4X7DC

Crystal structure of 2012 nsw gii.4 p domain in complex with nano-85
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
116
structure length
105
Chain Sequence
b'DVQLVESGGGLVLSCAASGSIFSIYAMGWYRQQRELVASISSGGGTNYADSVKGRFTISGDNAKNTVYLQMNSLKPEDTAVYYCKREDYSAYAPPSGSRGRGTQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP1
publication title Nanobody binding to a conserved epitope promotes norovirus particle disassembly.
pubmed doi rcsb
source organism Norovirus hu/gii.4/sydney/nsw0514/2012/au
molecule tags Viral protein
total genus 20
structure length 105
sequence length 116
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x7dC00
3IXTB 1KGCD 2W65A 1B88A 4F9LC 4DGIL 1UVQB 3FB6B 3KYNB 5BS0B 1ND0B 4Q9QL 3UTZB 4M62L 1OGTA 3V5HA 4LHUG 3WIFA 2BVOA 3SGKA 2W1NA 3QCUL 1X5AA 2EIDA 4AIXA 4EI5B 3L3KA 3BPOB 3DGGA 2AABL 1LD9A 4PJFE 4UINL 1XMWA 4YR6A 1XF4B 2WLYA 3WFBL 1R3LA 3KJ6H 3KJ4C 3O41B 3FT3A 3R4DA 1YEGH 25C8L 5E2VL 1YNKH 3D2UD 3IU3B 1DLFH 2WNGA 4ENED 3OQ3B 3OKLB 4P5KA 1XF5A 1ACYH 3WJJA 2JJWA 4ZUUA 1NDGA 3MNWB 4LEXH 5BJTB 1A9BB 2WINB 4J1UA 5JPMA 2X9WA 4MSWB 1AR2A 4HT1L 1JF1A 2GCYB 4PGZA 4OZFB 4MXQD 2ADGA 4WGWB 1MH5A 1JNNL 3KXFD 2JB5H 4FFYH 4ZOCA 1RHHB 2VWEE 4OV5A 2EKJA 1N4XH 4XB7A 4RZCB 5EZLA 1M7IA 4TUKH 5T1KB 3BGMA 5JW3L 5JA8B 5F9JA 3ZZ1A 5KJRL 2NW2A 1QD0A 4MNQD 1E6OH 4LVEA 4Z7UF 3RHWF 5HHMD 5H37H 5D2LE 2KQNA 1FPTL 3IXAA 4N0YH 3MRBA 2D9CA 2VDLL 1FVCB 5CJXA 3RBSA 1R3KA 3T4AA 1Q9WB 5GGVY 1UWXH 3P4MB 1U58A 1QSEE 3BP7B 5ELIA 2I9TB 3OAZH 5IVXA 5C0FB 3W5MA 1EAJA 1AIFB 4MJ6A 1BECA 4OTXH 3WS3B 3T4YB 4JFHE 4P2YA 4PGCB 4H0HB 4LSQH 5DSCA 5C6TH 3TJHC 3OSKA 5C0CE 3RY5A 3O0RL 2W9EL 2ZSWA 1MHHB 3T8XA 3Q6FA 3IU4H 1ZXQA 4TVPE 2X1XR 4U1JB 3BN9D 5F9AC 1RJZB 4PBXA 4F58L 1YC7A 5JXAL 4QEGA 3U0PA 1YEIH 3JWOH 3PJSB 4MMXC 4N68A 3QRGH 5HPOA 2DQHL 3O45B 5BOPA 6FABH 1GZPB 5H8DA 4Y4HA 1B0GA 1IKFL 1YEHH 4X6DB 3RGVA 3QHZL 4KUZL 4ELKB 2C4FT 3EYFA 1I1AC 2R0ZL 2Y06L 1HNFA 3A0OA 2E27H 1WT5C 3NZHL 5DI8B 3QG6B 5ILTL 1GHFL 3UMTA 2PYED 4UIKL 5D7LA 4KJPC 3VXOB 3U7YH 3JV4B 4PY7B 3L3JB 15C8L 3P4LA 5I2IB 2VLJD 1ZT1B 1R3IH 2VQ1B 4YGVB 1P7HL 3HMXA 1AC0A 2AVGA 3VH8G 4YHZL 3C2AH 3KPRA 3EFDL 1FIGH 5C1MB 1M05B 4Y4FB 3IFOA 2JCCE 4DEPC 3UROR 2HRPL 5E4IA 5DD6A 2XQYG 1X4YA 1T0MA 2YC1A 4KROD 3O3EA 3F6LA 3C5ZD 2DQUH 5T3ZH 1LO2H 5CJ8A 3MOBL 5DMGD 5F93C 3RP1A 2BHYA 4CN1A 3ARGD 1OD9A 4OUUA 4LOUD 1H5BB 2HJFA 5JDJA 4J6RH 4AK1A 1RZFH 1P6FA 5AG9A 2A6KA 3FFCE 1GCFA 1AQKH 5FFLA 2G60H 4LK4A 4PJCE 2X1PA 4DKDC 5B3JE 4HUXB 1CQYA 1LK2B 5HGAA 1G9NL 1OARL 3NACL 3NFPA 1HXYB 5F71A 3F7RA 5C0GB 3KXFB 4D9QD 4RMUA 4FFVC 3UTSD 2P5EA 1PDKA 4NO0A 1JL8A 1LO0H 4J23A 3IJYB 1U92B 1TQCB 3BVNB 1ZA3B 5D7SH 3T2OA 1HEZB 2EH7H 5BO1L 3IETA 5BQ7B 3IJHB 3RWHA 5IQ9B 1NEUA 3G9VA 4JFQA 4N90D 4MNQB 5IB3B 5E99L 5HHMB 5SWQA 1FRGH 4HMEA 4PGEB 4KHXH 2OR7A 3UTPE 1K85A 5CUSH 1C8PA 5ABDE 5I73B 4ZSOE 4MD0B 5JOPD 3B9KA 4KDTC 5KAQG 3MR9B 3OKDB 4L3AA 2BSRB 4JVUA 3L6FA 4FOMA 1S8DA 3TN0C 4OCMC 4WVRA 1OAXL 3NTCL 2FRGP 3GJFB 4XP5H 2OL3H 1QLEL 3HUJF 4WDIA 1BM3L 5CEZE 3MRGA 3CH1A 2Z35A 5CWSA 2B20A 4XBPB 4UV4H 4G80B 2ZUYA 4YC2C 1F6LL 2BZDA 4O9HH 1OGAD 4X9HA 2APBA 1M6OB 4K9EH 1IGIL 5TQ0L 1J8HE 2AKRA 5JW5A 4IOIA 1NGZB 5E8DL 1I3GH 5FOBA 3K80A 3QXWA 3ZT5A 3C5SB 4U0RC 3DX8B 2RCSL 1OWRM 2GT9B 1MUJB 1VEMA 3IDIB 5HHOA 4QRRE 3QHFL 5KVFL 3OHXA 1UYWH 1P4IH 2PYEB 4P2RE 4GW4B 2NY4C 3RIFF 2L4OA 2Q8AL 5EULV 3V9FA 5FXCH 4MB3A 3CC5A 4PJ5D 3FMGH 5DMIL 1A0QL 2OTPA 4JQIH 4I3RH 4AEFA 4FRWA 4RX4A 1VFBA 4HHAB 5DHVA 3KPOB 5DRWA 1KB9J 3ULUL 5CJOL 2XY2A 4K94H 4LAJH 1I8LC 1RFDH 5EU6A 4JFOB 3G5VA 3ARTA 5IROC 3MLWH 3GUTB 3KYKH 4PV8B 3CUPA 2L7UA 2W9DL 2Y5EA 2ATPA 5DMJB 5D72L 4UT7L 4KROB 4RBPH 2IH1B 4LLWA 5EUOA 3C5ZB 1J0HA 4PJAA 3OWEA 2UZXB 1JP5A 2PTTB 4PRAB 3BIKB 2OK0H 4RGMC 3ARGB 1HDMB 2D31B 4PJGF 3QUMB 4QHKI 4HWBA 1HILA 2X4PB 1JPSL 2XTLA 4XC1L 4FZ8H 3UTTE 2ERJC 5MHSE 3SE4C 1ZT7A 2AJYL 5I8OL 1NMAH 1EXUB 2AJUL 4I48A 4HCRL 3RWFB 4JFZL 1P1ZB 3QFJD 5EU5B 1SBSH 2IFGA 3ZLQC 1DBAL 5CSGA 32C2A 4FZEL 3LKQA 3PABA 4YHIB 5JHDA 1OP5H 3MUGA 3UTSB 3KNBB 3CLFL 2GK0B 3EFFB 1X5KA 1FO0B 2OS7A 3P73B 4ZFZA 2X6MA 2NY7H 2C1OB 2EEAA 3G6JF 3T3PE 3NIGF 4EVNB 5GRUL 1LK3H 4LCCA 5JUEL 1KC5L 2JJSA 1KELH 1DE4A 3FQTA 3IAQA 2DIAA 1TZIA 3AS0A 1HHHA 3QIUD 4HKBB 4NP4H 1QRND 4PD4K 4GRWB 2P46B 4XMPH 2IEPA 4YUEH 1D9KC 1H8NA 2R0KL 5JOFB 5T1LD 3DSNA 4WW2A 4L8DB 3WKMH 4C56D 5HY9B 4MQSB 3U7WL 2C3XA 4TVSa 2XQYK 5FECA 1N5YH 5BVJA 4R7NB 2BVQB 4JO1H 5EPMA 5DWUL 2PN5A 1RIUL 2P5WA 3O2WL 5I9QC 5A3IC 1HHKB 3NFSL 1XGUB 3DYPA 4L8CB 3DBXA 5B38A 5FA4A 1NUNB 1G0XA 4E9LA 2ZUWA 1OGAB 2I27N 1EO8H 4A6YB 2HT4C 1Z2KA 3VFPB 1GXEA 3CX5J 4Q6IC 2CRZA 5E2UH 5B4MC 3WFEL 1FAIH 2XXCB 1J1OH 3TFKC 4CNIA 4HK0B 3QUZD 3H42L 3CSPA 4HG4J 3TIDB 4QYOB 1CGSL 5AYUH 1C5CH 1FGNH 3QIBA 4N5ED 1SBBA 2BRRL 2Y9RT 3LCYA 3BEVA 4GKZB 5D7IF 4X0KA 5LXGH 1YEKH 2DQFA 5JW4R 1LP9B 2V6HA 4PJFA 1B4RA 2YD2A 2VLLB 3TV3L 4NNYA 4HPYH 4J4PD 5I8CB 1CCZA 4IMKA 5CGYC 5SWZE 4ZTPH 4PJ5B 4BFEA 1K8DB 3NIDE 1CBVH 3P2TA 1F4YH 2QEJA 3OX8B 1BQLL 1KEMH 1Z9LA 5ANME 3EJYC 3S3PA 1MJJA 1AO7E 3D48R 