2YRZA

Solution structure of the fibronectin type iii domain of human integrin beta-4
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
118
structure length
118
Chain Sequence
GSSGSSGSHDSRLTAGVPDTPTRLVFSALGPTSLRVSWQEPRCERPLQGYSVEYQLLNGGELHRLNIPNPAQTSVVVEDLLPNHSYVFRVRAQSQEGWGREREGVITIESQVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Integrin beta-4
publication title Solution structure of the fibronectin type III domain of human Integrin beta-4
rcsb
source organism Homo sapiens
total genus 13
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2yrzA01
3EYSL 2XN9D 1Q72H 2NR6D 2VLLB 5HHOB 1TJIL 2BVQA 3B9DA 3GBML 3D0LA 3FB8A 2WBKA 1XGRA 3R0MA 4JCLA 4NRYB 1RK0A 1DE4B 4G6JL 1NCDL 5A2LH 3PHOA 1M6OA 1T04A 1PLGH 1HHGA 1S3KH 2Y9RT 4LLYB 3ZTJG 5IVXA 5I1EL 3QG7H 1SJXA 5C71A 4QGTA 3TNNB 1CICB 5C6PB 1GZQA 7FABL 1E4KC 3ALPA 4AIZB 3FONA 2JJVA 4FMFA 3UZQA 1QBLL 4RAUA 1T20B 2APTA 3RL1A 1BQLH 5CIPH 5DMIH 1WCQA 4P3CL 1CIUA 2P4AB 5EBMB 4C55A 5DRNB 3ZHKA 4PLOB 1AE6H 2NW2B 1S7TB 5FKAA 4LSVL 4QHNA 4JGJA 4NRXA 4U1SB 2Q20A 1EXUB 3ARDC 4NZTL 2VKXA 4PJ5A 1P4BL 5T1KA 1DVFA 1S7UB 5FIEA 1Q1JL 1AFVL 1VEPA 2VLRD 5GS3A 3B8SA 5J1SC 5E70A 2KZ1B 4Y19E 4ZSOA 3EO1B 4YBHA 3STLA 4QCIB 4QXWA 3FQUB 5EU7E 1OAUL 2VITB 1RIHH 4N5UA 4KROB 5JHDD 4MD4A 3LPFA 1B0GB 4PJEA 1DL7L 1DTUA 1EHAA 4JRYD 1CLZH 4ZUSB 5T3ZL 3WD5L 2FL5B 1I1RA 3TC9A 2XA8L 3PWVA 3IF1B 3ZDYF 2X89D 2BCKA 4OCMC 3LEVL 1KG0A 4N8VA 1CICC 3JTSA 3ZT5A 5IEKB 2VR4A 3TM6A 2WWKO 2BOBB 4WFED 3BKCH 2C9AA 3S34H 1BFVL 2YPKB 4GXUM 1FIEA 4OFKA 1JPSL 5LWYH 2Q86B 1OWRM 2J8UE 1MRFL 5E08L 1ZHBA 4GRLA 2R1WA 4R90H 4HPOH 4KQ3H 1SJHA 1UWXK 5E6ZA 3EOBB 2BSRB 5GSVA 3WS6C 4ZDHA 3R1GH 3SOBH 4Z8FH 4PRIA 1QSED 2O5ZH 5HHVL 1JN6B 2PTUA 4JY5H 4OFYD 3GSXA 3QG6B 2R1YB 5DWUL 4PJ8A 4LRIC 3QUYD 1WV7T 4WTXA 4LMQE 2ZG3A 4X4XA 1ZAGA 5IVXE 5ESVA 3TPUB 2VXSH 1N59A 2OTUA 4KJQC 2F58L 4KROC 3U2SA 3JUYA 4JRYE 4NGHH 5D7LB 5CBAA 4YXHL 1W8NA 4S1QL 1V3KA 4CU8A 5ACZB 4ZG1A 3WXWL 4AENB 1EO7A 4ZS6D 3BFOA 5KZCB 2AK4B 3FB7B 2P5WA 4NO0D 4Y2DA 4I3RL 5J6GB 2YZ1A 4Y4HA 4X99B 