4HS3A 2WZPD 3ARRA 2BNQA 3RDTA 3SDDC 4G8GA 1L7IL 2FNBA 1XZ0B 2V7NB 1HCVA 2DKMA 2IFFL 1BQUA 3ULUC 3BP5A 4PJ8A 1KCRL 1D5BA 3EYFB 2FHBA 2XFXB 2O26U 4M61B 4R4BA 3RU8L 4MB4A 4K23H 4QHMB 4Z77A 4NKOB 3O3UN 4LEOB 2HT2D 3KG5A 4F7EA 2VNCA 3AXLB 3FT3B 3OPZH 3QI9A 4ZDHA 3OAZH 3ZYOA 5KG9A 1QR4A 4Y16B 4K3EL 3ROOA 1KIPA 2C5DC 4MVBD 1YEGH 1QRNB 3IDMA 3KYOA 2GW5A 1F4XH 1LEIB 1YMMD 5HYIA 1FL5A 1OQXA 2BCKB 1A1MB 1EGJL 1DN0B 5E5UB 2CQVA 2V9TA 4X7FC 4TNVK 5ICXA 1JF5A 1AIFA 4G9FD 1T0NB 3I50H 5C0EA 4KRNA 4L4JA 1KXQE 3KPQA 3NABL 4EQ3A 4HIJB 3I02A 3IJSA 2XOTA 1FO0L 3SCMB 1BJ1J 1EMTH 4FQ1H 4HXBL 3UJIL 5GZND 2VWEE 3O3BB 1S8DA 3GSRB 2GFBA 2DS4A 4KHXL 4O58L 1G6RL 3VDAA 4YJZL 5D7JB 2Z35A 3RVVD 3VGGA 3WFEH 2NXYC 3UXFA 2JJTA 4ERSL 3LB6D 3C60B 1FC1A 1X5KA 3KWWA 2V9RA 4JFEB 4X6CB 5E8OB 1BVLA 4P9MH 5BV7H 4D0BA 2JB6B 1NMCB 2QQKL 1WIOA 1EXUB 4L5FL 5GHWL 5D2NC 2HYMA 4UV4L 3CDYA 1O0VA 2NNAB 4TSCH 4K2UL 4I9WE 1CVSC 4GXUN 1XCQA 3HB3D 1MFBL 4H8WL 4PJAB 5T1MB 4G8GE 4PJ5A 4OCXH 1BQLH 1H3VA 4URTB 1TZGH 3MV9D 2ESVA 4OCSH 2EH8L 3VW3L 1X44A 3GRWL 5KW9H 1T03H 4L4VD 2V5SA 4ODUA 2MPAL 3K7UA 4OLZH 1GPOH 4KY1H 3V52L 4UIKL 3GMRA 4PBWD 1CLOL 4MJ6B 1JHLH 1F2QA 3ARYA 3QUZD 3WUZA 5A2IH 3MFFB 1RULH 2DF3A 5C71A 4NQCB 1WUNT 3LH2L 5BJTB 5HVHC 2VXUH 4MHHG 1WLHA 4OCWH 3DX6B 2H26A 4NQVB 5JIPA 3ES6A 4A2MA 4XNUH 2ATKB 3NFSH 3UTPD 2DM4A 3DUHA 4HF5L 2VLRA 1CDHA 2XZZA 4XP5L 1TZIA 1DQMH 2GUOA 4JKMA 1MY5A 4NQTA 3LN4A 2H2PC 3HC3H 1OM3L 1UCBH 5I71C 4EOWH 1FLTX 1PYWB 1KIQA 3JZ7A 3TC9A 1ES0B 1ZE3C 1YEFH 3LN5A 2B2XL 5D7KD 2P48B 3U36B 3VFPB 1R3JB 3BPLB 3QHFH 5IB2B 4HPYH 1OTSC 1NANI 1MLBB 3LQZB 2XN9A 1KULA 3ZMRA 3ZHDA 1J05B 3T8XB 3L3DB 3LS4H 4Y5VB 1Y18B 1ZLSL 3D39D 1ZT7A 3K2UH 2EYRB 3DV6B 1W8NA 5I76A 5KZCB 1RZFH 3TA3B 1YDPA 5INDA 3LSOB 1JYNA 5DDHA 3V9FA 4YC2C 5GS1B 3ILPB 1T3FA 2AJUH 43CAB 1CGTA 3MYZA 3QIBB 4FFWD 5DD0H 2EE2A 4OSUH 4N1CA 2ZCLH 3D6GA 3GSUA 4M5YL 5EO9A 3SJVE 1S9VA 4N8VA 4EZMA 4ZMAT 3GSXB 5CP7A 1ND0A 2ESVE 3CXHJ 1HKLH 3IYLW 4XRCA 2X40A 4S2SA 3CX2A 3MXVL 3TO4D 3BP4A 1TNMA 1NBVL 1TCRA 3SE3A 5JUEL 5E6IB 1JMZA 1MFNA 1SJEB 4N5EC 3O0RH 1EFXD 1YC7A 1MCQA 2EIDA 3HE7C 4JKPH 3Q1SH 4AT6B 4QRTB 4K9EL 1JMXA 4LNVA 1NJ9A 3CH8A 1MAML 4TSAL 2FH8A 4OCYH 3FMGL 3NIFF 5TF1L 4CAGA 3DUUA 1JPGA 2VC2L 5ETUA 4LRNL 3HR5B 4PRPB 4ELKB 1AD0A 3QPQC 2VLRE 5F88A 4LSTH 3HI5H 1FQ9C 5CEYB 1CWVA 1L9MA 1TJIL 2UZYB 5D2LB 3WFHA 1IZKA 4PP1C 2ZWLT 1I3GL 4X0KB 3NIFE 2R23B 4PRHA 1KJVB 2X70B 1T4KA 2JJVA 2B0SL 3VXQB 4NJ9H 2BJML 3IVKA 4FQJL 1QO3B 1N3NA 1MQKL 3RI5K 1VEPA 4AM0B 1F4YL 5H37G 1SBSH 1RIHH 3HLAB 4J4PA 2ARWA 4M5ZL 2XN9E 2VN4A 5IMOA 5HYJA 3U0WL 4KXZI 3VGBA 4P2RA 4XNMA 3Q6GH 3T2PA 2F5AL 3NA9H 5E94B 5IK3B 2DI9A 3VXRD 2H9GA 2YR3A 4XCFH 3GM8A 3ALPA 2B1AL 1NAMA 5C9JA 3SE9H 4KDTA 5HYSB 5IGXL 3OGCB 1L7TH 4WNQB 5F1IB 3HPJB 1TJGL 3C5ZA 4E5XB 4NUGH 3CIQA 3EYUL 4Z5RA 4L8CB 4NHUA 3CK0H 4FS0A 5F7MC 1KC5H 1GGYA 1R3KB 3QNXA 4LAQH 4N0FB 1QR1A 4JJ5B 5I19L 1ACYH 1RUQL 5EC2B 1KB5H 3LV3B 1KJ2H