1U8MB

Crystal structure of the hiv-1 cross neutralizing monoclonal antibody 2f5 in complex with gp41 peptide eldkyas
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
235
structure length
227
Chain Sequence
RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWLAIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHRRGPTTLFGVPIARGPVNAMDVWGQGITVTISSTSTKGPSVFPLAPGAAAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLQTYTCNVNHKPSNTKVDKRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY 2F5 (LIGHT CHAIN)
publication title Crystallographic definition of the epitope promiscuity of the broadly neutralizing anti-human immunodeficiency virus type 1 antibody 2F5: vaccine design implications
pubmed doi rcsb
molecule tags Immune system
total genus 38
structure length 227
sequence length 235
ec nomenclature
pdb deposition date 2004-08-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u8mB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u8mB01
1QLFA 3MBXL 4LSUH 5CEXB 3I6LD 3BKJH 3K81A 1G6RL 3CCHA 4IRZL 3HMWH 4MD0A 4QOKE 3MV01 4I5BA 1YMHA 5ISZD 1CG9A 1VESA 3PWUA 1LEKA 4M1GH 3NCJH 3TIDB 4JQVC 2GSIB 5DO2D 3BYYA 5GSVA 3C6LC 5I1KH 5JO5B 4R4BB 3SDAA 4JHAH 1U3HD 5DC9B 1B4JH 4FHBD 4QCIB 4JFQA 3MX0A 4MJIA 4NQCA 1IC1A 5TQ0H 1C8PA 2ZPKL 5C0FA 1TLKA 3PQYD 5TE7L 5EU6B 2HTLD 3O4LB 1ERNA 4X8XA 2Q7YB 4Y5XB 2OSLA 3I84A 4WJ5A 4E41B 5JHDA 4FOMA 1HKLH 4ETQB 2FH6A 1MJJA 2FATH 5E2TL 3EIFA 1B0WA 3NGBC 2JKXA 1BOGB 1YDPA 2V5MA 2IC2A 3GHBH 4RAVA 3UO1L 4PGDA 5I0ZA 2AEPH 1H8SA 2M2DA 3KPQA 4YDVB 1RUKL 4I18B 4KHTL 5FA3A 3VRJB 3FN0L 1A1OA 3NCYP 1NC4D 4LEOA 5CHNB 1WJ3A 5HI3C 1QBAA 2BVPB 3GSQB 4UT6L 3ZYOA 2ZCHL 2OL3L 2JK5B 2BY3A 3VGEA 2E6QA 1IM9A 3RI5F 4Y19A 1IMHC 1UZ6E 1OOAA 4PJDB 2I60L 5JIPA 3Q5TA 5FOBA 2VKWA 4XPGL 1MAJA 5DMGC 4O4YH 1UT9A 1HHIA 2F53A 4IRJB 1CS6A 3T0EA 5EU5A 1ES0A 4J4PC 1A1NA 1IEHA 1JHTA 2BVEA 3FFCA 3D0LB 1Q9KA 3BP4A 3RHWF 2JELH 1BBJA 5IBLC 1QVOB 4XNZC 1Y6NR 3RWGA 3MRFA 2N56A 3QCVH 5GGSY 1XF1A 3QCUL 4XNXH 1BLNA 2HKHL 3BZEB 4ZXBD 4X4XA 3TPUB 1BFSA 1DP0A 1OHQA 4YHMH 4IM8A 5J06A 2X1WL 2LFGA 3I9GH 4EDXA 3FQRA 1AXSA 2HFFB 3BZ4B 5SWSD 3WN5A 3HE7A 1T4KB 5E5UB 1RUMH 1DLHB 3E0GA 3D18B 2OZ4L 1W0WA 2YN3A 5D6CB 4D9LL 2WLYA 3QAZC 4AEFA 1I7UB 4NHCL 1OAYH 4AY0A 1DBAL 1ZVYA 4MD4A 3RVTD 3GIZL 2A6DA 5FYJL 4NHUB 4LLVA 3LHPL 4UQ2B 3TT1H 1RZ7L 2YKLL 3TO4A 2PR4H 4JFYA 4IRJC 4Y1AE 1RY7B 3OMZA 1ZT4A 4LSRH 4KKAC 3T1WA 4LCWA 3CPLB 3DMMB 3F7VB 4RDQF 4HWBL 3EJZC 3QIUA 3AMLA 3NAAH 5FM4A 5EWIH 4WUUB 1PAMA 2ZJSH 5BRZE 3WUWB 8FABB 3DSFH 2EEAA 1UB5A 1ZHKB 3DECA 3MRKA 4S1QL 3VD7A 2XT1B 3BP7A 5IK3B 5ETUB 3C87A 1P53A 3E6HA 4OKVA 3VFTA 3CK0H 4QTIH 1CFQB 3MRQA 4L9LA 3TN0D 3GI8L 4PRBA 5D7JA 3VXSB 2WBWB 3E8UH 3U7YL 5ITFA 4TTGA 1XF5A 1OAQH 2W38A 3FO1B 3G9AB 4JANB 1F97A 1GGTA 2P5EA 4HZLA 3FO2A 1SJXA 3GJFH 1IQDA 5C0AE 3GSUB 5J57B 5KAQG 2NMSA 1C5DB 2IAMD 5IBUB 3L1OL 3QWQB 4XPAL 3QHFH 3WHE0 1BJ1H 4KQ4L 1A22B 2P8LB 2ATKB 4ERSH 1A6UH 1MI5D 2NW2A 4K3DL 1AI1L 3DMMC 4TTDD 3R0MA 1MJ8H 4D94A 5DVOA 2GJZB 3QFJE 3ARZA 3QNZA 3MGAA 5FCUL 1UJ3B 3UTTA 1JN6B 1NC2A 3GZKA 2OR9L 2YEZB 1UWGL 4JHWL 1BWWA 1T1XA 1K3ZA 4Y4FB 4TNWF 4NJAH 2DL2A 3FB5B 3QUKA 4DKEH 3DIFB 3PL6D 1BIIB 4YXKL 2IADA 3T08A 2QR0B 1L6ZA 5E94A 4G6JL 3UTSD 1K4CA 5L7XL 3MV11 1QSFB 4N8CH 5JUEH 5HDOA 4X6DA 2IQ9H 1X5JA 3DETD 3MRIB 3SGDH 2DI8A 1Q9LB 5GISH 4HLJA 3P0GB 2HG5A 5F96H 3D1MC 4XVSH 3HFML 1YC7A 4M00A 3LN9A 3TT3H 3GKWH 3GFUA 4DUXA 2R56L 5EZOL 4BSVB 4EDWL 2EZ0C 5CGYC 3WNOA 5CWSB 1XGTA 2EKJA 3KJ6L 5GHWL 3KYOB 3WIFA 2IPKB 1WT5A 1A6AA 1I3UA 3ES6A 1UM6L 4PR5A 2ZCLL 1QLEH 2A6JA 4JKWA 5HSFA 3N85H 4UUJA 3RUGA 4PRPA 2ED9A 3S97C 1Z0NA 1UJ3C 2ESVB 3P11L 5L8JB 1KN4H 3EUUA 3CVIH 4PB0L 1IKFL 5I8KH 3V6OC 5MHSD 3LKSB 3MRMB 4NJ9H 2AXFA 1U8OA 4G43A 2R29L 3P77B 4KKCC 6FABL 3SKNB 1A3LH 1KJMB 4OZFA 3W9EB 1CCZA 4XP6L 5ACMA 1MEXH 4LOUD 5BCAA 4RBPH 5HBBA 4PJEA 3TC9A 4NIKB 3NFPB 3QUZB 3V52H 3HCVA 2CIIB 3CLEL 1FORL 2DICA 5J7CC 4PP2A 3O3BA 3QDJE 1E27B 1BQHA 4K3EL 5F44A 5J1TC 3MLWH 2J3SA 3BE1L 4PJAE 3SBWA 3H42L 2AQ3A 4KZEL 2G60L 1C1EL 1A3RH 5ERWA 1IARB 2C3VB 2P43B 1N64H 3LB6C 1F90L 4RZCB 4MX7B 3KWWB 5HHXL 1BD2D 3UJJL 1IL1B 4JZOA 4ORGA 1PKOA 3LKQB 3TBYB 2VUOA 1N59B 3KDMA 3CX5K 1NUFA 5ACZA 4MB5A 3OBAA 3GSNB 2AGJH 1JNNL 1CGUA 1QRKA 1XT5A 5F89A 1TVHB 3NZHH 4OT1H 1J9CT 4Z7WA 4UV7L 3KHOA 5HI4D 3MBEC 1WWBX 5DMIL 5KVEL 5GRWA 5DA4A 1J8HE 1S7WB 2ZUWA 3QG7L 4DZBB 1A6WH 4NP4L 4QHNA 3T3ME 5BW7C 2FNBA 1CK0L 4NRXA 1YNTA 3DRTA 5LAXA 3NCFB 5H35A 1YYLH 4UQ3B 3L3HA 2XIDA 3ZL4H 1QBBA 5KSAD 2VDRL 1NFKA 4F15B 3DYOA 3H0TB 4O2FA 4RFEA 3S35H 4DZ8A 4JZNB 1KIRA 1ZS8A 1HSAA 4LASL 4JFFD 3QXUA 4XPBL 4P2RA 3TEUA 4Z7QF 4K7PY 3QUZC 1BFOB 3W11C 1RVFH 2X4NB 2VDPL 1TZGH 4M7ZB 4WI9A 2ZG1A 2DB8A 3RX7A 4GG6E 1AXTH 4KI5E 1DVFD 3ORJA 3Q2CA 3DV6B 3CSBA 3HC0B 3WS3B 3CNKA 3QHZL 5EIVA 4G8GA 3B6SB 3OAUH 4KZDL 1UXWB 2L7UA 4I2XA 4AT6B 1UCTA 1UVQB 4POYA 5D1XD 5FO8B 4GRLC 4JDZA 5E5MA 3RL2B 4IMLA 1JBJA 3EO9L 4XBGA 2E7LC 1I1RA 4MCZA 4DW2L 2OCFD 2VH5H 4OB5H 1QUNA 3C2SA 4P5KA 3DHJA 3U1SH 3MZTA 1OF2B 5EBLB 2AK1L 2PYEE 1CVSC 3MRLB 2R69H 2IH1A 3O41B 4HHAA 1M6OA 3ZSSA 