4X7DC

Crystal structure of 2012 nsw gii.4 p domain in complex with nano-85
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
116
structure length
105
Chain Sequence
DVQLVESGGGLVLSCAASGSIFSIYAMGWYRQQRELVASISSGGGTNYADSVKGRFTISGDNAKNTVYLQMNSLKPEDTAVYYCKREDYSAYAPPSGSRGRGTQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords VP1
publication title Nanobody binding to a conserved epitope promotes norovirus particle disassembly.
pubmed doi rcsb
source organism Norovirus hu/gii.4/sydney/nsw0514/2012/au
total genus 20
structure length 105
sequence length 116
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x7dC00
4HFUH 2CK0H 3HB3D 3EFDL 1I8KA 4P4KB 2LTQC 5EOQL 3OHXB 5HGAA 3MXWH 3QUYA 1MJJA 2YUVA 2I5YH 2APBA 4N68A 3FCTB 4HUXB 5GGTA 2J8UA 1SJEB 4LCCC 1FZOB 3SE8H 2DTML 3QHZH 3HRZB 5T1KA 1OY3B 3DSFH 2HKFH 4OBSA 5DO2C 4KKNA 4J3VA 3EBAA 4NGHH 4M6NH 2FR4B 4PB9H 2KQMA 4XVUD 3V8CA 1JI1A 1EAJA 1CE6A 3GSQB 1MREH 3W81A 1G9EA 2XQYG 2UVFA 4OZFG 1A6ZB 1UKSA 3A6CH 3BXNB 2YK1H 1HKLH 1M4KA 1VFBB 2VXUL 2IFFH 4K2UL 1S9KC 2G5BB 3T0ED 4X4ZA 4ZNCD 4JZNA 5GPRA 5I8KL 1YJDH 2XV6B 4K7PY 4P3CH 1FGNL 4N1HB 4IBLT 2QQKH 3OMZA 3V79C 5DEGB 3IDMB 1AXSA 1XF3B 3GGWB 2Q8BH 4ODVH 4HXBH 4H1LH 2IJ0C 4DEPB 4ZXBA 4ZFOB 1ETZB 1UA6L 3BKJH 2C3WA 4K3DL 1NBQA 4OUOA 4FQCL 3S88H 1JNNH 1U8IA 2Z8WC 3QEUA 5F7LB 1CDCA 1CL7H 1NLDL 5F7KC 1J88A 3TV3L 2QADC 4JRXA 4XXDA 1DDHA 2NXYC 2CH8A 4RGNB 4KAQH 3W11C 3CCHB 4UQ2A 5DD3H 2FLBT 3FOLA 5E8DH 4LF3A 4WTZA 1U3JA 43C9B 3BUTA 3MLRL 1KV3A 5ID1B 4WU5B 4HQQL 2XA8H 3FB6A 1HINL 2BVOA 2C3GA 3RWEA 3IETB 3M07A 4WFHE 2XXCB 4OZGE 3DUSA 4MA8H 5IESH 5ELIA 2R0LH 4NBZB 2YKLL 5I1KL 1FORH 4ODXA 3D48R 2IQ9H 4Z78B 5DMYA 1W8NA 4CDGC 3M17A 3B5TA 4M61B 1KENL 3C08L 2WWMD 3MRKB 3GIVA 3VXRE 3FZUC 3ARWA 2R2CA 1YYMH 4G8IB 3VWKC 5L2KA 2BNRA 2QLVB 1EGJA 3VW3L 1IM3A 4JFEE 3U2SB 1WCQA 2YWZA 3L3DB 1IAMA 4ALAL 2DQEL 4NM4H 1ZLVK 4JPVH 2DLGA 3MJ9L 4UDUA 1GHFH 1J5OL 4NQED 4XCFL 4X5WA 5ADPL 1WICA 1CDGA 3FQTB 3GB7A 3OGOE 4MAYB 2XT1B 3MGOA 1AGDB 3V52H 1MQKH 4MA1B 1LGVA 1OT2A 1U8NA 3SPVA 4P48A 1AGCB 3HMXL 1PQZA 5E8PB 1MNUH 2I25N 4OIBA 4FABH 5M94B 5AD0B 5C09E 4OLUH 4WO4D 5EC1A 4PP2B 1BQSA 1B4JH 3RI5F 4MB4A 1JRHH 3ZYOA 4D8PA 1NMBL 4A2LA 1NCDL 5FCUL 3GI8H 4YC2C 2FJHA 3NIGE 1A4KB 1OD7A 3K4DA 1FIGH 1SM3L 4OZIE 4DZBA 3PGCA 3MO1A 5FYKL 4NO0D 1WK0A 3QIBD 3KPSD 5IEKA 1KPUB 4CJ1A 1NC2B 4PJ9A 4PJCB 2BVQA 1X7QB 4WY7L 4XNZB 4B5EA 1D5IL 3ARYA 1RK1A 5GRUH 1YQVL 1R3IH 3O3EA 1CE1H 1A7BA 1P9MC 2AERT 4OB5H 3RVWC 1GIGH 1Z9OA 2LQRA 5M95B 4Y4FC 4PJEB 3VI4F 3TIDA 4EBQL 4EI6B 3LDBB 3MRGB 4QRTB 4XH2B 2W38A 3T0VA 4C4KT 3QQ4A 5ICYA 2AQ1A 3VH8A 3GHEH 5SWZA 5LBSL 4J6RH 5BV7B 3QWQB 4JKMA 1QQDB 3TT3L 3VFTB 1NSNH 3GO1H 2YPVH 3MUGA 1AO7A 5DD6B 5BW7A 1G6VK 1P1ZB 3FO9B 3QUYC 3MV7D 2H3NB 3SDDA 4YXHH 2FYYB 3MR9A 2BNUB 4F58L 1MFDH 1HYRC 1RZ7H 4Y0GA 1U8JA 4U1HA 3L7EA 4G6FB 2A6JB 1UG9A 1EX0A 3GBNL 2EDBA 3MYJA 3OPZH 3JV6A 1TPXC 4L4VA 1OGAB 4M62L 2WANA 1YEIH 2YD9A 1ZLWK 3RWIB 5T1LD 4M03A 4I18B 3MZGB 4MS8C 3D9AL 3DI3B 1BOYA 2H1PH 5F89A 2XN9D 1JWMB 3CSGA 5IMOB 1EDQA 4XTRD 1PLGH 5TFSH 4PR5B 3QSKB 1FAIH 1CZ8L 2IPUK 2NYYD 3QDGE 1JGEB 4LSPL 1S7UB 4XNQB 4NOFA 5C92A 5D6CB 4K94C 5IMMB 4PJGB 4XCEB 3O6FA 5C0BD 3DO3A 3ARGD 3N1PC 2FD6H 3T1WA 4J3TA 3O2VH 4ODUB 2EH8H 4KHTH 2G9HA 5SV3A 3V7AE 4ZXBC 5T3ZE 2NLJA 3VXME 4ONFL 3NFSH 5A2JH 1I1YA 3UJTL 5I30H 3T77B 4YQXH 2OTWA 4PRHD 4PJCF 1N59B 1AY1H 3ZE1F 4MDJB 3NIFF 5FDYA 5HBBA 2DRUA 3BRGC 4NZTH 5LAXA 3ISWA 5ANME 3WFDH 5C0AA 4NNPH 1RVFH 5KSAB 4OGYH 4PJEF 3VCLB 2Q1EA 4ZO6A 2MQ3A 3MJ9A 1F58H 1EEUA 2VZ1A 1N5YH 3SE4A 4JG0H 4ZD3L 3HCVA 4TTGA 5F44A 1KCLA 5I75B 1OLLA 1WC7B 3H9HB 5LCVH 2HTLD 1BLNA 1NMAH 1I7RA 1B2WH 1O0VA 2Z8RA 4JY6A 5HHVL 1PSKH 3L6FB 3NBNA 1HYSD 2P7TB 2XRAL 1QVOA 2ZOKB 4R26H 4M7ZC 5CKAA 3HMXA 3DMMB 3CFEA 4HIJB 3UC0L 1Q9LA 1EZVX 1OAXH 4Y4HB 1JV5B 5F6IB 3KYNA 2R56L 5ILTH 1LO0H 3DV4B 5J6HB 1MHHB 2JJUA 1EJOH 5B38A 4R97B 5BZWB 3SDCA 2EH7L 5C71A 3T0BA 1S5HB 1SYVA 3IS0X 3VXTB 3U46A 2EYRB 1QRNB 4WUKH 5D4QA 4M3JA 2CXKA 2DLTA 1ORQA 3B2UD 2DYPB 2UY7A 4LSDA 5IFHL 2R2BB 4F37F 4KKLD 1XCQA 1ZT4A 4XMPH 1NGPH 3MRMB 3UJIH 3B9KB 4JJHA 5K93A 3PL6A 4U2ZA 2HJKA 2WK2A 2IALA 5D72L 2AXGA 3C6LD 3FT3A 5CEZL 1ADQH 2B4CL 1S7WA 4OD1H 5IKCA 5L0QC 3GHBL 3NFNB 3BQUA 1T1ZA 4O58L 1FVCA 3I3DA 4PJGF 5CBAA 2R9HD 3QDMD 1YZZA 1NCCL 2AKRB 2EO9A 3BESR 4CU8A 2DJSA 2DQIH 3FHQA 4M7LH 3FN0L 1AQDB 1NC4A 2X1PA 2X70A 3ZYZA 3UPAA 2F5BL 4Z7UE 4TYUA 3F6IA 1C16A 3I50L 1RJYB 2GK2A 4NN7C 1TIUA 3B8SA 4PJ9C 1WITA 3ULUF 3FFDB 3QUKB 4JN1L 4JKKA 4LLYA 1CGXA 3IGAA 1YUHA 3DVNA 1KFAH 1JJUA 2DIBA 5L7XL 1ZT7B 2PTTA 1FO0B 4LCUB 2IH1A 3FMGH 3KPRB 5KVDL 4Q7DA 1ZGLP 2XWJA 3EOAB 1I9RH 3C5JB 2DM3A 4N8VG 1BBDH 5TDNA 1EZVY 4OM1L 1ZE3C 2YN3A 4KRPD 1K4DA 1R3HB 4S1QL 5CZXD 2HTKC 3DYOA 5I8CA 4M5YL 3FQXA 4FZEL 2MHAA 2WIMA 3SDDC 4PJ8D 4KVCL 1KELH 5FYLH 2MCPH 3UAJD 3CFBB 5C0NC 4L8BB 5C0JB 3W5MA 2HMID 4QCIA 4G9DB 3NA9L 1ZKAA 2R0WL 2CUIA 4NHCH 3G6AA 2VABA 1Q0XL 2ZOLA 2E6QA 1H8SA 4BH8B 1A6UH 3O41A 2FO4A 1I8IB 3LEYL 2X9WA 4OBRA 3TVMC 4HMCA 4MQXC 5A2LH 1B90A 4HPYH 4F2MB 