1U8MB

Crystal structure of the hiv-1 cross neutralizing monoclonal antibody 2f5 in complex with gp41 peptide eldkyas
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
235
structure length
227
Chain Sequence
RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWLAIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHRRGPTTLFGVPIARGPVNAMDVWGQGITVTISSTSTKGPSVFPLAPGAAAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLQTYTCNVNHKPSNTKVDKRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords ANTIBODY 2F5 (LIGHT CHAIN)
publication title Crystallographic definition of the epitope promiscuity of the broadly neutralizing anti-human immunodeficiency virus type 1 antibody 2F5: vaccine design implications
pubmed doi rcsb
total genus 38
structure length 227
sequence length 235
ec nomenclature
pdb deposition date 2004-08-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u8mB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u8mB01
3FQRA 2AXFB 1INDL 4X80L 5KVEL 5JIPA 1NDGA 3P0VL 1E4WH 1YPZE 5C0CE 4Y2DC 1E4KA 5HHQB 1C08B 3O6LH 3QCTL 4YHYC 5E2UL 4F7TA 5BJTB 4IM8A 4OZFA 3T2NH 1FFPA 5MEND 3LEYH 5EZJA 5C0JB 2YRPA 3RU8H 3MXWL 4S1RL 4NO5A 3WKML 4JEGB 2GJZA 3X12A 3MTRA 1ITBB 5DJ6A 1MHHB 5IMKB 3MV7D 2JJSC 4XCFH 1ZGLA 5C6PB 4I2XB 1DLHA 4MNQB 4OM1L 4XVTL 4HPOL 1UFUA 1YNKH 2RR3A 2R0LH 2Z93A 3SKOA 4YXHH 3VXUD 1QZ1A 1OHQA 1VDGA 1SM3H 3HS0A 4DN3L 4PUBL 4S1QH 3LEVH 4NYLA 1T7WA 3RX5A 4P2CG 3TH2T 2DLFL 1MJUH 4FTVA 5CJXC 1SYSB 5I1AA 4FZ8L 4L8DA 3L6FB 1R5WB 2HKFL 1DANT 2NR6C 2P24B 1JHKH 1WF5A 4QRQA 1F4XH 3RY4A 3T3MF 4PRIB 3S36X 4MJID 5CBEA 5C07B 1BBJB 4LCYB 4Y2DA 3EYVB 3D25A 4RGMB 1KPUA 2J6EH 4PJ5B 5F70A 3QIBD 5HGGS 2R29L 4S2SB 4GXVH 1AO7E 5IW6B 4JFXA 5C8JB 3FOMA 1FJ1B 3LPFA 4F58L 3KPMA 2IMNA 2JJSA 4ZPVB 3IFNL 3GMLA 5I8EA 3C9NA 2P49B 2DQDL 4ZUWA 2QQLH 2A6DA 1EO7A 1H3XA 1TNMA 3TJHC 4HCRA 5DS8A 1X7QA 1G7QA 1FYTD 1A6WH 5SX5K 4NDMA 1YZZA 4NQCE 2Q8AL 5T5NG 1ONQB 3QXVA 3OTTA 5IW3A 4MD5A 1H5BA 1JNHB 4JB9L 5L2KB 4LP5A 1IE5A 3GRWA 3VWKD 4YAQB 1G1CA 1NCBL 5DMIL 3GFUA 4M7LL 2WBWB 2I25N 4JGUA 5CJXA 4JFFA 3WNLA 4QXGL 4X8JB 1NCWH 2AK4A 3MRNB 3BP6B 2DN7A 4HH9A 4QYOB 1KPRB 3VXMD 1E6OH 5I17B 1IGIL 2ADJB 3T3PF 3KXFB 4I0KA 2C3GA 3T65A 4L8BB 5ICZA 3EOAA 4P2OD 4ERSH 5I1GL 4TRPH 3T0EB 5J0BA 1BD2E 4CU6A 5IGXL 4MQ7A 5KANG 4FNLH 4PRHD 2VSCA 4KHTL 5HI3C 3UMTA 3N1MC 2PYEA 3K46A 1XMWA 4F7MB 1GL4B 5F7EL 4QKXB 5AWNH 3ZYIA 2WV3A 1URLA 4XNMA 5B38G 1CG9A 3OB0K 4LPUA 3P4NB 1QSED 1ZXQA 4N5UA 3U4BL 4CN4A 1RJYA 3LEXA 3QUZD 4MHHI 3WDIA 3VFSB 1RU9H 4XPAH 1IMHC 1FZKA 1HH6B 4G6KL 4XI5C 3IB4A 4X98B 3MBXH 4XP5H 3T2OA 3JV6A 3DXAA 4RZCB 3KLAA 4OFYA 1F11B 1XR9B 2OBGA 1JYWA 1Z3GL 2V2WA 1KJVA 1VFOA 2FJFA 3SJVE 3EZJB 1LK3L 1OGAB 4WGVB 5TH2B 4KJPD 3FOLB 1DP0A 2JCCE 3CFDA 5IROC 3D2UD 1I75A 2Y6SD 3NFPA 1OF2B 4H8WL 2QSCL 4OM0L 5T1MA 1AP2A 5FF6A 1FZJA 1NFIB 2O26U 3MREB 2JB6B 1AJ7H 2ZNWA 4GOSA 4NGHL 4G6JH 1S5HB 2OTWA 3TBWB 1IGMH 3MNVA 3HE6C 3OAYH 4GG6F 3JWOL 1RFDL 3MV7E 1OLZA 1N5YL 2BDNL 1JWMA 5C08A 4GAYA 5I0DA 2YD9A 2YMXL 3ARWA 3EHBC 1QRNB 3MRBA 3GI9H 1T03L 1W2KT 1CXIA 3MLWH 4IJ3B 3FQTA 1W0VA 1J9CT 4HKBB 3JTTA 2LAAA 5GRVK 5GGRB 5I71B 1YPZA 4S11A 4M6NH 2XNAB 2C4XA 3NZ8A 2AJSH 2WMPA 4I0CC 1BFOA 1CCZA 1KC5H 1E4JA 5BV7H 4BQ8A 3LCYA 1F90L 3OKMA 5JHLH 4AEHL 3ZKQD 5IROA 2B1AL 3K1DA 4MJIE 3MRJA 2NX5B 4YQXL 1ZE3C 5K9OA 3GMOA 4U6VL 2E8ZA 2LTQB 3HPJA 3ULUD 3UROR 1RUPH 3LKQB 1WQVT 1UH3A 2VAJA 1J0IA 5I74B 3BZFB 3RPKA 4PRIE 1WFNA 2QBWA 4HGWA 1T22A 2E6QA 2KPNA 3HE6A 1UB6A 4G8GB 3T4AA 4IDLA 3WIHH 3IAPA 2FEDC 4OV6F 1VENA 2P7TA 4K7PX 4G42A 4YDVB 2ICWA 5DUPH 3L5WA 4QNPF 4PJ5E 1MCBA 2GSGB 3FONB 4RDQG 5D7LB 3EO0A 3OKDB 4LPTA 5HYJD 5E00A 3AFLA 5E2TL 5IVXE 3PG2A 1Y0LA 1QR1B 1VSCA 1HEZA 1FAIH 3ZDZF 3CDGA 5C92A 3HG1D 1DBKL 5E9DD 3OAZK 1Q9LB 1DBBH 2YBRA 5B38B 4PS4L 1A3RL 2IALA 4F9PC 5EU4A 5FYJL 4MHHG 4PP2A 1RUQL 4LSRL 1YN7B 2Z0BA 1FG2A 3UC0L 3X13A 3D0LA 1F3JA 2OQJB 2VDML 5DR5L 1H3VA 2YPKB 4IRZH 5JDSB 3B9EA 3MLYL 4BYHA 5IW1B 4XWOD 5FEBA 3U9UA 3ULUH 5C0BD 3W9DA 2XFXA 2PR4H 5IHZB 1INQB 4PRHE 1AI1L 4GQ9H 3QFJB 3P11L 5ILTH 2NXZC 5JW3L 2A6KA 3MZTA 4I0PD 4UUJB 2EIDA 2FIRT 3CFKB 4OLZL 4WDIA 5F9WC 1A6VH 4LIQH 4JZOB 1XH3B 2X05A 1INDH 1AQKL 4X80H 2VR4A 5KVEH 4HWNA 1RURL 3P0VH 1MHEA 3O8XA 2EE3A 3AU1B 5CP3A 4ZDHA 3L3HB 3QCTH 4E5XB 1CFQA 5E2UH 1MH5B 4HAGA 1R3KA 2IH1B 2IPKB 3PHOA 5BQ7A 3IFPA 5LVEA 1FNHA 3MXWH 4S1RH 4ONFL 3QXDB 1VEOA 1E6JL 3WKMH 4JQVA 2CIIB 3FFDB 1BD2A 1I7TA 5EZIL 3DTXB 5ETUB 3S7GA 4DKDC 1YNTB 3FN3A 5L0QB 4FQJL 4U1GB 2C1PB 2CD0A 4B53A 4OM1H 2W60B 4UILL 4OAWB 4XVTH 4HPOH 4YHZL 1NAML 4U0RC 4U2YA 2VXUL 2Q6WB 4Z7WA 5ID1A 5KSAB 3CMOL 4RNRA 4G3YL 4YO0B 4DN3H 4PUBH 2NW2A 1U8HA 3NH7L 5FO8B 2BSRB 4WO4D 4MXVF 1MJ7L 2HN7A 4O4YL 1E28A 2Q7NA 3WUWA 2DLFH 4I18B 3VFOA 2AJZA 2DM3A 4RMTA 4FZ8H 2APXA 4WW2B 1RK0B 3FB7B 3RDTB 2HKFH 1JBJA 4M48L 3V6ZB 3DOSA 5J7CC 2BNUA 5HJ3A 1LHZA 1P4LB 4H0IA 4JPWL 1D9KB 5D7IE 2BRRL 4LPYA 1ZEAL 4KWUA 3SJVA 3VI3F 3B2UD 4S1DD 5T5NF 2JCCA 4KK6D 3DETC 2YA0A 3QWRD 5EOTB 3CDCA 4WI5A 2R29H 4PJDF 3O41A 3K1KC 2ZZUT 2GFBB 4HMEA 1R3JB 2J6EA 2OR9L 4ONHB 5ICXB 4KI5F 5FK9A 