1I1AD 4N8VG 4BKLA 2ADIA 5EN2B 5LVEA 3SKJL 4XP9H 4E42A 5ICXA 4QRRD 1WTGT 2MCPL 1UWEH 2FIKB 3RWEB 4J3UA 4JRYB 5SWQB 2BNQA 4GG8B 1FZJB 2IANA 4C83A 4F15C 5IKCA 1E4KC 1KGCD 5FV1L 2DYPB 5L0QB 2JB6A 1SYSB 1K2DB 4ZPVB 4JHBA 3GJFB 1YEHH 32C2A 1P2CA 2QTEA 4XNUH 2IH3B 3GMRA 2P45B 3VE0B 4FQ1H 4NCC1 3LKRA 4M7ZC 1U8IB 3D39E 4R6UA 1KIQB 3VCLA 3OAZH 3QDGD 4N9GA 3SDCA 3BDBA 4UV4L 1X5LA 2ORBL 5FYKD 3EFFB 4ODWB 5EO1A 1E28A 3OXSA 5C0CB 2VXVH 3RRQA 3G08B 1BGXH 1YEEL 4RISL 2QQNH 1T5XA 3L95A 3EZJB 1CXKA 2GHWB 4OZHA 1IGCH 1JGDB 4XMKL 4MJ5A 5GS3A 1GIGL 5CZXC 2HH0H 5KSBB 4BFIA 2MKLC 4OBSA 1ACYL 1FFPB 4APQA 3O0RL 5F88A 2MPAL 1R3IL 2Z8SA 3O81A 3QEQB 3TYGH 2W9EH 1FV1B 1A4KA 2XXCB 5FM8A 4ELMB 4X6CB 2GEEA 2VZVA 3N1GC 1FNGA 2IFGA 3CFEB 1PKQB 5TDPA 1I7ZA 4Z95H 1UZ8B 2BSSA 4UMGA 4NN7B 3OHXA 1XF2B 1RFDL 4N8PA 5SV4A 5IMLB 1G7LB 2HVJB 2EDNA 1FG9C 3BP5A 5SX4I 3I02A 5L0QC 4LGRB 4QHLB 5FHAL 4Z7VA 1NBYB 1ZGLB 2VDNL 3G5ZB 5JHLH 4IRSC 5CBEA 4KFZC 4GKNA 5B38B 3MROA 4X99A 3MRPB 4YHZL 1KLFA 3LMJL 1F5WA 3BX7C 5ISZA 1RUQH 3VGDA 4NZTL 5L9DH 2VWEE 3Q3GA 3DVNA 2J6EH 4F57L 4U1JA 4G8EA 4CNIA 4JPVH 4KK5C 5JR1L 1XGQA 1KCUH 2B1AL 5C07B 1U3HA 4M3JA 1J1OH 4KTYA 3T65B 3MREB 1JF1B 4L4TE 4LSTH 1GC1C 4HQQL 4EUPA 4KK9D 2O5ZL 3PQYA 4LK4A 3QQNA 3MXWH 1PSKL 2M8XA 3C5JB 4TUJB 3T2OA 4QGYA 1X5IA 5MI0C 3NIDE 1QSED 5ADPL 3HR6A 1DBKL 1SM3L 5F70A 1KNOB 2R1XB 5DD6A 5IM7B 5HPMB 3ME0A 3MA9H 1IQWH 2NY7H 4PS4L 2Y36H 4NN7C 1NC4A 4JAMB 3RNKB 1LEGA 2NZ9D 3MNWB 4NDMB 3TF7C 4F7MB 1S7RB 2HT3C 3IB4A 2YK1L 5EORH 1WAAE 4Z8FL 1TJIH 3A6CH 1KLGB 3MCLH 2JJWA 3CFDB 2WZPD 2B1HH 4RGNB 2BRQA 2VR5A 2BCKB 3U79A 1K6QH 4WHTA 2VZSA 1V3MA 1R0AL 2LU4A 3UTPE 4DJMA 2WUCH 5CINH 2ADJB 5T3ZD 4JY4A 5HHME 5T3ZL 1OAUL 5GSRA 2IALB 3ARFC 4GSDH 3IDNB 3UJTL 1FNHA 3SCMB 5EB9A 4PG2C 3QCTH 3S3SA 4IOFD 2ATPB 4OGYH 4XRCB 1CICB 1HWHB 4GRWH 1G6RH 1L0YA 3V4PH 4IRZH 1I7TA 1D9KD 1KPRA 4J3XA 3EO1B 5HYEA 4ZOCA 1FJ1B 4M7LL 4LIQL 4MCYA 5SWSA 3JZ7A 5IB1A 1JE6A 4UIKL 5BZDA 5D7IF 3WNMA 2A2QT 2GAZB 2AJVH 5FK9B 5EIQA 1N0XH 4D8PA 3BFOA 3IJSA 3NCMA 4OKDA 3GRWA 3EO0B 4BH7B 5IEHA 3G6JE 4P5TD 3H3KA 4OLVH 4WHDA 5TE7H 2ITCA 2LTQB 3KPTA 1NJ9B 3QEUA 4MWFA 3ARBC 1QR1A 5I1JH 4MNGA 5E2TH 3CFBB 4DOHB 3U0PA 4RGNC 3TH4T 3UO1H 5MENB 1XF4B 5HHQA 4KKLD 4NZRL 2FGWH 1G7JA 1ZT7A 3MSPA 4NM8H 1RUKH 3PWLB 1U8HB 4JFZL 3JWOC 4KHTH 3FN0H 3FQUB 1C16B 5IVXB 4JO2L 4ODSL 1AHWA 5BXFB 4UT6H 4CADB 1TZIB 2ZCHH 2OL3H 5EH1A 1KPVB 4CUCA 4F58H 5IVOA 4ODTL 1IC7L 1T5WA 4WV1B 4TVPH 5DUML 2XV6B 2EXYC 5H94B 1T21A 3QZWG 1T2JA 5EZIL 2MOVA 1J05B 1CICC 4LLWA 5DEGA 4F7PB 3M8OH 4NSKA 1SBSL 2Z8WC 1PBYA 1NCWL 3HRZB 4PGEA 5AWNL 1IKNA 2UYLB 4LRIC 4PV8A 4Y0GA 5IB5B 5D7KE 4OZGE 4PLOB 3CFKA 4PP1C 3TN0A 4EKXA 2DQEL 4WNQB 5C9JA 5T5FL 1AKJB 1MJUH 2YXFA 3MLXH 4UDTB 4OAWB 4NPYB 2J12B 1QEWA 2QL1A 2VAJA 3HNTL 3QCUH 2HKHH 2CDFB 3WUWG 2VLMD 4LQ1A 1X5ZA 1ZLUH 5FYJU 2V2TA 4MQXC 2FJHB 4HS6A 3JVGA 5EUOA 5E9DB 5HI5D 5IMOB 5D5MF 4GUPA 3PE9A 5M94B 2YRZA 5DK2B 1ITBB 1S78D 3ALWA 3VG0H 5E1AB 4ZFZB 4G9FD 4U1MB 4NKOB 5D6DC 4FTVB 4M6OL 4XAKD 1MI5A 2AS5M 5F7WC 3SGKC 4HUXB 4POZC 4L3CB 4XWOD 2P8MA 4K3GA 4OV6F 3DSNA 3H9SD 4NHCH 2Q3ZA 5HYJD 1DBAH 4WV1C 1MCFA 5FYJH 4H26B 5J6HB 4U1KA 5EZJB 3LHPH 4X5XA 1QBMH 1RZ7H 2YKLH 1Y18A 3UTSA 1TITA 4OCWL 4I4WB 5IHZA 2DN7A 2IPUG 2D0GA 1H3PH 3HNVL 3QHTC 5AYUH 3CX2A 4HWBH 3V6BR 3O6FB 4BQBA 2XNAB 4XPTH 3QDAA 4Z18A 2VLJB 1P1ZB 1NDMB 2D9CA 4ZO9A 2ZOKA 4LSSL 2P8PA 3EOAA 2R15A 1UKTA 1CU4L 5DJAA 3VH8A 3CZJA 4TPRL 4I48B 3UROR 3WIHA 4E5XA 3PJSA 3IT8D 3BO8A 3VWJD 3LQAC 5ADOL 4U1GB 4NN5B 1Z3GL 1FL5B 3D3VD 3GI8H 1Q9OB 3AXLB 4ODUA 4PPTA 4PJIF 3LSOA 3RX5A 5A40E 4L9DA 5FF6A 5DD1L 4FQCH 3BQUB 3O3AA 4HWUA 4HIIA 4AYFA 4LNVA 5KS9B 1I9IH 3MLTA 1PJ9A 1MWAH 3NFSL 2NX5B 3CU1A 1EV2E 4U7MA 2WW8A 1XEDA 3N1MC 2FHFA 1HNGA 3DHMA 1NLDL 3ARGC 4B53A 4LSVL 2EXWD 4KQ4H 1TTFA 3QWOB 4WTZG 1N26A 3I6GA 4GOSA 1BVZA 4FFVD 5C09A 3G9VA 4K3DH 1AI1H 1EHAA 3ULVE 5FO7B 3FTGA 3WJJC 3K80A 2CKBA 3BPOB 1F2QA 3O6FC 3Q5YA 3FZUC 5GGTA 3FB6B 4NGHL 2D4DA 4N90E 4UILL 5DJXB 4P57B 1R3JA 2OR9H 4JY6B 1D6EA 4ZUTA 1UWGH 4JHWH 3TYFA 4N0FA 4FXGB 3T4YA 1UZ6F 2EYSB 3REVA 1BD2A 1XMWA 2G5BB 4YXKH 5L7XH 4XZUB 3D69A 2QQKH 5J1SC 1S9WA 5SWZE 2H8PB 1RHHB 2ICWA 4NN5C 3RWCB 5CLWA 5HGHB 1UXSB 2O61B 1ADQL 3UZQA 4DKDC 4HMCA 1HI6B 2NNAA 1CDHA 4GRWB 2XKNB 5I1LA 5F1KC 1G6RB 3B8SA 2R4SL 2EDFA 1O7SA 4HFWB 1XZ0A 3BQUC 5ID0B 1WBYB 1HH9A 1IEAA 3HFMH 2DQHL 3K2MC 1U8PB 5DJYB 2R56H 3FB8B 1U0QA 5EZOH 3T04D 4EDWH 2HJKB 4EN3B 3LEYL 2XWTA 3FRPA 4QOKD 3KJ6H 1YMME 4OGXL 5T1LB 5GHWH 1KTLA 3RPKA 3U0TB 2WM0A 5KSAA 2XFXB 2A83B 3TJHD 1YEDA 3DX7B 5E2WH 2UZIL 4JFFA 4MXQD 3SGDI 2F8VA 3I75B 3TCLB 4HH8A 3IAPA 2BSTA 2X1XR 2KPNA 5JIHA 4YDJB 1I1FB 1I4FB 4ZS6C 3BPOC 3T0BA 3SDYL 5DEZA 4WY7L 1YUHA 5E8OA 5E00A 4PJ9C 1DVFA 4Z7UF 2IG2H 4PB0H 1IKFH 5CEYB 4X5WA 2ARJB 3QI9B 1X5YA 1K8IB 2R29H 5KZCB 4Z9KB 3MRRB 4LBEB 4OD2B 4LPXA 2EC8A 5D1XA 3PXHA 5IHBA 4M4PA 3QJFA 2OL3B 2EECA 4WGVB 3NACL 2C1OB 2SEBB 1HHGB 1C12A 5CBAA 1Q9WA 4UNVA 2B20A 1P4LA 4DTGL 1FORH 3MFGB 2NYYC 5D1QB 2EE9A 1TTGA 5EU6E 4TQEL 1S9YA 3O4LE 4K3EH 3BE1H 4E41E 2EC9U 3H42H 5DEFB 1I1AA 4LHJB 3C6SA 4QRRA 1F90H 