1MHEA 1J8HB 2NW3B 2IAMC 3O4LE 3TGXA 5J56B 4OFVA 4CDHA 1OAKL 4ISVB 5LVEA 4H8WC 1NGWA 1BD2E 4JFYA 2HN7B 1K3IA 1A2YB 4O02L 1OTUD 1S9YB 5TQ2H 2X44D 4HKXB 3O6FC 1CLZL 1SHMA 4RMQA 5TGBB 1QBAA 3EO9H 5TPWL 4RAVB 3GI9H 5GSVA 3LS5L 4Z8FL 1J1XH 1RK0A 2DWDB 3U36B 4HT1H 1F42A 3NACL 2NY1C 3WV0A 4LSTH 2EXYC 2Q7YA 3QQ3B 1TTUA 5C8JA 1YN7B 1QSEA 5JW4R 5HPMB 3GNMH 2CR3A 4OTXL 1D6EB 5E2JA 4AZ8A 4JPIA 4XWOC 1RMFH 4YHNA 4IRZH 3T1FA 5IV2B 3IDNB 5D7SL 2IG2L 3R4DA 4IM8A 2VXSH 2AAVA 4U0RC 5D5ME 4G9FD 3QJFA 2Z31B 1EUTA 4TUOA 3QIUC 2CLVA 4NO2B 1INDL 4PJXB 4LEXL 1MFCL 3CSBA 4R7DB 5DC0A 4I3SH 4KTDH 1KBGL 4R0LB 5I2IA 2E27L 4ZSOB 2YD8A 2ARJB 3K74B 4JHWL 3ZDZE 2IFGA 3DVGA 3MLVH 1H5BB 3MUJA 3FCTA 4G43B 1W8OA 4HUXA 4DFIA 1G0XA 2W07A 1FZOA 1UXSB 1ZLWH 4RWYL 4ZPTB 1I9IL 2F58H 1IAOB 3VGEA 1QLRB 3WCYA 4HUVA 2R29H 2IBZX 4NQVB 2UZIH 3GMQB 1RZKL 4D3CL 4XC1L 2OSLB 1RZFL 5IROA 3BZEB 1U41A 1QA9B 2FR4A 2DMCA 2B7DT 2LE9A 3SJVE 3EO1B 4PYHA 1SMOA 3GSQA 3QQ9D 5BV7L 3CFIC 1C1EL 3QXAA 3T04D 2YXFA 5D70H 5IFJA 5IHBA 4JQIL 3BN9C 2P47B 4C56B 1JGUH 1VFBA 1V3MA 4L8DB 3VFVB 3BP6B 1FVDB 3I75B 4YR6B 3TFKD 1XF4B 1ZLUK 3H8NA 5E56A 4R6UA 3U4AA 3CFKB 2XOTA 1YNKH 2CJUL 4X9GA 1TDQA 4JFXA 1CS6A 3IDMA 5DEGA 5CJQL 5C07D 3GGWA 5F9WB 3WFEL 4YHYB 3ZT6A 1FC2D 1Z5LB 3CFCH 5IGXL 4LPUA 4E0RB 4ZUTA 3W5NA 1S9XA 5DZOA 1ETZA 1NUDA 5H8DA 5J3HC 4EJ1C 1U3HB 4JO1H 3F62A 1YEFL 2OXGA 4PV9A 5ICXB 5E1HB 5IB5A 4GMTL 5E24E 4PJAE 3MV8B 1WVZA 1MCJA 1YEKL 5SV4A 4GKSB 5HHME 5A16A 3CCHA 5DWUL 1GH7A 1Q94B 3LN4A 4X7TA 2DD8H 3VA2C 4IOFD 1F45A 5I17B 5GGQL 1MCIA 1A7OL 3FT2B 4QRQB 2A1WL 2BDNL 1E4XL 4UBDD 4Y4KB 5CZVL 4WU5A 2J2ZA 4JO2L 5IM7B 3STLA 1JPGA 2HFGL 3IETA 3PDOB 1TQBB 2NXZD 3CVIL 5MERB 4N0YH 3RNKB 5GRXG 1KLGB 4Z78A 3SE3A 3MRPB 3ULUL 2K1MA 2NY0B 5IB3A 3T2NH 2JE8A 3EDJA 1DQJA 1ND0B 1OL0A 2YZ1A 3HG1D 4JM4H 3ZKMC 1KTLB 4POZD 4C55A 1ULVA 2Y07H 4L1HA 4O2FB 1MCPH 2P8PB 5CKGA 4RFNC 3U2SA 1HZHL 3V6FB 4JRYE 2O5YL 4XPAL 3CX2A 3H0TB 4TVPE 2VXTL 4J4PD 4U1GB 5J1SC 4HIHB 5HY9B 1UB5B 4TNVK 5B4MD 1FNSH 3V4PH 3W0WE 2VDLH 1MEXH 4MAYA 5B8CA 1AGDA 4LL9A 4D9RD 1N26A 1Y0LB 3RJQB 1JPTL 4ZOBA 1E4KA 3RPIB 2F53D 1KJ2H 1X5AA 3LEXA 1AGCA 1YECL 4BSVB 1QKZH 3HE6B 5FYJH 1F4XH 1OAQH 2OJZH 2CRMA 3GKZA 4PG9A 4HJGA 1JIBA 2PO6B 4TVPH 4YDIH 4XP9L 5K9KB 4Y5XB 2GT9B 3KXFD 4N8VB 3U0WL 4I2XE 3TA3B 4RZCB 4JFQB 4H26A 1UKTA 4ZFFA 3MMEB 2J5LB 1VEOA 2DI8A 1IMHC 3S9DB 3QHFL 4UT6L 4AYFA 2VNCA 1WF5A 2MQCA 3HNSH 4I8DA 3EDFA 4MJIA 1KJ3H 5HI3D 4MJ2A 4MZ2A 3CMOH 4NWUH 3U4BH 2I24N 3MOBH 4YHOL 3V4UH 4PJCA 4ZMAT 1CFBA 2EE2A 4O2EB 1ZHLB 4DGYH 3BGAA 2O61B 3WHE0 3JWOL 3PWLA 5I1HL 3AREA 4WI5A 5C0FA 3VRLE 4CL7A 4PJEA 4NUJB 4OLXL 1TQCC 1BOGB 4EI6A 5JW5B 3MRGA 4PTTB 4QRTA 1JVKA 5JXEA 1T1YB 1T7WA 2AEPL 1ZANL 3RVTD 4LGPB 3CPLB 3WUZA 3WKML 3WO3B 4LSVL 1ZWIB 1CTNA 2OI9B 1Z0MA 1HSBB 4P4KC 1QQDA 3VFTA 3PWPD 1GOGA 3CZFA 2WUCL 3PGFH 1CLOL 3OKNB 2P5EA 4HG4K 2X6MA 1TVHB 2H3NA 5DS8B 1ED3B 1MFNA 5MEQB 1IILE 1ODAA 2B4CC 3QZWA 3V0WH 2BNUA 3RX8A 2YRLA 1FO0L 4TPRL 2IADA 2WW8A 3IAPA 3QR2A 4K94H 4QRRE 3QUZD 4NQXA 1RUQL 4I48B 4ZQKB 3SKUD 5FGCE 1T1XA 5LG1A 3U9UB 4LSUH 3CLFH 4NQEB 5DQJB 4P2QD 3OJVC 5CGMA 4QRPD 1CFSA 1LO3H 4LIQL 4OZHE 4KK8D 1N7ML 5DC9B 3LHPL 2PYEB 4N0UB 1ZA3A 3T8XB 3QISA 3QWRA 1JWMA 3FB8B 3EYOB 5IMOA 3EFFB 5DT1L 5EU7E 1TTGA 2YHGA 4CBPA 3WFBL 5I6XB 1JGEA 4TN9A 3R1GL 4N0RA 1S7UA 3QCVL 4KTYA 1JNJA 4XNQA 3CVHH 1T20B 5EWIH 3NMEA 3P0VL 3OKMA 4F9LA 5IMMA 3V6BR 2MJWA 1IGCH 4XCEA 1W0VA 3BPCB 4MX7B 5EUOE 4LEOA 5HYJD 2DM2A 1YMME 4ODUA 2FX9L 2NX5E 4EUPA 4Z95H 4DEPC 1BJMA 1DL7H 1CFVH 2K7PA 2F54D 4JN2B 4MCZB 2C1OB 3QIBB 2OQJB 4NC1C 3GSWB 3T77A 3D25A 3N1GC 4M93B 3VFRB 2NCMA 1H9VA 3P30L 3QXUA 4MDJA 2UZXB 4NKOB 3EO0A 3RHWK 3ULVC 4RGNC 1F11B 1G9MC 5LGKA 1WUNT 3L5XH 1YMHB 4WV1A 3OSKA 5KSAA 5DUBB 5IVXB 3TWCH 3VCLA 2Z92A 3WNOA 4R3SB 3JZ7A 4LLQB 1K8IB 4IRSC 4PV8A 5F7FA 1WC7A 1JTTA 2FWOB 4HS6B 4OZFA 4BUHA 5CCKH 4QWWC 5DSCB 3L6FA 4DN4H 3WNMA 2ZOKA 4WW1B 2JK5A 3I9GH 3TCXA 5KSVB 4LHUB 2RR3A 4NKMA 3ZMRA 4RX4D 1IEHA 3DMMA 4MXWH 3MV7B 4HIJA 3GKWL 4R90H 1VEPA 1MJUH 2DBLL 3CSPA 1IC7H 1JV5A 1O5DT 4UT7H 5TDPA 4JFHD 3AMLA 3KHQA 2YMXL 3HNVL 1P4IL 1WBXB 2DQUH 4YDJB 1JCKA 1MHHA 4YHIB 3BP5B 3QFJB 1FYTA 3G5YB 4X9BA 5EORL 5BZWA 4HGMA 2R2HB 5JTWA 5CJ5A 4QY8A 2J8OA 4Z7OF 5KVFL 3VXTA 3RBSA 2EYRA 3WHXA 1M1SA 3P0YL 5C6PB 1FH5L 3DTXB 3MLXH 3MRMA 2O5XH 4XNYL 3GSVA 1E4KC 5J06A 2D03H 3B9KA 2QSVA 5EOQH 2IBBA 1NPUA 3WLWC 3L7FA 1ZLUH 4CRPA 2XWTB 4GBXA 1FVEB 2Y5TB 5H94B 5MI0C 3JWNC 5C08D 3S34L 3ZT5A 4FQ1L 3ZKND 3NFNA 1UCBH 4W4NA 4LHJB 4YGVB 4J1UB 2AKRA 4HKBB 4Q9RH 5DC4B 5IJKC 5DEFA 1AE6L 4G5ZL 5K9OB 1KJVB 3BDXA 4L4TE 4HW6A 5EB9A 4PJIE 5D1ZB 1F3DJ 4RFEB 1AQDA 1PYWA 2P5WB 2YD1A 1GGCH 5A1AA 5EBMB 2VZSA 2PKDA 2HP4A 4FQLL 3H9SD 1S5IH 4O4YL 3OAUH 3FFDA 3QUKA 4AEIL 4XNZC 5I8KH 5EU3B 2X4PA 5J0BA 1Z3GH 1ZT7A 1FO0A 4LCUA 4NQDB 1UYWL 4Z0XB 3FT4A 4TSAH 3WFHB 4ELME 1RZKC 5HHNA 3EOAA 4RISH 3C5JA 5IVXF 3LDBC 4KI5F 1KB5B 1P6AB 5BRZA 2DL2A 5JXEC 3AM8A 5GZOD 1AJ7L 2EECA 3JVGC 1IARB 1IGTB 1R3HA 2XNAB 1TZHB 3O2DH 5DK2A 3V8OA 4MNQE 5F96L 4LU5H 1NCWL 1T21B 4HKZB 4X5XB 3TBVB 