2YRZA

Solution structure of the fibronectin type iii domain of human integrin beta-4
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
118
structure length
118
Chain Sequence
b'GSSGSSGSHDSRLTAGVPDTPTRLVFSALGPTSLRVSWQEPRCERPLQGYSVEYQLLNGGELHRLNIPNPAQTSVVVEDLLPNHSYVFRVRAQSQEGWGREREGVITIESQVSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrin beta-4
publication title Solution structure of the fibronectin type III domain of human Integrin beta-4
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 13
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2yrzA01
5C7XL 1NMCC 2VLRD 5ACLA 5MENA 2PXYB 1TZIB 1WTGT 4OD1H 1A6ZB 1W72A 2H32A 1U91A 5A16B 1TVHA 4WHYH 1H3TA 1DE4A 2X4SB 1MFEL 2WBJD 5B8CA 3UDWA 2KKQA 3DYOA 5C6WH 2F58L 3LKPB 4L9LA 5EBMB 3OSKA 3FB5B 4JKMA 3VWKC 1XF5A 4WENB 4ZOBA 5BXFB 3I3EA 1WFTA 5D6DA 2H1PL 4NHUA 4RX4D 1LEKA 2NY2B 2XWJB 4OQ1A 2B2XH 4YIQA 1P1ZB 3KJ4C 5CJXA 1HZHL 1KULA 2Z91B 3WIFA 1YJDC 5B3JF 3DARA 2FBOJ 4PRPA 5A2JH 3EYFA 3GJFK 3ARED 4QRPE 5TPWH 2W9DH 4RMSA 1BBDH 1QRNA 5JXAH 5GJTL 2VDKL 5I2IB 4M93B 4K3JL 5ICZB 4YHMH 3RHWF 3LKNA 2GITA 1LE9B 3RL2A 2LQRA 5ADOL 3MJ7A 3WFDL 1HSAB 3QPXL 1DBAL 4P4KB 5GGTH 3QCVL 2BNQA 4Y1AD 4LSQH 5DQJB 5LCVL 5JMOC 1DLFH 4DZBB 2PXYD 5AD0A 2DLFH 3KR3L 3UTQA 4PJDF 3BW9A 4HK3N 1FCGA 3O6LH 2ZKHL 3O4LB 3BEWA 2CXKA 1BJ8A 4PGBA 3TH3T 2DQDL 1Y0LB 1JWUB 5EC2B 5LVEA 2IQ9H 2HFFA 3IDXL 4RDQF 1JPGA 3T1FB 3TBYB 3QEUA 3EKCA 3VFUA 4WUKL 1S7WB 3GKWL 4MWFB 2FL5B 3MLUH 4RNRB 5DJAB 1W8NA 2B0SH 2GQHA 4ONGH 4XPGL 4HHAB 5GRUL 2CRMA 3C8KB 4B0MM 3KDMB 1DJSA 4JRXE 1BFOA 4XNZB 3KYMA 5GGRA 5E9DA 2NY2D 5TDNA 3HPLB 4OGXL 1AD0B 4RZCA 2FCBA 1HCVA 3HLAA 4GAFB 4NQVB 5IW1A 2BSTA 3MTRA 3UTOA 3P4NB 2XPGB 1INEH 3TVMB 5I19L 4NM8L 3GIVA 3IDJB 5BQ7B 4UOW1 5FCUL 3SO3C 3EBAA 3VXSE 1FNAA 3OJDB 1NSNL 2WIIA 2DQHH 2J8UF 4PJEE 5TE4L 1IFHL 3QEHB 3X14B 5DFTA 2EDEA 1CD9B 4P4KD 4NGHH 3ZL4H 5MEQA 1UYWH 2CLRB 2MJWA 3IFLH 1KJMB 1QRKA 3TO2A 2VLJA 4P5TA 4QXGH 4WUUE 1FL5A 2QQLH 3RGVC 1CFTA 4KY1L 2XN9E 3TH2T 3D0LB 1IT9H 2AV1B 2HRPL 4DTGL 2WWMD 2R0LL 3UTPE 4HJJL 3O4OC 1U92B 2RCSH 3BESR 3O4LD 1NLBL 4LSVH 1EEZB 3VFTA 1G7JB 3QIBC 3O0RL 4M1GH 3G9AB 1CGUA 5I18H 1KLGA 4R7DA 3WL9A 4HDIB 1XGQB 2E8ZA 1Z0MA 2CDFB 3MNWA 4ISVB 3ZTNH 1T5XB 2NY3B 5CSBA 1KLUA 3K2MC 5D7IA 3A6BH 4PV9A 3LMJL 4PGJA 4DKDC 1VPOL 1OD7A 4QO1A 4BKLB 1S3KL 1Q0YL 3T0BA 3KXFA 3LV3B 5GS1B 5HJ3A 3UTTA 4F57L 4YHOH 5BOZG 1UM4H 3IKCB 2V7HB 3MA9H 5ACMA 3UTSE 5EUOF 2CKBB 3OKDB 1ZLUK 2GJ6A 1WK0A 2V7NA 3P4OA 4LPTA 5DZOA 5IHUH 3AU1A 3RWDA 2FJFA 4O2FA 3C60C 5T1DH 2CLZB 3QH3A 1ND0B 2LU7A 4WWKA 1JK8A 3LHPL 1FZJA 3IF1A 1BZ9B 1JGEA 4DVBA 1JYVA 3BAEL 3MRNA 1B4JL 2NW2B 1A3LH 2G60H 3TPKA 1G9MH 4K8RH 4MB5A 1YYMH 3DV6B 2EO9A 4EXKA 3U9UB 3IAPA 3T4AA 1YEHH 1VFBB 4ODXB 1IGJB 2D3VA 4GW5B 2VOTA 5DI8B 3ILPA 5IJKC 2FX8H 1P7QB 2NY3D 2QQKL 4X99A 2YPVL 1CGSH 3T8XA 4DQOL 3ARBA 2ICWJ 5EBWA 1DDHA 5E8DH 3CDGB 1UKTA 1HIMH 5C0NC 5D2LF 1P84K 2VZSA 3HE7C 2UWEA 3JTTB 4PJHE 5I1DB 1GGBH 5HBBA 1D5XA 1XIWB 4KZDL 1RK1A 4MNHA 5T3XH 5IMMA 4M43L 1X5JA 1IC4L 4MQTB 4CNIA 2X4NA 1IRAY 3MLZH 4P9HC 1R24A 3Q3GB 1CU4L 4GAJL 2F53E 3ME0A 3U0TB 5E2TL 5EZLB 4YH6A 2QHRL 3KJ6L 1PZUB 5ENWA 3F6LA 3UPRA 2P24A 3DUSB 4MD4B 1U8HA 4X98A 5HYEA 2YMXH 1GAFL 1I8KA 3RRQA 1GGTA 3NCEB 3ULUL 1TZHA 5TE6L 4F8TA 1A7QH 4JB9H 5GGTA 25C8L 4UAOC 1QFOA 2VXVH 4JQVC 5DQDL 43CAA 2VLKE 4MHHI 1BPVA 1AO7B 2XZCL 5DUML 4NRXA 1T7ZA 4YHYC 4YEEA 5EU6E 1P7QD 4UTBL 3R4DA 4DUWA 5EORH 3PQYA 5F7NC 1A1NA 5DMKB 5HYQA 1L7TL 1XGYH 5B3NA 1QVOB 2R1XB 3IDIA 3T2PA 3G6AA 2NCMA 4KMQA 4LLWA 2IQAA 3X11A 3BT2L 1XIWD 3V0VB 2FEEI 4PJ8A 5J6GB 4FABL 3KPOB 2W91A 4F9LA 3LCYA 5DYOB 5MHSD 5CEZD 1EVUA 4XPTL 1FNLA 1JF5A 1G9NH 1HXYA 1VHPA 4PY8J 1A6TB 4X5XB 1QD0A 4XCFH 4DGYH 3H3PL 1GCFA 1CFNB 1F4WH 4WEBL 1QNZH 3ZDXF 3BP6B 4TPRL 2UV3A 1I1RA 4N0CD 4RMWA 3V2AR 2PKDA 4IS6A 1OSPH 2BSRA 3QFJB 1QFUH 5C6PB 3P9LA 5HVGB 3DMMB 1AO7D 4UIKH 4HC1H 4P59H 3EYUL 4KMTL 5IB4A 1JYNA 2CMRL 2DLHA 1I1FB 4R7NA 2X1OA 2VSDA 3MRMA 3V5DA 4GKZB 5J57B 1SVZA 2ZPKH 4PGDB 5GGVL 1A1OB 3GSQB 4OCSH 1FFNA 1YMME 1T22B 4LQFL 3T2NL 1AQDA 4H8WH 4HX1A 1A7BA 4NKOA 5JTWA 4PJFA 5D1ZA 1VACA 2FWOB 5J89A 4FQPA 4NO3B 5F9WC 2X4QA 4RDQG 1OP3H 2DQIH 2NY5C 4PLJD 4GLRI 3DWTA 3JVGA 2FYYA 1HWGB 1HDMA 2OI9B 1MEXH 4L8CA 1AGCB 3BKCH 1XCTB 1OHQA 3VXRE 1VGKA 4U49A 4M48L 5F97E 4YBLC 1H3PH 3GK8L 4HIXH 4JO4H 5CBEA 1PG7H 4L4TA 3WJLC 3PWJA 1XAUA 3TV3L 3WBDA 15C8L 3LZFH 4LKXB 4QHLA 5D7JB 3STLA 4UV7H 1SVCP 3QFJD 3RWCB 5C1MB 3O6FB 5B38B 4GQ9H 1WICA 1LDPL 2BHYA 1MJJB 2BSSA 4N0FB 3DMMD 4M03A 3FB7B 3DX8B 1ZT4A 1UT9A 3WLWC 1T03L 2AJSL 4Z77A 4HWBL 4PJ9B 1S7RB 2HN7A 3PIQA 1F3JB 1H0DA 3MGOA 1UWEH 3NH7H 3C5ZB 5AWNH 3VXNA 2Y7QB 1NBQA 4KJPD 4LMQE 4ZTPH 4E41A 4YHLH 3T0AA 4Y4HB 4JPWH 2GSIA 4LQ1A 3NABL 5B39B 4X7EC 5C0CA 2HT3D 3C87A 3CC5A 1X3DA 1FNEA 3KLAA 4MD5B 2YN5A 2Z31C 3HRZA 3OPZL 3GHEL 2H8PB 3NIDE 2C1PA 4HUWB 1ZTXH 5HVWA 4JJ5A 3QJHA 1S9WB 3CVHL 1TETH 3HNTH 2V2WB 2GAZA 2IANA 2YA0A 3PV6A 1CXEA 4ZFOA 1N5YH 1EK3A 2WZPD 2NY1C 1C12A 1HILB 1CBVH 1C16A 4F7CB 5TE7L 1TJGL 3FRPG 2IAMB 4R26H 1D5ZA 