4PJ5E 4HJJH 3FTGB 4GO6B 4ZUWB 4HUWA 1GGCL 3V2AR 4OBRA 2VC2L 3RY5A 2DKSA 4ZSOE 3HNVL 1E6OH 4KKNA 1JZ7A 1J12A 4Q74A 3PL6C 2BSSB 4MAYB 3V9FA 3VXNB 5SWSA 1G6VK 4XMLL 4XP9H 3QIUD 3RUGF 3VXMA 3C6LD 4KUZL 1E6JL 4TULL 2JELH 1PGRB 3HUJA 4MA7H 4OCWH 4L4VA 5IHZA 1A6TA 4OZ4B 3T65B 4G8EB 1IKNA 1IT9H 2JLLA 5HYEA 4TNWK 1MLCB 3V5HA 2X44D 2AABH 3MRBA 3B8YA 1IEBB 4OZIA 5JHLL 5FA3A 1MHCB 2FYYB 4HIHB 4LHQB 5INDA 4M61A 4MNQB 3QHFL 1GOFA 5EWIL 3C08H 3MRIA 2XZQH 5DUBB 3WLBA 5GSRA 4FFWD 2W9EH 3NFSH 3D85B 5HHMB 3LN5A 3PV6B 3VXUD 3P73B 4HIXH 3WLWC 1YMMD 1JTOA 2XFXA 1SEBB 5DQ9B 4JFPB 5KAQF 1DBAH 5DD6B 4KY1L 2OI9B 5SWZE 5EORL 3HFML 5GHWL 5TE4H 3OB0K 1RUMH 2W38A 2OZ4H 4MAYC 4IRJD 1MCQA 5ALCH 4K7PY 5IQ9A 4M93C 4LHJB 5EU5B 2I24N 4R26L 1C5DB 3P30H 3BPLB 4JM2F 3F5WA 1JPTL 4LFHD 4J3UA 4JZJB 4W4OA 5DD3L 1G84A 1PX3A 3JWOC 3FT3B 4ELMF 3MA7B 1IJ9A 4FFVC 4MX7B 2HJFA 3EYOA 5C2BH 3S36X 2B4CL 1S9KC 4NZRH 1I3VA 3C9NA 2D7PA 2P8PB 3KYOB 4P9ML 4NQVA 3ZKMC 5TH2A 4KI1A 1U8IB 2D3VA 1PG7L 2XG5A 3BUTA 5HD8D 4JRXE 5GRYA 3VI4F 2HLFD 4MXQC 1ZLVH 3WUZA 5LG1A 4BQ6A 3VXUE 3UTTA 5LQBL 4MYWB 5SWSE 1EGJH 3EGSB 3VXME 3ULUL 3QH3A 3VG9B 5ACMA 1BX2A 5CJBA 3HUJE 1QPXA 2XWTA 1OB1B 2FJGA 2OI9C 3HG1A 3LEYL 2OL3B 1I7ZB 1A21A 1JPGB 4R6UA 1IGCH 1NCTA 4Y4FB 3OZ9H 4U4BA 1FLRL 5DRZA 4HX1A 4XNYH 4GKSB 3CD4A 1MCOL 1FSKB 5ISZB 3VWJB 1F2XK 1HIMH 5DK3A 5BS0B 2N56A 1ROWA 4ODXB 3ULVF 2QV2A 4P2OD 1OAYL 3PGDB 3ZT6A 3L9RB 3G6AB 4EUPH 1H3TA 1FZJA 4XAWH 2NY1D 4PV9A 2DJSA 1MAML 4QRSB 4M6OL 2A77L 1YY9D 1RU9H 1T4KA 1IC7L 3U7WH 4PB0L 5TPWL 4Q9RL 3TNMA 3GMPB 3PWPD 4FQXA 3ARQA 4MMZC 1P5VA 1JYNA 4TNWF 2X4RB 1IC1A 3NPZB 3SY0B 5KN5A 4D0CA 2Y4SA 1FG9C 4LIQH 3QPQD 4YEEA 3LKSA 3B5HA 3OTTA 3MBXH 4HWEH 2UWEE 4LSQL 4PBVC 4LLQB 3RIFK 1RUKH 2YPVH 1RZFL 2IC2A 3L6FA 1AXTL 4RFEB 2QL1A 3TN0A 4JQXA 1MREH 4RMQA 2ZUXA 5DVOA 5CGMA 3UTOA 2YC1B 4WI9A 3VWJC 1GGIH 5EO9B 3S3JA 1KF9B 1ETZA 4Z77A 3WXVL 1CXFA 5KVGL 2V2TB 4DGIL 5JXAL 4WFFD 1CF8L 3LH2H 3I3BA 2VLJA 4FZ8H 1D5XA 1U93A 4P4KD 3ZL4H 3T0EA 5F96L 3TYFA 1PAMA 1XF5A 4YGVA 4CAGA 1I75A 3AREB 3PWPE 5ILTL 2DD8L 