4D2NA 1A22B 3AB0C 4NN6B 3CXDL 4OGAD 1FE8L 2W65B 1WZMA 4K7PH 1IEAB 4H8WH 4AIZB 1WZ1L 1M7DB 3B9VA 3MRHB 5DJCA 5C0JA 3KLHC 4G9DA 4NZRH 5IIEB 1DE4A 5KVEL 2WP3O 1HXMA 1G7MA 1ZOXA 4LNVA 3PQYA 1SJHB 4TULH 1JNLL 4BH8A 2YPLD 4LAJH 4I18C 2DLHA 4PJ7B 2VLRD 1I8IA 3VXSE 1TJGH 3DBXA 5ADOH 4F9PC 4HUUB 5EC2B 5DMIL 2CKBH 2J88L 5DVNA 3W9DB 4FTVB 4F2MA 1J8HA 5A3ID 5JMOC 4GUPA 3G6DL 1NKRA 3LPFA 4HDIA 4IOSD 4ISVA 1V3KA 1QR1B 4P2OD 4TRPL 1KCUH 2HFEB 1HQ4B 1N6VA 4GW1B 3U30B 1TVDA 3WIIL 1A2YA 1ZHBA 1S9YA 1CQKA 4O2CB 4HKXA 5AYUL 2XKSA 3N1QC 5BVPL 5TGBA 3KPMA 3BIKB 4RAVA 3S4SG 4UV7L 4X80L 3QEQE 4KFZC 1UH3A 1MRCH 2DWDA 3U36A 3WXWL 4MGXA 2DJUA 4GG6B 3ALXA 4HS3B 3QI9D 1OTTD 1RZJC 1LO2L 3MRRB 4XVJL 1YN7A 4N0CD 2DM4A 2Y23A 2DOCA 5HPMA 2B8OT 2I27N 1EEQA 2N7BA 3O6KH 3GUTB 2EDJA 2EO1A 1PG7L 3JUZA 5I9QB 3MRFB 5E94A 3VFUB 2HKHH 5E6YA 1GZPB 5IV2A 3IDNA 5DRNA 2BP3A 3D2UD 3BP4B 5KSAC 2V5YA 2QSTA 3UTQB 1Q0YL 4CN4A 1TJIH 3N06B 4NO2A 3UZEA 2XZQL 3DXAA 5I75C 2ZCLL 4ONHA 5DFWH 1DR9A 4PRID 1F4WH 1IBGH 4R7DA 5HHOD 2AK4E 4R0LA 4G8GD 4X6BA 3TYGL 1YNTB 1A6VL 4ODSH 1K5NB 4XP4L 3DMMC 4ETQB 3V9FA 3EDEA 4LCWE 1FZKB 2H2PC 3BIBX 3RA7L 3MODH 3TNNB 4Y4HC 5C0CB 1K3ZA 3FN3A 1GGUA 4PJ5E 1H5BA 1I1AA 5CEYB 3U0TA 4G43A 5F6IC 4JGUA 3BZFB 3RBGA 1UXSA 4HHAA 1AHWB 1YYLH 1IAOA 4R97C 1QLRA 4TSCH 4H1LG 4NQVA 3GMQA 1S9VB 3MLSH 2OSLA 3PUCA 4PGJA 5BO1H 1IM9B 4WWID 4FQQB 2W59A 5D7JB 3BZEA 3TO4B 5FO8B 1QA9A 3C2SA 2AJ3A 3MACH 5HDQH 3WJJA 4YZFE 4PJ7F 3EO1A 3VFMB 5LBSH 1W72H 4YE4L 5DA4A 3Q5OA 3B9KC 4HWBL 3MQIA 4C56A 1BF8A 4L8DA 2RGSA 3VFVA 5DD0L 3I75A 4YR6A 5C6WH 1UXWB 3U4EA 3JWOC 4UTBL 4N90D 3CFKA 1H0DB 2X9YA 3ARDA 3MV11 4LCYB 3KDMB 3ARBD 5E8EB 4QLRA 5I19L 5DI8B 3SCMD 2Q3ZA 1JI2A 2FJFA 3E6FB 4YHZH 4Y1AE 5DA0B 5DTFB 3QULB 4NRZB 1Z5LA 2WM0A 5I1DA 3B4NA 1ZV5A 1AXTH 4AMKL 5JQHC 4E0RA 4GG6F 1GOHA 4DZ8B 1U3HA 4QHKJ 5KSUB 3JSSA 4KK5D 1SEBA 2ENSA 4YXKL 2WWKO 5ICXA 4WFGD 3TZVD 3SE9H 3DUHA 5E9DB 5IVZB 1JWUB 4BSWB 2IGFL 2DDQL 4GKSA 2YXMA 3B6SB 1HILB 1Q94A 1JN6B 3U82B 5I17A 8FABB 1WQVT 4CN6A 4QRQA 1JZ3A 2V9RA 1FV1A 3RL1B 5BVJB 3GEWB 4TUKL 1MWAH 1M6OB 1E28B 5IM7A 4P2RE 1HHIA 3GMMB 4YJZL 3RNKA 1A6TB 1KLGA 1E6OH 1HHJB 3E2HB 1A7NL 3HE7B 5BJTB 4KJQD 4QTIH 4JFDD 2JF1A 1DBMH 5DO2D 1D5XB 2MKWA 1AD9B 4XB8A 4LSRL 4M4RA 4M7LT 5E7FA 1JGLH 2DBJA 1IFHH 2P8PA 4O2FA 4EN3B 1SYSA 4X98A 5TE6L 3V6FA 2FBJH 4X6DE 1T0NA 3L1OH 3EOBB 3L3GB 1T3FB 4HIHA 5HY9A 2DQCL 5EO9B 5GGRA 2I9LB 5H37H 3PNWB 3RGVB 5C7XH 3QWOB 5J4MA 2YA0A 1Y0LA 5FA3A 1QBLL 3T0XA 3RPIA 1E27B 1WSST 4K23L 3E1F1 2VAAA 3D5OF 4BSVA 1J86A 3UC0H 3UX9B 3HE6A 3G08A 3N50A 2YBRB 3HRPA 1CF8L 3T0EA 4CNIB 1JHKH 1UACH 5K9KA 4Y5XA 2GT9A 4N8VA 5K9QG 3IDIB 3B2VL 3HZYB 3QJHB 1RZGB 4JFQA 1RQ5A 4F7EB 4YWGL 4XWGL 3MMEA 3PWJB 4XGZA 4XNMB 3WL9B 1QOKA 4L5FH 3EYFB 3CNKA 1UVQA 3KPNA 4BM7A 3OZ9H 2ORBH 3FN9A 2AV1B 1LP9B 4B50A 1CGTA 5GZNC 1ACYL 3QDJE 3BPLB 1T89A 4AL8H 5EN2A 1KGCE 1T83A 2NXYD 3O6MH 3BKCH 3W11D 1DP0A 5T5FH 4U7SA 5CP3A 4OM0L 3H3PL 4O2EA 1ZHLA 4WWKD 1A5FH 3MRQB 5IOPA 4MNGB 4NJAL 3IDUA 1MPAH 3UO1H 2P8LB 4PUBL 4NUJA 4OLYL 3D85B 1D6VH 5JW5A 3HNTL 4ERSH 4PTTA 2Z31C 1S3KL 4R7NB 1T1YA 3PHOB 5CMAB 5GS1A 2YS4A 3CPLA 4FXGB 3SDXA 3BPOB 3FZUD 3ECBA 2BSED 3VWKD 5DJ0B 4K3EL 1IT9H 5EBWB 4GAGH 3EGSA 3DSNA 4HWBA 3CC5B 3OKNA 1TVHA 3GJFK 4I77L 3KAAA 4LLMB 1ED3A 5MEQA 4LOUD 1H5BC 4J3WA 1D5BB 3BKML 4RMSA 4XCNA 4MZ3A 4U49A 4Z0BH 3HAEG 3U1SL 1N64H 3OR7B 2Y36L 3S4SB 4ZQKA 5GIRA 1P7QD 3CUPB 1V3JA 1KB5L 2ARWA 1JPSH 3BISA 2DJ4A 3WJJC 5I1EL 1F2XK 4M8QB 4NQEA 4QF1B 5DQJA 2GFBA 5C0EB 1QHOA 5EZLA 3QUMB 2I07B 1VERA 4Q9BA 1A4JB 1LWRA 3P4LA 4N0UA 3T8XA 1KCVL 2H26A 4GSDL 3FB8A 1KACB 1EO5A 1H15B 3CK0H 1UM6H 5DRWB 4U31A 4UILL 1BP3B 4WO4A 3CU7A 5T1DL 3ULVH 5DMJB 5DJ6A 1G9MH 3VRJB 3V5HB 1MRDH 4IDLA 4KPHH 1G7JB 4ZYKA 4WI6A 4GQ9H 5F9WC 3QIWC 3BPCA 4EEEA 2WAHA 4YHYC 4DFHA 4PGEB 4G3YH 5FYJD 1SVCP 2X1OA 4JDVB 5D7IE 1LP9F 1H3UA 4QKXB 4XPTL 3SQOL 4JN2A 1U3HC 1I3GH 4NO0A 3QIBA 3KPSA 2DS4A 2D31B 3GSWA 3O2WL 3RVWD 1H8OA 4PIRF 5BMFL 1Q9OB 4Y4FD 4I3RL 3VFRA 1BQUA 3FB7B 4HXAL 2NNAB 2E6JA 2VITB 1OCWL 2HAZA 1PJ9A 4H1LB 2HFFB 4QT5B 1MRFH 1FFPB 5EZIH 2E6PA 4P2CG 1DQQA 1CCZA 1FPTL 4P3WA 3T09A 4IRJB 5DUBA 5IVXA 4YAQB 1K6QH 1HI6B 2CPCA 1PGRB 3RPKA 4Y4KC 2CIKB 5C0IB 1K8IA 4X6EB 1T5WA 3X11B 3QUYD 2VH5H 3PABA 3OKEB 3KR3L 2FWOA 5DMGC 3D69B 3QA3A 4FNLL 3D1MC 1TQBC 3E6HB 1ONQB 4ZNEE 2X4NB 1YEEH 3PWPB 1FNEA 5KSVA 1HHGA 2WUBH 1BZ9A 3DX9B 5FDWB 4F57H 4L8SA 3MV7A 2GYSA 2NY0C 4LPYA 3IFOB 5E99H 3ARTA 2X4SB 1CG9A 1KTRL 1WBXA 5C0DB 5DK3A 2D2OA 4MS8D 1QUNA 2IG2H 3QUZB 4ZUUB 2R2HA 4NNXB 1P7HL 4OI8A 3E3QC 5EO1B 4XBGB 5T3XL 1FBIL 5IQ9A 4PD4J 1G1CA 3CX5J 4PJDE 3O45A 4PRAB 4OCXL 4O9HL 1BREA 3QT2A 2I26N 3MTRA 3KPPA 3T3PE 1C5DB 3TO2A 4HZLA 5KW9H 5I15H 3DTXA 3MV9E 2XN9A 1FFNB 2E27H 1D9KB 2P44B 4MVBC 3MC0A 4WW2B 1MCKA 2XWTA 3LKNB 3HE6C 4DAGL 2Y5TA 1CDIA 4XRCB 5H94A 4OZGB 4JRWA 4JHBA 4FQIL 2PO6C 1ZAGA 4MCYA 1XGPB 4Y5XC 4RWYH 5C9KA 1RFDH 3TNMB 4G6JL 3TA3C 2AXHA 1JF5A 1RHHA 3QO1A 2YA2A 3VXRB 1H8NA 1LHZA 3ZTJH 4NWTL 5C0BA 4YGVA 2J5LC 4J1UA 1L0YA 4LLDB 4HKBA 5HYJB 1AGFB 1MCWM 1ZTXL 