4E5XB 3SKJL 2CDGA 5CJOL 5I76B 1G7PA 3H2WA 2AJYH 3E8UH 2W1NA 1TCMA 4WGVB 4E42B 1P9MC 3BYYA 5IHLB 1Y6NR 4GW4B 4MNQB 4HIEB 3O6FD 4U3HA 5GGUB 3EO0A 3PF2A 1OARH 3QHFH 5I1IL 5I1GL 5C09E 1ZLWH 3RY4A 3GSVA 3RWIA 4EDXB 1NAKH 1X5ZA 3OAUH 4KHXL 4LCIL 1DQJA 2G5BA 3WYRA 4PJ9D 3OGCB 4KROB 4JO2H 1I7UB 3L95B 2D7MA 3MRGB 3C5ZD 1TTGA 3HR6A 2CUIA 4X7CC 1KJ3L 1WF5A 3FRUB 4LGRB 2A9NL 3VGDA 4Y4HD 1TVBB 4NKDA 2DJUA 1H5BB 3G5VA 1ZKAA 1IL1B 1BVKB 4QXTB 1GHFH 2ATKA 2IMMA 2C3VA 5HHNA 4WTZA 3V6OE 3MMEA 2RAMA 2YUXA 3L5WB 3U1SL 4XWGH 4JHBA 3JSSA 3QHZL 1RZGB 4MCZB 4MXQD 1XEDA 32C2B 3WIHL 4NO5B 1XZ0A 2AK4A 5F93C 1FYHB 2R9HD 1GPOL 1DBJL 4I18A 1T5WB 2IBBA 2HTKD 43C9B 4EI5A 2IAMD 3F5WB 4HF5L 4M6NL 3IRZA 2W0LA 4U1KB 4JFED 4WO4A 4X6EB 3RP1A 4F58H 5D72L 2VLRA 4P2YA 4MNQD 1Z2KA 1QBAA 3WFBL 1RK0A 2NY6D 4Z5RA 2IPUG 5FXCH 2EO1A 5D93C 1INQA 1B6DA 2XG5A 4NM4H 4D8PB 1DEEA 1N3NB 2R4SH 2WBJA 3RL1A 4KROD 4P57A 5IVNA 1SJEA 4LIQE 1CLYH 3BE1L 5D7IE 4LRIA 4OKDA 3B2UC 3MZGB 4I48B 5IJVA 3I6GA 4WU5B 5A43C 2J4WH 3QUZC 4L8BA 3LEXA 4NPYA 2NR6C 4ZSOB 3UTTE 4RX4A 1HHKB 2XRAH 3A6CH 4HC1A 5DLML 2CKBH 1CT8B 1FO0B 1JF1B 1A14L 3P4MB 1WIOA 4RIRA 1F3DJ 1NCWH 5HI4D 3OHXB 1SQ2N 4N5ED 4YO0B 1CDCA 3DURA 5CWSB 4RAVA 2GJ6E 3AREA 3D6GA 4LEOA 2ARWA 4XBPB 2BOCB 5JLZB 1EAPB 3TIDA 3ZTJG 2CDEA 1DFBL 3O2DH 2ID5A 4ZUUA 2R2HA 3PGDB 4OT1L 1FGNL 1R3LA 5KSVB 3FCTB 5JR1H 5D71H 4LVHC 2QTEA 1MH5B 4NP4L 1HINL 1N0XH 4RGOH 4Y1AA 5T33L 3RVXD 3ZYIA 3TFKD 2PXYA 1TZIA 4M3JA 3SE8H 1A6ZA 2H2PC 4WCYH 2NTSP 1YDPB 1NJ9B 1CGWA 3FOLB 4M7ZC 3RGHA 5AZEH 3C8HA 2X4SA 1Q9WA 1G1CA 1N64H 1WWBX 1ZVSA 4L29B 4LPUA 1S78D 1VEMA 2A1WH 1F90H 5J3HD 3KPSB 3LKPA 4ALAH 4GXVH 4LOUD 1U6AH 5EBMA 1WSST 3FB5A 1NANH 5EA0L 2Q6WB 2DKUA 2Z8VC 5BXFA 5IF0B 1I1AC 4PRHB 3U48A 3MRFB 3TO4C 5IIEB 2Y06H 1KYOJ 1OP5K 3OQ3B 1UJ3B 3CFEA 5C0EB 3CJJA 4TULL 5CEZH 3ULVD 2XWJA 5FHBH 1XGPB 5FO8B 1P1ZA 1FLRH 5IFJB 4U05A 2Z91A 4JPVL 5C0FB 5D70L 2CKNA 2HFEB 3PDGA 1N7MH 5DD0L 3DLQR 5I2IA 1BIIB 3EJYD 4Y16B 1KTDB 4DVRH 1CWVA 1LE9A 2I25N 2BZDA 2VQUA 3BIAX 2EEDA 1RZKH 1HSAA 3D3VB 4P4KA 4HUNB 2QR0A 2EDWA 3GJFB 3RWEB 4OCRL 5DQJA 4APQC 5C0GB 4A2LA 4DW2H 3CX2A 2VDPL 2VL4A 4DZBA 4NN5B 1Q9LB 4JFOB 5F7MC 3IFOB 5ABDE 1RZJH 4K9EC 3UP1A 3OAYK 2RJMA 3O4LA 5EOCH 5ITFB 2BDNL 4YXKL 3SKOB 1Y0LA 4K3DH 4O5LL 1ZHLB 2NX5E 5EC2A 5BS0E 4Z7QE 1EHLH 3KPSD 4PJBB 3T1FA 4P2OC 3S37H 3TBYA 2ZUYA 4BZYA 1S7WA 4MWFA 2FL5A 4KV5E 4PJEF 4J4PD 4RNRA 3AGVA 1MHPL 1YC8A 5DJAA 3VRLE 1OGAB 4HHAA 1GIGL 4PRHD 3C8KA 5CJ5A 1JNHA 4ELME 4MHHG 1IKFH 3E6HB 4YR6B 1G6VK 1NMAL 2I5YH 3IFNH 3HPLA 3U46B 1AD0A 4NQVA 5HDOA 2XQBL 1T66C 2DI8A 3ESUF 3HE6B 3P4NA 2XPGA 2VAJA 1YJDL 4PB0L 2YD2A 3IDJA 5BQ7A 3BRDA 1FL6B 2OTWB 2VZOA 4G3YL 4KJWD 1XT5A 4Y16D 3OJDA 1ACZA 5I15L 4OM0L 2YK1L 2HVJB 1YPZB 3OX8B 3O3EB 2WWKO 2DQJH 1RIUH 3FO9B 1AHWC 3QEHA 3X14A 5FYLL 3GDBA 2CLRA 1KJMA 4ODHL 4FZEH 3WHE0 4CADB 4CU8A 4OFPA 2NZ9C 3VG0H 2OLDA 1T89A 1YEEL 2AVGA 4PY7B 1P4IH 1JGLL 3BPNC 1F00I 4AMKH 2GK0B 1F5WA 4LSPH 3MOAH 4Q9QL 1U92A 3ALWA 1OAZH 5ISZE 4PJCB 3B5TA 4NQDE 3HE7B 3QZWG 3I6LE 1ITCA 2BNRB 1EEZA 1G7QA 4PS4H 1HOCB 1G7JA 4KVNL 3MOQA 4FQJL 1MNUL 1JJUA 5IFHH 3QI9D 1LGVA 4KZEH 3RTQC 1XGQA 2CDFA 5FUOL 4ISVA 1DQLH 3N1FC 1OGAD 3MFFB 2KQNA 1IVLA 1DBKL 2D03L 1IM3B 1IGTB 1HH9B 3B9KC 3NAAH 4GKSB 5F7HA 5KJRL 4DFHA 5JQ6H 2VDOH 3LV3A 5GS1A 5IGXL 4M9PA 5T3XL 5D5MB 2JK5B 3HE6D 1EIBA 3WFCL 4NO0B 4JREB 4X6CB 2IG2H 4KUZH 5D1XB 2V7HA 5DTFA 2PTUA 4FNLL 2P43B 2R0WH 2CKBA 3K4ZA 3OKDA 1UKQA 5F6HJ 3D0VB 1A6UH 5BO1L 1QSFB 1FFRA 4NWTL 2CLZA 1QBBA 4QHNA 2X1PA 2LV4A 4JFYB 5CINH 1ND0A 1T83A 5E0QA 3D9AL 2LU3A 2XWTB 1BZ9A 4HFUH 3CUPB 2EIDA 1FN4B 3O2DA 2NW2A 1AQKL 2FB4L 3QXDB 5HGAB 3HAEB 3KLHD 3DV6A 2NYYC 1ZGLB 2BNRD 4PJHF 3U9UA 4LAJH 3VRJB 1T2QL 1VFBA 4ODXA 1CDHA 4GW5A 5DI8A 2DQTL 1JHKH 4FRWA 1F4AA 4H25B 1P7QA 5IQ9B 4IOFD 2K9UA 1OSZB 2NQCA 2PO6C 1W2KT 4H88H 2ENSA 3S8WA 3N0PB 5IMLB 3CDGA 1A7RL 3QUYC 2P8LB 2YPLB 1MFBL 2IANE 3JTTA 4NO0D 5I1DA 2OQJB 1XIWA 4OSUL 4PRAB 4HUKB 5D1XD 5CP7A 3OG6B 1G7HB 3CLEL 5CGMA 1RIHH 5FFLA 3WHE1 1KFAH 1AI1L 5F9DC 4Y8AA 1QSFD 2VXTH 1AKJB 3Q3GA 2LU4A 1R0AH 1JP5A 2AEPL 5CBAB 5J13B 5EU4B 2WBWB 3JBG7 1NCAH 2B39A 3PE9A 4XWOD 5EZLA 3ROLA 4KI5E 3SE3A 5SX5H 1U93B 3DUSA 4MD4A 2F5AL 2O26U 3UBXB 4LVNB 1R3HB 2IH3B 4GAYB 4OGYH 5EBGA 4LMQI 1NEZB 3H42L 1OTSC 3T0WA 1OY3B 2R29L 4X6DF 2FHCA 1AO7A 1Q1JH 5H35B 4DN3L 4R2GB 1SY6L 1C5DB 5GZOD 5DMKA 2PN5A 3ES6B 3EYQC 2DIAA 1QVOA 4FQQB 5C3LD 4G7VH 5KVDL 3MZTA 2R1XA 4PUBL 5HVHB 4CUCA 4G9DB 4F9PA 3KPQB 3TT1L 3V0VA 1K2DB 1YN6B 3KPOA 4ZPVB 5FGCB 1D3CA 4N8CL 4D9RD 1FDLH 1JTTA 5DYOA 4HJ0D 4WEMB 4NNYA 4UV4H 3B5GA 1MCOL 1AKJD 3G9VA 1A6TA 1BFVL 2D7PA 3PV7A 4X5XA 1NC2B 2NLJB 4H0HB 4LSUL 1N6VA 1QBLH 3N9GL 4P9HL 4H5SA 3QDHA 5C0RH 1CFNA 4LLMB 2VLRE 4OLUH 2O5YL 3BP6A 5JIPA 1P4BL 4IRZL 1WFNA 3EO9L 4OCMC 3QPQC 4J3VA 5EC1B 3C09B 1CE1L 2VXSL 3LS4L 5E1AB 4N0UE 2WANA 3QFJA 5H37G 3QIUB 1UM6H 1GC1H 3Q6GL 3WJJA 2OJZL 3DMMA 4LCWE 5L2KE 4LVOB 2JJTC 3QUXB 1FO0H 3ULVH 2IEPA 4R2GD 1TNMA 1I1FA 3GUTB 1OW0C 4NOBA 4GKZA 4FQIH 4PGDA 2R23B 1A1OA 1C1EL 3D39E 3GSQA 3MXWH 