1U8MB

Crystal structure of the hiv-1 cross neutralizing monoclonal antibody 2f5 in complex with gp41 peptide eldkyas
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
235
structure length
227
Chain Sequence
RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWLAIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHRRGPTTLFGVPIARGPVNAMDVWGQGITVTISSTSTKGPSVFPLAPGAAAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLQTYTCNVNHKPSNTKVDKRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic definition of the epitope promiscuity of the broadly neutralizing anti-human immunodeficiency virus type 1 antibody 2F5: vaccine design implications
pubmed doi rcsb
molecule tags Immune system
molecule keywords ANTIBODY 2F5 (LIGHT CHAIN)
total genus 38
structure length 227
sequence length 235
ec nomenclature
pdb deposition date 2004-08-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u8mB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u8mB01
3HI1B 1K5NA 3C60B 3BP5A 5FYJD 4K3EH 1JGUH 5HYJB 3CFIC 5HDQH 3C5SA 2W65A 4PJFF 3W39A 4EVNA 4XC1L 12E8L 4LFHD 4YBLB 3JWOL 1H3PL 5ID0B 4TULL 3PV6A 3RQ3A 1NKOA 2B4CC 1A02N 1CGSL 3P4OB 5HHME 2D7QA 4H25B 1HOCA 3RX7A 1RZJH 1G7IB 2NY1C 1TXKA 2DTMH 5D7SL 4XNMA 3RAJH 3MJ7B 4R26H 5SV3A 2HTLC 3PDOA 4ONFL 3MR9A 4ELMF 3Q6GH 2AEIT 3HG1D 1QFWM 3RPIB 1KEGL 4JKWA 1FVEA 1SEBA 2EIZA 4MGXA 2XNAB 2OCFD 4KKAC 2OSLA 4X83A 1D5BB 4K71B 4XNQA 1U3ZA 3VJ6B 1BFVH 3KYKL 2X4NA 2LTQB 3TBWA 4MAUL 4R9HA 4P0DA 5HGAA 5KSAA 1OQOA 5TH2B 3BAEL 4JVUA 1M71A 4ELME 5A43C 4KRNA 2XN9E 1UADC 4NRXB 4P46B 4LPCA 3W2DH 5TF0A 4S1SL 5GRJH 3VFPA 4P3CL 4L5FH 5IB5A 3RZCA 4I0PD 2DJ4A 3HC0B 1S5IH 4HK0A 3RDTB 1RZIB 4M62H 4FXKA 4IRJB 4FZEH 5CZXC 4QT5A 3VXSE 1YMHA 4GG8B 5E6IB 4NUJB 3ARZA 3IJYB 4X5XA 2R2EB 1X6LA 1MFDH 1CLCA 4UU9A 3SDYL 4EJ1C 4OD1H 3FB8B 4KXZH 1JWMB 1FNSH 2BK8A 5DRWA 3RIFF 5CEXB 5LGHH 2YMXH 3EDDA 2ARJQ 1AXTH 4ZO7A 2FB4L 4HKZA 4PRID 1U92A 1EERB 3C6SA 4LDOB 1CXIA 3AU1B 4KVCH 3X12B 3EO1A 4LVHC 5EUKA 1A1MA 4PJAF 1ZT4A 3LRSB 3ARBB 3O9WD 2YA1A 4KTEH 5JOEA 1LO3L 4NT6B 2GSGB 4MAYC 1DFBH 3UPAA 1YPZF 1ROWA 1F13A 5DYOA 1YNTA 1SJVA 4GBXC 2OZ4L 3MRKA 2OSLB 4ZG1A 2R0ZH 4XP9L 5C08D 2ADIA 3NZHH 4YUEL 4JY6A 4Z7OE 1YEFL 1CDGA 2CDGB 2ESVB 3I6KA 4LBEA 2WM0A 1VERA 1ZK9A 2GT9A 4H88H 1EAJA 1N6UA 3KXFD 2NY6B 4WHTA 2W9DL 3L1OL 2P7TB 1A6PA 3OKKB 1BOGB 3UJTH 5LAXA 2QQKL 3DXAB 5TE7H 3ES6B 5DHYA 3U0WH 3VXMA 4MQ7A 2CO7B 2NY2C 3HG1B 1OD9A 2RHEA 5DZLA 1UCBH 3C5SB 4KI1A 3MROA 4BFEA 3O8XC 5GRXG 5H35B 2CDEA 4U1NB 4QTIH 1MCOL 4HEME 1KJMB 12E8H 3PJSB 3SE8H 4ERSL 5I8OL 3K81A 4P99A 4KRLB 3MRGA 4HGWB 4Z7WF 2W59A 3CSYA 5C0DA 5KSBB 1MPAL 3TVMC 3P4LA 1C7SA 2VRAA 1HDMA 1QYGL 3MLYL 5EC2B 5BOPA 3HA0A 2GY7B 4P46D 1CG9A 5CP3A 3GJEA 3D0VA 1KFAH 4XBGB 4HGWA 3NA9H 1B4RA 4C83A 4GQ9L 1LEKA 4Y4KA 4X0KB 2RIKA 2ZSVB 4M5ZH 5E7FA 2CDEB 4U1NA 4UINH 2HTKD 1YNKH 3C6LA 2UZYB 3QJFB 1JI2A 2WUBL 1QBML 3FAXA 3SDDA 3WS6A 3GSRB 1MRDL 1T3FA 3BYYA 4I0PA 5BW7A 4M6OH 2XQYG 4KPHL 2AEPL 1DBJL 4QOKA 3RI5K 3EOTL 3JUZA 2VR9A 3LH2L 1SY6L 1DQLH 4ODVH 2IPTH 2A6DB 3D39B 2DIBA 2X1OA 1MCJA 3F5WB 4HUWB 4TN9A 4DGVL 1DBAL 4PP1C 4PJ8A 4XP4L 1FYTD 4FRWA 1HQ4A 1IAMA 3L7FB 5ALBL 4WI5A 2FLRT 2F54B 2ITDB 3OKDB 4Z7QF 3O9WC 4XNZB 1MEXH 2CJUL 3TN0B 1IAIM 4NZTH 3RVTD 5HBBA 4XPHH 5HY9B 4KXZI 2CIKA 3IF1A 4GAFB 1M7DA 4NZUL 2IQAA 1R3IL 3PWJB 4KAQH 3HI6H 1MHPL 4GMTL 1QACA 4OZIE 5AWNL 5D6CB 4YHPA 4QRRB 1QFUH 1KC5H 1ETZB 1IAKA 3STLA 1YQVH 1BFTA 5I18H 5F7YC 4PY7A 4UIMB 3E6FA 4F7PB 3QG6A 3AS1A 5F7DB 5JMRA 1SVCP 5E99L 1KT2B 3WIIL 1A0QL 2VERN 1BP3B 2V2WB 4H26A 2ITCA 4LSTH 4OCWL 3EYQC 2Y5EA 3RNKB 1JFQH 4D0BA 2QQNL 4QOKD 5D2LB 1K8IB 1ORQB 2D31B 5M7QA 3UBXI 3VWJD 2IH3A 1FQ9C 1PG7H 3SDDD 2YRLA 5I1JH 1NC2B 1OARH 4JFEB 1GAFH 4TOYL 3DUUA 1KC5L 4H26B 4N9OB 4HT1L 2VDQL 4JN1H 3PV7A 3OXSA 3SEPA 3QUXA 4LK4A 1LMKA 3KPRB 4L8SC 4UT6L 4CN6A 1YMME 4S1RH 5ERWB 4GH7B 1JBJA 1QQDB 2ZG1A 1G7JB 1UCTA 4F7TB 5KSAB 4MWFB 4AEEA 2EE6A 3UXFA 1E28A 3KHQA 4H1LH 2AJXL 3MV11 2JJVA 1CCZA 1TZIA 4OZGA 3JWNC 3MRJB 5D72H 2H1PH 2Q8BL 5L6YH 4QYOA 3V0WH 2PXYC 5F21B 1A4KB 2DQFA 4JO4H 3N1GC 3HC3H 5C2UB 4N8CH 5TE4L 1RJYA 3C5JB 1PLGH 4HWEL 4UUJA 4HC1H 3MA9L 5BV7B 3QIUD 1XGPA 1N3NA 2GCYB 4JFZL 1GPOH 4LNRA 5C92A 2ZJSL 2G5BB 4PB0L 4PBVC 3SY0B 3ZDYE 2WUBH 1IKNA 1KIUA 2CK0L 3WUZA 5C6TH 4J3XA 3QQ3A 2DYPB 2FEEI 5BVJA 4NNXA 5IW6A 5INDB 5LWYH 1OL0A 4I0PB 3ZT5A 1S9XA 1NC2D 3OJDB 4BQ6A 3R8BB 3QFJE 1I4FB 2XOTA 3OPZH 3LN4A 3MRCB 5E5MB 1NMAH 2IGFH 1AQDA 1KELL 4E5XA 2B0SH 2VZOA 4J8RA 2J8UE 4DGVH 4H8WH 4GQPH 5ISZE 4IDJL 1DQLL 4L4TB 3UPRB 5HTSA 1RHHB 2CMRH 1RUQL 3P0GB 4ZQKA 5JQHC 4WO4B 5FK9A 3K80A 3MLSL 5I1LA 1QBBA 1KJ3L 4CJ1A 2IFFH 1T5WB 4YHYC 1NL0H 4YE4H 1N7MH 3PWPD 4XHJD 3O2WH 4NDMA 3Q5TA 3TV3H 3U83A 4L8BB 4OZIA 3F7RA 5CZXD 2VABB 5MEPB 4GQ9H 2EDJA 3REWA 2CIIA 3HKFA 3FQTA 5IHZB 3VD5A 1Z2KA 4CKVX 4MJID 1U91A 3BKJH 3ULUD 4JRYB 5TFSH 1LVEA 4HC1A 2BY3A 3AMLA 1FYTB 3HPLA 2E8ZA 3X11B 3FO9B 3PWLB 3VXMB 7FABL 4Y4FD 4RZCB 1C5CL 4JB9L 5HHVL 3IDUA 3BZ4A 2XWTA 3K8LA 2QEJA 1YEFH 5ACMA 1IJ9A 5IK3A 1J1XH 4Y19A 1PAMA 1R5WA 2QV2A 3GO1L 4AEHH 5JPMA 2OZ4H 3NABL 1ZT1B 