3PV7A

Crystal structure of nkp30 ligand b7-h6
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
222
structure length
212
Chain Sequence
b'ADLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDDKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNQEDPGTVYQCVVRHASLHTPLRSNFTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig-like domain-containing protein DKFZp686O24166/DKFZp686I21
publication title Structure of the activating natural killer cell receptor NKp30 bound to its ligand B7-H6 reveals basis for tumor cell recognition in humans
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 38
structure length 212
sequence length 222
ec nomenclature
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3pv7A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3pv7A01
3JTSB 2VQ1B 2V7NA 3B4NA 3V5KB 2SEBA 1P4IH 3U36B 1RZIA 3JWDH 1EGJH 2Q1EA 1OGTB 4NM8H 3EOAB 4TRPL 4F7MB 5FO7A 2FB4H 3QCTL 2C7UA 4WUUB 3I6KB 3MOAH 3D39E 3VA2C 4NKMA 1KULA 3PWLA 1ZV5A 4CADA 3ARGD 3V0WH 1I9IL 1J1XL 1H3TA 1GVIA 3SDXB 1JPGA 3G5ZB 5KS9A 4NHUB 4GMTL 4OF6A 3HFML 3V6OC 1O7SA 2G5BA 1QSVA 2VIRA 3ROLA 3DHMA 3VXQA 1NGQL 2ADGB 4KROD 1OARL 4LSPL 4U1MB 1Q8MA 3EZJB 4XNUL 4D9RE 3RWHA 2J3SA 2WAHA 4MB3A 2I60L 1X5JA 2F8VA 3N85H 1ZHNB 1XF5B 3ULUC 8FABA 4B0MM 4EVNA 2NXZB 1MAJA 4C4KT 5J8OA 3HI6L 1CDJA 4Y4FA 4K3EL 4YDJA 3QT2A 3T0AA 3JV6B 1A7PL 1AHWC 3EFFA 1XMWA 4TUJA 1A4KA 1R5WB 4PGDA 2X09A 5ANME 1JK8A 3TBYA 1RZFL 3CFCH 3HC3H 1IRAY 3L5XH 2OTUB 1T5XB 5IBTL 2I27N 3ZDZE 2DQCH 4LKCB 3NIFE 1CGTA 4U49A 3KPQA 1X5ZA 3B2UD 2FWOA 1ETZA 1RK1A 3BE1H 3AM8C 3AAZB 5GQBA 2OL3H 4FABH 3N1QC 1EDQA 2R15A 4S1QH 3UZQA 3S8WA 1O5DT 5I9QB 2D4FA 3KLAB 4PBWD 3IJHB 4QRTA 4ZOEA 3TP4A 2VC2H 2D03L 1RURL 5FV1L 2RB8A 3UJJH 3J8F7 1SM3H 4E5XB 2Q8BH 4ELMB 1RULH 1FJ1B 5IHBA 4Z0BH 4MQTB 3S34H 3V9FA 4G7VH 1LE9A 4LSDA 4NCDA 4FQCH 3A0OA 5H35B 4E41B 1J8HE 1PFCA 1U8HA 2J12B 2VITB 1S3KL 5BOPA 4IRSD 1GRWA 1Z0NA 3RA7H 1JNHB 4OCNC 2R23A 4LLUA 4PJCF 1RUPH 1CDYA 1IARB 5LGJA 3O8XA 4TVPH 1RZ7H 2CGRH 1KN2H 1V05A 3OKEA 3QJFA 1H8SA 1ZEAL 3VFGL 3QFJE 4LNVA 1PEZA 3VGBA 1X5GA 3KNBB 2ID5A 5D7SH 5DJ0A 4A6YB 3LKSB 3NABH 1KG0A 5KVDH 2VR4A 4MJ4A 3VD9A 3ISWA 3SBWC 3LS5H 3FQXB 3WJLC 4P3CH 1IGML 1WWWX 2FJGA 5DQ9B 1HSAB 1QFUH 2H2SC 3U1SL 4PV8A 1TJIH 5DGQA 1A8JH 5DHXB 3T1FA 2R2BB 1NJ9B 4HK0B 3RWJB 3Q5OA 4PRID 4QXUH 4Q9RL 1OAKL 3HZVA 4HQQL 3QDMA 2GCYB 3LN5A 5HVHB 4BFIB 1G0YR 2HT4D 4PJ7B 4P4KA 5SWSD 5J6GB 1NSNH 3BW9A 4JE4B 4LSVL 1J5OL 2WBJA 4WW1A 3ZZ1A 1G7LA 1NCDL 1RZ8B 6CGTA 4LCUA 3OAYK 2NW2B 1KCUH 4I0PA 1HKLH 1JUFB 1C12B 4GRLA 1IGCL 1D9KD 2E7LA 4KKBC 3DETC 1ZS8A 3MUJA 4O51A 3WL9A 3LRGA 5B22A 1FE8L 1WAAE 3DV4B 3SDAA 1LDPL 2DQHL 2NZ9D 5JMRA 1FIEA 4S1RH 5JLZA 4OIIH 1MCRA 2IH3B 3BO8B 4XH2A 5DEFB 3JVGC 1QRNE 3VCLB 3TVMC 3HUJB 3VXSA 2CQVA 3PP4H 3WO4B 5FK9B 1RUAH 5FYJE 5BCAA 5DF0A 1QPPA 4LKXA 2DWDB 3GNMH 4FQ1H 4YHML 4G80A 5C07D 3VI4F 4BKLB 5CD5D 4HJ0C 1N7MH 2AJVL 3STLB 1F6LL 4HUUB 4NJAL 4RRPG 4EUPA 1T7XA 2F5AH 5L6YH 4X99B 2VXUH 2BNQE 1LK2B 1QYGH 4R4FL 2ZZUT 1GZQA 3SOBH 1BVKA 5F1IB 1CLOH 1OP9A 2YBRA 3HB3C 2VLJE 1NGWA 5ICYB 5BJTB 3ARTA 3WXWL 4L3AA 2R0KH 1B4JH 1BBDL 2BNUB 1TFHA 5HGHA 3QO1B 5ILTH 5E1HB 1S5HB 4Z7UB 4MA1B 1I9EA 1P6AB 5GS2D 1CI5A 3SE9L 4X8XA 5JNYA 3U83A 4N0FA 2ZSVA 5C2UB 1N0LA 4IIQA 1F4YH 3MRRB 5CCKH 2FX9H 5D5ME 1EVUA 1S7TB 1CD9B 5GS1B 2BRRL 3O3BA 2DL2A 1TQCB 4QXWA 3JXAA 4DGVH 3CDGA 4JVUA 5CBEB 3WSQL 2A6JA 3CSBA 1OWWA 4OD3H 1LEKA 3CXDH 5I1EL 3U4AA 2WWMC 4NDMA 3BP7B 4Y1AA 3ECBB 4X9FA 2EICA 4YBLC 1HXMA 5GHWL 1XH3A 4ODVL 3MV11 1QSFA 1FRGL 2VABA 3MO1A 1J7VR 3OKKB 1EXUA 2V5SA 2C3VB 1SVZA 1M7XA 3P0YH 1NBVL 2DRUA 4LP5A 1T7YA 4XB7A 4YHNB 4C57C 3T4AA 1WCQA 1Z9SA 1A64A 1UM4H 1LD9A 3CD4A 1MQKL 1BVLA 2PXYD 5HYQB 5C0JB 4NKDA 3EO9H 4P5TD 1N6UA 2APXA 2UZIL 3BSZH 1MCIA 3RIFF 4H26A 3IAGC 5IB2B 4GAFB 5GSVA 1AKJA 1OTUC 4LIQL 4LLYB 3G04A 1NC4A 1C08B 4MMZC 4LGRB 3H0TA 5I17A 2YPKA 1M05A 4LRIA 4MDIA 5F1SA 4FQ2H 1I3RB 4GG6F 5CEYB 1NEZA 1YEIL 3MRDA 4O2FA 1B0RB 3C5ZA 3ROOB 3UJTL 1IM3B 1YQVH 3V2AR 3HC4H 3RIFK 2Z8WC 4CU8A 1BEYH 5FA3A 3MA7A 4LSSL 5IVNA 3V5HA 1HH9A 2OQJB 1HHKB 4GXUM 1REIA 4XWOD 1MHPL 2RCSH 3MBEC 5FIEA 3M8OL 3O3DA 4MSWB 2XQBL 4FQJH 4JO4H 5EU6E 1FPTL 5FB8B 1IAII 1JZ5A 1FYTA 4U1IA 1I7TA 1KTDB 4PRHE 2H8PB 3VFPB 1U9KA 3G6DH 5T3XL 3DIFA 4PD4K 5JZ7C 1INDL 4H1LA 3MJ8B 2Z4QB 3VWJC 1I1AA 5BOZG 1EEZB 2J8HA 3MUZ1 5F7FA 4TTGA 4ZXBA 5D2LB 3OHXB 1OL0A 4NQXA 1IM9D 5KSAA 2CRZA 2V17L 2WV3A 3L5JA 4L4TB 3QDJB 4FZEL 5CWSA 1H8OA 1JVKA 5IVXB 3WN5C 5K9JL 4L8CA 3UO1H 2OBGA 4L3ED 5I1HL 5IW6B 4G9DB 3V5KA 1BD2B 3T2QA 1A6TB 3DVGB 2Q87A 2COQA 4X7FC 1CR9L 4H8WH 1UM5H 4F7MA 3EOAA 1XFPA 1I8LA 1I9JH 4F9LA 3DXAA 5K9OA 4WUUA 4R7NB 1X7QA 4ZUTB 4JRYD 3QEQA 4P46C 2XNAB 5FGBA 2HFGH 4Q6IA 3VFMB 3GHEH 2VXTL 2FATH 3SDXA 5CD3B 4X98B 3H9YA 4NHUA 2BVPB 1N64H 3WFDL 2XA3A 4WI3A 1KEGL 4YPJA 4K9EH 3FQNB 2F15A 1QFPA 3DUSB 3G9VA 3B9AA 3MODL 4EI5D 1IGIL 1UH4A 1QBML 2ADGA 4X9HA 5JHDB 2EYRB 1G7HB 1AY1H 3O6FB 4U1MA 2D7MA 4PTUA 4CMHB 5C0RH 3DVFA 2IQ9H 3N9GL 1A9BA 2NY3B 1NLDH 5IM7B 4ZFOL 1ZHNA 3TV3H 3QUYD 4R4BB 4XAKE 1FVDB 