3QJFB 5SWSB 1TJIL 5KAQF 1AD9B 3W11C 1T22A 1QO3B 1JZ3A 4NJ9L 2DBLL 1H9VA 2CUMA 5GRXG 5D8JH 1KEGL 2R8SH 4XNQB 2FWOA 3R0NA 4NO3A 3BH8B 3DSFH 3NBNA 4LNVA 2GJJA 2EXYC 3V4PL 1T2XA 2H6PB 3K2UH 1IC5L 4S1DD 1EJOH 2X2YA 4F15C 5CD5C 2F74B 4XPFH 4PRIE 1AGCA 3VGEA 1XCTA 1H8OA 1NC2D 4R4BB 4I0PD 3IXTB 3TJHC 4RFNC 4WNQB 4MVBC 4LKXA 4R0LC 4KAQH 3TH4T 4XXCC 3V6BR 1DL7L 2ICEB 3QIUD 3RWCA 3O6FA 3NIDF 1BOGB 3CCHB 5IEHB 3TN0B 1MJJA 4N0FA 3LS5L 3QG7H 3FB7A 3DX8A 1JPTH 2P5WE 3BN9D 3LEYH 4WI9A 3QUXD 1PFCA 4KDTC 2LAGB 3M17B 1ZANL 4LBEB 4PJ9A 5FYKL 1X5HA 1S7RA 1F3JA 5F72S 1I1YA 4KHTL 3C5ZA 3M45A 2AJVH 4UMGA 2Y7QA 2IC2A 2FGZA 2EE9A 5SWSD 4XZUB 4Y4HA 2CR3A 4HQQL 4Z7UB 2RR3A 4RQQB 5B39A 1IAKB 4ZUVB 4Z7WB 5BRZE 4MD5A 2X10A 3MBEC 4RWHA 2H8PA 1MCLA 7FABH 4HUWA 4Z7VE 2DAVA 5A2LH 1S9WA 3GJFH 1G7LB 1VEPA 2V2WA 3IJSB 3LRHA 1J05B 2NY7H 4UNUA 3AB0C 1L9NA 3NN8B 4LU5H 2QEJA 1JGUL 3QUML 4OZHB 1G7MB 2NY5L 4F7CA 3D25A 5EOQH 2B4CH 2IAMA 5CZXC 3VXMB 4E5XA 4JFEA 2BK8A 5J6HB 4GSDL 5I76A 1KB5B 1R5VB 4AQ1B 5E03A 4E42A 2PUQT 3SCMB 4XB7A 4GW4A 4KI1A 4MNQA 4HIEA 1PVHA 2YD6A 3ZKXC 1KYOK 1R6VA 5GGUA 3SQBA 4XGZB 3TN0D 3P0YH 4EDXA 3P30L 1B0WA 4U1NB 5I8OH 4L3CB 1Z9LA 3T08A 5ADPH 5KSAC 3OGCA 2YS4A 4JHAL 1I7UA 3L95A 1LQSR 1ADQH 3BIBX 3MRGA 1MREH 1FGVL 2XKSA 3MV11 4KK8C 3IDUA 4XCCL 3FRUA 5IB5A 1A7NL 3GMPA 1TVBA 1H5BA 4Q6IB 1UCBL 1IL1A 1BVKA 3M8OH 1SHMA 4QXTA 1Y6KR 2RFXB 1HH6B 4MA1C 4NBYB 3IS1X 3L5WA 4LSTH 5DJ2B 1LEIB 1XF2A 1M4KA 1OPGL 1U8LA 2Z92B 2CIIB 5FDWB 4GMSL 4K55A 4MCZA 1RZGA 1HN1A 32C2A 3OR6B 4NO5A 3NZHL 1TJHH 1IARB 3ZDZE 1T5WA 3U9PL 4TVPL 3BI9X 5D7IF 4ZD3L 43C9A 4ZFGH 1RULL 3VXMD 1YEIL 5FOBB 1O0VA 4U1KA 3FFDB 4X6EA 1I8LA 3G6DH 3NPSC 3SCMD 3RVVC 4LCUB 5D1QB 4C58B 3ARWA 3I3BA 1KPRB 3IU4H 3SDCB 4KKCC 3MYZA 3GGWB 5HI5D 4KC3B 5DGQA 1BX2B 3LQAH 4NBZB 4D8PA 2B7DT 2BSED 1N3NA 5L7XL 2W60B 3CK0H 4KGJA 5MP6H 4ZODA 2DQCL 2VE6B 2MQ0A 4EIGB 4NKMB 5DZLA 4I48A 5CHNB 4PTTB 3CNKA 4WU5A 3S5LG 1Q38A 1JZ5A 1J0HA 4JO1H 1UWGH 1CLZH 2XQYK 4ZSOA 5A2IH 1G7IB 4PJAB 4QTHB 1CT8A 1FO0A 1JF1A 5D7LE 3P4MA 3IU3B 3OHXA 4LLYB 3O41B 5CP3H 5GXBB 4LSSH 1S5IH 3U79A 5CWSA 5E56A 4BQBA 1MHCB 2GCYB 3AC0A 3KVQA 4XPAL 4XBPA 1HHIB 4HS3B 5HHMB 1EAPA 1HEZA 1E6JL 4WWID 4CN1A 1BMGA 4MJ6B 3ULSB 3PGDA 4PJXB 1NMBH 4Y2DC 3WUWB 5KSVA 3FCTA 1F58H 3ULUD 3EO1B 3KPTA 2P5EB 1N4XL 5T1KB 1MH5A 3UC0L 4KKAD 1ED3B 1SBSL 2WNGA 3VDCA 3I6KA 3MACL 4MJ4A 5D1QD 1J18A 5E2VL 4HAGA 1YDPA 5E6ZA 4QHUB 5FGBC 3WFHB 3SDCD 1GRWA 1NJ9A 2UVFA 1K4CB 1A2YB 3O3UN 3P0VL 2F5BL 4EN3B 5E2WH 4FQXC 4NQCE 4A6YL 4QNPE 5HYFA 5KTEH 5JUEL 5IG7B 4J4PA 4M7JH 2Q6WA 3MCG1 3QEQB 4W4OC 5EIIB 4PRHA 3MRFA 4L1DA 5IIEA 1PEWA 3QNZB 5KVEH 3VI4E 1KIUA 1LD9B 2R0ZH 4NWUH 3GRWH 1UJ3A 4IMKA 3PG2A 1EJ6A 4OUOA 3WCYA 4NKIL 3OG4B 5C0EA 4JKWA 4M5YH 1XGPA 5FO8A 3N85L 1P7HL 5C7XH 3BPNB 5SWZB 4F37F 5C0FA 4OZFG 1GJIA 5MHSE 5CEZE 1J7VR 2HFEA 2GJZB 4F8QA 4G6ML 1RURL 4XT1C 3KYKL 5HHMD 5C0DB 4NKQB 2DLIA 5GS2D 1MFEH 5E6IC 4Y16A 4Z7QF 2A38A 3BGAA 1VESA 2P4AB 3BUYB 4LLVB 4MLIA 1MRDL 4XNYH 3ZT7A 4KV5F 2P5ED 5T1KD 5KAQG 3RWEA 1OAYH 3GJFA 1DBML 3GO1L 5C0GA 4ELMF 4ODSL 1BZQK 4UQ2B 1Q9LA 3JXAA 4JFOA 4XPBH 3MLRL 4JRWA 1OAKH 4QRSA 3IFOA 3VD3A 1TPXB 1HHHB 12E8L 5IHBA 4ENEC 1HZHH 2D2OA 5ITFA 3SKOA 4UBDC 4EN3D 1ZHLA 1T7XA 5IQ7L 1NEUA 5HHXL 3QI9A 2BP3A 4HBQA 2AEQL 4DKFL 1G0XA 1FVCB 1G0DA 3QEQD 1OGAA 2ICWB 1JZ4A 2DJSA 1L0QA 1DBAH 2OMBA 3E6HA 4YR6A 4NUJA 3V6FB 3FKUS 1FPTL 5DWUH 3TLRA 4JZJC 3BKYL 3U46A 1NGPH 1ADQA 5SWZD 1WFUA 1DQMH 4G8GB 3TNNB 3HE6A 2MHAA 2CR6A 3FB6B 1RAMA 3MJGX 1FL6A 2OTWA 4XP4L 2Q76B 3KYAA 4CL7A 3IDXH 1C7TA 2HVJA 1YPZA 3O3EA 2ED7A 3FO9A 1A9EB 2Q86B 3EDFA 5FUCE 2NXZC 5DEZA 1TZGH 1CXFA 3MV9E 4G42B 4PY7A 3QFJE 2GK0A 1OB1B 4PJFF 4KWUA 1WV7T 4XNXH 2HJLB 2DM2A 4JFHD 4LLUB 4OLXH 4K9EL 4PJCA 1CICC 2BNRA 4Y4FD 1T6WA 4Q0XL 2WUBH 1HOCA 4NZUL 2HTLC 3HZVA 1R3KB 5DC0A 2AJZB 1NCDL 4JY4B 5BV7C 2GFBB 3IXAB 3DPBA 2Z0BA 3I3DA 3MFFA 4MXWH 1F2QA 2YKLL 1WZKA 3MLWL 1IM3A 1IGTA 1HH9A 1WBXB 4XI5D 1WISA 1ZSDB 4PJ5B 1EHNA 2MSPA 5FHAL 3T65B 5I71C 4F2MB 1HI6B 3ORJA 4DTGH 4G8GD 5D5MA 1MCKA 3WD5H 2JK5A 3O3AB 1OCWH 4NO0A 4X6CA 1RUKH 4ETYA 5TFSH 4XMKH 5D1XA 4HLZG 2XTJC 4BSVB 1IGCL 4XAKD 3D0VA 1KCLA 1QSFA 2FH8A 2BXYA 4HIHB 5CP3A 2DDQL 3KLDA 4QWWC 2XWTA 3NTCL 4WRLA 3O6ML 1EEYB 4ZYKB 3CUPA 1ONQB 3QXDA 1I7RB 2Q7YA 4U6TA 3GKZA 4MA7L 1TMCB 4JFPB 4PGZA 1ZGLA 1PEZA 3VRJA 1U2HA 2GI7A 3MRKB 2YD5A 1T4KB 2XA8H 4OCXH 3ZKMC 3JV0A 2X1XR 3BDXA 1FRGH 3PHSA 4H25A 2C4FT 5EU5B 3I50L 3QB7C 2OXGA 4TVSa 3W9EB 2QJDA 1RIVH 5IQ9A 4X9BA 1T1YB 5CCKL 1OSZA 1LO5B 4KTEH 3IJHB 1P53A 4K3HA 4U33A 1UJTA 3REVB 1S9YB 2A0LC 3RZCB 5IMLA 1CG9B 3H9SB 5E99H 3BAEH 2J5LB 1CQKA 5E8NB 5CILH 4I1NB 4PRAA 1AXSB 4EEEA 1CZ8L 1OAQH 1G7HA 5E00B 5JIIA 3GRWA 1UXWB 4KJQC 1TQCB 3FT4B 1VFAB 1AKJA 3MRJB 5HXMA 5EU4A 4GG6B 3T2OA 4G6KH 1F6AB 3NCYP 1U93A 5E08L 3GM8A 2BOBA 1F97A 2H2SD 2YR3A 1JPST 1IQDA 1M71B 1R3HA 2VMFA 1OTUC 2IH3A 2B5IC 4GAYA 5EO1B 5LBSL 3RA7H 5J56B 2YD3A 4GRLB 3BX7C 2C4XA 4WHYG 5H35A 3ARVA 2DI9A 3QIWC 4MJIB 4N90E 5HDQL 5GHWL 1C5DA 3D2UB 4GAJH 4LCCB 3KPNB 5E2TH 2AXFA 4FQQA 1BEYH 1Q8MA 