2ICEA 4KHXH 3I3DA 4Z7VB 2VLLA 3GSOA 4M8QB 2H6PB 2AVGA 4WNQB 4ZMAT 4AH2A 4ZXBD 3TZVA 5IT2L 3TO2A 1K4DA 1OGAB 3G6JB 1CFSB 3QH3B 4Y1AD 1MCPH 2R1YB 1DLFL 4NN6C 3MLXL 3WUWG 5A3IC 2GSGA 4OV5B 5IQ7H 2C4XA 4KTYA 1XF5A 2B1HL 4OLXL 3QXVA 3L1OH 4KVNH 4Y5VB 3VWJA 2LU3A 1KYOK 2CD0A 3DX9B 3BRGC 2ICWB 3QI9B 5GGRB 3RTQD 1W72B 3H9HB 4POUB 5DA0B 2Q6WB 2E8YA 3IU4H 3N9GH 1I1FB 1X5IA 4HWUA 4K7FA 3M17A 1KB9J 2DF3A 1T4KB 5DJDA 4DK3A 1W72H 2GFBB 2WP3T 3DI2B 2R8SH 3O6ML 3DNKA 4Z7NF 4WU5B 5JHLL 5D9SA 1MQKL 2OI9C 5C0EA 3LZFH 5J11C 3RGVC 1JV5B 3NCFB 3VG0H 4ACPA 4YAQB 4P3WA 4BK5A 3LPWA 1ZSDB 2ENSA 3EAKA 3LS4L 1BFSA 1WF5A 2GSIB 3L9RA 4PJEA 1KIPB 3G5ZA 4LAJH 1YMMB 2HLFD 4P5MA 4QHMB 5E2JA 3WNPA 1QRKA 4IOFC 5DWUL 4Z76B 1A7BA 4IM8A 5DS8A 3QDMA 3C5ZC 5D5ME 2QQNH 3KJ6L 1ZGLB 4OLUL 3MGAA 2HVKA 3I2CL 1X5FA 1QEWA 4OD1L 3A0OA 2C3XA 2X4UB 3MQIA 3IU4L 5D7IE 4U1JB 4PLJD 5IV2B 3L3KB 1NC4D 4L8CA 1IGCL 1QFUL 4J23A 5T1KA 3M1BA 5HHNB 3SKJL 3LSOB 4ENEC 4M7KL 4HXAL 3TZVB 4K94C 5DD5H 2RJMA 4DKAA 1WLHA 2HG5A 1HKLH 2BSRB 3JV6B 2J12B 3EYSH 4HWZB 3HCVA 1X4ZA 5C0CD 1NMCB 2NPLX 5JO5B 2GHWB 1N59A 1BFOA 1B6UA 2R39A 1EHLL 1AHWC 3QG7L 1N5YH 4P2RA 4YBHA 2PO6D 5F9WC 2CLZB 2EE2A 5M94B 1D6EA 1BAFH 4RZCA 4QRRE 2BY2A 4ZXBC 1FFNA 3C5ZB 3HPLB 5ITFA 1OWRM 2N7BA 4AK1A 3D25B 1INQA 2BHZA 2ZNWA 3CUPB 1MWAL 1MSPA 2BSSB 3MV01 1LEKB 1MRDH 4TSAH 3B9KC 4JQVA 3MACL 1IAII 3CVIH 2V17H 2Q1EA 1P1ZB 5KS9F 1WAAE 1RAMA 5L88L 3WHXA 4XWOD 2N56A 4G8GB 1F6AA 2P46B 3QFJD 4OCRL 4UAOB 1Z9OA 3B5GA 3JTTB 1Q72H 5D96B 3WN5C 1DDHA 1TTGA 1RZGB 5B38A 2UWEF 3W0WD 3N1MC 2CDFB 2HTKC 1KJ3H 3HLAB 3MRGB 3WO3B 3TNMB 3TBYA 5DR5L 1BX2A 4PJCB 1RMFH 4XP1L 1I85A 3QHZL 3S6CA 3U7YH 1IC5H 1Q9WB 2DQTL 5DEGB 1NLDH 3O3EA 3RKPA 2QTEA 3J7HA 4OM0L 4MD4B 3M8OL 3VFVB 2E27L 4RMQA 3AC0A 1RI8A 4JFYA 3MNVB 4MB3A 4RA0C 1NMAL 3MRIA 1IEBA 3BKCL 4P2YA 3FHQA 4EEEA 3GJFA 1KJVA 2GI7A 5CD3A 4ODWA 4OGAC 2ZUQB 1G7PA 3SDCD 4EI5D 1JF5A 5B8CB 4WI4A 3RVUD 3OKOB 4PTTA 3TF7C 3I6KB 3WEXA 3O8XD 1UXWA 2XTJC 3SDXA 2Y1VA 2FEEL 2C5DC 5TDNB 8FABA 1BOYA 4CMHB 1SJXA 5J9PB 3RU8H 5LG1A 2VNCA 3C08H 1F8TL 2HH0L 1ZKAA 4EUPH 1GHFH 1H3VA 2AJUL 2R0WH 1DUYB 3TJEH 1CGVA 4U05A 5IWLA 3PL6B 3QZWA 4PGEB 3V8OA 4JFPB 3CZJA 5JW5A 1ZLSH 4A6YH 3WUWB 3T77A 2Q87A 4GRWH 3UTSB 3OQ3B 2EDNA 4XMKL 3CXHK 3FRPG 2UVFA 4ALAL 4WUUE 5J7CC 5MEND 2NNAB 3CFJA 4R4BB 4RBPK 3RWIB 1NAML 3B9VA 4M9PA 1W0WB 2EXWC 5DGRA 2NY4D 4ZUWA 3RWDA 5DUML 3BRFA 4XXCC 1D5MB 2LV4A 3BMWA 4LSSL 3CU1A 4XB8A 3RBSA 3V4PL 1AHWA 1KLGA 2A0LD 1OAUL 1W72L 1XGRA 2Y07L 5KG9A 4CGTA 2EKJA 2FH6A 2VITB 3MODH 3VXUD 1BJ1J 3KPSD 5IF0A 2BVEA 3GEWB 5HPMA 5HGDA 1JZ6A 3QO1A 4XAKD 5BQ7B 2XTJB 3IRPX 4KV5F 3HR6A 1GZPA 2AABH 3GSNA 1I3RB 3DO7B 1BZ9A 3G5XA 4O5LL 1FG2A 1QA9B 4K3JH 4F57H 1CTOA 2UYLB 4M1DH 5IG7A 2Z92A 1OPGH 4OKVA 1TVHA 5I30H 5DRXA 2VZ1A 5K33A 4KHTH 4IOSD 1ED3A 1CL7I 4BQ8A 3PHSA 5IT2H 2ADJB 3H42L 3ULVC 2EYSB 2FD6H 3QUML 5IGXL 4OD2B 5D7JA 1TQCB 2F19L 4F58L 3L95B 4OV5A 2EEDA 1F3DH 4UOW1 1GGUA 5BZWB 5J89A 1YMMD 4G9FA 1WWBX 2W91A 3VGDA 4P23A 1TQBC 3I6LD 1JPSH 1OSZA 1CL7L 1IGFL 4PTTB 1DQJA 2NX5E 2UWEB 3R1GL 5BRZD 5BJTB 1Y18A 1NAKH 3WLWC 2D7NA 3BH9B 1ZHKB 3DTXB 3KNBA 1TZGH 2VDOH 5CEYB 4UB0L 1HOCB 2PW2B 3AREB 4G6FB 3FOLB 1RPQA 3OR7A 1UGNA 3GJFK 2NW3B 2OXHA 1OTTC 4ZAKC 1NLDL 2R69H 3QWRD 2AKRA 3RAJL 2VL4A 3O81A 4HK3J 4P4RB 1LP9A 1CGYA 1MCSA 3JBG7 2YEZA 4R4NC 2W9EH 1MJJA 5FKAA 3H3PL 1I3VA 1UWGH 4ZODA 5SWZA 4EQ2A 5MEOB 1DJSA 3EOTH 3UC0L 5ISZA 3MRLA 3GSQA 4F7CB 1K5NB 5D2NC 3GIVB 1JTPA 4CAGA 3HNTH 2IBZY 3LV3B 3HE6B 1YYLL 4JGJA 3VMPA 1MLCB 3OR6A 4Y5YA 5D7LB 1D5IL 5C9JA 4HCRL 4TNVF 5F3BB 3KJ4C 4YFLF 1G7HB 3A6BH 1TQBB 3K7UA 1D6VL 1VEOA 3MOAL 2E9JA 5K9OB 1P1ZA 3HAEB 3OPZL 2E6PA 2W9LA 4R2GD 1DVFA 4BK4A 4LCWD 4O2EB 4U7KA 4ZAKB 1MLBA 4OIAA 2AK4D 5J3HD 2W0LA 4RIRB 1YYLH 1INQB 4NQCA 4S10A 4WGVB 4WJ5A 3KLHC 4WIQA 1BGXL 4ZUVB 5C0BB 4BJLA 2F19H 4F58H 4ZFGL 1BPVA 5D2NB 3FQXB 4L4VB 4LL9A 3T0XA 3P73B 4J4PA 4GKOA 2X6MA 3F7PC 3QHFL 5JHDE 4C4KO 2B5IB 2PTVA 2X5PA 5L2KB 5BJTA 5DLMH 4LHUA 4JY4B 3RWEB 1VENA 4P2RE 1T20A 1E0OB 4CDGC 2Q3ZA 3NH7H 5DVLA 3DO3A 1CICA 3ALPA 3LKOB 3Q2CA 2G60H 3FN3A 3VW3H 5AYQA 1KPRB 3T65B 2VZVA 4PPTA 5FYKD 1G7MA 2NLJA 4KK6C 4UT6H 1ZVSB 4TNWK 1AO7E 1WBXA 3WFCH 1CFQB 4I18A 1NCTA 2VDRL 4PBWD 3OMZA 1FPTH 4UTBH 5ERWA 5GS1B 1TVHB 1NAMH 1ZGLA 5ALCH 2ESVD 4MYWB 3NAAL 3K4DA 3FB5B 3H42H 3QDMB 5EORH 1BVLA 3TC9A 4RFEB 1MJ7L 4Q6IC 4RGNC 5DRWB 2H9GA 3CGTA 3MLWL 3E3QE 4XNYL 3L7EA 5IR1A 3WNLA 4JO3H 3TO4B 1RZKH 3FRUB 3OKEB 1CLOH 4HHAA 1KTLA 3QDGE 4I77L 1XGRB 3ROLA 5T33L 4JO1H 1YY9C 4YNYA 3V79C 1D5MA 2V2WA 4KVNL 4Q2ZB 4OF6A 4S1DD 2P1YA 4Z7UF 3KVQA 3TVMD 1LK2A 1W72A 3VGGA 4Y4HC 3VXOB 5DUBA 4NRXA 2C1OB 2CSPA 3PUCA 2YPKB 4UQ2B 4RCAA 4KUZL 2F5AL 4HGMA 4J4PD 3D69A 1MREL 5GZOC 2VDKH 2WW8A 2VXQH 2IQAB 1C16A 1ULVA 4YDLC 3O6FB 5DURD 4ODXA 4HIHA 1T2XA 3WIFA 4JZJA 1VGKA 1K4DB 1OGAA 3G6JA 5KTEL 3TM6A 4Q6IB 3SKMA 1H3GA 4PRNA 3TBTA 3MRPB 3CK0L 3EJZD 3AY4C 4M8QA 4ODSL 1I1AB 3B2VH 1QZ1A 5DHXB 3BO8B 4XCNB 3F7VB 4JY4A 4YHYB 4WW2A 4JFEE 1S7TA 3DETC 3IDXH 2IQ9L 1IGTB 3DRQA 4RDQG 2HJKB 1CTNA 2P8MB 3L5XH 1U42A 4YO0A 2FR4B 2A6IB 1YNLH 5ACZB 1G9MC 