4F58H 1XR8A 2HRLA 3IFNH 3TZVD 3MLPA 5D72L 1XCTA 2E7MA 3FQUA 4OZGE 3LKSB 2DQDH 4PRBA 4FFVC 1ORSA 2AXFA 3QDJB 1WFTA 1LEIB 5HHQA 1JIBA 3MV7A 2Q8AH 3OAYK 3OKOB 1DQJA 1IILE 3VMPA 1MHCB 4JB9H 1BZ7B 2CGRL 3PQYD 4PB0L 1NCBH 5DMIH 1BVZA 3DX9A 3ULUE 4M7LH 3VH8G 5ACZB 3CK0L 1MHHA 1NGXB 1UYWL 4QXGH 3FRPG 1CYGA 4LIQE 2VLKB 1HYRC 1IGIH 4HF5L 5DJ8A 2HH0L 1IAKB 2NY2B 1EAPB 3IXTB 3FKUS 5I1GH 5EU3A 3AMLA 1JMXA 5EUOB 3KPQB 4OGAC 2P42B 5IGXH 1EBAA 5HYJE 1RZGB 4WUUB 3NCMA 4QXUL 3T04D 1RQ5A 3UJJL 3HUJB 4P2OC 4KHTH 2R15A 1QBAA 2YOCA 5HYEA 2FBJL 2P24A 3B3IB 5F7EH 1FVEB 3MPCA 4P2QE 5F9OL 2BC4B 4LLAA 4PRIA 5LBSL 3CPLA 2XOTA 4WI4A 5C07A 3B5GA 3U4BH 5E2VL 1OGTB 3SDDC 3IDGB 2EDTA 2HJFA 4FG6D 3QHFL 3RTQD 1EUTA 4JZNB 4DUVA 4YFLF 5IOPB 3H42L 4PJ5A 3L7EB 4NSKA 4G6KH 5A2KH 1FFQA 4RIRA 4S2SA 3RI5K 4D9LL 5A1AA 5IVXA 5C8JA 1FJ1A 4WENB 4B0MM 4ZPVA 15C8L 3LD8C 1PQZB 3T4YB 5DD0L 1BIIB 2DKSA 4DW2L 2VDQL 2AERT 3ZT6A 1MCWM 1LK3H 3WIFB 4AEFA 3QBTB 5BV7C 4H8WH 2QSCH 4XNZC 4OM0H 5DA0B 4X6FB 3ESVF 3ARDD 1PDKA 4NGHH 3R0MA 4BH8A 5L2KA 3CJJA 3QFJE 4HZLB 4JRXD 2CLZB 4CRPA 2V6HA 4GRWB 4N8VG 1IAIM 5F7LB 1P53A 5E0QA 3MJ7A 3MRNA 3BP6A 3JWOH 1RFDH 3C6LB 4LBEB 1N5YH 1J8HD 2BDNH 1BWWA 4JFED 2YN5A 4KKBC 2YMXH 4L8BA 2OSLB 5T3XL 3SDDA 1JL8A 3T0EA 4L1HA 1T03H 1L9MA 2FHBA 4M1CD 5EWIL 3ZL4L 1A7PL 4KQ3L 3DGGB 2D3VA 1UADC 1S7TA 4JZJB 1S7SA 5F7FA 4I3SL 3NIDF 1BZ9A 1P5VA 4OLWL 5FYJD 4EXKA 4F7MA 2IFGA 1AQDB 4LVOC 4PJCF 1F90H 4MGXA 3P4NA 2QHRL 3BAEL 2W65A 5FCUL 4Y4KB 5C9KA 4AEHH 3Q2CA 4OT1L 4M5YL 1YA5A 4R7NB 3VW3L 1QSZA 2B1AH 3O45B 5HHVL 4YQXH 1LMKA 3VFSA 1A7OL 2BVPB 4B5EA 4U6VH 3ZTJH 3LAFA 4NBZB 4YHKL 3EUUA 2YWZA 1RULL 4ENED 4HG4K 1NPUA 3FQWB 2NY3C 3GSWB 2YSSA 3QJFB 1F11A 1XR9A 2YPLD 1WC7A 1NKRA 2BSSA 3S37X 3RGVB 3ULUC 2I9LA 1CFNA 5TH2A 4C4KO 3FOLA 4MAYB 2GEEA 1FNSL 4RWYL 5D5ME 5E2TH 3DV6B 3MREA 3V95A 3ZE0E 2DBJA 4QHLB 3B9DA 2EYRB 4Y19E 1DBKH 1FG9C 1S5HA 1VFAB 2H9GB 4NCC1 5D7IA 4KY1L 3JBG7 4ISVB 5EUOF 4NN7B 4OBSA 1FNEA 4PJAF 5J13C 1A3RH 3DUSA 5IB1A 3VD3A 2H41A 8FABA 5FYJH 3P9LA 1U0QA 1RUQH 2RIKA 4LSRH 4N8CL 4JRWA 4TSAL 1QRNA 3FAXA 3UC0H 4OZGA 3QCUL 2VDMH 5DR5H 5C86A 1K4CA 4P46D 1GIGL 3MLYH 3ALWA 1A8JH 2L0DA 3E6HB 1ROWA 2VNCA 2GI7A 4ODHL 1AI1H 2NCMA 3P11H 3LN5B 5JW3H 2X70B 2GK0B 3ZHLA 1LE9B 3VG9C 3G5YA 4OLZH 1F6AB 1JNNL 4XWOC 4PGEB 5CZKA 1AQKH 4HKJB 4Z77A 3HNVL 1RURH 4WUUE 2N7AA 5JHDD 5D1ZB 5FXCH 1MLBB 2NX5A 1T1WB 1D3CA 4Z6AT 3RY5A 2HVJA 43C9B 4I0PC 3TNMB 4ONFH 1E6JH 2ARJQ 3UJIL 3KJ4C 1MHPL 5EZIH 1UM5L 2DYPB 5HYJA 4G8GA 4FQJH 4BJLA 4GRWF 3IT8D 3QIUB 4UILH 4HKZA 4YDVA 4OB5L 2UUDK 3O6FD 4HIHB 4Y5XB 1NAMH 4YHZH 5DJZB 3RKDC 2VXUH 1CT8A 2GSGA 3FONA 2M26A 2UWEE 3CMOH 4G3YH 2ZG1A 2V5SA 2WAHA 2WBJB 2XI9A 3JSSA 3KS0J 4YDJB 4P2QA 1FL5A 3A67L 1S7VB 1QR1A 3BN3B 3NH7H 4CW1B 1CWVA 4UT6L 5BVJB 3VMOA 1MJ7H 4O4YH 2YD1A 1Q9LA 3FO9B 2EKSB 3SE4A 3RNKB 3JVGA 3GGWB 4AIOA 4M48H 5MHSE 4WO4C 4OLVL 2YWYA 2I26N 2PYFB 2ZPKL 1BQLL 1RAMA 3SDXB 2OI9B 5CJ8A 4WI7A 1WBXA 3MV9B 4JPWH 4W70A 1DQLL 2RFXB 2BRRH 3GMQB 2Q87A 4I1NB 1ZEAH 2OQJA 5IKCA 2YPKA 2XKNA 1TQCB 5FGBC 5JDSA 5E4IA 5IW1A 4A6YB 3B9KB 2OR9H 2K3TA 4FQCL 4R8WL 3B2UC 3QFJA 4IRJB 5D72H 5FYJE 4UUJA 3CFKA 1YMMB 3DV4B 1XH3A 2NPLX 4HAFA 3TT1L 3RFZC 2GHWB 2FECI 1RZ7L 2R2EB 5F21B 3L3HA 3TYFB 4C56B 3TZVC 1MH5A 1EEQA 5KSBB 4OQ1A 2IH1A 2IPKA 2MTPA 4KC3B 4BSWB 4KK9C 1QFWM 2CGRH 4QY8A 5C09B 3PV7A 2VZUA 4PB0H 3D39B 5BZDB 1IAII 1MCFA 2CIIA 4LCUB 4UNVA 1RMFL 3CK0H 2MKWA 3FFDA 4XXCC 3DTXA 5ETUA 1UYWH 3MNZA 4NO3A 4X4ZA 5I6XC 5I1DB 2VR5A 2IAMD 4P5TC 5F7WC 4HF5H 3LVEA 4OLXL 2HH0H 3S4SG 1MUJB 4EZMA 1LK2A 1LO5B 4D0BB 3DVGB 4Q9QL 1MFBL 5C1MB 4P2YA 4TSCL 2HG5A 5HYQB 3ARFB 4H8WC 1OTTD 1H0DA 4UT7L 5JQHC 2GKIA 3HCVB 4ODTL 4UI2A 4QXUH 3GSQB 4UT9L 3UJJH 2NZIA 3WO4B 1HQ4B 1NLDL 1KIQA 4WW2A 3OJDB 1RK0A 4LGPB 2FBJH 3BIKA 5C3TA 1A2YB 5DHXB 5T3XD 2EYTB 1QBML 3V6ZA 5F9OH 4Z0XA 5LBSH 3T2PA 5KZCB 2XWTB 5E2VH 1I9RL 1D9KA 4D9RD 5DRZB 4MLIA 2EDHA 3QFDB 3KAAA 4AEIL 4TTDC 1PFCA 3QHFH 2W0KA 5EFIA 3H42H 3W0WB 3V7MA 3MO1B 3W2DL 2FR4B 4D9LH 2GFBA 3CFIC 4NKDB 3MNWA 1R3JA 2AV7A 3HKFA 5ICXA 4CN1A 1K5NA 5DI8A 15C8H 5F88B 4B50A 5ADOL 3RTQC 4Y19A 5DD0H 4DW2H 2VDQH 4DEPC 4KPHL 2IEPA 3LKSA 4P5TA 1RZKL 1JWSA 3QDJA 2WIIB 5E8OB 3PWPB 4E41D 1LEIA 1Q9KB 2WP3T 4IOSD 4Y4HC 2ZSVB 2XWBB 3BZ4A 3RBGA 3UX9B 2GW5A 1HHIA 5BS0B 1BECA 4NRYB 5JHDE 3VFRB 1KXTB 1MHCA 1U2CA 1BZ7A 3WL9B 4JO2L 1JHLL 5AEAA 4IOFD 2VE6A 4ZFFB 5KJRL 3BEWB 1P7KB 2CDEB 2AP2A 1NGXA 4JFPA 3VFPA 4BELD 2UZIL 5FGRA 4OZIB 3F8UB 4PRAB 3ARDC 1B4JL 4RQQB 1IAKA 5T3XH 5FV1L 1NGQL 1K8DA 3VI4F 5CZXD 4JKPL 1ZVHA 2ZUSA 5EWIH 1KTDA 2C4FU 3O0RL 1XGPB 1A7PH 3VWJD 3ZL4H 3T1WA 4KQ3H 2HTLD 3ESUF 2QKIB 1RZGA 4WUUA 2N56A 2PO6B 5BRZB 2UV3A 4LRNL 5EC2B 4HEME 2D03L 2F19L 1OWRM 4YJZL 4AM0B 4DUWA 4I3SH 5F6IB 4OLWH 2I07B 5HXMA 4L29B 1DEEB 2DB8A 4OIIL 4WWKB 2BC4A 4J3WA 1A6ZA 2QHRH 3BAEH 5IR1A 3KS0H 1WUNT 5FCUH 3ARBD 4OT1H 4M5YH 3VW3H 3IDGA 4KMQA 1CDYA 1I4FB 1TENA 2BNQD 4Y4HA 5HHVH 2GSIB 1A7OH 5IOPA 3GKZA 4N1EA 4XCYA 4DKFL 1XGRA 4ZFOL 4YHKH 3PJSB 1RULH 5KSBF 4NJ9L 3LS4L 3VGGA 1MCOL 2OTPA 1LO2L 1JWUB 1PQZA 3S4SB 1BIIA 5IBLC 4U1NB 3ARDA 4H5SB 3WIFA 