3HR5B 3BN3B 4M9OA 3F58L 5B8CC 4LF3B 1E4XH 3UDWC 3TWCH 4DGVL 3H9SD 3WNOA 5EZOL 3DVFA 1JNNH 1KN4L 3KPQA 5I74B 2AV7B 1AE6L 4L9LC 3ULUH 1YN6A 4ZPVA 4Y4KB 3K8LA 1NUDA 4Q9RH 3BD4A 3RIAF 1IAIL 3TA3B 3O6KL 5D6DC 3GHBL 3CFIC 1CTNA 3DRQB 4KK5C 4ZS7L 5ALCH 3T09A 4HK0B 4M3KB 5DD3L 3FHQA 3R06B 1NC2A 2NLJA 2JCCE 4UTBH 5CJXC 4NNPL 1EO7A 3SDAD 4D9LH 4I0PA 3GBMH 4IIQB 1N5AB 2IFGA 3CDYA 5F7EH 1L7TH 4HG4J 4JKPH 5CUSL 4NYLA 4P3CL 1OTTC 3HUJA 1CF8L 5FM5M 5EC1A 2IWGA 3SKNB 5E1AA 1ACYL 3QIUA 3GZKA 4HCRH 1ZHKB 4GRLD 3MUJA 4G5ZL 1OQOA 5JW4N 3QUXA 3W0WE 4EIZC 1IGIL 1WCQA 1FNFA 1CQYA 4AEEA 3GUTA 2CPCA 4O58L 3D2UD 1IGMH 3NGBB 4ZSOE 2VWEC 2R23A 4F7MB 4F33B 2HJFB 2KBGA 3PP4H 2XY1A 3QJFA 4PLKD 5B21A 5SWSA 1AD9A 3WS6A 5GS2H 1QO3A 2ORBL 5DA4A 4J3UA 3ESVF 2E7CA 1ZEAL 5DC9B 4P9ML 5I6XC 3E6FB 4Y4KD 2EDNA 3BH8A 1U0QA 5LXGL 4XC3H 4RGNB 3TA3D 5C0AD 2H6PA 4OB5H 4LEXH 4ZTOL 1AY1L 2I24N 5ICYB 1MIEL 4YHKH 1IC1A 2F74A 3HG1B 3Q6FB 1NCNA 3BKMH 4QOKE 2VYRE 1NUGA 3ETBF 4FXGA 5T1MB 3CMOL 2PNDA 5DVOA 3IXTA 1F42A 3SE9L 1UZ6E 3PWLB 4MS8C 4WNQA 1UXSB 4HGWB 3ARDB 2BHZA 1YQVL 4G9FB 5C0BE 4LQFH 5HGBB 3T2NH 1HQ4B 2ICEA 2EZ0D 4YUEL 4HS6A 3CCHA 1TXKA 3WE6B 3TN0A 2AERT 1QOKA 2BJML 3IVKB 1CFBA 1VEOA 1ZE3C 4OLYL 3U36B 5JOPD 4GMTH 3KPSE 2X1QA 2NY0B 4XVSL 3JV6B 4P5TC 1AGFB 3M17A 5K9JL 1XR8B 4LBEA 2VDQH 4M1DH 1WLHA 2FEEL 4FQCL 5H8DA 2HLAB 5I30H 5DD5H 1OP5H 4XZUA 4Z7UA 4RMTA 4JFZL 1A5FL 4K2UH 3ZYZA 1IAKA 5KVFL 4Z7WA 4YDJB 5TQ2L 5ILTH 4IRJD 2D4DA 2BY1A 1G7LA 1J05A 2O93L 4JJHA 4RGND 4J8RB 1U3YA 1QYGH 2AGJL 2B1AL 2NY4C 3NN8A 3HG1D 3D3VE 4OZHA 1G7MA 2ADJA 4PYGA 4KQ4L 4OZGE 2N1KA 3VXMA 3ARDD 1I8IB 2NMSA 5J6HA 1QR4A 4G9FD 1R5VA 4ZO7A 3SCMA 1T7YA 4W81A 3K1DA 4JHWL 3CD4A 5LWYL 1NFIB 3OAYH 1TTFA 3IDNB 2VXUL 2HH0L 1YNTB 4OJFH 4PJBE 4U1NA 2NY0D 4P46B 3CXDH 4CN4A 1T0MB 4HH9B 4FOMA 4L3CA 3D48R 1RUMH 1FYTB 2ICCA 4WWKC 4YE4H 1ZVHA 1WUNT 2IGFH 1NANI 1HYRC 5F96L 3P0GB 1KCRL 5FYJL 3ZDZF 4TNVF 3B2VH 3G08A 3L3HB 4KK6D 4Y2OA 1LNUB 4Q6IA 4S1QH 3NA4A 4YWGH 3SDDB 3OL2A 2EDKA 4M8QB 3VMPA 2MQ3A 2RFXA 1T20B 3BVNB 5INCB 1HH6A 5HI3D 2F8VA 5DJ2A 1LEIA 4NFDA 1H3UA 5FO7B 3T0EB 2Z92A 2CIIA 8FABB 1TDQA 5I1IH 5FDWA 2XOTA 3GBLA 4TNWF 1Q72H 3OR6A 1YPZE 5E5RB 4P4RB 3VDBA 5GRZA 3ARBC 1JFQL 1AXIB 4GJTB 1NGWB 3DO3A 3HZKB 3A67L 4YXHL 3ARFB 1FC2D 3RVWC 3RZWA 4GAGH 1B2WH 3LPFA 5FOBA 3FFDA 5E2UL 3ILQD 4ODUB 1KJ2B 1JGDB 1U3JA 4U1HB 4WTWA 5D1QA 1FQ9C 4RRPA 2BNRE 3B9AA 2L7JA 1KPRA 1JHLL 1MAJA 1Q9KB 3SDCA 1S7XB 3GGWA 4IDLA 1BX2A 1D5IH 3DYMA 4P46D 2D7TL 2W60A 1FYTD 3WIHH 3VXTB 1BJ1J 2WP3O 4K71C 2ZUQB 5DS8B 4NKMA 1GPOH 5CHNA 4PTTA 1HSBB 4HCRA 1ZS8A 2EDLA 2R2EB 1RZIB 5DEFB 4WTZG 1JGVL 3SDDD 3QBTB 4N1EA 5BVJB 4DN4L 1G7IA 4XAWH 1GZQB 4PJAA 4Z95H 1AP2B 1MIMH 4QTHA 3SDXE 5D5ME 1J10A 4Q97A 4GKNB 3IU3A 4P23B 4LLYA 3O41A 3WFBH 3IDYB 3QXTA 3T0ED 1AR1D 3PWPB 1MHCA 1LEGB 2GCYA 4MZ3A 1HHIA 1WEJL 4HS3A 1U9KA 5EWIL 1QSFE 4U3XA 4TUKL 4MJ6A 4QNPF 4Z7OE 2ZCHL 3ULSA 4PJXA 1B0RB 3ARFD 3IETB 3BE1H 3MRBB 4MX7B 4C4KO 4YPJA 3EO1A 4EJ1C 3U82B 2P5EA 5T1KA 5GZNC 1MPAL 1X4ZA 4YC2B 1YZZA 4G6AD 4PJ8C 5I1HL 1UCTA 1LHZA 1T80A 3VI4F 1ED3A 3X3FH 1IJ9A 4F9LC 4V1DB 1P4LB 5EU7C 4OGAD 5KVMC 4Y19D 1A14H 3HCVB 4QHUA 3WFHA 3S4SB 1K4CA 1A2YA 4GO6B 2OTUB 1SEQL 4GFTB 2MCPL 3RVTC 5JO5B 4EN3A 5F1OB 3NZ8A 2X4RB 3HHRB 1DFBH 5IG7A 1IAMA 1MF2H 4JPIB 3QEQA 3B6SB 3ARUA 5EIIA 5LQBH 1MCCA 4ZO9A 2OL3B 3N1GC 1LD9A 4WI7A 3PABB 2YPLE 2FEDC 3BO8B 4P23D 1J1PH 5SWZA 5ETUA 4FXKB 4NZDA 4R90L 3TM6A 4ZMAT 1WIUA 4D9RE 3DVIA 1MELA 3MGAA 3PWPD 4UT6L 2O5XL 4HPOL 1MCFA 2GJZA 4YQXH 3DSNA 5FYKE 3RIFF 5C0DA 1N59A 2VLLB 4JVPA 3MNZB 3EGSB 1QPPA 4ELKB 1YEJH 4L4VE 4OFKA 2EDRA 5BV7B 1Q9OB 4ONHB 3U7YL 5EA0H 1WTLA 3TBTB 1X5LA 1OAXL 5D1ZC 2CK0L 1FAIH 2GYSA 4JFDB 1DTUA 4UQ2A 3HA0A 4V1DD 1HYSD 3FO0L 3SJVB 1CD8A 1HHHA 1QR1A 4LRNH 1DUYB 3JVGC 4LGSB 4ODVH 2JKXA 3T4YB 1L7IH 4X9GA 4LP4A 2QQNH 4Y4FA 5D70H 4U7MA 1KGCE 1M05B 4X7DC 3IGAB 3AY4A 4RMRA 1CLCA 4KPHH 3GEWB 1J0YA 4O9HL 4K7PL 4BH7A 1CK0H 1FVCA 3K0WA 3VG9C 4M7LL 4Z76B 2ICWA 3QXWA 3QISA 2YA1A 3SQOL 5CJQH 4F3FA 3V6FA 3EFDH 3L3OB 4FXLA 4L5FL 5E4EC 3CFCL 5BOPA 4RMVA 2UZXB 3EDEA 2LTQB 5FGCE 5D6CB 4IMLB 5E4IA 4U4BA 4G8GA 3O3BB 3O3DB 4U1IB 3TNNA 5DD6B 3FB6A 1NFDB 1ORQB 1G9MC 4K8RC 5AYUL 1BQLL 2Q76A 2AJXH 1GL4B 3CSYA 3DHMA 5CJBA 1T7VA 3HNVH 5FKPB 3CVIL 4NN7B 5IBTH 3MROB 1AXTH 1A9EA 2Q86A 1RZFH 5DVKA 2L7UA 3CX5J 3K8KA 1MQKL 1MHPH 2VABB 4HXBH 4QTIH 4FN0A 1CI5A 3LH2H 3F7QA 4G42A 2OR7A 2R1WA 4R4NC 4WW2B 5IW6B 5JW4M 4MA8L 2F54E 3SJVD 1OB1A 1X6LA 3F65A 2HJLA 3U6RB 2I60H 3SGEH 2IALB 4BZ2H 4LLUA 2XFXB 1KF9B 1ZT7B 4WJ5A 2W9EH 1LO3H 3VFGH 4AM0B 3Q5TA 1RJCA 4PGEB 1R3KA 2AJZA 3UJJH 4JY4A 3ZKQD 2GFBA 3IXAA 2YK1H 5HGHA 3ZHKA 1WBXA 4WY7H 1TQBB 3HC0B 1ZSDA 3KYNA 4KRNA 3W39B 1T3FB 4I4WA 4KK9D 2VDNH 3T65A 1MFDH 3WIHA 4F2MA 1HI6A 2W0KA 4D0DA 1ZA3B 4WW1B 4GRMB 5DR5L 3HI6L 3O3AA 4HG4K 2QADC 1AFVL 5IHZB 4HKZB 4P2RB 4DGIH 4WGWB 4OFIA 4KRPB 1PX4A 2DS4A 4HIHA 4RFOL 1K8IA 4U1SB 3X12B 3BRGC 4PB9H 4ZS6C 5KS9E 5AG8A 4N9GA 2VDLH 2WWKT 2B1HH 5DUBB 2A6IB 1EEYA 3GNML 4DCQB 5KN5B 1ONQA 3WLWD 3AAZB 5B8CB 5BMFL 3QWQB 