3TO4C 1Q0XH 3ZKXB 1MI5D 2VXTL 4N8CH 2D7OA 3MNZA 3BWAB 3VG0H 5IV2A 3MACL 1U8LA 2FEEL 2HG5A 3LKPB 4NFCA 4DQOH 5T5FH 1WJ3A 1K6QL 1PEWA 2DAVA 4GAGL 4V1DE 4PJIF 4Y0GA 4HKJB 2YD7A 4NUJA 1EVTC 2A9MH 2R4SL 5TDOB 4DOHE 4Y2DC 4PG9B 4ZDHA 1BOYA 5E4EC 3LN5A 1ZHBB 3T09A 1DUYA 2NXZC 4JFFE 5ENWA 5ERWA 3KR3L 4GW1B 1LEGA 2PYFB 1IEHA 3QFJB 4K55A 4XPGH 4YHMH 3LKRB 1T5WA 5D2LA 5F7KC 4DK6A 1HCFX 3QI9D 4P48A 3TYFA 1WFNA 1PG7W 1AP2A 3GFUA 3LRGA 4KK9D 4NBYB 5HDQL 4NOFA 3VFNA 4JFYB 1MVFA 4O58L 1QSEA 4O5LH 4ZNCD 1UB6B 4MXVF 4DKFL 3GI8L 1YNLH 5TE7L 4OGYL 4XNMB 1EFXA 2J6EL 1QRNB 2F5BL 5LG1A 3V4PH 4JPKH 5EBWB 3ETBF 1FV1A 5C0CA 4HH8A 4YAQA 1KCUL 5DVOA 1MAKA 4Z7QE 1A8JH 1GGCH 3V52H 5C0AD 5DLMH 4X4XA 4DUVA 3S97C 4C56B 4HFUH 4H1LG 2YWYA 4PRPD 3FB7B 1CYGA 4GRMA 4MQ7B 4PGBA 3MROA 1EJOL 3GSVA 4KRNA 2IFFL 1MFAH 3RZCA 5EZJA 2W59A 2WK2A 4XBGA 4D0CB 1QBML 2JJTA 3PWJB 4M93B 4JCLA 3WJLA 4ODTL 4MB5A 1FFPB 2FGWH 3UPAA 5I18L 4QHLA 3WO4C 1PZUB 2A83B 1X7QA 2HVKA 3QWQB 1RUQL 2VKWA 3BD5A 4GKOA 5F6HJ 5TF1L 1BHGA 4AT6A 3NPSC 2RBLA 1QSZA 4MWFA 2ZOLA 4H5SB 4CDHA 1MCFA 3HG1D 4I18C 5ID0B 3JSSA 4OM0H 1MCKA 1QYGH 4TTDC 5I75B 2VLME 4ZMAT 4DGVL 4XWOC 3TM6A 4OF6A 1TJHL 2X4NA 2I5YL 2EC8A 2H2PC 5FHBL 3MJ8B 3QEUB 5GGTH 4GKNB 4XP1L 4P4RB 2VMFA 2NY0C 3FB8B 1T7XA 2K3TA 4AEHH 3V8CA 1MCPL 4R6UA 1A4JB 4OM1L 3IT8D 2JCCA 5F7DA 3GSNH 3V0VA 1Z9SA 4YLQT 3SKOB 4HBCH 4KTDL 1D3CA 4KFZC 1TCRB 4PRBA 3WNNA 3SDCD 1U8IA 4DTGL 2H8PB 4OBRA 2YK1H 3KYAA 2V2TA 1SEBA 1A6TA 4BZ1H 2EXWD 4G6MH 4X8JA 3OPZH 3RL2B 3C9NB 1MI5B 5CS7A 3P4OB 1RZJC 3FFCA 4F7PB 4PJCA 4R90L 4RGNE 5DJZB 4Z7WB 4UTBL 4LEOB 4S1QL 3ZDYF 1FFOB 5FF6A 5GIRB 1JPTL 1QLFA 1KPRB 5HVGB 1IEAA 4LCWE 3MCLL 2EH8H 4ISVB 1JGEB 4MD5A 1C5BL 1YY8B 3GMPA 1ZOXA 4D9LH 1G6RA 1CDHA 2EYSB 3JWDH 1UWEH 1T04B 4JAMB 1AGBB 2EDTA 4JHBA 3VE0A 3ULUE 1FC2D 4WHCA 5ITFB 3MUY1 3DX9A 2VZ1A 4N0CC 1NKOA 3FN9A 3QI9B 5KW9H 1JZ3A 1FBIH 4LNRB 1N6QH 1FORL 1S78C 2MSPA 3T65B 2AXJA 4U6VH 1RZ8B 1BIHA 1C5DA 3QUYA 4YXKH 1HZHH 3MRQA 2OQJB 2BC4B 1RZKH 1OPGL 5DTFB 3T0ED 2XZCH 4BH7A 4OCXL 3ZL4L 1E4KC 1HWGB 3QXAA 4MA3B 4PJ9D 2HTKD 2HWZL 1RULL 2I07B 3K81A 3QDJD 3QCVH 4Y5XC 5C0AB 4P9HC 2XRAL 3O4LE 5FYKL 1Q1JH 5CP7B 1NGXB 5F7WC 5J89A 2V7NA 5I1DB 4PRPB 1BJMA 1HOCB 4FNLL 4KRPD 4UUJA 5A16A 2QQLH 4U6YA 2PO6A 3BZ4A 1OAUL 4WV1A 1UB5B 4E0RA 1NCCH 3RWIB 1F42A 4OJFH 4UILH 2EKSA 3NABH 3RVXD 1J8HA 3IDNB 1DBML 4FA8A 1BGXH 3MREB 1T1ZA 3ZO0A 2YPVH 5IHBA 4POYA 4NZUH 5GJSL 2XQBH 1ZLUK 3HG1B 5IGXH 2CKNA 1CK0L 2VXQH 4M1DH 3N1QC 4WUUD 1MQKL 5HHVL 3FN0L 3RWCB 4QRRA 4JFED 3VJ6A 2XPGA 3QNZB 4P2RA 4WTWA 3W9EB 4G8EA 4LLAA 4LSTH 4H20H 1MREH 3AVEA 2ADFL 1UM6H 1A3RL 3UEZA 3EGSB 3ORJA 5LGJB 4QF1B 4M6NH 4L4TE 4TPRL 1IAOA 3MCKB 1S7VA 2DKUA 5FO9B 1YDPB 4HULB 4JPIB 3GNML 2GJZB 4WI8A 1DL7L 2AJSL 5DRXB 3QWOB 4WWKC 7CGTA 3K8MA 3QIWD 2P24A 3U46B 1NBZB 2FATL 2XN9E 4WI9A 3W9DA 3AAZA 5C9JA 5H2BA 3DRTB 4IRJC 1OAYL 5C0JB 2DQIL 4KY1L 4BUHA 1GC1H 4AM0B 3IDXL 1BVKA 3UTTA 4M1CD 5KG9B 4OIIL 3MNVB 3B6SB 4TQEH 2QKIA 1BJ1J 4I9WE 4PJGE 3MJGX 3D39A 3STLB 3VRJA 5FCUL 5T33H 4BSWB 3DO7A 5DD5L 5KS9E 3ILQD 3O8XA 2NR6D 2ZOKA 5ACMA 1IJ9A 5F7LB 5TDPA 1MLBA 1BFVL 3E8UH 4UBDD 1INEH 1P4BL 3KPNB 3IVKA 1JN6B 4KHTH 5I8KH 2AXGB 3X3FH 1GPOH 1T5XB 4NKQB 4PREB 1S7TB 2ZUTA 3SJVE 4G6AD 1BFSA 2ICES 1BPVA 4RISL 2PF6A 4FP8H 5GS1C 3W11C 2QSQA 4TSAL 3BP6B 2C3WA 2WWKT 4OT1L 3ULVH 5J12C 5JMRA 3EJZC 4FQHB 3PP4H 4WGVB 4P9MH 3T0EB 3WE6B 1KBGH 4JREC 1IKNA 2BMKB 1SMOA 4X98A 5D1QA 4ACPA 2Q7YA 1XIWC 3ZDXF 3BAEL 4PJ9B 1GGIH 4C58B 4KJWC 4OD3H 3QDJB 1RZJL 2CR3A 3THMH 3AS3A 2DJ4A 3RI5F 1OAQH 1U91A 5C0BB 5IEHB 4KRPB 1CU4H 4ZS7H 3HNSL 3EO1A 5L6YL 5ESAA 2GJJA 2DKMA 4ZO8A 3QNXB 1P7QD 5C7XH 1QA9A 2F53E 2BNUA 4QXUH 3H9ZA 1O7SA 3O9WA 3KDMB 4I0PC 1XF2B 5D1ZD 2LU7A 4QT5B 3LKSA 3GBML 5DS8A 1I3UA 4C54A 1IL1B 5BRZD 1YEFH 2XZQH 3BRDA 4EI6B 4WUUB 1FYTB 3HCVB 4URTB 5LGHL 1IFHH 4JFEB 3ARSA 5D2NB 1EEZB 3OGCB 4D3CL 1RK0A 1ZEAL 3LD8C 1S9YB 5DJ6B 4YBQD 2DYPD 4K23H 1G7LA 3BH9B 3LQZA 3QQ9D 1BFOA 1RK1A 5SWZA 3FO9B 3LV3B 1X6LA 3P3YA 2RGSA 5GGQL 5D7IE 1H3WM 1MF2L 1XAUA 5IFHH 2AI0L 3HE6C 5FUCC 5ANMA 2DD8H 3S4SA 1A6ZA 1AO7A 2EE9A 4LSRL 1BJ8A 5I1AB 5GRVK 3QIWB 5JXEA 4XWGL 2W9LA 1U93B 5AWNH 4HXAH 1EZVX 2X89D 5KN5A 3SKUD 1NCAL 3LS5L 1FNEB 2APFA 5EBMA 1PY4A 3VCLA 3BJLA 4V1DA 1TQBB 2ID5A 2GFBB 4TSBH 4TRPH 1EVUA 4RRPG 3MRFB 4PRHD 1E4XL 4UDTA 1DBJH 2HA1A 3MO1A 4XGZB 1KLUA 1OD7A 3QUML 3CZFB 5DQDL 4OZFG 4Z78A 1I9JH 3WFDH 1JFQH 5T5NF 4PRNA 1BVLB 5BZDB 3NH7L 2P44B 3I2CH 1NFIB 2Z92A 4WENB 2D7NA 2ZKHL 4LQFH 3QJFA 1KB9K 3DJ9A 3OR6A 5E94B 3RPIA 4ODBD 4LCIL 4HZLA 1IM9D 4OCRH 1WBZB 3EO0A 2E9BA 4EN3C 5GGRY 1TVBA 1MVUA 5SWSE 3FOLB 2AEPH 4AL8H 1KOAA 4L3CA 1FO0L 5GSVA 1AGFA 5E6YA 2VDPL 1R5IA 1T80A 4LCYB 4QTHA 3DUSB 4NGHH 3QDMD 3TCLA 5DRNB 3RY4A 3MRMB 3QP3A 4JKLA 5JQHC 5TFSH 3FOMB 2BNRD 1ERNA 1WISA 3HI5H 4Y16D 2CKBL 1WAAE 4HUUB 1YN6B 1S5IL 1OM3L 4OI7A 4XP9L 5AZEH 3TT3H 2IALA 5TE4H 2OTWA 2XA8L 2WUCL 5D7JC 2OX5A 1EFQA 3NBNA 2HVJB 2IMNA 3LKNB 3HMXH 3KYMB 4WFGE 4ODWB 4D9RE 4JG1H 4MVBC 3HI1A 1I85A 1HYSC 3H7BB 1J7VR 5E03A 2FLBT 4E5XA 3IRZA 4PV9B 2ILLA 1FE8L 