5DGQA 4LHQB 2VN7A 4OFIA 1MI5D 1U3JA 5A2LH 3VI4F 3E1F1 1B4JL 1I8KA 4P9ML 1M7XA 5EUOE 3K1DA 1I1RA 4HUVA 5C7XL 3O2WL 1HHGB 3IFPA 3W0WA 5HYJA 3UCRA 3MV8A 1ZTXL 4LRNH 2FECI 3B43A 3I3BA 2DQEH 3KWWB 4M61A 3MRDA 4P5KB 4PGDB 1BQHB 1J05B 5E8DH 1XR8B 5JZ7D 5KS9E 2F54D 4WY7H 3QHZH 1GOFA 3BD4A 3H2WA 1FLRL 3O9WA 4K3HA 5DUPH 4XAWL 2BX5A 5DR5H 4FQ2H 5FV2A 3UMTA 1BAFL 4EN3A 5IHBA 1ZVYA 1I1AC 4N0UE 3MRRB 4LKCB 5CKAA 3L3GA 1TCRA 1WZ1L 3BGFC 3ZYOA 2QKIB 1IGJA 4X7SH 2OZ4A 3V6BR 1I7TB 1TLKA 3DX6B 3HMXH 1D5ZA 2ZKHL 1L0YA 4H1LG 3EDKA 4ZOEA 3LDBC 4F3FA 3U2SA 5SWZB 1CFNA 5E9DD 5MEOA 3OAZK 4NO3B 1QVOB 5DD5L 3UBXA 4RGNE 4I0PC 3QI9C 3K2UH 1HKFA 5BW7C 3CFKA 2ZJSH 5GRVL 1BD2D 1QLRB 1FBIL 1LP9B 2QR0B 2J5LC 2M26A 1SM3H 1X5XA 2FL5A 1PLGL 4MX7A 3GSUB 3U7WL 2EXYC 1QSEA 1BFOB 4XMPH 1NEZA 1BOGA 2VQ1B 3KDMB 4G43B 5DJAB 4PG2C 3SGEH 1FL3A 2DMBA 1LDSA 2YKLH 5IJKA 1YN6B 2GITA 4N0UA 3KJ6H 5I8CA 2VLME 2BSRA 5JR1L 3TVMA 3BDYH 1ZHBA 1ZVHA 1VGEH 4PJAA 3UTPD 4D2NA 4JFOA 3RVVD 2F5AH 4FXGB 4Y4FC 4G3YH 5DJCB 4IEFB 1JE6A 2Y4SA 3L95A 3BGMA 4C58B 4MMZC 3DSFH 3SHSA 3TA3D 3T2QA 2X4UA 4M7KH 3QIUC 3EYVB 4Y88A 5EUOA 2X7LA 3EIFA 4HT1H 2EKSA 1RY7B 4JREC 1NQBA 4I13B 3VMOA 1KCSL 3U0TA 1GJIA 1YJDH 3SGJC 1N2RA 2DJSA 3WFBH 4AT6B 2V2XB 1A7NL 2J8UF 3QDGD 1YA5A 3QUXB 4NQEE 3SJVE 1GZPB 4XPBL 4Y4HD 4YFEA 4DAGH 1F3JA 3QO1B 3L3DA 1N8ZA 4JFEA 3CDGB 5EBMB 4G80B 1MIMH 3QQ4B 4JAMB 4X80H 4I0CC 3LKPB 3CPLB 3NAAH 5CJBA 3QUYD 5ESVA 1S9VB 4GRWB 4JM2D 2C4FT 5I73C 3WE6A 4K7PY 5DJDB 4ZUWB 5GRWA 2R4RH 5D1QD 1BJ1H 1KCRH 1R3KB 4FFVC 4PD4J 3RWIA 4GBXA 1GZQA 1A7QH 4DVBA 5I1CL 3N1QC 5C0AD 1UWEH 2VDLH 5JQ6L 4YHPB 3HPJA 4PP1D 4Y5VA 5BRZE 2J8OA 4KTDH 3QIUB 1LEIB 25C8L 1A5FH 3HMXA 4KU1A 5IHUH 3MMEB 1X4XA 4B7LA 1BZQK 4JDVA 3RWHA 4JFED 4U6XB 4F7MB 3S88L 1C7TA 4R2GB 2ITDA 3OKDA 1PEZA 2JF1A 5TFSL 4NRYB 3JTSB 5TDNA 5IFHL 3S37L 4MJ4A 2R0KH 2HFFB 4ODVL 2X4RB 4W6WB 3RNQB 2R4SH 3MV7D 3OKOA 1MCFA 5L2KA 3C9NA 5DO2C 1O0VA 1S78C 4XC1H 3QHTC 5AD0A 3BPCB 3MRMB 3N85H 2VJXA 3MRIB 4UINL 5HYFA 3VH8A 4OQTA 4RFOL 4JFYB 1KULA 5H2BA 2BY0A 5IESH 3Q6FB 4IDJH 4OFDA 1CGTA 1FSKC 2JJUA 4G6ML 1XCQB 2BNRB 3C6LB 3H9YA 4PJDA 3RGHA 4F3FB 4M7ZB 4RX4D 1UYWH 4X0KA 2QJDA 4PJGF 3GMRB 3CFBA 4DUXA 1FDLL 2IADB 1AR2A 4O2EA 3WO4B 1Q8MA 4DOHB 1KXVC 1QNZL 3NFPA 4P3DB 3DBXA 2ZCLL 3ABZA 4NRZA 5ANMB 2NY1B 5F1OB 1LDPH 2ZOLB 3OAZH 3OKLB 1KGCD 1KENH 2P8PB 4R2GC 1EA9C 3F8UB 4WFGD 3JTTA 3QA3B 4NHCH 1LO0H 4GFTB 2J8UA 3V6ZA 1OP5H 1KTKE 4YXKH 1Z3GH 5GS2H 2GTZA 4JKPH 3QDAA 1F2QA 3FONB 5BXFB 4P3DA 2IQ9H 1NGPH 3GMRA 3L5WA 1P4LB 5DD3L 4F7CA 1T83C 5I9QC 1AQDB 2ZSWB 4MXWH 2IG2L 4U6VH 2VC2L 2BFVL 2BOCB 1HHGA 5IUSA 4H8WL 4PLOB 5C07B 3UJTL 5ITFB 2BZDA 5BRZA 1G6RH 3IDIA 3SOBH 1NBYA 2IALB 2XZAL 4GKSB 2W9DH 5I6XC 3DX8B 2Y7QB 1H3XA 3QUZD 1JYNA 1DBMH 2VXQL 1ITBB 1E27A 2R2BB 2P5WB 1A1OB 5ETUB 5JORB 5DQDL 3KYAA 5LAXB 4YUEH 3QDJA 3ZKSD 2EYRA 4MZ2A 1T04B 4QTHB 5FGCB 5E6IC 1OSPL 3C9NB 1U3HB 3RIFK 3WD5H 5I15L 1R5VA 3RUGA 3DVGB 3TESA 5FYJL 1UJTA 3INUL 1YY8A 1AGDB 4U6HA 5T3XH 4YC2B 1PSKL 1HXYB 4N5UA 5ID1B 2APFA 1TDQA 4NNYA 1OLZA 5F9OH 4Y16D 4YGVA 2HFEB 4U1HA 3B9DA 1JL8A 3CCHA 2DD8L 5I30L 2VLJB 3HC3L 3O6FA 1OPGL 3GSNH 3L3KA 5D7JB 1DBBL 2COQA 4Y2DD 2PYFA 3E2HB 1QLFA 3HR5A 4OZGF 3KPSA 1I3GL 3SCMC 1TQCC 4E0RB 3MOQA 4ZDHB 4QLRA 1R0AH 1KYOJ 5DUBB 1UA6L 3KPMB 5KS9A 4QNPE 1IGMH 2APWA 1EZVY 3TH3T 2QHRH 5K9KA 4QXWA 5EU6A 1KCSH 3O41A 5EU7C 4PJ7A 4H5SB 5DT1H 2GSIA 2FHBA 3CXDL 5HPMB 2P8LB 1IMHC 3IJYA 4NQED 1ORQA 4MNQB 4JAMA 4HX1B 5J12B 1A5FL 2YUZA 3GSWB 1A6VL 5EBMA 3NFSL 1MEXL 1VHPA 4FQLH 4V1DD 3CX5J 5GJTL 4JFXA 4YC2C 2BHUA 3TPUA 1I1FA 1UWEL 1QO3B 3VXRB 4F9LA 3RZCB 1I8LC 5A40E 2I60L 4XBEL 4WI9A 2WBJC 2F58H 3T8XB 5T3ZH 4NUGL 1F11A 2C9AA 5C6PB 3F58H 1BEYH 5F7UA 1I75A 1X5ZA 3O6LH 5JOPE 1CDBA 3DYMA 5HD8C 3CH1B 1UJ3A 3RY5A 3KXFB 3RIAF 5ADOL 2EDFA 3SE9H 1JJUA 4YHNA 3HUJF 1HHJB 5HD8D 1EMTH 2EDYA 4PGBA 5D7LE 5DVKA 4POZD 4LGPB 1A7PL 4MDJA 5GJSH 1P4BH 3NIGF 4NZRH 3D85B 1X5AA 3MR9B 1YJDL 2GITB 4Z7VA 2HVJB 2EH8H 1R24B 4M02A 2XTJE 4I1NB 4Y5XC 2HN7A 2VLRE 4OGAD 1MVFA 5D71L 4RDQF 1I1YB 5EO0B 4Z0XA 3QWOB 4X6EA 4EI5B 2WWKT 3WV0A 4K3EL 5E2VL 4RQQB 1G0XA 2Y36L 4JRYA 5C07A 43C9B 2A38A 1PKOA 2CO6B 3O3DA 4BH7A 1AGBB 3VXME 4ZOCA 1Q72L 1D5ZB 4FMKA 4QRPD 2PO6B 3DV6A 4JG1L 1QRNB 2AV1B 4LQ1A 4XBGA 3L3GB 4XX1G 3ZHDA 4MA7H 1W8OA 1QFOA 1E6OH 3G6JF 5C09D 3OKYA 5HYIA 4QRTB 4TUKH 1HSBA 3JSSA 2O26U 3NTCH 3OB0H 1CD1A 3MLZL 1KFAL 3OR6B 2QQKH 5AZ2L 2PO6A 3W5MA 5HHOA 4ZNEA 3MRBA 1JMZA 1YZZA 4OGXL 5KSVA 5M95B 3CDCA 1XCQA 2X4SA 3TJHC 4R0LB 5L8KB 2KH2B 5CP7B 3V0VB 2YEZB 4ZOAA 5I8KH 2NXZC 4IRZH 3MNWB 1MELA 2D2OA 5IW1B 3W9DA 2DYPA 1TTFA 1TJHH 1NMBH 2B4CH 1CU4L 1CR9L 4AG4H 1F4XH 2A6IA 5J0BA 5I8EB 3GUTB 1WVZA 4LIQE 3V6OA 2FBJL 2P8MA 1J8HD 4HXAH 8CGTA 2PO6C 1J1OH 1R24A 4JLRB 3U0WL 1MCCA 3P77B 1S7TB 1TCMA 2BSTB 5F6HJ 1RUAL 4KVCL 4FQ1L 4M1DL 4MJ6B 3F7VA 4X6DE 5C0RL 4JY6B 3V4VL 1A9EA 3D5OF 2AXFA 2C7UA 2AK4E 2QHLA 1IQDB 4LLWB 3MRJA 3OB0K 3PGDA 4U1SB 3SGJA 2PETA 4HIHB 2VLRA 1JZ3A 3WFDL 1LO5B 1PW3A 1UJ3B 4XWOC 4KFZC 3QUMB 4JGUA 3VXUE 1UVQB 3CFDB 3IFOB 3RX5A 4U6YB 1BM3H 1X4YA 1CDIA 1DN0A 3C8DA 3MGOB 3G6DH 4NWUL 1AKJB 