4WGWB 3TO4D 2CUIA 4ODWB 3JV6A 3WKML 4UAOC 1KB9K 4OZFB 5J06A 3O3AA 4PP1D 2XN9E 3WFEL 2YUXA 2EH7L 3GKWH 2VLRD 2UZYB 2VWEC 3RTQB 5GZOC 4AZ8A 4Y16B 5DQJA 4FFVD 1P7QB 3OSKA 4LKCA 2R8SL 4WTZG 1JYXA 5HHVL 2ICES 1VADB 2BSTB 3QWOB 3GBNH 3AAZA 4P99A 1INEL 3QUXB 3H8NA 3AVEA 1PSKL 3KLAA 4EDWL 1RUKL 3K1DA 1XGYH 2GAZA 3GSUB 4ODHH 4G3YH 1MVFA 4E5XA 1WZ1H 2ZCKL 2F58L 3GMRB 2DYPA 4HHAB 1ZHLA 4X6DE 4KK8C 1GIGL 5H35A 32C2B 5DD5L 4DKEL 2NY4C 2EC9T 1JNHA 4MNGB 5IMMB 3NVQA 1MRDL 1KTKE 4XGZA 5SV4A 3Q6FA 4OLYH 2DJSA 4RWHA 2R0ZL 2ZUWA 2NY1C 3GO1L 1FDLL 5GISH 4M5ZL 1S9WB 4XXDA 4LASH 4OKVB 4PJHB 1NCCL 2CRYA 4A6YA 1A0QL 2K7QA 2R0LL 1KYOK 3LKSA 2YUVA 4APQC 4W6WB 4L4VB 1RIUH 3FQXA 3W11C 4YNYB 1OVZA 5EBLA 5T1DH 1W0VA 1RMFH 2Q7YB 2NQCA 4KQ4L 4NO0D 5BZDB 1PD6A 1BOYA 2R2BA 4C58B 4HK0A 1S7UB 5EZLB 4UNUA 5JXED 4MNQD 5TF1H 2GCYA 1MNUL 4BFIA 1I4FB 1AHWB 2CH8A 1DEEA 3T0BA 1TZHA 3GI8L 5J6GA 4BUHA 3CLEH 4KRPD 3OAZK 2X4SB 3IB4A 1RZ8A 3NIGF 1KCRH 2L7JA 2NW2A 4ODSH 4ALAH 2JELH 5JDJA 1C12A 1MIMH 5ESQB 5D72H 5EIVA 3QG6B 2EE9A 3KPSB 4JFFD 3IFOB 5EULV 4GS7B 5IV2A 3DV4A 1UA6H 3QQNA 4U4BA 3ZDZF 3RBSA 4KGJA 5E0QA 2YRLA 5D1QD 3T65B 2HRPL 5D2NC 2Y7QA 2ESVB 4RMTA 3TZVC 3U0WL 5EOQL 1RV6X 2IH3A 3BO8A 4S0TD 4YFLF 4N0RA 4RX4A 3HUJA 5BW7A 1C8PA 2O26U 4YBQD 2IPTH 2R2HB 4OF8A 3DUUB 3QDGB 4U31A 5A3ID 5C0BE 2Q86B 2DWDA 1UKQA 5L88H 3U9PL 4BKLA 1H3PH 2R1WA 4F8QA 1UWEL 3STLA 3HNTL 4MZ3A 2VDLL 4HUUA 4PJ8B 4WHCA 3ULSA 3D25B 3OKLB 1LK2A 3UTPD 1SQ2N 3QHZH 5E70A 1WEJH 3GJFK 4GAGH 2NY0D 4XPBL 4Z6AT 1ZLWH 5ICYA 5BJTA 2XTLA 2J8UF 4H0GA 2D0GA 1OD9A 4U2YA 5EORL 4P9HC 4QRRE 2E6QA 4Z7UA 4QRPA 4Y4FD 3D9AH 3KYMB 3DROB 1V7NH 2XICA 5EUOA 3MRRA 1S7TA 3ZDXE 5GS1A 5D93C 3WS3A 5IT2H 2YZ1A 5CBEA 1CDCA 2N7BA 3KPOB 4L29B 1HSBB 4BH8B 5GSRB 5L2KA 4X6BB 1ZVHA 4KDTC 1INQB 1JNNH 3BP7A 4XVTL 3ECBA 4MQXD 3FRUB 2OJEB 4XC3L 1F4AA 5D1ZB 5E1AB 1PKQE 3IJSB 5D7LB 4XI5D 1BM3H 3NCBB 1CXKA 1CGSH 3QIBC 3M45A 4Q9BA 3OKKA 3NA9H 1KLGA 2C3VA 3EDJA 3GEWB 3VXME 4FQXC 1M7DB 5ID0A 4DVBB 4YHNA 5JUEL 1QBLL 1ROWA 1MJ7L 1QLEH 3ZL4H 1MCOL 5CGMA 5DT1H 3KWWA 4NGHL 4OCSL 3FB5A 3BDXA 2R4RL 4NP4H 1U93B 2GSIB 5C0JA 1JPTH 3DRTB 3NCYS 3O4LA 3BAEH 4LLVB 4ZSOE 5IB2A 4LLYA 2MTPA 3O8XD 4PJXB 4A6YL 5EOCL 4NUGL 4TSCL 1C08A 2AJXL 3P11L 2AS5M 1IAIL 4K94H 5IESH 1T0NA 1W0WB 4UTAL 1N5YL 2FBJL 2WINB 4Z7VB 5GGVL 3P4NB 2UVEA 1G6RA 1JF1B 4PLKD 2OTWB 4OUUB 3BVNA 4LSRH 4AG4H 5CEYA 3ROOA 1BQLL 1L7TL 3L3OA 5AZEL 2XV6B 5F21B 1J0IA 3QCVH 4NCC2 1FO0B 1IAKB 3S88H 2WBKA 2GK0B 4ORGA 4QOKB 4MSWA 1YECH 4XCCL 1CF8H 4YFDB 5FYLH 3VXRA 5BV7B 5FB8A 3ULVE 2VDML 1CICB 4IEFB 2DF3A 2Y4SA 1IC1A 1RK0A 1U8PA 1EO5A 5HHME 1SEBA 3QDMD 4HWBH 2H8PA 3D2UA 3LHPH 4F8TA 5JW4N 4XP4L 1NUFA 4I3SL 1OAYH 4P4KD 1CL7I 3MJ8A 4LLMB 3HN3A 4Y5VC 4U6YA 2KUTA 1NDGA 5D2LA 3OHXA 4GRLD 3NFPB 4KJPD 3KYNB 5T3XD 3VFVB 4N8VB 4L4TA 5CJ5A 4Q2ZB 3TA3A 2YKLH 5JIHA 1S7XB 3SDAD 5C8JA 3BZ4B 2WWKT 3WHXB 4LCIL 4JFHD 1BD2A 4X5XB 5FV2A 1A6TA 3DVGA 2JJSA 3WDHA 1P4LA 2Y6SD 1SBSH 1BFTA 4ONGL 1BJ1H 3VXSD 1JTOA 1NAMH 4M93C 2XNAA 3VFMA 1RZJH 3QZWB 4Y2OA 4P3DB 2JCCE 1CD0A 4ZO9A 4X8JB 2BVPA 4FA8A 4KI5D 4KPHH 1A6ZB 5DK3A 2QSCH 3FQNA 3OAZH 2OYPA 3DUSA 1OAQH 4KKCD 1FG2B 3AU1B 1SJHB 2HLAB 4GW4B 4ZTOL 5FOBB 5JHDA 1H5BB 3O6FA 3OAUL 2QR0B 2NX5B 3C60B 4EN3B 4O4YL 1UACL 4TPRL 4G8EB 1HHGB 4G6AD 2XZQL 5E4EC 2WIMA 3TEUA 2NYYC 5IM7A 1NLBH 4OZGB 4R4BA 3HE6A 5IQ7H 2QHRH 3LH2L 3VRIB 4JHWH 5HJ3B 4PJFB 4UV7H 4NNPH 4ODWA 4QXGH 4AH2B 1GGYA 1NUDA 3TT1L 3KLSA 1FBIH 2BFVL 4XBEH 4LBEB 5DJDB 4EIGB 4OZFA 3BRFA 3RX8A 4YHPA 2X4NA 1PLGH 3QIUA 1CD8A 1MCQA 2WWKO 3TBWB 1FYHB 1U95B 3GMOB 2V5TA 4P2OC 4U0RC 2C5DC 3RTQA 3T3PF 1N5AB 4KK5C 5HGBA 1P7QA 4WI2A 4P48A 3THML 4S1SH 4QHUA 5FO9A 5HI3C 3MOBH 2BSTA 3QWOA 5GGTA 4Y1AD 3QUXA 4M6NH 3VWJB 3SE8L 2F19H 1NEUA 3CGTA 1CDGA 1QSFD 4FXKB 5DJ8B 1R5VA 5JXAL 1LO4H 3O6ML 4GAYA 2HLFC 1ZVYA 3MFGB 3D87B 3C8KB 4JKPL 5CZXC 4YO0A 3GJFH 3MLWL 4QKXB 4O2EB 3GMRA 3WN5B 3IKKA 4NT6B 4HHAA 2IPUK 3RRQA 5DO2C 1JE6A 1G7MB 2HJLB 2HKFL 4F80A 3MJ7B 1UYWH 32C2A 3DI2B 4OT1L 3X3FL 5F96H 2PTVA 4MNGA 4HS3A 1JIBA 4YHZL 3KPLB 5CMAA 3FB6A 1AH1A 4I77L 4LLQA 3VGFA 1AKJD 1NFDE 5DUMH 3W0WA 5F6IC 3T2NH 2K3TA 1NC4D 4OKVA 5ALCH 3MBXH 5KAQG 1FGNH 3V6OA 2ED8A 3MCG1 4PJHA 1YZZA 3BP6B 3NPSC 1XF2B 5LWYH 2VDKH 4BJLA 1F90H 3HPJA 4L4VA 3CK0L 5KSVB 3CXHJ 1YPZA 3C5ZD 2UUDK 2FIKB 2J88H 4UNTA 4JR9L 1ZVSB 4LRNH 5BZDA 1Z2KA 4EI6A 1R5IA 5EZLA 1LGVA 3C9NB 2ZUXA 3BQUB 5IUSA 4POZD 2FEDC 5DUPL 3FRPG 3OGCB 1DUYA 3P0VL 4CRPA 1FIGL 1I4FA 5DJXB 1AHWA 5I1JH 4KZDH 4XHJC 4I13B 4POYA 2LV4A 1K6QH 2JB5L 4HS8L 1I1AD 5DRZA 3K0WA 3FFCA 7FABH 1YY9C 1R3KA 2Q20A 3KPSA 4ZXBD 4MCZB 4KC3B 5KVEH 3AM8A 2CDGB 4JPKL 4X7DC 4WFFD 2H32B 5KSAD 3OJMB 5I18H 1J0ZA 1YDPB 3T65A 3HLAA 1KJ2B 1XGTB 1DBJH 2ESVA 1L0YA 1EZVY 3RZCC 3S3SA 5IVOA 1DQLH 5DHVH 5FM5M 3LKOA 3MXVL 2BP3A 5DGRA 4MJIB 4O58L 5DFWH 3QDGA 4NSKA 2GJJA 3EZ8A 1NKRA 1ZT7B 2AJUH 3DXAD 4WUUD 5DR5L 2Q86A 4JFPA 3F7QA 5FYJH 3ETBF 4J7RA 1R3LB 3TO2B 3H3BC 3O0RH 2VZTA 4PJ8A 5F6HJ 4JPIA 1K8DA 4X6DF 3HZMB 5INCB 2F5BL 3D25A 2O5XH 4U6HA 3OKLA 5FUOL 2QLVB 3HG1B 4MZ2A 1K2DB 4ODTH 1R0AL 3PWPE 4QRUB 