3UZVB 5DYOB 1N2RA 1KJVA 1N6UA 1X5KA 4JFEB 3M8OL 5D1ZA 3RX5A 3K46A 4RFEA 2D7TH 4G6KH 4NFDA 1T83C 4MMZC 5EBMA 3V6OE 4LCIH 4EDWL 2J6EL 1JGVL 1X5LA 4LARL 3ROOB 1F3DH 1VB9A 4I5BA 3MYZA 1P4BL 4PTUB 5EU3A 1OAUH 3MRNB 4JFPB 1FFRA 5IHUH 4NQDA 2C7UA 2E7LA 4Z0XA 5EIIB 2Q8AH 2CJUH 3VFGH 3WFHA 5C09B 2OTUB 4P59L 3SKMA 1T1WB 1KB5A 1F6LL 3UTSE 4HPOL 1Q9WB 1U0QA 3D0LB 4RFOH 2XNAA 3S96B 1TZHA 5I1GH 2OI9C 4N8CH 1JMXA 2ZG1A 1MHPL 4KXZI 1I7UA 2DIAA 4HKZA 4X5XA 4RBPH 4AEEA 2PW2B 3NCBB 2W65A 2LU4A 4KY1H 4XX1G 5IHZB 4OZIB 4AIZA 3NPSB 5EA0L 4MYWB 1M7DA 3ZKXB 1FLRL 3MRHA 2CIIB 4OLWL 2QQLL 5IIEA 1LO4L 3LB6C 3OKDB 4YK4B 1F8TL 3MRIB 4X5LA 3FQUB 4YBLB 5GHWH 2V5TA 2QEJA 4FMFA 2XA3A 1CLCA 1E4JA 1G7PA 1N5AA 4NM8H 4A6YB 2HFGH 2ADFH 1V8HA 4PRDB 4HUUA 1HH9B 3MXVL 1EVTC 1RZJH 1UZ8A 3W9DA 1CFTB 4RGOL 4YHLL 1BQLH 4NO3A 4BH7B 4WW2F 2L0DA 3SDYH 3C8DA 4OZGF 1QR1A 1E4WH 5CJ8A 5I6XC 5IQ7L 1XGYH 2D7OA 1V3LA 3C8KA 5SWSB 4HK3J 1HQ4A 1P7KB 4EXKA 1DBBH 5I1JL 3KWWA 3LKQA 1C5BH 1CYGA 3B3IB 4O2CA 4DKAA 3PJSB 1IKNA 3EW3B 1RZ8B 2IQAB 3BIKA 3LD8B 1WT5A 3EYUH 4IHOB 4X4ME 2E9WA 3OG4B 2GK0A 5I16B 3ZT7A 2ESVE 1TFHA 3HKFA 1LDPH 4LASL 3MRRA 2XZCL 5I1AA 4XHQA 1QFUH 5E4EB 4M93C 2RCSL 1E6JH 1EAPB 1MI5B 3ULSB 3WNPA 3GUTA 3HA0A 4J3UA 3RDTB 3HAEB 1XCTB 3VFUA 5H35B 1LEIB 3EIFA 4MD4B 5I1IL 4OQTH 1Y6MR 4GMSH 3CLEL 1U8KA 1RD6A 1HXYB 3F8UB 3QDGB 3RQ3A 5TE4H 2OBGA 5DFTA 2BY3A 4KI5C 3UTQA 2HTKD 2JJTA 2YD7A 1MCOL 4NKDB 2IPUG 1R3KA 3SDDD 4CAGA 4AQ1B 3RUGE 2EEAA 5C0ND 3VFPA 2X4OB 1RJZA 1YNTA 2GHWB 4XP6L 3RY6A 1U2HA 2FIRT 3NIGF 4X9IA 3W9EB 4Y19E 3PP4L 2J1KA 4L4VD 4GKNB 1UM5L 1FZKA 2P24B 3VXMB 4PJ8A 4OZIF 5C0GA 5C0CA 2GY5A 4LRIC 1A14H 1UJTA 5KSBB 3JWOH 1RU9H 4P9HL 3ARVA 2DAVA 3BHBA 4YPGB 1AHWA 3TVMD 1CICB 3VXUE 2X9XA 4MQXD 1KEML 1QRKA 1S9VA 4X6CB 1BPVA 5DJ2B 4FQQA 4QNPE 2IAMD 3X13B 5FO8A 1MAKA 2ZJSH 2YPLB 5D96C 4KJPC 5ANMB 3MOAH 3WIHL 5FB8B 1DQDL 1CR9H 3L3HB 1OF2B 3VFMA 1NEUA 2XG5A 5CSBA 3PWUB 2GW5A 4M1CC 2C1PB 5JW3H 2DQFB 1EXUA 2J6EA 4HF5H 1M71B 5F7EH 3CXHK 3IS1X 3HTLX 1J1PL 3ZSSA 1RUMH 4P2OB 5DHXB 1UXWA 4NSKB 1VEMA 4GS7B 3WD5L 1HDMB 3GFUA 3OQ3B 3DO7A 4U1LB 2XFXB 1X5YA 2ZNXA 3RWDA 1Q72L 2UYLB 4EVNB 4HFUL 5IVNA 2CK0L 1N3NB 3TC9A 4Q9QH 4LCYA 4ZODA 2NY1D 5E8EA 1QO3B 4OFYA 1CXFA 4MB3A 5DI8A 2EXYD 3AU1A 2J12B 1NGZB 3QULA 4NRZA 3MXWL 5F71A 2GJ6D 2I5YL 4PREA 5D1ZC 1PEWA 3QUML 3VRIB 1T03H 4XWOD 3QI9B 4DZ8A 1CGSH 3FTGB 1CK0H 1R5IB 3SE8L 4NN5B 3GSRB 3QHZL 5DT1H 3DSFL 2HKFL 1A7QL 4JZJB 3QIUD 4NGHL 4M6NL 1JWUA 4BSWA 2W92A 3BW9B 1A6WH 5D71H 3BD5A 1QFOA 1JN6A 1T6VN 3OG6B 2XZZA 1MREL 3X3FL 8FABA 1T22B 2AVGA 2FH8A 2RFXB 1DQMH 2YK1L 3A6CL 3M45A 3MJ8B 1HKLL 3RL1A 4Y2DB 5BVJA 2IFFL 2AI0L 1A7RH 4MD5B 1M6OA 4AIXA 1A6PA 3Q5YA 1FN4A 5BQ7B 2VC2H 3GMMA 5DJXB 4S1DC 4GLRI 4KRMB 1A6TA 2AJVH 4NN6C 1HHJA 1FG2B 3HE7A 1K2DB 2QQKL 5BJTA 4X4YB 2PN5A 4FZ8H 4UQ3A 5ESAB 2Q8BL 1D5XA 5LXGH 4Z7UB 2VDQH 5KSBF 4ODVL 4LMQI 2BVPB 4HXBL 1YPZE 3KYKH 2V5SA 3BKJL 4DKFH 4MXVE 2ED7A 4LFHD 2XQBH 3GMOB 7CGTA 3BMWA 1MJ7H 4X6CF 3S88L 3BN9D 3L3GA 1JNNL 4HIEA 1T3FA 1VGKB 4YBHA 1CL7L 5EO9A 1PKQB 1OWWA 2C3XA 3SGEI 2I9LA 4JREB 4KJYB 3PNWA 3RGVA 1OAZH 3QWOA 4YHPA 5E03A 4I9WD 4JPWH 1QP1A 1E27A 4KAQL 9CGTA 5DD3L 5IJVB 5E8DL 3HZVA 4P23B 1X5IA 4XXCC 2YBRA 2R4SH 4CNIA 1EHNA 2AJSH 1T6WA 2HRPH 2XA8L 3U30C 2IMNA 2Y5EA 4HAGA 3HZYA 3QJHA 5J3HD 4MA8L 5IESL 3VI3E 2R0LL 1FORL 3PWJA 1IKNC 4XNMA 3WL9A 4JDTH 2IQ9L 3UTPD 4L4JA 4JRXE 3QFDB 2AV1A 1LP9A 4ZOEA 2BJMH 2QR0B 4YDVA 1A3QA 1FH5H 1YYML 4W6YB 3GDBA 1HHKB 5EO0B 4NM4L 4JPVL 5FYKU 2Q86B 5I9QC 1GHFL 4L3EE 1HHHA 5E00B 4TTDC 5FUCC 3VMOA 3FKUS 3AS1A 5E2UH 3WUWG 1DEDA 5JPNB 1ITCA 1T7XA 3V52L 2P8LA 1MQKL 3D85A 4EQ3A 1BD2B 4GRLB 3RJDA 1WJ3A 2JJTC 3HN3A 3V7MA 2BVTA 5KOMC 5D2NE 4R7NA 4HBQA 4WHDA 1MNUL 1I8MB 4TNWK 5HYSA 3WIHA 3AXLB 5LWYH 5CMAA 3A6OA 4FABL 1L0XA 5L2KE 4OLUL 2BRQA 3ZKMD 4DUXA 3QXDB 2BNRE 3L3KB 3L3OB 4KV5E 5EBWA 2YR3A 4ZO8A 1B4JL 4WUUE 2ATKB 3CC5A 1URLA 5HI4C 5B22A 5B39G 2FHBA 3CU1A 1D5BA 3HG1A 1L6ZA 3SBWC 2VISB 3CSYB 2C4XA 2AQ2A 4OCYH 1MSPA 3OR7A 1FIGL 4YFLF 3S4SA 2ADIB 5ISZD 4J4PA 1U6AL 5D7JC 3TO4C 3E8UH 3SGJC 4KK9C 4QF1A 5F1KC 5JNYA 2VXVH 3QUMA 2I07A 5IB2A 1A4JA 4HD9A 5GRUL 1VFOA 5E08H 1LK2B 3F12B 1CE1L 1FNGA 2F53A 3FRUA 3DRQB 1INEH 3O6LH 4OB5L 1GIGL 4KKBC 2H8PB 5DRWA 5C2BH 3UTTE 1MCEA 3P4MB 4XMLH 2VLLB 2DM7A 4PLNC 2YPKA 3U48A 3KXFA 5KVEH 2CDEB 3GHEL 2ZSVA 4J6RL 4OJFH 1GOFA 1G7JA 1F6AB 3V6ZB 1NSNL 3GO1L 2YPVL 1BIIA 1UZ6E 1J0ZA 4QOKD 5KVGL 1FCGA 4JDVA 4QYOB 2E3VA 5CBEB 4Z7VB 4YXHL 2IH3B 5D8JH 5KZCB 1MH5B 4MAUH 1MFDL 4KTEH 1RZ7L 3C9NB 2D31A 2E9BA 4Y16B 5JUEH 1P84K 5EG6C 3SJVB 2ZP0T 3FB7A 2WWKT 4FQXB 2YD5A 3WN5B 1YEIL 1U9KA 2VITA 3L5WB 1FRGH 1V7MH 1G7IB 4WWKB 5SWZE 4H1LA 4QT5A 5JPMB 1FFPA 3S6CA 4I13B 2H1PL 1QZ1A 4YAQA 4P4KD 1AO7E 3VFOA 1HI6A 2J7LA 2CIKA 5C0IA 2WNGA 1PLGL 4X6EA 5TFSL 2IWGA 2COQA 4M48H 5FO7B 1FAIL 4XBPB 2YC1A 3E6HA 2X4NA 1MQ8A 6FABH 5F7DB 3ARXA 3PWPA 2F19H 4U1SB 1FP5A 3E2HC 2B5IC 3HE7C 2VE6B 3DX9A 1F13A 3IJYB 3IFOA 4F33B 2A73B 5CD3B 3QAZB 3O2VL 4HWZA 2EH8L 4KHTL 4EN3C 3QUZA 1N8ZA 1A9BB 4ZUUA 3ILQC 3NFSL 4IDJH 5I30L 