4X7DC

Crystal structure of 2012 nsw gii.4 p domain in complex with nano-85
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
116
structure length
105
Chain Sequence
DVQLVESGGGLVLSCAASGSIFSIYAMGWYRQQRELVASISSGGGTNYADSVKGRFTISGDNAKNTVYLQMNSLKPEDTAVYYCKREDYSAYAPPSGSRGRGTQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP1
publication title Nanobody binding to a conserved epitope promotes norovirus particle disassembly.
pubmed doi rcsb
source organism Norovirus hu/gii.4/sydney/nsw0514/2012/au
molecule tags Viral protein
total genus 20
structure length 105
sequence length 116
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x7dC00
3IRZA 2CH8A 3KYAA 4BSVB 3L7FA 1XAUA 3DYMA 1V7ML 5DWUH 5C0AB 2KBGA 5FYJL 4YFDB 3LV3B 4KV5F 1JHTA 3PP3K 1PZUB 2R23A 3PWJB 5E2UH 5IHBA 3WUWA 4PJGB 4M6OH 2PXYD 3HS0B 3F12A 1S7RA 5E6ID 1I3GL 4LPVA 3EFFA 2NY3D 3DROA 2O61A 3AMKA 1A1NB 5EBWB 4RX4D 2OR9L 3LKNA 1A4JA 5DJ0A 4P23D 2QHLA 1TIUA 3RVXD 5TF0A 4MB4A 3U0TB 1KT2A 4RMQA 1QNZH 1T1ZA 1JZ5A 2AXHA 1D9KD 4H1LB 3KXFA 1BX2B 3PUCA 3L3IB 3TLRA 3UP1A 3ARXA 4GXUM 4LEXL 4M00A 3O3UN 1DN0B 2GFBB 4N8VA 1B9ZA 2QADB 3BRDA 1A9EB 4PRHD 4GQPH 5D2NB 5L8LB 1MI5E 4M4RA 4XC3L 3SDDD 2ORBH 4QRTA 2G60H 2X4OA 1CGYA 3DETD 3RJDA 1CLYH 4HIXL 3BPLB 1YNLH 3Q6GH 4XMLH 4PJCE 4XPAH 4ZPVA 3GIVB 4IRZH 5L9DL 1NGXA 3E8UL 1SBSH 3I3BA 2FDBP 3MRLA 3VRLF 4NJAH 4HS3B 2ID5A 4H5SB 1OL0A 2A9NH 2APBA 3DXAD 1JV5A 5B3JE 4OBRA 1JZ3A 3D69A 5E0QA 3KPMB 3V0WL 2XWJB 2B39A 2CK0H 1YEFL 1KC5L 1C16B 4OLXH 3WKNA 1S7WB 4Q6IC 5AZ2L 3CX5K 4HAFA 5BXFB 5IBTH 4EDWL 1DTUA 3UTSD 1R5WA 3V5HA 3HC4L 4Z76A 3LQAL 4NC1C 3VFSA 3EJYD 4JPWH 4X9HA 4Z7VA 3O4LD 4L3ED 1I1CA 1X4ZA 4QO1A 4Q9RH 3EDKA 4RMVA 3D39B 1QEWB 3FB5B 3EYSH 3O2DL 3SDAA 4LHQB 2CDFB 1LO4H 5KANG 5T33L 5B4MC 4P99A 4KQ3L 2ZG1A 3L7FB 4FQQB 4FABL 5K93A 2KZWA 4G9DA 1SY6H 4PRID 1KULA 2WBJC 3QUYC 2R23B 3HMXH 3WUWB 1NMCB 4MJ5A 5D1ZC 3F12B 1S7RB 5DA4A 1T0PB 4YGAB 3EFFB 4K3GA 3DROB 2OSLB 2Z8RA 3G6JF 4HGWA 5FKAA 2O61B 1JYNA 4MZ2A 1RZ7L 4MYWB 3SBWA 1IRAY 3LKNB 4NQSA 1A4JB 1EA9C 5J3HD 4MAYB 3V4PH 3O3DA 1OQOA 3V4UH 3MNWA 2IFFH 3MPCA 4QHMA 4EI5D 1KT2B 2MCPH 1T1ZB 2VQTA 4NZJA 1X6LA 4HWBA 3LOWA 3KXFB 4NGHH 1F90H 4WJ5A 2Q8AL 3RWCA 5KVEL 1J1XH 6CGTA 4OD1L 4XPBL 2X4NA 4N8VB 1TJIL 4WUUA 1RFDL 5HYJE 4MLSA 3RX5A 2ZNWA 1MREH 1ED3A 2HVKA 5DZLA 4QRTB 2KPNA 1FAIH 3K8MA 2X4OB 3S88L 1JPTL 3BDYH 5E99H 4NNYA 2R0LL 3LEYH 4MA7H 3SE4C 2UWEF 1NKOA 2I25N 4ZPVB 5FHBL 4EEEA 5JUEL 1NGXB 3MRLB 3WDJA 3DMMD 5GJTL 2WP3O 3FT3A 3I9GH 4PV9A 1VGEH 3HZMA 1JV5B 4W68A 5IG7A 3D69B 4XPFL 1JPGA 3PWVA 3TC9A 1QRNE 1NLBL 4KJQC 3PV7A 5GHWL 4Q6IA 1QFWM 4UIKH 1FE8H 2EDFA 3U7WL 2RJMA 4F7MA 2VABA 2ZUSA 5LBSH 1R5WB 1VERA 3V5HB 2J6EA 5TE7H 4Z76B 3VFSB 4HLJA 3RDTC 1J0KA 4P48A 2CGRH 1P84K 2NY5C 5JW4R 1DEDA 4Z7VB 1TQBB 3AU1A 3L6FA 2LQRA 1QSFE 3DUUA 3ES6A 3VXTA 1UT9A 4DTGH 2DM4A 3N85H 3WUZA 2JB6B 3SDAB 1N3NA 2BY2A 2DQTH 3BP5A 2VKWA 2EC9U 4XP9L 1HZHL 2IPUK 2AVGA 3MNVA 2YWZA 4N0RA 4BH7A 2AXJA 4G9DB 2NR6C 4HS8H 1JL8A 1FYTE 2WBJA 3QUYA 4JQVA 4Z7WF 2QLVB 2AEPL 4YWGH 4TVPD 1EO7A 4GKNA 5GRVK 4MJ5B 5D1ZA 3QNXA 1RAMA 5EOCH 4HGWB 5FKAB 4NM4H 1OAKL 2HLAA 1JGVH 2CJUL 4NQSB 3O3EA 4YZFE 5DMYA 4Q2ZA 1FFRA 5A3ID 3O3DB 3EZJB 3MNWB 4JFHE 4QHMB 4NN7C 5HDQL 3E1F1 1E6OH 1P7KA 1GZPA 3QEGH 4G5ZL 3MLUH 3TP4A 5DVOA 5ERWB 1JGEB 4WJ5B 3RWCB 3BQUA 1JNHA 3TGXA 1QG3A 3QDJA 1DP0A 2EDLA 2X4NB 4WUUB 5HPOA 4MDJA 3Q6FA 3WFCH 4LBEA 2DBLL 5BJTA 1AJ7L 5D4QA 5TF1H 3P9MB 2DN7A 1ED3B 1GYAA 1D5XB 2HVKB 3QRGL 4YK4C 4P2QA 5T3XL 3VI4E 1RI8A 2D2OA 1Y6MR 2EYRA 1S9KC 1QFHA 4QTHA 4PFEA 5ADPH 1FDLH 5FUOH 1BM3L 3CMGA 4JFXA 3SE4A 5D1QD 3WFHA 1WQVT 1T5WA 2AJVH 4APQD 1NLDL 1Q9KA 4PV9B 4OCLC 3HZMB 5DK0A 3HMWH 4X6DF 3CFKA 5IG7B 1H3XA 3VFWA 4XHJD 4HUKB 1JPGB 3PWVB 2D0FA 4XPGH 3TBWA 4R2GC 2XI9A 2GJJA 4Q6IB 2UY6A 3QXTA 5JHDD 4YHOH 4YR6B 2XA3A 2BFVH 3CFCL 2NX5E 2VABB 2YR3A 3WXWH 4P4RA 4F7MB 4EVNA 1O0VA 4N0CD 5ICXA 3KYKH 1DQML 4DKFH 5J13C 5D5MF 3MV11 5CSBA 5F3BA 2DWDA 4ZDHB 1DQLL 3AU1B 3L6FB 2KDGA 3IFLH 3DUUB 3ES6B 4KQ4L 3IFNL 3VXTB 4TTDC 1N3NB 3E2HC 3BP5B 2BOCA 4U7KA 2AAVA 5FCUL 4BFBD 2E7MA 1P2CA 2FLBT 4BH7B 3HE7C 1GC1L 4Z6AT 4XVTH 3L3OA 5F70A 2WBJB 3QUYB 3WKMH 1UA6L 3KLHC 3NGBB 1X5HA 4GKNB 1G0DA 5D1ZB 1MVUA 3QNXB 3KAAA 5EA0H 3RY5A 2PNDA 3EHBD 4I9WD 4TVSa 4MQSB 1EDQA 2HLAB 5FYLD 5DD5H 3V52H 3ZKNC 3ULUE 3TCLB 5JQ6L 4YDJA 4Q2ZB 1TPXB 4GRWF 1P7KB 1GZPB 3VWJA 3WIIH 3P4LA 1MCNA 5A2IH 3OKNA 3CZFA 3BQUB 4M48L 1JNHB 1KYOK 4OI9A 4WHYH 4UINH 3ARRA 2OXGA 4MDJB 3Q6FB 4LBEB 5BJTB 3MA9L 1Z5LA 2KH2B 3ARFD 3L5XH 1A6VH 1G7JA 4C55A 2EYRB 1A6TA 4QTHB 3SDYL 4X4MA 3MACH 4JFXB 1N64L 3GI8H 4DOHE 1EZVX 3WFHB 4HIIA 1T5WB 1KIRA 1G84A 2H1PH 2IQAA 1OY3B 2GK0A 2B4CH 1LQSR 3DECA 1CTNA 1S7UA 3T4YA 5DK0B 3CFKB 3VFWB 1GHFL 2JJTC 4WW2F 1KTRL 3AS0A 4R0LC 2XV6B 1NEZG 3TBWB 4BFIA 1NCCH 2VDLH 2XZQH 5HI3C 1LO2H 2K7QA 4P4RB 4Q74A 3MR9A 4EVNB 1ZGLP 4XMPL 5BW7C 5DJZA 3BD4A 1Y18A 3RGHA 4QOKA 5ICXB 4G6AC 2ICWJ 3RDTB 1MWAL 5F3BB 2DWDB 3EJJX 2B2XH 3CDCA 2DYPA 3VRJA 4XCFL 4HKJA 1U9KA 2CRYA 1MFCL 3HI6L 1BJ1H 1WZMA 3C5JA 3ILPA 3HZKA 2BOCB 3ULVE 