2J3SA 5CJ8A 3GSVB 2KL6A 3C6SB 5HI3C 4KTEL 1BZ9B 3CK0H 4NKMB 1BLNB 5IROC 3NCJL 5E2WL 1B0RB 1Z5LB 2FWOB 3DUUB 1JTTA 1CXKA 1FPTL 4UTBL 4A6YL 5GSRB 1OGAD 3JWDL 4L8DB 3VFTB 5I1KL 4Y5XA 4HQQL 2DLFH 5IEHB 3WDJA 3BKML 1JV5A 1FE8H 3PL6D 5BV7C 4GG8A 5DVOA 1HIML 1FVDA 3QT2A 4OBRA 1G9EA 3RDTA 2V5RA 4PB9L 1OAKH 3M17B 2JCCE 5GS0D 3JVGA 1KEGH 2GW5A 1BWMA 3EO0A 5DHVB 5HGHA 4PY7B 5IOPB 4FZEL 5DLML 5ANME 1OT2A 2GK0B 4C54A 4NQSA 1IGIH 4E0RA 1J7VR 3H7BA 5D6CA 1UB5B 2J7LA 1UJ3C 2D4DA 5HGAB 1CU4H 1ZVSA 1RZKL 4JRXB 1WEJH 1B0WA 5JLZA 3KPNB 5L2KE 2E27H 1I9RL 3NABH 1X9QA 2GIYA 3VFWA 3U0PA 5MENA 3VFOB 3LN5A 5IHLB 1BFVL 3D39E 3E3QC 5JMOC 1QFHA 1EHAA 1QUNA 1JZ4A 4XWGL 3ARGA 4O4YL 4KKLD 4JPVH 4XCCL 1BM3L 3G5VB 2OR9H 3QDGB 2NY4B 1HSAB 3P4OA 4TUJB 4MQTB 4RNRB 3B8YA 4OZHB 1G7QB 5A2FA 5ESAA 1E27B 5ETUA 3PV6B 5JORA 1JHLL 1YQ2A 4XC3H 1DL7H 4YHLH 2DTML 5D7SH 3W9DB 5IW1A 1YEHH 4N0CD 2J6EA 3ZKNC 3GI9L 5HPOA 4QRSB 3CFKB 2VLKE 3TBVB 1OCWL 5C3LD 4D0CB 4JFHE 1MF2H 1MCBA 4Q9QL 5EOTA 5FUZL 4TSAL 4Y4KB 2EICA 4L8BA 4OZIB 1J1OL 3FAWA 4NDMB 3O6FC 4HK3N 4Z7WB 1FLTX 3FONA 2XFXB 4GJTB 4OUUA 3UJIL 4LLMA 1ZLWH 3H3PH 5C0ND 4H20L 2W60A 4DKEL 2IPUK 4XAKE 3VRIA 3DIFA 3JV0A 4B7IA 4XHJC 3AY4A 1S3KH 3WS3B 4PV9B 5L2JB 2FYYA 5DDHA 3MUJA 5I16A 1MFBL 5J57B 3CSYB 5C0DB 5HI4D 4GKZA 3NMEA 5GGSY 4Z0BL 3BRDA 2ZOKA 3OJMB 2H3NB 4S2SA 5BCAA 4GRLA 4J12A 4P4KC 4DEPB 1N0XH 4OZFG 1IGFH 1W0YT 3MREB 5SX4I 5E5MA 3GK8H 1R3JB 1D5XB 4M1CD 4W6YB 1V3LA 4XVSL 4Q9RH 43C9A 4OQTH 3P40A 1DP0A 1I4FA 3PGCB 4YDVA 4Q9BA 3VFNB 5HHXL 1G9NC 4LLQB 2FSEB 4G8GD 4Z7VF 3SE4A 1S78D 1HILB 5DHYB 4EXKA 3SDAB 4HUUA 2CLZA 1XF4A 3LVEA 2R29H 4HV8A 3MRFA 1G7QA 5FKPB 5ACZA 5EOQH 3MRMA 1I1CA 3QCTL 2KQNA 3UTTE 1IEAA 5CEYA 3IDJB 4NWTL 1IZJA 1VSCA 1H9VA 5FB8B 1PX4A 5SX5H 3KS0H 3MYJA 1PX3A 1A4KA 4GSDL 3MLPA 3F7YA 2OL3A 4RRPA 4Q6IA 3SKMB 3T3PE 2VDML 5D70L 2W92A 3LSOA 3BZEA 2EXWD 2JELL 5L8LB 4PJ9C 2H8PA 4D9LH 4JRXA 3VD7A 4OCSH 3U36A 1WQVT 4Q74A 2GY5A 4XTRC 2FIKA 1ED3B 2YUWA 3F6IA 4U1MB 1IQWH 1T0PB 3C2AL 2DWEA 3VG9B 1MWAB 1QPXA 1MJ8H 3RZCD 2UYLA 3K74B 4P2QA 4NO5B 2YS4A 2J6EH 1NLBH 1WIUA 4S11A 1VKXB 2JKXA 2VTFA 4NOBA 4QHMA 1JFQL 2I5YL 3HFML 5ESVB 2D7TH 4KY1H 4ZYKA 2R2EA 4KKCD 2AV7A 4YAQA 3R0NA 4J1UB 1OW0C 3RP1A 1TNMA 4ZNEE 1G0DA 2IFGA 3QEGH 3VFTA 2NCMA 4Z78B 4HMCA 3O6LL 1KCLA 1GC1H 3UTQA 4TUOB 4WFEE 1BZ7A 5FGBA 3MBEB 5BO1H 3H8NA 1CE6A 2EECA 4NO5A 3HZMA 4UNUA 1XCTA 5F6IC 3V52H 3V2AR 4NQVB 2PXYD 1HI6A 3ARSA 3QDJD 4ZPVA 2ATPA 5TGBA 2NYYD 3RVVC 4IRSC 1ODAA 3L5IA 3QUZA 1YEEH 3B5TA 5DEZA 2XZAH 1AE6H 3ARWA 5EOCJ 4JFOB 1T21B 3I84A 4X4MA 3WJJC 4AJ0A 1P9MC 5JIIA 1SEBB 1RK0B 3EO9H 3VXRE 4D9LL 2CK2A 1J5OH 3O3BB 5D96C 1J12A 5E6YA 3I6GA 3PDOB 4OFYD 4C56B 3NIFE 1NFDB 1NGWA 1I3GH 1SBSH 1KJVB 1BHGA 3BD5A 3GUTA 4KH2A 3ZMRA 4DCQB 4KV5E 2R0WL 3LEXB 4MX7B 5D5MF 3C87A 2VSDA 4NWTH 5HVWA 5GRUH 4ZUUA 5H94B 5DI8A 3T0EB 3RL1A 1Z9LA 2EZ0D 2FJHB 1R3JA 3BW9A 4HPYL 3C60A 4LLUA 3INUH 5DSCB 5DRZB 1BX2B 3MJ6A 3MCLL 3KYNA 2WBWB 1HH6B 2YPLA 1MPAH 3QPXL 4GXVH 4G6MH 1QBLL 2JJSC 4YHKH 1CR9H 1JIBA 1MAML 3ARFA 3MGTB 5B38B 5ECJE 1CG9B 5DDHB 1P7KB 3BFOA 2A9NH 1VACA 4BKLA 1E4WL 2MCPH 1X5YA 4Y7MA 4IRZL 1IKFH 3L3HB 4EDWH 1ZEAH 3DIFB 5C0IA 1A47A 1FV1A 1R6VA 5GZOD 4IIQA 4EI6B 4G5ZL 4U6VL 3MA9H 1EEYA 4V2BA 4YPGA 5DRZA 4LSRL 3NCYP 4NKOA 1J1PH 1N4XH 1AFVL 3V0WL 1R5IB 3BKYL 5I1IL 4MQ7B 1T1ZB 1FSKB 5KVGH 4OCRH 4Q9QH 1CFVH 4R4ND 3SKOA 2RCSH 5L88H 3GDBA 5CZVH 3VXRD 2ZCLH 4D8PB 3HUJB 3REVA 1IGTA 3HG1E 1NFDA 4Z77B 5EOCH 4L3EA 3Q1SL 5F7HA 1AD9A 1VA9A 3S96B 4WV1A 3WNNA 1HHIB 1A7QL 2CDGA 1I1AA 3O2VL 1MFEH 4Y8DC 2VXTL 1NUFA 1TJIH 5ICXA 3GJFH 3JTSA 4BFIB 5IVXE 1YEKH 3BPNB 3MXWL 1JPGB 5I1JL 4M48L 3C09C 2F74B 2O61A 3MMEA 3VFSB 2P45B 3FO1B 3QG7H 2L4OA 2FB4H 3VH8G 3O6MH 4XHQA 1PKQA 1ZLVK 4LPUA 1OGTA 2G75B 3WHE1 3OWEA 1NBVH 4KKBD 3RUGE 3EO1B 3GHBL 2XG5A 3HE7D 4X6DB 1V5JA 5GIRB 4OB5H 4K9EL 2DKUA 3GSNB 2C3GA 1A7PH 3QUYB 2JJTC 2GKIA 3PNWA 4JZOA 4JDZA 5E8EB 5FM5O 5BV7H 1DQDL 2YD6A 3UJJL 3MLTB 2ZCKL 5IQ7L 3LRHA 5C0EB 1Y6KR 2HT3D 4PP2B 4WW2C 2NXZD 4LVNB 1WICA 3K4ZA 3T0ED 4MS8C 1B0RA 4HJJL 4CDHA 1AJ7L 2X4QB 1I7ZA 4GW1B 5A1AA 4JZJC 4HBQA 3U0TB 4MDIB 4H8WC 4QF1B 4KC3B 1FNLA 1NCAL 5TQ2H 5IIEB 1KCVL 1PD6A 2IANA 4AEHL 4WTZA 1XF5B 3PL6A 4HUXB 5CGTA 3U36B 1SY6H 2X70A 3U7WH 3R4DA 5EIIB 3A6CL 4NSKB 2EDBA 3LIZH 1KPRA 3MC0A 3BZEB 3JUYA 1J0YA 4U1IA 5GGVY 3VE0A 4R26L 4X4YB 5F70A 5JNYA 3VWKC 5DK2B 4FQCH 4GAGL 3KG5A 2IF7A 4PBXA 2FX9H 2IEPA 4IS6B 5I19H 3MO1B 5IW3A 1ZV5A 4MJ6A 3EGSA 4OGYL 1KIQB 2APBA 5F7EH 1G6RA 1KNOB 1T04A 4F2MB 3V4VH 1L6XA 4OLWL 1MHCA 3V4UH 2CR6A 2DQIL 2NY1D 5DMJB 1WZLA 5C8JB 3QNYB 2XKNB 1KPUB 5IBUB 4QHLA 4M48H 3MNWA 3BP7A 2EDHA 2CMRL 3SQOH 1U8JA 4XPTL 3X11A 2ZWLT 3VFVA 2A0LC 5CP7A 3V0VA 3SDXF 2QQQA 3QNXA 3BT2L 4M8VA 4ZXBA 1RV6X 5T3XL 2J2ZA 1B6DA 1NMBL 3B6SA 4NZDA 4D0DA 3QAZC 4ELKA 5BOZG 2MQ0A 1P4LA 2DQEL 4PJCA 4LCCC 1E4JA 1LP9E 4HH8A 2IBBA 3ROOA 3FT4B 4QTIL 2P42B 4PGZA 1HZHL 2EC9T 2QSCL 3RKDD 4RX4A 3STZB 2XICA 1OWWA 5KZCD 3KPPB 1U8KB 4GXVL 1WCBB 1V7ML 3L3HA 3PWNB 1DEDA 3QUKA 4LGRB 5J1AA 4G8GA 3G5YA 7FABH 4DZBB 4ORGB 1PY4A 4APQB 5C2BH 1P5VA 4YFLI 2B2XH 1RVFL 2VXVH 