5F3HB 1DBKL 3O3UN 5D9SA 1J12A 5D8JH 1X5FA 3NH7L 4G5ZL 4XNXH 3OZ9H 1U6AH 2ITDB 3SBWA 3PWJB 4O02H 4UUJB 3BOVA 3I3EA 4YX2H 5C09A 5D71H 1Z9LA 2C26A 4Y5XB 1JGUH 4OFKA 1C5CL 5GGTL 3WFCL 2N1KA 1XZ0B 4KK9D 1ONQB 3NCJH 4MQ7B 4L29A 5DD1L 3Q3GB 4BH8A 1DVFC 2ILLA 5GSRA 4X6BA 3ZO0A 2Q3ZA 4H20H 3IFNH 2OJEA 3VFUB 5D1ZA 5E1AA 5J3HD 3SGDH 5D7LA 3RVVC 2K9UA 3VH8A 4GRMB 3FCTB 1Y18B 5DQDH 4G42B 3G08B 1IGFL 5HDQL 1WQVT 4X6CF 4XP6H 1N0XL 4DVBA 4GO6B 4K7PY 2EIZB 4L1HA 5C0FB 5KW9H 5CKGA 3MJ9A 1ULVA 4RMSA 5D2NB 3TZVB 2DYPD 3BH9B 3IDGA 5DEZA 1U93A 5KVGH 4FRWA 3JVGA 3DRTA 2X1WL 3PWVB 3H42L 4HKXB 4JY4A 4EXPX 5C0NC 3S4SB 3VD5A 2QL1A 3T8XB 1KV3A 4ZFFB 3KGRA 3VG9C 4PJXA 5D6DC 4RIRB 1TVHB 2XPGB 4P2YA 2ERJC 4NCC1 1T1ZB 5CIPH 3SO5A 1W0WA 3RVXC 3D0VA 5F72S 4RGOH 2AV1B 4F7PB 3P4NA 4LMQE 3BZDA 4YHKH 1JF1A 2HAZA 2OTWA 4OUUA 3GSVA 1P2CA 1CL7L 2R9HD 4JM2F 4Q58C 5GRWA 3VU2A 4JZJC 1FL5A 4KRLB 1YNKL 3BKYL 3SGEI 1F58H 1PAMA 1DL7H 4QOKA 2GK0A 2ZOLB 4I3GA 4OF0A 4UBDD 3QFDB 4JG0H 1CICA 3KYKL 3E6HA 3A67H 3GMMB 4QWWD 1H9VA 4YXLL 4L3EE 3RPKA 4G7YL 3KPNA 4OJFL 4FQHA 1B88A 3W9EA 4JDVB 5FGCE 3WD5L 2EC9U 4UQ3B 2BSED 4TUKL 4L4JA 2AJYH 4AQ1B 1IC7L 4XC1H 4F58L 3LEXB 2V2TB 4JHZA 4R2GC 3WLWC 2FD6L 3ARQA 4JRYE 2I9TB 4JY5L 1TDQA 3NFPA 4YAQB 1QD0A 3KYNA 3R1GL 1P5VA 2HP4A 1JHTB 4N8VA 5E24E 3UBXB 4DVRH 5ISZB 2DJ4A 3CCHB 2E27L 3G5YB 1QHPA 4Q2ZA 1S7XA 2QTEA 4HS6B 3KR3L 1FNSH 3IDIB 5F7YC 3WHXA 4JRXB 4RAHA 4X5XA 4X5LA 2UUDH 4YEEA 4NWTL 5DJ6B 3U4BH 1VPOH 5CGYD 1CGWA 1X6NA 3WNNA 1YN7B 5SWQB 5JHLL 4TULH 4PLJD 1CLZL 1LO3H 5E99H 4RX4D 3O2DA 1J1PH 4NZRL 1YYML 3QZWA 3IU4L 4P3DA 4X8JA 2X89A 3CX5K 3HZKB 3MCLL 4NQEA 5E2WL 2PW2B 1N8ZB 3DURB 1FG2A 1HHIB 1SJHA 2HLAA 4GW4A 1H5BA 4LCCB 4AYFA 1FZOB 2QR0A 4U7MA 5GGVY 2NX5A 4EN3A 4AM0A 2CUHA 2FX7L 4OI9A 4G8EA 4JFDB 1J88A 3ARZA 3QEHB 1GPOH 4K3JL 3R8QA 4P2RA 4OZGA 4OIBA 4UIKL 4Y0GA 3KXFB 4UV4L 2MJWA 3VRIA 4HWEH 5HJ3A 4PJFA 1H3GA 1ADQH 4HXBL 4KV5E 2EIEA 5I19L 4AH2A 1C5BL 3U7AA 5DJDA 1K3ZA 3MBEA 4P5KB 1HCFX 4ELMF 1BQSA 3OB0K 1KFAH 3D0LB 3LV3A 1G1CA 1XGQB 5DD0L 3TBWA 1U95A 3CJJA 3GMOA 3PDDA 1NGPH 2B0SH 2E7BA 4YE4L 3P0GB 1N5AA 4M48H 2CIIB 4OGXH 3R8BB 4DKDC 5L2KD 3GFUA 2J7LA 4NZJA 3VW3H 2YK1H 5T3ZL 4NRYA 3VWJA 5J0BA 3CC5B 3ZYOA 1GHFH 2E9JA 4ONFL 3MJ9L 4RFNB 5I76B 4FXKA 5DJ8A 1P6FA 3G6JF 4OF5A 2EDLA 1EBAA 2HKHL 2VDOH 3NAAH 4HF5H 4Y8DC 3C8KA 3K4DA 4DEPC 5C08B 4IS6B 3WN5A 4NT6A 2DMKA 4N68A 3VXNB 1G7MA 4R3SB 2HJLA 3CVIL 1TQBB 3MJ7A 1JPST 4QCIB 1CE1H 3L1OH 3ARDC 1VHPA 1MFDL 1E4XI 3QYCA 3RKDC 5ALBL 5EO0B 2FR4B 4P46A 3O4LD 3NGBC 3I02A 3HMWL 4IRZL 1XGRB 1EFQA 4YGVB 1WTLA 4X80H 4L5FH 5GS0H 4PJ7F 1QLFB 2GKIA 3BP6A 4MB4A 4R90L 1XF2A 1FO0L 3AY4C 2CRMA 5KSVA 2I26N 5BV7L 3ULVC 2FIKA 1F4WH 1AD9B 4ZFGL 4PJIF 3UYOD 1ZVSA 1LP9B 3MLPA 3RGVC 2HT2C 2VDNL 4OZIF 3MLVH 5DK2B 3C9NA 5GPRA 3O6KL 3OKOB 4JFFE 4L8BB 5AYUL 2WK2A 5JMOC 1FVEB 4U6XB 2QQKH 3OGCA 1M4KA 5DJXA 5BS0A 3DYPA 4HJJH 2YD2A 5ADOL 3ARGC 3K2UL 2FECI 1PY9A 2HTLD 1O7VA 4PY8J 2MWCA 5ERWA 5C6TL 3DPBA 3ZYJA 2KQNA 4HBQA 1LK3H 1T2QH 2CDGA 5HHOA 4KROC 2H32A 2VDRL 1DBAL 1YDPA 3MRHB 4L4TD 5C6PB 5KS9E 3TJHD 3QDJD 2DTML 4DCQA 1JHKL 3TA3D 3O2DL 1G9MH 1LE5A 4TTDC 2YD4A 3UTPE 2ZUUA 1L7IL 3GSRA 1BD2D 4S10A 5IR1B 4KMTL 5IHZA 1D5MB 3V4VL 3FO0L 5EPMB 2OZ4H 1PZ5B 1QSEB 4MJIA 4W6XB 1KN4H 4HUKB 3QUKB 5FUCE 1A3QA 2F53B 3HNVH 4D9LL 4GKZB 2AJZA 5I6XB 1HIMH 2YSSA 1R3LA 1W72H 5IB3B 3MXWH 3U9UB 3HZMA 4G8IA 4UNVA 1LVEA 3HG1A 1MFBH 5JW3H 1HINL 3IAQA 5F6IB 1EV2E 3B2UC 4U1SA 1KLFA 5JHDD 4H88H 3O6FD 4BQ6A 4TYUA 2A9NL 4JDTH 5C2BL 5AD0B 2NY3D 4O9HH 4GMSL 2IG2L 2ITDA 3HE6D 4UUJA 2VR5A 2VOTA 3WDJA 2F9BT 1RUQL 2A6IB 3SCMB 4ZODA 3VRLE 1RJCA 4Y5XA 1S78C 3N1GC 2CMRH 1BVZA 1Q9KB 5DS8B 1FNLA 2VRAA 3L7FB 4FOMA 4OQTA 3MREA 1EK3A 4IRSC 2DQUH 1G7PB 3QIUD 5I1DB 1XZ0A 4P5MB 1KIPB 4XHQA 4MQ7A 1CLYL 4UZGA 3Q3GA 3TWCL 1JZ2A 3RTQD 1P7QD 3EJJX 4YLQT 2JJUA 3VFUA 1DUZB 4LQFL 3QUXD 5IW1B 4GRMA 3FCTA 1Y18A 1JHLH 3OKMA 2OP4L 2V9TA 4G42A 1XCQA 2FH8A 4K3DH 5I1GH 4TSAL 2UV3A 3EYQD 1I3VA 4LF3B 1JYNA 3UDWC 5DI8B 1YEDA 2EIZA 5C0FA 2AK4B 3EAKA 1NL0H 3JTTB 3OKYA 2OL3B 1UVQB 4XVSL 5EA0L 1Q9WB 1MRCH 5D2NA 4MX7B 3TZVA 3BH9A 3W39B 4NC0B 2AERT 4LIQE 2B2XL 3NOIA 4ZYKB 3RWIA 4XVUC 3H9SB 3CX2A 1HHHA 1PG7X 1EUUA 2B1HH 3PWVA 4HKXA 3RNKB 3S4SA 2ZKHH 2V7HB 3FFDA 5A2LH 3CFDB 4FP8H 3T8XA 4ZFFA 3OB0H 3JSSA 2HT4C 5SWZB 2XPGA 3ES6A 3REVB 4FNLL 3W0WD 1T1ZA 1YMHB 2AV1A 4F7PA 2DQJH 1IQDB 1D9KC 1FSKB 3ZE2E 4S11A 2YD5A 4L4VD 2PW1B 5EN2B 1M71B 2VDPH 1KB5H 1WC7B 5EU4B 1J0JA 2EZ0C 2GFBB 3EGSB 1Q94B 3DX9B 2FIRT 2ZOLA 2NZ9C 4KDWA 4LEOB 3DARA 2AGJH 4ZAKC 3QI9C 3ULUD 3GMMA 2EYTA 3NZHH 5FA4B 3LQAC 5D7KE 1CD1B 3B9KB 5F7HA 4JFHE 1JWSB 2NXYB 1BLNA 4JDVA 4UQ3A 1IILE 3UJIH 5CLTA 2X7LB 3LPWA 5CD5C 5CJQL 4I18B 1QR1B 4U6VL 3FFCD 2I9TA 1KJ2L 3VXSE 4KDTA 5H2BB 4YAQA 6FABH 1N6QL 5CLWA 1JHTA 3KPSD 2QV2A 5D70H 5ISZA 4HDIB 3RPIB 2W65B 3BRGC 3PDOB 3UXFA 3QXVA 2B8OT 3G5YA 4JO2H 4KI5E 4OTXH 3QIBA 2IJ0C 4HS6A 2XA8L 3IDIA 3CFJB 5FCUH 3ALXA 2VLKA 4FQXA 2ESVD 2G60L 4PRBA 2X1QA 5F93C 5DJ6A 3K81A 1RIVH 2QADB 4QLRA 4YFEA 4QRSB 4JGMA 5SWQA 1TCRB 1B2WH 2WW8A 4WTZA 5E08L 3QPXL 3IU3B 