4F58L 5JO5A 3P73A 3SE3C 4C83A 3ARGC 1P2CB 4ZPTA 1LO5A 3UYOD 3HE7A 3CDGA 3I50L 3L3OB 1J10A 4KK8C 5SV3A 1MVUB 3L5IA 4MA8H 5D8JL 4OTXH 1OGTA 1F4WH 4NKOA 1MRDL 3NCYS 4YDJB 3BUYA 4KJWC 4HJJL 3N1GC 3MV8E 3OXRA 4LSQL 4NN7B 3VWJB 4NP4H 1B90A 4OM1L 5LWYH 5E24E 2BK8A 4OGXL 3EYVA 3TFKD 5E1AA 3OKNB 2IWGA 3CZFB 1WBZA 3VCLA 4X7EC 3TV3L 1ORQA 4PB9L 4EQ2A 2Z31A 1DN2A 1Z5LB 4YK4B 5GRJL 2VRAA 3T65A 2DM7A 1G7JB 1CXEA 5C09D 3KPSA 5I1DA 1C8PA 3CC5A 2Y25A 4HIIB 1KIRB 2IQAB 5TDNA 4K3JL 2GK0B 2CRZA 3BIKA 4HEME 4LQFL 1S7UB 3T4YB 2YPVL 1GL4B 5C3LD 1HH6A 4YC2C 1NAML 2R29L 4QWWC 1LHZA 5C0IA 1Z9SA 1IGJB 3NCMA 2JJTA 4U4BA 4R0LA 1GXEA 2XY2A 1EX0A 4XB7A 5DZNA 3EYOA 1MHEA 4R2GB 4Z18A 1ZLSL 4BFIB 4KU1A 3SJVE 4BSJA 1CCZA 4CAGA 3EO9L 3MR9B 4RFNC 5DJZB 5BW7A 2ZCHL 1Y18B 5J13B 1SHMA 4NUGH 3GSWA 1CICD 3NZHH 3VRJB 4HGMA 2DYPB 1I1AD 4HKJB 2HMID 4K3DL 1B2WL 4XVJL 2AJYL 1WJ3A 1BFOB 3C5JB 1ZSDA 3E2HB 1UEYA 1G1YA 5FM8A 5JO5B 3P73B 4MJID 2XFXA 5MEPA 3SE3A 4X5XB 1JZ7A 4C83B 4P9HL 1H3TA 4ZPTB 1LO5B 2XQBL 3VD9A 3HE7B 2BMKA 3CDGB 1OGAD 2C5DC 5EC1A 4PLNC 4MJ2A 2GSIA 1TVDA 1JNLL 2YRPA 5E70A 5MI0B 2LVCA 3QDJD 2F8VA 3TH2T 2W1NA 1IAIL 1WWWX 1DQQB 3FO1A 3D6GA 1OGTB 3N0PB 4NKOB 4P2QD 1UM6H 1IEAA 5EU4A 2FLRT 4I3RL 1IKFH 3UAJD 2DDQL 4WHTA 1D5IH 4QTIL 4N0UA 3VFOA 3OXRB 5EO9A 3EYVB 1ITBB 3MSPA 2FYYB 5A1AA 5E1AB 2Y4SA 1WBZB 3VCLB 1TCRA 1S7TA 1JRHH 1ORQB 3MUY1 1MOEA 3HE6C 2Z31B 3G6JA 4ZNEA 3T65B 4XNXL 1SVCP 3VW3L 4Y4HD 3KPSB 4HUUA 1FZKA 3CC5B 3S37H 4O4YL 1U8LA 1AD9A 1KJ2A 4JFED 1AO7D 3RHWF 4OF3A 2PYED 3JVGC 2VDOH 4YXKL 5TDNB 3SDXF 1DCLA 1P1ZA 1PY9A 5IT2L 1U3YA 3BIKB 2P45B 5E8EA 4JRWA 1HH6B 1V5JA 2YD5A 1CU4H 4R0LB 2IG2L 4O02H 4V1DD 2GQHA 3EYOB 1MHEB 5I15H 1EFQA 3LVEA 4P46D 3GNML 4UQ2A 3UYPA 2FH6A 2AK1L 5I18H 2IH1A 3RY4A 1PBYA 2UWEA 2MWCA 4G6KH 4KK5C 1F02I 3ZO0A 2HTKC 4LHJB 4EUPA 1KEGH 1CLZL 2DI7A 1Z2KA 3GSWB 2ZSVA 1IARB 3VXUA 1F2XK 4PJ5E 1KPVA 1WIOA 3O0RL 2AW2A 3IYLW 1LE9A 2W9EL 3R8QA 4TNVF 1FNFA 1ZSDB 1HWHB 2R56H 1KELL 3QDHA 1IEBA 1GGIH 3RWDA 3MLXL 2XFXB 4P2RA 5MEPB 4GRLA 3FRPG 2PXYC 1P7QD 4OCWH 5E6IC 2XZCL 1NMBL 5IBLC 2D7OA 5HDBE 1ZT1A 2BMKB 5EC1B 3FZUD 2GSIB 4QHNA 4MJ6A 3PV6B 4OZFA 1EUTA 5DD3H 3LMJL 1R3HB 2OX5A 2R2HB 1VESA 3FO1B 3RVXC 1UYWH 5F7NC 4X5LA 5J57B 2VIRA 4WY7H 1IEAB 4PJIE 4XAWL 5EU4B 3UEZA 4WHTB 2KKQA 1QACA 1HIML 4JY5H 2JJWA 3QT2A 4N0UB 3V95A 3VFOB 1FNLA 5EO9B 3PL6C 5FYKD 1ZXQA 4IOFC 4JGUA 4MNGE 3MLSH 3E3QC 3MJGX 1G0XA 3BHBA 4GKZB 3GUTA 4P57A 1TCRB 4Z7WA 1S7TB 1N6UA 1V3LA 3MOQA 2J8HA 1H8NA 3DETC 4DVRL 3HE6A 4LVOC 5FYJD 4UV7H 2BHZA 4K8RC 2VNCA 1K6QH 3G6JB 3RWHA 4YEFA 4H1LH 5AAMA 4ONHA 1IQDA 3ILQC 4IMLB 2P46B 4HUUB 1FZKB 4XP5L 2NXZD 3DO3A 3NZ8A 4OQTH 5L7XH 1KPRA 1U8LB 1KFAL 1L7TL 1AD9B 1QSED 2P1YA 2E9WA 4MQXC 1KJ2B 4K9EH 1R3JA 2BERA 1JGUH 4AMKH 1P1ZB 4QOKD 5LQBL 4WO4C 5E8EB 3QZWG 1JPSL 3ARPA 3FCTB 4NJ9H 2O93L 4YC2B 5F6IC 3QQNA 5JW5A 4W4OC 3JWOH 2P8MA 1IC4H 4OV5A 2NY4D 3O45A 4LPUA 3NOIA 3K2UL 4UQ2B 3WSQH 1P6AB 1A6UH 4H88H 4R26L 2IH1B 2UWEB 3MROA 4RFNB 2XNAA 3RL1A 4EUPB 5LGKA 1JUFA 3MUJA 1JRHI 1OAUL 2ZSVB 2QQKH 2CRMA 3RX7A 4AEIH 5E8PA 4LPTA 3VXUB 1NCDH 4Z0XA 1KPVB 4X6DA 4IMKC 1KCUH 3T2PA 1LE9B 3GSNA 4WW2C 4JKKA 1RIHH 1MELA 3W2DH 1IEBB 2APFA 3WE6A 3C08L 2EDTA 5IEHA 3RWDB 4P2RB 1RU9H 2DKSA 1RZKC 1ZHNA 1ZT1B 1H3PH 4L9DA 2FATH 4QHNB 3RVUC 1MCWM 1FORL 3FHAA 4MJ6B 5ISZE 4OZFB 5DEFB 3SKUD 1ZVHA 5D5MA 4DQOH 3VGAC 4HF5L 1EUUA 4F57H 4NO2A 2D03H 5CCKL 4PBWD 2VIRB 5MP6H 5D7IE 1YY8A 1L6ZA 5CILH 4X83A 5AZEL 4ZFOL 4EXKA 1S8DA 2UZIL 3PL6A 2BSRA 3UJJH 3ARBC 4PY8J 4Y88A 5TDOA 3BHBB 3GUTB 4XPHH 4P57B 2C4FT 1A0QH 4Z7WB 3GI9H 1DANT 3TIDA 4G6JL 3HE6B 4GQ9L 5F89A 3RWHB 2WW8A 4ONHB 1T2XA 1IQDB 3P4MA 4M7JH 3TJHD 4RMWA 3NZ8B 3DMMC 3NFSL 1KPRB 4X7DC 5CBEA 2NW2A 2V17L 4JO3H 4X9IA 4YIQA 2H26A 4AL8L 3TNMA 4R3SA 1T03L 2JJVA 1RK1A 2GEEA 4WO4A 2AXFA 2EDBA 4D9QE 4TTGA 3N1FC 5DUBA 1W72A 2X89D 2A83A 2VDRL 5JW5B 4W4OA 2P8MB 4HG4J 4OV5B 3QDGA 1N0LA 3FRUA 1ZK9A 1V7NL 4NQDA 2UUDK 5E7FA 4M03A 5D1XD 1CGVA 3EYFA 3A6OA 1MCJA 5I30L 1JF5A 1PQZA 1RJYA 4M62H 3FTGA 3L5HA 3MROB 4HMDA 3Q0HA 2HRPL 3KGRA 5J06A 1AGCB 4KRMB 2XNAB 2FJFA 3RL1B 3I6GA 1JUFB 4PJXF 3PDGA 1P5UA 4NQEE 5E8PB 1MLBA 3ARED 5ILTH 3OKEA 1WK0A 2ZKHH 4X6DB 1YJDC 5DEZA 1J1OH 3GSNB 3QXAA 4WW2A 3WE6B 3VG0H 2J3SA 3G6DH 5IEHB 1CS6A 2P49B 3OGCA 2FB4L 5DMIH 3T0EE 1ZHNB 3CD4A 1OARH 1JTOA 3Q5YA 2OMNA 5T1DH 3FOMA 5D5MB 5E03A 3UC0H 5D71L 2YD7A 4NO2B 4P4KD 4HC1A 3QHFL 5KS9F 4U1MB 1OQXA 4NRXA 4Q9QL 4M1CC 4MMZC 1YY8B 3ZL4L 5INCA 1EEQA 1U3HD 5L88L 1CE1H 3T04D 2YPLA 5IB1A 1S8DB 3PL6B 15C8H 5IB3A 3ARBA 4KZEH 4YBLC 1CGXA 4DN3H 5CLWA 5TDOB 1KF9B 2XWBA 5EO1A 1VEMA 4UT7H 5I19L 3TIDB 2GTZA 5JOPD 3F6LA 4PRPD 3UXFA 4LVOB 4ZS7H 4OCYH 4PJDF 5KW9H 4KMTL 5F89B 3O3AA 4HWBH 4YE4H 4EN3C 3P4MB 1A7PH 1E28A 3B9DA 1YMMA 2VB5A 3MBED 3MYJA 5CBEB 2NW2B 4GRWB 3HNTH 5DYOA 5B8CC 3TO4C 4P59H 4YIQB 5JZ7C 4BQBA 2HH0H 4G8EA 4R3SB 5D2LF 3TNMB 5J6HA 1CFBA 1I85C 4WO4B 1PY4A 4YXLH 3QDMD 2AXFB 3ARVA 1FAKT 5DUBB 1W72B 3IU4H 2A83B 2YD9A 1N5AA 1NKRA 3GSRA 3KPOA 1DFBL 1NGPL 3QDGB 2A0LD 1L7IL 5KSBF 3MOAL 3EYFB 1MRFL 3DPBA 2OK0L 4WEUD 