2XT1B 4LSUL 5ITBH 1QSFB 4DVRL 4OF0A 4EI5C 3RWJB 4D0DB 1H15B 5ISZB 4O00A 4K7PH 5GS1C 3O4OC 3TWCL 5C0FB 4HUVB 1AQKL 5DI8B 5EZJB 1JNHB 2YPLD 5INDA 5I75B 1HQRB 2UY7A 4HIIA 2WBKA 4RGNB 3F12A 3T2PA 2GUOB 3HNVL 4TUJA 5KANI 4UDUA 4HZLA 1A7RH 3QPXH 1S7QB 3CFEA 2YBRA 3PQYB 3H9SE 2BCKB 3O11A 4CVZA 2LABA 1YEEL 3MRPA 4JN1L 4N90E 2EC9U 1J86A 5F7EL 2Q20A 1FZKB 3V5KA 3M1BB 4L4TE 3OAUH 4JN2B 4L8CB 3IS0X 4L3AA 1KTDB 2A73A 4HS8L 4KZDL 4HIXH 4XNYH 5INCB 3IT8D 3L5XL 4UV4H 1FH5H 4OKVB 5T1LB 2PYEA 4V1DB 4NQSB 3S9DB 3BE1H 3U9PL 3LQMA 1A2YA 1FNHA 2ZUSA 3U1SL 3WKML 4Q7DA 3WL9B 1I7RB 1W0VB 2QLVB 1WWWX 3EW3B 1FNFA 1IAIH 2AJXH 1MHPH 4D3CL 1SVZA 1MCEA 5IHUL 4RGND 3BDXA 1F4YL 4NZTL 3MLTA 4MD5B 4P23C 2APTA 4O58H 4FMFA 4KZEL 2BNUB 1T7XA 1FIGH 2HRPH 1C5DA 1NDGB 3IDYB 2R23A 1WFTA 4WU7B 1KCRL 2X1WL 4V1DA 1WWAX 4HBCH 4L29B 2QSTA 1QFWL 1P4IL 5EBLB 5E4EB 3CMOL 1WBXB 3WKMH 1LE5A 3FO1A 2APVA 1E4XL 2BNRE 4G6AD 4BH8A 3BGMB 3S4SG 1NBVL 1NBQA 1B0GB 3OG6B 4MNHA 4FXGA 1N0LA 2D7TL 1A14L 2WIIA 2YN5A 4JANA 4N1CA 1B88A 1FZKA 3GNML 1IZKA 3PGDB 3WXVL 2K7QA 2WWMC 5F44A 2E3VA 2MSPA 3RPIA 3OAUL 1ACZA 1ORSA 5JW4Q 1A6ZA 3KPQB 4X6DF 2AK1L 3MOBH 3MXWH 3P77A 4DN3H 1YPZA 4MJ5A 5JPMB 5IMOA 3TT3H 4GRWE 1MCDA 3SO3B 1MI5E 3GJFB 2Q7YA 2A6DA 4KAQL 5TF1H 1A6TA 4XXCA 2EYTA 4XVSH 2FL5B 2K9UA 1NUNB 2JELH 1D9KB 2AEQH 3IDIB 5DVNA 4WJ5B 2QL1A 1BBDL 5E9DE 4TSBL 5I1AA 5FOBA 2L7UA 4ZFZA 3T2NL 1Z9SA 3FQTB 4WEMB 1L9MA 4RIRA 3MREA 5MEPA 1QSZA 4P5TD 5I1IH 3TBYB 1ND0B 1T22A 4HIJB 5EBWB 1F00I 4N8VA 5SWZD 3RJDA 2DM3A 3IDGB 2DMCA 4Y8AA 1JNLH 3WFEL 4X6CF 4LKCA 3HI5H 1AY1L 1DDHB 4QRPE 3GRWH 1G7HA 4YHOL 3ARQA 1HWGB 3VWKA 2W60B 4L4TA 1KB5B 4Y4FB 4B0MM 1MIEH 5BS0A 5FXCH 1X7QA 4M5ZL 3ZYZA 2GAZB 1GVIA 1U8QB 5IFAH 3CUPA 3QXWA 4ZOBA 5MHSD 5CHNB 2X10A 3MV8B 1XR9B 2BNQA 3GGWA 4PRDB 3P11L 3IU3B 3MROB 4D0CA 4G9FD 1MJJB 4L8SA 2VWEC 3SPVB 1RD6A 4Y0GA 4F9PC 3QUXC 4JGMA 3VH8B 3GKZA 1NBZB 2XKNA 2AKRB 1IRAY 4W81A 5FYLD 5E94B 5DUPL 3BPCA 4NM8H 3FOLA 1N3NB 1J0IA 1CDJA 5CUSH 3S8WA 3VXSB 1YPZB 4MJ5B 2P24A 4YFDB 5AAMA 3W5NA 5FUZH 1CDCA 3IVKB 1CD0A 3D9AH 1UWGL 4WUUB 2CKBH 2QSVA 3NZ8A 4LEOB 5I2IB 1TETH 4ODHL 5GHWL 1B4JH 4PJCF 1EBAA 3ZZ1A 1TMCB 4JDVB 4FABL 1KN2L 3KLAA 5E7BA 5TE7L 1KLUA 5EN2A 1YC8A 1R3HA 4FQJL 4PJAE 3LRSA 3EYFB 2PNDA 5T5NF 3D69B 2OR9L 2QADC 1HI6B 1TZGL 1AE6L 4MSWA 4G6KH 2E9IA 1VADB 5IOPA 1LK2B 2W0FA 5FYJE 4YPJA 4GKNB 1XZ0A 4M3JA 3CLFL 4C59B 4TNWF 2Y5TB 1CD9B 4UOJA 4X98B 4Z78A 3CVHL 2IH3B 4PJ8C 4HG4J 4XTRD 4OLVH 1FP5A 4MNQA 4RMVA 1ZHLA 2NYYC 3QUMH 2FZ3A 1UM5H 3BE1L 3O4LA 3MNZB 2NXYD 1RZIA 3G08B 2BRRH 1T4KA 5C0NC 1OP3K 2FATH 4DKDC 1K3IA 3I02B 3CFJB 3U4BL 4YZFE 4JE4B 2HMID 2PTTA 4ONFH 2ADFL 1AKJA 3QIWB 3PQYD 3UTSA 4DAGL 3C6LC 5JW3H 4UV7L 2X7LB 4JFPA 5JW5B 4OZGE 1EK3A 4OB5L 4Y16C 4D9RE 4U2YA 2VLKD 1P6AB 1KTDA 2MPAH 1T7ZA 4KMTL 1CT8B 4WFFE 1MJ8L 1G7MB 2WINB 2EDTA 5F8QC 3UDWA 1X5KA 3VD4A 3NIDF 1P7QB 1QPPA 2EDOA 1UM4L 3ARVA 3MFFB 1CICB 1ZHBB 4MLIA 5HDQL 4KJPC 1I9IH 5HHMD 1CQYA 5KVEH 3W2DL 5I8CB 4X9IA 1DBKH 4EUPA 1U8IA 1TJHL 2BSTA 2DLHA 4HWBA 4PJFB 4LSVL 3TA3A 3F5WA 1F4AA 2V9QA 2VXTH 1N6VA 4UDUB 4L4VA 3NGBB 3KR3H 2CLRA 1A1OA 3LEYH 2GJJA 1XT5A 4X4XB 5FECB 4PRHB 3WIHL 3NFNA 4K3GA 3P4MA 2BVUA 5A2JH 3EYQD 1QVOA 3UBXB 3LKQA 3R06B 4JY5L 1XR9A 3GGWB 4LQFH 4PRDA 1ZA6A 1VFAA 4OF5A 1U58B 4QXGL 1ZLUH 1XIWC 4KJQD 1QSED 3BKYH 3BJLA 1T1XB 4WUKL 5CSZB 1ONQA 2J8HA 3BH8B 4AG4L 1KB5A 2C26A 3BKCH 1IEHA 3G04A 2FO4B 5CZKA 5A16B 1JK8A 1MCHA 5DJYB 4QRTA 1M7IA 4TSCH 1JF1A 1P9MA 1ZS8A 2DDQH 3KYOA 5TDOB 4CMMB 1EGJA 2VZTA 2V5YA 4UT9L 5ABDE 4LDLB 3C09B 5FDYA 4MAYA 2H2PC 3X13A 3QUZC 5CJXC 4FQ2L 2E5EA 1MRFL 3EZJB 4DQOL 4X8JB 2GJ6D 3DSNA 3NPZB 2HJFA 2AJSH 3CDFA 3EYOB 2YD4A 5KANG 2PR4H 1D9KA 2CGRL 5BMFL 4DUWA 2ICWJ 3IKCA 4OD3L 2MKLC 5SWQA 5CLTA 5JIPA 1I1YA 4GS7C 1D5IH 5DF0A 5EO0A 4Z0XB 1HSAA 1P4BL 4YO0B 1MFAL 2IAMB 3B3IA 4U2ZA 2YD7A 3WXVH 5DHVH 4BM7A 1JHLH 2ADFH 4M93B 3OJVC 4OTXH 1OSZB 1QTYT 3SE9L 5JDSA 1DEEA 3TBTB 3KPOA 3BPOC 4PGBB 4XCCH 3TIEB 5CAYB 3IDXL 3UO1L 1TZIB 4OZGB 4ZTOH 1B2WH 5FYLE 4ZSOA 5DYOB 1J8KA 3ULUF 3D3VA 1KJ2A 2ZPKL 1I9IL 2XQYK 4LEXH 3VGEA 5IV2A 1E4KA 1ES0B 1UG9A 3BHBA 4X7DC 1E4KC 4PGCA 4M43H 4ZO8A 3VXSD 1B3JA 5LQBL 4CU8A 1TVBA 4MDIA 2Z92B 2LAAA 4KK9C 3HZMB 4PJBE 1A6VH 1H3TA 2DKMA 4W4NA 5F1IA 2OYPA 1QO3A 2BNUA 4E41B 3FB8A 1NFKA 3MNZA 5C6WH 1EJOL 4ELMA 3MXVH 1MVUA 3HZKA 4OFKA 5DMKA 4OZ4A 4FQXD 4NUJA 4X5XB 5FM4A 4XCFL 1Y0LA 3BZFB 4NJ9H 3GZKA 4Y5XB 1T1YA 4CADA 4OUOA 4YXLL 3KPTA 2OLDA 2BC4A 3CX5K 3U7AA 4XVTL 1HIMH 3RRQA 1TITA 2AS5M 4OM1L 4N5ED 1BVLB 4F7PA 1AO7A 1P69B 4R6UA 1A4JA 3E6HA 2FLBT 1J8HE 3ALWA 5KW9L 2Q7NA 4GG6B 3ULVL 3IFOA 4OZIF 3EYVA 3FB6A 5D1XC 1YEKL 2PYFB 2P43B 1CFTB 2Z35A 4M3KB 1WC7B 5CJXA 3LZFL 1F3RB 1QFWI 1RIHL 3P30L 2PW1B 2FIRT 3QEHB 4U7MA 5D1QC 5DD6A 2Y07H 3MX0A 5F9JB 1AC6A 5CCKH 4ZSOB 5I1HL 5J9PA 3RZWA 5HDBE 3IS1X 2EE3A 1HXYA 4JVPA 3BKJL 3QUYC 3IXTA 2R0LL 1MCWM 5JDSB 4FFZL 4BSWB 3UTSD 3FO2B 5DK0B 2NQCA 1IT9H 1ZT1A 2FHCA 5HDOA 3D18A 4LSPH 5C0BD 3U4AA 1FL3B 2IPUG 1PYWA 3SDAD 1F90H 3VDCA 1NEZB 4FXLA 1JPFB 5IVOA 3GSUA 4XBPB 3HMWH 4MVBD 3RBGA 3MRQA 5ELIA 4R0LC 4PRPA 2BP3A 4JFDA 3PG2A 1A1NA 