5KOVC 3QQ3B 4ENEC 1KV3A 2EE2A 5CS7A 4JFDD 4NQSA 3CXHK 4PJ7B 1FNSH 4XX1G 4RWYH 3OGCB 3O3EB 4X6FA 2APTA 5T33L 3S98A 4HZLA 4JCLA 3ECBA 3QAZB 4KY1H 2GCYB 5KW9L 4YPGA 2A77L 3AB0C 2X89A 1FPTL 2AGJL 1PY4A 4LBEA 4JM2F 2CQVA 3SO3B 4FABL 1WAAE 5IT2L 4N8CH 5CWSB 5C09E 3DRQB 3CNKA 5IMLA 3L5XL 3QYCA 4HGMA 3SBWA 3NGBC 3QCUH 1U92A 1NC4B 5ABDE 2DQFA 4JVUA 1GIGH 1VACB 2OXHA 1M71B 1CFSB 3BEVA 4KJYA 3RAJL 4P5MA 5T1LA 1EFXD 4ODHH 1N0XL 4JLRB 1AQDA 4ELKB 1TZGL 2GQHA 4OCYL 1JNNH 3HNVH 4R7NA 3ZSSA 3DMMB 3O45A 2QQNL 3VFTB 3GMRB 4LMQI 3AUVA 1BX2A 4LDOB 4FZEL 4TOYL 4D9RE 1PY9A 3ILQD 1FL3B 2CKBL 2BVPA 4R7DB 4X6DE 5HGDB 3SCMB 3U1SL 1XIWB 1QFWI 3DYPA 1MAJA 3FRPA 2X1XR 3FQWA 3UJIH 3W39B 3GSWA 1MHPH 5DGRA 2PW1A 1UM5H 3BZEA 1HWHB 2WLYA 1N7ML 4UBDD 3GSVA 3RGVA 3RIAF 5SWZD 3ZDYF 4OB5H 4HT1L 3W0WE 5GZND 1QQDB 2H26B 3IFOA 5DUBB 4OI8A 4Y88A 3SDCB 3DV6A 4F37K 3A67H 1WIPA 4P3DB 3QJHB 2CPCA 1DLFL 3G04A 4WIQA 3VFUB 1ETZB 2FZ3B 4UT6H 4HIJB 3O6FC 5KTEL 1VFAA 2MWCA 4ISVA 1IGJB 3ET9F 3FO0L 3UEZA 5B3NA 1QFWL 3PWPE 1BF2A 1DVFB 1LD9A 4R97B 1IRAY 4WU7B 5BS0E 2MQ0A 1CVRA 4OLVH 2DJUA 1UH2A 3MJ6A 2ZPKH 1BQLH 3F7YA 2E9JA 1DQLH 4KZDL 5SWSB 2YKLL 3U2SB 5DO2D 3MLVL 4WFGE 3VXQA 1MCSA 1GZQB 2AABL 2DJ4A 5T1KD 3E6HA 3OR6A 3P77B 1I9EA 4FQCH 4R8WH 25C8L 4PBVC 5LGJB 1NC2A 4JKKA 3LN5A 2D4DA 2GK0A 2X70A 1LE9A 3U0WL 1F6AA 4PGEA 2W38A 4GRMB 3TT1H 4HKJA 5BRZE 2MHAB 1RZ7H 4IDJL 1MLBA 2ATPB 5IK3B 5JNYB 5CJ5A 3C09C 1ZWIA 3TNMA 2J8OA 2YUZA 1RMFH 1IGTB 3T3ME 4MWFA 2DYPA 2D7PA 2VIRB 4M00A 4LAQL 2DM4A 2N1KA 3QIUA 1MI5E 3BGAA 1S5IL 4HIHA 4OLXH 1MCIA 5IQ7L 4X99B 2WBJA 2E7CA 1ZSDB 1MFBH 4Q9QH 1S7VA 2IAMC 4J3VA 5FFLA 4TSCH 4CW1A 3G6AB 3MQIA 5BVJA 5F3HA 5J1AB 4UT7H 3OR7B 4ODTH 3FO9A 3UAJD 4UT9H 2UYLA 2EKSA 4KDTC 1EEZA 3KYNB 1NLDH 4JHBA 4CMMB 5HHMB 3VXTB 4PJ7E 3KNBB 1OTTC 3KXFD 1QBMH 5JDJA 4H0HB 2VC2L 2PYFA 4DGVL 3S34L 3LV3A 2IBZY 1I9RH 1RJLA 3GMQA 2HT2D 4AEIH 1HHHB 4WFEE 2VR9A 4NUGL 1J0ZA 1A7BA 3CU1A 5B3JF 3W2DH 4OQTL 3EFFA 1T04B 3VGBA 2CJUL 5C0DA 4HSQA 4Z7QF 2IH3B 5ADOH 1GAFL 1B9ZA 4WJ5B 5I1CL 4KPHH 3NFSL 4URTB 1RZKH 2F74B 1EJ6A 3GMMB 3MR9A 4OCWL 4OF7A 5E8DL 1FNGB 2R2EA 3EIFA 1QLRB 2DWDA 3H3KA 5A2JH 2X1OA 2IAMA 3H7BA 3TWCL 1WAAA 1GJIA 5C09A 4JO2H 4PBWD 4LOUC 1JHLH 1G7JB 3NMEA 5KJRH 3Q48A 3GSNL 4PLJD 3U9PL 3O81A 3VGDA 3S96B 4R6UA 3PWNB 4G7VL 5I1DA 2UZIH 1OGAD 5H35A 1CD8A 4HUUB 2BOBA 3ARTA 4MQTB 1P5UA 1MLCB 1B4JH 4KV5E 4IOFC 4LVEA 3CGTA 1U8JB 5F1NB 1OP5H 5SWZE 1NGQH 1D7FA 3QEQB 1LO5A 4OZ4A 4D0BA 1MQKL 3DVGA 4JKPH 2J8UB 4XP4L 1JZ5A 4HUNB 4AJ0A 3O0RH 3VRLE 2WLZA 3MUGB 3V4UL 4PG2C 1OM3L 1I3RB 3HCVA 3IJHA 4LRNH 1T3FB 4OV5B 3GSQA 2D03H 2F19H 1OT1A 4J3OC 4QHKJ 1HQ4A 1P4IL 4X6DA 3MCLL 3OJDA 2CDFA 5GGUB 3CSYB 3MOQA 3VWJC 2EYTA 3WYRA 5JPNB 1HHJA 2HTLC 4OIIH 1G9ML 5GSVB 3STBA 5JMRA 2FD6L 2XWTA 3ALXA 4JFHD 3OWEA 3AREB 3I6GB 4M7ZB 5EB9A 4CU7A 4Y4FC 1GGTA 2R39A 1KOAA 1AGCB 2HTKD 1INEL 4GLRI 3W0WA 3MO1A 2HAZA 4DKFH 2FR4A 1NGYB 3SGDH 3ARBC 4NKDA 4K07A 4NJ9H 2P8PB 2AEQL 3LS4H 1MCOH 1LO2H 1I1AD 4L4TE 4RGNB 3ZZ1A 1FO0L 2VQUA 1FQ9C 3C2AL 3F7VA 5BVPL 1XF5B 5SWSE 1DUZA 1X5KA 3BESR 1U58B 5E8OA 3PWPA 3RL1B 2ORBL 4IIQC 1Q9KA 3T77B 1N26A 4KI5D 4LL9A 2ZSVA 5BS0A 4M61B 1KACB 3LN4A 4NRYA 3VFRA 5F7NC 1KEGL 1IEBB 5T33H 3U6RB 4HHAB 4PG2A 4ZFFA 3OV6A 3BEWA 1P7KA 2J1KA 2CDEA 5KW9H 2A77H 4ORGA 3F6IA 4AK1A 1FPTH 2AGJH 1B0RB 1HXMB 1V3KA 4PJEF 3D87B 4HH8A 4RQQA 5E2JA 4FABH 2OTUB 5JA8B 1KJ3L 1MFNA 5IT2H 4HS8L 2HA1A 3AC0A 3L5XH 2CLRB 4Y4FA 1W8NA 4BK5A 3ZE1F 4UQ2B 4F7EB 1XGPA 2OLDA 2PO6A 5BRZA 3LOWA 3KPRD 5DJ0B 3SE3C 1T7XA 1RK1A 4LPVA 4AM0A 3RAJH 2XTJD 2I07A 4QEGA 5HTSA 1ED3B 1N0XH 3SPVB 1G1YA 4WWKA 5CD5D 5I19L 1TZGH 2R1WB 1WCBA 4CDGC 4OCYH 4NUJB 1UT9A 4RRPG 1A6TA 3ZDZE 1CFTB 4IIQA 1I4FA 2QQNH 2X09A 1MI5A 4TOYH 3PL6D 4FZEH 3D3VE 2NW3A 2GSIA 2CKBH 1X5JA 5F7MC 1JNJA 3U1SH 1S7RA 3PJSA 1NBYB 2HVKB 3R4DA 1RZ8B 1JWUA 1N7MH 1PLGL 5AG8A 3ZDXF 4POZD 5HI5D 4U1NA 3MRMB 3CLEL 5A43C 4H5SA 2X4UB 4NOBA 4GS7C 4HT1H 1WIUA 4FQHA 4PJ7A 4UBDC 5HHOD 3OGCA 4MJ6A 3GBML 2YN3A 4JN2B 4CVWA 3N1QC 1DLFH 1XIWC 5KTEH 2VJXA 5GZNC 2GCYA 4LLMB 4NQXB 3FO0H 1KCRL 1DQQB 4KHXL 4X9BA 3I6LD 4V1DD 5JMOC 1QFWH 5GS1B 4GW1B 1BVLA 4R96A 5HYSG 2CO7B 4FQXB 3D0VB 3OKKA 3DRQA 3LPGA 5GSRB 4X6CF 4KZDH 5F9DC 2YKLH 2XYCA 3BGMB 1OAQL 3MLVH 5D2NC 3WHXB 5DHVH 4PP1D 1M71A 1KT2B 3DUHA 3EYQD 2AABH 4FMKA 2B5IB 5JW4M 4NHUB 3RDTD 4NQVB 3GK8L 25C8H 4JLRA 1CE1L 3QEQE 4OFPA 4OI9A 1HH9B 3SGEI 3U0WH 1NEZA 3U30B 4G8FB 1D6EB 1A1MA 4RFEA 4GKZB 3DMMA 4IDJH 3A6BL 4MXVE 3VFTA 1CXLA 3GMRA 1I85A 1FL3A 2FIKB 4R7DA 4I8DA 5HGDA 3SCMA 4OF3A 4UV4L 5LKNA 1XIWA 2NY4B 4HQQL 3W39A 2BHYA 5E5UB 3D18A 4B7LA 1WBZB 4WI8A 2G75A 1G7PB 4C59B 3K4AA 3PNWB 5FOBB 5JW4N 5C3LD 1DTUA 3MOAL 4LAQH 3UJTL 3A6OA 3V5DB 4QRRD 4K7FA 3C8KA 1S5IH 2QL1A 3NAAL 1Q9OB 1QQDA 5IQ7H 2H26A 1RZKC 4OFIA 2GYSA 4PJDE 4K55A 3QJHA 4OF8A 1T1YA 2HJLB 3VFUA 4RGNE 5AD0B 3QIWD 4HIJA 4FRWA 4NQDD 1XFPA 2H8PA 3FT2B 4IS6A 4ODXB 3TN0B 1CTNA 5C0IA 3V8CA 2UVEA 1XAUA 1JI2A 5KSVB 3WLBB 2VLKD 4ZOEA 3P3YA 5MERB 3P4LA 2NY2D 2VC2H 5CSZB 1AKJA 2Q3AA 1FN4A 1QR4A 1KJ2B 3CAFA 1U93B 3IF1B 3OKEB 3UAJC 4DGVH 4L4TA 3S34H 5K59E 5T1KA 4B41A 4OLYL 