4KJPC 5HHXH 4JDTL 3UJJH 2DLEA 5L2KD 2CDGA 4OIBA 3BKCL 3WHXB 3SY0A 2AQ1A 1H3WM 2RFXA 1JNNH 4O51B 3GHEH 4KI1A 2V2WA 3AMKA 3GGWA 2APFA 4LP5A 5IWLA 3KPRB 4HD9A 4UV7H 3ULUC 4PJDE 5DMIH 5I9QB 3VFOB 3QG7H 3QDGA 1UGNA 2G2RB 4NP4H 4LDOB 1AJ7L 2J8UA 3ROOB 4HS3A 4ONFL 1J87A 3OKNA 4QHMB 3KG5A 3FAWA 3QI9C 5DJ2A 5TDNA 5IOPB 5JXEA 3QFDB 4YC2B 1QFWM 2VDRH 1WC7A 1EHXA 4FQLL 3CGTA 3ARYA 4LASH 4N0RA 3ZHDA 3IDXL 4X4YB 1DCLA 3JV6B 4PJGF 3MRNA 4MDJB 4X0KB 4YDLC 2VDPH 1CE6B 5F9JA 5D1QC 1PG7H 5CZVL 1G9EA 3L5WB 3QUMB 3QQ3A 4QRTA 1ZA3A 1UKSA 1WIOA 3QHZH 3TV3H 5JDSA 4Q97A 1OGAD 4NQXB 4YFLF 5C0JA 4Y1AD 1ZVSA 3TZVC 3PGCB 1I7RB 1JUFB 1FGNL 4N5EC 4KZDH 4ESKA 2BSRA 1P7KA 1VDGA 4ZSOB 3EO9H 5F71A 1W0VB 4BQCA 4W68A 3PWPD 1IC5H 3R4DA 4DW2H 1W72A 2IGFL 1UA6H 5BRZD 5CIPB 2AK1H 1NANH 4U2ZA 3PNWB 1E4WL 2MMXA 3PXJA 5GRZA 3ZKSD 3S6CA 5I9QC 2BX5A 3IF1A 4RFOL 4DWHA 3ALXA 2F5AH 1CFNA 2EDXA 4NKMA 3LQZA 1DUYB 2MCPH 5MEPA 3HPLA 3L3GA 4HKJA 4YC2C 5FGBA 3IFNL 3VXUD 1P5UA 4PRHB 4WRLA 1OT2A 1MWAB 3CDFA 2YN5A 4WUUE 5DRZA 3LPFA 3N1PC 1BF2A 2RGSA 3BUTA 3VFSA 1X7QA 5CJQL 2IFFL 2XI9A 3HB3C 5EO0A 5C0AD 2OI9B 4AIXA 4UV4H 3X11B 4XNMB 5DTFA 1QSEA 5DT1L 1JGUL 2A1WL 3EOTL 4KMLB 2FLBT 2YPLB 3UPRA 1P6AB 2GFBA 5JZ7C 3QIBC 1YEEH 4RISH 4XXDA 3N9GL 4G9DA 1FG2A 5IW1A 4PRDA 1T1WB 4DK6A 2R2BA 4HX1A 2OMBA 2NXYD 3RTQC 3GSOB 4FQXD 3QFJD 3C5SB 1FBIH 3SPVA 4NC1C 3QO0A 4JPKH 1ACYH 1SY6A 3O0RH 4YEEA 5IROC 4OFIA 2MPAH 1R3IH 3HE6D 3F6LA 3MODH 1G7QA 1FYTB 1G1YA 3V2AR 1ZTXL 3W39A 4Y2DB 4YHNB 1JZ2A 4PJAF 1Y0LA 1HXYB 4BZ1L 2BMKB 3QEHB 3LN5B 3P0VL 3CFIC 1ZHLA 3MYJA 2H45A 1JZ8A 2EYTB 1X5AA 1F3RB 2HWZL 2VITA 3P4MA 4ZUWB 3PWNB 5C0IA 1JGLH 4C56D 1RFDH 3HS0B 1CL7L 2VZ3A 3AM8C 2ZUVA 5DA0B 1CLYL 3STLA 4EVNA 1GOHA 3JV5A 4UOW0 1I9JL 1NGWA 5FHAH 3S4SB 1RULL 3P73B 2JIXD 4K8RH 2VDNH 3HAEH 3V6OE 4GXUN 1KPUA 5SX5H 3BN3B 5A2JH 2OI9C 3NIFE 3TVMB 4MJ2A 3JTTA 3T3MF 4AIZA 1D9KA 3MLVL 4JKPL 1KB5L 1F02I 1QSFE 4S1DC 4U33A 2ZZUT 1S7UB 4NZTH 5EC2A 5I8CB 1YNLL 2VDKL 1KEML 4F57H 3KS0J 4MDIB 5JR1H 4M48H 1PYWB 2P48B 1H15A 4PGBB 4HQQH 4LGPB 4EOWL 4X4ZA 2O5ZH 3K1DA 3SKOA 2GK0A 4OFKA 3IJHB 3G5YA 5A3ID 1PSKH 1GAFL 4Y2DC 4KK6D 4GG6F 2FX9H 4KI5F 4WWKB 5EU4A 1DBKH 5E99H 3DXAB 5J4MA 5D93B 1S7QB 4DVBA 4ZFFA 1V5JA 1AQKL 4JEGB 4OFYD 4UBDC 5BOPA 2EDTA 5JMOC 2I25N 4PS4H 5DFVC 4Z0XA 1CDCA 4I8DA 4QY8B 5EU3A 5AD0A 5CS7A 1U6AL 4KJWC 4AH2A 5JXAL 1EAJA 2OTUB 4LLUB 2ESVE 2YK1H 5DVKA 4ZFOL 2MQ0A 3HG1E 2GJJA 4Z8FH 4YDKH 4HJ0C 4GMTH 1FLRL 1OPGL 5HHOB 4MD5B 4ENEC 3EYQC 4F7TA 1CIDA 2H26A 5DHXB 3H8NA 2H3NB 1ITCA 4QHUB 4OSUL 2WINA 4FQIL 1OAUH 5I30L 2AKRA 2XZAL 2COQA 3DURA 2LU3A 4GBXD 3MRGA 3RVXD 4WHYH 3UJTH 4H0IA 5JLZB 2HVKB 1JWSA 3O3EB 4J3VA 4Q9BA 3VXOA 4FRWA 5GIRA 3GJEB 2HJFA 1U2HA 3P4OB 3QQ9C 3MR9B 2R0KL 5EOQH 2VZOA 4NYLB 1J0KA 1PX4A 2HKFL 2Z35A 3V6FA 3TPKA 4WWKC 3HA0A 3PABB 5D93C 3X14B 4G9FA 3X12A 4MXVE 4OLXL 4UIKH 4R3SB 1B9ZA 1LO5B 4ZUSB 4X6FB 5E6ID 5FGSA 3C60C 2BOBA 3SOBH 3H9YA 3SO5A 1U8NB 2JF1A 4LF3A 4KRNA 2XACC 3H9SA 5HYJA 4DCQA 5CEZD 3B8YA 5JQ6L 3MUZ1 2HFGL 3NH7L 5IF0B 3U36A 4QRQB 4KKBC 1S7TB 1VHPA 2DIJA 4P2OC 5DR5L 1CFBA 3QIWB 1NAMB 4U6HB 4ZPTB 5DJ6A 4NNPL 1EUTA 1MCWM 4NZRH 1AIFB 1QO3B 3UPCA 5E7BA 4CU6A 1WICA 2VSCA 4BQ8A 4JO2H 4HKXB 1DQJA 3I3BA 1Z5LA 1AGDA 4ODTH 2G9HA 2H2PD 2PYED 3VDAA 2WBJD 5DUMH 1R3LB 1EEYB 1XCTA 5EZIH 2F74B 2F58L 4NQED 1FH5L 4ZYKA 3D85B 4NRYA 5BQ7B 4X8JA 3VWJA 1L9MA 1SBSH 3L3DB 2HT4C 1A6VL 3G6AA 4U1IB 2ZCKL 5DGRA 5AWNH 4PJHA 3JSSA 2DDQL 4ZUUA 3RVWC 3M17B 2DQEH 2MHAB 5HY9A 4HWNA 2E3VA 5B8CB 5HGAA 4LHQB 3HNTH 2FJFA 3V5DB 1FGVH 3D39D 4FQQA 5D5MA 3FFDB 5JNYB 4HUWA 3P0YL 3EYVA 1ORSA 3L9RA 2XOTA 3K2UH 5FV2A 5KAQF 1G1CA 3FOLA 4GQPH 4JRYE 4WFED 1FNFA 1M1SA 5EFIB 3NIDF 4FG6C 3MUJA 4P48A 4RWHA 2CK2A 4LAQH 4XH2A 5D72L 5C08B 3C8HA 1NMBL 3KYNB 1U95A 3HR5A 2BXYA 4JZJB 5FUCC 3X13A 2A77L 5E8DL 1YPZB 2DI9A 1ZHNA 4L8BB 3TBSA 1F6AA 3PDOB 4JGUA 5ENWB 5E2JA 1QYGL 3VMNA 2I9LA 1IJ9A 3D9AL 1GPOL 2P7TB 3LZFL 4LEXL 2VL4A 1NEZB 3F12B 5C0CE 1WAAF 3DLQR 4YFEA 2NTFB 3C9NA 2FO4B 2V17L 3VRIA 3GM8A 1XFPA 5FECA 4OCWH 5B21A 5GRVK 4X7TB 2EDKA 3BGAA 4KK8C 5F1NB 1S9VB 3HAEB 4RCAA 1JGVL 2F54B 1JPFA 3HNVH 1L7TL 2YD7A 4K94C 5KSBE 1UH3A 4KDTA 3BEWB 1I3GH 3EHBD 5B8CC 3GI9L 4PJFA 4X9HA 2VLLA 3QEQE 1QLFB 3OB0K 5IT2L 4XVUD 1CU4H 3DX6A 3ZE2E 4ELME 4X6CE 2KDGA 4I5BB 1YMHB 4QOKA 1PKQE 5JW4M 5DWUL 1CG9B 3T2NL 3PWUB 3FHQA 4HWEL 4HC1A 3LRSA 5ADOH 3CSYB 1G7MA 4GAJL 4Y4KD 3U82B 3BVNA 3EJJX 5GSVB 1Z3GH 1EBAA 3SDAB 1K5NA 4JFQB 4JZJC 3O45B 5JOPE 3ILQC 3K1KC 4L4TD 4O2EA 3S37X 5DD1H 4OLUL 3NA9L 1IILE 2OSLB 3FL7A 3OF6D 3LEVL 4WJ5B 5JHDB 1CXFA 1A1MB 5I1CL 3UYRL 3G6JF 3F65A 4XCNA 1YDPB 4RAVB 4MHHI 4QKXB 3TJEH 3KPQB 1FN4A 1E4XH 5D1ZD 5FA3B 1NLDH 1A1OB 3ZTNL 4LEOB 2IMNA 1FO0A 5C07E 3S34H 1NSNL 1PLGL 4K8RC 2W0FA 4OZFH 4L8CA 5KW9L 5I17A 1A8JH 4OCMC 1F4AA 3THMH 2R0LL 2Y5TB 4Y19B 4JDVA 4R2GB 3WFHA 4NGHH 4UILH 4KQ3H 5FOBB 2HLAA 5KSVA 2F53B 3U0WH 3T0EB 4NFBA 3DROA 1ES0B 5EU5B 5L6YL 1A1NB 2GITA 4XWGL 1Z0MA 1NFDA 1JHTB 3FFCB 1Q9KB 2IBZY 3BP4B 4WFFE 3UTZB 3V5KA 5L2KA 2ADGA 1BBJB 4OCLC 4U1NA 5BZWA 3UTPD 3O6ML 1E6OH 3DRQA 3MRFB 4LLMA 1FRGL 3SDAC 4OZGF 4XMPL 3BEVA 