4BQCA 2UYLA 4GBXC 4JHWL 4M43L 4A6YL 3WL9A 5MEND 1ULVA 4LLYB 1ZK9A 4LAQL 3FRPA 4XCCH 2PXYC 5D93C 1J1PH 1CFVH 3MZGB 3PGDB 5ECJE 5K9JL 3KHQA 3KYOB 5D1ZB 2UY6A 2IC2A 3JWOC 2Y25A 3ZTNL 5E9DD 2X4QB 4CGTA 3O3DA 2NLJA 4BH8B 5BRZB 5GHWH 4LU5H 4F7EA 2VLKE 4KUCD 4H1LA 5FYKE 4LL9A 2J88H 4HJGB 4OZIF 3GBLA 2VSDA 3L7EA 4XI5C 4YE4L 3D3VD 1IQWL 3FCTA 1QEWB 3KHOA 3ULSB 3RTQC 1KPVA 4NBXB 2Q86B 5F7MC 3CX5K 5IVNA 2D7TL 2X9YA 5KANI 3PDOA 4N9OB 1RUAH 5MP6L 2X7LA 3TIEB 3W0WD 2R69L 3HC4H 4HGMA 3SQOH 1JPGA 1UM4H 2EE6A 3AREA 3CK0H 4YDIL 4X6FA 5FUOH 1KN2H 1XZ0B 1NCDH 2UUDK 4LCWA 4PRHB 5E08L 2UZIL 3PWVA 1F6AA 4HIHB 5E5MA 3ZDYE 2P49B 2XWJA 3QQ4A 1KGCE 2VXSH 2VZUA 4IRSC 4I5BA 3DIFB 4GMTL 4RWYL 3T1FA 1QG3A 3U0WL 3CMOH 5DEGA 2AJZA 1LDPH 3T04D 3E1F1 3LB6C 1IM9B 3BZEB 4U1KA 5M94B 1YECL 5J7CC 5ID1B 3BPNC 3FQRB 1HH6A 5EO0A 3WLBB 2A6DB 1NAMB 5DA0B 1UACL 3MLVL 1RUKL 1MCIA 2P42B 3P0GB 3FHAA 3WIIH 5IOPB 3LPFA 1ONQA 4KKCD 2YSSB 5TH2B 3QDMB 1CE6B 4HCRA 4NQXA 3PDGA 3VW3H 1F90H 2PUQT 1N0XL 2Q6WA 1G7HA 3K0WA 4CVZA 3O4LA 2Q3AA 3P4NA 1B3JA 4HH9A 4P46D 5KSBF 1IE5A 4XMLH 2I26N 2BNRB 1MLCA 5AUMB 2PR4H 4Y16B 3KXFE 4ODUB 2X4UB 1KYOJ 1JGLH 1CFSA 4J3XA 3MUZ1 3DPBA 2ICWJ 2X42A 5DHVH 4N0FA 4Q6YA 4TNWF 5HHME 1YN7A 5GZOC 1JWMA 1ACYL 3U9PH 3QXDB 3IKCB 2AV1A 1ODAA 2FX9L 5MENB 1WC7A 4PLKC 3GEWB 2H45A 3GKWL 1A7RH 5MEQB 1L6ZA 3TO4B 3D0LB 4K9EC 4L4TA 4WIQA 1L9MA 4HWBH 1XGRB 3HS0A 4HLJA 5E9DB 3MLUL 1FHGA 3F12A 3NA9L 5JW4M 1IGJA 1U3HC 1N4XL 3OR7A 1T1XB 1CR9H 2DLTA 4TUKL 5HGBB 3RGHA 3TA3C 1FDLH 1K5NA 1T21B 4LDEB 3D69A 4HW6A 2XN9A 3D3VB 3P11L 3S35H 4XCNB 5E4EB 2DQJH 3VFSB 4PBVC 1A5FH 1G0YR 2J8HA 2NXZB 4TNVK 2PW1A 2B0SH 4HGWB 4PGDA 1FZKB 4PIRF 2MCG1 4QXTB 4KZDH 4PG2A 3C6SA 3OMZA 5I1IH 2WIIB 4X99A 3O3BA 3FT4A 3LIZL 3HZMB 5IJKC 1VGKB 2DQGH 3QUXD 4NT6B 5I30L 1FZOA 2J7LA 3W0WB 2DIBA 1VGEH 4K94C 2XTJD 3EO9H 3MJ6A 2F8VA 2V2XB 1I7RA 2FD6L 1I3RA 1R5WB 2R29H 3NN8A 1DN0A 4E41A 4HPOH 5F96L 3P0YH 4AH2A 2PYEE 4P23C 1ETZB 4NRXB 5KS9A 3VXRA 3MLYH 1SM3L 2VLJE 1A22B 3A67L 5IBTL 5L8JB 4FQXA 4OLXL 4GRLC 3BZFB 5C0RH 5DVNA 3X13B 3BOVA 3IFLH 4NOBA 5JORA 3WNOA 1H0DA 3EYQD 3SJVA 2YPLD 3K8LA 3O6KL 3HB3D 5EWIH 5DZNA 4QCIB 2JELL 3RWGB 1A9EA 3BWUC 4KKBC 3OV6A 4U1MA 5E2JA 1FZJA 4PP1D 4GXVL 2DDQH 2ZSVB 4OGXH 3ZTJH 5ITBL 1TITA 2YUXA 1HKLH 5E8EB 4EZMA 5D1XA 3EOAB 1LO4L 1MCSA 1MPAH 1HSBB 5BMFL 1DQJA 3L3IB 1SQ2N 3U7YL 3G5XB 5CBEB 1WWBX 4MXWL 1RV6X 4OLYL 5J6GB 2AV7A 1AI1H 2JB6A 3FO0H 1RZGB 4P46B 2NY1D 1C1EL 3L1OH 4ALAL 4D9QE 1UENA 2CMRL 4OD2A 3UTSE 4XPTH 5ADPH 1PG7L 2H6PA 1KXTB 5FGRA 1JV5A 2V7HB 1NCTA 1ZWIB 2F53A 4LPWA 8FABA 1T1WB 2J6EA 4ETQB 1OHQA 4N90E 1QKZH 2QQNH 2UVEA 4JFPA 4JEGB 2VDKH 2SEBB 2DWDB 4JY4B 4U3XA 4G7YL 1EX0A 3MRRA 4GRWE 3IFNH 1AQKL 1HE7A 2PW2A 5ETUA 3C08H 1FZMB 1MFCL 1GAFH 1F4XL 5JOPE 3ARFD 4ZQKA 1KB5B 3MRDA 3VXME 1JYXA 3QB7C 2YEZA 4RFEB 2WUBH 2DQTL 4OD1H 2FO1A 5D7IA 2E6QA 4YHOL 5EORL 1LEKA 3WFCL 4WFHE 3UBXA 3FQNA 4LPXA 3HZKA 2W0FB 2EDQA 4WTZG 4DFIA 3RDTC 1GGYA 3ILPB 4HQQL 1JPFA 4JRWA 3MFFB 1FVEA 5J3HD 1FRGL 1OGAE 4HIEB 1ZVYA 1CGTA 1JYNA 4GS7B 4KHXL 3MLXL 5C0NC 1QSFD 3GJFK 1EBAA 2BJML 1AHWA 3PNWA 3NCFB 2F5AL 4JZNB 3QUXB 4QHUB 4AY0A 3T0XA 3ARVA 2NYYD 3D0VA 3WNLA 3SPVB 3O6FC 1UVQA 2XTJB 2OZ4L 1ND0A 3CVIH 3FB6A 3KYNA 3UTZA 4XP5L 2OL3L 2YZ8A 1ZGLA 3PWLB 3OF6D 1S3KH 3MODL 1OTTD 5AAWA 5MI0B 2B2XL 4RQQB 4Y4KD 5GGSB 4EI5A 2GSIB 5EB9A 1U8JB 3UJJL 3TC9A 4TVPH 1LP9E 4O9HL 1IAII 3U7AA 5CZVH 5C3TA 5SWSA 4MA1C 1HYRC 4NO2B 4PJ5E 2VR4A 4UQ2A 5IB5B 4K9EL 2GW5A 3CU1A 2A73B 3IU3A 1M71B 2YPLB 2D7PA 3KS0H 4JY6B 3OKLA 4AIOA 1CT8A 3WS6C 2AS5M 3MNWA 1XF1A 1A9BA 2WINA 4MSWA 1QQDB 3CFJA 3QYCA 4YK4C 4KU1A 2WQ8A 1VKXB 1WAAA 3MA7B 2ZNWA 2H2SD 1X9QA 4EXKA 1Z3GH 2X1QA 4ZUWB 2NY6D 1OAZH 4HWUA 4N5UA 4MCZB 4JQIL 1T66C 2QSCL 1OW0A 4LVNC 3V4VH 2L0DA 2NY1B 1MRDH 3QFJE 4U6HB 5GPRA 5LCVH 1YYLH 4OFPA 4K94L 3QISA 1PD6A 1UXSB 6CGTA 3LPGA 1A6VL 2K1MA 2QHRH 1RJLB 1NFKA 1IT9L 3MZTA 2E9JA 2HJLB 1Q9WA 4WWKB 2OK0L 3VWKD 5C0FA 4S0SD 1G1CA 5HSFA 1AIFA 2CLRB 4NRYB 3G6AB 1F4HA 3OB0K 3WS3A 3RWDB 3T4YA 4G8GD 4Z76B 1QRNE 3HAEG 4QTIL 4KQ4L 4PGCA 5CSZB 1BREA 4OUOA 3ELAT 4ZOEA 5DYOB 1GSMA 3I6GB 1NBQA 5EZOH 1MHHA 2I9LA 3ARFB 1K8IB 4YDLC 5IBUB 3QDAA 4C56E 1P69B 3QT2A 3D18B 5DEFB 4OFKA 3SGEI 2DF3A 4JKWA 5HGHB 1G6RH 1RJZA 2VITB 4X9GA 4XP4L 5DK0B 1CDYA 1T4KB 1F8TH 3G6DH 2P4AB 2I60L 2BNQD 5JMOC 4OAWB 3PJSA 1PZ5B 3U4EB 4MJIB 5KSVB 4YDKL 3CVHB 1KELL 5ALCH 1GZPA 4M7KL 1L7TL 3H0TA 3ZT7A 1FC1A 4NP4L 4HS3B 3HC3L 1HSAB 2YUVA 4XMPL 4KV5E 4EN3D 4NDMB 1QSFB 4ZAKD 3C2SA 3WCYA 2A1WL 5DI8A 3QG6A 5DRZA 3WKNA 4PRDB 1ORQB 5FV2A 4JR9L 4H0IA 4PY7A 3RUGF 4B53A 3S34H 2PNDA 5K59E 3L3JA 3U83A 5J1TC 5I2IA 2R2EB 5IVZB 1ZT1A 1JNHB 2VQ1A 4JO1L 5GS1B 3FZUD 5CEZH 5H35A 2BOCB 3UJIL 3S88L 1GGUA 4Y4KB 2YD5A 4GO6B 3RAJH 4BSVB 4GG6F 3MV11 4JREB 4R7DB 1CD0A 2F19H 3KPQB 5D7JD 3QCTH 1W72B 3LY6A 1MFBL 5HDBE 4JDZB 4YX2H 1Y6NR 3JWDC 4MA8L 3DSFH 3D2UA 1PAMA 4N0UB 1H5BA 5C0DB 1MI5E 1MEXH 3PGCB 3AY4C 2X70B 1PKQB 4XXCA 4Y88A 3RVVD 4MAYC 4HUXA 4M4RA 1FGNL 5L9DH 1T7YA 1SJXA 4MZ3A 5LJYH 4OKDA 3NCYP 1MRFL 2HMIC 4WO4C 2I24N 5EU3B 