1JVKA 5TQ0L 3Q0HA 1ADQL 5JO5B 5SWSA 2VLJB 4YC2B 4JDTL 3DIFB 5DEGA 4J6RL 5HGHB 5J6HB 4NUGH 3V5HA 3DARA 1TTGA 4HJ0D 2AQ3A 5HBBA 1PAMA 4OQTH 4R4NC 1F42A 4XMKL 5FO9B 5KVGL 2VL4A 2CJUH 1EHXA 4X4ME 4M5ZL 2HT2C 3KPRE 1Z9LA 3KHQA 3FN9A 5LGJA 1GAFH 4KKCC 3D69B 5I1CH 3NFSH 2VDLL 4OGXL 4LRIA 2X1QA 1X5IA 2EZ0C 3WIIL 4OCWH 4XH2B 1T83A 5E8DH 4IOIB 1J87A 2AXJA 2GTWB 1I7ZB 3CXHJ 4OD1L 4ZNEE 3BFOA 5L6YL 2PTTB 4NT6B 2XY1A 1BF8A 3TA3D 4NZRL 4QF1B 4NP4L 5ECJE 5FM8A 1FDLL 3TWCH 3VGEA 3MXVL 5KG9A 2AJVL 1TITA 3W11D 4P9HL 3SEPA 2GIYA 4GRLB 1GH7A 3WCYA 3GSNH 3U9PH 2Y23A 3WEXB 5HYSB 3AM8C 5E03A 5F89A 1KPVA 3GSXA 4G7VH 4IMKA 5IUSA 1EV2E 1REIA 5L88L 2CDGB 1FP5A 1X6NA 1XF2B 2DI9A 4PLJC 4X99A 5C9JB 1C8PA 3ARGD 1G0DA 3L1OL 1MQKH 4XP4H 3PABB 3TO4B 1PG7W 5ISZB 2F5AL 5HHOE 3V4UH 4M62L 5J1AA 3OR7A 1OM3H 1WLHA 2E7LA 2QADD 1JZ8A 1SJEA 4JY5L 4BSVA 3KYNA 3D3VA 1P4IH 2EDJA 5H94B 5CKGA 3MCLH 4WI3A 3UTZB 3C6LD 1L0XA 4CMMA 5I75C 3VXTA 3GSOB 1FAKT 4NKMB 4V1DE 3TJEL 4LLDB 4HDIB 4HBQA 1G9MH 4PJBB 2NY0C 4L4VB 3RIFK 4NPYB 1I7UA 3HLAA 2GUOA 2FD6H 4UIMB 3IDNB 4YDLC 2YC1A 4U2ZA 3O4LE 1KEML 3LSOA 4AH2B 2GTZA 1MNUL 1INEH 2DD8L 2FNBA 4UAOB 5DT1L 2AEQH 1KLGA 5MP6L 2IH3A 1FO0H 3C2AH 2Z8VC 5DTFA 1LVEA 4P23B 1V3JA 4D94A 5BVPH 5I1JL 2F74A 4Y4KD 3GMMA 1ZVSA 3HRPA 4GAFB 4PJGE 2ORBH 2J5LB 1DR9A 1QO3A 1UENA 3BH9B 3HMWL 1I1AC 1QLRA 4EI5B 1HDMA 4E9LA 2F54D 3PP3H 3CVHL 3QUYB 3NIDE 4LLVB 4BZ2L 1KEGH 3MRHB 2NMSA 2G2RB 1A1NA 4WWID 1G7JA 3SKUD 1SEBB 1WFUA 4PJCE 3RJDA 3S96A 4KI5C 2VXSL 2ZP0T 1A4JA 1WZMA 4HUUA 2DS4A 1BHGA 3PWVB 1PVHA 1MLCA 2NY6B 5DRXB 5KS9F 1KJ3H 5F1NA 3OXSA 2JE8A 4HS8H 5HGBA 1CU4L 4LLQB 4QRRE 4PGDB 3QEQA 5CP7B 1ORQB 2J8UA 2B20A 3CFCL 1BLNA 3DJ9A 3MUGA 4Q6YA 4Y16B 1B6UA 1I3RA 3QSKB 2RB8A 2WINA 1A3QA 1OCWL 4NQDE 1X4XA 4U4BA 3VGAB 5HVWA 1P7QB 4L3AA 5GGUA 3CSYA 5DJ2A 4N0UB 5JPNA 4W6XB 5T3ZL 3X3FL 3REWB 5GSVA 5I19H 2W0PA 4RGOL 3AREA 3DI3B 4OI7A 4XC1L 1K8IA 2XTJC 4LVHC 1DUYB 3O4OB 3DUUA 1DQDL 4JPVL 4PJAE 1HYSD 1NGYA 3C5JA 4F80A 4PJDA 2NTFA 5JOEA 4LF3B 3PL6C 3SKJL 1VGEL 1PLGH 6FABL 3VXPA 1QPPA 3CLEH 4NQED 1U58A 1LWRA 3RL1A 5CZVL 5D1ZD 3T77A 3HI6L 2JK5B 2LAGB 1S9YB 4S10A 3GBMH 1F2XK 4I48B 4ZS6D 3U6RA 5DJCB 4RX4A 4QLRA 1KCRH 4KHXH 1T80A 4J3SA 4DK3A 1DCLA 2DLIA 4LHUG 2G9HA 1B0RA 1HXMA 3D85B 1CGSL 1D5ZB 4LNVA 2BMKB 1P6FA 5KN5B 1FFOA 3DNKA 4X4MA 1AGBB 3G9AB 2ERJB 3WBDA 2P44B 3R06A 2JLLA 2B7DT 2WK2A 4UQ2A 1FBIL 5JR1L 4KGJA 1B2WL 4WNQB 1OAQH 4CNIB 3ARUA 2WM0A 4XNUL 1F4WL 3R1GL 5D7JD 5FCSH 4UV7L 2O5XL 2ITCA 1HXYB 5GGSY 3FMGL 5DHVA 3GK8H 4NO2B 3PL6A 3SPVA 1CE1H 3GO1L 1RVFL 1WWCA 2R1WA 5ISZE 3MV9D 4PP1C 5L2JB 2YS4A 1UWGL 2WP3O 2APFA 4PY8I 1CFTA 3R0NA 3QDMD 3A6BH 1IGYB 1G7IA 5C7XL 4UV4H 4HKXB 3MJ8A 3EBAA 4MMZC 4HQQH 1NBYA 4P2RD 2HVKA 4PJBE 4WW1B 4L4VE 3HR6A 1RZ8A 4IRJD 3MGOB 4X83A 3OXRB 1PG7L 5HHOA 3PDGA 3VDBA 1YMMD 3MOAH 3UJTH 3MRMA 2PW2B 4OZHB 5GXBB 5GGTL 3O3AB 3PP4L 4C56D 4APQB 1VERA 3CH1A 2V9TA 4V1DA 2FWOB 3GNML 3LKNB 3D39D 3KPSD 1XF3B 3F6LA 5GS0L 2F54E 4KKLD 5ERWB 2BY2A 3O4LA 4GG8B 4LLMA 4NQXA 1DQQA 3TEUA 5JPMB 4JFZL 3DVIA 2BP3A 1LDPL 4KK8C 1BJ1J 4BFBD 1I8IB 2VUYA 5CMAB 4F15B 2VABB 3JWNC 2P5ED 4XRCB 4IHOB 4HJGB 3WHE0 4L9LB 1CLCA 5HYFA 1F4AA 4OLYH 5TQ0H 2IPUG 4NO0D 3ARFD 3IETB 1ADQH 1JPGB 2X10A 4YHNB 4JDTH 4YIQA 3KPPB 4J6RH 4NIKB 1XT5A 2FX9L 5J56B 1EUUA 4PJGA 3U7AA 3WFEL 3WHXA 1KT2A 1MCCA 4GKSB 4XMKH 4C57C 5KVGH 1DEDA 3X14B 4NQVA 4XVSL 1CS6A 2MQCA 4M5ZH 1M1SA 4JFQB 4OQTA 1XGQA 4Y5YC 5CGYD 4HJ0C 2VDLH 4OGXH 1X5HA 2OR7A 4MAUL 3WIIH 2V5TA 1D6EA 2ZG2A 5BZWB 1G9MC 1H9VA 3DO7B 4OD1H 4YC2C 2I24N 5L6YH 1KGCE 4M9PA 1YQ2A 2FIKA 2IANB 2OL3L 1UJ3C 4NZRH 4NP4H 1FDLH 4N0FB 2EIBA 3MXVH 2AJVH 4DJMA 4DK6A 4GKOA 3V7AE 3KPNA 5IJVB 4L8SB 2FJHB 4P9HH 4LHUB 3G9VA 1XF4A 4WFFD 2H2SD 3Q5OA 1EO8L 3VDAA 1BQSA 3K80A 1CK0L 1KTLB 1WBZA 3ARZA 4PJXF 1G7PA 5SWQA 3PNWA 4I13B 5I2IB 3TA3C 3IVKB 4BUGA 1M7DB 3TIDB 1ZA6A 5L88H 4FP8L 4NQDA 5FHAL 3W11C 4K23L 1Q9OA 4R2GD 3OX8B 1UM6L 5E1AA 2IMMA 5H2BB 4N9OB 3L1OH 1NCDL 4MNHB 3ZT5A 5CLWA 2HJLA 3RX7A 3WJLA 2F5AH 3MYZA 5AD0A 2IF7A 4M62H 1EXUA 1T5XA 3FT2A 1FRGL 3TN0A 2QJDA 2ZUUA 4JY5H 4QRUA 3ARGC 3GBNL 4ZUTB 1G6RB 5KSVA 3MUHL 4PJAA 3VXOA 3TJEH 4Y5YA 5MERA 4Z7UF 43CAB 1PSKL 1DZBA 1KJ2A 4LLUB 2QADC 3TH3T 4O2EB 3TF7C 1AHWC 2NLJA 5CCKL 3CD4A 3ZYJA 2A83B 1YEJL 1FFRA 1KEMH 2XA8L 4Z0BL 1V05A 4J7RA 3DIFA 5HGHA 1MNUH 1UJ3A 5SX4H 4HLJA 1EEYA 4JDVA 8CGTA 4HIEB 3T0BA 3CFEA 2DD8H 1HSAA 3C5SA 2DKMA 3QXAA 3LIZL 1U8MA 5FO9A 2ITDB 1X6LA 3HC0A 5DT1H 5T3ZD 2AQ2A 5MP6H 1IVLA 5CJOL 2QHLA 3VXNB 3O3BA 1TVHA 4WFHD 3UTPD 5I1JH 1P2CB 3QRGL 3RZCD 2W0LA 4XMLL 4XH2A 2FBOJ 3QCVL 4R0LB 5ALBL 4IOIA 3HMWH 4PRNB 1ZA3B 1I7ZA 2HJKB 2Q20A 4EN3B 4NRZB 2PTTA 3QDGD 3QDME 3CVHH 3BUTA 5FYLL 1NFDB 4BZ2H 1XZ0B 1ZLSL 4DVBA 2AJ3A 2CRIA 1ND0B 2O5ZL 1KULA 1HNGA 2VXSH 3GB7A 1CDGA 1QYGL 4WHYH 4Y1AE 4WV1B 2D2OA 1U8IB 2EYSB 2A9NH 2E6JA 1Z9SA 2OYPA 3UXFA 4G6FB 1QSFB 1TDQA 1CU4H 1AHWA 3U46A 5C9JA 4P4KB 3CFCH 3NOIA 5ISZA 4BQCA 2A6JB 2VRAA 5D9SB 4BFEA 1BAFL 4AIZB 1W0WB 3OSKA 3E6FB 2IBGA 3QNXA 1U8PA 2ESVB 4AY0A 4OZHE 1OCWH 4LARL 5H94A 1EHNA 5DJAB 5C0GA 5CEYB 5EO1B 1BPVA 3GSOA 3NPSB 3HPLA 4NKMA 