2B4CL 5MEQB 4RRPG 3E8UH 3TYFA 4HMEA 4TVPE 1ZWIB 4NKOB 1CFBA 4NQEA 3DVIA 3Q3GB 1HCVA 1YEJL 4M6NH 4YXHH 5BS0B 1CIUA 4B41A 4WFHE 2NXYB 1M6OB 1AD0B 1JZ7A 5I16B 4PJ5E 2WLYA 2XXCB 5HI5C 5DJYA 1MIEL 2OP4H 1NGYB 1U8LA 5C71A 5AEAA 3OKMB 3G04B 4BUGA 1SJHB 4N8VB 1OP5K 4A2MA 5B39A 3U7YL 5DEFB 1X44A 4DW2H 1T22B 5DD3H 3PHOB 1GL4B 4NQEB 4WHYG 4HCRH 2R1XA 4PJXA 4YK4C 2BOBA 2Z4QB 4WWID 5DC0A 1RUMH 1NGQL 4NO0B 2A6JB 4NCC2 4E41D 4NQXA 1MHEB 1F90L 5TPWH 5EC1A 3QQ3B 4PRHA 4M1GL 5C8JA 2R1WA 4R97B 3EJJX 4PJDE 3SY0A 1DTUA 5MP6L 3EO9L 1V3MA 2VH5L 4DN4H 2KZWA 5ISZD 2PW2A 4XCYB 4P2OB 3CVIL 1NGWB 1U9KA 3D18B 2BXZA 2DLTA 2ERJC 1SHMA 4POYA 4KI5D 4X7TB 4H0GA 1UYWL 3BO8A 4XCNA 1FHGA 3A6CH 3GRWA 4M03A 2VSCA 3RWFB 25C8H 1UXSB 3BN3B 3H6JA 4ZS6D 3P0YH 3ZT6A 5BZWA 2ADGB 3QWRA 4JJ5B 2X89D 4G7YL 2ATKB 1C8PA 3V5HB 3BWUC 4I4WA 4KJPD 4FQQA 5DZOA 4AYFA 5JXEC 3U30B 1UZ6E 1KN4H 2DQHH 5CIPB 3BEWA 5E4EC 5KZCB 1CFTA 3CH1A 3N1PC 1QQDA 1CGUA 4GG6A 2AJZB 1A1MB 2GJ6E 1S7SB 2C1OA 3MV9D 4ETYA 4LCWE 1EEZB 3T8XA 1MCNA 4N8CL 5TE4H 3EO0B 5DHVA 3JV4A 4GBXB 3MRHA 5HVHC 1FRGH 5CEZD 1QFWH 3L5JA 5T1MA 5HGDB 3GKWH 4MA1B 2F58L 4PP2A 5EO9B 1P7HL 2MOVA 3ZKMC 3ULSA 4HS3B 3O2DH 4PJBF 3I2CH 1YYML 4HK0B 2YWYA 5FA4A 2Y5TA 2ZCHL 4K7FB 2X4PA 3QUYA 5DQJB 1A21A 4JRWA 4RFEA 1FVCB 2DI8A 3MBXH 4UQ3B 5CMAB 4LCYA 5IMMA 1QR4A 2NY2B 5F7WC 2PCPB 3BUYA 3EFFB 3HTLX 3NN8B 3U30C 3T77B 1OTUC 1P2CB 3QUMA 3BDYL 4YEFA 1A8JH 5TDPA 2XA8L 3D2UB 4AZ8A 4GSDH 4Q97A 4G6JH 4AIOA 3VJ6A 1LP9F 2R1YA 1SJEB 2AEPH 4ODTL 5DFWH 5T1DL 4HS8H 2XG4A 1IM9A 1AQKH 1WAAF 2F53E 4LLWA 1NDMB 3TLRA 3WIIH 1MJUH 4AH2B 3GSNL 1OD7A 4XP5L 3WEXB 3CAFA 5AG8A 1G1YA 2X4TB 2WIMA 3FCTA 1JRHH 4DW2L 5CD3B 1VFOA 2R56L 2B1HH 2VQ1A 5FGSA 1LO2L 1G9ML 5EG6C 4HV8B 2XWTB 3PWPA 4HLJA 1IAOA 3LOWA 4PJCE 5F7MC 1M05A 4RMUA 1HILA 3GK8L 3DX8A 3W11D 1GXEA 1HCFX 1IBGH 1JGEB 4EQ3A 1X5JA 1NFIA 1CICD 4C4KT 3MZTA 3LPFA 1Q9WA 2G9HA 1JYWA 1FO0L 1A7OL 4ERSH 2NY6D 5I8OH 4XMLL 4U49A 2WQRA 3I75A 3AXLA 1MCOH 1M4KA 4GRLB 3TGXA 1VB9A 1IGYB 4MAYB 7CGTA 3HAEA 6CGTA 1MAMH 4KROB 1U0QA 5K9OA 4I3RH 2HLFC 1A6UL 3MUGA 1NGYA 4DZBA 1WBYB 4O02L 3MJ9A 3T0AA 3UPCA 5I1LB 1IBGL 4BKLB 1DBJH 1UM6H 2PKDA 2RGSA 1RHHA 3M07A 5CIPH 5T5NG 2DQIH 1OP3H 3RVXC 4B50A 1QRNA 2AV1A 4MZ3A 1XR8A 4PJ9B 5GGTH 5FYLH 2VKWA 4LSPL 3DWTA 2D9QB 3S3SA 1FG9C 2NZ9C 3MRCA 1FNEA 4PJDB 4TNVK 3VGBA 3WKNA 4L1DA 1D9KC 2R0ZL 1NL0L 4I0KA 4JDTL 1Q94B 1QYGH 3MLYH 2YUXA 1CI5A 1VEMA 3IFNL 4WI6A 1GOHA 2BVYA 4XAWH 1V8HA 3LEXA 1HINL 3TIDA 1HXMB 1EFXB 4F7EA 4ODSH 4LVOC 4DCQA 1T89C 2E7HA 4NM4L 4PRBB 4UMGA 5I0DA 3BH9A 3ZKXC 4E42B 4MQXD 3HNSL 1U8NB 5HHPA 2ID5A 3NCMA 3IXTB 4MAYD 4MDJB 3EOBA 2NY3B 4N90D 2EH8L 4U1GB 1A9BA 1ZHNA 1JPTL 3QPQC 5JW3L 2WV3A 2WWMD 1Q38A 1C16B 2V9TA 1JHTA 3W0WE 4CNIB 4HJGB 5EZLA 2CR3A 4I9WD 1DR9A 4OT1H 3HPJB 4XVUD 3LQZB 2I9TB 2EO9A 4L3CB 4KGLA 1H5BB 32C2B 3RL2A 2HP4A 4R7DB 2BMKB 3BDBA 4OCNC 3GHBH 3OXSB 4JO3L 2Q8BH 5L6YL 1KPVB 5K93A 3BSZL 2HMIC 1YMMA 4P5MB 3X3GH 2R9HC 4FA8A 1KTLB 3TA3C 1C5BH 4H0HB 2HKFL 2P5EA 2ZPKH 4LEXL 43CAB 5J1SC 4DGYL 3QQ4A 4WFED 1MNUH 4W4OC 5F7NC 5KAQF 5KG9B 1FL6A 4XRCB 5LJYH 4I48B 2NY5L 3VD9A 4NWUH 4EXPX 4X6FB 4NQDB 2DOCA 4JZOB 5E8EA 1W0WA 2V2TB 1C08B 3SE3C 3DURB 4GAYB 4OJFL 4HFWA 5SWZE 5JZ7C 3WFCL 2ZCKH 1TTUA 5DXWA 4R7DA 3T3ME 4P2QB 2Q6WA 3KPMA 5KS9B 4NC1E 5ILTH 4L3CA 2O5YL 3CFCH 2EE9A 3N0PB 5GS1A 5KJRL 4TOYH 4WI3A 1WTGT 4KDTC 1QLFB 5TH2A 3EOAB 5MP6H 3BEWB 1JI1A 2RCSL 5EZIL 1OAZH 1IC7H 1YPZE 5GRYA 1CBVH 2HLAB 3AAZA 3TYGL 4LEOA 5I2IA 4PJ5D 3MUHL 4GG6F 3FT3A 3VI4E 3IAQA 1A3QA 3RTQA 4G3YL 4CVZB 5CP3H 4HJ0D 3GMPA 2X1XR 2MCG1 2HKHH 1QHPA 3OZ9L 4JPWH 5DJXB 1DQQB 2D7OA 2YA0A 2A1WH 4URTB 3LKSA 2CRMA 2D7PA 5I8EA 3FQXA 1QSEB 2A74A 3TIDB 5D8JH 3I6LE 1HWHB 3H9ZA 1S9YA 5KVDL 4LU5L 4QWWD 4J3VA 1N0XL 4RSVA 4ZFOL 4A2LA 2IH1A 2R9HD 5HHQA 5IVXB 3OL2A 4K3DH 1FNEB 4Z0BH 2ZSWA 3QYCA 4GUPA 4Y1AB 3CDYA 2X05A 1XGUB 4YDLB 4ZPTA 5DEFA 3QQNA 4XVJL 1G1CA 1TZHB 2CDFA 3JXAA 5GS0L 1DE4B 5EIVA 3PWUB 3H0TA 1T2JA 3GMNA 1RZGA 1BQUA 4X6CE 5EU7E 2OTUB 1JF1B 3QUKB 2PXYB 5DFVC 3WIHH 4RWHA 5F3BA 1MCQA 1WTLA 3CVHA 1B90A 1TZHA 1T1XA 2IFFL 5CSZA 5KOMC 3S3JA 1LQSR 5GGQL 4KMLB 2Y36H 3GIVA 4GUPB 5DSCA 3VA6A 3LD8B 3O3DB 5C0JB 4GW5A 4MQXC 5ICZB 4PRHE 3PHQA 3BW9B 3VXTA 4Y5VC 5FDWB 3AB0C 5E8DL 1MCRA 4MA3A 4YHIA 3MRNA 4OZFB 3MCLH 5CCKL 1I8KB 3P4MB 4JVWA 4XNUH 4QHLB 4JHWL 35C8L 4O4YH 5FHBH 3V8CA 3NIDE 3VCLB 5GGTA 4JFQB 3PWPB 4DGIL 4AENA 1JZ5A 2D03L 5F89B 4UV7H 3RGVB 5I0ZA 5F7FA 2HVJA 5C6TL 3GNMH 1PY9A 5E2UH 5T5FH 4QGTA 2ADIB 1Z9MA 5MENB 2EH7H 4PRNB 5DK2A 4YDIL 3NCCB 4XPFH 4YXLH 3UEZA 4U1IB 1U8MA 1SJEA 1XF1A 4NSKA 2P5WE 3QO0B 1WC7A 1CLYH 5D5MB 5E6ID 1LE5B 4LMQE 2I60H 4XBEH 5L8JB 5D1XB 3QIUA 4JJHA 2WAHA 4NC2B 2AQ1A 5C0CA 3L3OA 5CSGA 5GRVK 3CXHJ 4FQLL 2LE9A 4FHBD 4X4ZA 4EIGB 4I3SL 2A83A 3T2OA 4H1LA 4BZYA 5DQ9A 4KJWD 5CMAA 5FO9B 3I02A 4BA8A 2X4QA 4F80A 5CEXA 4V1DE 3W9EB 1G84A 2E6JA 5AUMB 3DMMC 4LP4A 4BSJA 1JVKA 1AI1H 5E1AB 3QXDA 1JNNH 3P30H 3LS5H 3VFGH 1K8IA 1QSVA 3QR2A 5DMKB 1O7VA 4IJ3B 3ULUL 1GC1L 3HRZA 4S0SD 3UZVB 3WXWH 3VXNA 4OQ1A 2JE8A 3ILQC 5E70A 3G6DL 4PJ7B 3ZLQC 4BZ2L 4YH6A 5LCVL 5GSVB 5K9KB 3HZYB 