2VDQL 5C0GA 3KXFA 3KPSD 4FMFA 1QFWM 1YEKL 1YYMH 2YD3A 5KSBE 1OQOA 3IJYA 3BVNA 1ZA3A 2DL9A 1HEZA 4RFNB 1RZKC 5J11B 5BQ7A 1IAIH 3IJHA 4OIAA 5IQ9A 1Y18B 1WTLA 1KEML 2F54E 4MNQA 4LDLB 4XVUC 3ECBB 2M1KA 5IB3A 3PHQA 3L9RB 4PGEA 2ZCHL 4KKLD 3ARZA 2BY3A 2BDNH 4DZBB 1NANI 3ROLA 3TBWB 2VXVH 3VGAC 4MD0A 3M1BB 5FDWB 2IGFH 2DLIA 3OKDA 2BSRA 1YJDH 3OAUL 5AD0B 3VWKB 4BKLA 3V79C 4C59B 4G8GB 4DGIH 1WBXB 4Q9QH 5B21A 4OZHB 3GJFA 4M62H 3G5ZB 4WY7L 5DGRA 3QCUH 4LPYA 4RMTA 5F6IC 3SO3B 1U41A 3MRCB 4M6OL 4K71B 5EO9A 4XBPA 5C0AE 1JCKA 3QWRD 4G80A 2AGJL 2AABH 1T7VA 1ACZA 4UINH 4PRPE 5T3ZD 3VRLE 1KLGB 4MLIA 4KK6D 5C08D 5DFWH 3WFBH 4XHJD 5CHNA 1V3KA 3L3GB 4NQTA 1OT2A 1M6OA 1IC4L 5I1LA 2NCMA 3EYUL 1C12B 1NGZA 5E2VH 1MHPL 1UM5L 3L3HB 3V7AE 2Q87A 3HE7D 4LKCA 3C5SA 3DX8A 2GT9A 1MUJA 3HG1E 2DM3A 4EN3B 3IDIA 4HT1H 1DQDL 4ZAKB 4M7JL 3TBYA 4UTAH 2PYEA 1GGCL 1JNNH 3MX0A 4PJXB 5DFVD 2DMCA 4GW4A 4OFVA 2YA1A 2Z9TA 4LVHC 4NO3B 1FG9C 1A02N 1GC1C 2VLJA 3SKJL 3MRLB 3VWJD 5FB8B 4GKSB 4ZODA 1S7UB 4RAUA 3SGEH 2DMKA 3W5NA 2FGWL 2DMBA 3UCRA 5C70A 2B4CL 4YBHA 4JFOA 3TBTA 2Q8BL 3CFDB 2R2CA 4Z7VF 4PV8A 3SDDD 4YDVB 2EDFA 5D7JB 4ORGB 1LVEA 3C5ZA 3MRPB 1NL0L 3MV7D 1WCBB 2BVYA 3U0TB 2PTTA 5CD5C 4PRAA 3BIKA 3RX7A 5T1MB 1VESA 2D31A 5DT1L 3QUMA 2CIIB 2DOCA 1FLTX 4R96A 3X3GL 4LHUD 1NAML 4YHPB 5GGTL 1A7NH 3AS1A 2LTQB 4ODSL 2W9EH 1EXUA 1NAKL 2X4SB 3RWFA 1FFNA 4N1HB 5DZLA 5ICZB 2VUYA 1JZ2A 1A2YB 4KJQC 3KPSB 4YHIA 5KOVC 1NC2D 2GYSA 4RDQF 3UTSA 3GM8A 2CO6B 3EFFA 3ULVC 5JXAH 2M26A 4BK5A 4JZOA 4B5EA 1FO0A 1G1YA 3P73A 3R0MA 2GITA 4PJBF 1VFAB 3CXDH 2C1OA 3WUZA 4R0LC 4BK4A 4EVNA 4HS8H 3C60D 5DD3L 3TH4T 3OPZL 5DDHB 3WEXB 2V2WB 3WUWG 4HKBA 43CAB 1IKFH 3KLDA 5F44A 4YPGB 2HKHL 4OSUL 4KUZH 3SGKC 1JTTA 4HUNB 2R0ZH 2Y06H 3N50A 3WV0A 5HVWA 2DTML 3NZHH 4ZFOB 1J0IA 5ILTH 4WCYL 1GHFH 3LAFA 3HC0B 4L8DA 1TTUA 5HY9A 5C0EB 1G7MB 1QLRB 1ZGLP 15C8H 1AR1C 4R4FL 4M6ML 4R7NA 2BVQA 4K7PL 1DCLA 2CH8A 2VLRD 5J4MA 1KYOK 3BDXA 2WBWB 4YHZH 1PYWB 4W4NA 3EFDH 1XGUA 3T0AA 3EYSH 2WSKA 4L8CA 3GSQB 3TH2T 2HRPH 3WJJC 1OGAA 5C08B 5IKCA 5EA0H 4A6YA 4QY8B 3MOBH 5C07D 5TGBB 2BK8A 4R3SA 4OFYD 1F02I 1T6VN 3CFEA 4PJDF 4YHNB 3HE7B 1NANH 3TT1L 1KIPB 1N5AB 1NKRA 4ODXB 3TIDA 4QYOA 2CXGA 3A6CL 5KSUA 3STZB 1U3YA 2FSEB 1G9NH 1OARH 3NACH 3VXPB 4WUUE 4XCYA 4JFEE 1SEQL 4GKZA 5D2NE 1AY1L 1T0NB 1LP9A 1IGCL 1K4DB 1F2XK 5I8CA 2X44D 3VWJB 3EHBD 1NCCL 3BP5B 4PJ5A 4OJFL 4WTZA 5CJXC 1K8DA 3EW3B 5BO1H 1I7TB 3NABL 2DWEA 1FL3A 4LHJB 3OX8A 3EDKA 4P3DA 2YRPA 1XGQB 3PL6D 5E99H 1CFBA 2VISA 3GMMB 4EOWH 3DXAD 5F89B 4W4OA 5HI3D 4NZUL 1UZ6F 3SDDB 2EDHA 1I75A 1PX4A 3PG2A 3BWAA 1KJ3L 3JVGA 1XGYL 4KMTL 3DMMD 2C9AA 3VI4F 5EOCJ 4GFTB 3GMQB 3LKPA 2VXQL 1VCAA 2OMNA 4JFDD 5LKNA 1PJ9A 5TDOA 4GXUM 4H20L 4NN6C 4R9HA 4PG9A 1OAXH 4M9OA 4LHUB 4LIQL 5DA4A 3NTCH 4JN2B 1ZHBA 3IKKA 1QLEH 5J57B 4GW1A 4ZO9A 1BM3H 2PYFA 3DV6B 1C16B 1RUPL 1FCCA 4XVJL 4H1LH 1XGTB 3QFJA 4OGAD 4Y4HC 4CMMB 3RVUD 3LKRA 5DUPL 4XCEB 3UAJD 3RGVC 2GSGB 1KIUA 4BJLA 5I6XB 1NC2B 4PJ7B 2HJKB 2IBBA 1U8QB 5CGTA 3SE3A 1HQRA 4KI5D 3O2DL 1IGIH 5TQ0H 4WWID 5CLWA 5FM5O 5E8DH 2A74B 1EDQA 3DTXB 1GC1L 1UB6A 2FEEI 2GAZB 4TUJA 1SHMA 1AE6L 3UTQB 3QIUA 4LPTA 2RCSH 3FB5B 1QRNA 1N59A 3FL7A 3QO0B 1JUFB 1EHXA 5EBWA 1AGCB 5IB1A 3RBGA 3QHFH 4Z7OE 3OL2A 5KVFH 5T1LA 5ACZB 1GRWA 5JPNB 4C56A 1Q8MA 4AIZB 2R2HB 3F65A 5HI4C 2Q8AH 3RPKA 3FB7A 4MQ7A 3VGDA 4FG6D 5EOTB 1KB5L 1C08B 5T1DH 5DMIH 3GGWA 1A0QH 4S0TD 2VC2L 5IBLC 4D0CA 1VEOA 3PWJA 3ULUH 2KZWA 1FFPA 4JKMA 4KHTL 4OF3A 1Q9OB 2A83A 3X3FL 3VFTA 4AEEA 5E8PB 3VFRA 4U4BA 5DJXB 4Z0BL 1G7IB 1MELA 2W9DH 4AEIL 2E7BA 4UT7H 5ID0A 4JY5L 4QRUB 2MJWA 3OKMB 2AXFA 2Y6SC 2VABB 5C07B 3J8F7 4Y89A 1CZ8L 3OGOE 1JPSH 4LF3B 1LEIB 3C5JB 4P5TD 3QUZA 3X11B 3HHRB 3MJ8A 3QEUA 4JO3L 4GKNA 4P9ML 2HTLD 4PLJC 4P4RA 5I8OH 1ZHKB 3FB8A 2AJUH 4HCRH 4F15B 3PF2A 1CDCA 3RUGE 5L88L 5DD0L 4FZEH 2FX8L 4DN4H 2IANE 3SKOA 1OAQL 1J5OL 4NC0B 3CLFH 5C2UB 1TCRA 4J4PA 4I3SH 1MCHA 3VXSE 3TPUB 2WAHA 3UBXI 2JIXD 2H8PA 3B9KC 2LABA 5GRUH 3DUUB 1T66D 1KC5H 5JUEH 5I71B 2E6PA 4ZPTB 3PL6B 3RL2A 3C9NA 1MI5A 3P4OA 3DXAB 3JUZA 4U1SB 4F7PA 1MCOH 4FXKB 1BF8A 5DJZA 2ENYA 4FQJL 2IPUG 4Z7WA 4LEOA 1YEFL 2R0KH 4ODHH 1JBJA 1BQHB 1IFHL 4JFDB 1FFOA 5GIRA 5D71L 1KPRA 4LKXB 3U7WH 1MHEA 1LHZA 4RIRB 3MRIB 3MLSL 4IS6A 3INUL 2BVEA 1C7TA 5DJCA 1ZHNB 5DWUH 4JAMA 1T04A 1RIUH 1FQ9C 3O2WH 1AGBA 1JYWA 4D0BA 2QV2A 3JUYA 3NFSH 1ZANL 3S3SA 5DJ8A 4HEPG 4U2YA 1DVFD 4NKIH 4PR5B 5ITFA 3UC0L 4FTVE 2E7HA 4OV6F 1WWCA 4LLQB 5J9PB 1Z0NA 4NIKB 4CL7A 1OTUD 4W68A 3IB4A 4HKZB 4P4KD 4IBLT 1RZ8A 3WFEH 3GK8L 4Y8AA 4TSBL 3GBNL 3H42H 3ARDD 2BC4A 3DVGB 1DBJL 5DTFA 1CGSH 4EIZC 3QXUA 2ESVE 2R15A 4PFEA 1TVHB 4OLWL 2BRRH 1EUUA 2F9BT 1I9JL 4KK8C 5F21B 2A38A 4H25B 5C0AA 1WUNT 1G7PB 2F15A 5CP7A 1NGXA 2YD9A 5I1DA 2NTFA 2BNRE 4PRPA 3TV3H 1HOCA 2EXYD 4WJ5B 1RI8A 1UB5A 3RWIA 2XFXB 1Y0LA 5CMAB 4XH2B 4X83A 3IDNA 2VZTA 1Y6MR 2YOCA 1BQLH 5DUML 5EC1A 2H1PL 1CLCA 4M1GL 2VXTH 3VRIA 1RSFA 4XP6L 1KJ2B 3RJDA 1A3QA 3HG1A 3MACH 2RFXA 4K3HA 4MA1B 3RWCA 1K6QH 1IGYA 3GSWB 1WQVT 1AD9B 1WFUA 3QNZA 5MENE 1KUMA 5TFSL 3V2AR 2R4SH 4Y5YB 