2NTSP 3KDMB 4LLDA 4HDIA 4LGSB 5T3ZH 3X3FH 3MYJB 2VAAB 3F62A 4OCLC 4PJBA 1WICA 4L4VA 5DC9B 5KVMC 1WTLA 2P5WB 4RGOH 3QPXL 4HXBL 4UIMA 4GKNB 2P5EE 3IDNA 4XC1H 3C08L 1F4HA 1NC4D 2A6IA 1U8OB 1MREL 4AH2A 4M4PA 4OZFG 1RUML 1IT9L 1DQDH 1FVCB 4JPVH 4P57B 1CI5A 2ZUTA 2A9ML 2LU3A 1HHGB 3P4MB 3SKJH 1VGEH 1NMCB 6FABH 1M05B 5IHLB 5DEFB 4P23A 4LAJH 4ZQKB 2ED8A 1T21A 3M17A 5DQJB 5CZVH 1TQBC 3U4EA 32C2A 3BH9A 3HI6H 5DMJB 1M6OA 1QLEL 3BOVA 4ZSOE 4JY4B 3U0TB 3CFJA 4BA8A 2F53B 4LLVA 2KZ1B 1JZ6A 5E8PA 2X9XA 3Q6FB 1SEBA 1V8HA 3LB6D 3DVFA 4LLWA 1WSST 4WEMB 5C2UB 3I84A 3LKRA 4ZS6C 1MQ8A 3PWVA 1CGSH 2IANE 5DRXA 4ELMF 1CBVL 4ACPA 4JRYB 3SDCD 4X4YB 3OJVC 1CD9B 1LO0L 3HAEG 4PJ9B 4TYUA 1NBVL 4XCNB 5CP7A 1ORQA 2W0FB 1T0MB 5JR1H 1AXIB 1FBIH 2OZ4L 1B2WH 5DK0B 1JJUA 1UWXK 3HI1B 4Y16A 4QXTB 4XNUH 1F4WH 3RWEB 3R1GH 3TESA 5GRYA 3MRGA 3ULVL 1DVFD 3UTSE 3ZE2F 1WZ1L 4UV7H 4NFBA 4R26L 3ZDYE 2O5XH 2ZCLL 4LVNC 3RVUD 3FMGH 4ZPTB 4O58L 4N0UA 1ZS8A 4XCEA 3GO1H 3REWA 1RVFH 1SBBA 3G5VA 1R3HA 3BJ91 3MJ9L 1UWGH 3UTQB 1JRHI 5D7JC 5F3BA 1CDIA 3MROA 3O11B 4X7TA 2A74B 1MCLA 3C5ZD 5C7XH 4ETYA 3KYMA 1OAYL 4Z7OF 4HUMB 2HKHL 3DBXB 4JDZB 4LF3A 5EO0B 1NFDF 1PG7H 2MOVA 3C8DA 3LQZB 5T3ZE 5I0ZA 2DQIL 2BXYA 5GGTH 4GBXD 4LPWA 3PWJB 3PP4H 4YXLL 5ESVB 3G5XB 2JK5A 1S9YA 3RX8A 2MQ3A 4R3SB 3WJJA 2R2CA 2RCSL 5CHNB 1N6VA 3V4PL 1DDHB 1JRHL 3GNMH 2ILLA 5JIKA 4AT6B 5E6ZA 4ETQA 3MRLA 1BP3B 2VN7A 1OARL 2HYMA 5GS0H 5E94A 3ARPA 3MA7B 2E3VA 2X4SA 5D7KD 4JFZH 2H6PB 1LDPH 1VKXB 4ODVL 4P9HC 4WEBL 1LP9F 1D5ZA 4XPGL 3IRZA 4G80A 3GJEB 2PNDA 5KN5A 4KKLC 1DQTA 2Z31D 3O3DB 4OZFB 5D7JA 5CILL 3T1FA 5EZJB 1PZ5B 1GC1L 2DQCL 2LV4A 1JPTL 4RBPH 3GSRA 4NO5B 4LLYA 4OD3L 4WNQA 3THML 4CNIA 3UTTE 4M93C 3X12B 2FX9H 1I3VA 2IFFL 5DJ6B 1Y6MR 3WFEH 1CQKA 5GGQL 1VCAA 3BYYA 4XVSH 1QSFE 4YBQD 3VGHA 4NO2A 1WT5A 1YEIL 3BQUB 4OUUB 5JLZA 2R2HB 5DJDA 4JM2C 4MAUH 1K2DA 5TQ2L 5L2JA 1L7IL 3HS0B 4Y1AA 3BWAB 3EDKA 1IGYA 4NHCL 2OL3H 5CGYC 1C7SA 4FTVB 4HKXA 3PWUA 4L8DB 1NH6A 4WW1A 2AS5M 4LEOB 3UZQA 3TVMD 4JPIB 1EO8H 1OP3H 3MGOA 1CK0H 5DZNA 1F3DJ 5CBEB 1EX0A 3ETBF 4Z5RA 3HAEB 4Q97A 4OIBA 4OZHA 4FP8H 5M7QA 4Y2DB 1EK3A 4Z7VF 5FHAH 4MJ2A 4AZ8A 4K23H 3EJZD 4YHYB 4POYA 2QSVA 1UM6H 2H2SC 3D25B 4APQA 4XPTL 3L3JB 4QGYA 4BH7A 1NCDH 2DF3A 4V2BA 3JV0A 5ESQB 5IB5B 1LE5A 3LKNA 4JFXB 4Z7QE 4CBPA 3KPLB 1XF3A 1FRGH 5ERWA 3OL2A 4GG8A 4R2GC 3GMLB 5I8EB 5JOPE 5GHWL 4UIKL 3GBNH 4MCYB 5CMAA 4WHTB 1IKFL 1PSKH 4U7MA 4XRCA 4IHOA 4Y7MA 1JK8B 3QRFM 4HJGA 5EU6E 4JM2A 4NDMB 1MWAB 3B9VA 5CCKH 1YEJH 4NCC2 4TNVK 3B6SA 3IETA 2XA8H 4NZUL 4Z0BH 1UZ8A 4YHNA 3KPPA 3ILPB 5CUSL 2DTSA 4OIAA 1EGJL 4GQPH 2Q1EA 1T0PB 3LIZH 4GKSA 4HH9B 2HLAA 1Z9OA 4ZMAT 4XVJL 4JRYE 3EKCA 3ULSA 5CJOH 5IVZB 4HS3A 3HE7D 2IADA 3T65B 1JF6A 1Z0MA 2H3NB 4CMHC 4C4KT 5A16B 5ICZB 2DLHA 3QRGH 4IEFB 4K2UL 4XMLH 1W0YT 1PBYA 3QCVH 5EORL 5ALBH 3DO7A 5BW7C 3VXSD 2IANA 5F9AC 4H1LG 3BPNC 4N0FA 1MRCL 4XC3L 4G43B 5FYLH 1X5ZA 4FXGA 3RZCC 4P3CL 5IJVA 3Q5TA 1ZLSH 2FJHA 4LHUA 3RZWA 5EULV 2KQNA 2O5ZH 4LCWD 5CEZL 1KTLA 2XN9D 1YEFL 2NY5L 3ZKXC 1UZ6F 3IVKA 1QYGH 1M7DA 5ICYA 3BPLC 1UGNA 2CR3A 1AC6A 4XAKD 3UTSA 3LEXB 1O7SA 3NFNA 1U6AL 1CDBA 4OBRA 5GGVY 2DMKA 1C5DA 2CIKA 1MY5A 3CX5K 5H2BA 1FZKB 4K3DL 1I3UA 1KYOK 4PJHF 5EU5B 2NNAB 4KI1A 1FHGA 4AMKL 5ADPL 3KLAB 1BAFH 1EZVY 2AXGB 1N3NB 2DLTA 5DLML 4LARH 2X1WL 5C0AD 2FJFB 5EA0L 4ZUTA 1G6RA 3S3SA 2DI7A 3WS3B 5FOJA 1L4IA 3CFDB 3S8WA 1MCHA 2VXTL 2EDBA 3DVNB 4KROC 4PLKD 4O2EA 5T1MB 3QPXH 5EH1A 4HXBH 5FF6B 1FZJB 3C08H 5JW5B 3L9RA 4ZS7L 1WK0A 3NIFF 1MREH 2OTWB 5BW7A 2DLEA 5M94B 3RWIB 4K8RD 4Q58C 1QHOA 1IT9H 4HIEA 4J3XA 5A2LH 2R0ZL 3FFCD 4R90L 3SDAD 3N50A 1A6PA 2A9MH 1JWMB 5B4MC 3VXNA 4GAYB 1H8OA 2FO1A 1P2CA 2JJWA 3GBLA 3ZE1E 3MRBB 3UP1A 1JNLH 4P4RB 4R0LA 2KUTA 1F13A 3AMKA 3JWDL 4C83B 1QLEH 3RA7L 2HJKA 3JTTB 4NRZA 1YPZB 5C0CB 4WY7L 3UPCA 1EERB 3FQXA 1WEJL 4ZAKD 3M8OL 4P59L 4UB0H 3TCLB 3GIVA 1CR9L 2DTML 1A02N 3WUWG 2YPVL 1G0YR 5DURB 3N1GC 3UTTA 4RBPK 3I50L 3OKMB 1U8IA 2EYSA 5HHPB 1MFAL 3LZFL 4JHZA 3V5KA 3MRJB 4D0DB 3VGFA 3PF2A 1CBVH 1QSFA 1ACZA 3LB6C 2ADFL 2EDYA 2HRPL 4G9FE 1LO0H 3GMOB 5E99L 1NBVH 4P4KA 4W6WB 3HPJB 5TDPB 1J05A 4PJFB 2OZ4H 5GGVL 5FYLE 4OF6A 2A6JA 4DKAA 1OTSD 4QHNB 1AXSA 5D9SA 1W0WA 3HE6B 3T4AB 3F5WA 3ULVH 3O2DA 1WZ1H 4XBPB 4R26H 5DJAA 2ZCLH 4G42B 5GS0C 1V5JA 4FQXD 3L5WB 3KDMA 4O58H 5HHXL 3EO0B 3MJ9H 1TNNA 5E00B 4RISL 1CFBA 4I77L 4H1LB 3RWJB 2YZ1A 3RVUC 1OP3K 1U8OA 4JFOB 1NBZB 3BP4A 4RMVA 1A9BB 5J1SC 2R4RL 1OAYH 1OB1A 3OPZL 2FRGP 4WTWA 2HKHH 1EJOL 1AO7B 1HHGA 5D1QD 1T7VA 1FFNB 3C5ZC 4PP2B 3H2WA 5DEFA 3CSGA 1FG2B 3QEGL 3V6OE 3OF6D 2FATL 2DQIH 3X13B 5DQJA 4QRTB 1F3JB 1NGWA 4YXLH 5IBTL 5TF0A 2RCSH 3V4PH 3MLRL 1JZ3A 1JRHH 3MV8B 3LS5L 5EU6A 4NQCB 2A2QT 1NFKA 3U9UB 1X5XA 4HV8B 1WFOA 1OARH 3W81A 4GBXC 5CD3A 4XZUB 2E6PA 1JTOA 2FCBA 3EYOA 4ZO9A 4ODVH 1G7HB 2PN5A 5D2LF 1JF1B 5I16B 3QUML 3KLHD 4WEBH 4XPGH 3ZKMC 1T0NB 4XT1C 4ZDHB 3KG5A 4WGWB 4JRYA 4PJ8C 1IKNC 5CILH 1R3KB 5BQ7B 1GC1H 2DQCH 3PHOB 2EDOA 3IFPB 4L4JA 1JPTH 1V7ML 1YECL 3L3IB 3VD7A 4OD3H 3THMH 4X0KA 3MBEC 2F8XC 2IFFH 4QXTA 3RWEA 2F15A 2Z31C 4JQIL 3QXTA 5GGQH 4X6BB 1YEHL 2R1YA 3BD4A 