4M1GH 4KJQC 4KQ3H 1A6UL 4PTTB 3QDGD 5T1MB 4FXGA 4LHJB 5I8CB 2XZAH 3T0DA 1D5BB 5IHLB 1VEPA 4OLXL 4S1DC 4WUKH 1OTTC 4PJ8D 1WWCA 3BPOB 1A7RL 2PW2A 4J6RH 5J57B 1MAML 1HHIA 1K4CB 4LCCA 2YD6A 1FZOA 3UYPA 4FZ8H 1ITBB 2BVTA 1DN0B 5INDB 2C4XA 3L3GB 1ZGLA 1JMZA 2BY2A 4JFDA 3G6AB 4ZUUB 2YS4A 1G9NL 3NIDF 4Y1AE 5F7MC 5LGHH 1H15A 4OQTL 1GH7A 3GGWB 4M5YH 1KJ3L 1ZSDB 5K33A 3WUZA 5C09D 4X6FB 5IJVB 1WBXB 3C6SB 4C83B 1XGQA 2P8LB 5SV3A 1I9RH 1JPSL 4P5TC 4K23L 3QISA 2FYYB 5GRVK 1WJ3A 3HMXA 1FLRH 2VZUA 5TDPA 5FKPA 4IMKC 5B38G 2DMCA 3CC5A 2CDFB 5D1ZD 3MLSL 3P3YA 4Y5VA 2AVGA 3CNKA 5D7LD 5I1KL 3WFBL 4PJGB 3I9GH 5JW4R 2V6HA 5IGXH 1KBGL 2PETA 2R1YB 3OG4B 4KKBD 1MHHB 3Q6GH 4R7DA 3QQ9C 3PIQB 3X14B 1BJ1J 1PQZB 5C08A 3DRQB 5T3ZD 5IKCB 1EAPB 3UTSB 1EX0A 4IS6A 3VXNA 3DVIA 1KCSH 3TIDB 2EECA 4M7LH 4L8DA 2H41A 1MCEA 4XWOC 4G9FB 4HG4J 5DJYB 5IFAL 1I1YA 1KGCE 1OAXL 2JLLA 3GBMH 5LBSL 1KPUB 1AGDB 5EO0A 2FR4A 1UH3A 2QSQA 1RJLB 4HJGA 4ELKA 2DBLH 4XNMA 1F4XL 1HWGB 4OV5B 1XGRA 3GI9L 4YGVA 2FHBA 1Z0MA 2V5RA 5LXGH 2K1MA 5DZOA 4XPHL 1QLFA 1FYTE 4HJ0D 4WEBL 4UDTB 1T0MB 3V4UH 2CO7B 3C09C 5EZIH 4BH7B 5I71B 4NNXB 3S36X 3FTGB 1ZLUK 2FECL 2UWEF 3O4OC 5M95B 4KJYB 1BJ8A 2NY7L 2A77L 1N3NB 1AD9A 3QAZC 5FM5O 2OR9L 1IT9L 3QEGL 4PGZA 1LP9A 1XGPB 1T21B 1MFEL 4QOKD 2APWA 3HB3D 3PE9A 5DK2A 1IC4H 4MD0B 3OKOA 1FVEA 3KPTA 4U6XA 3MPCA 3T4YB 1CICD 1ZT4B 3MGOB 5I73B 1IEBB 1V3MA 5D6CB 1YC8A 4P57B 2APFA 1UEYA 4AEHL 4Z5RB 3SGKC 4G8FB 1GSMA 4KV5F 5E6IB 3LIZL 4YHLH 5F6HI 1AXTH 4P2OA 5CEZL 3PGFL 1ACYL 2NPLX 4I2XE 1UG9A 3DXAE 4WUUE 3BX7C 3QEQE 4LVNB 3BH8B 2BCKA 2B39A 4HSQA 5LJYH 1JF6A 3SDXE 1BZ7B 3TBSA 2W9EL 1IFHL 5ADPH 2Z8VC 4MAUL 4ZS7H 3OXRB 4HWZA 3QUYC 3DO7B 1HOCB 1IGTA 3K3QA 2EIBA 1QSEA 2L7UA 3D69B 3SO3C 2RHEA 5GRZA 3NCYP 4PJDA 4P59L 4ERSH 1AR1C 4QRQB 5GS3A 1GGIH 2F53A 3MLTB 2VQUA 4JPVL 5AWNH 4PJCB 2VXSH 4GKZA 1BF2A 3VXTA 1MCDA 5IB3A 4KUZL 4CJ1A 2DDQL 2R56L 3BD4A 1EGJA 4CKVX 1Z6JT 2X89D 4KHTH 3U9UA 4NPYA 4NQED 4TOYH 1QNZH 1OTUD 5DMYA 5DLMH 3MRGB 5BQ7B 1U8KB 5GS2H 1LO2L 1AFVL 1GZPB 4HFUL 2BERA 3ZTJH 2B1AL 2NX5D 2ZJSH 3OKDA 4EN3D 1GGBH 2YN3A 1QFWH 5AD0A 4JANB 1MHEB 2VZSA 2IPUG 4P2RD 3LDBC 5F3BA 3PF2A 2JJTC 4ESKA 2DD8H 3QRGH 2A6IA 3SCMA 2XI9A 3LKNA 3N50A 1Q9KA 4KAQL 1XF3A 3HMXL 3MBED 2YD1A 2ZCLL 3O9WC 3RAJH 1UJ3C 4OGAC 1G7PA 4JO1L 5I1DA 1KIPA 4JVWA 4WI6A 1E0OB 3P30L 5TDNB 4HK3J 1IKFH 1H3XA 2E6JA 2VXVH 4X9BA 5E8PB 4HEME 1FVCA 4UOW0 3KYOA 3VWJD 1YN6A 5BVPH 1GGUA 3JV4B 4P9MH 2Q7NA 5ESAB 4Q74A 1F3RB 1MELA 5JOPD 1GGTA 5F7LB 4Z7VF 1S7SA 5DI8A 2BVQB 4QHNA 2W0PA 1MREL 5IVZB 3ZKXC 3SJVB 2AK4A 1YNLL 3JTTA 1UVQA 4LFHD 5SX4H 5DTFB 1Q9WA 4MX7A 3RFZC 4X0KB 3W39A 5KSBB 3TJEH 4PB9L 3HCVA 4ZYKA 4FQQB 5FCSH 1U3JA 5C0IB 1KJMB 3P73B 2CK0H 1I1FB 3H9SA 5MP6L 2AW2A 5EWIH 1DN2A 1U8NA 3O3EB 3RNKA 3AUVA 5DJ2B 3T77A 1EHLH 2V7HA 3CFDA 1PG7H 1OTSD 3DV6B 3BP5B 4P46D 3Q1SH 4URTB 5SWZA 1DJSA 3CIQA 3REVA 4KRPC 3W2DL 1YMHA 1SY6H 3AXLB 4N5EC 2P8MB 3JZ7A 3MSPA 1U3HB 4LHUB 1M7IA 4G43A 3C8DA 4XPFL 4LARH 3H9HB 5IW3A 3NCMA 4PRNA 2PW1A 5EN2A 1K5NB 3VXOB 4NKIH 1MH5B 5EU4A 3EGSA 5JIPA 4P23B 4PB0L 5J9PA 5I1IH 4Z8FH 1BREA 1RPQA 1UGNA 3VFNB 4JO3L 4PYHA 1GCFA 3ZKQD 1KIUA 5J12B 3F58L 5FA4A 4WDIB 4IDJL 2VERN 4DWHA 4XPAH 1QG3A 1CD1A 3EW3B 1JWSA 5BS0D 2A1WH 2C3HA 4GBXB 4N1CA 4RQQB 4ZNEA 5FECB 1CZ8L 3WNKA 2JB6B 3U82B 2VJXA 4LAQH 3S35H 3VRLF 2X7LA 3M1BB 5TE4H 4LQ1A 2VZ3A 1RFDL 2XOTA 2EDXA 1DVFA 1A6WL 3HUJE 4CDGC 1J1OL 4RBPH 5H2BA 3NACL 4WO4C 4YZFE 5E8OA 1KNOB 3PDOA 4Z0XB 4KKAD 4G8GA 5HHOD 2RR3A 3U46B 4W4NA 3UC0L 2H3NA 5MEPA 3CFJA 4XVJH 5ACZA 2NY0C 5FUCC 1AO7B 1MCCA 1T20B 3QCTH 3LMJL 4JKMA 4HMCA 1WZMA 4QRSA 1MVUB 5A2KH 1TCRA 2X9YA 3MRPB 3RY6C 1OWRM 5AAWA 3U0PB 4NM8L 1EGJL 2NLJB 3PQYB 1KACB 4GMTH 4MJID 2FB4L 4Y4FC 5T1MA 3E6FB 3RKPA 2HA1A 2PO6B 4LGSB 5I8CA 4RISH 1D5BA 2NY4D 3V0WL 4HLJA 4N8CH 1OARH 2YWZA 5IBUG 2GT9B 5D6DA 4Z7UE 2NY1D 2P1YA 4QRPE 5AZ2L 1F2XK 1K4CA 3PHQA 1JV5B 3HG1D 4HV8B 1AXIB 1D6VH 3EKCA 1WBZB 3S97C 3VFWB 5EUOE 1DN0A 4XI5C 5INDA 1RZKH 3D18B 4GG6B 4M02A 1NBQA 4GKNB 3HI6H 4ZUUA 4R4NC 5L2KE 3E3QC 5HPOA 3B6SA 3RDTC 3PL6C 3BMWA 5DZNA 3W11D 1ZSDA 4RAVA 3KHOA 5IJVA 1WBXA 5IBTH 4ZAKB 3P4OB 3QI9B 2P8LA 3AREB 2EDBA 5IK3A 4ZDHB 3TBTA 2Q6WB 4HULB 3BZEB 1U2HA 3L3JB 1JWUB 1WWBX 2FYYA 3ILPB 3CFCL 3VE0B 2F74B 3SDCB 4LLAA 4IM8A 3O8XC 4MXVF 1EZVX 4JREB 1RURH 2QHLA 3UP1A 4CU7A 4R96B 4X5WA 5KJRH 3BE1L 5GGRY 3MQIA 3GRWA 2OL3L 4FABL 4S1QL 4PJGA 1WF5A 5IB5A 3FONB 2R1YA 3O4LE 2GTWB 4N1HB 5IQ9A 5GIRA 1MHHA 3P40A 1CYGA 2VC2L 5HY9A 3O45B 3PIQA 3X14A 4LPXA 1VGEH 1EAPA 3UTSA 5LCVH 3TIDA 5HDBF 4Z0BL 1KJVA 4ZQKB 4G7VL 3X3GL 4LU5H 4OLZL 3R06B 4H1LG 5DJYA 3TZVD 3ZHLA 4FQCL 4Z7WB 1QBAA 2Z93B 3SKNB 1KPUA 1I7UB 5I1LB 4BQ8A 3MV9A 5AYQA 3RJDA 3N1PC 5GZND 5EC1B 2GJ6B 3PXHA 4TVPL 5EU3B 4GUPB 1RZ7L 2CGRL 4PY8I 4P4KC 3SE4A 4ZOAA 3ZE1E 1KN2L 3VXRE 4DZBA 1I8KA 2BOBB 5L8KB 3TT3H 4UDTA 2Q8AH 4F37F 1N59B 4I1NB 5A40E 1IGMH 4XBGB 1EHXA 4R26H 4QEGA 3U1SH 3FTGA 3RWCB 5D7SL 2UYLB 5HGAA 3NABL 4UMGA 1ZAGA 2ADFH 3ARSA 1CU4L 3S36H 3LS5L 1JGEB 4Q9RH 3SDDC 3SDAC 1MCFA 1EMTH 4LPTA 3MRLB 1AJ7H 1VA9A 1QFUL 5D2LE 4IJ3C 2MCPH 