5CEYB 4P5TB 1P6AB 4OGZA 3EGSA 4NQEB 3KR3H 3QUKB 4NO5B 1WIUA 2E3VA 3MCKA 4OLVL 2KPNA 4XTRC 5FO9A 1YDPA 4LCCC 2JJSC 4MAYD 4JPIA 2IJ0C 2Q76B 2GJZA 1HK6A 1UFUA 1OWWA 5DRXA 3QWOA 1KIQB 4WO4D 4Z7NF 3L5JA 1NBZA 2AAVA 3D3VE 1FLRL 3SDCA 5HDQH 2JIXB 3DRTA 5K9OB 5C0JA 1SYSB 2E7MA 4WW2C 4O58H 4ZFFB 1MCDA 2H3NB 4AM0A 5K9KB 2HKFH 4DKFH 3GI8H 2ZPKL 5TE7H 5L8LB 4GW5B 1PBYA 2AW2A 3S37L 2J6EH 3FRUB 2F5BH 1MWAB 5KG9A 2OZ4A 5BZWB 5INCB 1AD0B 3B6SA 3RVTC 1CIUA 5EBGA 3W0WE 1KCUH 5GHWL 4LLVB 5DMKB 1LO5B 1KJMB 5DFTA 3STLA 2BSTB 3SGJA 2Z91B 4BSWA 1L4IA 1YMHB 1JF6A 1VEPA 5GISL 4W6WB 3RNQB 3C6LA 4LP4A 4G9FD 1S9VB 3DX7B 4FQQB 4Y1AD 1JI2A 5ALBL 4KKAC 4ODTH 2BHUA 3KPNA 5I18H 1JN6A 2AXGA 2V9TA 5JW4Q 1RUQH 5F97E 5TF1H 1T5XA 3VXNB 4NYLB 1S7TA 2XWTB 5EUOF 5GS0D 5IW1A 3QIBC 1CGVA 1R0AL 2C7UB 3V5DA 1ZTXL 1XCQB 2XWBB 4S1DD 1UM4L 1JGDA 4DGVH 3BP6A 3RVWD 1TJHH 5FUOL 2I5YH 2G75B 4EEEA 5FHBH 3LKOB 1XR9B 4N9GB 1NCDL 3ARDB 4FQHA 4IMKC 3WHXB 4LIQE 3T0EA 2WWMD 5IM7B 2FJFB 2BMKA 2HFGL 5E2TL 3MJ9A 4PJ9A 4FFZL 1NFDB 2QQKL 1MCPH 4OM1H 3QDJA 4U1LB 1DFBL 3SCMD 2NY3D 4MB4A 5EIIB 4KTDH 3ZKMD 4U3CA 2OMBA 4X5WB 4Z5RA 1EHLH 2IPUK 4DTGH 2MQ0A 4MNHB 1J87A 4DVBB 3TO2B 4JRYD 5IMMA 1DBBL 2VWEC 3QNXA 3T2NL 2J8UB 2W38A 1O5DT 3EKCA 3KDMA 5FUZL 3WN5B 4R90H 4QT5A 4APQD 1KT2B 4U0QB 1NDMA 3P77B 1IL1A 4UTBH 4S1QH 4WUUA 4WW2F 4EI6A 3HCVA 3VW3L 1YA5A 4JFEA 5D2NA 1EEZA 1JPTH 4JM2D 5LBSL 1S9YA 2VE6B 3MCLH 2XKSA 4XMLL 3U9UB 1C5BH 1F5WA 3BH9A 3WFHB 4YDJB 5GRJL 3FO9A 3LHPH 2X4TA 2YXFA 4IOFC 1C7SA 4MAYB 1JGLL 3EOBA 2VL5B 4CN4A 3CLEL 5I1AA 4WO4B 1V5JA 3QIWA 1BD2D 1LE5B 3OXRA 1U93A 3BW9B 1FORH 4DKAA 1BBJB 2XYCA 1IEBB 5EU4B 1FNEA 2RB8A 4NM4L 1KACB 2BVPA 4M7ZC 3U9PL 3MLPA 3MRFA 1CXLA 1OPGH 3VI4E 2EDLA 3RZCC 4OCXH 2FB4L 3ZL4H 2JJTC 1KXVC 3CZFA 5DF0A 1J9CT 3WJLC 1OB1B 1G84A 2HWZH 1RULH 4CRPA 2DQEH 2F74B 4X7SH 2XTJE 1J88A 3K7UA 5BZDA 5I1JL 2XRAH 5FYKH 1NFIA 4PJ8D 4FNLH 1CDUA 2HFTA 5E94A 1OAUH 3RKDC 1YQ2A 2HLFD 1S5HB 2XG5A 4G9FB 3S35L 4UU9A 1WBZA 4Y1AB 1DBMH 5E8OB 3FOLA 1VFOA 2R0WL 5F6IB 1I1YA 4F3FB 4KZDL 1DUZB 1TENA 3HRZA 3WXWH 2WBJD 3MUHL 4LCYA 1SMAA 2OP4L 5HYSB 1WWWX 1RUML 1E4XI 5HHVH 3S98A 4ZOAA 1YY9C 3MRMA 3FTGB 2KH2B 2P8LB 2W0KA 5CAYB 2OJZL 3FOMA 3QQ3B 2ADFH 4MJ5B 4NN5C 4ZFOL 1A3RH 2R29L 3ALXA 2XG4A 3P0YL 4HUUA 1YN6A 4TPRH 2HLAB 5EG6C 5IBUG 5J8OA 4MQXC 1KENH 3GNMH 4LLDB 4OBSA 5D2LF 2HVJA 3LKNA 1DL7H 2AJSH 4ZFGL 2NY3B 1N7ML 3KYMA 2G5BA 3H8NA 4ODWA 1TTFA 2YRLA 4U1IB 2FATH 5D5MB 2EDXA 5EBLB 1NGYB 3H7BA 1LWRA 1OAYH 4JN1L 4WU5B 3H9SE 4PV9A 2DQIH 5L7XL 3DETC 3CDFA 3IDXH 1CXEA 2MNUA 4LLYA 1P7QA 4UB0L 5DJYB 2ARJQ 3BUTA 3ROOB 1MCQA 3Q3GB 1MPAL 1TZGL 4MHHI 5D1ZA 3DYOA 4OIIH 4UI2A 4C83A 2IQAB 4P99A 2X4QA 2GJ6D 4YO0A 5BRZA 1AFVL 2BRQA 2E7CA 4X8XA 1AGDB 3RUGA 1ZHLB 5FCUH 3OJ2C 2EDKA 1AI1L 3F7QA 4JM2B 4RFOL 4HJGA 4WHYH 2DYPA 5JO5B 4JJ5A 4WNQB 5DD5H 1XEDA 2ZCLH 1QEWA 5C92A 3ULSA 3L1OL 4NN7B 4PRIB 3T2PA 1BFVH 3BRFA 3ES6A 3IDMB 1P4BH 2Q86A 4P0DA 3QUYC 5FYJD 5IWLA 3BMWA 3FQUB 1WF5A 2ZP0T 1LE9B 3CCHB 4M02A 1KCRL 2YWZA 1QKZL 3ZYIA 2X89A 5F8RC 4RISH 2HFFB 5IB2B 3TIEA 2EYTB 4TSAH 3KLAB 3BYTA 4OT1H 2EYRB 4IDJL 3C08L 1XZ0A 3TJEL 2PO6C 2WZPD 5FYLD 4WV1C 4PRHA 2CDEB 1CFQA 3IJSB 4HIHA 5D7LE 1DDHB 1YMMD 3BAEH 3VMPA 4OD1L 3DIFA 2JCCF 4QWWC 3GJFH 4R2GD 5BW7A 3ABZA 1FNGB 1MHCB 2FIRT 3GHEH 4PJ8B 3RRQA 3KPRE 5DJ2B 5IW3A 5HYJD 1IM9A 3BZEA 3HNSH 3NOIA 5L6YH 3SE8L 1CG9B 4CKVX 3FT3B 1ZLWK 3B3IB 3WLBA 2IMMA 2A6DA 4PJCF 1NAMA 3UX9B 3C09B 5B3JF 3GBMH 5IOPA 3OAYK 2YSSA 5JPMB 3QDMA 4MX7B 5LGHH 5KVEL 1JF1B 3LEYH 3OB8A 3CVIL 5F7UA 4D3CH 2ADGB 1ZEAH 1T1YB 3B2UC 1HHJB 2BNRA 3S9DB 1F11B 4Y16A 4MS8C 2A9NL 1BWMA 3MV8D 5GGQH 4ODUA 1MF2H 2X4UA 1BJ1H 1YJDC 3UZQA 4HIXL 2AI0H 3UP1A 3QAZB 2DN7A 1CD9B 4LSRH 5E5UB 4XWGH 3ARUA 3BE1L 3S3JA 3IDYB 3P9LB 5C6WH 2OM5A 1NCAH 3LS5H 1ZMYA 3B9KD 3HR6A 1Z5LB 3QXDA 3IKCA 5HHNB 4GSDH 5MENA 5IVXB 1ORSB 1NCWL 2LQRA 3O8XC 2NY2C 5MEQA 3D0LA 3QUMH 5DQDH 1XGRA 4G8IB 5E9DA 2R23B 2GJ6B 1KFAL 4L9DA 4G8GE 1UZ8B 4U1GC 1T1XA 3T8XB 4KTYA 3Q6FB 3SY0B 2ZKHH 1T21A 5B8CB 1K2DA 3V4VL 2VDNL 3D3VA 2QR0B 4FN0A 4XCNA 3GHBL 3VFSA 3BEWB 5DO2D 3U0PB 2V5SA 1BZ7B 3OKOA 1MJUL 3ARBD 4HGWA 4F2MB 3L3DB 1IAMA 4Z7NE 5I1CH 1FO0H 2NZ9D 2BNQE 4NKDA 4NSKA 3QH3B 4M5YL 5KAQF 1N2RB 1IKNC 1P2CB 5D1QC 3HZMA 2XICA 1VGKA 4NT6A 4HS6B 3EYFB 1NEZG 2AJVH 5FCSH 3W0WA 5I19L 3U2SB 4LGRB 4HUWB 3CH8A 1KF9B 4GRWH 5F3HA 2V2XA 3MUJA 1R5WA 5HHOE 1FNHA 1A21A 5E00B 3FONB 5CD3B 1ETZA 3LQAL 1S5IH 2ATKB 1OM3H 1J11A 4XP9H 1PW3A 3F5WB 5J06A 1YMMB 2XA8H 2WUCH 5FO8B 4EQ2A 2GY5A 2XOTA 2JK5B 4Z77B 3E6HB 4R2GB 3BZFA 3VMNA 3X13A 4X6EB 4HD9A 2H26B 4XPHL 4BELD 1T0MB 5HYJB 5TE6L 4QHKJ 4P3CL 3MGAA 4OCNC 4QCIA 3QHTC 1V7ML 1RJYB 1AQDB 2VRAA 1FE8H 4EUPB 1XR8B 4A6YH 3JV6B 2ZSVA 1R6VA 3SDXF 2O61B 4XPAL 4KAQL 1BIIA 2HJFB 3T0WA 1QFHA 5K9JH 3TNNB 1U2CA 3L3IA 3ZTNH 3LMJL 3G5XA 2GQHA 5HGAB 4WEUD 5HD8C 5JHLL 5T1KD 4Q9RL 5JXEC 1RZGA 4P46A 2M8XA 4OLEA 4Z95L 4TSCL 4YE4H 1EO5A 4R0LA 3KPSE 2W60B 3O2DA 2IQ9L 4IMLB 4UZGA 4P2QD 4R4BB 1EJ6A 4Z6AT 3RWHB 3AU1B 3UDWA 1U8NB 4J3WA 3WDJA 1JPST 2F19L 2X4RB 2BFVL 2V7HA 4MAUL 5I74B 3GIVB 