2YXMA 4GKNA 2XN9D 3GSVA 4L4VD 4OM1H 2YMXL 4NN6B 3T4AA 2VDNH 4Z7UA 4F37F 1MFAH 3SDCC 3WXWL 2FEDD 3K4AA 5L2KD 3RVXD 4CJ0A 4CL7A 3DHJA 3PWJA 1DLHA 4ZNCD 4PR5B 4DZ8A 3DGGA 4PJ5A 4JN2A 1A6WL 1M7DB 1XF3B 2ARJB 5IBLC 1KB9K 4CW1A 3GM0A 3VRJB 4XZUB 4KKLC 2D3VA 1U8HA 4L9LC 2V5MA 3M45A 3OAYH 1S7VA 3QEQE 2YZ1A 4DQOH 1HHIA 1RZFH 4X7TA 4RGOH 1EVUA 2LVEA 2OI9B 3LKRB 4PJXE 5KVFL 4HUWA 4HF5H 1S7WB 3BP4A 3BAEH 5IJVB 1G6RL 5E8NB 2ZUYA 1NANH 1S8DB 5ALBH 2H45A 5CJ5A 3F62A 4V2CB 1GHFL 1XF4B 5KBNC 3UX9B 2C3VA 2ED9A 5HSFA 4GKSA 1NBYB 2IJ0C 3T04D 2G2RA 3QCTH 4M4PA 4XMPL 3WDHA 4H20H 3S35L 1U91B 1NCUA 1JMXA 4HH9A 3O3EB 2WWKO 2X4SB 3QJFA 3EUUA 2DJUA 3U2SB 5BS0E 4HIEB 4RA3A 3PF2A 5E2UL 2VIRA 4JPKH 1OB1A 1QSFA 2O5ZL 2OL3L 5IQ9B 3TNMA 1RZJL 5FFLA 2H3NA 2QKIA 1Q0YL 4N0YH 2KQMA 2MMXA 2V17L 3JV5A 1AXSA 4WO4A 1G9NH 1QP1A 5CEZH 2VMFA 3HC4L 2FRGP 2XZCH 3I9GL 1VPOH 4RGMB 4PLNC 3MGTA 1I7UA 1REIA 2E6QA 5HYSG 3IDGA 4JFDE 5EO1A 1ZA3B 1BQHA 3DX7B 1NMCC 1UEYA 5IMKA 3FT4A 3AS2A 3ZHLA 3I75B 5IESL 1JWSB 1OOAA 4IRSA 5T3ZD 2MTPA 4K8RC 5KVEL 1HH9B 4LF3A 3B6SB 1WFNA 1JPST 1BJ8A 1RIVL 3R06A 4JM4H 4OCMC 4ZXBB 1JWUB 5TE6L 5DJ2B 4UDTB 4MD0B 4NNXB 5IW6B 3GIZL 4RAUB 4Z6AT 3EYSL 3LN9A 4M7ZC 5FGBC 1MF2L 4X6EB 2IBGA 4EI5A 2EYTB 4JFFA 4OZFH 5FCUH 1JPFA 4IRJC 4NZRL 3WO4C 2Q7YB 5K9JL 5E00B 3DRQB 2NXYC 4B53A 4HWZA 3LKRA 3U6RA 3ARGB 1FGVL 1RUKH 3LQAH 4LAQL 1HEZA 3VXMD 4U3HA 5ADOH 3BD3A 5FCSH 1BIIB 1MH5A 1YN7B 3ILPA 1ACYH 3WN5B 4JPVL 2AJVL 3FT3B 3QI9D 3ARBD 1NAKL 2GTWB 3IDYC 2VO5A 4YHNB 2VDLL 4ODXB 5C09B 4NHUA 1ADQL 2DICA 3FT2A 2P4AB 4HUXA 4LCCA 4XXDA 3ARBA 3ARBC 3ZTNH 2B20A 1IAIL 5ADPH 1IE5A 1QEWB 2IANB 5JDJA 1NGZB 3NCJH 2PCPA 3BUYB 2N4IA 2J1KA 1FN4B 2FD6L 1S7RB 4U7SA 4N1EA 2V2TA 2NMSA 3AROA 3OAYK 4X5WA 4R97C 2EDEA 4QRUA 1KIPA 5FOJA 1RJLB 4K23L 5HYEA 5BV7L 3GSWA 4P2OC 1VFMA 2DQGL 3MLVL 1FYHB 2F8OA 4J4PC 3L7EB 5IR1B 1FNSL 3RNKA 4X7EC 3L3DB 3MA7B 3SKUD 3HUJE 3O6KL 4OCYL 4OLYL 4Y1AE 3PNWB 2BVTA 4KKNA 5I76A 1U41A 4NKMA 2KUTA 2ZUTA 4PREB 3B2UC 5EU4A 1EBPA 2ZNXA 5GGRA 3P4NB 1NGZA 5T1LA 3STLB 1KCKA 2DWEB 5DUMH 1EO5A 1FNAA 2Z8VC 3O8XB 1M71B 2X9WA 2IC2A 2NY5H 4TPRL 3PL6C 3S36X 3ULUH 1SMAA 3E2HC 2A73B 1R3HB 2Q8AL 5D5MA 3TBWB 3KGRA 3VG0L 3QULB 5C3TA 4KKAD 4UT7L 4LCWB 1KCUL 1U8MB 2ZUWA 1JPGA 3S5LB 3SJVD 2GTWA 4JHAH 4P9HL 3ISWA 4BSVB 4F33B 3IAGC 1RK1B 1IQDA 2RFXA 3O45B 4ISVA 4WFHD 5JTWA 1T20B 1MCWW 1F8TH 3RI5F 3PWVB 4JRXD 4OGXH 2BCKA 1JYVA 4Y5YC 5KSAD 1R5VB 3QRFM 5IB1B 3HUJA 1FZJA 4YGAB 4XCYA 3S4SB 1T7VA 1AXIB 1GCFA 3FFDB 5D2NA 2AJ3B 5IB4A 3BZ4B 4JFQA 4DFIA 4KROD 2R1WB 3SGDI 2BFVH 4GRMA 2JJTA 3MNVA 1U8PA 5DJ6A 1Q9OA 2FBJH 3TV3L 5EZJA 5L7XL 3MLRL 3VFNA 1CGSH 5C0FA 3KYMB 1Z3GL 2YD5A 3VGAB 1EO8H 4ZAKA 1BGXH 1LO0L 5F72S 1DVFB 1A6AA 2VDPL 3X14A 4PJDF 4U0RC 3LY6A 3ZKXB 4KQ4H 5F96L 4QHNA 1WFUA 1QG3A 4PJIE 4W6XB 4EN3B 1S7XB 1VACB 4KRMB 1WBYA 5D6DC 1RULH 5DJ0B 1WCBA 5D71H 5HJ3A 1MOEA 5TF1L 2VXSH 5HGBA 2NY6C 2IAND 3AM8C 3I9GH 3DMMD 5EU5B 5ENWB 3Q5OA 1A6AB 4RAVA 5IFAL 4DJMA 2NR6D 4P9MH 3V7MA 1A3RL 4OZHF 3TYFB 5EUOF 3MRLB 4R90H 1UKTA 2IAMD 4PFEA 4AQOA 2FJHA 4GAGH 2VISB 4HPOL 3T0EA 1OP9A 1DCLA 2DQDL 3FO0L 3WSQL 3TT1L 1SBSL 1FFNB 2G2RB 1A14H 3MLSH 5CS7A 3JVGC 4O02H 1K8DB 4DUVA 3CLEH 3WFEH 2FJFA 2AJ3A 1GGCH 3KLDA 3JZ7A 3PABB 5FYKH 2VR4A 2XRAL 4PG9B 2CRIA 1KCVH 3AM8A 1NCDH 2R69L 4TRPH 1MFCH 4LLYA 1RJYB 4JG0H 2E9WA 5JUEH 1QKZH 4KZEH 5IROA 1EUUA 5JNYB 1FC2D 1FNGB 2JJSA 4ETQA 1CK0L 3WNMA 2NTFA 4PJHF 4LCWA 5SX4H 4WTWA 2WINA 1BF2A 5EIIA 5HI3D 3D2UA 4G42A 4M7LL 3ZE2E 3MUZ1 3CZFB 4RMRA 2ATPB 3O0RL 3EDFA 2XWBB 2YPKA 1X5LA 1GH7A 2X4OB 5FO8B 2ESVE 2CXKA 4XH2A 5EPMA 3G6AA 2C1PA 4PTUA 4K7PX 4JFXB 2EZ0C 1U3YA 1GGBH 3OF6D 3F58L 5DMIL 4HS3A 4ZUTA 3O4LB 4JFDD 4KZDH 1F2XK 3RA7L 4X9HA 4G6JL 5E2TL 5IEHA 4HDIA 4OBSA 3UZEA 2RB8A 5A3ID 1FL5A 3CMOH 1FFPA 3QBTB 5DZNA 2H9GB 3W9EA 2Z91A 1OTSC 3U79A 2DQUL 5GIRA 2LU4A 1JNNL 1O5DT 4XNZC 4WO4D 4XH2B 2W0FB 4C57C 3H9HA 5FYJH 4OJFH 3Q1SH 3BMVA 4XPHL 3LKNB 1Z6JT 3MGOA 3J8F7 5EUOB 1T6VN 3EJYC 1PKQB 5F93C 1I85C 4PGEA 3D3VE 1KIRB 1XIWB 5GGVH 2HKFH 1KJ2B 1R0AL 5IM7B 3S3PA 2AERT 4MXQC 2P44B 2ZUXA 3GBMH 3V5KB 1FNGA 1W2KT 4OFPA 1DBAH 1NCDL 1UXSA 1EJ6A 3RWCA 3TJEL 3VMNA 4P5TA 5GGSA 2BXYA 4U6HB 2XZZA 4I2XB 5FYKL 1ZGLM 5LKNA 2H6PA 1D3CA 4N0UB 2VLRD 1R3LA 3S96A 3TH4T 3TO4C 1S7QA 1AO7D 4PRBA 3CSGA 4JPIA 3ELAT 5DJZA 1ZEAL 4WI2A 3BX7C 1YNKL 2PUQT 5SWQB 4IOIB 5I15H 3MTRA 3WD5L 1LILA 5CJOH 4G7YH 4HXBH 2XY2A 4RISL 3UAJD 3NCBB 1CXHA 1L7TL 4Y4HB 4YHIB 2W65B 3HB3D 1R5IA 3CIQA 2I26N 2OXGA 3IXAB 5ICZA 3F7QA 3SOBL 3HNSH 3MOAH 1JWSA 4EDXB 3DX6A 5EFIA 3DX7A 3HHRB 4PJ9A 1TCRB 2X41A 4K8RH 1IC5L 2E7MA 2DS4A 2VE6B 3BJ91 4KQ4L 4NZJA 1NGPL 5L2JA 2DL2A 1EDQA 3QXUA 1RURH 5ICYB 4PJEE 1P7KA 1HHHA 5C0AB 2YXFA 3H9SA 4YXKL 5DC9B 1M6OA 4CVUA 2VLKB 1YJDC 4POZC 4LMQI 5EBWA 3MRDB 5IQ9A 4FFWD 1NANI 3RY6C 1ZOXA 1JUFA 4A6YA 4KDTA 2VQUA 1YECL 1NGXA 2K3TA 3NCEB 5D7IA 4LSDA 3QNXB 5FKAB 1S9XB 5HHQB 4K9EC 3THMH 2OK0H 1U95A 1F02I 1U8JB 1RIUL 4ZO9A 1FCCA 5F9DC 4GRMB 1FJ1A 4PJ8D 4APQD 3QEUA 5E9DB 3RVTC 3P9MB 2PN5A 3MV8D 3IJHB 4PGJA 3BP4B 1KNOA 5CJQH 4U1KB 4NC1C 1XMWA 1OQXA 3FMGH 4X6CB 3RNQA 1OAYL 3QIBC 