1I7RA 1UEYA 4ZG1A 4JFPA 2A83B 4OLZL 4I18C 3S36H 1KCSH 4XNUL 1TNNA 2EE6A 4NQEB 4EI5C 4N0YL 1F3DH 3BKJL 3MRKA 4P3WA 3KPRB 4IDJH 5DJZB 1T4KA 4WO4C 1S9KC 1MWAL 3ZLQC 1AIFB 1V3KA 5CMAB 5D2NB 4X4ZA 4AEIL 3IDMB 5EU5A 3UMTA 3AS0A 4Z7UE 1BGXH 2NW3B 4PP1D 3W9EA 1RVFH 1G9NC 2CO7B 4YIQB 4PJ7B 4Z7WE 3RWGA 3VH8A 4YAQB 1T1YA 3QEGH 4I5BB 1J1OH 2EKJA 1LO5A 3IJHA 4JVUA 3REVA 4PRPB 1S9YA 2DWDB 3D9AH 5FA3B 4J3TA 2WBJC 3QCTL 3UZQA 3R8BB 2O5ZH 3H9SA 4YFDB 3MCKB 4Q74A 3QUKB 4YLQT 5E8NA 5BJTB 2VIRB 4LRIC 4CGTA 1VGEL 2IPTL 1AXSA 3MLPA 2ZCLH 5FV1L 2XTLA 5E00A 1E6OL 2QBWA 2YD1A 3NFSL 1UXWA 2YD7A 4P2RD 2BNQB 4KRPD 2ERJB 2AABH 2BVQB 3FT4A 1VFAA 2Y36H 1FNSL 3LDBC 4QHKJ 4YHZH 5MI0B 2DQTH 5I66B 5M7QA 3MRJA 2VSCA 3BWAB 4XP9L 4GG6A 3EFFB 3SDAA 3UTQB 4UDUB 2VXQL 1F6AA 2VR9A 4PRDB 3AREC 4PBWD 2VR5A 5DJ6B 3SKMB 1FH5L 3RI5K 3UYPA 4HW6A 4H8WC 1RZ7L 3QAZB 4XP5H 1A7RH 2HFFB 5C86A 3VGFA 1D6VL 3DX6B 4NQED 3IDGB 4LL9A 3EOYG 2BVOB 4GRLA 3KPRD 3U0WL 1YNLH 3D5OF 5F7DB 1NL0L 2J8OA 4B53A 3RPIB 2UY6A 2PXYC 3FT2B 1AC0A 3D2UA 2JCCF 4LCCA 3KPNA 5HHQB 2AEPH 1KNOB 1FZOB 2X40A 3MRLA 3HR5A 4KXZI 2JB5L 2SEBA 1KV3A 2E3VA 4LF3A 3RAJH 3E3QC 4WI6A 4D2NA 1MSPA 2ZUWA 3QXVA 2CRZA 3VU2A 2AV7A 1CDGA 2DKSA 4U31A 2ZJSH 4Y4KA 5MEOA 4NNXB 3WIIH 5MEPB 3TA3A 3O45B 5C0AA 1KJ2H 2WQ8A 2DQUL 3TO2B 3V4UH 2EYSB 3DRQA 2Z8WC 5ESQB 2NY2C 2EIBA 4HK0A 4YFLI 4XBEH 1G6RL 3R06A 2MTPA 3HRPA 4NFCA 3TZVB 1OOAA 1QFHA 4I77H 4IIQA 1N5AA 2DQEH 4OQTH 4OCWH 3ULVF 2APXA 4TRPL 1VDGA 1SM3L 2FH6A 4M93C 3WXWL 3SKNA 3L5XL 2E7MA 2FSEB 3WL9B 1IGYB 2AS5M 1ZHKA 4DOHE 4P4KC 1S9VA 2R0KL 5FECA 5HHOB 4QF1B 3T0XA 2FATH 4ZNEE 4X7SH 1EFQA 4HXAL 3C6SB 1WVZA 2WWMC 4PJAE 3EOBB 4F7MA 3MUY1 4F33A 1BFVH 2HJFA 3H3KA 4P9HH 1W72L 3GBNL 3C8DA 3MV7E 3WNPA 5HYJB 2J8UB 2O5YH 4X7TB 5M94B 4IRJA 3A0OA 4IRZH 4YEFA 2R69H 2Z8SA 1PYWB 3DV4B 2GUOB 3P11L 4OKVB 4ESKA 4EDWH 3E6FA 4X7FC 1C5CH 1IGFL 4OIIH 2W0PA 1E4WL 2FJFB 2ZUSA 4PJXE 4XNZC 2FX7L 3O2VH 5ICYA 1BD2E 1TLKA 5HHVH 1NDMB 3HG1A 3Q6FA 1PBYA 4BK5A 5T1MA 2VB5A 2FD6L 4YGVB 4HGMA 3IF1B 2M8XA 4OV6F 3TZVD 3PWLA 4RISH 1UXSA 4HGWA 2EEAA 3ARDA 3TVMC 4WFHD 1J8HB 4G9FA 4TQEL 5HGBA 1KCVL 1HQ4A 2MPAL 1ORSB 2DBLH 2ZZUT 1IEHA 4WFED 2VO5A 1MRCH 3OJMB 3P9MB 4M6OL 3WE6A 3IVKA 3ILPB 3BMVA 2OL3H 5HHOD 3K46A 3JV6A 1X7QA 4GRWB 1XR8A 3KYOB 1T89C 3QEQE 4HIJB 4XVJL 1CCZA 3FONB 1IC5H 3H6JA 3CSGA 2HLAA 5BVPL 1MCWW 2YRPA 5L8JB 1DSFL 2R2BB 3DXAB 5EBWB 1GGYA 4JRYB 2YD9A 3P4LA 5HYJD 2R15A 4OCNC 1YEKH 5E8OB 4YDJA 3VFPB 3RU8L 1JYWA 3U4BL 4YFLF 2R1YB 2ZCKH 3SBWA 1PX3A 5EZIL 2NY3C 3K4DA 2DQFB 1MAML 1KN2L 4J8RA 4PJBF 2FO4B 3EOTL 1KC5H 3FZUD 2A9ML 4NUGL 3WO4B 4BELD 1U8JB 2CGRH 1YEFL 5GS1C 5E2JA 4KHTH 5D7SL 3FQNB 4LASH 6FABL 5A3ID 2FO1A 2DOCA 1FV1B 2PYEE 3S7GA 5GIRB 2WAHA 2PF6A 1LVEA 1J8HD 1JPSH 3D18A 5B38G 5L0QB 1OM3L 4DUVA 4QKXB 1DR9A 1NFIA 3IDNA 1P69B 1YNTA 2G5RA 3QT2A 35C8H 2OP4L 4P46A 1T0MA 1CFVH 3U30B 1FNHA 1FYTA 1YPZF 1T83C 5F1NB 1BWMA 3ARQA 5I1LB 5D2LB 3W2DL 2N56A 4TOYL 3DXAD 2VH5L 5B39G 1I9RH 2YWYA 3RBSA 2AJUL 4HUVB 3KWWB 3L3HA 4JAMB 4JRYD 3SDDA 3L1OH 4EBQH 3BVNA 5INCA 3LAFA 2K7QA 5FO7A 4LARH 3T0EA 2DM7A 8FABA 2R4RL 4XAKE 2GSGA 4HZAA 3MRCB 1RV6X 2XZAH 3ZSTA 4P4RA 4LIQL 3TCLB 2AK1L 3UBXI 4JG1H 3UYRH 2E9JA 1NGWA 3OJVC 3HZKA 5EBLA 3ARFA 2C7UB 1BHGA 3QWOB 1I9JH 2YEZB 3AS2A 1EO8H 1XIWC 3RUGA 3L5JA 4UDTB 4UB0L 4ODUA 2PCPB 1KJ2A 4M7LT 1JGDA 1I3GL 4U1HA 4NHCH 5D5MF 5IEKB 3VGHA 3QDJE 4ZOEA 4PJGE 4X6CF 4Y19A 3RX5A 4BQ8A 5KSBB 2J88H 5DHYA 4J7RA 3C9NB 2C3GA 1Q9KA 1S7XA 3TT3H 4G80B 4JM4H 5F1IA 4OQTA 2BFVH 3S34L 4FFWD 3SE3C 1CS6A 2E6QA 5F9AC 4NBXB 3VXTA 1V7NL 2VR4A 3NZHH 4Q7DA 3B5HA 1KLFA 5CZKA 5DD1L 4N0CC 4ZUSB 3DO7B 1HSBA 1W0VB 4PJ5E 1RZIA 4JPKL 3AS3A 1RZKC 1QA9B 5BVJA 1HE7A 4G6FB 1GZQA 3PHQB 1AP2A 1FZKB 2C3WA 1VACB 4FFZH 3CX5K 4P23A 1KACB 1AGBB 4BK4A 4KVCH 1RZJC 1WWAX 4OM1L 4BQ6A 3PWPA 3OKLB 1LEGA 5FO9B 5DJXB 2X44D 5KANI 1INDH 5D9SB 4I3SH 4HWEH 5IWLA 2EH7H 5GGQL 1B0RA 3IETA 3VDAA 3Q5OA 3MRBA 4MX7A 3L3KB 4F9PC 4W6XB 4AH2A 3ELAT 1A6AB 1LO2H 4Q2ZB 2BY0A 3G5YB 3G6JA 4V1DA 1P4LA 2DMCA 4MDJB 4UZGA 4Y5YB 1JZ7A 1QLEH 1U8MA 3HCVA 2PTVA 4PLJC 2OTUA 2B2XL 4HGKC 4TTDD 1XR9B 2DRUA 5FUCC 3KPPB 4E41B 2PO6D 1E6JH 1MJ7L 3OKEA 5TPWL 2X4RA 2W9DL 5JXAL 1BBDL 2E5EA 5ERWA 3CC5B 2YD8A 1FNEB 3B6SA 4YHML 2EE2A 3KS0J 3ABZA 5DC4B 3CFDA 4G6FD 2OL3A 1A4KB 1VERA 3WJJC 3H9SE 2ENYA 2H45A 3PABA 3DMMC 3PGFH 4M7KH 3BO8A 5GGTL 1A8JH 1PSKH 1SBSH 4LSQL 1LMKA 5J1SC 3L7FB 3PV6B 4FXKA 1JRHH 3RY6A 4GUPB 2DLFL 4KJPC 3O6LL 1HK6A 1I3RB 2VLLA 2P7TA 3MNZA 3MLSH 3EGSA 4ELKA 5FB8B 3WXVL 4GG6E 3MUGB 2HT3C 2IQ9L 1MCHA 1Q9OA 3MUZ1 3TBTA 5E24E 3V9FA 2IBZX 5F6IB 4U1GC 2B0SL 3SJVA 1GXEA 3REWA 3IYLW 4OBRA 1RHHB 1DUYA 4X9IA 3AFLA 2OI9C 3T4YA 3K1KC 4ZXBB 1DVFB 3ZHDA 2AJ3A 1QP1A 1M05A 3BJLA 4MJIE 4S1SH 1J12A 4P2QE 3IGAA 3DYPA 3MRPB 4WHTA 4U6VH 1INEL 2X4UB 4NKDB 5D7JC 3RX7A 4C59B 2BMKB 1XFPA 3VFSB 4Z76A 2C3VB 3OGOE 1ZGLP 3O6FC 2HWZH 4V2CB 4OF3A 4WIQA 1DBMH 2RIKA 3L3OA 1EDQA 4AG4H 5I1EL 5J11C 5EOTB 1UYWL 4ETQB 1D5BA 4QXGL 5D6CA 2QQLL 4TTGA 4IMLA 4PJ9C 5DK0A 3BGFB 4U2ZA 4U1IA 3O3BA 3O3DA 3L7EB 5DD6A 1IT9L 1HQRB 