1PQZB 1RJYB 4YHML 1CGWA 3FTGB 3HAEA 1TJHH 1W0WA 3HB3D 4Y5XA 1CDCA 3I6GB 3HNVL 3CK0H 5C7XL 3VXME 4M8QA 1LDPL 2YD6A 3ULUL 1MLBB 3OKEB 4I18C 3SY0A 4CVWA 1V8HA 4UTBL 4KZDL 3QXAB 1WF5A 4WW2B 2YD2A 4F33A 2J6EH 1HHIA 3S4SG 1W8NA 3GKZA 4BZYA 3AS3A 5JOEA 2F54A 3OGCB 1YPZF 2LTQC 25C8H 5I1GH 1WCBA 1KEML 2NY1D 3ALPA 4ODTH 1PKQA 3FOMB 2IH3B 4KPHH 2CXKA 2WUCL 3PJSA 4X4XA 5KSUA 4JG1L 1OTSC 5F96H 1AGFA 5F7FA 2D7TH 3K8LA 4ENED 4NRXB 5C07A 5C8JA 5FUCE 5INCB 2BVEA 5HGHA 1WZLA 1IZJA 1CLOH 3S35X 2YPLB 5IB1B 1UACL 1KPUA 1LVEA 5IB3B 3ARBB 4OJFL 1HEZA 4EOWL 5TQ0L 3SGEH 3ARFC 2XWBB 5EO1B 3H9ZA 4PJ8C 2B0SL 5T5FH 4WFEE 1YEJL 2GTZB 1OAQL 4ZUSA 5EZOL 2H8PA 2ZJSH 1JGLL 3UJIL 1DQDH 3O3AB 1FGNL 4KY1H 4MXWH 5FEBA 4EN3A 1E28B 2YN5A 5DMGD 1YMMB 3VFTA 3MYJB 1RZJL 2HYMA 5CZXD 5DYOB 5E6YA 5B8CA 3UZEA 4N0YH 1ZA6B 4MNQB 2Y36L 1UZ6E 3QJFA 4G8EB 5J6HB 1I85A 3WFDL 3HI5L 2NNAA 4TNWF 2Y07L 3SE8L 2P5WA 2BNQA 4JRYA 1IGMH 3QFJA 3PWPA 1N5AB 2SEBA 1HXMA 3GSRB 3KPOB 1KCSL 5JR1H 1RIVL 2EZ0C 5TPWL 4AEFA 5GGUA 4LVNC 7FABH 1MJ8L 3FN9A 2WANA 4ZFZA 5HBBA 1P69B 3HAEB 2P5EE 1FIEA 4E41E 1W0WB 2DQUH 4KKAC 3SDXA 12E8H 4WI4A 5ACZA 4M8QB 3K4AA 3WO3B 4I18A 5ACMA 3SY0B 5FDWA 2QQNH 4F33B 5ADOL 1HHIB 3VXRE 1SJHA 2EDJA 3U83A 2ILLA 4GH7B 4OT1L 2F54B 3G5YB 5T3ZH 5C0RH 4J3OC 5IVXF 4Z7NF 2CRIA 1QFUH 1WCBB 2ED9A 1CDIA 4ZQKA 4I13B 1PKQB 3NIGE 2NW3A 3CVHL 1JCKA 5HPMA 4X4XB 5KSUB 1U42A 1C5BH 4HZAA 3BVNA 5I17A 4R8WL 1KCVL 1AGFB 3HG1A 1Q1JL 4JFFA 5C07B 1MCBA 5C8JB 4RA3A 2OTUA 4OV6F 3TFKC 5CZVH 3ZSTA 5HGHB 1JPST 4HKZA 4PG2C 4J2XA 3VXPA 5H2BA 1KPUB 1HEZB 3OF6D 3F8UB 4PJ8A 1J1PH 1NSNH 4KROC 3ME0A 4XNQA 2VAAA 2HT3C 4ZUSB 1AR1D 2V5YA 2H8PB 1EMTH 3JWDC 3KPQA 2R39A 1TETH 4EN3B 3CH1A 4RAHA 1G6RA 3VFTB 4NQDD 1A14H 3QCTL 3MLRH 1FZMB 1CYGA 1QLEL 4P3CH 2DLHA 1HK6A 1CFQA 3KJ4C 3V5DA 2XKNB 5B8CB 3TO4B 3SE9L 1JHLH 1X5YA 1Q0YL 5EB9A 3BPOC 3V5KA 1FV1A 1YEGH 1ZV5A 5EORL 1FCGA 1KXVC 2NNAB 4FQLH 5KZCB 4I1NB 4D9LL 2P5WB 3MGTA 2XIDA 2BNQB 4JRYB 1DBAL 1OAYL 5JHDB 4J8RA 5EBLA 4XNYH 4Z7UB 3L9RA 2SEBB 1HXMB 4RGND 1M6OA 5IF0A 5JQHC 4G3YL 2NY6C 1VENA 3OAYH 4MAUL 5GGUB 5I8EA 5F7MC 1CICC 2X1WL 1S5HB 4ZFZB 4O2EA 5SWQB 1Y6NR 3GBNH 1MAJA 3MOBH 3ZYIA 3SDXB 3SGEI 1G9EA 5ACZB 4JRXA 3RPKA 3OAUL 4IRJD 1A7OL 4I18B 2D9QB 5FDWB 4UT6H 5HHVH 2FZ3A 4YX2L 3VH8A 3LKRA 2BVYA 2A9ML 1YYML 1SJHB 1QSVA 1MFAH 1NEZA 3EYQD 4P9MH 2LTQB 1U8NA 3CFBA 1T6WA 3G04A 5M95B 2HFFB 4ZQKB 5HPMB 5HGDA 4NC2B 5L8JB 3UAJC 3GGWA 3BVNB 5I17B 1K9TA 4LDOB 4YFLI 1GGBL 3FOLA 4M7ZC 5SWSE 3HG1B 5ANMA 5K9QG 1F8TH 4JFFB 5CP3A 2FR4A 3M07A 1QPXA 2OTUB 2ERJC 5HYSA 2HT2D 5F7LB 1OVZA 1NH6A 4HKZB 4PG2A 1E6JL 3VXPB 5H2BB 4NT6B 5GGTA 3LPFA 1BZ7A 4PJ8B 4J3VA 2YD1A 4XNQB 2VAAB 3TVMD 3KPQB 3TPUA 3CH1B 4S1SL 1EBAA 4NQCD 1G6RB 1PD6A 2EE2A 3VXSE 1T7WA 3HR6A 2VAJA 4FTVD 5I74C 1CFQB 2VXVH 4JY6A 3V5DB 4AENA 4LGSB 3NA9L 5IFJA 3WNMA 4ONOA 3V5KB 1FV1B 1XF5A 3QR2A 4KVNH 4L8BA 1MCQA 1LMKA 1MFBL 3O6FC 4F7CA 2OJZH 4KDTC 2F53D 4ERSH 2B1HH 3QCVL 3MGTB 1RUKL 5ITFA 2X1QA 4HPYH 4J8RB 5EBLB 4UILH 4MNHA 2Q20A 3L9RB 1M6OB 5IF0B 3GIZH 2JKXA 4Z7QE 1VEPA 3ZKMD 5I8EB 5I1JL 4LVNB 1X5ZA 3F58L 1B0RA 4O2EB 5JXED 1K8IB 1EZVY 3QO1A 4QRPE 2HT4C 1H0DA 5F88A 2AEQL 4Y0GA 5DHVA 4JRXB 2VDNH 4NWTL 5CUSH 1RD6A 2NYYD 2FZ3B 3VH8B 3R06A 1J0HA 3LKRB 5E2WL 3BP7A 3RHWK 1F58H 1IFHL 4I48A 4NUJA 5J89A 1NEZB 5F1IA 3H8NA 3U79A 4KKBD 1U8NB 3ARUA 3CFBB 5I8KL 4L9LC 5SV4A 3G04B 4FQ2L 4HT1L 2I60L 1IC7H 1ZGLM 1QBLL 1EJ6A 5HGDB 4QLRA 4GW4A 3GGWB 4PJXA 1F6AA 1R3IL 4YUEH 3FOLB 1EJOH 1H8SA 4IOIA 4XXCA 5ANMB 4YXHL 3UYRH 1A7QL 1JGDB 2ADIA 3GO1H 2FR4B 4DFHA 2VLRE 1DBBH 4FNLL 5HYSB 3UTPE 4YDIH 1T21A 2BDNH 4NN5C 5I2IA 1SJVA 4JO4L 1F4AA 1IC5H 5KOMC 1U8PA 3VD3A 1INEH 4TRPH 1BZ7B 1CZ8H 2VDQL 1J0YA 3MXVH 3FQXA 3OJ2C 4KROB 3N9GL 4HMEA 4HFUH 5CJBA 4YBHA 2QSCH 3KPLA 3TYGL 1I1YA 3QFJD 3WIHH 3NABH 4O2FA 1KB9J 5K59E 5KS9A 3TPUB 4BZ2H 5BS0E 2F58H 3BKJH 1EVTC 2FNBA 3EO0B 1VPOH 3KJ4B 4JY6B 4AENB 3O6MH 4G6MH 4PGDA 4HDIA 1NFIB 5IFJB 3B5GA 3BPOB 5HHQA 3BW9A 3ALWA 1XF5B 3MMEA 3M8OL 5E94A 4L8BB 2FHFA 4F7CB 3O6FA 4GUPA 4KDTA 3V6OA 5DS8A 1I4FA 2C7UA 9CGTA 3NCJH 4KTDH 5ITFB 4R97C 1KJ2H 2GTWA 4PJDA 4N68A 2L0DA 1FFPA 1VSCA 5CZKA 2NY6B 4NZRH 1SEQL 3P3YA 5TE6L 2VDKH 5DRNA 2DOCA 1B0RB 5F8RC 1T1XA 3QO1B 5KVMC 2HP4A 5D2LA 2NPLX 5F88B 1FCCA 2OMBA 3KYMA 5DHVB 4IS6A 2J7LA 4K2UH 4ODUA 3S97C 4PRHE 4OCSL 5FUZL 3WS6C 2VISA 5E2TH 3R06B 1H5BC 1UH3A 3BX7C 4EUPH 3BP7B 5EN2A 1FH5L 3VRIA 1XF1A 5KSBA 4NUJB 4I48B 4PJFE 4BQ8A 5F1IB 4HH9A 4R96B 4HIEA 4L9LA 3ZHDA 4Y1AA 3HFMH 5D7JC 5LXGL 1X5IA 3LQAC 4I0PC 1DSFL 4C56A 1AGEA 3MV7D 3M17A 2YD8A 2OBGA 1IGIL 2VOTA 3DUSA 3DXAE 4GW4B 3UROR 4PJXB 1F6AB 2FEEL 4ISVA 5BMFL 1GOGA 4IOIB 1KIUA 3GK8L 4M7ZB 1BJMA 4Y7MA 3CVIL 5FKPA 5DHYA 2HRLA 4EI6A 1N4XL 1AE6L 2ERJB 1UEMA 4OZFH 5F7WC 4U3XA 1T21B 5EOCJ 5BRZA 5I2IB 1U8PB 1YPZA 1J0IA 2AJXL 3ORJA 3UTSE 4PRAA 1BOYA 3UTTA 3FQXB 1VACB 3M45A 2ZG3A 3O4LE 3KPLB 5HYJD 3LN5A 1I1YB 5DK3A 4O2FB 2GJ6A 5KS9B 1S9VA 5HHXH 4G7VH 1OP3K 3KVQA 3ZTJH 1FIGH 4JAMA 4KHXL 5HGBB 5GS0L 3DI3B 2C1OA 4HDIB 4RDQG 5ALBH 2WLZA 5C08D 3MJ9L 4PP1D 2C9AA 3CU7A 4J4PD 3BW9B 