3VXUA 3TN0C 4MD0A 1NBYB 1BOGB 4F37K 4NFDA 4LVHC 1IJ9A 4AENA 3T4YA 4CN1A 1ZT4A 2DN7A 1P84K 4L4TE 4JQXA 1J5OH 2MPAH 5D6CA 4QXUL 4G6ML 5I74C 1I7RB 1YMMB 5SX5H 3C5SA 1U8JB 1VFUA 4G8FA 4JAMB 4WHTA 4WCYH 1ZA6A 3V0AC 1TZGH 1CIUA 5E6IA 4I3RL 1LO5B 4K7PX 3QXAA 4JFZH 4ZD3H 2F54B 1HKLL 2YA0A 3GMQB 1AGEB 4NN7C 1LDPH 2DQHH 3BH8A 1X5XA 1BZ7A 5ISZD 1CWVA 1JI2A 3QIBD 3OXRA 4MLSA 2VLKD 1FNEB 4FQXD 4UDUB 4OD1L 3DO7A 5JHDE 3LY6A 2CR3A 5KVMC 3BPCB 4YHMH 4QRQA 1GYAA 1TZIA 3MLTA 2IF7A 3ARDA 1RUAL 4MAYC 5C0EB 2W07A 1WGOA 5GRJH 3GNML 4FQ1L 7CGTA 4R4FH 3VI3E 3NN8B 1N7ML 2E7CA 4X9IA 3HAEB 4WY7H 4EKXA 3MRGA 5BQ7A 1NAMB 3D39B 2F5AL 2VXUL 1GZPA 4HUWB 4D0CB 4MS8D 4J12A 3WXWH 1NMCC 2DQEH 1QYGL 1FG9C 1BBDH 1S7VB 4YEFA 2X1PA 3ZKMC 4JFDD 4NO3B 4JANA 4O5LH 3OGOE 1CLOL 4QHKI 1J9CT 3O4OB 1FZMB 2E3VA 3CFKB 4JZNA 2R0KL 1B4JL 3RZWA 5F9WB 5ILTL 3WSQH 3RGVA 1U8QB 3IF1B 1FGVH 5I1EH 4I8DA 1F4YL 5D7IF 1Q38A 2FX9L 5GHWH 4A2LA 5TDNA 2LAAA 1D7FA 3GRWL 4GQPH 4DGVL 2VE6B 1OGAB 1TENA 5E8PA 5GGSB 4OD3L 3CXDL 1JZ3A 1EFXB 4OLEA 3Q0HA 2P24B 4EOWL 1OT2A 1NBVH 2P4AB 4MNGE 4RGNC 4R9HA 5ANMB 5F9AC 3DHJA 3L3DA 1AP2B 4DGYH 5GGUA 2WQRA 3OJ2C 1PDKA 1D5XB 3MV7B 1AE6H 4OZHF 2JJWA 4KUCD 3B2VH 3NCCB 3W0WE 3VGAC 1DE4B 5C08D 1VB9A 1G7JB 5TE7H 1IGYB 4LCWA 5DTFA 3C6LC 4X0KA 4X6EA 3V6OE 1UM4L 4FQQA 5C0IA 3MR9B 1KJMA 4LIQH 4D0BB 3DI3B 2NY5C 5IEKB 2M1KA 3LD8C 3O3EA 5DJ2A 3GJFB 1YPZE 3EO9L 4PREB 2DI7A 3BKJL 5ID1B 3FQTB 4M00A 3DV6A 3BP5A 3BSZL 2AQ2A 3BGMB 1C7SA 3I75A 3UJTH 1YEIH 3ULUE 1J8HB 2DKUA 2P8MA 2WQ8A 1U3HA 3IXTB 1I1AC 1A6PA 5IF0B 1AQKH 1R24B 3IJYB 4R0LB 5CJOH 4D94A 3H9HA 5JPNB 2XQBH 1MH5A 1MUJA 4MXWH 4CN4A 1YQVL 1FPTH 5EDXA 1T1YB 4I9WD 4PGCB 2J8UB 3IDNB 4R8WL 4R97B 5T1LB 3FFCE 3OQ3B 3BUTA 1TETH 3H6JA 2NYYD 3KPSE 5B8CB 3VFNA 4FQJL 4JO4L 5CGTA 5C7XL 1INDH 2DICA 3CX5J 5CZVH 1B0WA 1I8LC 4F9LC 2EIDA 2YPVL 2ESVE 4RQQA 5FECA 1MLCA 2JB6A 3O9WB 3G6DL 1UJ3B 3JWOH 2N4IA 3WFZA 4PUBL 3M1BA 4P2OD 4DKAA 2X2YA 3CAFA 1ORQB 3QDGE 2ADIA 5I1HH 1CVRA 1QVOB 4XCNB 5EIQA 1KNOA 4GKSB 5HI3D 1VEOA 4Z0XA 4XCYB 4NYLB 1U8MB 9CGTA 1EO8H 1BIIB 1AO7A 1ERNA 4JFXB 4UT9H 2HLFD 1I85A 3UDWA 3FQRB 3VWKB 5C71A 4EUPH 2VXTH 3KPRB 1UB6B 3W5NA 2NXZC 3HS0B 3U0PA 3OJDB 1RHHB 1UM5L 1SYSB 3PQYA 1QSED 5DDHB 3E6FA 2ZNXA 1I9JL 1OQOA 2F53D 3OL2A 1JFQL 3SKMA 3VDCA 3GHEL 3MODH 2FATL 1IGIH 1QBMH 4QT5B 5DHVB 2XWJB 3GB7B 5I0ZA 4NQCB 1J0YA 1QRNB 1N2RB 5C09E 1N64L 1W0YT 2BMKA 4LK4A 4U1LB 2GT9A 3FN0H 1WITA 5SWSA 5TH2B 4K9EL 1EPFA 3HNSH 4HV8A 4TNVK 1WBZA 3I84A 2E5EA 2PKDA 1U41A 4UT6H 5J3HC 3INUH 5KOMC 4GG6A 1AY1L 2RGSA 4EJ1C 3U6RA 5C0RL 1FNAA 2IQ9L 1F4HA 3SY0B 2P48B 2FJFB 1X44A 3S98A 1N6VA 3P4MB 3I50H 3WFEH 5FKAB 3ZKSD 2BNQB 4XZUA 5D7LE 2X4UB 4YXHL 3SCMD 5DVKA 2Z92A 1OP3K 3EYUL 1QFOA 1DQQB 4AEIH 1UB5B 4ZAKA 3P4OA 1X9QA 3QI9A 4KY1H 5E7BA 2R8SH 2G75A 1MCJA 4HIHB 2Q6WA 4W4OC 5T3ZE 4BYHA 2BY0A 3BDBA 3L3JA 1JWUA 1INEH 3HA0A 3GKWL 2KDGA 4XMPH 3ILPA 3VE0A 3G5XB 1MJJB 3ZKND 1PSKH 4EDWH 1RUKH 3FQUA 4P4RB 5F7KC 2DLEA 1CXHA 2ARJQ 4F7EA 3F12B 3MCKB 1V8HA 5C07A 4Z7QE 2QQNL 3OG6B 5DJAA 4ISVA 2ZCKH 1T83C 2GTWA 5AG8A 2APBA 4WO4B 3VFSA 2HFEA 4YR6B 3UMTA 1XGYL 3O45A 4YPGB 2XRAH 5C6WH 5E5MB 2R9HC 4DKEH 2Y06H 3WMSA 1FAIH 2JF1A 2AK4D 1MRDH 3I2CH 4ZQKA 3UTQA 3R06A 3WV0A 4XP5H 3LEVH 3GO1H 1FDLH 2Z93A 4UBDC 3SKNA 3VA6A 3H9SD 4QWWC 3KPMB 1I7UA 1OHQA 1P1ZA 4HCRA 4OLYL 4YFLI 5HVHC 2GJ6A 3L9RA 2YUWA 3PABB 4L3CB 1NCCH 5EU3A 5LKNA 5SWZD 5GISL 5I30L 3GK8H 1ZHKB 8CGTA 5DVOA 1RJYB 4M6MH 5E03A 1N59A 4XBGA 5KANI 4HIJA 3F5WB 1AD0B 1MRFH 5FO8B 1NPUA 3IDJB 3RIAF 4OAWB 4ETQA 4QNPE 4TVPD 3RWCA 4YK4C 1RIUL 4RFOH 4JCMA 5CIPB 3MRMB 2YD3A 1IL1B 1JGEA 2ICEB 5IOPB 1RMFL 2BHUA 2YXMA 4QTIL 1Q0XH 5CP3H 4OCWL 5EUOF 1NBYA 1BOGA 3RDTB 4CVUA 5I2IB 2BOCB 5F71A 5TGBA 4PLJC 1I7RA 3RIAK 1UH2A 1YMMA 1Q0YL 5TF1L 4RMQA 5BW7C 1U8JA 4JAMA 2X4TB 2EKSB 3WO4C 3G5VA 1LO5A 2P7TB 3S6CA 1CIDA 4ZFZB 3DX7B 3AROA 3MRJB 2HMID 3P9MB 3OPZH 3M07A 4K7PH 2ED9A 2F54A 4ODSL 4ALAL 2JK5B 3GMQA 2NNAA 1AGEA 1MIML 1IQWL 2HRPH 4PRHB 4IMKA 4KMLB 3U0WH 2MHAB 4NO5A 2PYEB 3GJEB 5E9DB 4XPTL 4G8GD 3RVVD 2OMNA 2GUOB 4OZFG 1UA6L 1YNTA 2A9ML 4NQEE 1HEZB 2CRIA 5HDLA 2ZP0T 4UDUA 3VD7A 5E2UH 5K59E 1A9EB 4JY6B 1A7NH 3NZ8B 1X4XA 2UY7A 2EDTA 3Q5TA 5K9QI 1SJXA 2VDLH 2IPTL 2V5MA 3F7YB 4P2RE 5C0EA 3UTTB 2Z35A 4PFEA 5E8NB 4PJFE 5L88L 4N8PA 1WK0A 1DBBL 4Y4KB 5GS1C 2IBZY 3HAEA 3ME0A 3CLFH 3D39A 1ORSA 4EDXA 4HUWA 3UPAA 4D0CA 2CR6A 1UXWA 2IEPA 1A4JB 3QHZL 4WHYH 5MERB 4K3GA 3RVXD 1S7VA 2N56A 4U3XA 1WEJL 2XWBA 1KCVH 4GAGL 3ZE1F 3MACH 1WFUA 1AGCB 4DFHA 3SHSA 5JW4M 2BVOB 2YD7A 3IDMB 1T3FA 2IFFH 2R69H 1HZHH 2VN7A 3SDDB 2ATKA 2A73A 4YC2B 4CN6A 1U8QA 3MLZL 4NBZB 3IF1A 1ES0B 2IH1B 3LQAL 5D96C 3D9AL 4K2UH 3TN0B 3CXHK 3K8KA 5JOPE 1NCBH 4G6JH 1V7NL 4WWKB 3L7EB 4LVHB 5EFIB 4FN0A 1OGAA 3SGKA 5GGSA 3VMOA 5F1OB 1EFXA 1JNNL 2CSPA 3RVWD 5ANMA 1A7BA 5I8EB 4HIXH 1QBLH 3WLWD 2MQ0A 1MJ7H 3MV7A 1D5XA 1CGSL 4NN7B 2NMSA 3VFRB 1BQHB 3NA9L 3HI1A 5DSCB 4XMLH 4JVPA 1VKXB 1IGJB 2YXFA 2R4RH 1DE4A 5IWLA 1HHJA 1AXSB 1G7JA 2C1OB 2ZOKB 1IGYA 3UTSD 1IE5A 1PJ9A 5HYJA 1QLEL 2EKJA 3MR9A 5DT1L 5EZJB 3CFBA 3DX8B 3PWUA 1UWGH 