1BLNB 4X4XB 3OX8A 2R4SH 3VGBA 2V9TA 4I1NB 3ZDZE 3HN3A 3WYRA 5TE4L 2F19H 5KN5A 4EDXB 3LV3A 1NCDL 1MCBA 4F33A 3KPOA 4RGNE 1MVUA 2FEEL 3K3QA 4P2QD 5I8EB 1MLBA 4UINL 4OGXH 5D70L 3HE7B 3GKZA 1EDQA 3CFCH 4KUZL 3I50L 1W0WB 4HG4K 2AJYL 2VISA 4NBYB 2UZIH 4NO5A 1TQBB 2FWOA 4O2CA 5ICYB 3MJGX 4MD4B 1ZXQA 2WP3O 3TBVA 1EHNA 2A6DB 3UTQB 4YAQB 3SDYH 3GMLA 3G5VB 3O6KL 4LLVB 4WY7H 4WI4A 4URTB 5HD8C 2QSCL 3TIEA 1QHOA 3FQWA 3FQNA 2PO6D 4JFYB 4YZFE 3T0EC 1OGAA 1DN2A 3ROLA 3MRDA 5J1AB 2DM4A 1ZT4B 1JWMA 1PEZA 4LCWB 3O11A 1U8KA 1ETZA 5IVNA 5DJCB 5C6TL 3QIUB 3NACH 3V7MA 5HVHB 3PWPA 2D31B 4XBEL 2ZUQB 3WLBA 2PTUA 4R7DA 1RI8A 3ARTA 1Z2KA 4TQEH 1UB5B 2EDEA 3MRKB 3ILPA 4IMKA 2HMIC 4KRPD 1Q94B 3BP7B 4R7NA 2EE2A 1KCRL 3E6HB 3JWDH 4DOHE 4OKVB 1BOYA 3ZE0E 5MENE 2IQAA 2XY2A 3PGFH 4CBPA 4OCYH 3MRQB 3WN5C 3HE7C 4L9LB 4PRBB 2FH8A 3NCCB 1EFXD 5D7KD 5D7JB 4YHYB 3ARPA 3RWDB 1NBZB 1XAUA 3VXUA 5IVXE 1G7IB 5ITFB 1VFAA 1MCOL 5F3HA 4Q0XL 4KTDL 4KVNL 1TQBC 3RBSA 4YUEL 2EH8L 1V7NH 2P5EB 4MHHG 1HH6A 4HZLB 3FO2B 1IQDB 2N7BA 3CDCA 5I74C 2FX8L 2HLFD 2HTKC 2AV7A 2VIRA 3TO4C 5CKGA 2OBGA 5FDYA 3RGVD 2BZDA 3QXVA 3GMMA 4NO3A 4GAGH 4MA8L 1KIPA 2NW2B 2B2XL 4OF3A 2Z8RA 5I1EL 1LQSR 3QIUC 4PREA 4CMHB 3QNZB 2ZUQC 1ZEAL 4FQXA 3QFJA 1EZVY 1NC2B 1MCSA 3ULVF 1L6XA 1T1XB 3QUKB 3HE6A 5HYSG 4UT9L 2XKUA 3UCRA 5K9JL 2ZKHL 5E9DE 1R3KA 1PQZA 3BUYA 4Q2ZA 2IADB 5E94B 3CXHK 1K4CB 3MQIA 4HUUA 3FB7A 4FTVE 3UP1A 2DLFL 4L9LC 2DQGL 3U6RA 3S8WA 5D7JC 4HXAL 5EDXA 3RWFA 5BO1L 4C56A 1S7SB 1D5ZA 3CVHA 4P99A 2HG5B 3MFFA 2JB5L 4P9ML 2DLTA 2Y5EA 4P46D 2IGFH 4KDVA 4WVRA 1AR1C 4EI6B 4A6YA 1ONQB 1E4WH 3B2UC 2P42B 1XGTB 1UEMA 2RJMA 4RDQG 2YHGA 4MS8D 4RFOH 3WIFB 4BYHA 3VMOA 5I1HH 1IAOA 4WHCA 3ES6B 2A9ML 1LDSA 2Z93A 4PR5B 1A4JA 2A6JB 4K9EL 2DQFA 4EI5B 1P4IL 3TFKC 2VLJE 4UUJB 4PRPB 4CMHC 3S4SG 1HHHA 4MQTB 4DGVL 1NANI 2X6MA 4NQUA 4KWUA 1P7HL 2DQCH 3SE3A 3FT4A 4MVBD 2IFFH 2AXFB 1NAKL 4G43B 1WGOA 1WWCA 5F7YC 1MREL 5GS0D 4M5ZL 3ZO0A 3CMGA 1PG7X 4OZFB 1JGUH 5DT1H 2VZTA 3EOTH 2V7HA 4J3OC 3TNMB 4PJBA 4PJEB 4OFYA 3N9GH 2APTA 3HCVB 1LK2B 1MVFA 4PP2B 3QG6A 1D5BA 3T1FA 1J1XL 1SJEA 3ULVL 1U58B 1BQHB 2L4OA 2Y06L 4J3WA 5KS9E 2OP4H 4PJAA 1U8LA 4R97B 1OW0A 2FGZA 5ERWB 2NX5E 3FN3A 4LSDA 1UACL 1OSPH 2VSDA 4JZOB 2A9NH 2DQUL 3P0VH 3F62A 1A14L 1WT5C 1QSZA 3CH1A 3KDMB 5ACZB 4PTUA 3L3OB 2YD4A 2ZOLA 1XF3B 1CE1L 3ET9F 2R1YB 3L3JB 5F89B 2XTJD 1II4E 2OX5A 2CSPA 2BY2A 2GY5A 1CL7H 4GBXA 3BAEH 2Q8AH 2D7NA 1FNLA 1I9JH 3MV9E 3OGCB 2HFEA 1RULH 2QQLH 4QHNB 3U2SA 2P47B 3LKOA 2H6PA 5LAXB 1F3DH 5H35B 3C5ZD 4PJDF 3HI6H 3L3HB 1T7YA 4JKPH 1KB5H 2FIRT 4RFEB 4O2FB 4DZ8B 1KIRB 1ZS8B 1HSAB 3Q6GL 2DLGA 3SEPA 5E6IA 1KEMH 3KPSE 3NCBB 4GRWE 1T03H 4PJ8D 4OF6A 1CI5A 1FE8H 2GJ6D 4J8RA 4U6VL 3SBWC 3GRWH 1B4RA 4R97C 1D6VL 2YS4A 1GAFH 2RR3A 3FAXA 1ZSDA 3SJVD 4OUOA 3OSKA 2B5IB 2PW2A 3EW3B 4JDZB 4K7FA 5E5MB 4IMLB 4JFXA 4XBGB 4DVRL 5IBLD 1DE4A 3WFBH 2V5SA 5E8PA 4MCZB 1AQKH 4GKSA 1UFUA 4YE4L 2GSGA 4C54A 2WUBL 4JKLA 1U6AH 5DDHB 1I1CA 3ULUE 4XHQA 5ALBH 5EU6D 5JXAH 1CFTA 2IH1B 3O4LD 1K9TA 2NLJA 3RZCD 2PYEA 1M6OB 2WBJA 2XN9A 4JQIL 4BKLB 4E41D 2ADIB 4CDHA 5DURB 3DUHA 2C5DC 4V1DE 2OYPA 1RJZA 1AD9A 1DQQA 4E42B 3PV6A 5ICXB 4NQEA 1GYAA 1B0GB 5I6XB 1OPGH 5B4MC 2IANB 4C83B 5IKCB 3S36X 2C3XA 2V7NA 5CD5C 3W0WA 4TVPE 3RX8A 4YO0B 1T7WA 2JB6B 5I1DB 1TFHA 1AQDA 2W0KA 32C2B 3I6KA 1P2CB 5EIIA 2UWEA 3BN9C 3GMRB 3O9WB 4FQIH 4XNQA 5I30H 2XZAH 3LKRB 1CGYA 1ZWIA 2O5XL 1BJ1J 3S3PA 1QQDB 1LNUA 3I3DA 3N1QC 3P9LA 3WFCH 2BP3A 4N9GB 3SDCB 3D39A 1MAML 3U9UA 1GGUA 5EO1B 1E28B 1E4JA 1JPST 3OXSB 2L0DA 4JM2D 3VDBA 5CJOH 4KKAD 3L5HA 4H20L 3T3PE 2HKFH 3AB0C 4K23L 4ONGL 1T5XB 2B5IC 2GTWB 3L95B 4U7KA 2HT2D 1HIML 4OLXH 3QJHB 3HC4L 15C8L 4MJ5B 3SKMA 1DANU 4Z7UB 1X5XA 1RIUL 3RBGA 4BFIB 1ZVHA 1MIML 2BNRD 3T2PA 4APQB 1I1YA 3KPRE 4UTBL 3MGTA 3JWDC 1R5VA 2DIAA 5JQ6H 1A4KB 4WEBL 5LG1A 2HFGH 3NH7H 3UBXI 2E27H 4P4RA 3DO7B 1FNGB 1AP2A 5TDPB 3OTTA 4XHJC 1I7ZB 5I6XC 5E7FA 2VYRE 3VRLE 2W59A 2BSSB 1N5YL 3OHXB 4JB9L 4MMXC 4KJYB 3BISA 3BP5B 4X4MA 5I73B 4Z7VB 2C7UA 3CLFL 2VAAA 3KNBA 4HT1L 4M4RA 2CRYA 1QPXA 5CBEB 1K3IA 4GAYA 2X89D 3CDGA 4GKNB 2BVOA 1MRDL 3SDCC 4IOIB 1GGCH 5EO9A 1NEZG 2F58H 5H2BB 3T77A 4JPWL 5EBMB 5ISZB 4LHUG 3Q3GB 3NIFF 3MJ9A 2ZCKH 5JPNA 4ZSOE 5A2IH 4U1JB 4G8EB 1T89A 2N1KA 4KAQL 1XGQB 2DDQH 4HC1L 4MAUL 5FGRA 1U3HB 3HAEG 4LU5H 2Y07L 2IPTH 4NC1E 1HNFA 5JIKA 4L4TA 3PQYB 1CZ8L 4APQC 1HWGB 1CD1B 4ONOA 5F7UA 1BAFH 3CDYA 3T0WA 2LAGB 2YA1A 4M1CD 3P0YH 1YN6A 1CF8L 4PRID 5DD6B 1I9RL 4NZJA 2D03H 4PJGB 1KB9J 4GMSL 5E08L 3ZKMD 5D1ZA 1T22A 5EBWB 1J18A 4PRHE 2VOTA 3B2VL 5D72H 1LEGB 1CD9B 1MHHB 6CGTA 3LDBC 3IU4H 1NMBH 5DK3A 3RA7L 5I73C 1X5FA 4JN2A 3EOBB 2W1NA 5EC1A 4HWZA 3T4AA 4G6AC 2EZ0D 2G75B 3D9AH 1GPOH 1N6QL 1F8TL 3LZFH 4LEXH 1JF6A 2YD3A 4Y5VA 2YPLE 4ZNCD 1S9XA 2V17H 1HYSD 1NGQH 4I3RH 2NY1B 5HYIA 5GSRB 3OZ9L 1JGVH 1U3HC 5JW4N 2I07A 1HYRC 1L7TH 3QUYA 2VXQL 5ESQA 2HTLC 1SYVA 4DGYH 3G04A 1FYTE 4Y4FD 1KB5B 4R96A 2AJSH 5ITBL 4P59H 1P7QD 3RY6A 2B39A 2GY7B 3GMNA 2R2EB 5TPWL 1I7TB 1KPRB 2YMXL 5KTEH 1A7PL 3PDGA 2AVGA 4WO4D 3IU3A 4O58L 4P2QA 5GGRA 4MCYB 2Y25A 5DWUH 3T2NH 5IB1B 5BZDB 4HWEH 