1X4XA 3PQYD 2RQ8A 1T1WA 2J5LB 1UC6A 5MP6H 2EIZB 3IGAA 2SEBA 2DWDA 2R69H 4JY4A 3B2VL 5J13C 1H15A 4DJMA 1KJ2L 2BSED 3B9KB 4YDIH 3WLWC 1B2WL 1FZMA 3UXFA 2Z31A 2BY0A 2ITCB 5E08H 5F9WB 2R1WB 2UZIH 1KB5A 5I8EA 3R1GH 2CLVB 2QTEA 1KTDB 1FG2A 3MRGB 3CH1B 3PWPD 4GMTH 4RWYH 3VGEA 5HJ3B 1QFPA 1ZLVH 2DI9A 3U0WH 1A1NB 5JIPA 2W0FA 4PY8J 1J0JA 4ZUTB 2B5IC 1G9NC 3MFFA 1JRHL 4PJEB 1Z9OA 1F13A 1I4FB 4HIEA 2AKRB 3ARBB 1JK8B 1WEJL 3AXLA 1FN4B 5LQBL 1YQVL 2MOVA 3LN9A 1UACH 3MLVH 1RUKH 35C8H 5CP3A 1SJEB 4G9DB 4JZNA 3QUXA 4QHUA 2HT2D 4NKOB 5BXFB 3MGOB 3SPVA 1MWAL 1N0XH 2NTSP 1B4JH 3L5HA 5CZXC 1JVKA 1M7DA 2XNAB 3PWLA 4HLZG 4DUWA 2R56L 1I85C 5GGSA 4GQ9L 4Y4FD 3NIDF 3CC5B 1U8JA 1J05B 3IS1X 1RHFA 3EDDA 4KK5C 5DRWB 3BPCA 5GS2D 2D3VA 1NMBL 4NZRL 4IOSD 2D2OA 3G5VB 4ONOA 5D96B 4PB0L 2B39A 1M71A 2YPLA 4KPHL 4TULL 4JY6A 2ZUQB 3O81A 4FHBD 2KKQA 1JIBA 4PJAB 2J8OA 2L7JA 2HT3D 2FX9H 4K3EL 4HMDA 2ADIB 3MV7E 1HILB 3GKWH 1EEUA 2P47B 4UTAL 3LQMA 4I4WB 5HI5C 3MA7A 1OSPH 2ZUUA 3MLUH 3NA9H 1ZT7B 4JFXB 4ERSL 1MCLA 1F3DJ 4QXGL 2BCKB 2D0FA 4MCZA 4Q2ZA 5GS3A 3QEHB 1UWXK 3LKQB 3ISWA 3PABB 4RGNC 4U6HA 3RA7L 2RIKA 3BUYA 4AJ0A 5M7QA 3P11H 1KNOB 2ZG1A 4XZUB 4R4NC 4ETYA 3AREC 3G5YA 1L0QA 4P2QB 3H9SA 4PJ7E 4ZFZB 1UJ3B 1UXSA 4JQXA 5EOQH 2BVTA 1CFNB 1UKTA 4LCCB 3MBED 1CLZL 1YZZA 1DE4B 4U1HB 5J6HB 1A6PA 2H32B 3PQYB 4P2OD 5H94B 1HHHB 3MLZL 3LIZH 5I30H 2DQDL 4Z7QF 2CLRA 3NGBC 4X6CF 3G6AA 3ULUC 3RWDA 4Z76A 5D9SB 3N1FC 2ORBL 2YR3A 3H7LA 5L2JB 4QKXB 5CSZA 1I9EA 1A7NL 3GO1H 2FD6H 3D85D 3KPLB 5F96H 1T22B 1DR9A 3ARFA 1K8IA 5BVJB 3FFDB 3VI3E 5EPMB 3D18A 5DEFA 1OTSC 1SM3H 2DM4A 3A67H 5HGHA 5IBTH 2VITA 3PWPB 2NY5L 4DN3L 4OLXH 1T4KA 3C8HA 3B4NA 1KULA 2VLRE 3BH8A 4OAWA 1IC1A 4TNWK 5FA4B 3CSYB 3CXDL 3QPXL 1PZ5A 3U4EA 1A3LL 4JGJA 4G7VL 3O6KH 4HS8L 5GGVL 5KSVA 1CXKA 2JELH 1TPXB 2OI9C 4L4VD 3REVB 2Y5TB 4GXVH 1HSAA 1QRKA 4JKKA 5ITBH 4NDMA 1QSFA 4Y5VB 3WNMA 5C07E 2ZCKH 2FCBA 1LO4H 2Z93B 3SDAD 4PRDA 1ORQA 1CF8H 5BMFH 1JZ5A 3BO8B 5AYQA 4A2MA 1BQHG 4HFWB 5HVFB 4MXWH 2R2EA 3FAWA 4OLYH 1JNHA 3BEVB 3T1WA 1ZVHA 4G3YL 4X0KB 3B9DA 3OF6A 2DQFB 1JYVA 5CJ5A 2BOCA 3MMEB 4PJFB 4CJ0A 4Y4KA 1OAKL 1C1EH 3EYSL 4ALAH 1CGWA 1II4E 2CMRH 4BSVA 1NPUA 4EKXA 2MKLC 4R7DA 1PG7H 1PFCA 1UA6L 4U3HA 3TZVD 5EA0L 3V6ZB 1W72A 2R4RL 3ARRA 3I50H 4JDZA 2EDDA 1H9VA 4RWHA 3MNZB 4WTXA 3DI2B 2NQCA 1HI6B 4L8SB 5C0DA 4G7YH 3PGCA 4FFWD 5DEZA 1CN4A 2X70A 2HG5B 4AQ1B 5IFAL 5GS0L 4CU8A 3BT2L 5T3XD 1MFCH 1Q94B 2J4WL 3N06B 4L9LB 4LVOC 4NQDD 4RMVA 1IAKA 1F4XH 3EDEA 4JFDE 4ZUSB 2FL5B 5HHQB 1DUYB 3ULUF 1UADC 2DQTH 2OBGA 1S7QB 4YHOH 5EORH 3WFCH 4PG2C 3CFCL 4EDXB 5DC0A 4C4KT 4HQQH 1Y18A 1CDJA 1GGTA 2XT1B 3UTPD 1FNAA 5FOJA 4QHMA 4PJHB 5EUKB 4EOWL 2FEDC 3KG5A 3MLXH 2Z4QB 1QSEB 4DZBA 2OXGA 4KI5E 2EZ0D 3TBWA 1BX2A 2YD8A 2BJMH 3MBEB 4G43A 3M1BA 3VA6A 4P2OB 2F5AH 1EEYB 5FDWA 5INDB 4QGYA 5E6ID 5AD0A 3VWKA 1MCBA 1F3JB 2NXYC 3ZKQD 4FQXC 1A7PL 4G8GA 1WBXA 3S35X 2OZ4H 4OZHA 1ZVSA 5DQJB 1I8IB 2WP3T 3G5ZA 3D85B 3MODH 5BV7B 2OLDA 2B2XH 1BAFL 3MRCA 4EXPX 4GRMB 4PGBB 4N8VB 3UJJH 1WCQA 4Z9KB 4L29B 1IGML 3RZCB 5DJ0A 5EZJB 5DD1H 3S36H 1KLGA 5I16B 3WHE0 4P5MB 4G8FA 4BM7A 5D1XC 2BNQA 2HVKB 1C12A 1DJSA 2ZZUT 4LSPH 4AT6B 3L3HA 5GZND 4AENA 2X5PA 5B39B 1VSCA 3PHSA 2D4DA 4L4VB 1AKJD 3WXVL 1HH9B 3UPCA 1UWGL 2G2RA 1TZHB 3HZYA 2X4NB 4ZAKA 4ODVL 4QRQB 4ZXBD 5K9QG 3SDAB 4F37F 4BUGA 3BP4B 4O02L 4ZPVB 4PJXA 5CKGA 4HJ0D 4WI7A 3OBAA 3GB7B 3MRLA 1QSVA 5FB8A 5T1DL 4DKEH 4GKSA 4FQPA 2HAZA 3MJ9H 1S7UA 2QSCH 4KDWA 3BPLC 4LLUB 4CADB 1KJVB 4KWUA 1QO3B 1F4WL 2ARWA 5F7EL 3CFDA 3CFKB 2YMXH 5KSAD 1T03L 4G6JL 1SEBB 3MRJB 1A6VH 2YN3A 1A6TB 4R97C 3TZVB 1IT9H 4ORGA 1JGVH 5IVOA 1RY7B 3UPRA 1H3PL 3WIHL 5T1MA 1TFHA 1OP5K 2CIIA 4ELMF 2FH8A 1CICD 3SDXE 4QTIH 4KQ4H 4D8PA 4YHPA 4KGLA 5L0QC 5FF6B 3KLHD 3N0PB 1J1XL 4NQDB 3BKJL 2X4SA 5KS9F 5ICZA 2FYYB 1SY6L 4X5LA 5DQ9B 1H3UA 3D39E 1A2YA 5F70A 3T3ME 3KPSA 4NFBA 1MAML 4DN4L 2OJEB 3BGFC 4OQTL 3UZVB 2HRLA 3TVMD 4XP4H 4I3SL 3DX6B 1AHWC 2QADD 2I60H 2WW8A 3ZKND 1BLNA 3DRQB 2UWEF 1VFAA 4ZS6C 4I2XB 4NNXB 4J3VA 4YDKH 1JNJA 4LFHD 4M7KH 1D6VL 5DDHA 3WEXA 1L7TH 2V2WA 1AJ7H 4ZSOB 1ADQL 2A0LD 3HC3H 3IF1B 4YPGA 4YXHL 2ZUSA 5L8KB 1MCOL 4EI5C 4JVWA 4AYFA 2A1WH 4ZFOA 2QSTA 3MRQB 3BPOC 4UV7L 5SV3A 4ODHL 2GTWB 1XH3A 4JGMA 4M8QA 1W8NA 4JR9H 5E6IB 5GRVL 4F9PA 5C0EA 1G7MA 4NCC1 3I6LD 1T89A 3BQUD 3TNMB 4YBLC 4Q0XL 5GGRB 2R9HC 4FQLL 4MZ2A 1CLYL 4K8RD 1KTKE 3QFDB 1PYWA 3UJIH 3S88H 1WVZA 4OF7A 5JDSB 2CK2A 1L6XA 4U6YB 4XNUL 3GSQA 3QWRA 4WV1B 4NKIL 1T2QH 1YPZB 4KQ3H 3ALPA 3V8OA 5C08A 3PXHA 3EDJA 1MFBH 4BFBD 1T1ZB 1NMCB 1V8HA 1Y6KR 4MA8H 4IRZL 1VENA 4ONHB 3HE7A 5F8QC 4UOW0 1KIPA 1N5AA 4V2CB 4POZD 5CCKL 4ODXA 2WQRA 1AKJB 3M17B 4I8DA 3STZA 1OW0C 43C9B 2FSEA 1TMCB 4P2RB 4G8EB 5DVLA 1A47A 4GH7B 3VXPA 4ZXBB 1MRFH 1GIGL 4WI3A 2VDQH 5FO7B 1T0NA 5FYLL 1CFTB 3VWJA 1INDL 3BP5A 2ZG3A 3AB0B 1I7TA 4OLUL 5C71A 2AQ2A 4JB9H 4RDQG 3Q6GH 4FQCL 4KC3B 1XGQA 4Y2OA 3AAZB 5GGUB 3CFBA 5L2KE 3GMMA 2ZCHH 4OZGF 5KSAB 3SDDA 3KGRA 1V3LA 1WITA 1F4AA 3SKMA 1T2JA 3GMQA 3S7GA 4M8VA 5HYSG 3MV7A 2E9WA 1NGQL 4TOYL 2FO4B 1CXHA 3VFUB 4J3OC 3OAUH 