4M9PA 1E4XH 3MMEB 5E94B 5K9OA 5L8KB 3O6FB 1U8HA 4PJAE 2IPTH 4OFKA 4GUPB 3DX7A 3VFGL 1VHPA 5DS8B 2A6DA 1I4FB 2C7UB 4YO0A 3DUHA 1ZEAH 5KJRL 2GTWB 1EHAA 3BH8A 4PJDB 3RWFA 4Z0BL 5IIEB 4HAGA 4M7LL 2PKDA 4NNXB 1HE7A 5HTSA 3R8BB 3RA7L 5DRNB 1RIUL 4M43H 2EKSA 1T1XB 2Z93A 5FCSH 4OFDA 3KYMB 1SM3H 4IS6B 4QT5B 4ODUB 4D3CH 2HWZH 1CFVL 5E2UL 1K5NA 3DNKA 4M6OL 3T3MF 4PJBE 3WS6A 2VISB 1JN6A 1S5IH 3QO0A 1WEJH 4OD2A 4JPIA 5EN2B 3VRIB 5KSBB 3D9AH 3PWLB 1F3DH 1C08A 3MV9B 3QEQE 3HTLX 4HH9B 4G6FB 4L9LB 5K9KA 3OL2A 3CXDL 3GSNH 4Y1AB 5D7JA 2AQ2A 1YEEH 4I0PA 1FYTD 1QNZL 3UCRA 2X4QA 1WCQA 1U8OA 4KXZH 1AGEB 3M17B 4YDVA 2MSPA 5MEND 4ISVB 3MRBA 5IROC 5TE4H 2YBRA 5FKPB 4JPKH 5DHYB 3O2DA 2X6MA 4EI6B 2BNRD 3CU1A 1NUGA 3LPGA 3CXHJ 2ORBL 4NN5B 5BRZB 2G60L 1CDJA 1YPZB 5IVXA 3W0WD 4WGVB 4D0BB 2OZ4L 4XMLL 2YPKB 4PRAB 4XPAL 3UTTB 5E9DD 4IRZL 3L5JA 2VDMH 4PJGE 1YNKL 1SBSL 1S9YA 4JREB 1JZ8A 2P43B 6FABH 3LN5B 3RUGF 4LVEA 4M5ZH 2GJ6B 1CGUA 5EPMA 1S9VB 4ELKA 3QDAA 5AYUH 2CK0L 4JDVA 4JAMB 4GG8A 2C1OB 4MVBD 4K8RH 1WWBX 4QRUA 5EU6A 4YHLH 5F71A 4CN4A 5K9OB 4NO3A 5IBTL 5GS2D 1U8HB 4TVPE 3T0DA 1IJ9A 2A6DB 4YO0B 5D72H 4GRWH 1OSPH 3ZMRA 4R97B 4J3XA 5FF6A 1J5OH 3BH8B 4JPWL 5GISH 2X09A 1UM4H 4Q9RL 2EE3A 3HB3C 3EYSL 4KI5F 4RAUA 4ZS6D 1LO4L 1HHHA 1W72H 2Z93B 4ODHH 1MAMH 2WIIA 1H8OA 1KN2H 1SY6L 3FB6B 3G6AA 5DVLA 4IM8A 2ESVA 4JM4H 4L8SA 1XMWA 5LCVH 4UTAH 1AQKH 3HMXL 1RUPH 1UADC 5IFHH 1K5NB 4IRSC 3TT1L 43CAA 5B39A 5IUSA 1A3LH 1JN6B 3QUMA 1H5BB 4NSKA 3U1SL 3QO0B 4BKLA 4OD2B 4JPIB 4B5EA 1C08B 4M7KH 1FZJA 3V4PL 1BJ1J 2PR4H 5K9KB 3V4UL 1NC4B 5D7JB 5HVWA 1E4XI 4I0PB 2ZUUA 4WCYH 5DJCA 2X4QB 2MCPL 1U8OB 2CXGA 5ITBH 2N7AA 3DIFA 4YDVB 3OXSA 1F90L 3MRBB 4HIJA 4HBQA 5IROA 1UCTA 2YBRB 5AG8A 1RZKH 3ZDZF 4PJCF 5DVKA 2EDWA 2VXTH 2W07A 1MREL 3D2UD 3ULUD 4LHUG 2V5TA 2ZUQC 3T4AA 2JB5H 5IVXB 4D9RD 1GC1C 4HC1H 3BDYL 5E99L 3LEYL 4ELMF 3QUXD 2LU4A 1SMAA 3G5XA 2YS4A 5D6DA 3D18A 1LK3H 4NQTA 2R8SH 4FXLA 1HKFA 1S9YB 1YQ2A 3LHPL 3I9GL 2VLJA 2BXZA 1VGEL 1DR9A 2WWMD 5EPMB 5DQJA 4ELKB 4JDVB 4PRBA 4GG8B 4Z95H 2E7BA 3W5MA 4QRUB 5EU6B 1BZ9A 4UIKL 1FE8L 4NO3B 3K4DA 3QULA 1BWMA 4OM0L 4QRRD 3GBMH 4KXZI 4RIRA 2CMRH 4LHUD 4DCQA 3RWEA 2FRGP 4I9WE 5FF6B 1WZ1H 3BKCL 3K7UA 5FYLE 2NY2D 3BAEH 5KTEH 3IS1X 1UH2A 5ICYA 3LD8B 4RAUB 3N85L 4K7PH 5GPRA 5HD8C 4RCAA 1JWMA 2DQTL 4U49A 1HHHB 4LPWA 3AM8A 5INDA 1KLFA 4UI2A 5EIVA 1FFQA 4LDLB 2WIIB 1BD2A 2Q3ZA 3RZCD 3MLPA 4C56D 4HS8L 4V2BA 3G6AB 2ESVB 4L8SB 2EICA 5CIPA 3F7PC 4YWGL 4IRSA 1MFNA 43CAB 5B39B 3HAEH 3QUMB 4JVPA 4WWID 4NSKB 1AC6A 3QNYA 4NM4L 4BKLB 1TFHA 2NZ9C 2O5XH 5L2KA 1GIGL 1JGVL 1ADQL 1J88A 3OJDA 2R69H 4XPTH 3GMMA 5IGXL 1FZJB 1F11A 4TNWK 4WENB 2ZUWA 2R2BB 3G08A 2IMMA 1E6OL 5DJCB 3N1PC 3MLUL 5JW3H 3DIFB 2E6JA 3KDMA 3OXSB 1KJVA 4HIJB 2VKXA 5ID1A 4HG4K 4PGZA 2FIRT 1W2KT 2NXYB 2NY0D 2J5LC 4PS4L 5D7KE 1VFBA 2XXCB 2JELH 4NCDA 1HYRC 2XQYG 4QYOA 3C5ZA 2DLTA 3T4AB 4K23H 3P11H 2XTJC 5ACLA 2WBWB 5ADPL 1FDLL 2X4PA 3CMOH 1BIHA 3G5XB 2EXYD 3EIFA 4XMKH 3D18B 3HUJF 2AJVL 1AY1H 5DURB 1Q9OA 2VLJB 4KUZH 3C9NA 4JLRA 5D7LA 5DQJB 1GAFL 4PUBH 1GZQA 2DB8A 4PRBB 3P0VH 3HRZA 4XPGL 4YHYB 3TH4T 2ICES 2W9DH 5F1KC 3D3VD 1BZ9B 3W82A 4RDQF 3ISWA 4YHOL 2BFVL 3QULB 2ADJA 5KN5B 4RGNC 3WXWL 1LK2A 4RIRB 4XH2A 4WUUE 3KYKL 1ND0A 4BM7A 4DCQB 2D7NA 2DL9A 2I9TA 3O6KH 4MDIA 3IFLL 5I0ZA 5JTWA 5EUKA 2A6IA 5ICYB 4AQOA 4DJMA 3SJVD 1JWMB 2IJ0C 5INDB 1A9BA 1BBDL 2DJ4A 3AXLA 3CX5J 2RFXA 1BD2B 5K9JH 4XVTL 2CKBA 4CNIA 4IOSD 5CIPB 3WKML 4IRSB 5KANI 2DWEA 1NFDE 5EA0L 3QNYB 5C09E 5DD5L 5L2KB 4UDTB 3CDYA 5CJOL 5DO2D 1LEIA 1JNNH 5DJAA 3OJDB 4UNVA 3GMMB 1F11B 4ETQA 1WISA 3LKOA 3JV6A 3B8YA 3M1BA 3ESVF 5IFAL 5EC2A 4L8CA 3G08B 1DVFA 3WIIL 1NBVH 1MWAA 3KDMB 1MFEH 3VI4F 1KJVB 4WRLA 4OFYA 5ID1B 4XCEA 1RHFA 5FO9A 4JDTL 4UINL 4Y2DD 1VFBB 2KUTA 2DKMA 3KYNA 4HJ0D 4NBZB 3L5XL 2Z0BA 4QYOB 2RQ8A 3KJ6H 3S36H 5E4IA 1A6VL 5BO1H 3UO1H 4P9HC 4JHBA 4OFPA 1FPTL 3A67H 4U0RC 1RJCA 4CU7A 4Q58C 4YHKH 4PGBA 3FFDA 1MIEH 2X4PB 1RUQL 4N1CA 1UCBH 3MACL 5J11C 3WNPA 4JFDA 5DTFA 4M7LT 1P4BH 4F7EA 2H1PL 5BVPH 3CCHA 3JUYA 2B4CL 2R0ZH 1Q9OB 2JJSC 4Y19A 2QQLL 5J12B 2J4WL 4R4ND 3IFOA 4JLRB 3MUHL 3JBG7 4HJGA 5D7LB 1GZQB 1T66D 4MJIE 5DGRA 3Q48A 3HRZB 4KTEH 4G80A 3V0VA 1NCCL 2VDLL 2XZQL 1OGAE 3C8HA 4WWKA 3SGJC 2ADJB 1G6RH 1LK2B 3QDJE 4J1UA 4XH2B 4YBQD 4NFBA 3PQYA 3WL9A 3ZKMC 1ND0B 3UBXG 3Q1SL 2H45A 4F8TA 3H2WA 3ECBA 5GGVH 2B2XL 5B21A 2I9TB 1EFXA 3CSBA 4MDIB 4P2QE 4CN1A 5EUKB 2A6IB 2JLLA 4OZGE 4JB9H 3QQ4A 1UJ3A 1T0MA 2DJUA 4XI5D 1Z9OA 1A9BB 3AXLB 2RFXB 2B1AL 2XN9D 2CKBB 3ZLQC 4JM2F 4CNIB 2CQVA 1A4KA 5EDXA 1NAMA 1MCIA 4P5KA 2DWEB 3I6LE 1BVKA 3H7LA 1P84J 3DV6A 2W92A 1EV2E 4OTXL 3HC3H 5DQ9B 3ZE2E 4HUVA 1LEIB 2PN5A 1I9JH 1FGVH 4JFEE 1PW3A 5F7KC 1AO7E 3LKOB 3JV6B 4LAJH 3M1BB 5EC2B 2PYEE 3LS4H 4L8CB 4UOW0 3QWOA 1DVFB 4LGRB 5LWYL 3AY4A 1MWAB 2OL3A 4TSBH 1WT5C 3EDDA 5FYKU 3U30C 4XCEB 3QQ9D 5FO9B 1A5FH 2J5LB 3RWJA 5AD0A 4MHHI 3KYNB 4G8GA 5DD6A 4PRNA 4H0HB 4OFIA 2YUVA 2XTJB 2A2QT 1H9VA 4OF5A 4PGBB 4P2YA 3FFDB 5CP3H 2D7PA 1GGCH 4HCRA 4JFDB 5DTFB 4F7EB 4QY8A 1ZLVK 3CCHB 4PY7A 2IFGA 4LNRA 2JJSA 