1PW3A 4LLQA 4BELD 4WHYG 2P24A 3IJSB 2LVCA 4HIJA 1FZOA 4U1HA 1XCQA 4MXVF 3UBXG 4U6TA 1JJUA 3BKJL 4QGTA 1E6JL 2OR8A 3T8XB 2WIMA 3HMWL 2ITCB 2D0FA 4OD1L 4X6BA 3RNQA 4OLUH 3NA9H 3QEUB 5L2JA 5C0GA 5IW3A 3LEVH 4GW4A 4LNRA 5I1CH 3MMEA 4MNGB 5D7SL 5D2LF 2I5YH 3F6IA 2PO6A 4EBQL 1CGXA 1KJ2A 3U0PB 3IGAA 1PEWA 2FX7L 5HHQB 5DJZA 4WW2A 3QXAA 1G7JB 1KBGL 1ZHBA 4JM4H 3SE9L 5L88H 1J86A 4TULH 3SGEH 4U1LA 3VXPA 5E70A 4CN1A 3ZTNH 1AHWB 1MQKL 2VN7A 4ZFOB 5BS0A 2XA8L 3I2CH 1NSNH 1PLGH 3TA3D 1WVZA 4UZGA 1HKLL 5KW9H 1T5WB 2FATL 4HMEA 4L29A 2R0LH 2ESVD 2EDBA 2PXYA 1BVKA 1TJHL 3GHBL 4OV5A 3HG1D 4B0MM 4XTRC 5JA9A 4ACPA 1JZ5A 3QNYA 4NSKB 3PWVB 1N7ML 5E4EB 5L6YH 3DXAE 4CJ1A 4G6ML 4N1HB 4PGEB 4XWGH 4PV8B 4P3DA 1E4XI 1KYOK 3CFKB 4FQ2H 3TN0B 4ZD3H 2P49B 5C9JB 1WSST 2BJMH 3O6MH 3VXMA 1FRGH 1DZBA 3NCEB 4H8WC 1T2QL 1EGJA 1HILA 4B7LA 3BXNA 3DWTA 5C8JB 1S8DA 2VMFA 3D6GA 4LVOC 3RVTC 3T0XA 4HS6B 5CJ5A 2EDRA 1OTUC 5EUOB 1CTNA 2JELL 5TE4H 4Z7OE 5HHOE 5J8OA 4GUPB 4WI6A 2EKSA 3SDXF 3RGVA 3HKFA 2L7JA 1QOKA 4QT5A 1KN2H 5FYKH 4HKBA 2JLLA 1MI5B 2YSSA 5AG9A 1MFEL 3OXRA 1AGBA 3GSNL 3HPJA 4U7SA 4F37K 4K2UL 4YHML 3O3DA 4PY7A 1AHWC 1JI1A 1QLRA 2GYSA 5K9OB 5I1GH 2EYRA 4GKZA 4OIIH 5DJDA 1KXQE 1FZKA 4ZNEE 3HI5L 2X05A 1DLFL 2W0PA 5K9KA 4XCEA 1DEEB 4RRPG 4U1KB 4GW5A 3O6KH 1DUZB 4X5XB 3QR2A 2QSCH 1W2KT 3DBXA 1R3HA 3UTSB 4Q9RL 3QXTA 5E4EC 4XCYA 1DDHA 2X9WA 5IHZB 1IKNC 2IBBA 4P49A 2X10A 3TN0C 1T80A 2ZUTA 5C6TH 2ICCA 2QBWA 1IAIH 1MHEA 2JCCB 5MEQA 4S2SA 1MFAL 4XBEH 5DVNA 1AC6A 4NZUH 2ZOKB 4JCMA 4P46A 2P8PB 2PR4L 5KSBF 3VH8B 3Q6FA 4N8VA 4WTWA 4FABL 5ANMA 2ICES 3PJSB 3OL2A 3BO8B 3JVGC 4HGWB 3H3PL 1QFHA 1KCRH 3ZE2F 3UYOD 4ELMF 3NAAL 2EO9A 5INCB 2X4TA 1EIBA 3GO1L 2ZSWB 5FUCE 3L3KB 1SMOA 4NBZB 4ODUB 5CD3A 3LSOB 4UDUA 4XMLL 4TTDC 3IDUA 5J11B 2VL5A 5FF6B 2DRUA 3O3AB 1YEKL 4NQDB 4HIIB 5KVMC 4KVNH 4GW1A 1BZQK 3HUJB 3MLTB 3BT2H 7CGTA 2EH8H 3OKKA 4LPTA 3JBG7 3RGHA 3FO9A 2GUOA 1WIUA 1T1YA 3ZHLA 3MRBA 1ZLWK 2IPUK 4X98B 1F00I 2AJXL 2DAVA 2XRAH 5FB8A 4ONHA 5C3TA 1QFOA 3GSRB 5IUSA 5HGDB 4MA8H 3DETC 4QRPD 2B2XH 5C09B 2DYPD 5I1EH 1HZHH 1N8ZB 3VI4E 3FTGB 3T09A 1NGXB 3KGRA 1Q72H 2QADB 3IFPA 3ESUF 1B6UA 3CMOL 4ZUTB 1D6EB 3TYFB 3BPLB 4JFDB 5GGSA 4N0FB 1LE5A 4P4KA 3RAJH 5K9JH 2ZKHH 3REVB 1BD2B 1EJOH 4HW6A 4PG9A 3MPCA 3D69B 4OZFG 2ICWB 4BFBD 5T3XE 3RKDD 1MY7A 4X7CC 5C08E 1WK0A 4HXAH 3VA2C 5I1LB 1YPZE 1GC1L 4Z5RA 5B22A 4YR6A 1XZ0B 1NUDA 2VZ1A 5C0EB 4P9MH 1HH9B 5IESL 1IEAB 3K4DA 3QEQD 2P5WD 3PV7A 4N8CL 1MAKA 5ECJE 2XWTB 1KTDA 3C5ZA 4NWUL 3ZDZF 1KTLB 1RQ5A 5GISL 5KSAB 4Z0BL 3Q1SL 1Q0XL 2A9MH 1PG7W 1YEDB 4LOUC 1T83A 2E7MA 2F54E 2BSTB 3TT3L 3KLDA 3LOWA 2E9WA 1L0XA 2DQDL 4G6FD 5JOPD 1NBVH 4O9HL 5EBGA 4PJ8A 5E8OB 1TZHA 2GJ6A 5E00B 4DGVH 1BEYL 1IGJB 5CEXA 2R1WA 4JFPB 1OL0A 4JFHE 4M7KL 1QLEL 3R8BB 1P5VA 3SJVA 1MREH 4QLRA 4K71B 4M5ZH 3QJFB 1ND0B 1NCBH 4YZFF 1IT9H 2GSIA 4P0DA 4JO1L 5CBAB 1K4DA 4ODXA 5C07D 1F6LL 1XR9A 1P4LB 4ZTOL 1ACZA 1U8QA 1OARL 3CVIL 4HEME 5I8KL 1J1XH 1GHFH 1S9YB 4YLQT 2YZ8A 4NJ9L 5EU6A 2Y06H 1FZMA 5HI4C 3RJDA 5JHDE 3G5XA 3RZCA 1YN7A 1I1AB 4Y5XA 3K4ZA 4FA8A 1A3LL 2CGRL 5KVFL 4QRRB 1B88A 1BOGA 3BRDA 1UACH 2ZG3A 4JG1H 1NUNB 2EDDA 1RJYB 3AS0A 3ZKNC 9CGTA 5KSAC 5B39A 1A14H 1U2CA 4I18A 3ZE0F 5GZOD 1KCSL 1CE1H 1XIWB 2V2WB 4KTEL 2JK5A 1A3RL 2DQIL 3GGWB 4F2MA 4Z77A 2P4AB 5IVXF 4Y19E 5GRJL 1G9MC 5DUBA 3U4EA 4NO2A 2XWJB 3QDGB 1DVFC 2F53E 2J8UB 3T0EE 4HS3B 4NKDA 3OKNB 2QKIB 4YFLI 4L8SB 4XBPB 4RGND 4R4FL 5DJ2B 4B7IA 3LN4B 4JM2A 3FFCE 1M7XA 5MEOA 1LILA 3D0LA 3LCYA 5F7FA 1WC7B 5D1XC 5FXCH 3MJ8A 4OT1L 5TGBA 3WJLA 5GZND 1G9NC 3JWOL 1RJCA 3Q6GH 2KQMA 1OT1A 4K07A 5FHBL 4ZODA 3KLHC 5TE6L 1CL7I 1IGFL 3MRNB 3K8MA 1QPPA 3CFJA 2BNRA 2FYYA 1G7PA 4W6XB 3SCMD 1RK0A 4PUBH 2EDQA 5F9JB 1JGEA 4PGZA 4O02L 3HNSH 4U6VH 1I1AC 3QQ3B 1ZA3B 4QRTB 2W9LA 1RUAH 2B0SL 5JDSB 1D6VH 5C0JB 1PDKA 3DVIA 4JPIB 2EDHA 2HFFA 1RUPH 1KF9B 2BSRB 1P7KB 2FZ3A 1RVFL 1I8KA 3QNXA 2YBRA 4DVRH 3TNNA 4RGMB 2X41A 2NY2D 1GXEA 2VXSL 4IEFB 4PJ5B 1Y6MR 4YE4H 3K74B 2YD5A 4DGIL 1W72B 4C58B 3N50A 4M7JL 1I7UA 4M9OA 1MUJA 4ZO8A 1FL3B 5IWLC 3QZWA 4KJQC 2X89A 5FA4A 1B2WH 1IEBA 4PB9H 4JCLA 1OTTD 4JQIH 3NCYS 1CDBA 4UOJA 1GJIA 1CFNB 2QHRL 2C3GA 3F58L 2VN4A 1J0HA 4NKMB 3LQZB 5E95B 3L3GB 3WNNA 4HKJB 4LCWE 5JXEC 3U1SL 2R2HA 4I0PB 3CPLA 5FM5M 2R69L 4Q7DA 2YOCA 5DRZB 3ZKXB 4LFHD 3NPZB 3WUWA 4XP9L 3VFSB 1X7QB 4TSAH 2ZP0T 2X2YA 2DKMA 4KU1A 4MA1B 3B5GA 2GTZA 5DTFB 1QSEB 3NTCL 5F7MC 3A0OA 3ECBA 2CMRH 4HH9A 1CXHA 1FCCA 4OGAC 5FYLL 3QPQD 4PRIA 2GFBB 1LEIA 4H20H 4AZ8A 3PG2A 4XXDB 1LP9A 4ONGH 4G9DB 1FG2B 1T0PB 5IW1B 5AZ2L 4PRDB 3WNKA 2R2BB 1HIMH 4RGMC 1HXMB 1URLA 1RIUH 3SPVB 4HFUL 2HYMA 1MIMH 4OUUB 1LE9B 3QO0B 2NY5C 5JTWA 2P5EE 1OD9A 2OK0H 4QXTB 4RMQA 1G7QB 1FFNB 5EA0H 3DX8A 4WEBH 1Y0LB 3EDEA 1KEGH 5KS9F 5E9DD 5HVFB 4AENA 3EOYG 4NNYA 5EOCH 3LQAL 4NBXB 2JJTA 1ZHLB 5DSCA 1UWXH 2VITB 4A2MA 2HH0L 3P4MB 5FGBC 5C0IB 4JB9H 3DVFA 3STLB 1LD9A 4FN0A 4G7YH 2W9EL 3ZKXC 2GJZA 3CLFH 4FMFA 1WEJL 3ULSA 2C4XA 5DI8A 4DFIA 4KK9C 3KPMB 2M1KA 1F11A 1KPUB 4Y4FA 1JHKL 2Q3AA 2FR4B 3BPCA 1T04A 1P7QA 4MA1C 2R0WL 3JTTB 3RIAK 1EBPA 1D9KB 1ED3B 4AIZB 2QR0A 2W92A 4WO4A 5F3BA 