3C5ZC 1NFDA 1ORQA 4Y4HC 3QULA 2I9LB 1S7SB 5FYJE 5FKPA 4LSVL 5C08E 1EGJH 5GPRA 1QBML 3MQIA 2OBGA 1IZKA 1F4XH 1YNKH 4L8SB 4M1GL 4DKFH 1J0IA 2HJKB 3C08H 5I18L 3RNKB 2VABA 3QPQD 1FG2B 5GISH 3ALXA 3LVEA 3VI3E 5JA8B 5JW5B 3I9GL 1RK0B 4Y7MA 2C3HA 4MXQC 4M1CD 1E4JA 1BIHA 5F3BB 3A6BL 3U6RA 3T3PE 2IALA 3JTSB 2XFXA 4ZXBD 2R9HC 1DVFD 1ZT7A 4J1UB 3LRSB 3U7WH 2HTKC 4OZIA 2IAMC 4YXLH 4AM0A 4BYHA 3JWOH 2EDXA 4PGEA 3I6GB 2CRYA 4YHOL 1F4YH 2DJ4A 3EHBD 5DJ8B 1UM4L 4BFEA 3F7RA 3LEXB 3MBXH 4NPYB 4OF6A 4LK4A 4I2XA 1AGEB 1GGCL 1F4HA 2NY6C 2Q87A 3HC0A 3VWJB 3W39A 5IHUL 1T3FA 5K59E 1E4XI 1MHEB 5T1DL 1A7OL 3VGGA 1ZA3A 2E9IA 4GRMA 4KROC 4WW1A 5FOJA 5HY9A 3GI9H 5CD5D 5LAXB 4KTDH 2EEBA 1A3LL 3HG1E 2G60L 1H5BC 5IHZA 1G9ML 4HKZA 3MJ9L 1YYML 1A6VH 4P2RA 4M4PA 5J06A 1C5BH 1YEHL 1MFCH 4X80H 2JIXD 3HKFA 4U1SA 4Z7UF 5HI4C 3X12A 2DTMH 4G9FE 1VFMA 2FX8L 4Z7WF 1CVRA 4NC2B 3ZT5A 1NAML 4GT7A 4GRWH 5DUBA 1Q9WB 2A6IA 4DCQA 5JHLH 1OP9A 5KN5A 5FHAH 2DL9A 3JV4B 3WDHA 1CGSL 3AAZA 1ZVSB 3HI5H 4ZFOL 2A83A 4ZFFA 4PD4J 5E8DL 4NQEA 1HIML 3ZE0E 1Z5LB 3KPRA 1DLHB 5DJZA 2H9GB 1EPFA 1GGBL 4NFBA 1I8LC 4OZHF 3FN0H 1AIFA 3PJSB 1D7FA 2ZOLB 4JDVB 3DX9B 4S0SD 5CMAA 1CGXA 3IDMA 5D2NA 5DO2D 3TFKC 2NW3A 3CFEB 1B0GB 5AZ2L 4PJ7A 1F13A 3VWJD 3MLZL 4YAQA 1N0LA 4I5BA 5FM4A 4YHIB 4QRRB 2DWDA 5FA3A 1CL7H 3U2SB 3NACH 4ORZC 2H3NB 3O6MH 5DFWH 1S78C 4AIZB 4NN6B 3MCKA 4OCYH 3QUKA 5J3HC 5BJTA 2AXHA 2VIRA 1NKOA 3Q1SH 3FT3B 4LOUC 5IB2B 1WJ3A 4AY0A 5IOPB 4BJLA 4I9WD 1GC1C 4KQ3H 1ZK9A 4JB9L 5IT2H 2QR0B 3LD8B 2HG5B 1KIRB 5EO9B 2BVQA 2VXVL 3ULVC 5I66A 4D9QD 3F6IA 1UM5H 3VXOB 1H8SA 3BWAA 3EFFA 1K8DB 1RSFA 3SEPA 4UDUA 3BP4A 4I8DA 3HAEG 5D7KD 5EORL 4HK3J 4PRDA 4J23A 2UVEA 5DJ6A 3SKMA 3E1F1 4RCAA 5JOEA 3EJYC 2G9HA 1YY9D 2BVPB 3TEUA 3DX6A 3IDGA 1FYTE 4I3RH 2BVOA 3MPCA 2K3TA 4IBLT 4KK8D 3IB4A 4FQ1H 4EUPB 4OLWH 5DQ9B 5F7DA 1JNHB 3RPIA 1YQ2A 4U6HB 3CSBA 1M7IB 3FT2A 4LAQL 3V79C 3MODL 4G6JH 3BUTA 1IILE 3TP4A 5HHQA 1KNOA 4N1HB 1FZOA 1A3RH 1G9NL 4Z0BH 2DWEB 4XCFL 5FF6B 4QRRD 3N1PC 4M62H 5DMGD 5CS7A 3PHOB 4PR5B 5C07B 3T0EE 3TYGH 1F4WL 5EIVA 1VKXB 1NCCH 1QNZL 1GH7A 2PR4H 4PBVC 4J4PC 4N9OB 4JRXB 4NNXA 1OSPL 2L4OA 5MEPA 3O45A 3NA9H 2E9BA 4UU9B 4K7PX 1IEBB 1UJ3C 4IMKC 2EYSA 4MAYB 5ESQA 2JLLA 4YGAB 2CUHA 4R8WL 4UIKL 4HC1L 3MOBL 5FCSH 3TZVA 4PJAF 1QFWH 2Y6SC 2BHUA 2LVCA 3UBXG 4KKCD 2ZPKL 3VXSB 3CFBB 3CLFL 3ZT6A 1EGJA 1G7QB 4KJWC 4Y16C 1NEZG 1T21B 2ICWI 4OCSL 3T0DA 4XVUD 5EZOH 1ZLVK 2FSEA 4H8WL 1IGYA 3FQWA 5HSFA 5ACZB 5T5FL 4WUUB 5HHOA 4QF1A 5GRVK 2XN9B 3P77B 4PJXF 1IAIH 1J0KA 2BCKB 5DSCB 4NN5C 3C6SA 2OZ4H 4JQIH 4ZS7H 2DQIL 1NBVH 3DJ9A 3EOBA 1AGDB 1MEXL 3BYTA 3OBAA 3RBGA 2B4CC 3BKCL 5E8PB 5HYJA 4CW1A 1H3PL 3UX9B 3BWUC 4JO4L 5CUSH 2J8UA 1PG7L 4X7TA 3TC9A 5C07D 3V7AE 1BQHB 3QCUL 1PYWA 3DV4A 2GUOA 3V6ZB 5DTFB 3HC3H 4WHDA 3LZFL 4OKVA 1H3XA 3V7MA 2FDBP 2XV6B 4UV7L 1NCUA 4JRXD 5EUKB 3LIZH 4GQ9L 5JPMA 4QHNB 4MAYD 1NDMA 4HPYH 4XMLH 3VA2C 4YGVA 1EHAA 1FJ1B 5KANG 3B3IB 3B9EA 4LNRB 3HE6C 5DK2B 1UH2A 3RWFB 1UWEL 3NH7L 3I75A 5AWNL 3VXSD 1ZAGA 1J8HA 4ZTPL 3UTSB 2VAAA 5C3TA 3NFPB 2OTPA 3ALPA 1ORSA 2ZSVA 4QT5B 1ZEAH 3P9MA 4W68A 2ZG3A 5BZWB 2CO6B 3FRPA 4WUUD 5ALBH 2XN9D 3QSKB 1ZTXL 5FA4B 3KYOA 2AKRB 3LN4B 4AZ8A 1TETL 3EYOB 3FONA 3HNTL 4HIJA 2EYRA 4GS7B 3UTPD 2KL6A 4JM2B 4FZ8H 4MAUH 2R2BA 3DXAA 2Q7NA 1BAFH 1CBVL 3KLHC 2ZUVA 4JRYA 3SE9H 3MCLH 2MOVA 5E8OA 3K7UA 3VFPA 2CRIA 1PKOA 5GJSL 4R26L 5CP7B 3FO1B 5JMRA 1RUPH 2R1YA 3BZEB 3GI8H 2AJYL 3E8UL 4OGZA 3H0TB 4MQ7B 2OK0H 2DQFA 1UC6A 2FO4A 1OARL 3LQAC 4IOFC 4JG0H 3ZKSD 3ZYOA 3BHBB 2NNAB 3ROLB 3AUVA 5K9JH 3DI2B 4K94H 1NAKL 1U8JA 5TF1H 3OAUL 1SJXA 4PJHB 4JFDE 3FQNA 5IW3A 1QSEB 1EVTC 4JO2L 1FV1A 3SJVE 4JREC 4ZNCD 1CXHA 1FG9C 2OCFD 2PW2B 5GIRA 3LB6D 3UTSD 5D1XC 3B8YA 1ZLSH 4FTVB 5KVFH 1ZOXA 1GHFL 3SE4A 3F7VB 2V5MA 2XTJE 5GS3A 3R1GH 3TBSA 1S9XB 3U4AA 4YX2H 2WIMA 4XWOC 4PPTA 4X9HA 3BD5A 4JLRB 4XWGL 4Y88A 5F1NA 5JXED 5I1LA 5D2LA 3VFVA 4JM2D 5I1JH 2XKNB 4C83B 2VC2L 5I8KL 3UAJD 4HUVA 1UFUA 3KWWA 4JAMA 4KQ4H 1QTYT 2MFNA 1R3IH 1KJVB 1KENH 4QLRA 1BREA 1PGRB 2VLKB 1J88A 4X6DE 1NFDE 5EU6B 4PJGF 4F58L 4NNYB 2VXUH 3H9HB 3O11B 5GZOC 1RFDH 3MRCA 2EDTA 4H5SB 3TCLA 2FZ3B 4NM4L 1CDUA 2R4SL 2C7UA 3QWOA 1QSED 2YEZA 2Q8AH 5SV3A 1U8IB 4UDTA 3SDYH 2PCPA 4GLRH 3CSPA 2VERN 4FTVD 1CD1B 2J4WL 5IEKA 4HJ0C 5KSBA 1T1XB 3C9NA 2XRAL 3A6CL 5GRJH 1R3JB 2CKBL 4G80A 1NCWL 4BM7A 5J13C 3FFCB 1IMHC 1F02I 5JHDE 1FL3B 2PO6A 3AMLA 4EKXA 4LGPB 4OD3H 4ZUSA 3DO7A 1W0VA 3BZFB 3QXAB 4LVNC 1O7VA 1QA9A 3O2DL 2VLKD 3PHQA 3OXSB 1FNGB 1FZKA 5D71L 1M7XA 4U1GB 5I0DA 1AGBA 1N0XL 5EU6D 4RGOL 2OZ4A 1BZ7A 4R2GC 3BQUB 4YHNB 3CU7A 4RA0C 3TGXA 1G6RB 3OKLA 5FO9A 5LGHL 3SE8L 1FZMB 1NGYB 5DJXA 4TUJB 4WCYL 1U3ZA 4ONFH 1N8ZB 4Z8FH 5D9SA 2D7TH 5K9QI 5TDOB 1FAKT 5MENE 5HVHC 3BP5B 1N64L 1Q0XH 4JFXB 5CSGA 3L3KA 3MLXH 1F90L 2YUVA 4O02H 4S1RH 1A6AA 4ALAL 4RRPG 4GXVL 1U6AL 1BP3B 2FLBT 1NDGB 2FJGB 4Q2ZA 5KOMC 3G5YA 4RSVA 5J11B 3ARGB 2Y06L 4KKBD 4N8VB 4MDJA 4Y5YA 3PGCB 2Z93B 1ZWIB 5CEZL 1FLRL 3NIGE 1XR9A 5D96B 3FFCD 1I1YB 5C2UB 4IJ3B 2ZWLT 1PLGH 5GGSB 1EX0A 4XPHH 3KPPA 4PJ7E 2HKHH 