2Z4QA 4Y19B 1QKZH 3CAFA 4YDKL 5GGTH 3IFOB 1ITCA 1OP3H 4MXVE 4HJGB 3Q5TA 4F37K 1XIWA 3C60D 3TESA 4G80B 3JWDH 2DQHH 1A22B 4LCWD 4MWFA 4KKLC 4JFZL 5DD0H 3SGJA 2XZZA 1ZLWK 3OR7A 3BE1H 4J1UB 3PQYB 4LCCC 5IW6A 3WL9B 3ULVF 1LP9F 2WINA 1T04A 2E3VA 3RUGA 3ECBB 4NZDA 5JDJA 1EFXB 2BY3A 5C0CA 3BDBA 3HA0A 1MVFA 1VDGA 1UM5H 1QLFA 4CKVX 4X4ME 2BJMH 3ARDC 4X80H 1JZ4A 3D0VB 3QQ4B 3ARYA 5FYKE 2BC4A 7CGTA 5IVNA 2FCBA 1KLGA 2UYLA 3FFCA 2EH7H 3IRPX 1M05A 1A4KB 2X41A 3TJEL 3WHE0 5F7DA 1NAMB 5HHNA 4P5KB 4TOYH 1QFWL 2IANB 35C8L 3DV6B 5GS2H 5GSRA 2HAZA 1J8KA 5DHVH 3AS1A 5I1IH 3B9VA 4HUVB 3C5ZD 1UM6L 3OKLA 4HWEH 1IKFL 1D5IL 1AD0A 4S1RH 3SKOA 3C8KA 2MTPA 2CK2A 4JN1H 4LLVB 3QWOB 3JV0A 1X4YA 4RNRA 1FBIL 4ONFH 4QOKE 5CSGA 2DIBA 5IEKA 3WO4C 4LGPB 3QI9A 5E8DH 5DK2A 4K94C 1JRHL 1EEUA 4XTRD 1FNEA 4JN2A 5GGSA 2R9HD 4G8GB 5DD6B 1KN4H 4FQIL 4PRNB 4U6XA 4U0RB 5EZIH 5DC9B 4N8CL 3S37L 2VDPH 4L4VD 5J11B 1MI5A 3EOAA 4QY8B 1Q94A 2VDOL 5I16A 2AEIT 5D9SA 3MRRB 4LNRB 2Z4QB 3LZFH 1HQ4A 2DLFH 1KYOJ 2YOCA 2P24A 4PJCA 5HSFA 1CU4L 4O51A 3PWNA 1G7LA 1XIWB 4O02L 1J8HB 1KG0A 4MWFB 2V2WA 3OKMA 4WV1A 2YUXA 4ELMA 5I18L 3OR7B 4G6KL 1GRWA 4LCCA 4S0TD 5IW6B 3ZHKA 1KEGL 3DV4A 1UFUA 1T04B 4D9QD 3RUGB 1L0YA 3QUZA 5FO8A 1YA5A 4DN4H 1T2QH 5C0CB 4RISH 1QLFB 4ODVH 1B4JH 2R56L 3ARDA 3HZYB 1X7QA 4JO2L 1CK0H 1GGIL 3ZDYE 3C2AL 3CSYB 4JPVL 2BC4B 5TFSH 2A6KA 1KLGB 2UYLB 4I0CC 4TUJA 3FFCB 5CD3A 5JHLH 1EGJA 3T8XB 2O5YH 3IAPA 5F7DB 5HHNB 3MCLH 4Q9BA 1T5XA 1HNFA 4LIQE 2W0KA 3O2VL 3FHQA 1UYWL 5GSRB 4BYHA 1E4KA 4WY7L 4JEGB 3RKDC 1BFSA 3DVGA 3OKLB 4DW2H 3MRKA 4HWZA 1AD0B 1CGTA 3SKOB 4JY5L 3EBAA 4PJ9D 3C8KB 2FD6L 1BP3B 4RNRB 1UKTA 4EBQL 5IEKB 3MLSL 2BNUA 3I75A 1YEIH 1OT2A 4ZD3L 3U0WH 1ZLUK 2RCSL 5DK2B 3U30B 2XG5A 3BEVB 2DQJH 1FNEB 4JN2B 4UV7L 1MCPL 5GGSB 4BQ9A 1K6QL 5KSVA 1Z0NA 4LQ1A 4U6XB 4Y4FD 1JZ6A 5J9PA 4TVPL 5E7BA 1IMHC 4WGWB 2DI8A 4Q9CA 1N0XH 1UH4A 2ATPA 1KIPB 3PDOA 4RFEA 1JHKH 4KJYA 4K9EL 1MI5B 2EH8H 3EOAB 3WS3A 1Q94B 5I16B 1JGUL 4AMKL 5D9SB 5T5NF 5EU7E 5F8QC 5HVGB 1HQ4B 3FB8A 3CFIC 3B5HA 2P24B 4PJCB 3RZWA 1EAPB 3MLWH 1L0XA 4YLQT 4O51B 2V9RA 3JWOL 3CSPA 4JHWL 1G7LB 1NL0H 5J56B 3WNLA 3I85A 3WSQL 1PYWA 3WLWC 2V2WB 3OKMB 4A6YA 4Y16D 5IB5A 1IM9A 3LRGA 4ELMB 3W39B 3I3EA 1T1WA 3NPSC 5IK3A 2WUBH 4LCCB 3K80A 3HUJA 1QRNA 3DV4B 4NOBA 5GJSH 1J11A 1UQSA 5LGJA 3L3JB 2QQKL 4AEIL 3QUZB 2OQJA 5FO8B 5HDBF 3AMLA 3B83A 2VL5A 4OQ1A 1KCUL 2AERT 4LEXH 2NZIA 3ARDB 4ZNCD 1X7QB 3W2DL 4P5TD 1CDUA 4OGYL 1DLFH 3E0GA 4AEHL 5JDSB 2A6KB 1QSFA 4TUJB 5CD3B 4PJIF 5GRVL 2FATL 5JOPE 4ZXBC 3UPRA 5CP7A 3DJ9A 4PRPE 2YA0A 4U6HA 4U6YA 3VGBA 3E8UH 4QRSA 2QEJA 4DGYL 2D03L 5MP6L 3DVGB 4HWZB 1UG9A 1WLHA 3NFNA 4HUWA 1RV6X 1YEFH 5EG6C 1KC5H 2C26A 5IB2A 3UJJL 2Y7QA 1OB1A 4X7SH 4CGTA 4OZHE 4GLRH 5EBMA 2BNUB 1A7RL 3I75B 3QDME 3ULUC 4JM2C 2VR9A 1A0QL 2X9YA 3KPRA 4HKBA 1INDL 4TUKL 2XACC 5TJWK 3HC4H 3LQAH 5KSVB 5JIHA 3C87A 5FM5M 1S3KL 5J9PB 4M7JL 1RULH 2E9IA 5HJ3A 4YGVA 1T2JA 4RFOH 4JANA 2ATPB 3O2DH 4RFEB 3PDOB 4S1DC 4KJYB 3TWCH 5KSAA 5T33H 3WS3B 5BZWB 1UKQA 4HK0A 1BIIA 2Y23A 4WTZG 4DK3A 3FB8B 3HCVA 3IDIA 1BQHA 3O8XD 4HW6A 4U33A 2DLEA 2CIKA 2X42A 3SHSA 3SPVA 1SJEA 4FQXC 3TM6A 1HWGB 4OKDA 3TBTA 4ZFOB 3FN0H 1PYWB 4M61A 4XWGL 4A6YB 1IM9B 5GGQH 4M62L 1T1WB 4Z7WE 5IK3B 1BREA 1DJSA 4OFVA 3HUJB 1QRNB 2B5IB 3WNNA 1UQSB 2WBKA 5ILTL 2K9UA 5KVEH 4ODWB 2ED7A 2NX5A 2VL5B 2ZKHL 3IDGA 1J1OL 4OD1H 1RZJC 1TJIH 1RFDH 3RZCC 4KI5D 5JNYA 2C3XA 3R1GH 3FT2A 2HLFC 4X0KA 1MHCA 1HCFX 1FYHB 5DMIL 1QSFB 3MZGB 1OARL 4LARH 3S88H 3T08A 1MNUH 1PG7X 4IDJH 3QI9D 4ZXBA 3UPRB 5CP7B 1KCKA 2Q76A 5T1DL 3ULVC 4U6HB 2A6JB 2C4FU 4M6NH 1I3VA 3DGGA 4QRSB 4K71C 3UC0L 1DANU 3DVFA 5DJ8A 1QD0A 4MXQD 2DBJA 3V2AR 4XPFH 3NFNB 1CE1L 3KPNA 1BAFL 4HUWB 1E0OB 3QUMH 3S37X 2NY0C 15C8L 3RTQD 1OB1B 1FNSH 5C86A 4KZEL 5EBMB 4DN3L 4OGAC 4JM2A 5DJ6A 1HDMA 1EH9A 5EIIA 5F3HA 4HKBB 4UT7L 3TF7C 4CVXA 4QHLA 4DK6A 4ZS7L 4OCYL 1I7TA 5KAQG 4HWBL 1UKSA 1F6LL 4PY8I 2EDDA 4LSPL 4N1EA 1OD9A 2KZ1B 4O00A 5HJ3B 4YGVB 2WM0A 4OI7A 4JANB 3HNTL 2DD8L 5KSAB 2HH0L 1CN4A 4XP9H 4HK0B 1NUFA 1BIIB 2JK5A 3LN9A 3SOBH 1OCWL 4YXLL 2WWKT 2EO9A 3HCVB 5DRZA 3IDIB 1BQHB 1KBGL 2OJEA 4KUCF 3IU4L 5E2VH 3IKCA 4G9FA 3SPVB 5HXMA 1SJEB 4FQXA 3FQTA 4ZTPL 3TBTB 4KRPB 4JQIH 4M61B 5LG1A 2CJUH 3NPSB 1M71A 3SDCC 4GLRI 5F93C 5HI5D 1WV7T 5HDQH 2ZUVA 5IM7A 3CK0L 3BXNA 3QIBA 1QLRA 3CXHK 3BISA 4NKIL 1T83C 2NX5B 3IDGB 1L9NA 2E7HA 3WD5L 3LEVL 5JNYB 4MA1C 4GRWE 5A2JH 2DBLH 4F7PB 4X0KB 5E5RB 4GJTB 4MZ3A 3NBNA 5I1GL 4NKQB 2AS5M 4ZXBB 4Q0XH 1JF1A 1PKOA 1EAJA 1LP9A 1S7SA 3DGGB 2X1PA 2VZOA 4M6ML 1L9MA 4K07A 1NLDH 4P2OC 5DJ8B 5F96L 2D7TL 1MJJA 3QDGE 4NQDE 5B38A 5CIPH 4XNUL 4OZIE 2W91A 4U3HA 2W0LA 4LAQH 4NDMA 3KPNB 1CLOL 3N1QC 3RNKA 2EYSA 5C9JA 4JFYA 3S34H 2UVEA 5KBNC 4JM2B 5DJ6B 5LKNA 5EIIB 5F3HB 5T5FL 4CVXB 5EFIA 4QHLB 3SQBA 4ETYA 5C0GA 4ACPA 1I7TB 2ZJSL 1CBVH 3WFEH 1DQDL 1I9RH 2HTLD 5JIIA 1KTDA 3FJTA 4M3JA 1DQLH 2HFGH 3BZFA 1AP2A 2K7PA 1ZLVH 4R4NC 2BY0A 2OI9C 3FQWA 4N0YL 2EDKA 4DWHA 2JK5B 4ZAKD 1TTGA 1T66C 1QHOA 2R15A 2VWEE 2XA8L 1PX3A 5DRZB 1D6VH 2OJEB 3S5LA 4DOHB 1UWGL 1IGML 3IKCB 