4JPWH 3WKML 1MQ8A 3EYOB 4W6WB 5T1KD 3QO1A 3LKPA 4ODVL 5GJTL 1Q9LA 5JHLL 4F3FB 4KAQH 4HS8L 4HC1H 3O6FD 2D0HA 4MAUH 1JTPA 2VZUA 2NZ9C 4TRPH 2VDLL 4OLZH 1H15B 2CQVA 2Q6WB 4HCRA 43CAB 3BIBX 1NCCL 3SKOB 2GK0B 1CZ8H 4GRWF 1I8IA 4XGZA 3W9DA 3G5YB 4P23D 1RUQL 4BSVA 1C08A 2NY6B 5KVGL 4LCYA 2X40A 5EU4B 1REIA 4M1DL 1CF8H 1KCUL 4ZFFB 4AK1A 3JV4A 3F5WA 4GMSH 1U93A 3WLWD 5FIEA 4PJ7A 2ILLA 5EU3B 2GIYA 5AD0B 3WHE1 3C09B 4F9PA 4PRPE 3TA3A 4AH2B 3RA7H 4RNRA 4PLNC 4ISVA 3HG1A 3L5JA 1J0IA 3ULUF 4IOFC 2B4CC 2NX5D 1IQWL 1H3GA 1N6QH 4U1SA 1F8TH 1D9KC 1DQTA 3BIKA 3SKNA 4R0LA 4YK4B 3NA4A 3BYTA 4PJEE 3BKYL 3CUPB 4LP4A 3ZKQD 1ZGLP 2WINB 2AKRB 3IRZA 3OWEA 3DURB 3LPWA 3OZ9H 3BDXA 3MRGB 4RAHA 1R24A 2E9BA 3MCLL 3NGBB 3MV9D 1JWSB 3GMOA 4NUGL 5IIEB 1T0NB 5GIRB 1WBZA 2HJFB 5ITBH 2C3VA 5IR1A 2WUCL 2NY6C 3DOSA 5TPWH 4MX7A 3MJ6A 2YMXH 2Z35B 1UQSA 1IL1A 4LAJH 3V6FB 1A7PH 3NBNA 3LKQA 3TBYA 4O58H 4G9FB 3CZFA 1I8LA 1DBMH 3LKNA 3AAZA 1E0OB 1MJ7H 3T3PF 2ICEA 2WIIB 1QFPA 4QF1A 5DRNA 2BOBB 1TVHA 3KPSD 4OGYL 4NZDA 2ICWI 3C09C 5E6ZA 4LF3B 4OLEA 1E6JH 3EAKA 3H9SB 5HYJB 3MV7D 3V4PL 3S3JA 2APXA 4DCQB 3VFGL 2NTSP 1S7WA 3REWA 4OD1H 2R23A 3U36B 4J2XA 3VXRD 4EN3D 3QWRD 4KJPD 4HDIA 5E6YA 5D7SH 4PJIE 2AJVL 5C71A 2C4FU 4XNZB 4EBQH 5ICZB 1N0XL 5DJ6B 2R8SL 1VGKB 2FX7H 2X7LB 4YK4C 1WIPA 3HMXL 4JZNA 1KBGH 3SE9H 4RQQA 4OLVL 4YHLL 2VXTL 3VRLF 2XPGA 3L3IA 5FGCB 2Y72A 4OQTA 1MQKH 4NM4H 1DQJB 2XA8H 1P4BL 1AGDB 4ZOAA 3S5LA 5I1JL 3J7HA 2CO7B 1NUGA 4UU9B 3ULUL 3EFDH 1XCTB 1TJHH 2MKWA 2X4QA 3NN8A 2Z92A 4V1DD 4ZYKB 2FGWL 4NRYB 4BUGA 3QI9D 4U0QB 4X8JB 3VWJB 4DAGH 3B6SA 1CDYA 4NM8L 1N7MH 1UXWA 1BX2A 3G6AB 4NQTA 2A0LD 5E8NA 4G6MH 1S78C 1CD8A 3QAZB 4PJHB 3OAZK 3X3GL 3GMQA 4F58L 4ZUUB 4TUKL 3SGEI 1N4XL 4TVPL 3BPNC 4AEIL 2HFTA 1LMKA 5AG8A 4M6AA 4XWOC 5HGAB 2NQCA 5HJ3A 5D1QD 1ZK9A 2HJLA 2FHBA 1T2QH 2FJFB 3M8OL 3BMWA 4XX1G 4FQQB 4HUWB 5EN2A 3MUGA 1ORSB 3L9RB 2C3HA 3FOLB 2FIKA 1MJUL 5DS8B 3LEXB 3MLXL 4AEEA 2IANE 5F9OL 3BD4A 4GG8A 2N4IA 2NY4B 2X4PA 1U3ZA 1FZJA 4LARH 4UAOB 4XH2B 3WFDH 5I66A 4QRPA 3HR5B 4H5SA 1MFEH 5C0BE 1SYSA 1Z9OA 3X13B 3GSNH 3GJFA 4K2UH 25C8H 2IH3A 1ZHNB 3VE0A 3TBSB 3VXQB 1F6AB 3E6FA 4X7DC 3HI5H 2I9LB 1DLFH 4PYHA 1D5XB 4UB0L 3VG0L 5EUKA 3S37L 4ODWA 1BPVA 5AUMA 2VKXA 4OI7A 3VRIB 3G08A 3VWJC 4BSWA 3A6OA 5FECB 4Q9RH 2FEEI 4J3TA 4OLYH 3MV8B 4M8VA 1YEGH 2FO1A 1YYMH 1YEFL 5BVPL 4Z7UE 1JPFB 2CKNA 1RIHL 1SEBA 3MNVA 5FYJD 4PJCB 4NUJA 2J4WL 1QHPA 1MFAH 2F8XC 2VLLB 4IIQA 2CRIA 4U3XA 1QBML 4L4VA 4GKOA 4FFWD 2P5WA 3DX6B 2BVUA 4FABH 5J3HD 4DUWA 1DL7L 3QUML 4X6CA 3ZDXF 4QOKB 3TBTA 3H3PH 4JR9L 4A6YH 1H3PL 3CFEA 3ESVF 4LQFL 2DWDA 5AYUL 3LRSB 4XPTL 1F58L 1UEYA 3PUCA 3SDDD 3CSGA 1S3KL 2NY4C 2EXWC 4UAOC 1RHFA 3GO1H 4Z7VE 4FFVC 4EQ2A 4LPVA 1IAII 3IDGA 4XMLH 3FT3A 4I3SH 4O2EB 3BH9B 3SO3B 1KXVC 1YEKH 1X4XA 4HZAA 1ZANL 3ARSA 3C8KA 5JORB 4XCNB 3MLPA 3FRPG 4NNXA 1HINH 3RIFF 1FN4B 2AJXH 2FD6L 4WU7A 3RVUC 3S7GA 1MRFL 1Q0YH 4PLKC 4D2NA 4FQCL 2D2OA 4PRHD 2W0FB 4IJ3B 1I9IL 4L1DA 1MWAL 5EZLA 1OTSD 3MREA 1JF1A 4KDTC 1CN4A 2APWA 4JDVB 1N2RA 3WFHB 5GGVL 4M5YH 3CMOH 5GGUB 1CDIA 1B0RA 4TUJA 3MRHA 2V9QA 4S1DD 2GITB 1J88A 1NFDB 1KNOA 2YPLD 4MNHA 4PJGE 4Y4HD 3V5KB 5L2KB 2ADGB 1J0ZA 4KY1L 5BZWB 4NRZA 5HXMA 1GGYA 2MFNA 3GB7A 4JAMA 4MNQA 4LLMB 4U4BA 2C3WA 3DI3B 3BEVB 5FUOH 2FEDC 5EPMA 3DVGB 1CBVH 3OX8B 1S7VA 1GC1H 3I3EA 3VFWB 3SO3C 1F4WH 1RZ8A 2C1PA 2PN5A 5IESH 3OKDA 2QQKL 4YJZL 5KN5B 3LV3B 1HOCA 1P9MA 1KLGA 1S5HA 3KPOB 3CFDA 1T66C 1M7IA 5AZEL 1MLBB 3TO2A 3DYMA 4NWUH 2WP3T 5BJTA 4B50A 2Y6SD 1INDL 2YWZA 3D25A 4Z7OF 4Z0BH 4UBDD 4XC1H 3Q1SH 1JRHL 1Q0XH 2VISB 5DFVD 2IALA 3SE4A 4NO5B 3LH2H 4OZIF 1G6VK 4CVWA 3AC0A 4IJ3C 4OCXL 5TH2A 1CXLA 1AC0A 4DFHA 2DQDH 3SCMA 1KT2B 4LGSB 4CJ0A 4O9HH 3GMLB 3SQBA 1MSPA 4MXWH 3MCG1 3JWNC 3TIEB 1BEYH 1OY3B 3FQWB 4HPYL 4QNPE 3HHRB 3TVMD 1OGAB 2GW5A 2NXZD 5E2WL 4M7KH 5CEZH 1JZ4A 3MRDB 1NGPH 3EO1A 1JWMB 3B9EA 4QWWD 2QSTA 3O11B 1ETZB 3MRJA 1MRCH 3MBEB 4YXLL 5FK9A 5MP6L 5IJVB 3PWPB 4JO1H 1WQVT 4RGOL 3WLBB 2X4OA 4OBRA 2RIKA 3Q0HA 4ZTOH 2IG2L 4R7DB 1OARH 2BRRL 1X5HA 3ILPB 3MNZA 1AO7D 2DMBA 4R7NB 4MNGE 5DRXA 1XGPA 2CGRH 5KVFH 2IQAB 1INQA 4HV8B 3PHSA 1XF4A 3IAGC 3VXUB 4YBLB 3KYKL 1VFAB 1KCSH 2ZUXA 4M6ML 5F3HB 5K59E 4KTEH 2DQIH 1HH6B 5GRJH 4ZTPH 4Q9CA 4JRXE 1NPUA 1FSKC 3RQ3A 4GRLB 2AV7B 4KVCL 1FYHB 4E0RB 5LCVH 2E7CA 1X5KA 5HDQH 4R4FH 3HRZA 3GMMB 4NO3B 4KMTH 3GHEL 1LDPL 2UYLA 1MFCL 1KIPB 3DUUB 4FNLH 5F6HI 4AM0B 3LRGA 3QDMD 5F1IA 4WI3A 3JWOH 3BGMA 3FT2A 2DM7A 4PREB 1MHCA 5D2LB 1CT8A 2NXYB 3HZKA 5FHBH 4FQXB 5TE6H 1IGFH 2OQJA 3RDTD 3FJTA 3VI4F 2BFVL 1BP3B 3HE6B 4QXGL 4TOYL 2XQBL 2ZUUA 3OAYK 4IMKC 4JJ5A 3QA3A 5EUOE 4O02H 1HN1A 1XR8A 1PQZB 1T1ZA 3BUYB 4HBCL 4Q2ZB 1MFDL 4MAYD 5E9DA 3RI5K 2B0SH 5HDLA 1A6ZA 2DIBA 5IVZB 4UNUA 4WW1A 5DK2A 2AXJA 4N5UA 1IGML 4HUUB 3UDWC 4L3AA 3GM0A 1N5AB 1MI5E 3RVWD 3U6RB 3KVQA 3QEGH 1GL4B 4P5MB 4C56B 3FQXA 4TNVF 1PG7L 1L0QA 4YBLC 1D5ZB 3CVHB 2VXSH 5GGQL 2FL5A 1YEIH 3RHWK 2OJZL 4XP1H 4DGIH 4JO4L 4M7JH 5F9WB 3TV3L 4A6YB 1KG0A 2WWMD 1YPZF 1VCAA 3VU2A 3KLAA 4H26A 3ZYJA 1MELA 5EZJA 1C7SA 4JO3L 3QIWD 3UTSE 2QHRH 4ZQKA 3BOVA 3O2DL 3F58H 1NAML 1IC5L 5T1KA 