5GGSY 4GG6F 3C09C 4XX1G 2FLRT 3OWEA 3QXUA 3QIUC 3R8QA 4DVRL 3TF7C 4PRPE 3ET9F 1IC7H 2WP3T 1OAUH 1MPAH 1A4KA 4P5MB 4WDIA 5C71A 1KT2B 1U8OB 1X4YA 4RBPK 1QRNE 1RZKL 1QSZA 2DLEA 4L3EB 3BN9C 4LVOC 3QUXC 4PG9A 3RKDD 2KQMA 2J6EH 3GIZH 2PETA 4JR9H 3L7FA 4S10A 3BQUD 3QO0B 3WKML 4DW2L 1LWRA 4LSRH 4QY8B 3QDGB 4GUPA 4ODTH 4S11A 3F8UB 3HB3D 3WLBB 1QKZH 2BNQE 1I3RA 3AVEA 2MCPH 4XHJD 3D25B 2P1YA 3LN9A 3WUWG 3WS6C 5EOCL 1DQDH 2ADGB 5FB8A 4PD4K 3V0WH 4K3DL 2VDRL 2BX5A 3MUGA 4JFEB 2CSPA 2VWEE 4ZUWB 1V7ML 1EHLL 1H3VA 2YA2A 4BH8A 3S37L 2Y23A 4EUPH 4XC1H 3DUUB 3GSUA 1OTUD 4HV8B 1JZ8A 2NY6B 5A40E 4C4KT 3ARGD 4XP1L 1WZLA 1IKFL 1RHHA 1EZVX 5IROA 4K23L 2I5YL 3IFNL 3PWUB 4JEGB 3QIWD 4MA3B 4R90H 4ZXBA 1DVFA 1RJLB 1MCNA 3P73B 3MRPA 4F7EB 5GS0D 1NLDH 5E9DE 1IQWH 5IB5B 3GMPB 2X4UA 1EERB 3QQ3A 5C0JA 2BMKA 3VFSA 2EDYA 2EXWD 3EOAA 1FSKB 2WV3A 4URTB 5C09B 4JANB 5IBUB 3TN0C 1FVDB 2D4FA 1RIUL 2DQJL 2UZIH 1OAXH 4MQXD 3VI3F 4K3EH 4L3ED 4R3SB 5EOTA 4ETQA 1XF2B 1U8LB 1Y6MR 1X9QA 1EZVY 4DUXA 3VG0L 4M5ZH 4D94A 3L7EA 3QDGD 3T3PF 1HQRA 4CVXB 3N1QC 3MOAL 2VLJE 2YBRA 3KG5A 4LHUB 2I9LA 3RVUD 1S7SA 4R4FH 5FM5O 3KPLA 4PS4L 5B4MD 3WNNA 1YYLH 1CR9H 4L8SA 4R0LA 4O9HH 2HJKA 4NQTA 3RNKA 2JIXA 4KZEL 1FG2A 4M7LH 4WFHE 4EVNB 4B50A 2RGSA 3VD5A 5JW5A 3GB7B 3EJJX 3L3JB 3HZMB 4AK1A 4WFEE 1YY8B 5K59F 2AI0H 4L5FH 3HFMH 3FQXB 3NAAL 5F3BA 4U1JB 1GOFA 1Z3GL 2HFGH 4Y5XB 4KDTA 3JTSA 5JQ6L 2VDOL 5HHOE 1U3HB 5I1KH 4J1UA 3LRSA 4I0CC 2GK2A 2NPLX 5CGYD 1HCFX 4TNWK 1PW3A 2ATPB 5AYUH 3SHSA 1MRFH 5DZNA 1WT5A 2IG2L 4LFHD 4HT1H 5DJ8A 3KXFE 4KUZL 2HKFH 5FGRA 4MSWB 3SCMC 4P3DB 5I8CB 4M6MH 1AGEA 5C09D 5HYJE 3Q48A 2R0WL 4WV1B 4XVTH 4MQSB 1A6UL 1D6EB 4MZ2A 3VWJA 5HI5C 4P99A 1MHEA 4QXWA 4LVEA 1MCPH 4HUXA 5CINL 3IAGC 4UINL 5A1AA 2QKIB 1HEZB 5KVGH 2PTTA 1XF3B 5LAXA 4HFUL 2HT4D 4GXUN 4LHUD 3ZE0F 4XXDB 4RA3A 2QHLA 4Q6IC 3TESA 2FGWL 1NGQL 4JN2B 2W07A 3V5KB 4FMFA 5HPMB 1KXVC 3I6KB 4FQ2H 1J8HE 2FIRT 5EH1A 4BSWB 1JHKL 1E4KA 3QRGH 2EIZB 2JELH 4M6AA 4UT7H 1T1ZB 4FG6D 5JDSB 3JV4A 1U3HD 5C9JB 4H88L 5DR5H 1MUJB 4Z0XA 1CN4A 4GRWE 3NIFE 3BGMB 4YK4B 3ULUC 1Z5LA 1AJ7H 3L3DB 1DLHA 2H9GA 5I75B 3DTXB 2VDMH 3PJSA 2ZOLA 2HLFD 3DX9A 4JDVA 4KKAC 1I7ZB 2XT1B 3GSWA 1K85A 5JIKA 5D1QC 4DZ8B 2UWEE 1B0GA 1KFAL 3BDYH 4WI3A 2VXTL 3SDCC 1MJUH 1LILA 1X5YA 4YHIA 2XZQH 1R0AL 5HPOA 4QRRA 1GGIH 1JUFB 2I07A 3MLYH 3U2SA 1NCAL 4NZRL 2H3NA 3LOWA 1QPXA 4AIZA 3F12B 4U6YB 2HMID 1WC7A 3OKOB 5BMFH 5IB2A 3FT3A 4HBCL 5FM8A 4WHCA 5IOPA 3MLVH 4BZ1H 5DK3A 5I73B 1FBIH 2V17H 2HG5A 1KIRA 4OGYL 5EO9A 2J6EA 3EJZD 4X4MA 1PZ5B 3VXOA 1Q1JL 4QRSB 1K8DA 2ITCB 2ZUTA 1L0YA 1JE6A 4RAUB 3ZSSA 5T3ZD 4G7VL 5TDPB 4WFGD 1D9KB 1F2XK 2BVPA 3PDDA 3QI9B 3PQYE 4KGLA 1Z9SA 1JWMB 5J8OA 4MB3A 4EUPA 3I84A 3UZVB 3OAZK 2D7QA 5DQ9A 1JN6B 4U6HA 3QWRD 2XNAB 2FX9H 1KCUH 4NUJB 2AEWA 1FDLL 1M7IA 2N7AA 3X3GH 5F6HI 3BSZH 4U2YA 3F62A 2FJHB 4UV4L 2BNUB 5DURB 2DWEA 2NX5B 5FF6A 4EN3C 5EU7E 2MHAB 4PV8B 5C0RL 1S5HB 3PHOA 4PR5A 5C07A 3HMXH 4TSAL 1VKXA 1T1WB 1J1XH 1RZ7H 2A6JB 4MNGB 5K93A 2PW1B 4ELMB 4JRXA 1F8TH 3DROB 1UM6L 2WUCH 4UU9A 3U0WH 1GC1L 1IEBA 1IM9B 4MAYA 4JDZA 5IFAH 1BLNB 5JNYA 3KLSA 1FO0L 3ULVL 3GSOB 5IV2B 4FQIL 5KSBE 1RJYB 3VXSA 1VADB 2OJEB 3CFBA 4RGMB 2VN4A 3MXWL 5JDJA 1T21A 1D9KD 4MGXA 3HZVB 3O8XB 2MCG1 4YBQD 4CDHA 5C0IB 5ACZA 3PL6B 4FFVD 5D8JL 4WUUA 1NCBH 2XN9A 3P77A 4M02A 1KEMH 2R8SL 5DRNB 2BCKA 5DSCA 5L9DL 1A4JB 3DSFL 2DQUH 2DIBA 2EDFA 1TPXC 4PJFE 3K2UL 2DL2A 3VFRB 5ISZB 1AGDA 1EJOL 1G6RH 4XPFL 3VGBA 4POYA 5DURD 5E8PA 2NX5D 4AYFA 4YDKH 5BS0D 1XH3B 2A77H 2WBKA 4TRPH 1KTKE 4CMMA 3AY4C 1BQHA 3HI1B 4WI2A 2F19H 4KKLD 3WHXB 3V6ZA 1P6AB 1CDIA 2ZUUA 1A3QA 4KAQL 2J12B 3GSNL 3ISWA 1JL8A 4HAFA 4L4TE 5EUKA 4TSCH 1WFOA 4XI5C 1IM9D 4POZD 3DI3B 3QG7L 1JPTL 3GMRB 3LEYL 3F7PC 1KXTB 1FJ1A 5EZJB 5HVFB 1V05A 3B3IA 4LNRA 3RWFA 4IOIB 5DK2A 2VLME 3TBVB 5K9QG 2Q7YB 4BFIB 5GS0H 3UTSA 1MCDA 1R5IB 3NFPA 4X8XA 3EUUA 3DUHA 5CLTA 1FORL 4QT5A 3O8XD 2B20A 3H7LA 4TSBH 5LG1A 4JKLA 3V4VH 4YBHA 5BZWA 2APBA 4E41E 3PL6D 2DYPB 1HHGB 2CLVB 4GBXB 5FA4A 2AKRA 3LN4A 2HVKB 5C0CE 2FX7H 3A6OA 3EYOA 3FOMB 3FMGH 5JXEA 2DIJA 5JZ7D 5DJ0B 2NY7L 5J1TC 4NCDA 4JM2A 1RUAL 3T2QA 1URLA 5ISZD 2FD6H 4NQDD 1J5OH 4QEGA 4M61B 3V95A 2Q20A 4UILH 5DRWB 5EOQL 2B4CL 4K07A 3FO1A 5FUZL 1X5KA 2VZTA 5DMYA 3BZEA 2MKWA 3SGDH 3H0TA 4GKOA 4MQ7A 3FJTA 4JQXC 5T3XE 3QP3A 1QHPA 3CU1A 3WSQH 1U8PB 1NAMB 3P0YL 3BHBA 2NNAA 1F45A 4JY5H 4PJHA 3BXNB 5ADPL 2BOBB 1QSEA 3CH8A 1ADQL 1MREL 2PW2A 4JN1L 1IQDB 1CGYA 3NCJH 1S7VB 4FTVA 1YECH 3M8OL 4Y5VB 1NFDF 1HKFA 3UJIH 5KW9L 3EYSH 2DYPD 3F7VA 5EZIH 1S9XA 4GBXD 4LSTL 4UTAL 4X6BB 5IK3B 4BFBD 3SOBH 4JLRA 4HFWB 5C2BH 1JNLH 3EOTH 4GOSA 2AXFB 1FIGL 4NUGH 2XKNA 4C83A 5HD8D 2H2SC 1UVQB 1LE5B 4WW2F 5D7SH 1Z9MA 2UYLB 1X5IA 4CBPA 6FABH 1KJVA 3C2SA 2VLKA 1WQVT 3LPWA 2AK4E 1JRHI 1SYSB 4JFFB 5EU6A 3NCMA 3NPZB 3G6DL 5I9QB 1W0YT 3MR9B 3VFWB 2CK2A 1NCTA 3H9HA 4ZPTA 3O11A 4HLZH 4YDIH 4JY6B 3IU4L 3G04B 4I0PB 1HKLH 5L6YH 2FZ3A 3ARPA 3D1MC 3LQAL 4R4ND 2CH8A 3HMXA 3RZCC 4NYLB 2JJSA 3TJEH 3CK0L 4ZAKB 3HUJB 2J5LC 4MJ5B 4QXUH 5MP6L 1TENA 3UO1H 4R96B 1U8IA 