4G9FB 3F7QA 2PTUA 4FQXB 3P0GB 2DICA 3FQTB 4DGVH 2W59A 4YBQC 4H0IA 4X9GA 2VL4A 3WV0A 3CX2A 1ZLWH 7FABL 2F15A 2YEZB 1RMFH 3KLSA 4WI3A 3L95A 1M71B 1SBBA 5IBUG 3SDCA 5FAAA 2DQUL 3LRSA 3V0AC 5IM7B 1QLRB 4ODBD 3VFMA 4L5FL 3P9LA 1ES0A 4XI5C 5F7YC 2R4RL 1MCEA 4X99A 1FG2A 3F7RA 1H3GA 3MA9H 1K3ZA 4URTB 5T3ZL 3DBXA 3RGVD 5GRUL 3TZVC 1QFUL 2R0WL 3SDYH 5FECA 3AUVA 3TN0D 3KPRD 1AKJA 1JF1B 1LP9B 1OAXL 1S7SB 4K71B 4P2OA 4HBCH 2AJSL 2EECA 3EO1A 2PETA 4NQCE 2CKBH 3FT4A 5B38B 4WIQA 4FTVE 1FZOA 3PF2A 5CZVL 1F4XH 4NDMB 1EIBA 3RNKB 2EYSB 2YSSB 4JFYB 5FGSA 4NNPH 4HS3A 2LAAA 1AI1L 2F53E 2WV3A 5FV1L 2DMKA 5HHOA 2VLKD 2ADGA 1NSNL 3QIUD 5EFIB 5F7UA 4EKXA 1LO3H 3MV8B 4OLWH 4ZG1A 3MLTA 3NACH 3PNWA 1EMTL 5C0GB 1UZ6F 5DFWH 1TETL 1MWAH 1KTDB 3GSOA 5LGHH 3BZFB 1A14L 1VADA 3MLRL 2BCKA 3EOBA 1DLHA 1AP2B 3HI6H 4P3CL 1CD8A 3VD5A 3FQWB 2Z92B 3CVHB 1PKQE 1MJUH 3OSKA 1NUDA 4F58H 5M7QA 4HXBL 3GRWA 4L4TD 1ZVYA 4Y4KA 3REVA 4BUHA 1KLUA 3K3QA 4FQLL 3C60C 3G5ZA 3BWAA 3I50H 2JE8A 3NFPA 3S5LB 4XNYL 2CDFA 1RUMH 5BS0D 3BESR 1HKLL 5T1LD 4FQQA 3IXAA 43C9A 3BD3A 4ZUTB 3MOBL 3L95B 3PG2A 1TJGH 3SDCB 4RWHA 1IKNC 1Q9WA 3IJYA 3LRSB 4LSQH 1FSKB 1QQDA 2OSLA 3VFMB 1ZS8A 3BJ91 3P9LB 1ES0B 3QA3A 4UT6L 1IAMA 5DDHA 3EJZD 4MAYA 4X99B 1BEYL 2Q1EA 1ZAGA 5IWLC 1FG2B 4MA1B 2VXSL 3OQ3B 4PJ7F 1RZ8A 2H2PD 5GRJH 4XWOC 4BJLA 1PLGL 2YMXH 3DBXB 4PJ5A 3TZVA 1WICA 1AXTL 4RRPG 1F4YL 4WEMB 4F80A 5FECB 1AKJB 4JRYE 1N5YH 3QFJE 1MCKA 3PWPE 4C57C 4K3JH 4OIIH 4P2OB 3EO1B 1F8TL 4LQFH 2A74B 2HFEA 3FT4B 3JWNC 2YPVH 1FZOB 1NAMH 1DQJA 4RMSA 2H2SD 3BSZL 5IHUH 3QHZL 1ZLUH 1NCAL 3SDXE 2J12B 1F3DJ 4PJIA 3TNNA 5HHOB 4XHQA 3BZ4A 1DBML 2ADGB 3MUGB 4ZFGL 4MSWA 4KMQA 3D85A 4XBGA 5GSVA 3WNOA 3MLTB 3PNWB 4JO1H 3STLA 2JIXB 2OL3H 3GSOB 3LN4B 2ZUYA 3T0VA 4GG6E 3BD5A 1VADB 2BCKB 1YEKL 1DLHB 3EOBB 1N7ML 2AJYH 1TZGL 2OI9B 2ZZUT 4XBPA 2WMPA 1YNTA 1CQKA 4Y4KB 4KVNL 3REVB 1KLUB 1I9IL 2W38A 3G5ZB 3BWAB 4ERSL 2B1HL 3QIBD 2PO6D 3NFPB 3TA3C 4B50A 4HCRH 5C0BA 2JB6A 4HPYL 3B2UC 4UILL 1K2DA 4LLQA 3GIZL 3HR5A 2EDYA 1U93A 1FC1A 2C1PA 3IXAB 2BVPA 1XGPA 2F5BL 43C9B 2EYTA 3FQNA 3IFPA 5B3NA 4LIQL 3MV7E 3FMGL 3LS5H 1IKNA 3ZT6A 5IHZA 2D4FA 3IJYB 1Q9WB 1QQDB 2VDNL 4LSVH 1ZS8B 2XQYK 3PWUA 1V3KA 3QA3B 4OGZA 4X6FA 3TBYA 5DDHB 3SO3C 3K8KA 5GS0C 1TXKA 2V6HA 5IWLA 4CU6A 4MGXA 1RZ8B 5HYFA 2VC2L 1ONQA 2ENYA 4PJ5B 1KB5L 3VWKD 5ERWA 4H8WL 1JGEA 4LSRL 3TZVB 1IC7L 1X9QA 5CBAA 3DI2B 3MGOA 5IW3A 1G9NH 2WLYA 3NMEA 5LAXA 3T0EC 2EIEA 3H7BA 3P9MA 1WIPA 1D5XA 1D5ZA 2HJFA 3G9AB 2ZP0T 5CGYC 3UYRL 2HFEB 2N4IA 5AWNH 1KV3A 3GO1L 1LEKA 5GGRA 3RPIA 5ISZA 1IL1A 1DBBL 4X98A 1DQJB 3QEQD 5C08E 4LRNH 2QJDA 2BDNL 2IG2H 5ESVA 4F15C 5AAWA 4HUXA 4ESKA 1GOHA 4TRPL 4XCCH 4PJIB 3MXVL 3TNNB 3BZ4B 2WIMA 5BV7B 4MSWB 3D85B 4XBGB 5GSVB 4H1LG 2QSCL 2E8YA 1YN6A 2VZ3A 3WIHL 3NABL 3STLB 4OUOA 2P8PA 1KACB 4YAQA 3MO1A 4BZ2L 3VU2A 3WHXA 3O0RH 4YR6A 2F58L 5C0AD 1VPOL 1U8IA 3KWWA 3LKQA 3O6ML 5DR5L 1KELH 4XBPB 1YNTB 1JI1A 1L0QA 5FM5O 4Z7QF 3U7YH 1M7XA 2F9BT 4ZDHA 3RP1A 3JSSA 4LU5H 2OTPA 3TA3A 3NCJL 4KTDL 5C0BB 1KJ2L 1PG7W 4WFGE 2WQ8A 4N5ED 2EEAA 2EDEA 1MHPH 3LMJH 1ACYH 3QWRA 1K2DB 4LLQB 2VQUA 4NZRL 3HR5B 3ARZA 1U93B 2HKFH 2C1PB 2VDKL 2EE6A 1BQUA 4C54A 2BVPB 1XGPB 4K7FA 4TSAL 2EYTB 3FQNB 3IFPB 4XVUD 1XR8A 3KS0H 5DUPH 1MPAL 4I3SL 3MLVH 5MENE 5IHZB 2QADD 4AG4H 4X6CE 5FGCE 4Q6YA 3VGGA 4P5TC 2A77H 2YRLA 1EHLH 3LEXA 2BNRE 3PWUB 2P44B 3BZEA 4X6FB 2IPUG 3TBYB 3OV6A 4OIBA 5E2TL 3TCLA 2G9HA 1FL5B 3F6IA 1FRGH 3W0WE 3P30H 1CFNA 2APXA 4NQEA 3MNZA 3GKWH 3UTZA 1ONQB 4OI8A 3PGFL 1OWRM 5DFVC 5E9DE 1CVSC 3S35H 2AJ3A 3HFML 5CBAB 2B7DT 4NKMA 5I71C 3MGOB 5IMOA 5LAXB 3T0EA 3H7BB 1KIQA 1D5ZB 2HJFB 3WUWG 1EGJH 1LEKB 5GGRB 3RPIB 5ISZB 4JVUA 1IL1B 4X98B 1WITA 4JG0H 1P6FA 4HLZH 4N90D 1IEHA 5ESVB 1GPOH 5K59F 5K9QI 4UUJA 4HUXB 3K2UH 5FUCC 3VD7A 2YUZA 1J87A 3D39D 4P3DA 1YN6B 3J7HA 2MPAL 3KR3H 4KKNA 3LCYA 1A6PA 2MQ0A 1PEWA 4N8VG 2P8PB 4WI5A 4KFZC 4YAQB 2QV2A 3MO1B 5HHXL 2BVQA 1I1FA 4G7VL 4K94H 3EAKA 2ZCKH 4PLKD 3RVWD 3WHXB 4G43A 1FIGL 3BI9X 3IDUA 1U8IB 2GUOA 1XF3A 3KWWB 3LKQB 4RZCA 3O8XC 2CIIB 3C08H 5C92A 4WFHE 1U8QA 1E4XL 2DMCA 3RDTA 3E6FA 3SKJH 4FRWA 2G5RA 2IPTL 1JBJA 4WI6A 3TA3B 4GXVH 1FORH 5GZOD 1CIUA 2EIBA 4MAYD 3NTCH 4HIHA 3RI5F 1WC7A 3MA7A 3PHQA 2OZ4A 4K7FB 3NIFE 4M43L 3RVTC 1V3JA 1XR8B 1CXIA 4R4FL 2NTFA 3KXFD 1AHWC 1X5KA 3VGEA 1TZIA 2E9JA 4FFWD 5AZEH 3VG9C 3NPZB 4LPYA 4PJFF 2M26A 3BH9A 4A6YH 4P2CG 4D3CL 2HWZL 3LEXB 4UBDC 3BZEB 2DQCH 1P9MC 3H9SA 3SO3B 1F42A 2G9HB 5IESL 1S5IL 4FZ8L 1WEJL 2X1XR 1I8MA 4PLJD 3VXMA 4D9RE 1CFNB 4NQEB 3UTZB 3MNZB 3QP3A 5I8OH 1SYVA 4UAOC 4GBXC 3B9KC 1SQ2N 4MXQC 1U58A 1WVZA 3BEWA 2AJ3B 3OZ9H 1B88A 3V6OE 3WXVH 1SEBA 1YEEL 4NKMB 4NQUA 2QL1A 2YKLL 1YY9D 5IMOB 2P48B 5C1MB 3T0EB 1KIQB 1HOCA 4POUB 1MF2H 4JPKL 4RBPK 5CEZH 4GAGH 1MH5A 2VH5L 4TN9A 3S8WA 3O11A 5K33A 4F15B 4XXDA 4LOUD 5D2LE 1RQ5A 4UUJB 2QHRH 2GY5A 4QRRE 5I9QC 1UWEL 5LJYH 4JDZB 2AK4A 2CLRA 5I30H 1U91A 2DQDH 2VDML 2R1WA 2EDNA 1IGJA 2HRPH 5D7KD 3RFZC 1NMAH 1PAMA 4P3DB 1T7VA 2VERN 3SDAD 4NO0A 4XNZC 4TSCH 3SCMC 4PJAF 3E6HA 3P4NA 4W6WB 2BVQB 1I1FB 4CMHC 1CF8L 4G43B 