2G5RA 4NUGH 4PRPB 4TSCH 5CP7A 2AJXH 1HQRB 4U2ZA 1RJZB 5T5NG 3P11H 4PREA 3CVHH 1OP3H 3FQTA 4UTAH 1N5YH 3VMNA 1C1EH 4KWUA 3MV9D 5GGVH 3BAEL 2P5EE 1BF8A 1Q1JL 1NCWL 4MAYB 3LEYH 4X6DB 4QF1B 2HTLC 1L7TH 4DAGH 2DQFB 3RP1A 5MEQA 3FOMB 3GDBA 5DHYB 5IF0A 1QR4A 4PJEF 1R24A 4R0LA 2GTZB 3U4EA 3PV6B 5BS0E 5JPNA 4AG4L 2XQYG 3MNWA 1NMCB 1I1RA 1T1YA 2VDMH 4PGCA 2J8UA 3TJHC 5EIIA 2VWEE 3QCVL 3TH3T 1WUNT 3FO9B 1F3DH 1F3JB 4HWNA 5B8CA 1YECL 4I3SH 5HI5D 3VXUD 5FYLL 1K4DB 1AIFB 2JJTA 2JJSC 5HHOE 4HZLA 4UOW1 4PR5B 2FDBP 3LHPL 3TNMB 3O9WA 1UJ3A 1AGFA 1OAYL 3GSWB 5E6ID 3CFEB 1D3CA 3MRNB 3WNPA 4Q9CA 3QB7C 4MJIE 1ORQA 1L0QA 4XCNA 2FZ3B 4GKSA 2HYMA 35C8L 1IAMA 3NFNB 4XCYA 4NYLA 4Y4HC 4RGNB 5FOJA 1U8MA 5GJSL 4ZS6C 3X11B 3O6FC 1E4WH 4J3UA 1BIIA 1UFUA 4CMHC 4JFXA 3CZJA 4EIZC 3FQRA 3VWKA 3HG1E 4HWUA 3L3KB 3V52H 3KPRA 3TH2T 4U1KB 1WIUA 3HS0A 3RUGE 1MF2H 1RHHA 2WP3O 1SYSA 1YQ2A 1QFWM 3PHSA 5DVLA 1P7HL 3MRKB 3DVNB 1NAML 5FAAA 5EBGA 5FGRA 1RZJL 1JL8A 3ARDD 1EEYB 2VXQL 5C0GA 1WWAX 5DHVA 2XWJA 3GB7A 2JIXB 4NQCA 4J1UB 3RKDD 3V6FB 1QRNA 5ELIA 4U1LA 4O4YH 3RTQC 3ARFB 4Y16C 1MPAL 5TH2A 5F70A 3MA9L 2W60B 4OUOA 4PGEB 1OAQL 4BK4A 1X4ZA 4HUVB 1T7VA 3S96A 1E4KA 3LH2H 3QUXC 4OCXH 4M43H 5HPMB 4JM2B 2BFVH 3HZYB 1NLBL 2YEZB 1VGKB 5IQ7L 4GW5B 3HPLB 5IIEB 4JHWL 3EYVB 1ZOXA 3MNZB 4QXGL 1T04B 2VYRE 3U7WH 1NUGA 1FBIL 3I6LE 4FMKA 4XBEL 4AQOA 3RGVD 5I15L 2HT2D 4HIHA 5GJTL 1VFOA 1PLGL 1WVZA 3VJ6B 3QJHB 3G5XA 4NWUH 5E2VL 2VH5H 5D2NE 4P4RA 2VB5A 5JXAH 4HLZH 1E6OH 4LNRA 3MCKA 4E0RA 12E8L 5B21A 4WI9A 2AABH 4HX1B 1X3DA 3L95B 1NBZA 4JZOB 4PGBA 2F19L 2BVEA 4JN1H 4WO4A 2Y72A 1MLBB 4YR6A 1FZJA 2Y9RT 4YPGA 5JDSB 1Z9MA 2E9IA 5E5MA 3ARPA 4OT1H 3LCYA 1QA9A 4NC2B 3PGCB 3X3FH 1R3HB 4A2MA 1CE6B 2FGWH 3O41B 1PKQB 5BO1L 2BXZA 4LCWD 5IMKA 4DW2H 1BX2B 4C54A 4BA8A 4TTDD 3TBVA 1UC6A 4I77H 1G6RH 1UYWL 3VXMB 3RY6A 4QHLB 3KPMA 3LZFH 5F96L 3GMNB 3OF6A 3BN3B 1J0HA 4D9QD 1R6VA 4WVRA 4N8VG 3MLXL 3PABA 4L3CA 5AG9A 3WXVL 5DUML 1ZHKA 4UQ2B 2MNUA 3T2NL 4E42B 4X4YB 1RJYA 1S7QB 3BKML 3MV8A 5ALCL 1AD0A 1KEML 1U3HD 5FO8A 4XWGH 3IDJA 1GC1C 4H25B 4QGTA 5DJCB 3KJ4B 2BX5A 2G2RB 5LWYL 2VDKL 3QXDB 4N9GA 1OAUL 3WE6B 2X42A 5CIPA 3MRMA 5KN5B 4GS7C 5DD6B 4L8SB 2ICEA 5DUPH 2J88L 3AB0C 4LEXH 3QZWG 3P0VH 3CDCA 4HD9A 4P23D 5F7UA 3GSQA 4AMKL 1U42A 3RDTA 4ONHB 5DMKB 3PL6A 1AGBB 5B3JF 5F7DB 4HS8H 5J13B 1S78D 3IXAB 2CJUH 5IROC 2EKSA 2IADB 2YPLB 4WW2B 5BMFL 5I1JL 2VLKE 1T5WB 3UPRB 3NBNA 3BJLA 4GBXD 4OV6F 4KZDL 1PYWB 2P7TA 1U8LB 2HJFB 2RJMA 3DX7A 3MRJA 3P9MA 4AK1A 1K6QL 4PJ8C 2AXFB 4FG6D 4JKLA 4Q0XL 4QTHA 5HHMB 4ZTPL 3RQ3A 2VAAB 3WUWB 7FABL 3EDEA 3QA3B 4BZ2L 1DQDL 5K93A 2PYEA 3I6GB 3GJEA 5E9DA 5ENWB 3BGFC 2NR6C 3MV01 3G6JB 3UTZB 5I1AB 5KVEL 2GUOA 4LSUH 2B4CC 5BRZB 3F7RA 4NM4L 2A74B 3O2VH 3T1WA 1S9XB 4PY7B 3W82A 1AO7D 5JORB 1A9EA 3MRFA 1I1CA 2PUQT 4JY6A 5CBAB 2AAVA 2I25N 4DUXA 5TPWH 2HFFB 2W0LA 3PQYD 4P2QA 2DM4A 1YEFL 4JFDE 3F7YA 2F5BH 3VD4A 2AJUL 4NRXA 5FUOH 2IANA 3UTTA 4XVUD 5ETUB 2BC4B 1R0AH 1CFSA 5E8NA 2AEWA 3EJZD 4Y4KA 2BJML 5E7FA 2I07B 2CLZB 4G5ZH 4LFHG 2O5XL 4XMKL 4OZFH 4ODTL 3AS2A 5D1ZC 1HXYA 2JCCB 3VFOB 4LLDA 1E27A 1QTYT 5D8JL 5EBWB 1AGCA 2XY2A 3KLHC 4PJIB 4XNXL 3H7BB 2BVOA 4YK4B 4DZ8B 1U6AL 1AQDB 3MZGB 4OZIB 4O02L 3SDDA 3CFIC 4FMFA 4UB0L 2EZ0D 3QNXB 5D71L 3BGAA 1ES0A 2IH1A 3TN0A 1JGUL 4ZAKD 4WWKA 3L7EA 3QI9D 5A2JH 5KSBF 5C08E 5I16B 1C16A 2FSEB 2MMXA 3B5HA 3BYYA 3NCJL 3A6BL 3DLQR 5IHUH 1MI5B 1FN4B 3MMEA 1CT8B 1B4RA 5HDQH 4H20L 4WI4A 3D48R 1YEKL 2XZCH 4Z78B 5GXBB 3OR7A 5DQDL 3VFRA 1F13A 5DSCA 5HVGB 1VKXA 3EOBB 1IGJA 1GXEA 4XP6L 3R0MA 2C1OA 5IG7A 2ZOKA 3H42H 5IFHH 5F7EH 2HN7B 3DX8A 1QEWA 4PRPA 4PJAF 1HQRA 1RJZA 5BV7C 2ZG1A 3SKJH 1CICC 2EE2A 4I9WE 4KJQD 3T3ME 4KXZI 3UAJC 5K59F 4RGMB 1LP9E 2DQGL 2GJ6D 4MAYA 4ZFOA 4N0UA 4NKOB 4BQBA 1CL7H 1TNNA 3EYFA 3ULUH 4S1DD 1YNKH 5DHYA 1CBVL 3SGJC 3EYSH 4RSVA 1OTTD 2GTZA 4YHKL 4JLRB 1T2JA 2MQ3A 1ZA3B 4ZPTB 4GLRH 3KYKH 4HH9A 5LAXA 4PG9A 3PUCA 2AXGA 3FO9A 2VAJA 4YXLH 1F3JA 4G7YH 2HVKB 43CAB 2QKIA 4XP9H 1K4DA 1AIFA 4XBPB 5JOFA 1KIRB 3BP4B 3ZYIA 4HC1A 3WD5H 4MCYB 4JG0L 3F7VB 3A67L 3JV5A 3FT3B 4PR5A 4F58H 1IC7H 1WTGT 3OR6B 3QRFM 1YMMD 2FD6H 4MLIA 5D96B 5ESVB 5DWUH 3TNMA 5A43C 1A7OH 2D7OA 3GZKA 2DL9A 1DFBH 3GSWA 4CVZB 5FYLD 3R1GH 2V9QA 3QQ4B 3BZFB 3MRNA 1A3LL 2AJYL 1FAKT 4XC1L 1QSEE 4F7CB 4U6TA 4PJDE 1CFVH 2DI9A 3KR3H 1IKNC 2F54D 2F53E 1DANU 1T1XA 3NFNA 2A6KB 4U7KA 3RNQA 2X70B 1H5BC 4CJ0A 4DVRL 3X11A 3B5TA 4X6CA 3V7MA 5JHLH 3BIKA 3FT2B 1Q9OA 3C60C 3H3PH 4EN3C 5E6ZA 3WYRA 2XKNB 1PZUB 4V2CB 5LGKA 2XFXA 4NZRH 5H37G 3QQ9D 3IU4H 3U4BL 2DMBA 4U1KA 5E8DL 2R0WH 1E6JH 4KHXL 4WENB 2EXYC 2W0KA 3C6LA 4ZPVA 5KVFH 1LO3L 1MAKA 3MCLH 5FUZL 1OPGL 5L8LB 3DVNA 3UX9B 4HGMA 4IDLA 1EEYA 5HHNA 3HHRB 2JIXA 4QY8B 4MJ6B 5FDWB 1OF2B 1OY3B 2FX7H 4HUMB 2OSLB 3ZTNH 2W60A 4K3JH 4PGEA 2J1KA 3D39D 3A6CL 1BFSA 5I19H 5HPMA 4JM2A 1HCVA 1C5BH 3HZYA 1DBMH 3S4SG 2YEZA 3B8SA 2ITCB 4GW5A 4YHIB 3HPLA 1ZLWK 4Z7NE 5IIEA 3EYVA 3PWPB 4KU1A 4YE4H 3Q48A 3JTSA 2VQ1A 4C59B 4XNYH 5B4MC 5MHSD 3TESA 1A6VH 3GMPB 3ZE0E 3ARXA 2EE6A 1DTUA 2XXMB 3U36A 3QJHA 4DGIL 2AK4E 1OGTA 3BIAX 4Z7WF 