3PV6A 2HFFA 3B8YA 3QI9C 4ZPTA 4Z95L 1YEIH 2VO5A 4DN4L 1S7UB 1RZIA 2ZUYA 4DAGL 4RNRB 2X4QB 1DN0A 1IM9D 5TQ2H 1L7IH 2AKRB 3ORJA 2UZXB 2VLJD 2LE9A 5GGSA 4NHCH 3L5HA 5J9PA 3D1MC 3WUWB 3VFOB 3E8UL 1IC4L 1XCQA 1IAOB 3ULVE 4MNGB 4GBXA 1YPZF 2EXYC 3DBXA 5E7FA 2NXZB 3B43A 3N1PC 3AY4C 2BNUB 4Y0GA 1ULVA 4JPKL 3LQZA 5DRWA 5F9WB 5IFAL 5FUCE 5D93C 4HX1A 4QOKE 3TVMC 4PJ8A 2EDDA 4R3SA 2JCCB 4XPTH 5CHNA 3K2MC 1DDHA 1IFHL 1DL7L 1AD0A 2CK2A 5TGBA 3MBEA 3QQ9D 3MRQB 1K85A 1KENL 4GRLD 5CEZD 5ID0A 1XR8B 3EJZC 3EYFA 4X9GA 1KTRL 3MA7A 4HULB 5MENB 3FQUB 5GHWH 4UIKH 2H6PA 3NCBB 1VKXA 4P48A 4PRBB 1M7IB 1ORSB 3QI9A 2ZUQC 4YR6A 3TNNB 4U0RB 1IKFH 4JN1L 3GJEA 3MV7B 4E42B 3O3DA 3S97C 5ACMA 4GO6B 3TO4D 4RA0C 1DQJB 1PZ5A 2EO9A 2VDNL 1ZK9A 4NZUH 1CD1A 3HR5A 3DX9B 2FH6A 3U82B 4GAJL 5CUSH 4U1KA 1EGJH 4I5BB 3VXUB 1KB5L 2XZQL 1O0VA 4XVJH 3QH3A 5DJ8B 3BQUA 4OUUA 2R2HA 4PJFE 5JXEA 5EU3B 4IMLB 4ZXBC 4NNPL 4K2UH 4B7IA 3MV01 4J4PA 3IAQA 5EORH 3BWAA 3MRDB 3E2HC 4MYWB 3V6OC 3HE7C 4LFHG 4MJIB 3HI5L 5KVFL 1BOYA 3S35X 4XC3H 2AQ1A 2VZVA 4P3CH 4G9FA 4Q6IC 4M43L 4QTHA 4LEOA 1FCCA 3WNKA 4JPIA 1OTUD 3FB5A 5CEZH 1YEFH 3RY6C 2NY5H 3CPLB 3T0DA 2M1KA 2JIXD 3HAEA 5IEKA 5MI0C 1OQXA 4M3JA 5I73C 4EI6A 2HJFB 3DI2B 1U6AH 3H9ZA 4EI5D 5J11C 3PGDB 4DQOL 3QUYD 1CIDA 2RBLA 2XZCL 3L3JA 4K3DH 4LSSL 3HTLX 4J3UA 4NSKB 5ESQA 5IB5A 3UDWC 3QUXC 4RIRB 3TBYB 4M02A 5IVXB 5K9QI 4AMKH 5ADPH 3KPLA 3PDOA 1FYTB 1R3LA 4QWWD 2X6MA 3RJQB 4PJIE 5DLMH 1NMAL 4HS6A 4MCYA 5EA0H 2WIMA 4ODWA 4WHTA 4JANA 1CGUA 4D9QE 1U8KA 3U7YL 2VXTH 3MV8E 1JK8A 5AG9A 4K71C 1MWAA 4CADA 4ZXBA 1I1CA 5DRNA 3LRHA 5JIHA 3VXMB 1Z2KA 4ZS7H 4BH8B 2AK1L 4Z7WF 1B3JA 3HE7A 3ILPA 4N5EC 4P2OB 4ESKA 4L3ED 4PLKC 3LQAL 3MJ7B 2R0ZH 3QQ4B 4Q6IA 4R90H 1P7QD 3GI8L 1PD6A 5F1OB 3BKJL 3NZHL 5KS9E 2J8HA 5IVZA 3AS3A 1NGZB 2H3NA 3ULVC 4EDXB 5A16A 4PRHB 4EVNA 4NN5C 3SDDB 2M2DA 3H9SE 1FC2D 3SDAC 3ZLQC 4YK4C 5D96C 3JWDH 5FUCC 3RA7H 1AGDA 1AGEA 4Q2ZB 1A47A 1ZLWH 1J86A 4WY7H 1S7TB 3VXRD 1QSEB 4GUPA 1WEJH 3QUXA 3M8OH 4G43A 4OF5A 4P59H 1S7SB 1BZ9B 2JCCF 1CR9H 1HN1A 2DTMH 2JF1A 1OT2A 1IAMA 2HT3D 3LD8B 2YPVH 1G84A 1C1EL 4JHAL 5F1KC 4U3XA 4LGRB 3I50H 2W65B 4KVCL 1CICC 5DFWH 1F97A 4ZAKC 4N0YL 5L8KB 5BV7B 1MFAH 3LZFH 3RRQA 4ALAL 3KHOA 2Y36L 4XNZB 4XVUC 5EIQA 2ADFH 2ZOLB 3SGJC 2HRPH 2J4WL 1TMCB 3VU2A 1A1OA 5E99H 1C5CL 4MNGE 3HRZA 4J3TA 3NABL 2R2BB 5EU5A 1HKFA 5GGVH 2NNAA 2AVGA 2BFVL 3D2UB 2PXYD 2YSSB 3MOBL 2ZCKL 5B21A 4PLNC 1WC7B 2OZ4A 2AXGA 1N3NA 2BSSB 4HLZH 4UINL 2IJ0C 3CSBA 2I9LB 1CFNB 3D85D 3ZHKA 2QLVB 3WS3A 4V2CB 5HHXH 1KCLA 1U8LA 1C16B 3DVNA 1NAKL 3WLWD 3BHBB 4GH7B 3RUGE 4RISH 3GJFH 4I77H 5CEXB 5JW5A 3MFGB 1TTFA 4KTDL 3MJ9A 3CUPA 5MENE 5D7IB 2JELL 4NC1E 3RWIA 2PETA 3L95A 1GC1C 4QOKA 2R4RH 1FNEB 3RWHB 3VFWA 3OPZH 1A6UL 2C3XA 4F8TA 2EC9T 4MA1C 4X4XA 3O6ML 1XGTB 3DUSB 3T8XA 5F93C 5IB1B 3QG6A 1EJOH 4LVOB 8FABB 4BUHA 4KRPC 2GK2A 3KGRA 3P9LB 1QFPA 3P4OB 4WI6A 4PIRF 1CICA 4ZAKA 1TZIB 3V2AR 3C60C 3QEGH 4GSDL 1WGOA 4PY7B 2FATH 2D0FA 4OZGB 4ZUVA 3HMXA 1ZT7A 1W72L 3P40A 3O2WL 4P4RA 4K3HA 5IBTH 4C83A 1KN2L 3VXUE 5K9QG 1K4CB 5D1QC 5JORB 5C0CA 3MLRH 1FGVL 3CSPA 3LS5H 1ZLVH 3UCRA 1UKSA 1JZ7A 2NY3B 3TCLA 4LPCA 4X9IA 4QRPD 4ZNCD 3EDFA 5FYKL 1KSRA 5J12C 1QACA 5IVXF 3G5YB 2J12B 3QUMH 4Z77B 5HHPA 1NLBL 4D0DA 2X9WA 3LPWA 2YRZA 1K3ZA 2HVJB 1JFQL 5TDPA 1V7MH 1YECH 2OMNA 4PJFA 1A4KB 2OCFD 3KLHC 1UEYA 4R4FL 2WWMD 4O51A 4QHNA 2DIAA 5HYJB 1CTOA 2VLRD 4JQIH 5J13B 1YEHH 4K9EL 4NWTL 4XBPA 3I02A 2V9RA 4HKZB 5GQBA 3HG1B 5E9DB 4Z95H 1FSKC 4DN4H 1CT8B 3VRIA 4U33A 4DAGH 3C60A 1LEKA 2BNRD 1T66D 4P2QB 1FL5B 2V5MA 1X44A 1YMHA 2C3HA 3MSPA 2YUWA 1FYTE 4H1LA 3RWJA 1LO3L 5I9QB 3SE9L 1Q0YL 4JFOA 1J5OL 5IP4A 3QB7C 1F58L 1NBZA 2C4FT 5D1QA 5TDNB 3IKCA 1A9BA 2AI0L 3CFBA 1J0JA 3E8UH 1Z0NA 1IC4H 3STLB 2E8YA 4LK4A 1S8DB 3QWQB 4L3EE 5IQ9B 5I8CA 1AO7A 1LO4L 3A0OA 4MMXC 1FFNA 4JPKH 3VG9B 5IFAH 3VXME 3BRFA 1WBXB 3V79C 5C0BB 4PJIA 4QRTA 4PREA 4KRLB 2Y06L 5IKCB 4HWEL 2XKNB 1QP1A 2YD2A 3IJSB 4PD4K 1KJMA 3CX5J 2BX5A 4I0PB 1KYOJ 1IFHH 1DL7H 3MV8A 1I7RB 4NQCA 3KJ4B 4HV8A 3UPAA 1KENH 3VXRE 4XZUA 1ZVYA 5EBWA 2LFGA 1G7HA 5FECB 1JF1A 5E8NA 2XWJA 5I16A 1WZLA 1G9EA 4JN1H 3QQ9C 4MQXD 1T0NA 2NY5C 1QSEE 1MCKA 2VDNH 1KNOB 3NIGE 4QY8B 4NC0B 3L3IA 4G8IB 5E6ID 3H9SA 4LCIL 2KDGA 4GAJH 3RI5F 2BCKA 4PJXE 4MLSA 1GGBL 3DX6A 1YN6A 5IVOA 3MNZB 4NO3B 4Q9BA 4FQ1L 4X6BA 3WS6C 4Z8FL 1KB5H 1VGKB 5D7IF 2XZQH 1S9XB 4NC1C 3ZTJG 3BSZL 3TBVB 4WO4B 4F9PA 1EGJA 5HPMA 5F8RC 1OAXL 1ZLWK 2FX7L 4HD9A 1S7UA 2EDLA 4YBLC 5DF0A 4PY8J 2YD3A 1LK2B 2X4QA 3G6DL 4KKAD 3BRGC 3U7WL 4NNPH 5I8OL 3L5IA 2AKRA 2H32H 2HG5B 1Q0XL 1H0DB 3S5LG 3HI5H 5KVFH 3T08A 1MELA 4N90D 4U31A 4GW4B 1IAOA 1KIQB 4M43H 5ANME 4MNGA 3ARXA 3WN5C 4Z7UE 3BIKB 2D9QB 4Z0XB 3SY0B 4PGJA 2BY3A 3KYOA 1JE6A 3WDJA 3EOBB 4EN3D 3TZVB 1IEAA 4Y8DC 5EFIB 1OTUC 5FHBL 2C3VB 4DQOH 2XZCH 3ARSA 3MACL 4LSSH 2VXQL 3KPTA 3K81A 3JWDC 4NKOA 5D5MB 3RUGA 4P99A 3MNWB 2AV7B 2X7LB 3MRQA 3PIQA 3EDJA 3L3KA 1K5NB 5DI8B 2H2PD 1FVDB 1HE7A 4Y2OA 4Y19B 5I6XB 3TFKD 5MENA 4P5TB 1NMAH 3BYTA 2VZ1A 3QIBC 1M7IA 4M8VA 2LVEA 1JWSB 3PQYB 3TNNA 1TFHA 4G6FD 5EOQL 4MCZB 5FM4A 1A5FL 3U7YH 3VRJB 2APBA 