5AYUL 1NC2A 1VFOA 2ZG2A 2OTWA 2GUOB 4TYUA 1XF3B 4HD9A 5H37H 5DQDH 1IT9H 4K8RL 4RZCB 5IQ9A 4C56E 1U8QB 4YHLL 1G7HA 3E6FB 4FFVC 5C71A 5C0NC 5IVZA 5D72L 4MCZA 3MJ7A 1BECA 4MS8D 1BFOA 2R2CA 5GISL 5T1KA 2P47B 1J5OL 2HJKA 4HZLA 4M02A 2OP4L 1X5LA 1UM4L 1FNHA 5D71H 4X5XA 4HIHB 4G42A 1WC7B 1YPZE 3MA7B 3PHQB 5HYIA 4LCUA 4ALAH 1FL3A 2B8OT 1IQWH 3UTTE 2NTFB 1AHWA 1CXKA 1TZIB 3T0XA 4ODHL 1MAML 1RK0A 4WUUD 5EZJA 1KN2L 1DQQA 5LCVL 4UTAL 4X4ZA 1AQKL 3BH9B 2GJ6E 4CVUA 2Y9RT 1G6VK 4UNTA 5IFHL 4WTZA 2Y6SC 2P5EA 1P9MA 3H9SB 4NWUL 4E41A 1A3LL 5HVFB 2VUOA 5IMKB 4P0DA 3IETA 4NCC1 3DSFH 1I8MB 3VXMB 5FA4A 1SYVB 3G9VA 4M7KL 2FYYA 4GBXA 2PR4L 4OLZL 3FAXA 1U58B 3BEWB 3VXRA 1SEBB 2VUYA 4WCYL 5I71B 1X5FA 5ITBL 4DEPC 1UB6A 4NM8H 3QIWC 1RZKL 1HOCB 1XGYH 2VXTL 1CLCA 3O9WC 4M4PA 5FB8A 1G1CA 1MH5B 2XWTA 5DD1H 3VI3E 4PJ7A 3D3VE 4HWNA 3O11B 1OW0C 1DFBH 4TQEH 2JB5L 5DLMH 4XXDB 1L7IH 4HC1L 3QJHA 4G8FA 2X40A 1F3JA 2CR3A 2HTLC 2AK4B 2CLRB 1ACZA 3INUL 1LK3L 1U91B 4YHMH 1KTLA 1ORSA 2R1WB 2R8SL 1A21A 4JZJC 2EKJA 3GMQA 1OP9A 4JGMA 3ZYZA 2W0FA 4NO0B 3SCMA 5C7XH 1LDPH 1ADQA 4Y8AA 3E6HB 3P4NB 4LLYB 1T0NA 1A6AA 4UTBH 4KZDH 1NC2B 4Z95L 2OTWB 3OG4B 1VKXA 4OF7A 5IQ9B 2WBJD 3QUYD 3TBSA 1G7HB 1QHPA 5D1ZD 1MQKH 4NFDA 5IVZB 1KEMH 4QHKI 4MCZB 2AABL 2CMRL 3MJ7B 1WZ1L 5T1KB 2HJKB 4HZLB 2GHWB 2M8XA 4DFIA 3BAEL 3QB7C 5KTEL 4YDLC 4GG6F 4JG1H 4LLWA 4G42B 1LO0H 3ARGA 4K7PL 5E1HB 3MRCA 1I7UA 4LCUB 1FL3B 1AHWB 2C3WA 3BQUD 3PV6A 1BMGA 1A7BA 1RK0B 4NRZA 3VG9B 5EZJB 1R3HA 2R2HA 4XT1C 2R1YA 1J9CT 3NA4A 1GVIA 2P5EB 4E41B 1QZ1A 2I5YH 2ZNXA 3IETB 2WQRA 3IDMA 2O5XL 5FA4B 1WWCA 3UJIH 5IJKC 2R69L 3CLEH 4XPTL 4UAOB 4GBXB 3B9KB 3MQIA 4GKZA 1RZJH 3VXRB 3C6LC 1ZHBA 1UB6B 4OUUA 2Q6WA 3I6LD 4Z7UF 2L7JA 2IAMC 3QIWA 2FJHA 2XXMB 1FP5A 3HI5H 4X8JA 1YMHA 2Y07H 2C3GA 2I07A 4IMLA 3O9WA 4TPRH 3IKKA 1C5CL 2BRRH 4KJQD 1I7RA 1EXUA 2JELL 5C3TA 3T2OA 5FB8B 1DBJL 3ULVH 2XWTB 1Q72H 4PJ7B 4DKEH 5SWSA 4K23L 3QJHB 4G8FB 3CMOL 5I9QB 2DQGH 1F3JB 3RDTD 4F9PC 1MJ8H 4XMKL 3FCTA 3SQOL 5T3ZD 1KTLB 1ORSB 3DRQA 4KJPD 4JZJA 4A2MA 1AY1L 3GMQB 5GZNC 4U1IA 2W0FB 4XNZB 3H6JA 3SCMB 3WN5C 1T0NB 1A6AB 5EOQH 5HI4C 4PUBL 3VMPA 3OAYK 4CMHB 5L0QC 1LD9A 3QWQB 1VKXB 2NR6D 3EOYG 3MFFB 3AROA 4PRDA 3TBSB 1IE5A 2XN9E 4NQXB 2IADA 4OT1H 3TT3L 1ULVA 3VXSA 5C0JA 2ADFH 2EXWC 2VE6A 3S3JA 4PGEA 1RZGB 3U82B 3O6LH 1VCAA 5J0BA 3P4OA 3BP6A 3O6KL 4R8WH 4LLWB 1KCVH 3ARGB 3MRCB 3VWJD 1I7UB 2GSGA 2NY3C 5IV2A 3VGDA 1NFKA 4BQCA 4GW1A 1RY7B 5DEFA 3LAFA 3KLDA 4NRZB 1I1RA 1G9MH 2MMXA 4P23C 4UQ3A 1BVZA 2F8OA 2R1YB 5F1SA 4D8PA 1RURH 1D9KC 4X5WA 3RL2A 4QRPA 4GSDL 5FHAL 1NGZA 4U0QB 2KQNA 2APWA 1F00I 1S7VA 1TNNA 1BQSA 3HNSH 3LH2H 3IDMB 5CJXC 1YQVL 4AQ1B 5IJKA 4Y89A 2VZSA 3JUZA 1CL7H 3FB7A 3SDDC 3QCTH 3QUKA 3C6LA 1ZHBB 1NBVL 2D0GA 4OUUB 1CR9H 5SWZA 3SE9H 4DEPB 2Q6WB 2Y5EA 2IAMA 3QIWB 4JR9H 1U3JA 2FJHB 5FV2A 1T22B 4X8JB 1YMHB 2I07B 5D93C 3O9WB 4FZEH 3UZVB 4D9LH 1TENA 4R2GD 1I7RB 1EXUB 1YECH 4W6XB 3S3PA 1DBAH 2FX9H 4LCWE 3KJ6L 3RBGA 5BO1L 5SWSB 3UO1L 3A0OA 2YZ8A 2E9BA 1MAKA 3JVGA 5FA3A 4YHKL 4MAUH 1MIEL 4OLVH 1R3LA 1UCBL 4F9PA 2VLRA 1P4BL 4MA3A 2DYPD 3BT2H 1QYGH 3DRQB 4JZJB 2R0ZL 3HC0A 2F5AH 4U1IB 3T0WA 4N8PA 4QXUL 3UTQA 2AKRA 2I9LA 1A7OH 4QF1A 5HHME 4L8DA 2CD0A 2WWKO 2ZOLA 3EJYC 3IDXH 4DVBA 1LD9B 3GFUA 3HE7D 4KTEL 2PO6C 2LFGA 1YYMH 1AGCA 5JORA 4PRDB 4Z5RA 3BFOA 2IADB 1T3FB 2EIDA 4X6EA 4UZGA 32C2A 1M7DB 3VXSB 1G6RL 5SX4H 5C0JB 2VE6B 1FVCA 5SX5K 1OT1A 4PGEB 5H94A 5DZOA 1AGBA 3MRFB 1N26A 5GGVL 3ZKND 3P4OB 3BP6B 3GRWH 2J2ZA 1GGBH 2NMSA 2PXYA 5E6IA 2GSGB 3MRDA 1NFDF 5C6TL 5IV2B 1NGWA 3EW3B 4GW1B 4RX4A 2JJUA 5J3HC 4W81A 3FO9A 4UQ3B 4P23A 2BVUA 2Z31D 5C2BH 3RY6C 4EI5C 4U1MA 5ESAA 2FGWH 4D8PB 4X5WB 3RL2B 3UTOA 4QRPB 3VWKC 5IB4A 4Y5YC 1NGZB 3KPSD 1S7VB 5HGAA 1JNJA 4ZMAT 5CJXA 3HC3L 4L4VE 1I9JL 4FQCH 1FGVL 4PRHA 3IAGC 2EDHA 3FB7B 1IGFH 1JWUA 3SDDA 5BCAA 4F3FA 3EDFA 3QUKB 3C6LB 5SWZB 4FQ1H 4YHZL 4PJFA 4U1JB 1GJIA 3VXOA 2IAMB 1MFBH 4LSSH 5J6GB 4XAKD 3QCVH 1XZ0A 1RUKH 1LNUA 3QISA 5AEAA 8FABA 3DXAA 5HI3D 1YEHL 1KNOA 4NHCL 1MY5A 5FA3B 3SN6N 4KDWA 1Z9LA 3QHTC 1R3LB 1GGCL 4G6AD 1E4JA 2X4RA 2VLRB 4MA3B 3HPLA 3X17A 3DARA 4PR5A 3HC0B 4M3KB 1QKZL 5GGTL 3GJEA 2BX5A 5I75C 3UTSA 3UTQB 2AKRB 2I9LB 4QF1B 4L8DB 2APVA 5BQ7A 4PJEE 2ZOLB 3THMH 4BA8A 5BV7H 4ODSL 4DVBB 5F21B 4L3EA 5FGBC 2DQHL 4KK8D 5JORB 4Z5RB 1CL7I 4OZGF 5DD0L 4X6EB 2OCFD 32C2B 3QG7H 3BE1L 1FVCB 1Q9LA 4HT1H 4IMKA 5H94B 1AGBB 4PRIA 3MBXH 2DM3A 1BVLA 4PJAA 2PXYB 2X2YA 3NAAH 4HX1A 5E6IB 4YXHH 1UM5L 3MRDB 2NY3B 2FBJL 3C09C 3LIZH 1Z0MA 1NGWB 3ZDXE 2P4AB 2IH3A 2IALA 5FOBA 1MLCA 4QXWA 3FO9B 2E7LC 4JKWA 4P23B 1T20A 2EH7L 4Y19E 3RY6A 1FLRL 5A3IC 3F7YA 4UV4H 2RR3A 3BYYA 5ESAB 3ZE1E 4EI5A 2ATKA 4TOYL 5A2FA 1D9KB 4EUPG 3D25A 3NIDF 5IB4B 4Y5YA 3JWOC 2BVOA 2AGJH 5HGAB 4BSWA 3T0BA 3B8SA 4FQHA 4NO5A 3FN3A 3TYGH 5I1IL 2JCCE 5F44A 2A73A 4HWEL 4PRHB 4S1RL 3ZYOA 1JWUB 3SDDB 4F3FB 4JN1L 4B7LA 4R4BB 4G7YL 4ONFL 3HLAB 4A2LA 3A6BH 5SX4I 4PJFB 4QWWD 3VXOB 1RZFH 2QSQA 4OCXH 3ZTNL 5D1QC 4RBPH 4OZFG 1HCVA 5D93B 4APQC 3X3FH 1XZ0B 3DMMA 1LNUB 1UVQA 8FABB 3DXAB 1WIUA 1KNOB 4PJHE 5E8NA 