1PX3A 2B0SL 2WUCH 4ONFH 1OTSC 3I6KA 4OGXL 1OGAD 2HH0L 4M6OH 4PJBF 2VDQH 3P9WB 3WNOA 3VW3L 4HX1A 1EFXD 3G5ZA 4H5SB 3RWEB 3PHOB 3EYOB 4V1DB 2Z8SA 3QXUA 3MV7D 3CVIH 5JDSA 5SWZE 4IRJC 1G84A 1F97A 3NAAL 4HF5L 3PGCA 4Y4HB 1R3HA 1MFDH 2VR9A 1CDBA 4NIKB 1JGVH 1P84J 1BX2A 1ZANH 5HYJD 5DC0A 3HMWH 3VRJB 1XF5A 4QHLA 4MGXA 3L1OL 3GMNA 3NMEA 1FLTX 3BQUC 2R39A 1U8OB 2DIBA 5E00B 1UJTA 1AR1D 2HG5B 1XIWC 3UBXG 4R90H 3ESVF 1R5WA 4M9OA 4UQ2A 3BEVB 3RUGF 2PYFB 4E42A 1HK6A 1S7QA 4Q7DA 4L5FL 5GS0L 2OTUA 4ZFGH 1T5XA 5DJCA 4LL9A 2G2RA 3GSXB 4DN3H 4K8RC 4NJ9L 3WE6A 4ZNEE 1G9EA 4KKAC 5K9KB 5KN5A 4M7LT 4HC1L 4L8SA 1F4WL 4QO1A 2X44D 2OJZL 4OB5H 3IJHA 1TXKA 3BDYH 1QRKA 5DMKA 1JNJA 5ADOH 5I66B 2WUBH 1WZKA 4ELMA 15C8H 4G8GE 4J2XA 1FJ1A 4CMMB 4CU6A 2QQKL 3IXAA 4LPUA 1WCBB 3WLBB 2IADA 2YPLA 1ODAA 4WEUD 1T5WA 4E41A 2VITA 1PYWA 4HJJL 4W4OA 3O9WD 3LPGA 1EJOH 2HJFA 2JE8A 4OGAD 1M6OB 5EO9B 2LAGB 4M62L 2QQQA 1DBAH 1MCPL 3WUWA 2DTMH 1OSPL 1JHKH 3QA3A 1NCTA 4L3EB 5DMIH 1EERB 1JNLH 3I6GA 5ENWA 1LK3L 3UTZA 3G6JA 2CKBH 3V4VH 5BRZA 4JFQB 3FN9A 1F6FB 3BD5A 1T83A 2A74A 1W8OA 3CU1A 5KBNC 3KNBA 5FHBH 4M7KH 3LRHA 1G9ML 4KKLD 2NY5L 1PKOA 3VWKD 2NY6B 5J11B 3KPRD 5DVNA 5DQ9A 3LRSB 3LQMA 4OSUL 1HSAA 1NCAH 1P4BH 1MCLA 1XCTB 4Y5XC 3ZYZA 2DQDL 3HNVL 1CFTB 5TDOB 1G9NC 1NJ9A 5ETUA 1HINH 3RWJA 4EI5B 1MCWW 1HIML 4ZOBA 1J05B 1Y6NR 4NQCD 3MXWL 4Z76B 1QRND 4HG4K 3IKCB 2CLZA 4WV1B 4DTGL 4PJ7A 3STZB 5AAMA 2KL6A 4NNYB 3MUY1 5L2JB 4GMSH 2IG2H 1MFBL 5JW3L 4K3HA 3SPVB 1TVBB 1BHGA 3VFOA 4N5ED 4WI7A 2UWEB 1JUFA 4ENEC 5EBWA 1HH6B 2KZWA 4PJIA 4JDTL 2MOVA 4XPGH 5C0AE 4O9HL 1FQ9C 2D7NA 3H7BA 2XKUA 4DZ8A 1AQDA 4AT6B 4OCMC 4D8PB 4OZIA 4OLVL 3QNXA 4YIQB 3AB0B 1CLYH 3TWCH 3NIFF 4PJGE 2CMRL 1KSRA 5DEFA 2A0LC 4GQ9H 4X83A 4AL8H 3WEXB 3VCLA 5I16A 2H2PD 2DQUL 2FSEA 1GJIA 5J7CC 4G6FB 1CDUA 3AC0A 2OP4H 5GZNC 1MI5A 2C3GA 3FN3A 1FN4A 5FK9A 1CT8A 4PGJA 2CLVB 2BY1A 4TSAH 1WFOA 3O81A 5IP4A 4NQDE 4WFED 2RAMA 1VEMA 2AJSL 4MWFB 1AC6A 2YD9A 1JHLL 3MV9E 1DDHB 2WSKA 4XVSH 4F33B 3QHFL 4L1DA 3EOBA 4K3DL 4WO4D 1DSFH 4X99A 3V6BR 5I1GL 3LB6D 4Z95H 5GRYA 3BGFB 1T1WB 3SGEH 1NL0L 4K55A 5F1IA 1ZWIB 4X7EC 4K7FB 4YUEH 2HN7A 3DGGB 3SQOH 1B6UA 4HKBB 5D1XB 1IEHA 3V95A 2BNUA 1XR8B 2B1HL 1H3UA 1S5IH 3QO1A 5J4MA 3GMLB 3OF6D 4PRAB 4JFEB 1S5HA 1MWAH 1UM6H 5BZWB 4MD5B 3VXUE 1KOAA 3QXWA 4OCYH 3DOSA 4G6KL 3MV8D 5LQBH 2DQJL 1OW0A 3V4PH 2H6PB 3OXSB 1I3GH 1ZA3A 4ZPTA 2VDPL 1BFVL 4LPWA 3BN9C 3IRZA 2EXWD 2HVKA 4R4ND 3GSNB 4JG1H 3PGDB 4XBPA 1JJUA 4ODBD 1KIRA 3RDTD 2YOCA 4MCYA 1J10A 3PL6D 1BGXH 3F7VA 3GIVB 2H32H 5ESVA 4Y5YB 4JPWH 4U6VH 3SEPA 3GKZA 5DMJB 5HYQA 4CVZA 1K8IB 3QQ4A 1WAAF 3BZFA 3VMPA 3UJIL 5IB1B 4F7CA 1SHMA 1RI8A 5FM4A 3TIEB 4LGPB 1TJHL 3R4DA 6FABL 4HMDA 3IDYB 2A6KA 5D70L 4MS8C 4LCCC 4WFHD 2PYED 2V7NB 5E9DD 2SEBB 3GHBL 1T66D 4OTXL 2XKNA 5EOCJ 1RZIB 1I3RA 1MCBA 1B0RA 5C0CE 1OQXA 1IM3A 4NKMB 2A83B 3PWLB 1TCMA 3PDGA 1HYSC 3W5MA 4OLXH 1JPGB 2OQJA 1HHKA 4HGWB 5L0QB 1ZMYA 4KQ3L 1A7RH 4P2QD 1CGXA 2GY7B 1QBBA 2IAND 3UTTD 4QY8A 1ITCA 2CLRB 3ROLB 3VXQB 3L5WB 4MJ6A 1KTDA 4BZ1H 1OF2A 3PJSB 4Y4KD 5CZKA 3VFPA 3MUGB 2DKSA 1P9MC 2ZUSA 1YJDC 2Z4QA 3T3MF 1F3DJ 4OQTH 4FZ8L 4RMUA 1EEZA 4EVNB 4RFNC 1W2KT 4HXAH 4MHHI 1FNFA 3WNMA 1H3WM 5D5MF 2GHWB 3BT2H 2O5YH 4TUJB 1A4KB 3PWPA 5LGHL 3QDJA 4KVNH 1JPSH 5IVXA 1CGUA 2YRPA 3SDDD 1UZ6E 1IC5H 3FAWA 5IW6A 3ARBB 3J7HA 4G9DA 1TQBC 1DQMH 2Z31B 1L9MA 5HYIA 1SEQL 3GMPA 2EE3A 3TN0D 2JJVA 4WWKD 1E4XH 5ICZB 2ARJB 1I9RL 1ETZB 2OK0H 4LCWE 4XCEB 4R7NA 4ZUTA 2ARWA 1ZE3C 4ZG1A 2MFNA 1WIOA 4QRTB 1FLRL 1VENA 5CD3A 2L4OA 4X98A 3ZMRA 1IAIM 1T6VN 1YEJH 4H5SA 4MA3B 4D9QE 3EYOA 4YHOH 4V1DA 3I9GL 3VI4E 4D2NA 1LE9B 2DM3A 4Y4HA 5IFAH 2EYRA 4NQVB 1G7HA 1TPXB 4NN6B 1U8HB 3GUTB 4GXVH 5EZOH 1TVDA 1KCSL 4LLUB 1Y0LB 4M7LL 1F8TL 4UI2A 2VN4A 5JIKA 1FVDA 1SBBA 2E7MA 4PRPD 3GBML 4PV9B 1KPRB 1U8OA 2ZUQB 3QJFB 4XPHH 4N0YH 4WEBH 2HG5A 2DBLL 2DM7A 3QQ3B 1F42A 5T5FH 2ED7A 3BEVA 4MAYD 3KJ6H 2X05A 4N90D 4HAGA 2NY7H 1KG0B 2A77H 4OLWL 2F8OA 1WV7T 2PTUA 4P9HH 3EBAA 4Y16A 3TNNB 3MOQA 2OI9B 2WLZA 3V4UL 3GSXA 5EZIL 1VADA 3S5LB 3TM6A 4YWGH 1SY6A 3T1FB 1CFNB 3VDBA 2X4QB 5GS0D 3MYJB 3T0EB 4RWYH 1L9NA 3MGAA 5F9OH 3ZKMD 4OFPA 3QSKB 3HR5B 3GSUA 4PJ5B 3OV6A 4GAJH 5I66A 1IC4L 4AIOA 2HWZL 3LIZH 1D5IL 4W68A 2WBJB 3IS1X 4WW1B 1DCLA 5EU7C 3WLBA 5L9DH 4RMVA 4LCUB 3IETB 1H8NA 1AO7E 2RFXB 2MSPA 4I0PB 1YA5A 3WIIL 1KENL 1M6OA 3X13B 5I6XC 5EO9A 4ZUWB 4O51B 5IMMA 4YHLL 3OTTA 4M6AA 1EA9C 3JWDC 2DQIL 3PQYE 3AFLA 1FZKB 1IAOB 3ZE0F 1S9WA 2XXCB 4PRIE 4RGND 1NGXB 4JFQA 4U7SA 3DSNA 1T03H 4U0QB 3EDFA 3EIFA 3FT4B 3ALPA 4IRJB 5SWSE 3BFOA 4D3CL 2Y07H 4YNYA 4KUZH 3LRSA 4LKXB 3I85A 4GG6E 3SCMC 2GK2A 3C6LD 4ERSL 1G0XA 2Q7YA 1XCTA 1CFTA 3C5JB 2B5IB 5TDOA 1RZGB 1FORL 2VXSL 4PJ9C 1S7UA 1F02I 4EUPB 1LO2H 2JIXD 4U1GB 1II4E 1H3VA 4RA3A 3IKCA 4XCFH 5GGQL 1XIWB 3ZKNC 3STZA 4NNYA 4TOYL 1QNZL 1TITA 5L2JA 3SPVA 2X4SA 5IMOB 1KT2B 1TVBA 2GQHA 1P69B 2VNCA 2UWEA 5ESQA 4JM2D 5FHAH 3BMVA 3QG6A 1HH6A 2LTQB 5J1TC 4CVWA 4KAQH 1MOEA 4AT6A 1MY7A 4MA8H 3IFOA 2E6PA 5C07E 5KZCD 1WT5C 2DD8L 4IIQB 1BFOB 3CDGB 5JPMB 3WEXA 2D31B 3RAJL 4NDMB 1UEMA 5IROA 3VGEA 