3HI5H 1RULH 4PJAB 5EO1A 4YQXL 5HHMB 5JOPE 5CZKA 4P2QA 4PRAA 3P4OA 4QRPA 3RGVC 4HJ0D 3T3ME 4X7EC 1C5DA 4YO0B 4QGYA 1FFNA 1D9KA 3ROLB 4NZTL 1RUAH 4WVRA 3GJEA 4WW2A 4NNPL 4PRPE 1RVFL 4OGYL 1J8KA 5HJ3B 4U4BA 4XRCA 1F58L 1N5YL 4JG0L 4C54A 1CN4A 2AW2A 5LCVL 4XZUB 5ALCH 3ZDZF 2W60B 3TNMA 1JGDB 1NMAL 1B2WL 1EEZB 3VXRA 1KB9J 1XAUA 4CGTA 1PSKL 3T0WA 1KJ2B 1PBYA 3BKYH 4R26L 4LLDA 4FP8H 1QNZL 5HYJA 1AGFA 1CFQB 4CW1B 4D0DB 3QYCA 4FQPA 3ZLQC 1I8LC 3MOQA 2GSIB 4JRYB 1OAXL 2HH0H 1LEKA 4Z7VF 3LPWA 5FHAH 3BPLC 3HS0B 1XR9B 2F54A 1P2CB 2PXYB 1VFMA 5C0AE 3ULVD 3P3YA 1LO0L 5ILTL 4RGND 1PG7W 1KLUA 1EJOL 2FSEB 4MLSA 5E8OB 3W0WB 3O0RH 5CIPB 3ROOA 4D9QD 1Q1JH 1GGBH 4MHHG 5EUKB 1OSZB 3OAYK 1OSPH 1ERNA 2Y6SC 4PTUA 3BFOA 4IRSD 3BT2H 2BXYA 4P9HC 3WIFB 4F15B 4WUKL 4E5XA 2PNDA 5EIIA 4HLJA 2X4TB 3QG6B 3BH8B 1YDPB 3WNKA 4QWWD 3S36L 1H3TA 5HVGB 4XMPL 1NGPL 4KUZH 3UJIL 1UEMA 4RCAA 5C1MB 2X5PA 3TPUA 4JPKH 4MMXC 1JZ8A 1CGVA 1OLZA 1Q9WA 4I2XB 3D0LA 1FZMB 4V1DE 3BPOC 3BVNB 1ADQL 4OD1L 1L7IL 4WFED 2Z35B 3MPCA 5DQDH 1TENA 5D1XC 4OZIA 2APFA 5GGVY 5L88H 4KI1A 4BA8A 4POZC 2ICWB 2CIIA 2DQIL 2IGFH 3D0VA 4XCYA 1QYGH 3OKDA 1JF6A 5C70A 5FYKE 3MRIA 3T0DA 3FQUA 3FJTA 4J4PC 3NCYS 2ITCB 3QCTL 3WLWD 2VWEC 4PJAF 4UIMA 2KPNA 5FUOH 2ZZUT 2VLJB 1D5ZB 1KFAL 4PS4H 4PRDA 4R9HA 1HH9A 4KKCC 1DQLH 1CFTA 4QRSA 4BH7A 3EOTL 3FMGL 5IBTH 2YN5A 3U9PH 1I9RL 3ABZA 3RWGA 3WUWB 1BBDL 4RMWA 4LSRH 5I18H 1IL1A 5SWSA 5J6GB 1P7KA 2NY7H 4PLKC 2NY6D 4KGJA 4OF3A 4KQ4H 3RL2B 1YY8B 3PJSA 3TBSB 1XGRA 3UTPE 1RZ8A 2IQAA 4JQXC 4OCWH 4PP1C 4R8WH 3GMPA 1NC2D 2FB4H 4QRRB 5MEOB 3OAZK 1KELL 5FYLL 4YNYB 3CVHB 4KRNA 3STBA 3MLTB 2ADJB 4B7IA 3H9SA 4GAJH 4HJJH 4NHCL 2DIJA 1MI5A 1EAPA 3ULSA 3KPQB 5AAMA 1CF8H 1I1RA 5ACZA 4YBQC 1I3UA 1XCTA 5JXED 4C57C 1QSFE 5H35A 1A6UL 1HOCB 4JR9H 4XNUH 4OD3H 4XPBH 4L9DA 5L6YH 1AR1C 2DN7A 3QPXH 4IRJC 2WZPD 3QDGA 1HXYA 4FG6C 4YWGH 2OP4H 1F4YH 2EDLA 4HPYL 4F7PB 2V5RA 3VGBA 2GJJA 4CVXA 3WSQH 3KLHD 5EUOB 1ZT1A 2X4OA 1NFIB 5F8RC 3U6RB 5TQ2L 1OGAD 3VXMA 4MA3B 3EO9L 5KSBA 5KAQG 3GI9L 3F7PC 5HYEA 1J1XL 4KROC 5FO9B 1OAYH 4HT1L 5F93C 5F1NA 4S2SA 2BSSA 2IPKA 1CD1A 3OXRB 2IAND 4LSTL 4X6CA 4U6HB 5DJ2A 4QXUH 3X13A 1MJ8H 3QCUH 3P0GB 2YPLA 2X4RB 1JFQH 5ANMA 3GNML 4G8FB 3VRLF 5FB8A 3TH3T 2A83B 3UXFA 1OF2A 1RIHH 4B7LA 1RMFL 5L0QB 4IRZL 1D9KC 2DQFA 2DKMA 1M71A 4WW2C 2GQHA 4NZUH 2VXSL 4J8RB 4P2OA 1XMWA 4NSKA 3NVQA 3MCLH 4F37K 1HDMA 4U1LA 3K81A 4EVNA 5E5MB 1ZMYA 4I3SL 4KTDL 1QSEE 1JBJA 2G75B 4TQEH 3MFFA 1NGZA 3BZ4B 4HFWA 3BH9A 3RWFB 3WNLA 2PW1B 3MLVL 4JY4B 2ZG3A 3AC0A 5DFVC 1ADQA 3I6LD 2F8XC 1DLHB 3QI9A 1A9EB 1TZIB 4GG8B 3U7YH 1L4IA 3MLZH 3FTGA 5HYFA 1R5IA 2F58L 1RHFA 1TZGH 5J13B 3MNWB 2BRRH 5KSAD 1J0HA 2R29L 1A3RH 2UZIL 3LQAH 3AAZA 1K4CA 1NANI 4HIXH 4JZJA 4OQ1A 2VUOA 3H2WA 4ACPA 1IGJB 5ESQB 3BW9A 1CGUA 3SEPA 4PY8I 1WWAX 5H37G 4PJFA 4D0CB 1A64A 2QKIB 5D70L 4HK3N 4QXWA 1T22A 4XAKE 1JGUL 4F8TA 3MJ8A 4IEFB 3DMMD 5CEZE 1R0AH 4MD5A 4PRIA 2H2PD 1JF1B 3CGTA 1RZIB 4Y4HD 1QFPA 5DJ8B 4Y2OA 5BQ7A 4MB5A 5HHOA 2DLFH 4G8GA 3W39B 5EUOF 5BS0D 3K4AA 4Z7WA 3GSXB 1YNKL 3G5ZA 3CDYA 4L4TB 1FG2A 3MRDA 4PJIB 4I3RH 4X4YA 3FAXA 5CLTA 4S11A 2IPTH 4M7KH 3ZYJA 2VB5A 2IMMA 2A77L 2XQYK 1OCWH 3NPSC 4P0DA 5DF0A 2Z93B 3CFCL 4H20H 1QRND 2BVPA 1ZSDB 1H3PH 2FBOJ 4YK4C 4K3HA 2DYPD 3C60B 2MNUA 4HEPG 4YBLC 1F02I 3MLUL 3B9KD 1VGKA 1PZUB 5E7BA 1PKQA 4ELMB 2XWBB 4ODHH 1LE5B 3I3BA 3RWHB 4K9EH 3DJ9A 2NY3B 4Y88A 5IUSA 2DD8L 5F72S 1SBSH 3MA7A 4MNQB 4LVHB 2QHRH 4HK0A 4PRNB 5L8LB 3T65B 3LN5B 1KJMB 4Z5RA 3F58H 4DK6A 2CKBB 3ARBA 3RKDC 4N0YL 3SCMA 1A6AA 2FEEL 3LD8C 5EU6E 2HJLA 1EA9C 3UYRH 3QFDA 3T2NL 5IW1A 1VFAB 3AS2A 2QR0A 2VL5B 4JM4L 3VD9A 4PYGA 3VI4E 5DJZB 1RJLB 2Y07L 3OAYH 3P9WB 1MCPL 1HHKA 5EO0A 3BDBA 5E4EC 3KPRD 1OP3K 3FB5A 1LE9A 1T0MB 2Q86A 2AK1H 4KXZH 3RDTC 3L5IA 3JV4B 1LD9A 3V4PL 5F3HB 5C0RH 2VDLL 1MEXL 5JPNA 2A0LC 3M1BB 3OKKA 4N0FB 8CGTA 3CDCA 3O9WB 4NWTH 4GRLA 1KJ2L 4WCYH 2QJDA 3K2MC 1QKZL 5FYJL 1F4XL 1OAQL 2OJZL 3AXLA 3M8OH 4QTHB 4NQSB 4PBXA 4TVPL 4YDIL 3QXDA 3L3KA 4RAUB 3OJDB 5KVMC 1JGVH 3GZKA 3QEQB 2ATKA 4PJIF 4MD0B 4JFDA 3JTSB 4XNXL 5FF6B 2EEBA 3OGCB 3HNSL 2VISA 1PFCA 3CSYA 4N1EA 1S7RB 3DWTA 1DQTA 2AABL 1KJ3L 4NRXB 1CICC 1GC1C 4IMLB 1Z6JT 2AEQH 4P46B 1CGYA 3CMOL 4NWUL 3U4BL 1J8HD 5HDBF 3MOBL 3V4UL 3O11B 4XAWH 5I76B 2VLMD 2VLKE 3UPCA 5CILH 2XACC 4ZAKB 4ELMF 1VPOH 4DGYL 1MHPH 1UJ3B 1LK2A 3F12A 3AGVA 1WCBA 1N6QH 5JDSB 3ZKQD 4TNVF 5L9DH 2O26U 4KVNH 1EMTH 4F80A 2R23B 2R0KH 4P2OC 3P4MA 1HH6B 2VLLA 4NJ9H 1AKJB 5MENE 4GS7C 1H3VA 4MJIE 1OARH 1LO4H 5IP4A 1X4ZA 5F6HJ 4KUCF 4LCWB 1IJ9A 1W72B 1F8TH 3FOMB 3UP1A 2V2WA 4Q97A 5F9OH 4PJ5B 3OAZH 1F6AA 3H9YA 2EE3A 3V6ZA 3BOVA 4TSBH 3EYVA 3VFSB 4YHKH 3WFZA 2WLZA 5T1MA 4HUKB 4J3SA 4QYOA 3IJHB 1F4HA 2A6DB 3GK8H 4Z7VA 2WIIB 3QI9C 2W9EH 2IH3A 2VKWA 4MQ7B 3V0WL 1MH5A 3C9NA 4RGOH 2B1HL 3LCYA 4K94L 4Y16A 2AQ3A 4K07A 4JZJC 3WN5A 1CFNA 2Z31D 5GGSB 2GI7A 4WWKA 4LSUL 3CLFL 4GKZB 2VERN 1LO3L 5CGTA 5JPMA 2YD2A 5DRXB 2BSRA 3EYSL 4NYLB 4FQ2H 2P5EE 3GRWH 5I1LB 5GJSH 2W9DH 1TLKA 4Y2DC 5GS3A 1I85A 5FO7A 4XBPA 4OIAA 1S7VB 4I0PB 1GL4B 4JAMB 3JV5A 5A43C 