1RZJH 1UA6L 2QJDA 3JV0A 3UX9B 4BZYA 2JCCE 3WXWH 1T6VN 2XNAA 1PGRB 2NXYC 1SJHA 1HHHB 3JXAA 3SDXB 4FQXC 2F5AL 2MQ3A 2OR7A 4XX1E 2VQ1A 5DVLA 1BFTA 2BSED 3IDMA 3HE6C 4I48A 4P23A 3ZTJH 1NLBL 4N68A 2J6EA 2J8HA 2BHZA 4ZOEA 1GOGA 4PJXA 3H7LA 3NTCH 4YWGL 5DJ0A 5J9PA 5FYLH 2CRZA 4PJBB 3WS6A 4H1LH 5DMYA 2J5LB 5HHNA 5AZ2H 4IRSB 3R1GL 4K94L 3QG6B 1D5BB 3QULA 1V7ML 1SJEB 3GUTA 4NQDE 1T3FB 3U46A 4HFUH 3HUJE 5C86A 1NFIA 1U8LB 5F9WC 1J0YA 2D7QA 1MCHA 5MHSE 1OLZA 2NX5A 2E5EA 3S88H 3LQAH 4BSJA 3CH1B 4G42A 4PTUB 2ZOLB 2V5YA 5DYOA 1FBIL 5C70A 5C09E 3QWOA 5T3XL 3D2UD 3UXFA 4JPKL 3E3QC 2JJSA 5C08D 1V8HA 1XH3B 3MODL 5FO7A 3ILQD 4GBXB 4N1CA 3PHOA 1U8JA 4WUKH 5MI0B 2HFEB 1WEJH 2FJGA 2HN7A 3MV9A 5DJXA 3U2SB 3LKOB 2H6PB 2EH7H 4JFDE 3K46A 4WFGE 1JHKH 4FQHA 5CSBA 3SE3C 1MY5A 3IXTA 1BD2E 5A3IC 2R0WH 1JGLL 1FL6A 4LHUD 1JMXA 4XZUA 3BD5A 4NFCA 3WKMH 3OR7A 2CK0L 4YHIA 5CGMA 1OGTB 4XPFL 4D0CA 1EVUA 2EEBA 3OGOE 4K8RD 4ODVH 5GJTH 5E6IB 2J5LC 5CFHA 4K8RL 1HI6A 1AGFB 2IBGA 4PV9A 5DHVA 3W82A 3KPSA 4HS8H 3S36L 4BQ6A 2VDLH 1CFVH 3MV7A 4J8RB 1IAKB 1UB6A 1NCCH 1BIHA 2AJZA 1OW0C 1DR9A 4OFDA 4MA7L 4H25B 3VXRA 3FB8A 4EN3A 3QWRA 5KVGH 1ZSDB 3OR6B 5DD5L 1JPSH 2PW2B 3ARFB 4M1DH 1MCJA 4K7FB 3U0TA 4JFXB 3QXDB 2XFXA 3OJDA 4M48L 4TNWK 5IEKA 2PCPB 4Q74A 1DE4B 1KJ2H 3VJ6A 3O2VH 3SDAD 4GKSB 4HUMB 3NABL 4CDGC 3V0WH 3RVVD 3TCLA 5IFHH 3LS5L 4F9LA 1VGEL 5TF0A 4YDJA 4GBXC 3RVXC 4MA3A 1WCBB 4OQTL 2FX9L 2WBJB 2XN9B 3ARXA 5JHDD 5E99L 4X7SH 1RJZB 1AD9B 1DQQB 3V9FA 1PZ5A 4V1DA 4NQEB 5I19L 5CEYA 4U0RB 2CXKA 1BBDH 4H0HB 4JRWA 4OD2A 1YJDC 2RBLA 2V7NB 2OL3A 4X9IA 3W0WB 1U42A 2OTPA 4NKIH 2DM2A 1PVHA 4CKVX 3BKYH 1HHGA 1AQDB 4M3KB 4C55A 2UWEB 5E6IC 3LIZL 2Z9TA 1U41A 3BP6A 3IAQA 3ARBB 4YDKL 1ZWIB 4GMTL 4R2GD 4YHPA 3P9LB 3GMPA 3U9UB 4NUGH 1RD6A 3ZHKA 4MSWB 3T0ED 5IFJA 3BWUC 3FFCD 3L7EA 4CAGA 2V6HA 4FZ8L 4HK3N 3WHXA 5JOFA 4ZXBA 4O51A 4L8DA 1FVDA 4HLZH 4R4ND 4XI5C 1I1YB 2DTSA 5ABDE 3MGTB 5EOQL 3AGVA 3QQ4A 1R5VB 2H2PC 3QDGE 5IHUH 3VFGH 3UEZA 2WBJC 2G2RA 2J8UE 5FYKE 4U6XA 2AJ3A 4HSQA 1AP2B 1QA9A 2H1PH 2OZ4A 4U0RC 3NIGE 2R8SH 4JN1L 3SOBL 1IZKA 4POUB 3HMXH 5ESAA 2OM5A 2XYCA 4YHLH 2VXTH 3OKLA 2C7UB 3HZYA 1MCCA 4X4YA 1BVLA 3KNBB 5J89A 3K8LA 3KR3L 4U05A 1P4BH 3WE6A 4MDJA 2AI0L 2DD8H 4ZO7A 4FP8L 1YQVL 3CDGB 1QRND 3M07A 3WL9A 3ULUH 1UJTA 2YUXA 2BVOB 4OFVA 3O2WL 3PGDA 1KENH 1KLUA 5TQ2L 3T77B 4NQXA 4N0UA 1RJLA 4HWBA 5E1HB 4LKCA 1I7RA 1JUFA 3V4VL 4AJ0A 3ZYZA 1TENA 3SDDA 4ZSOA 3X3GH 1CQKA 4E9LA 4PJ5E 4TUKH 1N4XH 3VA6A 3ABZA 4ZUVB 4AEIH 1IM3A 3W2DH 3EDJA 5T1MA 1RZGA 5IMMB 3B3IA 4HK0A 2R9HD 2VJXA 3EJYD 4GQ9L 1BWMA 4NWTL 2XZCL 5IV2A 3IKCA 1AE6H 3BMVA 2KL6A 1DQLH 3B9AA 4H1LB 4P9HH 1YN6B 1OB1B 1DUYA 3RL1A 5D1ZB 3V6ZA 1T22B 2ZG2A 4HJGA 5F9OH 3WDHA 4CL7A 5GS0H 3EDKA 4PTTB 1FGVL 4U6YA 1A21A 3V4UL 2XQYK 3MJ7B 5EC1B 3EHBC 4HWZB 3T4AB 2Z91B 3K2UL 2IAMA 5HYSA 3B2UD 4UB0H 3S37H 4LAQL 1H3UA 1S9XB 1RZJC 4HPOH 2BDNL 2NY0D 2YPLA 4Y4HA 1J11A 3DGGA 1VA9A 2FDBP 4KROD 2VWEC 1CXEA 1T89C 1F3DJ 2VRAA 4LSQL 1YEFH 5BVPH 2I07B 4PJEF 5JW5A 1RIHH 3QUYB 3LAFA 1OAKH 1HSBA 1JVKA 3BWAB 5ESQB 2VE6A 3MRCA 2J4WH 3VFUA 3PL6A 1SYVB 3G04B 4R96B 3P4LA 2VB5A 4RMSA 4HKZA 5IB4A 5IBUG 5IMKA 3ARGB 3GMNB 2EEDA 3SHSA 1DL7H 2H32A 3QUMH 4NQVA 4IS6A 4P2QB 5GGRB 2AK4B 4JR9H 5TDOA 1Q38A 4LQFH 2EDOA 2X70A 4LLQB 4Y16D 3CX5J 4CW1A 4WTXA 2VLRD 1F58H 1I3GL 2AW2A 5D1ZC 3TM6A 4CN6A 3PWNA 2P24B 1S3KH 4PFEA 4HIJB 1FZOB 4U1HB 1XCQB 1TCRA 3D48R 1O7VA 4X6BB 3RNQB 5CIPH 5C0GB 1A7BA 4I0KA 4GW4B 1ZANH 4LNRB 3MMEB 4QTHA 4D0DA 1KJ2B 3TVMA 3H3BC 3IGAB 5DJZB 3V0AC 1KXTB 4Y5VC 4ELKA 2Z31D 4WW2B 1KFAL 3QXAB 3V0VA 1ZHBB 3VGFA 2FD6H 4JFEB 1S7UA 1NMAH 3OKMA 1MRFH 4U1LB 3VXPB 4EI5D 4CRPA 3S98A 5BS0B 3MCKA 3IDJB 1N6UA 1PYWA 3ARWA 1X3DA 4PRPD 3N06B 4XCFH 4D0BA 5KVDH 3QUYC 1HQRA 4D9QD 3ZE1E 1RK1A 2PXYB 1BECA 1ZKAA 1BVKB 4OV5B 3TJEL 2AERT 3DI2B 1RZKC 5GGVH 1AO7A 2CDEA 5CILH 1E4XL 3RY6C 4XCCH 1UCBL 2NPLX 5F7DA 3S34L 3HC3L 1S7QA 4P3DB 4DKAA 4YBQD 3PP4H 3TLRA 2E7BA 4KY1H 1KTKE 3THML 3B9KD 4KGLA 3GK8H 3VXMB 1DN0B 4QY8A 1KELH 4KQ3L 2V5TA 4PJ9B 1FP5A 1HILB 4JGMA 3U0WL 1S8DB 3M1BB 2K3TA 1B3JA 4ZFGL 5DFWH 1YA5A 4LLDA 4UOW1 4ZOBA 1GRWA 2DJSA 5J6GA 1E6OL 1WUNT 2FECL 2EKSB 1FFOA 2PO6C 4MD5A 4QHKI 3RGVB 5D7LD 2Q87A 5AZEH 1VFUA 4WW2C 1INDH 4HKBB 1KCLA 2X4SA 3VFNA 4OCRL 2YSSB 1CIUA 2H3NA 3OXRB 3QDMA 4QHUA 1AGBB 1JRHH 1WLHA 3O3DB 2EDWA 4PY7B 4L3EB 1QLRB 3PIQA 2EYRB 2F19L 2OXGA 4GKZB 4OCXH 4S1RL 1FZKB 1WF5A 3RDTA 2QHLA 5TF1L 4BZ2L 3CXDL 4ZNEA 5K9KB 1EPFA 2NCMA 2PXYC 4LLYA 4GW5B 3TWCH 2ED7A 3QISA 4KRPC 3P4OA 3CFCL 4HPYH 3DBXB 1R3HB 4MAYA 1BZ7A 4XCYB 1DDHB 1X4YA 4RX4D 1FNEB 4G9FE 3GBMH 1L9NA 5T1DH 4EJ1C 4QRUA 1G7HB 5C9KA 3IETA 3O8XD 4R3SA 5LKNA 4EXPX 1LO5A 4HEPG 1CLOL 5I16A 1W0YT 4YXLH 1MHEB 3BSZL 5MP6H 2UY7A 5MEQB 1TVBA 4S2SB 2HAZA 4RGOH 4P46B 3H9SE 5HYJE 1WFOA 2BRRH 3Q6FB 5ANMB 1RZFL 3V5HA 5E8EA 4LSPH 1N3NA 1EO5A 2HLFC 1CGSL 3QIWA 2BVQA 1NH6A 3RGVC 4BA8A 3MZGB 4HJJL 2CLVB 1VKXA 3U7AA 1OP3H 4EXKA 2PTVA 4YDLB 1JPGB 5CD3B 3ARDD 1QO3A 5FGCE 4UDUB 2NY3D 3GDBA 3KYKH 2VL5B 4M6MH 4HKXA 3TGXA 2Q7NA 4GW1B 5D9SA 4LPUA 4YEFA 4AQ1B 1GVIA 4Z7VF 1LO2L 3JWDL 3OKKB 5D4QA 3TZVB 