1ZA6A 2AV7A 1FLTX 4MNQA 5EZIL 4XHJC 2VDPL 1SEQH 4MXVF 3X12A 5TE6H 5MEOA 3DURA 2X4RB 2IPKA 1A7NL 2CR6A 2AJUL 3HPLB 3VXUD 4M1GH 4CN6A 5F6IB 5ETUA 4PLKC 3T77A 3RVWC 4PR5B 2LABA 4N9GB 2H41A 3LZFL 3GJEB 5ENWA 3RAJH 3UTSB 4N0CC 4P2RD 1U95A 5BQ7B 3DYPA 4GRLD 4F9LC 4OCSH 1K4DB 5FUZH 3O4LB 2BP3A 4L3EB 2QQQA 4OAWA 4OB5H 3QBTB 5KVFH 5GZOC 4OLYH 5E95B 3ESUF 1Q9LB 2FBOJ 4H20L 3X11A 1AFVL 1IGCH 5LXGH 1RJZA 1BF2A 4PRIB 4D0CA 4Q7DA 3MRQA 1BVLB 3VGFA 5BMFH 4PJAB 1T2QL 4DN4L 3G5YA 1PSKH 4FFWC 4HX1B 1U36A 4KGJA 1XGQA 3CVIH 3PIQA 4RISL 5LVEA 4ODVL 1B4JL 2C3VB 2PF6A 1CK0L 1N4XH 3EHBC 4XP1H 2IBGA 3ZYJA 2BHUA 5TFSL 5E4EC 2IALB 5FOBB 1MLCB 5CEXA 3VGAB 2E7LA 1T20B 5JHLL 3HE6D 3F7YB 2O5YL 2AJXH 1GCFA 4EI5B 2VXUH 2ATKB 4LLUA 4KHTH 1XCTB 5CD5D 3D25B 1OTTD 1Y0LA 2W65A 4Y5YB 2BVOB 4BSWB 4FQHB 4NO5B 4GG6A 2J8UE 2A73B 3WBDA 2X05A 1QFOA 1B6UA 1I8KA 4KHXH 5GS0H 5J7CC 1YEIL 3U0WL 3ARQA 3RUGE 3QEQB 1LWRA 5FIEA 2Y72A 3DOSA 4J6RL 5D1QA 5I6XC 3RI5K 4WEBL 3TH3T 5JXAH 2DQJL 2BSTA 4APQA 2CUMA 3DMMB 1EO8L 1FZMA 4JKPH 1UVQB 5B22A 2XKNA 4JJ5B 3TO4A 1TQBC 5E8NB 4YNYA 2AV7B 4KK5D 4QXGH 1N0XL 2HTKD 3RA7H 3X12B 1QFPA 5MEOB 3DURB 1PFCA 2IPKB 2EH8L 3V6FA 3N06B 2KL6A 1G0YR 5ETUB 4XVSH 4ZFFA 1R24A 3T77B 5JHDA 2DJSA 4Z7UA 3OKKA 5ENWB 3OWEA 5I75B 4KI5E 1MJ7L 3MLWL 1U95B 1CFVH 3QEHA 4F9LA 2DAVA 4WW1A 5DVNA 1S5HA 5SWQA 5IBLD 1NL0L 3LRHA 2X44D 4GW5B 2VYRE 4WU5A 3ALXA 3AB0C 4XCYA 3P0YL 4MS8C 4OAWB 3SBWC 2DIJA 5EH1A 3TYFA 3ZDYF 1YC7A 3O41A 2WUBL 3CXDH 1EO5A 3X11B 3W9EA 1RJZB 5GJSL 4FS0A 3A6CH 1BPVA 4D0CB 1HI6B 3MRQB 1TLKA 1SMOA 3K81A 4KVCH 2NY5H 3MREB 1XGQB 3PL6D 3PIQB 4IOFD 3C09B 4WVRA 4TUOA 2HFFA 1DLFL 5CEXB 1SJXA 3KHQA 3H3PH 5D7SH 1RVFH 3QXUA 2OZ4H 5I1KH 3ZDZE 4K8RD 4LLUB 1FHGA 1J0ZA 2DIAA 4I0KA 1Y0LB 2W65B 3ILQD 1YNKH 4GMTH 3MV01 4GG6B 4MQXD 5GRXG 4NT6A 2NLJA 2AXGA 1JWSA 3BMVA 2PUQT 4YBLB 2R0KH 3B43A 4ELME 4U3CA 3ARFA 1I8KB 4WO4D 1R5VA 5I1LA 1UZ8A 4X7SL 1R6VA 4YJZL 4LCIH 5DUML 4JVWA 5D1QB 1CXLA 3IVKA 2GITA 1HINH 3D5OF 2BY1A 3QDGD 4LMQI 5EU3A 2BSTB 4APQB 2FEEI 3S96A 3V7MA 1DL7H 4YNYB 4F7TA 1RULL 1JFQH 3I2CH 4RFOL 3BGMA 5I1CH 3TWCL 3V6FB 4NQVA 4ZFFB 1R24B 4K3HA 2IBZX 3OKKB 1ZHKA 4ZTOH 5E08H 2CPCA 1LEGA 1JHTB 1GGTA 1IZKA 4JQVC 4LP4A 1X5GA 3P40A 4OSUL 3QEHB 4OCNC 3NGBC 4WW1B 3TT1H 1WAAE 1FO0L 5CGMA 1I1AC 5CEYA 1K8IA 4WU5B 3U1SH 2HMIC 1WWAX 3CLFH 2EDRA 4XCYB 3FN0L 3RVUD 4DZ8A 3GSQA 5GGQL 3TYFB 5KOVC 2GW5A 5DJ0B 1PJ9A 1TPXC 4NIKB 1OAZH 4O58L 3O41B 2I26N 1NDMA 3W9EB 4L4JA 3RBSA 1MFDH 3B2VH 4M5YH 1OM3H 3BQUC 2YPLD 3H0TA 2YD3A 5F9OH 4KK6D 3ARBD 1L4IA 3R1GL 4TUOB 3OPZH 4FFYL 5E4EB 3F65A 2QBWA 1MEXH 4LARL 1MNUL 4IDJL 3HAEG 2CKNA 1JGDA 4U1NA 1VFAA 3NH7L 4M6NL 1MUJA 1YMMD 3DVNA 4OZHF 5TDPA 3LHPH 1BGXH 2DQIL 2VZTA 2NLJB 2AXGB 1JWSB 4MNQD 1NFDA 1NUNB 2IC2A 3ARFB 3RVVD 3IJHA 3QUML 2DQEH 3B6SA 1R5VB 5I1LB 1UZ8B 4Y4HC 2X9WA 2I24N 5C09A 4CJ0A 2DM2A 3HUJE 1FNSL 3MRJA 5DRXA 1C1EL 3V4VH 1XT5A 5I6XB 3IVKB 1J18A 2GITB 4OM0H 1U6AH 5EU3B 4O9HL 1KENH 5GRYA 3D1MC 3EO0A 2RGSA 2V7NA 4UB0H 3S96B 3MGAA 2R4SH 3BKCH 1NFIA 4KJPC 4F7TB 2A1WH 3CFJA 4NYLA 3BGMB 2Q8BH 5C0EA 1T4KA 5CEZE 2AI0H 3STZA 4P46C 3Q2CA 5A2KH 4NQVB 4HFWA 2D7QA 2ED8A 4U6VH 3SOBL 1W0YT 1R0AL 1ZHKB 4J3UA 3DSNA 4WTXA 1QSZA 1LEGB 1OOAA 1WFUA 5E2VL 2EDXA 2F54D 1CICA 4ONGH 2PW1A 2V5MA 1I1AA 4OD3H 5CEYB 3K46A 4NKDA 3AB0B 4JQIL 4DZ8B 1GIGH 5SX5H 3GSQB 1E4WH 1ADQH 5ALCH 1BQLH 4NZTH 2X7LA 5IGXH 3KPRE 4MJIA 1NDMB 4HS6A 3U9UA 4MHHG 3VWJC 5C07D 5IR1A 4M1CD 1OGAA 4RMTA 3FZUC 5I66A 3UZQA 4IDLA 1I3RA 2IQ9L 3GJFA 3H0TB 3CJJA 1U2HA 4JZOA 4PS4H 5FO7A 4R96A 1D5MA 4BFGA 3FO0H 4RGOL 3U46A 5CMAA 2MKWA 4OZGA 2H6PA 2XKSA 4PGJA 2VLKE 4QKXB 4I2XE 1AXSA 4NNYB 4PG9A 2W0PA 4Q0XL 2GIYA 4U1NB 1JE6A 1VFAB 4EN3D 4FQJH 1TTUA 4AYFA 5F7EH 1BJ8A 1MUJB 3ZE0E 3DVNB 5TDPB 3FT3B 4XBEL 4IEFB 1DE4A 3TO4D 3KLAA 1JIBA 2F19L 4GO6B 1OTUD 5JZ7D 1NFDB 4LAQL 3WFBH 1GAFH 3IJHB 3EKCA 1MRCH 2KQMA 3QNZA 3B6SB 1VACA 4L4TE 5KZCD 4Y4HA 5C09B 4TNVK 1PDKA 2P5WD 3MRJB 5CLTA 2NXZC 5DRXB 3S34L 4WHCA 2BNQD 4NBYB 4JRYD 2FH8A 1B4RA 3PWPD 4JFEA 1NEUA 1AO7A 4Z9KB 4WDIA 2PYEA 4R90H 2O5ZL 1CBVL 3WFEL 3V6BR 3QPXH 5HGBA 3GHEH 1I9RL 3GBLA 2V7NB 1S9WA 1MY7A 4BK4A 2HFGL 2RB8A 3CFJB 4NYLB 4PP2A 3RIFF 4EDXA 4V1DA 5C0EB 4Z8FH 2NY4C 4ZUWA 1T4KB 1QRKA 3K2MC 3STZB 4P46A 1N2RA 4HFWB 3MNVB 4HPOH 5EU5A 1X5XA 1BBDH 2QTEA 1MCHA 5IIEA 5JOFA 1S78D 1CI5A 2PCPA 4NNXA 1D6VL 3OMZA 4RA0C 5MI0C 1CICB 2ZOKA 2PW1B 5E6ZA 4DGVL 3MZTA 1I1AB 4KDVA 4N9OB 4NKDB 3W9DA 5FOJA 5CJOH 1I8IA 3HKFA 3HHRB 1RMFL 3O3EB 2X7LB 5I0DA 4QT5A 4MJIB 1OTSD 4LASH 4HS6B 5IFAH 3HG1D 3U9UB 5IOPA 1P7QA 4U1GC 2GKIA 4JFFD 2J88H 2C3HA 5IR1B 3OJMB 2UVFA 1OGAB 1J12A 2BHYA 5I66B 3OHXA 3PWLA 3LKPA 4W6YB 1I3RB 3QDJB 4LLDA 3GJFB 3MV9A 1CXFA 3TBVA 5IQ7L 4JDTH 4JZOB 4DUWA 5FO7B 1CWVA 2NQCA 2Z31C 1D5MB 4M1DH 1JZ2A 3BN3B 4AIZA 2H9GA 4PJ8D 1A3RL 3U46B 4P2QB 5CMAB 5ID0A 4OZGB 1FPTH 2H6PB 4V2CB 5DT1H 4OZIF 1AXSB 4PG9B 1RUQH 4CBPA 3KS0J 1TVHA 4FP8L 4DUXA 4G9FE 4NC0B 4HBCL 1Q9KB 2CKBL 3VDAA 3I6KA 2QQLH 2J4WH 4ORZC 1DE4B 3KLAB 5E5MA 3VH8G 4D0BA 4UOJA 1F4XL 3FRPA 2YPKA 3L3KA 3QNZB 4LP5A 2ICEA 4JFQA 4Y4HB