4DQOH 2R2HA 3DUUA 1XH3B 4FS0A 1EUTA 2VABB 1NMAL 1IKFL 2VXVL 3MO1B 1VERA 1JN6B 3QPQC 1MREH 3OKNB 2R29H 1UQSB 2DKMA 5BVPL 2X4RB 4KTYA 1DDHA 4F33A 4P9ML 4WRLA 1FSKC 1HILB 4PB9H 4GH7B 1T6WA 3RVTC 4NQUA 1FC1A 3HTLX 3AGVA 1NFIB 3ET9F 4K7FA 3RWFB 3TJEL 3OWEA 5FM8A 2W59A 2W92A 1AKJB 5D1XA 2CK0L 4J4PC 3VXMD 3SKUD 5J56B 3TC9A 3W2DH 1XR8A 2Y5TB 1FV1B 1YYLH 1CTOA 2NXZD 3GMLA 1EHLL 4JFEA 5DFTA 5BZWA 1CXEA 5I17B 1PG7L 1IZJA 3KYMA 3DROA 3B9KC 4MD5A 4KTDL 4U1HB 2NXYC 3UPCA 3OJVC 1S7WB 1SY6L 1JZ7A 1NEZB 3MRDB 3C5ZB 2HMIC 2CD0A 5GRVL 3KPOA 3IDXH 2B7DT 4EBQL 1YMME 4I18C 1HSBA 25C8H 4UTBH 3EFDH 1OCWH 2MQCA 5FA3B 2H6PA 1INQA 3V5HB 1HH9B 3FRUA 3KHQA 5FYLE 3IJSA 4JO3H 3QR2A 4BFEA 1S7RB 1FYTB 2LU7A 1BAFH 4U1IB 5C3TA 3GSNA 5I8OH 3MUHL 5I1IL 2DS4A 1M7DA 1JPFB 2QADC 1CZ8H 4UINH 2P46B 3GIVA 3QBTB 5D4QA 4BQCA 1A5FH 1JBJA 2IAMB 1RFDH 3TH4T 4P0DA 1QKZL 2KH2B 2YPLD 5D7IB 2GSIA 3NACH 3QIWB 2A1WL 4E41D 4LAQL 5MENB 3UC0H 1NC2B 5TE4L 5JR1H 5KSAB 4LLVA 3BPOC 4F57L 2OXGA 4L8CB 2GEEA 1B90A 3LMJH 4JFOB 2JKXA 4OZHB 3VG0H 4NQSB 2WINA 4Z7VA 5F89B 5BRZD 2QQLL 2NCMA 4XVJL 4LDLB 4JB9H 4I2XB 5K9OB 3DXAB 1X7QB 2A83A 3QEQB 1V7MH 1YEHH 4HAFA 1ZHBB 4Q6IB 1KC5L 2LQRA 3UROR 2J6EH 3IAPA 1F5WA 4HGWA 4NFCA 1FO0A 1IAKA 4X7SH 1FC2D 1NKOA 4RMRA 3D5OF 4XAWH 5AZ2H 2FNBA 5D7JC 4RISL 1DZBA 2CLRA 3RY5A 3L5WA 4N8CL 3PJSA 4KDVA 4YDVB 5KOVC 3MUGA 1ND0B 4PTUB 1BECA 1GC1L 5MHSE 1A9BB 3RVWC 3DO3A 1D6VL 4LLMA 3SGJA 4J3VA 4GRWE 1RZKL 1ZXQA 3E2HB 1OGAE 2LVCA 1NMBH 3NIGE 1ZT1B 3VFVA 3ZDXF 3QP3A 3O3AB 4N9OB 5FYKL 4X4ZA 2V2XB 3PV7A 3BZ4A 3ARBA 3MV7E 2Z31A 4YDIH 5DQJB 4HK3N 4WWID 4LHUG 2GIYA 5ICZA 2ARJA 2ZSWB 2NW3B 4TSBH 4XCEA 4N0CC 3BPLC 5HYJE 3C2AH 1MI5D 2EC8A 1IBGL 4WI8A 3WO3B 2GAZB 3SE4C 2DI8A 2D7TL 3P77B 2AEIT 5KJRL 4MA3A 4S2SB 1DLFH 1A6ZA 2B4CL 1IKNA 4LSTL 3X3GH 2DYPB 3EHBC 3AU1A 1ZHLB 4OLZH 5FOBA 5I71C 3DMMB 4NQVA 3HC0B 1A7QH 1T22B 1VGEL 3GUTA 3C60A 5TQ0H 2VLRE 5LCVL 4U1JB 4KZEL 1Y0LA 4XGZB 1HHGA 3U48A 3Q6FB 3IT8D 1GOHA 4LU5L 1HDMB 5HI5C 4OF3A 4B41A 4C4KO 4PV9A 4F9PC 1KPRA 4ONOA 4EXKA 4JQXC 4XXDB 5I73C 2J8UE 5A2FA 4PBVC 4LBEA 5CINH 3QQ3A 3AS3A 5F9JB 4MA7H 3K4ZA 1CFQB 1Q72H 5E6IC 3N06B 4WW2F 5ICXB 3CVHB 1CU4H 5DD3L 2Q8AL 3TNNA 3TT3L 2WZPD 3HE7C 5EBLB 3T2OA 1W0VB 5HHPB 4R26L 3ULVF 3GSNL 2FLBT 4LVNC 3S5LA 2IC2A 1CFNA 2XKSA 2D9CA 2X4QA 5T1KB 2ADFL 3S36L 5I8KH 3MYJA 4G6MH 3RU8H 3T0EA 3W81A 1EMTL 3HR5A 2ZUYA 1AJ7L 4PJ5A 3RJQB 4OM1L 2MCPL 1DEEB 1TZHB 4ODUB 4I3RH 4O2EA 3UTOA 1JGLH 2MPAL 4YQXH 3IETA 2RFXA 4JHBA 1A1MB 1SYVB 4JHAH 4WCYL 1RIHL 3X13A 1TZGL 4MDJB 5CHNB 4ZUWA 3KPRE 3B5GA 1UZ6F 4TQEL 4WU5B 4H8WC 1T80A 3CMGA 3KPLA 4DK3A 4JFZL 5IV2B 1OAZH 1FZKA 1IAOA 4OLUH 4ZD3L 2ICCA 4JGUA 4YXKH 2Y7QB 5TE6L 4OD1H 1F00I 1NGXA 4W6YB 1T4KB 2EDQA 4MNQE 4NQCE 3O11B 4U3CA 1KLUB 4XX1E 1NDMB 3FT4A 4IRJA 2JCCF 4K9EC 3IFLH 3IYLW 3MLYH 2DQTH 4NZUL 1CK0H 4OFDA 4HPOL 1RHFA 4JGJA 2R1WB 1BPVA 3C5JA 1RZGA 4WNQB 1P7KB 1MY5A 3ULSB 3BQUA 2ZCHH 5DRNB 5GRJL 2FEEI 2DOCA 1XIWA 1KXVC 4KFZC 4WY7L 4LP4A 4X9GA 5IMOA 1KT2A 4FTVB 3L6FB 2ORBH 1A3RL 3FQWB 5TQ2H 2DQEL 3HRZB 3BJ91 3LSOB 1G6VK 4MCZA 4O5LL 4QRPB 1FCCA 1PY4A 4WFEE 4NN5B 4BSWB 1MJ8L 3WJJA 5EUOB 3PWPD 1ZGLP 2R4SH 1KJ2A 1XGTA 1BFOA 3GRWH 3WS3B 4LDOB 5E6YA 5L7XH 5JPMA 4XP1L 1FGVL 2D31A 5L2KB 5ACLA 2VL5B 3UBXI 2W0FB 4EOWH 2FL5B 4YDLB 3FL7A 1ZT7A 1WICA 2PCPB 1RUML 1MJUH 4I4WB 1KLGB 1JN6A 3OKNA 1D6EB 1UQSA 1N4XH 3KDMB 5ID0B 2X4RA 5INCA 1U3HC 4FQLL 4DGYL 3F7PC 4KVCH 4IHOB 4V1DD 1HILA 4C56B 1AE6L 1K2DA 3C8HA 3P9LB 3B83A 2EEAA 3KWWB 4QRUA 3B2VL 3QUZB 3FB5B 4Y4HD 2D4DA 1T89A 5DFVD 4ZS6D 1A1NB 5F3HA 4M9PA 5TE7L 3MV8E 1NFIA 2M26A 3BKJH 1NFDF 4KK6C 3RWFA 2EDJA 4P23C 3O4LB 1SJEB 3T08A 2UVFA 1KCKA 1JTPA 3PWJA 2Y5TA 1FV1A 5MI0B 2AP2A 3WHE0 5J12C 1PVHA 2ZG3A 2W9DL 1T0NB 3EOTH 2A6DB 5C1MB 1DEDA 1CXIA 4ODXB 2WMPA 1DQJB 4PJ9B 4U1HA 3E3QE 1GGCH 4GBXC 3LKRB 1G6RB 2H1PH 3BVNB 1MEXH 1NQBA 1S7WA 2P44B 4Y19B 1ONQA 3L3OB 1R3IH 2DLFH 1KTRL 5J6HB 3B9DA 4FG6C 3FKUS 4Y16D 4F2MB 4R8WH 1AQKL 2KKQA 3ILQD 4XNZC 5CJOL 3E0GA 1YEEL 2ENYA 4ORGB 3T3PE 4FXLA 5GRUH 3VXRB 4MXWL 3AMKA 1S7RA 3K1KC 5C7XH 4L9LC 5T33H 2EDFA 1HKFA 4MXQD 4MVBD 3G08A 1RK0B 1U8PB 5CS7A 5FYKU 1SEBB 4UT7L 2YPVH 1TETL 3D2UB 4KH2A 1JPFA 1I85C 2OTPA 2X1OA 3WIHA 4WFHE 2PYEE 5E9DE 1PW3A 4BZYA 3HAEG 4HBCH 4PUBH 2IAMA 3NFSH 1QHOA 1TTFA 3DSFH 4P3WA 1Y6KR 4U6YB 5CZVL 5D7IA 3QIWA 1NDGB 5CP3A 2ZPKH 2PO6C 5I75B 5MENA 3JWOL 3EJZC 5HGDB 1NC2A 3ARRA 4FFYH 5B39B 1CXLA 4P2QE 5J89A 4RIRA 3TA3B 1TVHA 3WCYA 1RVFL 5C8JB 4JFOA 2IANE 3UTTE 4OZHA 4NQSA 2BHYA 3QUMH 5F89A 2P42B 1PG7W 1P4LB 5B3NA 3QDME 1EO8L 3EO1B 4IOIB 3M17B 4Y88A 4MJ5B 3CZFB 4I2XA 1YC7A 3RWGB 4DUVA 1JFQH 4YDKH 4UT9L 4M1CC 1ZHBA 3FMGL 2NY6D 2X6MA 1CS6A 5E5UB 4ACPA 5T3XE 3K4AA 2EDHA 1FCGA 4Y7MA 3AREC 3QFDA 2BDNH 1OLZA 3ULVH 1WIPA 3OAYH 2X5PA 4YDVA 1ND0A 1BIHA 3FN0L 3S35X 3SDCC 5CUSL 4JREC 3HNSL 3MLUL 4K8RL 4PJEB 3QG7L 4Z9KB 3LEXA 4UT6L 2V2TA 3HE6B 4B53A 3CMOH 3INUL 4YXHH 3TFKD 3TPKA 4OCRH 4X7TB 1A14L 3EYUH 2CO6B 1ZT1A 5KANG 3UBXA 5ITBL 1MCNA 3ZSTA 3I50L 4YHPB 2X4NB 3CCHA 4OD2B 2V2XA 2XTJC 3QIUB 5HI4C 3BESR 3GIZH 4JRXA 2J4WH 2YWYA 4BK5A