1EEYA 3FO9B 3NZ8A 3PP3K 2GUOB 5DURD 3PGFL 1G84A 2UY6A 1Q1JL 4OCYL 4J3SA 3M45A 1UYWH 1KV3A 4XHJD 4KVCH 1T7ZA 4EIGB 5FB8B 4M7LT 3L3DA 4ONHB 1JFQL 4BFEA 2D3VA 3LS4L 3SN6N 4PJHE 3BDYL 1LK3L 1MCNA 4CU7A 1LDPH 4ZO6A 1MFCH 3GSVB 3TH2T 1JV5A 4TYUA 1OWWA 5FO9A 3M17A 1V7NL 5C0BD 3O9WD 3IS1X 1FPTL 5I1IL 3A6BH 2X4UB 2A73B 3DX9B 4P46C 2BFVH 1LE5B 4QXGH 4TOYH 2XQBH 3FFDA 4P4KB 1WFNA 4GAGL 4X83A 3L7FA 1H3TA 3FCTA 2ICWJ 4HBCH 4KGJA 1MFDH 4MS8C 2YD9A 4WI5A 3QBTB 3FOMB 1HK6A 1EAPB 1IGMH 2X4RA 3OQ3B 5EOTB 1OCWH 5C6PB 1Z6JT 2XTJB 3D2UA 2GK2A 4PRNA 1LO0L 5C08A 1X6LA 2E6JA 2UUDK 4YH6A 1XGRA 5GGQH 4Z5RB 4YR6B 5LGJA 2OJZH 2O5YH 4JO4H 4P9HC 3PDOA 1VFBA 4O5LL 5ENWA 1KJ3L 1QP1A 3P4NA 2WLZA 3N0PB 4YIQA 1WZLA 4AG4L 3QIBB 4F7EA 3C5ZB 3F12A 1NEZA 4MVBC 3PWJB 4JO3H 3BGFB 2DWEB 3HZMA 1RURH 4K7PH 1NQBA 4X6EA 5HDBE 3O2DH 5GS0C 2PYFA 4LHUA 2XG4A 1CDGA 1NAMH 1VEPA 5E2VL 3MV8E 2H41A 4HUNB 3RTQB 5EG6C 4LMQE 3HAEA 1UH4A 2Q86B 4PJCE 2WNGA 4PJ8B 4G6AD 1TZHB 2GJ6B 1IVLA 5I1HL 5DZLA 2R1WB 4P4KC 3QUXD 4HCRH 1NLBH 3SJVB 3S96A 2VNCA 4YGVA 4QNPF 4YWGH 3CSYA 1HKFA 5F9DC 4U2YA 1A7QL 1K4DB 4ODXB 1XR9B 4K3HA 2XTJC 1U8QB 3R1GH 4K94H 2VR9A 1V7MH 3O45A 2DQCL 1F3JA 1EA9C 4HIHA 1FZMB 5B38G 3G5XB 3RZCB 1YN7B 4Y88A 5I71B 1A1MA 1R5WA 1H0DA 5I2IA 4AL8L 3C5ZC 3BGFC 3VXSE 5IB2A 3EDDA 5B39B 5HYFA 1QACA 2VTFA 3VXNB 1T83C 2OP4L 5T3XH 1TVDA 1FVEA 2KBGA 4F2MB 2K7PA 4Z77B 2VLKB 2Y5TA 5DUBB 3U4EB 5DMKB 4NO2B 3MOAL 1OSPL 4PJ8C 2Y1VA 5K59F 2GCYA 1N6VA 2A9NL 5HVGB 3V7AG 4FFYL 4NKDB 1V3JA 1YY9C 5DHYA 4FFZL 1NFDE 4JM2B 4YQXL 5MEOB 5L2KE 3UTZA 5TGBB 3MJ8B 4P3CL 2IJ0C 3BAEL 2Q8AL 4FQPA 2NY1D 4J23A 2ADFL 2CK0H 4XPFH 2DBLL 3CC5A 2QQLL 3UBXA 5LXGL 3CFJB 2BNRB 2FYYB 4GXVL 1G7PB 1RK0B 3S36H 1JGEB 4FXKA 2KZ1B 3HI6L 2J8OA 2FRGP 4XTRD 3RZCC 4S0TD 4BK4A 4Y5XC 5I71C 5AYQA 2W0LA 4MA7H 4MQ7B 2Q8BH 1QG3A 5DVMA 4G80A 5I8EA 3AUVA 4D9RE 5EUOF 5DD5H 4KV5E 2FZ3B 3IJYB 3HZVA 1I8KB 4NT6A 3QNXB 2YBRB 3U7WL 3TNNB 1T03L 4I18C 1BREA 4H0GA 3L5IA 4P5TA 1FE8L 3NABH 1GGIL 3DYPA 3GRWL 3P30L 4ZG1A 3LS5H 1U36A 4H8WL 1MFBL 1OSZB 5FKPA 5ICYA 1VGEH 3O4OB 1MUJB 4JY5H 3QZWB 3UTQA 1X4ZA 3BHBA 3AY4A 5FA4B 4YAQA 1IEBB 1QRNA 4OQTH 5HGBA 3G5VA 1OTUD 3MLUL 2YPKA 3VFPA 4HAFA 1OGAE 2VC2H 1JZ7A 3VGAB 4BUHA 5I19H 3WFBL 4QXUL 4QYOA 4X7FC 1F42A 3C60B 4JM2C 4WEMB 5J1AA 1CXIA 2LVEA 2R2HB 3JUZA 1M71A 1Y6KR 4ZAKD 1CTOA 5DJCA 3WJLC 1EO8L 2HT2C 2AJUL 2VDML 4DQOL 5ALBL 3QDJD 2EIDA 3PWPE 2F5BL 1SEQL 2YPVH 4YXHL 2D31A 4WENB 5T33L 3LIZH 1ZLSL 4AMKL 2JCCF 4P2OB 1RZIA 4JRXD 5CSGA 2BVTA 1Q94A 2GTZB 4OZIB 3ECBB 4HH9B 4PRIB 5DQDL 2A74A 1LEIB 1GZPA 5KANI 5LGKA 5GGVY 1LP9B 2ZWLT 1OWRM 2EDJA 3VXUE 4FZ8H 3RWDA 1NBZA 1G7IA 3WFCL 1J8HD 3NFNA 3ZTJG 1Q8MA 4J6RL 4KPHL 3O4OC 1IAIM 3FO0H 5CJOL 1AY1L 4RRPA 1NEUA 5D7IA 4JQXA 3DX8B 3EGSB 4HF5H 3HUJF 5IFAL 4AENB 4NNYB 4H1LG 2X09A 5AAMA 2CRMA 5A2KH 3GBNH 5TJWK 3QRGL 3FRUB 3VGAC 4EQ3A 3B5TA 3S9DB 5DSCB 2AXGA 4JN1H 1JZ6A 2YZ1A 2J7LA 3MC0A 1LD9B 5D2LE 1WITA 2XWBA 3IVKA 3LD8B 3ULSB 2E27L 5DI8B 3ARED 4KI5D 3KR3H 2V2XA 1F11B 2AI0H 1T20A 5GQBA 4FP8H 1YQVH 1CGTA 3BPCB 1T04B 1P7QB 3VI3E 1EK3A 3O2WH 3FQTA 3RWHA 4M1CC 5TQ2H 4WO4B 5F3BB 3SQOH 1ZMYA 3F7YA 4Y8DC 2P46B 5A16A 3V4VH 3QO1B 4Y16A 3LKPB 3ZKMC 2VLRA 1SHMA 4C56E 2OJEA 3IFOA 4WDIA 1S7SA 5F7EL 2BNUA 2EIZA 1F13A 5JIIA 5D2NA 3BRGC 4HULB 3SGJA 1GGCL 1ZOXA 2IF7A 4EI6A 1I8IB 4GQ9H 4XGZB 4NWTH 3W9DB 1ONQA 4OJFL 1I9EA 1C08B 2XZCH 5L8KB 4LCYB 3WIHL 4OFPA 2VQUA 1KSRA 3T2QA 1OAXH 3D3VA 1RMFH 2JJTC 1HDMA 1MCDA 4LU5L 2Z31A 3JV4B 3F5WB 2IPTL 1U93B 4I13B 1GSMA 2CLRA 1HYSC 3WD5L 3E3QE 3INUL 4PJ7B 4EI5A 2Z4QA 5IW6A 2FLRT 1C7TA 1NCUA 1BAFL 4S1SH 3TA3B 2PW1A 4RNRB 4NQDD 3SDXE 5D96B 3V4UH 3LD8C 5F6HJ 3IDIB 2QSQA 3U4BH 4ISVB 3VFRB 3HG1B 3UMTA 1VACA 2D03L 4Y4FC 1TPXB 1R6VA 3RU8L 3KXFB 4IHOA 4HUKB 4U1SB 3BIKB 4R0LB 4RAUA 2I9TA 4WO4C 3WDJA 2BDNH 3DJ9A 3BH8A 3IU4L 4PJBE 5INDB 3TNMA 2Z8VC 3B9KA 5C09D 4ETYA 4Y8AA 4LSQH 5SV3A 5C7XH 1LK2A 3MLYL 4IDJL 2CKBL 3UAJD 1U58A 1R24B 2W60A 1KOAA 3KPNB 2QADD 3R0NA 4NQSB 5GGTL 4M62L 5C0DA 5C1MB 4HIEB 1KCVL 3GMOB 4Q6IA 5KANG 4PRAB 1WBZB 4JFDD 2X9XA 1XGUA 4WFGD 5IR1B 1Z9MA 1C5BL 2VABA 1NGQL 4W6YB 4I3RL 1UQSB 1ADQA 1AGCA 3K8KA 5D7LA 4BK5A 2XXMB 3CZFB 2F15A 1QD0A 3LKNB 2D9QB 3AAZB 3L3OA 1XF3A 2ICEB 4JFOA 4QF1B 5DRNB 2R1YA 2VDQH 3L3JA 2W65A 1G0DA 4P2YA 2WWKT 4DGYL 2AJSL 4P59L 4F9PC 3TA3C 1QBLH 3CCHB 1P6FA 4MD0B 3OGCA 5D96C 3VFMA 5KTEL 3REWB 2R23B 1ORQA 2DQJH 3FONA 5JW3H 1LEKB 1TPXC 4HDIB 2QQQA 4PJIA 4MLSA 2J8UF 3ZKND 4R0LC 4RX4A 5DJ8A 1KFAH 4HLZG 4Z6AT 4NQCB 1YC8A 4MJIB 4RQQB 3STZA 4M61A 5C0FB 3O8XA 3GNML 3NIGF 2XPGB 3L3IB 3P40A 4Q58C 3EYFA 2XZQH 3IXAA 3OKOA 3S5LB 1MJJB 1G9ML 2DI7A 5CEZE 2I5YL 3VD4A 2X4QB 3NN8B 4PGDB 2Z92B 4KC3B 5L88L 4JM4L 4TULL 5CSZA 1BX2B 1UCBH 4L5FH 5E8NB 5M7QA 4HUVA 8CGTA 3CSPA 3I2CL 3HC3H 3QSKB 4R26L 3GMQB 1I8LC 1G9NL 4CVXA 1IM9B 5K93A 3KLHD 3ARDA 5DQJA 3JTSA 3U9PL 3BJLA 3MUY1 5HJ3B 2MQCA 1VERA 2HJLB 5DDHA 2XN9E 1HHIB 1WBXA 3V7AE 2EDYA 1ZV5A 4ZFGH 2DKSA 4M02A 2JJVA 3QPXH 3MUGB 4NQEE 5DK0A 3RJQB 4FQ2L 4ZD3L 1HCFX 1B0GA 4PBVC 2BJML 1FDLL 4IOSD 3GSXA 2M26A 5HHMD 2Q1EA 3RWGB 1W8OA 3W0WE 2X4PB 2D7OA 4YPJA 5IQ7L 3WIIL