4OCSL 4E42A 2BJML 2HLFD 3BZ4B 2IWGA 4HXAL 1HHIB 5KOMC 3P73B 5AAMA 2VL5B 2AK1H 2WWKT 5JW4R 1J18A 2VE6B 1DJSA 2ESVD 2DKUA 4I5BA 4YBHA 4JFPB 3VFPB 3LQAH 3VXUA 1Y6KR 3GI8H 3WN5A 3TO2A 3BKJH 3NZHH 1BBDL 1FLRL 2VLRE 4LQ1A 4W4OC 5ESAB 3VWKC 2JJTC 4YHPA 5TFSL 5EN2A 2P5WD 4NM8L 4FHBD 4KTEL 1K8DB 3QZWG 4IMLA 4P3WA 1E27B 4XPHL 1CDJA 2L4OA 1KTDB 3FB6B 1QD0A 5E8EA 3MRDA 2C1OA 5HDQL 5K9KA 4X7SL 1LNUB 4MJIA 4U3HA 5HPOA 1TPXC 1T2XA 4ZD3L 1R5IA 3HG1E 1KG0B 5E9DE 3TGXA 2X40A 2L7UA 1NMBL 3RTQB 5BCAA 3O9WD 4DEPB 1HZHL 1C1EH 4JHAH 3QIBA 3S36L 1A6ZB 3Q1SL 4KVCH 4LASL 5IR1B 4N0YH 4DGIL 2NXYD 4ALAH 2Y36H 4Y4HB 2HT3C 1D5XB 3PGDA 2J4WH 1C5CH 4XCYB 1XGRB 2F53D 2XTLA 2UWEB 3NABH 3TBYA 2JB5L 3DX8A 2ADIA 4UOW0 5FYKD 1VESA 2BFVH 1T89C 4LHQB 4U1HB 1FYTA 3QUZC 3MOBH 2ZCKH 1UA6L 1Z3GH 5C0BE 3QG7L 4UINH 3KJ6L 1FE8L 5A2FA 5FUZL 2YD6A 3ARDB 3VWKA 2W9EL 5HDOA 3EJJX 2JJTA 4KTYA 3DROA 2PXYC 3FRUB 2W9LA 1NAKH 4GAGL 4NQSB 5F71A 3SGKC 4PJ9D 3U83A 4DCQA 4ODBD 3S5LB 1FV1B 3VXMA 4KTDH 4KJPC 4JFEB 3ECBB 3TYGL 2W59A 1Z6JT 1IC5L 2JELH 3GJFA 3RNQB 2Y6SC 4M6ML 4YPGB 4P2OA 1A6UH 3CH8A 3QQ4A 4U05A 3O6MH 4YGAB 4ELME 1NGZA 4WW2F 4XXDB 3VXRA 4EDXA 5FGSA 4PRHA 4PR5A 4PV8A 5IMLB 4GSDH 1CN4A 1BJMA 4QHMA 3BP7B 1W72H 5IHBA 1U92B 3O2WH 1YDPB 5I30L 5IJKC 1A22B 1KN2H 2DQFB 3JXAA 2ZCHL 4Q2ZA 5FAAA 1FGVH 2BSED 2O61B 1QSEA 4KXZI 3BEVB 5GS3A 3HC3L 4X8XA 4KJYB 1T89A 3QUZA 2PF6A 4P5MB 4N90E 5T1LB 3OKLB 2WANA 5FYKH 2X4RB 4JQXC 2YEZA 2GJ6D 4XNQB 4Y5VC 1H3WM 3TC9A 1NLBH 2PXYA 4RDQF 3U48A 4IRSD 1BX2B 1D5BB 2NY7L 3LRGA 2ZOLA 4S0SD 3QUMA 1JFQH 4Z7OE 2KH2B 1S9WA 1CLYL 2R2BA 3MRFA 2XKSA 1UQSB 4FA8A 4R4FH 3FB8B 3D2UA 2VERN 3AB0B 4K7PY 2PW1B 4U6HB 3BZEB 1ZHKA 4LHJB 3LN9A 3GSVB 4K9EH 4NWTH 5A2IH 3QZWB 1BM3L 2K9UA 2VDKL 2EXWD 3TCXA 5IIEA 2APWA 5ANMA 1JGVL 3WIHA 1C12B 1C16A 3IFOB 4MD0B 3BHBA 1NAMB 3NGBB 5CEXA 3V6BR 3SE9H 1LO3H 3G04B 3UO1L 7CGTA 1Q0YH 1J5OH 4LSVL 1F58H 3MRCA 1J0KA 4M7KL 2AI0H 4MDIB 1ERNA 3GM8A 1JZ2A 3PQYE 3RWHA 4KJQD 1T66C 4PS4H 1XGTA 2Y7QA 1LP9E 2VXVL 1LD9B 1NUDA 3HZMA 3RQ3A 4JQXA 3VD9A 3HUJF 1LO4H 1UEMA 1EHAA 3P4OA 3F7YB 4EOWL 1RSFA 1TZIA 4Y5VA 2YK1L 4PY7A 5L7XL 1VADA 5EOCJ 2Y06H 5I9QC 3R8BB 1RIUL 4HWEH 3FT4A 3OHXB 1HKLL 5JORA 3GHEL 4FTVD 2B4CL 1OVZA 4P9ML 3VXQB 3RHWK 2GITA 4G7YL 3OR6B 5JHDB 1CXFA 3DHMA 4X7EC 2N7BA 3OBAA 1U91A 1NC2B 3EOTL 3G6JB 4KUZL 1I9IL 5FV2A 1T4KA 4HW6A 3QNZB 4Y2DD 1MFCL 3IGAB 5GRVL 1D5MA 1DBML 1ZWIB 3E1F1 3O6FB 1A4KA 4LCIH 4MQXC 5DK3A 2EDKA 4KK5D 1GGBH 4MWFB 5DDHA 3LKPA 4FQ1H 3C2SA 4Z8FH 4K7PL 4CGTA 4Z7VE 3BSZH 5DJXA 3HG1A 1VHPA 3L3GB 4JM4L 5E6IC 5E9DA 1OAXH 2FX7H 3K4DA 5D1XD 3G6DH 3OG6B 3U7WH 1QRKA 5I8OH 1JGUL 2NY1D 3ROLA 5F97E 1FL6B 4XPBL 5F3HB 1Q0XH 5TDNA 5DZOA 3WUZA 4JFFD 4F3FB 1R24B 3V6FB 2UYLB 1EEZB 1DBAL 2AK4D 4JRXE 1XEDA 3STLA 2DL9A 1N59B 1S8DA 3MFFB 5GPRA 5IQ9A 4A2MA 2HMID 2VDRL 3LQAC 1IGFL 1DFBL 2VB5A 4PGCB 5AYUL 1J8HE 1P69B 3LV3B 4JFEE 5FA3B 5C0BA 1XGYL 3NCEB 1RJLB 5HVHC 2ICWJ 3IDJB 3IJSA 2WW8A 5FHBH 3C09B 2ED9A 3MACH 4I0PA 2VXQH 1FIGL 1I7RA 2PYED 3LH2L 3EFFB 1J0HA 1OL0A 5C0DB 1OSPL 4S1DC 4YEFA 4OSUL 1X5FA 1J8KA 4NKIL 4EUPH 4KK6C 1PJ9A 1UVQB 3MR9B 3TJHD 5FECA 2FHCA 5EOQH 5KBNC 1A5FH 2P4AB 3MZGB 4OCSH 2AAVA 2BJMH 4ELMA 4CKVX 1V3MA 4HXAH 2OM5A 3MJGX 2DWDB 1VPOL 1U95A 2IAMB 5HI4D 3H7BB 2ARJA 5FGCB 5CIPH 1D6VL 1KNOA 4KMLB 4G8IA 1CXHA 1N64L 3BMVA 3DXAD 4OFYD 3ARYA 1JHTB 4ZO7A 2HLFC 4N8PA 2BHZA 5F8QC 5H35B 1VGKA 3AGVA 2BOBB 4OFKA 1S9XA 1QFUL 1BBDH 5B39G 1FLRH 2YPLE 3QQNA 4WO4A 3TBVA 2EO1A 1CGVA 3IU4L 2P8MA 5TFSH 4NM8H 2A38A 4KTEH 1I9JL 4KU1A 2A73A 4OZ4B 4PJHE 2Z35B 1GZPB 4XPHH 1QKZL 2B2XL 1TTUA 1TJIL 5DD5L 1TLKA 2XPGA 2F58L 4OFVA 5FGBA 5HDQH 1NUFA 4H0GA 4X7SH 3IJHB 2EC9U 2BZDA 4ZD3H 4GW4A 2D31B 4X6DB 2CDFB 1A6AB 1TJHL 1NMBH 3BPOC 4LDEB 5C08D 1FZOB 3BIAX 1HHJB 1HZHH 2BVYA 3QWRA 3S36H 1E4XL 3SY0A 3Q1SH 3JWOC 4LASH 1HOCB 2G5BB 3P9MA 4HWZA 4DGIH 3EOBA 3RWDB 3SKMA 3I75A 4DFIA 3TZVA 3NCCB 3O9WC 3RL2B 35C8L 1UJTA 1RV6X 2C3VA 4EKXA 4PGBA 5EO9A 2M8XA 4M6AA 2ZUWA 2JB5H 2CXKA 1OWWA 5D5MA 4E41B 2NXYC 2X7LA 2R0KL 4XXCA 5CJQL 1FVDA 4UNTA 4FG6C 1OAKL 1UA6H 1E0OB 2ATKA 3T0AA 1T20B 3QG7H 3KJ6H 1FE8H 3F7VB 5FUZH 2UVFA 1X9QA 3ROOA 1DUZB 3OG4B 3PHSA 3PQYA 2W9EH 4RWHA 3TP4A 4FQIL 4MCZA 3BZDA 3VRJA 1YC7A 2Z8WC 4GAGH 1NEZG 3E0GA 3P73A 1BVKB 1ZGLP 1KCVL 3LN4B 1S7QB 4HC1L 5FUOL 2VL5A 1SJVA 3TYGH 3G6JE 1IC5H 2OP4L 4KJWD 2P8LB 4M6MH 3HE6D 2DIJA 4ORGB 1EO5A 2OXGA 3N06B 2V9QA 5E1HB 2K7PA 3VWJB 3O3UN 5ESAA 5D71L 5SX5H 2IBBA 4K9EC 2ZSWB 3IYLW 1FLTX 3V52L 1A7RL 4Y4FB 1B4RA 1E27A 3EFDL 1ZHBA 3FB6A 3SGDI 3AROA 5GGRY 5EIIA 5I30H 4F37F 1N2RA 3SDXF 5B8CC 5HDBE 2HFEB 4PD4J 2ZCHH 5I66A 1EAJA 5IFJB 1LNUA 1MF2L 4PRPD 3PHQA 1W72A 1YQVL 1KG0A 3ARBB 3HC3H 1RK1B 2B39A 5IB2B 4JFFE 2EE9A 4M1CC 2BNQB 5DA4A 3RTQA 2AK4E 4KQ4L 1JGDA 1WCBB 3W5NA 1B88A 1I8KB 1UXSB 2VUOA 2XQBL 2E7HA 2R23B 1A6TB 2QV2A 4IIQB 2Q8BL 1MI5B 4Z7VA 4RFOL 2NY7H 2NW3B 1D5XA 1S7RB 1CLYH 2UWEA 1QSVA 5LXGL 5CFHA 2D7QA 4WUKL 4U1HA 5B39B 5I76B 1WAAF 4IRSC 4UU9B 5TJWK 2FEDD 5JQ6L 4KXZH 3OB0H 3CIQA 4NN6C 1BM3H 4JRXA 3O8XD 4WI2A 4RAUA 2VDKH 1QHPA 4FQHB 1JGVH 3FRUA 1FC1A 1QFOA 4MJ6B 3S5LA 5L8JB 1FV1A 2I5YL 