1EAPA 2DQFB 4PB0H 3RTQB 5CGMA 4WO4C 4XGZB 5BO1L 1AJ7H 3U0PB 2Z0BA 3VFWB 2FGZA 2EDRA 4HWEH 3OHXA 2GK2A 4JANB 4KUCD 1Q9LA 3GBLA 2QQLL 2IANE 4FTVE 4JO4L 2VZSA 4P57A 1OVZA 3T0BA 3VWJC 3SCMA 3V4UL 4BQ9A 5HHOD 1UB5A 2I5YH 3HFMH 1C1EH 4HULB 3QFJA 3EKCA 3T4AB 2MNUA 3AU1A 1XH3B 3ILQD 4QNPF 3X12A 2VOTA 1NDGA 4FQIH 5HI4C 3WDIA 2V5SA 4HKXA 3UTQB 5KJRH 5FGRA 1YUHB 1FFPB 4I48A 2YD8A 2XKSA 4HLZG 4AL8L 2D0FA 2OTWB 2XA8H 2VZ3A 5C09E 2AV7B 5GRJL 4QT5B 4S1SH 4P49A 4FOMA 1AHWB 1KLGB 3ULVF 4ZTOL 1H0DA 4JRYD 4L9LA 4QCIA 4JFHD 1F97A 2FX8H 1OAXH 1TJGL 4AT6A 1AXTL 2R2HB 3MLUL 3CSPA 1J87A 2WSKA 3WFDH 1LHZA 5GGUA 2B8OT 3C08L 4QRRA 3I3EA 3KPLA 3BESR 1QRND 3KPSB 2N7AA 3OTTA 1CYGA 3SDYH 4OFYA 3PP3H 1HYRC 4FQIL 5EN2B 1IFHH 4WW2F 4JREB 1BF8A 1EGJH 2NLJB 4NCDA 3TN0A 4OLZL 3OHXB 2XZQH 1XAUA 5B38G 3HI6L 3NZ8B 1WWCA 5T1KD 4BFIA 4GW4B 3NVQA 4LDEB 2AXFB 1N5AA 2FECL 1CVSC 1WZKA 1UXWB 1T7YA 1J1PL 2YBRB 3PQYA 5FB8A 4O51B 4MXVE 1YEGL 4PUBH 1R5WB 3K0WA 2UY6A 2VXUH 2DQHL 3VCLA 5ID0A 4S1QH 2Y72A 4RAUA 1QLRA 4UDTA 1FLRH 4YDVB 2DIAA 1QBLH 3REWB 4ZTPH 3DPBA 3BP5B 1HH9A 4LF3B 3RWJA 3SDCB 4OTXL 2ZSVA 3ZHKA 4LAQH 4JDTH 4Y2OA 2OK0L 5E24E 4N8VG 4DWHA 2MWCA 1PVHA 5ENWA 5HDBF 3UTTB 3CC5A 2GTZB 1IM9D 3FTGB 5F1NB 1U3HC 1FAIH 5FCUL 4ZFFA 1FV1B 3U46A 3B5HA 4JG1H 1UENA 2ZKHH 3C5ZD 3ULUC 1AXSB 3MUGB 1U8KA 1MLCA 4FTVA 5MHSE 4ZTPL 4LLMB 1ONQB 4NFDA 1WISA 4CN1A 3LV3A 2OR8A 4ZPTB 2LTQC 5CSBA 4LSVH 2W9EL 3WCYA 1ND0A 3CFBB 1AGBA 1DBKL 5AYUH 4N8PA 3B2VL 3IFPB 3W0WB 3LN4B 1RUPL 3RL1B 2Y06H 5I1AB 2AI0H 4PJHA 2MFNA 2OP4L 1KOAA 4TSCL 1MHHB 2A6KA 5FECA 4JM2B 1S7UB 4Y19D 2MPAL 5J8OA 5CBAA 5E1HB 5AD0B 1PYWB 4PRIB 1JGDA 3G5VA 3VFUB 1ZE3C 4KK5D 2CK0H 5DJXA 3I6GB 4YQXH 3FO2A 5DK0A 4JPKL 4BUHA 4U6TA 5FGCE 2HG5B 4MNQE 3K8KA 1QLEL 4OV6F 5T1LD 1IM9B 1Y6NR 4RGMC 3VE0B 5CGYD 1YNTB 4Z5RA 4E41E 1H8NA 5T1KB 3VGFA 4IRJD 1XGYL 3DGGB 4NGHL 3QFDB 3ZYIA 3LEYL 2H1PL 3ESUF 3RGVD 2ZUVA 2EEBA 2V5TA 4R96B 3U4EB 4BZ2H 4NIKB 5GGUB 2H32B 3P4NA 5JPNB 1XCTB 3FHAA 1U8OA 1A4JB 4M6AA 3HZYA 2WQ8A 2YC1B 3FQNA 2Z91B 3MJ9L 5JHLH 4J3TA 3S7GA 3WE6B 4PJEB 5C0AE 3BPLC 1FVDB 1FL6B 4LPTA 1WAAA 3DGCR 1KF9B 2D31A 2P5EB 3O6KH 2Z93A 5FF6A 4ZYKB 2P8LA 4TVPD 1BVZA 2HJLA 4E41A 1PG7L 1WIOA 4I77H 1VKXA 3IJSB 3D9AL 3NH7L 4QHKI 5EU6B 5B4MD 2GJZB 3RA7H 4K71C 4CVWA 2ICWA 3QI9A 1V05A 2KKQA 2XWBA 3SDDC 3L3OB 3GHEL 1LEGA 3QHFH 2ENYA 2A77L 3QZWB 1PDKA 4HJGA 2K1MA 4WFGE 5EZLB 3SCMB 4CU7A 2R29L 4XCFH 3EBAA 5HVGB 3LS5L 3MBED 3VFGL 2DQJH 1YQVL 2VLJA 5I18L 4IHOB 4U0RB 2B7DT 3V9FA 4TQEH 4LLDA 4OAWA 2WBJA 4KHXL 1I9EA 1N64L 3S37X 2DBLL 4F9LC 4LASL 1L4IA 1INDL 3F7YB 2XPGA 4QWWC 4EN3C 5FHAH 5I74B 2G60L 4L3EB 1G7PB 1C5CH 4XNMB 1SYSA 3LHPH 2I25N 4O2CB 4U1KA 4D8PA 5E00A 2W0PA 1CN4A 2JLLA 5JUEL 4N68A 1HXMA 3QXTA 2A9ML 4OCSL 1RUPH 1RUKL 3LQAL 3F12B 5SV4A 3GMOB 2AEWA 1HQRA 5CWSA 4UNTA 1TETL 5EULV 5GHWH 3X17A 4PJHB 5T3ZE 1MHEA 2EXYD 2VH5H 5DFVD 1LNUB 1QFPA 4MA3B 2NXZB 4R0LA 4NQCB 3IU3A 1CFNB 2CIIB 2MHAB 2WBJD 1F3DJ 5F6HI 1JUFB 1WFOA 2VABA 5C0JA 5B4MC 4Z7QE 1U8QA 4LVOB 4YPGB 1X6NA 4LHUG 3D0LB 1N6QH 4NBXB 4FS0A 1I7TA 3UC0H 3HLAA 5DVMA 1EUTA 1RUML 2VLKA 5EOQL 4FTVB 3ZE2F 1I7UB 4QRQA 4ORGA 3VI3F 4F37K 5HJ3B 1T5WA 3AMKA 5AZEH 5E2VH 1I3UA 4XNUL 3ZE0E 4QHUB 1GIGL 4UILH 2CGRH 1U6AL 2AP2A 2B0SL 3QIBA 4MJIB 5I74C 1EFXD 4Y5YB 5D7LA 3O9WB 2XQBL 4YWGH 3DV6B 1J05A 1D6VH 3QB7C 2VDOL 1PEWA 4HIJA 3KWWA 3KYNB 5JHDB 1KJMA 4N9GB 2VQTA 4G8IA 5FHAL 5H35A 2FDBP 2JB6A 2BNRA 3QP3A 5GJSL 1CDYA 4G7VH 3H7LA 3V95A 4HD9A 3RUGF 4WEBH 1JGVL 3BP7B 4JM2F 4WDIA 3GRWL 3V7AG 1S9YB 2BDNL 3VFMB 1V7NH 3FRPA 3QAZB 4P9HC 3RY6A 1NCBL 1T83A 3JWDC 1AP2A 4DKEH 3DXAA 3FFDA 4JPIB 1CXLA 1CZ8L 1NCWL 5FUCE 5JO5A 3ZKND 5L7XH 2LVCA 4MJ2A 2ORBL 3OKKA 4KHTL 4M5YH 1P4IH 3TA3B 5JHDD 3HCVB 4LVEA 3CX2A 4EBQL 3HMWL 2WP3O 3HAEG 4WTZG 1MI5A 3QPQD 4GAJL 4YIQA 5F3HB 4GXUM 1ZLUK 4CVXA 1N5AB 2FX7H 4TSBH 1F58L 4KTDL 2AEQL 4F7MA 1YEHL 4JKMA 1JPSL 4XC3L 4IBLT 4NT6A 3QULA 3BKMH 2DBLH 5D93C 1E6JH 5GS3A 3DUHA 3JWDH 1IM3A 2CPCA 3CXDH 4J6RH 4P9HH 5KSAC 3H7BB 3BYTA 5E03A 5DK3A 3V4PH 3CSBA 5EUKB 4PY8I 2HKHL 3OZ9H 4JPWL 2UZIL 2AK1H 3MOBL 5F7KC 4PREA 5EU4B 1WSST 3Q0HA 3KPRA 3KAAA 1MCIA 3G5XB 1CWVA 1MUJB 3DURA 4GAYA 1BQSA 1NC4A 5FYKU 3WFHA 1GGIH 4QRPA 3G9AB 1OGAE 3G6JE 2DBJA 4OF7A 2XWJA 4K3JL 4F57L 1T1YB 2Z93B 5FF6B 4HHAB 4HDIB 5HYQA 4J1UA 3TFKC 5EO9A 1EO7A 3N50A 3TO4A 2FEDC 3EZ8A 4L1HA 5F9OL 1RJCA 5T1MB 4YX2L 4KKBC 5F1IB 3C8HA 4X6DA 1A2YB 5SWSE 32C2A 3RL2B 2JIXA 3OGCA 1OAQL 1YC7A 4YQXL 2FATL 5E08H 2QQLH 3QFJB 2NW2B 3K2MC 3BHBB 1VGEL 4FQXB 1ES0A 1NPUA 5CIPA 3ARUA 3U9UA 1L6ZA 2F74A 2O61B 4I4WB 5CINL 5C0CE 3X3GL 3FMGL 5EA0H 3KPOB 5ICXB 1J1XL 1MH5B 1YN7A 3MCKA 2YD9A 2ZZUT 4YLQT 3F6LA 3O11B 3GI8H 1J0KA 1MI5B 3RWEA 5HHPB 3SGEI 3MYJB 1FFOA 1S9KC 3TPKA 4YDIH 2AJVH 4AEFA 2B2XL 4G8EA 4LARH 4HIXL 3TCLA 1LK3H 5FKPA 3LPGA 1EXUB 3T3MF 1YECH 1FGVH 2AXGB 4NN5B 4ZSOE 15C8L 3BUTA 1C12A 2DQCH 3IDNA 1T1ZA 1JPTH 1G6VK 3HMXL 4X6BA 3SO5A 4NO3A 5DEGA 1FO0A 5FHBL 4A6YB 3MACH 2MQCA 3SJVA 2PR4L 2APXA 1MWAH 4PJBA 1OTUD 5BXFA 4JM4L 1O7SA 4Y4FA 5FV1L 2ZOKB 2DQTH 1TVDA 4HGKC 4KRPB 3SGKA 3FJTA 4NN7B 2Z31D 5C0IB 4N0RA 4UNVA 3QIBB 4MJIA