1CBVH 3VWKA 5FGSA 5F7DA 4Y1AB 3CVHL 3IDXH 4HKJB 4U1SA 5EWIL 4G8EB 4PGDB 2XZCH 2C4FU 3VJ6B 1P5VA 3QNZB 2VE6A 1U91B 4MJ6A 1IGCL 4W6XB 1KTKE 4PJBE 3IJYA 2HT4C 5GRVK 1KG0B 1KT2B 3ZTJG 5CD3A 5TE7H 1WZKA 1DBKH 1SVZA 2CDGB 3TM6A 5I1IH 3HC3H 4Z95L 1JZ4A 1Q8MA 1DL7L 3CLEH 1A9BA 2JCCB 3BO8A 1CFVL 2NR6C 15C8H 4PJAA 1CLYH 4KZDH 5HGHB 3DYPA 3T0AA 4LSSH 2CGRH 3GMLB 4JREC 2FZ3B 5F7WC 4YO0A 1G0DA 4PGCB 4R2GB 3L5XL 5F7YC 4P23C 4LDLB 5HJ3A 4P2RB 2NMSA 3QIWD 3SOBL 4DVBB 1PX4A 3INUH 4OIIH 4XZUA 5EULV 3SKOA 2ZG2A 5CCKL 1EEZA 1U3HD 3QB7C 4JO4H 4DN4L 1KJ2A 3IU3B 3ULUE 1FNFA 4U1IB 3I9GL 1CFQA 4QOKB 4D0DA 4MXWL 4R90L 2ITDA 4LAQH 2GSIA 4G7VH 4JRYA 4UT7L 2HJFA 2BOCB 3HPLB 5ID0B 4F7TB 3HS0A 1XR9A 4LMQE 2KH2B 4CVZB 3BJLA 2DQUL 3MV8D 3JTTB 1P9MA 5E8OA 4YZFF 5CINH 4BFGA 5KAQF 5FOJA 1OSZA 4OF7A 4QHUA 5DDHB 2VJXA 4Y4KD 2HVJB 3LOWA 3WIFA 5DMGD 4U1NA 4OLVH 3QG6A 3BH8A 3CH1A 3DGCR 1DUYA 3TIEB 3MLXL 4GRLC 2O5XL 2D03L 4P57B 4ZS7L 3X12B 3B9DA 3RHWF 3O3AB 2NY0D 3V5DB 1U8MA 2LU7A 1FZMA 3QUMH 3BVNA 1O7VA 3HI6L 5DUPH 1CT8A 4W4OC 5JW4M 1FYTE 3G9AB 4JHAH 1UCBL 2NTSP 4UIKH 4KDTA 4KJQC 3BSZH 3ZO0A 3QDJB 1A7QH 1KCRL 5HVHB 1I3RA 1PVHA 3LQZA 4Q9RL 4TOYL 3LKOB 4UU9A 1MAMH 5IVOA 3B9AA 4WJ5A 1XR8B 3QHTC 5SWQB 4Q74A 4APQB 2JCCF 1GGCL 3X3FH 1WBZB 1U95B 1U8OB 2ITCA 4MVBD 1S5IL 3JWDH 2AI0H 3IFPA 3BEWB 3HE6D 4Q0XH 2VLJA 3OAUL 2KDGA 1FL3B 1HEZB 1MCSA 2PO6D 1Z3GL 1W2KT 4QHLA 3H6JA 3O81A 4NPYB 1ZVYA 1ZHKB 4TSAL 4LP5A 3TA3D 4M7JH 1YC8A 3LH2H 3O3BB 4RISL 3TYFB 2FATL 4AIOA 3WUWA 5D9SB 2OL3B 5FGRA 4KU1A 5J6GA 4AJ0A 1GXEA 3O2DL 4O00A 4LU5L 4QEGA 5F7MC 1YY8A 3MCKB 3OKLB 2EYTB 1SQ2N 3WEXB 3PGDA 1DJSA 1NCBH 3SN6N 3IT8D 2XIDA 4QRRA 5MEOA 3RVUC 1TCMA 2W1NA 4K7PL 4H8WL 2UUDH 4ODWB 2X1QA 4HMDA 2PF6A 2EDOA 3S3PA 3CVHA 2ERJB 4NZRL 2VAJA 3MRCB 2ADJA 5B39A 4GQPH 1VACB 4Y16C 5TQ0H 3VFWB 5E2WH 5BRZE 4FQXC 3KPQA 4Q6IB 3WN5C 4O5LH 3O8XB 4TULL 1T7ZA 5E8NA 4IRSB 4LIQE 3Q3GA 2EDNA 4WWKC 25C8H 4F7MB 1FL6A 1HOCA 1PX3A 2HG5B 1TJGL 5DJDB 5ADOL 3WKNA 2CKBL 1DCLA 2GUOB 4F7PA 3F7QA 4WI8A 1I85C 1DANU 4U6TA 1KIQA 4WEBH 1NUFA 1KCUL 2DLIA 4M5ZH 4WENB 1NFIA 3LB6D 4L29B 3PQYE 4JZOB 1J0JA 5D7IB 3QUXB 3U6RA 2ICEA 2OMNA 4F3FA 4LOUC 3MRLB 3RIAF 4N9OB 3LS4H 3QAZC 1UC6A 4N5EC 5KTEH 1MRCL 4L8CB 1B0GB 5FO9A 5I73C 3OX8B 3ZDXE 1RAMA 2PYED 2CQVA 2JTDA 2GAZB 3OXRA 5HHQA 1VKXB 4U6HA 2GY7B 4OCMC 3FQRB 3HC0B 4DKEH 2X4RA 2V2XB 3O6KL 4G8FA 5ITFB 5MI0B 5ERWA 2A83A 4XVTH 1RURH 2HKHL 5BZDB 4BKLB 5SX4I 4ZUVB 3DHMA 3P73B 3D3VD 1TJIL 2XI9A 4IOIB 4HX1B 3AS3A 2NTFA 3RZCB 1ZA6A 1AGEB 3ET9F 5DJYB 3BUYA 3KYAA 1F4WL 3IJSA 3KJ6H 1IBGL 2NY6B 5E5MA 3RWCA 1BEYH 1FLTX 2G75A 1U6AH 3UCRA 1NBZB 2GTZA 4ODSL 3BZ4A 3RWFA 4E41B 2PW1A 3MODL 4UNTA 1S78C 1GAFH 1DLHA 1W0YT 2PXYC 1B3JA 4HGWB 1TZIA 4GG8A 3ULVF 4WNQA 3ES6A 5FECB 2FJGB 4PJDB 2ICWJ 5KOVC 2VIRA 3QNYB 3MNWA 1I4FB 1YYLL 3I84A 4TSCL 4BUGA 1DANT 1IC4H 4KI5D 3MLSL 5BO1L 3DXAE 1WIUA 3MV9B 1HIMH 4RNRA 3QXWA 3MACL 5HDQL 1IGJA 4F15C 2P8MA 5GGSY 2ZSWA 2HT2C 1U8PB 1W72L 1DEEB 1K85A 1T2QH 5IMKA 4D0CA 2QKIA 4ENED 5FK9B 1QSZA 3AB0B 4LHUD 3ZHDA 2UV3A 4JQVC 2C26A 5KVGH 1JF1A 4LLUB 5DJ8A 4A6YH 4BZYA 1GGYA 1JWSB 5I1CH 3QEHB 3W39A 3AVEA 3GSXA 3GSOB 2H9GA 3QFJD 4KDTC 4MSWA 4G80B 1U3ZA 4PJIA 2VDOH 2XTJE 2ZUVA 5D7IF 1C5CH 4YHZL 5FM8A 2CLRB 4KJPD 1NAMH 2EZ0C 3U79A 1AXTL 1QFWI 2EYSA 3ESVF 5ESVB 3O2DA 1FIEA 2IEPA 3KLAB 3TVMA 4G6MH 5DZNA 4C56E 2IANB 4M1CD 3S98A 3EHBC 3MZTA 1LILA 1CL7I 3S7GA 2IAMA 4HWNA 3SE9L 3R0NA 5IMLB 2R2EB 1ZHNB 2XWBA 5GJTH 1A47A 1WAAF 3C2AH 5IB4B 5HI5C 2YRPA 5EBLB 4ZDHA 1B9ZA 5KANI 3SY0B 1G7HB 1XZ0A 3RNQB 2ZUQB 3VDBA 2DQDH 2R15A 1ES0A 5EOTA 3HAEH 3DOSA 4UT9H 1A8JH 3PXJA 2WBWB 1MWAL 1MFAH 4PRNA 5D1ZD 3V5KB 3T65A 3LN5A 3ZE0E 1KJMA 4G42B 2P5WD 3PWNB 2CKBA 1Z2KA 2EKSB 1U8QB 4MNHB 3C5ZB 4D9LH 3MRJA 1JHLH 2MTPA 1E6OL 3FL7A 5J57B 1HSAB 4QTIL 3HR5B 5E2VH 4Z6AT 4BFBD 2GJ6A 1DBML 1VFAA 4H0IA 3T2QA 2VDNH 5HDLA 4BQ8A 4OUUB 3UTZB 1XT5A 5LGHL 1JGLL 1RJLA 4NQDD 1NGYB 1IFHL 3VGFA 1AC0A 3CFDA 4PJHE 4PJDF 2FBJL 4FQJH 2EDYA 5T3ZH 1AI1H 1T0MA 2ZNWA 5DEZA 1G6RH 2A6KB 3L1OL 5D7LD 3QIUA 3UJJH 1R3JA 3JV4A 1MCBA 1I9JH 5F3HA 5EU7C 4FMKA 5C7XL 3M1BA 4N0FA 1IAIH 1N0LA 1GC1H 4S1DD 1Z0NA 1X5JA 3DV6B 4WI9A 1QNZH 2GEEA 2X1WL 2BY1A 4QTHA 3TJEH 4NQSA 4XT1C 1ZVSB 4CKVX 2AXFB 4HZAA 1JHKL 1JRHI 4CADB 3OJDA 1UACL 5BS0B 1OT1A 1LK3H 1DN0A 4GRMB 4XPGH 3QEQA 5IG7B 3ARFB 1MCCA 4OKVB 2ESVB 2DLEA 4MD0A 3JTSA 2EDWA 4JVPA 5FF6A 5JHLH 4L5FL 3VA6A 4WFFD 5IEHB 4H25B 3OZ9L 2ORBL 3OGCA 4AL8L 3S36H 3GJFB 4UAOB 3O6ML 3V0VB 4FTVD 4P46A 3BKCL 4FN0A 4P5TB 5T5FL 3T0EE 5I76A 2L4OA 3VE0B 3RY4A 4NKQB 2GJZB 4Y5VB 1L7IH 1A5FL 4LKXA 1MPAL 3UO1L 1JK8A 5JDSA 3OF6A 3K80A 1IGMH 4MA7H 1D6VL 1R5WB 4ERSL 3IXAB 1HH6A 1AKJA 1UADC 5C9JA 1GCFA 3HZMB 4P9ML 4Y19B 5EDXA 2H6PB 2Y72A 1W72A 5GSRB 4KMTH 1QEWB 1WFTA 4FFVC 4NT6A 1IT9L 5HGBB 2VQUA 4GAGL 3QCTH 1AIFB 1KCSH 4LSQH 1ZGLM 4YHMH 2N7AA 5DVLA 3IJHA 3VXUB 4AEHH 2A6DA 3P11H 1A0QL 4TTDD 2B2XH 4LQ1A 3L3IA 5I71B 2FCBA 1NLBH 2AJZB 4Z0BL 1L7TH 3LZFL 2V7NA 1KTDB 3EOTH 1N64L 3BYTA 5J13C 5GGVH 2E7BA 3OBAA 5T3XD 1JPSL 3RIFK 5E6ID 3SDXE 4POYA 2X4QA 4GKZA 