3UO1H 3FQNB 5B8CA 1J8HA 4JFEA 4LSVH 1E4KC 2EXWC 3OKNB 2JTDA 1BD2D 3H9YA 4M7KH 3RNQA 3TBTB 1MCRA 5GRXG 1CVSC 2FEEL 4PV9A 5LGHL 4D2NA 1JPSL 5D2LE 3CDFA 2VXVH 3BPCA 1BVLB 4FFZL 3N85L 4R96B 4U1MB 1N6QL 3BVNB 1N8ZA 4PGZA 5FGCE 5IMOB 4X6DF 4XXDA 3OKKB 4EOWH 2WUCL 4TSAH 2YK1H 4DWHA 4KJQC 5LAXB 3VA2C 5L7XH 1CGWA 1I1YB 4TNWK 3BP7A 4QHUB 1EFXB 1YDPA 2COQA 1XF1A 1RIUH 1BGXL 1YEDA 1HKLH 3G08B 3ABZA 2VH5L 5T5FL 3GHEH 3RWGB 2O61A 5J1TC 2B4CH 3HA0A 4P9MH 4A2LA 3VFMA 4G7YH 3D6GA 3OKLA 2J3SA 2X4RA 1QA9B 4L3CB 2YZ8A 3EOTH 1J10A 4P46C 4WHDA 5CBAB 1U3HD 1UXWB 4KUZH 1I9IH 4XNQA 5T3XE 1NEZB 5C08E 5HSFA 4GS7B 1PEWA 4U6XA 4EXPX 1A1MB 1MFCH 2HFTA 4RFEB 3SJVD 1F5WA 4Z76A 3QDHA 5CP3H 1D5BA 2YPLA 2CO6B 5D7SL 2VISA 1DBMH 4LIQL 3BGFC 3S88L 5SWZB 1EVUA 4RFNC 2Z92B 1UQSA 4PJHA 3HZYB 1U42A 3FB8A 2GY5A 3D18B 3M45A 4U6HA 1BREA 2G75B 1N5AB 4NRXA 5EIVA 5DSCB 2KQMA 3S37L 5B22A 5J4MA 1SJXA 4K7PH 2LQRA 4FQPA 3QZWA 4K7FB 4JM4H 3C8KB 3IXAA 1HIML 3WSQL 1AXTL 1C12A 2VSDA 4OZIF 3QDAA 4KK5C 2K7QA 4NKQB 1AE6L 1L0YA 4MD0A 1B6DA 4OFDA 1WWWX 4JY6A 2JJVA 4E41E 2R1XA 1NAMA 1JGUH 3VFNB 1T1YB 4XPBH 4K3GA 5D2NB 3LKOB 2H8PB 4IS6B 4KAQL 5GRUL 4O2CB 4MDIA 5C0IB 5D1XC 3O2VL 1DBAH 4MNQD 2I27N 1H5BC 2NY1C 4BM7A 5A40E 1SMAA 1JPFA 4GG6B 3R8QA 1WWBX 5EPMB 4YFLI 2VDRH 1AKJB 4P46A 1FN4B 1IGFH 1DFBH 3RBSA 2Z9TA 3PGCB 5AYUH 4L4TB 3B2VL 5T1KB 2HWZL 2BK8A 1GYAA 4QHKI 1XGYH 4X5WA 5DEGB 3OAZH 3DETD 2HMIC 3V5HB 3OHXA 1P84K 4X9HA 1FIGH 1CLOL 4Z18A 1HSBA 3LH2H 4R4BA 4PRPE 1OSPH 5JHDA 2CMRL 3GEWB 3IRPX 4OSUH 5EBGA 4NKIH 2YD7A 4PRID 4FFVD 5FA4B 3G6JA 3OZ9L 5C07D 3MRRB 3N9GL 3K4ZA 3QNZA 3TT3L 4ZODA 4GW5A 4EUPA 4XP6L 3IGAA 3WXWL 4UDTA 4FXLA 1JGEB 4D8PB 4PJ5D 2APVA 1VPOH 1QBLL 1PKQB 2BNQE 5KG9B 1D6VH 5DXWA 3O6FA 4PJ7F 1N64H 5DMGD 4NZDA 5D1XA 3LDBC 5CIPA 4NJAL 5DD6A 1NL0L 5F89B 1KPVB 3GSXB 1QEWA 5HI4C 1QFUH 4NWUL 3TPUA 3MLZL 4TTGA 2ZNXA 4O2FB 3L3GA 2CK0L 3BKYL 3IU4H 4LU5L 4Q9CA 4BKLB 1I9JH 1GHFL 4OGAD 3F58L 4JFDE 1IZJA 1QKZH 2B2XH 1W8OA 2Y5TA 1TJIH 5L2KD 5DD5H 1FL6A 3QWOB 2F58H 2VITB 4F3FA 1R24A 3V6FA 1SJEB 4ZUUB 1ZHNB 1OD7A 4BSVB 3D3VB 2CUMA 5CGTA 3V9FA 3PWLB 1N59A 4UDUB 1TJHH 2PUQT 2X44D 3MFFA 4GMTL 1ITCA 3GUTB 2L7JA 4LQFL 4ZOAA 1E4XH 1U3JA 1I7UB 4ZTOL 3ZHDA 4PGCA 3SDDD 3HLAB 2GUOB 3T0ED 5FA3A 4Z7WE 1S3KL 4FFWD 2YC1B 2V17L 3LSOB 2CRYA 3IDJA 1X5YA 35C8H 2GTZB 1K9TA 3TBSA 4HG4J 1G6VK 4PFEA 2DMCA 2R0KH 4KV5F 1KLGB 5HHNA 1ZT1A 4U1IA 5CJQH 5EZOL 3T3PE 2X42A 1OAKH 4ZFOB 5IB4B 1NCUA 4TUKL 5DTFB 1UVQA 2Y9RT 3IDXL 3VRLF 1ZVSB 5D2LA 5E7BA 3DGCR 4FQIH 1H3PL 1QO3B 1UC6A 5F7HA 1JI1A 1HDMB 1KCVH 1YJDL 1L9NA 4HC1H 2G5RA 5FUOH 3H3PL 1A1NB 5JA9A 5ITBL 4OCMC 2OP4H 4YLQT 4KDTA 1JHTA 3ZTNL 2WSKA 1TCRB 4DTGL 1A4JB 5I75B 5C0EA 2EEAA 3T09A 3AS1A 2PTVA 3FO1B 4H26B 4KKBD 4PG9B 2NY0B 5D71H 3OXSB 5HGBB 4UMGA 4KJWC 1AFVL 4LFHD 3V52H 4YDLB 2ICES 4GT7A 1A7RH 5KVDL 2Z35A 1GZPA 3EFDH 4I9WD 1J1OL 2VKXA 1BLNB 4J8RA 4JREC 1B0GA 4ONOA 4MXQD 2BVUA 1MF2H 2WINB 1YQVH 2X4NB 5ITFB 1EIBA 2D31A 5CZXC 2VTFA 1IQDA 1A6AA 1Y18A 5FB8B 5DJ2B 4I2XE 4KQ4H 1FZOA 4LCCC 4MNQE 1S7XA 1ACYL 5F7UA 1QRND 3Q6GL 3RVVD 1HOCA 1KIPB 2G5BA 2XQBH 3EAKA 5D2NE 2XACC 4TSBL 5E4EC 1ZAGA 1K8IB 2CSPA 3RWDA 4H20L 1I1AB 2Q8BH 2V5YA 3WO3B 2R8SL 1NQBA 4RFOH 3RL2A 1ZHLA 1G7LA 3DUUB 1MIML 1HILB 3ZKND 1T1ZB 2YRLA 4GG6E 3ARQA 2NY3D 2BSTB 3C5JB 5LXGH 4WUKH 4E41A 4PJDB 1IJ9A 2CKBB 2NTFB 3L3OB 1NDMA 3VFGL 2B4CC 4HIXL 3ALPA 5JQ6H 3VXPB 4M8QA 1T20A 2VZSA 3AXLB 3W5MA 1YEGL 5C07E 2R0WL 2NX5D 2QQQA 4NFDA 4G5ZL 2GJJA 1BVKA 2OMBA 3DSFL 2CR6A 2I5YH 1S7QA 3JTSB 3JUZA 4XTRD 4EQ2A 3O8XC 4LPXA 4G6AD 2P8LA 4Z78A 4G8GD 3BP5B 5GIRB 5LGHH 1B90A 4ZO8A 1JPSH 4X6EB 4FQQA 5K93A 4RMWA 2G9HB 2X4PB 4FFZH 3VWJA 3HZVB 3WE6A 4LCCA 3N85H 3PE9A 3VE0A 4JQVC 1N6QH 1PYWA 4RMQA 2D7OA 5D7LD 1FFOB 2Y4SA 4PRPA 1PKQE 2WUCH 3KPRB 2ZSWA 2HT4D 4P2QD 4HK0B 3KVQA 2WZPD 4QRSB 2XTJB 4LVHB 3R06B 5IWLC 1JN6A 1BGXH 4D0CA 2HFEA 2VH5H 5L2KE 5T5FH 1NANH 5IFJA 2J2ZA 4JKLA 4HWBL 3ARBA 3SE8L 5IB2A 2ITCB 2KZWA 4QNPE 4JFYA 2BNQA 4H25B 5DHVB 3QXUA 3PL6B 1CXKA 1TZHB 4BQ6A 1JP5A 3EDDA 3MCG1 5GJTL 4F33A 3KXFE 1I8KA 1UXSA 4HK3J 2R23A 3F12A 4M4RA 5EZLA 5DMKB 4AENA 1G7IB 3LQMA 3T0EE 3EZ8A 4LSPL 5D7SH 2X5PA 3WFCL 2VN4A 2WWKO 1U3HC 3ZKSD 3MJ8B 3S88H 2Q86B 2W91A 4JFDA 5B39A 4G8EB 3QFJD 5I76A 4OKDA 3IDYC 4UU9A 5HHOB 4BFIB 1J12A 3ILQC 4MJ5B 3S37H 3K7UA 3MCKA 4NFCA 3RKDD 2OX5A 1HIMH 3WSQH 2FL5A 1AXTH 1AE6H 1A14L 1I1FA 3CH1B 4V1DB 5DD1L 1TCMA 4HUVB 3FTGA 5IWLA 2WNGA 3FQNA 3GM0A 1SVZA 3OKNA 5E5MA 4KAQH 1SEQL 3O4LB 5GRUH 1HCFX 3TBTA 2J8UF 3SE3A 1KLUA 3B83A 3O2VH 2V7NB 5AUMB 1U8QA 3NTCL 3UPRA 1RD6A 1AGFB 4HPYL 4U1MA 1OGAE 3BVNA 4C55A 5IMOA 2XKUA 5KSAD 5D70L 1WBYA 3IKKA 3B2VH 3MRPA 2HWZH 3K3QA 5LAXA 1I1YA 4QHUA 1EFXA 4YIQB 3JV4A 5EC1A 3RWFB 4PRDA 3G08A 4PJGB 1U3HA 4M7JL 4I9WE 3RWGA 1A7QL 1XGUA 1KB9K 4ZYKA 2XXMB 1CLOH 5DYOB 1NCAL 1WV7T 4GMSL 3MA9L 3BXNB 2RGSA 2XICA 2CMRH 5DO2C 1XGQB 1QA9A 4L3CA 4OGZA 5CBAA 3OZ9H 1UXWA 4PJCB 3N9GH 1D9KD 1RIVL 3RIFF 3TT3H 4JJHA 4X7FC 4XP6H 5FIEA 3X11B 2DQTL 1QRNE 4TUOA 5SV4A 3WXWH 4JFHE 1S78D 1QBLH 4KK9D 5SWZA 2CKNA 3KPNB 4QRRB 5KSUB 2IPTL 2Z92A 1C08A 3HZYA 3GSUB 1XF4B 1OP5K