4OTXH 1CD1A 1FP5A 1I8MB 2VUYA 3WMSA 4JO1L 1UWGL 1CLZL 1TQCC 1RD6A 1XCQB 2XY2A 1T1XA 5IB3B 3MRIB 1R3JA 5HHPB 3SGJA 4KI5D 3FFCA 2BY3A 5DT1H 1K4DB 4XTRD 4LSSL 1S5IL 2XG4A 3MJ8B 2ADFH 3B9VA 2HT2D 3THMH 1MHHB 1FL3A 4JDTH 4AQOA 4HS8H 2VNCA 3BZFA 5I1CL 3QXAA 1EXUB 3DIFB 2P44B 4LCWB 1NMBL 4XBGB 5F7KC 4GXUM 5L2KB 4OIBA 1KELH 1F58L 1FNGA 3OXSA 4GRLC 4D0CB 2BXZA 2ARJB 3L5IA 4JFFD 4LCYB 3D85B 4JO3H 2EYTB 1LO4H 4AJ0A 3E2HB 3BQUA 2Q8BH 4EOWH 4U0RC 4NSKB 4YHNA 5C92A 3UYOD 2EH8H 1ETZB 1G6RA 1FZMA 1VFUA 1NGYA 3D39B 1JWSB 4TUJA 4FXGB 2DLGA 3NIGF 4LCCC 1N8ZA 4Y1AE 3B9DA 4PLKC 4JZOB 3LKOB 3S34H 4D9QE 5TDOA 4B7LA 3BP5A 1CLOH 4JFXA 1F3RB 1V8HA 4PJ7F 5E2WL 4ZAKD 1HHJB 2FNBA 5F7FA 5T3ZH 2DB8A 5I74C 5KTEL 5D7KE 5D4QA 1PG7X 4HS6B 1NDGA 2FJGA 3FL7A 2FBJH 4JPKH 4LPYA 4M7JL 4Y4KC 1LO0H 3E3QE 3JZ7A 3TA3C 3ARGA 5DVNA 4N8VA 5KVEL 4PRIB 3PGCA 3QA3B 2Z93A 4NWUL 1XGUB 3GRWL 4GG8B 1ZWIA 3U4EB 3JUYA 4M5YL 3QIWA 4OM1H 4IIQC 5GGSA 1QFPA 4G7YL 1G84A 5F1SA 5CKAA 1BQSA 4YZFE 3RX8A 5GGQH 2Z8RA 2EZ0C 4QRRE 3KPMB 1MCJA 1U42A 4LCWD 4U7SA 4P5MA 2B8OT 2FIKB 4IRSD 1U36A 2AQ2A 5ID1A 1KT2A 1R5WA 1U8OA 2P5WB 4DEPB 5L2KD 4XNYL 4L3EA 3V7AG 1OAYL 1PAMA 3D85D 3DBXB 2XQYG 1CE6A 5F1KC 4FQLH 3QO0A 4QY8A 3QDGA 1ZXQA 4XPBL 1OAKL 3NGBC 3D39D 4R97B 4XCYB 3WLBA 1KTLB 4QRQB 2GT9B 2ADJB 4X4ME 5BRZB 1QEWB 2ADGA 3DHJA 3MXVH 3QQ9D 2CJUH 3JWDH 4ZUWA 1MJ7H 4IRJC 5FKAB 4Z7VB 3O2WH 4DAGH 3O4LE 2IH1B 4DKEL 2FR4A 4OI8A 5JW3H 3DUUA 4L9DA 4HV8A 3C2AH 1LP9B 3S4SG 4RGNC 1BBJB 5DJYB 4PRID 2X5PA 4CJ1A 4DK3A 3PWUA 2BC4B 5DWUL 1SMAA 4MA3A 5AUMB 3GMLB 4BUGA 1NGPL 1RJLA 3OZ9H 1MCBA 3FB8A 3O9WB 3P73A 3LEVH 1DQML 3RJDA 4F7EA 4AL8H 3ARDC 5L88H 1NC4B 3G08B 4P2CG 3AXLB 4K3GA 2DD8H 5DEGB 1IEAB 3WXVH 1WAAA 1K6QH 5EFIB 5C09A 4JANA 1QG3A 1SJHB 4D3CL 3S88H 1DANU 4HMCA 2P5WD 1FE8H 1FVDA 1RQ5A 1A6WH 5C07E 5L8LB 1CL7I 4R3SA 1TZGL 4PP2B 2NY0C 4TYUA 2CIKA 4CVXA 5F89B 4XNXL 4KRMB 2X05A 4LHUA 4KK6C 5IM7B 5BRZD 4OLXL 4NZTH 3V6OA 3B8SA 2WUBL 2NXYB 3AM8A 3WFEH 1IAOB 4PG2A 1X5AA 5HI3C 4EVNA 2P8MB 3DVGB 3SBWC 2IFFH 1UA6H 3GB7A 1BVZA 4MXWL 1YA5A 3L3JA 3WEXB 3HZMA 4HJGB 1YY8A 1IBGH 5I1EH 4NJAH 4IM8A 3FQXA 1PY9A 4U1JA 4Y5XA 1ZLVH 1U3HA 1ZGLM 5CAYB 5K9KB 4XP6H 3O9WD 2DQGH 4UI2A 2ATPA 3WD5L 3I2CH 1UB5B 1OCWL 1NC4D 3ILQC 1ZS8B 2F8OA 1RUKL 2ZP0T 5TFSL 4HKJB 4XMKL 4MSWA 4P3DA 5I8CA 3L6FB 1QBMH 2IADB 4HKXB 4WV1A 3R0MA 2R56L 4UNVA 1D6EA 3WNMA 5F7LB 1MJ8H 3I9GH 4P46C 2VQ1B 5C6TH 2QKIA 4RMUA 4OZ4B 3MRDB 1XF3A 1JV5B 2AEIT 2J7LA 4GRWF 3NIFF 4XXDA 5FK9B 1RMFH 2KDGA 3SDDC 4NC0B 5D7LB 2NXYD 3TVMD 4JN2A 4X0KB 3TNMB 3V5KA 3ARXA 3BPOB 2XA8L 4OCXL 5EB9A 5HPMA 1UACH 2C1OB 1QFWI 5KOVC 5J12B 2UWEF 1GGCH 4BSWA 1FRGL 4XMPL 3T0EC 1AR1C 2EIZA 1RIVL 5E5UB 4FQHB 1T1ZA 5JDSA 5IESL 1EO5A 2WINB 1A7OH 3LQMA 1N6QH 5C9JA 4KTEL 1MUJA 3OKNB 1M7DB 3BGMA 3ARFC 5GGVY 1A0QL 4RFEB 3ROOB 3NZ8B 1JZ6A 3L3DA 1IAII 5E99L 1RUQH 5CGTA 4YDLB 3V52H 4G6AC 3DTXA 1UENA 5CILL 1FIEA 1H15B 3MJ9H 1I7ZA 1OAQL 2APTA 3QWRA 3K8MA 3V8CA 3HMWH 4W70A 1DBBH 1KB5L 4QGYA 4JKKA 4CKVX 4DZ8A 4OGAC 2APFA 1L9MA 4TUOA 4LKCB 5ETUB 4WVRA 2Y72A 4S2SB 2BVUA 1QLRB 1NAMH 4NQCB 1JUFA 1UKSA 1X44A 5A2FA 4PLNC 3F12A 4U6YA 3DVNB 4UUJB 4G6KL 1N59B 3OKOA 2ZUQC 1LK3L 1NBYA 4LPVA 1EH9A 1LK2A 2F58H 1KPUB 1A02N 1UQSA 5D7LD 1QSEE 3RA7L 4PGCB 4X4XB 4P23C 2H1PH 1PZ5A 3QFDB 2YSSB 5DHXB 2ITCA 3IDYC 1QR1B 4FTVE 5AZ2H 1OWRM 4C54A 2DKMA 4RAUA 4CMHB 3RWHB 1UWXK 1AO7E 2AQ3A 5DJCA 4Y4FB 3KS0H 3MLTB 4MDIB 4PRNB 5IWLC 5TDPA 1D9KA 1BEYL 5GJTH 2VDKH 2VZ1A 4FMKA 1E4XL 4K3JH 3TWCL 1JWMA 1G9EA 4BH7B 1JNNL 4YC2C 3HPJB 1YUHB 5ADOH 3WFDH 1JN6A 5F9OL 3QPXH 3SN6N 2WW8A 3QCVH 2V5TA 2XNAA 4Q9RL 3CVHB 4F3FB 1HYSC 2JF1A 3C6LB 3S37X 5LCVH 2FJHA 2COQA 4QGTA 2BNUA 1MFAL 1F6FB 2EECA 4P49A 4ZOCA 5ALCL 3KR3H 1KXQE 1NBZB 2NX5A 1DQTA 3CIQA 5BS0A 1BQUA 4NQCD 4PV8A 3VFMA 2ZKHH 1S5HA 3S35L 4D9LL 5KSBF 5F70A 3GBML 5LGKA 1UADC 2YZ8A 5F7EL 1ROWA 1T1WA 2DQDH 3CSYB 4JKPL 3S6CA 5KSUB 5AG9A 2A6JA 4MNGA 3F7YB 2PW1A 1X5FA 4ELMA 3DROA 4WUKH 3GKWH 3LSOB 5HGDB 5AAWA 4HCRL 4XPGH 2JJWA 4NT6B 5GRUH 1IM9A 2ILLA 2R1WB 1BLNA 3HZYB 4LAQH 1TIUA 3RY6C 4OGXH 2X9YA 1GOGA 1MCRA 3MODH 3E0GA 4J2XA 3W9DB 3GSOA 3VFNB 5IV2A 1IGML 3PNWB 4ZDHB 4HUUB 1RJYA 2W9LA 1VADA 2OJEA 3X17A 3Q2CA 4WJ5B 3PP4L 1QLFB 5I19H 4NM8H 1AH1A 5J7CC 3O8XA 2N7BA 3FFCE 1NQBA 5FCUH 5C0IA 3MREB 3MGTB 1CDJA 1NSNH 3PL6A 3MV9B 3G5ZA 1X6NA 5TE4H 5HGHB 1IFHH 1DN2A 4ZQKB 5TH2B 5E7FA 5DRNA 1A4JA 3KYNB 3QNXB 3C6LD 4XC3L 1SJVA 4I4WB 4OB5L 4LEXL 4KY1H 3VFRA 5TF0A 5ISZA 4R8WH 4NQDA 3CFJA 4YHKL 3RDTB 4O2CB 3MOBH 4D0DB 2WQRA 2HRPH 3BKML 4HD9A 3B83A 1XH3A 2R0LH 4HJJH 3GMMB 3N1MC 1NLBH 1C08B 3CLFH 1I1CA 1SMOA 3HI1A 3WHXA 2XXCB 3P2TA 1MVUA 1MVFA 3O0RH 4XCEB 1K8IB 1I85C 5T5FH 3UTZB 4H20L 1K5NB 3WN5B 5BW7A 4KK9C 3GMRA 4GMTL 4N9GB 3G5XB 2EC9T 4YJZL 2LTQC 4HWZA 3LMJH 5EZJA 1VPOH 2VZUA 4O4YL 2VDQL 4M1DL 1DUZB 1Q0YH 1S3KH 4IOIA 3TBVA 5F9JB 3ECBB 5I30L 4OIAA 4BFIA 3GFUA 5DD5L 4F57H 1R5IA 1HXMB 4X4YB 1T7WA 4YNYB 4K2UL 2BRQA 3QCUH 2J3SA 4NN7C 3UCRA 1QZ1A 5ILTL 5F88B 2DYPA 4M4RA 3MV9D 5ECJE 1HHGA 2CLVA 2A2QT 4GBXA 1IKNA 1B90A 2HVKA 4WW2C 3W81A 5E8EB