4U3CA 1WWWX 1CDUA 4NQTA 4W68A 4JFFB 1J11A 1VCAA 4ZFOL 2OS7A 1N4XH 1H3WM 5DRXA 4NYLA 4NC2B 5I1LA 3MFGB 1OWRM 4UOJA 3CK0L 1UM6L 5HI4D 3P2TA 3Q5TA 5HPOA 5C0CD 1S7VA 4I0PA 4JAMA 3UDWA 5FV1L 4UI2A 3MUHL 5MHSD 3UYOD 3WO4B 2F9BT 1ZLVH 3ULVL 4Y1AA 2V7HB 4CVUA 4HKJA 4ODBD 4G8EA 1G9ML 3DX8B 2F8VA 4PGDA 4MWFB 3VJ6A 2H45A 1MRDL 3QNZA 2G60H 3KG5A 4KPHL 1UEYA 2ADGB 1G9NH 4JO3H 5T33H 1DFBH 4Z7OE 1MCWW 2GSGB 2APTA 1IM9D 1UENA 4GQ9L 1KG0A 3OR6B 4NQEE 3QXVA 5D7JD 1KT2A 1TNNA 3TO4D 3UBXI 1UQSB 5BXFB 1MWAA 4G3YL 4KK9D 4DCQB 2CDGA 2CSPA 3KLDA 4AH2B 4LLWA 4JFZL 4ORGB 4X8JB 2JCCA 4Y8AA 1I3GL 5ISZA 3C60C 5DMKB 5TF0A 4WHYG 4U1MB 3T4YB 3OXSA 4KKBD 3GMLA 4OCSH 2FZ3A 5HGAB 2GKIA 4DWHA 4M1DL 1MRFL 4AT6A 3VG0H 1K9TA 2NY3C 5EZIL 3ZTNH 4JFOB 1TITA 1K6QL 3S35H 4OFYD 2HLAA 2VZ3A 5T1KB 4LVHC 4PG2A 5D7KD 4XPHH 1IGIH 2QL1A 1IKFH 2VH5L 1NQBA 2CR6A 4QRUB 5CD5C 2JELH 3KPSE 1RUKH 4LBEA 1YEEL 2A9NH 1CE6B 3MX0A 3IU3A 4POUB 4U1IA 1YC7A 1JZ7A 2WUBL 1YPZB 4F57L 4QOKA 3S8WA 5I8EA 1OGTB 5E9DD 1PY9A 5E99L 2VOTA 2YD3A 4BK5A 3HPLA 5ID0A 5KG9A 4F7TA 3WNNA 1VA9A 4QNPF 3JTTA 4LVOB 4YH6A 1UM4H 2VZVA 3LEVH 2ZUTA 5DURB 4HG4J 2A9MH 5DDHA 4BQBA 2JB5H 5DZLA 3DX6B 1EBAA 3JBG7 2AJYH 4NP4H 1RI8A 5J1TC 5EZJB 1AFVL 1X5XA 1BHGA 5IW6B 1LVEA 1TNMA 2C5DC 3I6KB 1X44A 5KW9L 5I15L 3O9WC 4X7SH 5IWLC 4P4KA 3D39D 3DUUB 3TLRA 3MV7E 4BJLA 1MIMH 4HLZH 3X12A 2F8OA 2FHFA 3HE7D 3OHXA 3LY6A 4ETYA 1Y18B 3V5DA 3VG9B 2X89D 1SJEA 2CLZB 1ZLSH 5DK0B 1QPPA 1QSVA 4EN3D 4JRXB 1RFDL 3MLWH 4XXDB 1ZVHA 2PCPB 3HRZA 1DBAH 1DDHB 4X0KB 3VMPA 2BNQD 3ILQD 2AP2A 3QDJA 3ZHLA 3FOLB 1UT9A 3LKOA 2EDKA 2XN9E 3QEGH 3RGVD 5SWQA 3KPLB 2D7TL 1YQ2A 4G6KL 4APQA 1WBZA 4L3EB 1U95A 2BVOB 1U8OA 4LCIL 1A6ZA 4P46C 3RWEB 2D9CA 3BXNA 3DUSB 2G5BA 3BEWA 4KH2A 2BVUA 4LHUG 4ZAKC 2DWEB 1FL3A 3RVXD 5K59F 4U05A 5DUML 1OAUL 2HLFC 5D2NB 1UJ3C 3SO3B 2Z8VC 5IHUL 3GIVB 3VXOB 3TT1H 2Q8AL 5C0BE 1KN4H 5L2KB 3VFGL 1WISA 3O3BA 3TYFA 1RPQA 1XF3A 2BNRB 2A77H 3QIWB 5D9SA 1JZ6A 1X5ZA 4WUUB 4DQOH 5F9AC 1FAKT 4NC0B 2IBGA 1D3CA 4RFOL 4ZFOA 5I1GL 3FQWB 4N8CL 3G9VA 4X5WB 4FFYH 4PRHE 1BM3H 3MLUH 3OKLA 2EYTA 3WEXA 2BHUA 1C7TA 4LNRB 5IF0B 5D2LB 1YPZF 4J23A 4KY1L 2FDBP 4U6YB 1EHLH 3WMSA 2FIKB 2Y6SD 4ODWA 1PQZB 4UV4H 2BSTB 1RSFA 4JE4B 3MRCA 5F3BB 1VACA 3VFWA 3VU2A 1XGTB 43C9A 3D85D 5GHWL 1OVZA 4Q6IA 3S37H 4IRSA 4F7MA 5ID1A 4PJXF 3X14B 3BE1H 2APXA 1ZGLB 4NM8L 2HG5A 4MJ4A 2B0SH 3UTTB 4LHQB 2B1AH 3ESUF 1BWWA 1G1YA 2ADFL 3EJYC 4EKXA 5TJWK 1RZJL 4DGVH 2IBZY 2GUOA 5CJBA 1BQLL 3ETBF 4AK1A 1T0PB 3PGCB 1XFPA 4M61A 4N1CA 4BZ1H 5D1XD 2X7LB 3SDYL 2D4DA 3MRKA 1X4XA 4I0PC 1E4WL 3UDWC 4P99A 3THMH 3VI3F 4G8IA 1ZEAL 1XGYL 3C09B 1DBBL 4L29A 4YDLB 1RK1B 1C5BL 3L3DA 5F9JB 3O3EB 2P46B 1G0YR 4NQCD 1LEGB 3MRBB 3SKJH 3MRLA 1U36A 1JYNA 3TIDB 1MOEA 1QBMH 3EYUL 3TPKA 4OCLC 3FQTA 2QV2A 4L8CA 3NA4A 3OX8A 3DHJA 3IAQA 2GAZA 4KKCD 1LDPL 1VKXA 3VH8B 5SWZB 1FZJB 5JLZB 1ACZA 4HUNB 4OGZA 4JEGB 1QFUL 4OT1H 5E8PA 3HC0A 1KEGH 1E6JL 1MY5A 2V2XA 5ITFA 5AD0A 2O5ZH 1WAAA 3PHQB 2YD4A 2EEDA 5BZDA 4BKLA 3QDME 4OQTL 4PP2A 4R2GC 3WBDA 4PLKD 3MR9B 4XI5C 2MPAL 1EFQA 4GMSL 4ZUVA 1BWMA 5CIPH 5TE4L 4UB0H 3P73A 4XNXH 4IOIA 5GRZA 1BBJB 5IJKA 4PG2C 4PP1D 4S10A 2V2TB 4KV5F 1AGEA 1A4KA 1FCCA 1IGYB 4R4NC 2AABH 4Z76B 3QBTB 1IC5L 5FGBA 3V4VH 5F1OB 2VDRH 4K3JH 43CAB 1NBZA 1KPUA 1NC2A 4J3OC 1Y6NR 3NAAL 5D2LF 1X7QA 2P48B 4E41A 5FUCE 4YBQD 4BYHA 1A14L 1RU9L 4HGWA 2CMRH 5EH1A 1AR1D 3G6JE 3QNYA 3C87A 4IRJD 5T3XE 4OSUL 4FG6D 1NDGB 4EI5B 1SJVA 3MV9A 1S9WB 1CWVA 1CXIA 4XH2A 2ZJSL 3MOAL 4Q58C 3JVGA 4PRPB 4UNUA 1NH6A 4WTWA 1CR9L 4C59B 1U8PA 3NABH 1DEEA 5JW3L 2G9HB 1XF5B 1HWGB 5FK9A 4QHMB 4HF5L 5DD6A 5F7EL 3NTCH 3DURB 1P1ZA 3FO9A 1I1FB 4L3CB 4LLUA 1OB1B 1RUML 2FYYA 2D0HA 3FO2B 1OP9A 3QEHA 4R4BB 4ZFZB 2B1HH 4KROD 4QO1A 2A6JA 3T4AB 3GSOA 4HBCH 4Q9QL 1XH3B 1OGAA 5HVHC 5LAXB 3HC4H 3RWIA 1UWEH 4M6AA 5C0AB 3MCG1 1WWBX 2CLRA 4I18A 2DL9A 3AMKA 3HCVB 1T03L 3KLAA 4H88H 3EYSH 5DXWA 4APQC 4F9PA 2IANA 1D9KD 1CGSL 4V2CB 1BLNB 1CK0L 1FNAA 3PG2A 1I7RB 4JY6B 5I8OH 4PR5A 1QVOB 4WFHD 5EOCJ 3NFPB 1U58B 2E8ZA 4HJ0C 5IMLA 2R2EA 1ZHNA 4JLRB 4G6AC 2AGJH 2ZPKH 3HMWH 4YPJA 3T2PA 1Q9LB 5IB4A 4OFDA 5D6CA 1A6WL 5D71L 4PJGA 1JMZA 3FONB 3SY0A 1G7HA 4V1DB 1GSMA 1Z9SA 4FS0A 3RNQA 3VXRD 1KSRA 3HZKB 5ALBH 3D3VB 1YA5A 1DQML 5B38B 4EIZC 3SDCB 1A7RL 5AZ2L 4XPFH 4JFED 3DVFA 4FHBD 4GXVL 5B21A 5DFVD 2EDXA 2VC2L 4G42A 2YRZA 2FEEI 3PWNA 3U46B 7FABH 1IQWH 1BJ1J 1GPOH 2AJVL 2EKSA 1U8QA 3G04B 3C5ZA 4MNHA 4U2YA 4MLIA 5CUSH 2P49B 1N59A 1HSAA 2EIEA 3HR5A 3OB0K 5JZ7C 1D5MB 4FZ8L 4J7RA 4X99B 4XBEH 4EQ2A 3PL6B 5LXGL 2IALB 1GGTA 1IAKB 2VDQL 2W91A 5DVMA 3UTZA 2ERJC 4KKAC 1NGYA 3FT3B 1BGXH 3KYKL 2ZCHH 1S7WB 4U7KA 1U93B 1AD0B 4DKFL 4G9FE 1B0RB 3KJ4B 5C09D 2XQBL 3BQUB 1T1ZB 4Q6IC 1MJ7L 4KQ3H 3O8XC 2A6KA 4XHJD 3SOBH 3IAGC 4Z7QE 3H9HA 1KYOK 1OAZL 1GYAA 5F7HA 1DTUA 1MCQA 1MFEH 2P7TA 4JPWL 3L9RB 4Z18A 3A6BH 1VENA 1OTSC 2ZUUA 2IC2A 4Y4HA 1A7PH 3VGAB 2R4SL 1ZVSA 4U0QB 2AJSL 2HRPL 5HYQB 3DV4A 4OQTA 5BS0A 5J6HA 4X4MA 1EH9A 4DVRH 4W81A 3ARFA 3QUXC 2VDPH 2XZAH 1OOAA 1CGWA 2BVYA 4JDTL 1S5HA 5IEHA 5D96B 2XWJB 4GOSA 4H25A 