2MHAB 4JFFD 1U8MB 4YEEA 2ICCA 1TJIL 1A7BA 1P53A 1G0DA 5IB4A 1CICB 4LHUA 2QKIB 4JN2A 2AJ3A 4MYWB 4WY7H 2LV4A 1C16A 4M6OH 4DGYL 2RJMA 2BOBB 5ICXA 3C8KB 2AGJH 2X41A 5IESL 3ESVF 4PTUA 3I02B 1UG9A 4XT1C 5A2FA 2GSGA 4R26H 1NC2A 4PJ7A 2HJKA 3TVMB 2Z8SA 3ALWA 4MJ2A 4G9FE 3E2HB 1EMTL 2QADB 1IC4H 3EYUH 4U1GB 4CU6A 1IC7L 2XZAL 2A74A 3GMNA 1MHPH 1UM5H 3CXHK 3QULB 4BFIB 3C60A 2GAZA 4KDVA 2HKFL 2PETA 2HH0H 1TDQA 3UTQA 4OZ4B 4XBEL 3QO0A 1JUFA 4UDUB 1F2QA 5F7NC 3GZKA 1AGCA 5TPWL 4JO2H 1DQDH 3GSOB 1WAAF 1A6AB 1VHPA 4M7JH 4C55A 4UIMA 4O2EB 4K3JL 4X6CE 5ACZA 3B9VA 5JPNA 4AIZA 1EBPA 3AFLA 4X98B 2CQVA 3SKJH 3VFOB 1BOGA 1C08A 3BQUB 2VLRA 3ZYZA 1PX3A 1AXIB 3PE9A 5SX5H 1U91B 4ENEC 1H5BC 2B4CH 1Q9OA 2Q8BH 4XXCC 5E8PA 3ARWA 3EO1B 3SEPA 2AERT 5DJXA 1G7IA 4OB5L 5D5ME 1IQDB 4EDWL 2E6JA 2AK4D 2VN4A 3K3QA 5E1HB 4QRUA 3OKMA 5JQ6H 1NL0H 3F7PC 2AEWA 5JLZB 3V6FB 5C07A 2MKWA 4MXQC 2BNUB 4TNVF 4JRYE 4OFYA 5DT1H 3HAEB 4UOJA 3RNKB 2Y36L 3CSGA 3C5JA 3X3GH 1NAMH 3X11A 1TQCC 4XAKD 3MPCA 1RIHL 2F58L 3KLSA 3EIFA 1PEZA 1ZHKA 4ODSH 1NAKH 1NLBL 1RK0B 3EZ8A 5AG8A 4QOKD 2H41A 3ARPA 3LQZB 1CGXA 2LE9A 3K4AA 1BFOB 2XY1A 4J12A 4XAWL 3D9AL 5I73C 2VR5A 4CU7A 3TPUA 1ED3B 1EHLL 1MFEL 3S4SB 1A6ZB 5D8JL 3SDYL 4XCFL 4G42A 3DUUA 5DD3H 2YN5A 2VUOA 2YS4A 4ZPTA 4X6DF 3PL6A 4PLOB 3DVFA 1NUGA 3ZYJA 3DXAA 4IIQB 4R4ND 5EBMB 4U1SA 1BD2E 2HKHH 3DO3A 4OSUH 3VFWB 4V1DB 4FXKA 3RWJB 3DMMA 2DTMH 4NZJA 4V2BA 4WCYH 4LCWD 4DOHB 4GQPH 4JFDA 3MSPA 1QACA 2EIBA 4LKXA 4JFFB 3BN9C 4RIRA 3O4OC 5FYKU 1YNTA 4R4FH 4M6MH 4YHYB 3MYJB 2P45B 4K7PH 3VH8A 1GOFA 1RMFL 5J13B 1UXWB 1WZ1L 2D7MA 3LHPL 5K93A 1WIPA 4MDIB 1OCWL 3S5LB 4NFDA 4QRPD 3TJHD 3BKCH 3LEXA 1GYAA 1FFRA 1UH3A 4PR5A 4LP5A 3V95A 4M4PA 4LLQA 1I9IL 5J9PA 4Z7UB 3VFVA 1TVBB 3L7FA 1DQLH 3MA9L 4L3CB 3GDBA 3U1SL 4HKZA 1KSRA 2ICWB 2E7LA 4XC3L 1MJ7L 4QTHB 3TT1H 3SKNA 2CDFB 5FKAB 4F7TB 5GJTL 2B5IB 3A6CH 1KCSL 1U8KB 2GIYA 5F9DC 3MV9E 5DURB 2E8ZA 1TVHA 1KLFA 2DQEL 3RIAK 1SEQH 1I1AD 3NZ8A 3PUCA 4X7SL 4HWZB 3ZDZF 1AY1H 1BZ9B 3NMEA 5C0BD 2VAAB 4KJPD 1IGCH 1FGVL 2QBWA 4KROC 2ED8A 2VIRB 3C5ZC 2XFXA 2JKXA 5DMGC 1OT1A 5CMAA 5EIQA 3GMLB 3EYVA 4AZ8A 1A4KB 4LOUC 3ZHKA 4WU7B 4JRXD 1MSPA 5FK9A 3G08B 1RVFL 4GUPB 4E5XB 1KJ2A 1KJ3H 1J18A 3WXWL 1XGYH 4KMTH 2AK4B 3WL9B 1F45A 1FYTD 3GSWA 1KXQE 2DLFL 1AD9A 3KJ4B 3GSUB 1I8KB 1WICA 1BFTA 1UT9A 3HN3A 4Y5YA 5CEYA 4P5TA 4F33B 4LIQH 5D70L 2NLJB 4NHUA 5IF0B 3WDIA 4NO5A 1DANU 1RUPH 2B7DT 4XVJH 4O4YL 1KENL 4LBEB 2PCPB 4QOKB 5BVPH 2Q76A 4M00A 5DUPH 3FCTB 1KIQA 1CTNA 4XNYL 3IDJB 3KPTA 5I1KH 4FFVD 3TGXA 3O2DH 1P84J 2JIXA 4W70A 4JKPH 1SYSA 3WNPA 1U6AL 4ZFFA 1XGPB 2H3NA 3U6RB 3PDOB 4BQ6A 5K9KA 4EUPG 4PB9H 1S7WB 1JHKL 1BQSA 1AE6H 4X4YB 2YD6A 1HN1A 3FRUA 3SDXA 2X05A 1MWAA 3AREB 4Y19D 5HYQB 5BZWA 5INCA 1AD0A 4PBWD 4YHLL 1ES0B 4KRLB 3ZT6A 4LCWB 3OKKB 4ELME 1X5GA 4NWTL 4LLVA 4XRCB 4NRZB 1LO5A 1F6AB 1KJMA 4LRIA 5CFHA 1IZKA 4J3SA 5FYLE 2E5EA 1RZ7L 4OCLC 4E41E 4I0CC 1KB5H 3WSQL 1SJHB 3RNQA 2HN7B 3BZDA 3TN0D 2ZCLL 2VC2H 1S9VA 3VXRE 1YMME 4LCUB 1RZIB 4LASL 4NNPL 4QRPB 2AJZB 1DVFA 4HX1B 1NC4D 4M7LL 1F6FB 5DVKA 4U1KB 4NYLA 4Z0BH 4AEIH 1OQXA 1D6EB 2XWTA 4RMQA 4JY5H 5HYJE 2UWEE 2C7UA 1ROWA 5CGMA 1AH1A 1E6JL 1PY9A 3GI9L 4P4KA 3PP3K 4M61A 1CZ8H 2G75A 3QBTB 3HNVH 3LKOA 4N9GA 3ARDA 3WHXA 4JO3H 5DJAB 5CP3H 5IM7A 1OL0A 5JW4N 4KTEL 3QA3A 1FL5B 5EOCH 1ZLWH 3GRWL 1UKSA 1SJVA 5L88H 1FNSL 1I1AB 5DD0H 3HUJB 4U1LA 4UAOC 3ZKXC 1A1OB 2FX8H 4W4OC 4LSVL 3GHEL 5EIIA 5BV7L 1J5OH 1UGNA 3WBDA 3JVGC 5FGBA 5CJQL 1ZA6B 4NWUL 2NY4D 2Q20A 4X5WA 4F57L 4FQIL 5ICYB 3O3UN 3MV8E 1XCTB 4X4ME 5ESVB 1NLDL 2GKIA 5IK3B 4MNHA 4KXZI 3WUWB 5EC2B 4JRXB 4GRWF 2IAMA 2BXZA 3ARQA 1YN7B 4DEPB 3WN5A 1EGJL 3FQWB 1KT2A 1P5VA 4FQJH 1N64L 3SGDI 3P77A 3DYMA 2VO5A 1WC7B 2LVEA 3LEYL 4HBQA 5D71H 3PV6B 4ZUVB 4GG8B 1Q0YH 3MLSH 1GZQB 3SE3C 3INUH 5IHZB 1FJ1B 1PLGL 3QZWB 4YDJA 3IRPX 3N1PC 1K5NB 4BZYA 1ZANH 4MD4A 3TP4A 4JQVA 2VL5A 3QIUC 3UC0H 4NJAH 5L2KA 4NM8H 1CXFA 3GIZL 2VDRL 3DROB 4PJEE 4IEFB 4PGDB 1BBJA 4YIQA 3UYOD 5EU4A 3B43A 3O3BB 3OJMB 3GK8H 4OZGE 3N9GL 4GSDL 1N3NB 3GBNH 4DCQB 4JZJA 4R8WH 3BDYL 4PJGB 4Y19B 4M93C 4OLWH 1OB1A 1I3RB 4N0RA 2P7TA 1BWWA 2F74A 4JGUA 3MTRA 1D9KD 5BS0E 1LP9F 4AH2B 4K07A 5T3XL 3PIQA 4JO4H 1DP0A 3VD5A 3QG7H 1S5HA 5FKPA 4G9FA 3TN0B 4JM4L 5I75C 4RAVA 4LRNL 3EUUA 4Y1AA 1HXMB 2N1KA 3RWEB 5F7YC 5E8OA 5DUMH 1QPXA 3SJVB 3STBA 5IEKA 3O3AB 5I1CL 1KCVL 2AEQH 2H1PH 3QUZC 5A3ID 1NC4B 1X5HA 3G6JB 4M1GH 4YC2B 4XP6H 2W0LA 4JG0L 5C09D 1O7VA 5HPMB 4N5EC 3RL1B 2YRZA 2AQ3A 2AJVL 3SQBA 1LMKA 2HT4D 3FTGA 5D1XB 4X6CA 3O11B 2P8LA 5HGDB 3I75B 3QQ3A 3UYRH 4J4PC 5B4MD 5JIIA 3IAGC 3TFKD 3DGCR 3TEUA 2F8OA 1RURL 4U0RB 2HLAA 4WFFD 5HYIA 4OLVH 4Q9CA 4S1RL 4P57B 1KIRB 3X12B 3VXTB 1DSFH 2MWCA 3SCMA 5E2WL 5KVDL 5CSBA 4NJ9L 4ZD3L 2R1XB 3PV7A 5B38G 4U1IA 3MV01 5CKAA 2NY4B 5D5MA 2CK0L 1FLRH 5EBLA 1NGYA 4ZO7A 2H6PB 2P8MB 5A2IH 4JDTL 1JV5B 2OSLB 4WU5A 4P2QE 3BSZL 4PP2A 5CGYD 5KANG 1Z0MA 2HFEB 3BKYL 4JRYA 5DHXB 1W72H 3MLRH 2ZPKH 5DJYA 3S37H 5IJVB 3PQYE 3EJYD 3Q3GA 3RY6A 5E5RB 2VLKD 3TO4D 3MC0A 4APQA 3N85L 1D5BB 2PW2B 2D03L 3QJHB 1AGDA 4ZO6A 4BZ2L 