1QRNA 2BJML 1B6UA 2DYPA 2R2BA 3OJ2C 3GJFA 4HUWB 1G84A 1SEQH 1K4DB 3PWVB 1QSFB 2K9UA 3V0VA 4IJ3B 4JCLA 4ZS7H 12E8H 5JW4Q 1S7QB 3IFNH 3VE0A 1QBBA 1I75A 2OZ4H 3FO0H 1XGUB 2EXWC 3FQXB 3HI6H 5FKPB 2ZCKH 4Y5VA 3TCLB 2MHAB 5SWSD 5E2UL 2X40A 2NQCA 5C07E 3ARPA 4ZTPH 2BCKB 1WGOA 1KCRH 3RKDD 2DMKA 4YEEA 1RY7B 3WLBB 1R5WA 4WI7A 4TOYH 1LP9E 4GW5B 3RZCC 1EO7A 3EDDA 3G6AB 5LWYL 2VABB 2ZOLB 4Y19A 2H6PA 1N0XL 2NY6C 1QEWA 5FGBC 5HGBA 1RJYA 1AIFA 1BAFH 3N85H 4AG4H 1MCFA 2FHCA 1MI5D 1BX2B 4U6VH 1L6XA 2P42B 3RDTD 4X7DC 3BWAB 3MBXH 3MLPA 2AJZA 2R0ZH 4OCYL 2A0LD 3HPJB 3KPRA 3QDGD 2FATH 2FGZA 1S7SB 5DD5H 2Z0BA 5D7LB 2NY5C 2PR4H 1BF2A 3E8UL 4GRWE 2VXVL 2YUZA 4JFFA 5IBLC 3EZJB 5GSVB 3O4OB 1JYWA 5D1QC 1RK0B 4YDKH 2X4UB 4KK6D 5E08L 3DETC 4K7PX 1INEL 3O6LL 1RUPH 1YEGH 1I7TB 3HG1E 5C2BL 5T3ZD 3VXMD 2Q7YB 1J1OH 5C3TA 4XMLL 1I3VA 1QSEB 2XICA 1EHXA 1WIPA 3CFBA 4L8BA 3K2UH 3NCJH 2FRGP 35C8H 5LQBH 4GRWH 4OJFL 3OTTA 4YHNB 1CICD 4TNWF 2ADGA 4EOWH 3MUY1 2GSGA 3OR6A 3V6OC 2HA1A 1UQSA 5BXFA 3IKKA 2Z9TA 1LNUB 4D9RE 4DCQA 3RZWA 3LVEA 2UWEE 3QJFB 4TUOB 2W0FB 4ORGA 2F53E 1X5GA 5D8JL 1FQ9C 4MAUL 3MSPA 1PDKA 5DMKA 4KTEL 3T4YA 2LVCA 5C6TH 2NW3A 1DLFH 5JUEL 3HUJE 3PE9A 3K0WA 3DLQR 5I2IB 4EUPG 3TH2T 3MREB 1MCRA 3P9MB 1HQRB 3Q1SH 2BZDA 3KXFE 2CRYA 5BOPA 3GIZH 1FRGL 1V7ML 2HN7A 3DVGB 1F90H 5AYQA 1J9CT 1IC1A 3NCYP 3LV3B 5FV2A 3TN0C 1T80A 2NY4B 1Q38A 2VDKH 5JHDB 4JFOA 2MWCA 1UH4A 2ZUQC 5ETUB 2Y4SA 1A1NB 3J8F7 3CAFA 1HN1A 4LPWA 4HUVB 1E0OB 4M48L 4X6FB 3P4NB 4QRUA 2EDHA 3OV6A 1CIUA 1J0KA 2VN4A 4UINH 6FABL 2Y06H 2F19L 1B6DA 4X7CC 3C5ZC 3QQ3A 2Q6WB 3S97C 1YPZA 3QXAB 1OGTA 5IFJB 5EU5B 1D6EA 2WBJD 3GBML 2DKSA 2CUHA 4FA8A 2DQTH 2W9LA 4CU7A 2ZUYA 4U1KB 3MNVB 4IDJL 1GGIH 3U7WH 3HI5L 1RULL 2Z31A 3DX6A 3QXTA 4HUMB 5E6IB 4PJXA 4JFXB 4Y2DD 1QG3A 5EZJA 2W0KA 4OGXH 5IW6A 3PWPE 3I6KA 4HH9B 4Q2ZB 4ZUTB 3DUUA 4ZSOA 1S9XB 4DTGH 1RUAL 3G5XB 2NW2B 1QFWH 2ARJA 3MGAA 5AEAA 4HC1H 1Y18A 2HT4D 3IB4A 4ZUWB 4W70A 4PV9B 3SKNB 5IB5B 3Q6GH 3WDIA 2CLZA 5DK0A 5EU6B 5ALCL 4ZPTA 2PCPA 3ARFC 4X0KA 4RMRA 5FM5M 2NR6D 4PY7B 3N9GH 5A16B 3BKYL 3LN4B 4FP8L 2DQHH 4P2QE 4QRPE 4X7TB 2FLRT 3BDYH 4LRNH 2HH0L 2JJWA 3H42L 1A02N 5FYLD 3KPLA 1M7XA 5FHAL 5GGUB 3VWJD 4UAOC 4L3EA 1Z9MA 3STLB 4DK3A 5AG9A 1JPGB 2NY2D 2JB6B 4P5TC 5IK3B 3O0RL 4P23D 5MP6H 1Q1JL 1GGBL 3BP6A 2WQ8A 1FVDA 1OSPL 2DWEA 1XF4A 4Y5VC 4R4FH 3BT2L 5D2NA 5IB3B 1FNHA 3VXOA 1DQJB 4YXLH 2SEBB 3B83A 4PB0H 4Q6YA 1ZXQA 5HYJE 3EDKA 1X6NA 3LRSB 4KUZL 1K8DB 4S0SD 4DUWA 3NH7L 3QIWA 5FEBA 2H2SC 3IYLW 2AJXH 4JPKL 4WUUA 5AWNH 2F54E 4A2MA 4AM0B 3FFCB 3SDAB 4YLQT 3FQWA 3OB0H 5ITBL 1VSCA 3IDGB 2YUWA 5B8CB 4FFZH 5KS9E 5IF0A 4LNRA 3RP1A 5DQDL 5D2LA 4I4WB 2RAMA 1RV6X 4BQ6A 4U6YA 1QLEH 3LEXB 2FIKA 4JKPH 5L88L 1AH1A 4MHHI 1WWCA 2BSTA 5I71C 3MV8A 3O4LD 1QYGL 4PG9B 4HJGB 5F3BA 2VLKB 2E7CA 1XGTA 4L9LB 4J2XA 1HKFA 1BD2D 4GRLD 2CD0A 4RWHA 3FT2A 2JJVA 1L0QA 4Y4KA 3UYPA 1JZ2A 4H26B 5FUOL 4ZFFB 3X14A 1ZGLA 1CQYA 3I6GB 1OW0A 3RGHA 3PDOA 4JGJA 4PS4L 3UTTA 5JA8B 5MERA 4BZ2H 2KBGA 4OF5A 3D39B 1UGNA 4OI9A 1DQLL 4JM2B 4F7CB 5MENB 4MJIB 1S7XB 2B5IB 5IBTL 3BWUC 3MRPA 4JFHE 3U9PL 2ZKHH 3PDDA 4NOBA 2X7LA 4B0MM 2ARJQ 4ZG1A 1ND0A 5I18L 1KTLA 3WO4C 5LGHH 2NY7L 5CEXB 5CWSB 3PIQB 5J12B 3T08A 4KQ4L 3PWLB 2BNQB 5E4IA 1DVFC 5F9JA 3AREB 3H0TA 1LEGA 3MRBA 2VR4A 5C0FB 3QRGH 4OCWL 1UB5A 1MF2H 4R8WL 3C5SB 2FB4L 2A38A 1KOAA 3RY5A 4JG1H 1P6FA 3BGFB 1FZJA 5JLZA 3DGGB 5IT2H 4GAJL 4HJJL 5C08E 2OR8A 3CZFB 4M43L 5SWSE 4NCC2 2PO6A 2P5EB 3PHQA 5IBUB 1CD9B 1EUUA 5J7CC 4JR9L 4XNUL 3BD3A 4HCRH 3QZWB 4OD3L 4XPBL 3TA3A 4RZCA 3QPXL 5L6YL 2QQNH 3L95B 4RA0C 2IADB 2OP4L 1FSKC 1F4YL 2EDDA 1BBJA 4NQXB 4Z77B 1NCAH 2V2TA 4YFDB 1AQKL 3ORJA 2BFVH 1T1XB 1IGYA 3RVUD 3DVIA 4PJBB 5IHLB 1WTLA 4HAFA 4Z76A 1J7VR 1CVSC 5KZCD 3WSQL 5ICZB 3H9SE 1CFSB 4XC3H 2CXGA 2D7MA 43CAA 1MI5E 5A2KH 1JL8A 4Y16D 5GQBA 4LK4A 3SJVD 4Y89A 1ZA3B 5E2TH 4FQXD 1G7LB 3NN8B 4QXGH 5FUZH 2DQJH 3CD4A 2O61A 4XVSH 5FHBH 3UMTA 5A2FA 1BFSA 1OAYL 1SY6H 4LVOC 4WEMB 5CJOH 1NAKH 3KS0J 1BOGA 1NDGA 4EI5A 3OKMB 1S9WA 4QXUL 1MJ8L 3QCUL 4P9MH 1JFQL 3BIAX 1W0VB 3FAWA 4PRPA 1UWXK 4LEOB 1ZWIA 1RIHL 1HCVA 1HSBA 3MLYH 1M05B 1OQOA 4EUPB 4JM2F 1XF5A 2R69H 4QHMA 1RJCA 4NZUL 2QSQA 3H3BC 3DURA 2VSCA 5KSBE 1I1FA 5JQ6H 5D1XB 3VG9C 4L3CA 5DS8A 2FEDC 1OB1A 5IFAL 3D25B 1A0QH 3FO2A 1J12A 3MCLL 4N5ED 4R4BA 4XCCH 4NO5B 4ZFZA 3LZFH 1NL0H 4YIQB 4ZTOH 1RIUH 2BVEA 4JY5H 4PGZA 3T4AA 4X6CE 2W0LA 3QDHA 3EO0B 1WLHA 1XH3A 3IFLH 4I48A 4NQCB 2ID5A 2YPLE 4X83A 4TQEL 4WV1B 4NZJA 3U9UA 1U8LB 2VLRE 5HHMD 2OL3H 4OZ4B 1NCUA 4HWEH 4YEFA 2Z92B 3A67L 3ARUA 4PV8B 5HXMA 2PYEA 3U7YL 4HSQA 3QG7L 3MLZL 5HD8C 3F7RA 4OZFB 1YEHH 3EYOA 3EFFA 1TZGL 4M6OH 3CDGB 2BRRL 4LLVB 1A3RL 3LQAL 4QXTB 2JK5B 4HIXL 3NFPA 1U58A 1NFDE 4CMHB 4S1RH 3V7AG 4NKMB 4GJTB 4JLRA 2C3VB 4H5SB 5D2NC 3SO3C 1T20A 3BAEH 3KYMB 3WS6A 3EAKA 5TDPB 5EOCH 3FONA 2JJSA 4V1DA 4ESKA 1F4AA 2FX8H 3HZKA 3RKPA 3D3VA 4NUGH 4C83B 5JXAH 4MX7A 1FYTB 4AQOA 4G7YH 4OLZH 1R0AL 3MJ6A 4QY8B 5GS0C 4JRYD 4JFZH 4PJBF 4TVPD 1S78D 2DLFL 2PXYD 4HV8B 3WHXB 1EO8H 4MCZA 4XP1H 2XPGB 2XKUA 2C1OA 3G04A 2OQJA 4D0BB