5KTEH 2AEIT 4W81A 1M7XA 1T20A 4TN9A 1JTOA 4JM2A 2X09A 5GISH 4RGMB 4WNQA 5D7IB 1P4LB 4KK9C 3SOBH 4Y2DD 4MNGB 2OYPA 2ERJB 1AGEB 3UBXB 2NXZD 2P43B 5ALBH 1DTUA 3IDMA 4LDOB 1XT5A 2VDOL 2M2DA 3FQUA 1JPFB 1VFUA 1D5ZB 1QHOA 3EYOB 1LE9A 4X7TA 2NNAB 3CCHA 4KV5F 3X14B 4KXZH 4F7MB 5TJWK 1BD2A 1VFMA 1SYVB 1R0AH 2H9GB 4MLSA 5I1GH 2W91A 1ZTXH 2HFFA 3CDGB 4HG4K 2C3VB 4F80A 5IB2A 4OI8A 2EYTA 5F1IB 3U30C 4RGOL 3KLAA 3T77B 1ZV5A 4X6DE 1YEJL 3PNWB 5LWYL 1CL7H 2IPTL 4UQ3A 5K59F 2EYRA 2LU3A 4U33A 1QBLL 2N4IA 3CPLA 3SGDH 3JWNC 4PJIB 2CDEA 3V6OE 3VD7A 3D0VB 3IJSA 1QOKA 5EH1A 4J8RB 5MERB 5F7FA 3R1GL 1DDHA 4HIJB 2HFGH 5E2TH 1UJTA 1ZGLB 4FFZH 2ZJSL 1FYHB 3FHQA 2QQKH 1D9KB 1DFBH 3P0VH 1X5XA 3M8OL 1FNGA 1MHCA 1ZGLM 5E8NB 4PJ8A 2C26A 5DJ2A 5E1AB 5HDBF 5SWSB 1CVRA 5KVGL 4XXDB 1EO7A 4UQ2B 1CG9A 4QNPF 4YBLB 1N26A 4DZ8B 3EDFA 2FX7L 2EE2A 1DBBH 5AZ2H 3M45A 3WIHA 2O26U 3B3IA 3JXAA 5EFIB 3BKML 5I9QB 3T2NH 4I0KA 4ZNEE 4G6KL 1CT8B 5FUZH 2ITDB 2JF1A 4Z7WF 3H3BC 2WBJA 35C8L 5C09B 3MV9A 4HAFA 4MX7A 3CFJB 3OXSB 4K3GA 1ZSDA 1SY6A 3E0GA 4Q6IB 1B4JL 4TYUA 1CVSC 4TTDD 5LBSH 1DLHB 1T1YA 4XWOD 1HHJA 4OQTA 1F11A 1MRCL 2H2PD 3SDCC 5GRJH 4HIIB 1G7QA 3VFMB 2MTPA 2EXWC 4NC1E 2KZ1B 4N8VG 5ESQB 3ZDZE 3O6LL 4X7DC 2NY0D 3RX8A 1I9RL 3CLEH 1VB9A 2J3SA 4K8RL 3VGHA 1ADQA 3NPZB 4MNQE 3I3DA 3P9LA 1J0YA 2DB8A 1WIOA 1L9NA 4PJHE 4OF8A 3D5OF 4NM4H 3F7YB 3P9MB 5B39G 1Z5LA 3SGJC 4KVCL 5HHNA 3EOYG 2VTFA 4I13B 3H2WA 3C6LC 1ORSA 5DVMA 3RKPA 2FB4H 2VLKB 1OSPL 1JWSB 2NX5D 4G8IA 2R23A 2GJ6A 3PHOB 1BBDL 1UZ8A 4XB8A 5I1JH 4JLRA 2I9LB 2BSSA 3VRLF 4LARH 3SY0A 5B8CA 3S8WA 2APXA 1FVDB 2WV3A 2QR0A 4Y2DB 3BEWA 1PKOA 1BZ7A 4K7FB 1E28B 4F2MA 2R0WH 4L3ED 3L3DA 4XMKH 5EOQL 2VZSA 3QH3A 4QRTB 3T0EC 5EU7E 3H0TB 1N2RA 4LSUL 1P2CA 2OP4H 4N0CD 1RUMH 4PJ9C 2HTKC 4HS6A 3U2SA 1DQQA 4L4VE 1U36A 4HUWA 1S78D 3DUHA 3MXWH 4ELMA 5DRZB 3F8UB 3FT2B 2YBRB 3GO1L 2OJZH 4KRPC 3UJTH 5E00A 5F1NA 2GEEA 1JE6A 2VB5A 3FONA 5JIHA 5CD3A 1TTGA 2ATKA 3A6OA 5I15H 3F5WA 3RVXC 1YMMA 5FO8A 1D7FA 4MA7L 5H35B 3MLTB 2JK5A 5C9KA 1KTLB 4Z77A 3E6HA 4ZFGH 1N7MH 4X6EA 5IHUL 1U8OB 4YWGL 5FV1L 1MY5A 2H26A 3T0VA 1IM3B 3F7VB 5HYJA 2UWEA 1W2KT 4JN1H 4YXLL 1RJYA 5D2NC 2Z8VC 1AQDA 3MGTA 3REWA 3CIQA 5L7XH 4EUPA 1XR8A 2XA3A 3JV6A 3D2UB 4UB0H 2O61A 5JIKA 4JJHA 3P30L 5DZOA 2EIEA 2ZCKL 2KL6A 1TZGH 3WO4B 3TNNA 4HUMB 4J3UA 1CF8L 4M6AA 3NPSB 3TWCL 1AXSB 2YUZA 1AFVH 5IW6B 4I18B 2P48B 2DI8A 1INQB 1EZVY 4JHAL 4H8WL 5T3XE 3QIWC 4NQDE 5EN2B 4CMHC 1JNLL 4NKMB 4GMSL 4RFOH 2WIMA 4XX1G 2DICA 3Q0HA 1QVOB 2W60A 3MV8A 4IMLA 4X4MA 1TQBC 4R4BA 1X5FA 1P9MA 4ZTOL 3AU1A 1U8NA 2NY0B 2X4RA 3GIVA 4M1CC 3I50L 3OG4B 4X6BA 1KCRH 3PHQB 1MIMH 4I2XE 1R3JA 1ITBB 2EIZA 4WWKD 2R1YB 1EAPB 3VDCA 3ROLB 5HGGS 1EEQA 3DI3B 3AM8A 4XVSL 4IRJD 4IDJH 3TJEH 3VXMD 2Y72A 2ITCA 2JE8A 2R1WA 4BKLB 5LAXA 2K7PA 4O51A 5E6ZA 3ILQC 2NR6C 1PGRB 1YEDB 2CLVA 4M48L 4B7IA 4WFHD 1JHTB 2NX5B 4UBDC 1JMZA 2XI9A 1KTDA 4HLZH 4G5ZL 5EO9B 5HJ3A 1VPOL 2DBLH 1A1NA 4LPCA 4XX1E 3H9YA 1FH5H 4G6AC 4ZUTA 5JNYB 4P59H 3O4OB 4MJID 5CBAA 5I1HH 4WW1B 5IT2L 4X7CC 5CHNB 4PJEA 4UT9L 3SE8H 1YPZE 1I4FA 5I1LB 3ARBA 1JK8A 4L3EB 2ADJB 2VQTA 1W0WB 4OZGA 1BVZA 1Q72L 2CUHA 1FN4A 1M4KA 3L5XL 4C4KO 4LKCB 2ICEA 4S1SL 3C8DA 1SJEA 4G9DA 1JGUL 4MCYB 2FWOB 3IXTA 4NKOA 5BXFA 3MGOA 2A6IB 5KVEH 3TBYB 3FO1B 5BS0A 4OLZL 3W11D 2XNAA 2V5YA 5HVHC 1VADB 2ARJB 3EJZD 4DVRH 2VLJB 2A9NH 1MFDL 1J05A 3BFOA 4XNXH 5IMLB 4PS4H 5DD1L 1DN2A 1VERA 4RAUB 3S36L 1XF4A 1NUFA 4HIXH 1XIWD 2V17L 1P84K 3A6BL 1JRHI 2WP3O 4KJWD 3O41A 4Y5XB 5D1ZC 3TBTB 2EE3A 5TQ2L 2BP3A 4LSPL 3BE1H 4XVTL 5GRZA 4GOSA 1EIBA 4HF5L 3GSXB 4LFHG 4RRPA 2AK1L 5BJTA 1CTOA 1QNZL 4X7FC 4YBQC 2ADIA 3QQ9C 1NCWH 2GCYA 4R96B 5C2BL 4OZFA 4I4WA 5K9QI 3PWNB 1RHHA 4I0PD 5IWLC 1GVIA 5DJDB 1KFAH 4JFXA 2X4OB 4YFLI 1FFNB 4RZCA 1GOGA 1G6VK 2BCKA 5LVEA 4DKEL 1ZT4B 1A7OL 3QEHA 5T1KA 5HTSA 3MJ9L 1HHIB 5CILL 3HR5B 3LDBC 2VDNH 1HHGB 2YZ1A 1KNOA 4XZUA 3GHBH 5GRXG 4JZOB 4P2QA 2YMXL 1UJ3A 1MJUH 2GITB 1CD1B 2P8PB 3QDGD 1CFNA 1A1MB 3E6FB 3R06B 1FVCA 1JGVL 4U1HA 2YPKB 3GMRB 5J6HA 2H32A 3HE6D 3PQYA 4M5YH 5H94A 3P4MA 4G6FD 3BP7A 3KPPB 2I9TA 4Z7OF 5I66B 4HC1L 2COQA 3HNTL 5IR1B 4LQ1A 4Q7DA 5I19H 5BW7C 5D9SA 1BF2A 5L2JA 2B4CC 2CKBB 4IRJB 1PSKL 3VXMB 1RIVL 3KPLA 1T22A 1TETH 2QJDA 3LQAH 3FFDA 1MCJA 3NCJL 1UCTA 1KG0B 4YZFE 4JDVB 3S96B 4U1JA 3ZHLA 3I6LE 3PWPA 5BOZG 1CE1L 1I8MB 2VDML 4ONFL 1E27B 2FGZA 3CSYA 1T6WA 3S4SG 4XPHH 2YD4A 5TE6H 5IKCB 3O45A 4P3CH 1V7MH 3E3QE 1NBVL 3REVA 4CVWA 1AJ7L 4PY8I 2DTSA 2Y5TA 4X6DA 5C6PB 4R3SB 2D0GA 4ELKA 2FBJH 3H3PL 4XPAH 4Y5VA 3CFEB 4KAQH 4Y16C 2Z93A 3V6OA 1DEDA 5KSUB 4RNRB 3BO8A 3VXOA 4GXUN 3LMJH 5CIPB 4HFWA 1BZQK 2RHEA 3JV4A 1A14L 2FH6A 4JCMA 4XCYB 1IARB 4YGVA 5JHLH 1G7JB 4Q9RH 4U7MA 5EO1B 1FSKC 3MMEA 4Z95H 4TSCH 5J12B 1M05A 4Y4FA 3S5LG 2IQ9H 1T2QL 1CLOL 2EDBA 3H6JA 4KQ3L 3U48A 2DWEB 2OR9L 1FL3B 1XIWB 2BFVH 4P3DB 3V6ZA 4MAUH 1WLHA 4ZNEA 2R8SH 1ZS8B 2FDBP 4UAOB 3OKEB 2VISB 1NUDA 4OCSL 2O5YL 3H9HB 4QNPE 1HI6A 4L8SA 1IILE 4MVBD 3B2VH 1X5LA 1KJ2H 1HYSD 2EDJA 1QR4A 1B2WH 1I1FB 1Q94A 4L9LA 1U8PB 1LK2A 4Z7WE 3FO2B 4GBXD 1I7ZB 1HXYA 1ZLSL