3MXVL 5I1IH 3T2NH 2ICEB 1G9NL 3IDYB 4HUUA 5I0ZA 2EZ0C 1JHLH 3DMMD 2I07B 4XP5L 3RU8L 4L8SA 1HWGB 3KPSD 5IESL 3HB3C 3S36H 1TENA 4NP4H 1D9KD 1CDBA 5I16A 2D4DA 4X0KA 1N2RA 5IWLC 2DKUA 3Q2CA 4FXGA 1MFDL 3TO4A 2ATPB 4MNGB 3EHBC 3PDOB 1IM3A 4K7PL 4UT7H 4DVRL 3F62A 1DLFH 1JTTA 4RFNB 1GXEA 3C2AH 2BNQD 3O6LH 5C8JB 4HWZB 2F53D 4YDIL 2D03L 2VXTH 1YYML 2CGRH 2CR6A 4UDUA 5DVLA 4WFFE 4QXGL 4XC1H 3NIDF 3ALWA 3OKDB 5ETUA 4KK8D 4PJ9C 4XWOD 5D7KD 4W6XB 1U2HA 1J0ZA 3UXFA 5HSFA 4G8GE 3UTZB 4M6NL 3RPIA 2Q8BH 3KYAA 2HFGL 5JPNB 1QEWB 4KTEH 3QRGH 4OV5A 4IRSC 4YJZL 5IG7A 3MLTB 3CZFA 2XWBA 3CIQA 3IDYC 3MCG1 4MDIB 1MPAL 1F3RB 1FZMB 3ROLB 4BFIA 3ARGD 3BX7C 3NCCB 4N0UA 1NGQH 4JKWA 1QO3A 1MFEL 1T21A 5I74C 4NZJA 3SDYH 1KIUA 3NA9H 4FQ1H 3VXSD 1T2JA 5IFJA 2A1WH 2X41A 2A2QT 4KDTA 4HIIB 1BVLB 4EXPX 3DRTB 3RVWC 4R4BB 4HIEA 4HKXB 5E2TL 2RCSH 3L7EA 1OL0A 4YHLH 3HNSH 4RMTA 4CADA 1OAQL 3MNVB 2R56L 3EDKA 2BNQE 1QFUH 3VWKB 3SO3B 1G7JB 2JIXB 3HC3H 4RFNC 2F53E 3TO2B 2PUQT 1TTGA 3AM8A 4OTXL 4KMQA 1XR8B 4C56B 2HMIC 2V5RA 2DBLH 2G5BB 4Y16D 5FO9A 5I2IA 1K4CB 5I8EB 4X98B 3TBYB 3BHBB 3VXOA 1ED3B 4IRZH 5JMRA 5HHXH 2AP2A 4LLUA 5FHBH 5EN2B 4DZBB 4C57C 3P9LB 2IPKB 1DANU 4UOW1 1Y6KR 4D8PB 3H0TB 4CDHA 3QULA 4MLIA 4N8CL 3VFWA 2CKBH 4LF3A 3RI5F 5HXMA 5T1LB 3U36A 3HE6D 3QXWA 3MOAH 5FUZL 4N9GB 4BFBD 1Q0YH 5H37G 3MMEB 4APQA 2WBJB 4N0YL 1D5BA 3QWOB 3U4EB 35C8H 4LP4A 5IB5B 1PKQA 5C1MB 2P42B 4WNQB 5CZVL 2ORBH 4FFYH 4N0CC 4I2XA 3VDAA 3WL9A 4G9DB 3QUZC 2W1NA 4J1UA 1HQ4B 2W0FB 4ZOCA 1A6VH 2Z35B 4Y5XA 5CP7B 3KXFB 5HGAB 1J8HD 1A6AA 4RISH 3VWKC 1UM6L 1HWHB 1L0QA 3SO3C 4L1DA 4M7LH 5JW5B 2MQCA 3DVIA 4Z0XA 1S78C 3A6BL 4IMLA 3DBXB 2BERA 2NZ9C 4GRWF 4R7NA 2DL9A 1KN2L 1E27A 1LEGB 1YEDA 4WJ5A 2XICA 4ZOBA 1XF3A 2D31B 3BZ4B 3S9DB 1UVQA 1F4AA 1A1MB 5DA4A 1ORQA 2OXGA 2Q3ZA 3LV3A 1JVKA 1HILA 4ZUTB 4ALAL 4GJTB 3LS5H 2C5DC 4H0IA 2Y07L 2AJUH 2OR9L 4XBGB 1HHKA 1REIA 2C4FU 5DK0A 3BO8A 1F4XH 4R0LA 3PXHA 5IOPB 1BBDL 2ESVE 2WBJC 5C09D 4K3EL 3O2VL 5F1NA 3UJIL 1P1ZA 1BEYL 3GJFB 1BD2D 4PJDE 3DXAD 3WS3B 1U8QA 4XVSL 1EAJA 3SPVA 3DX8B 1J8HE 3FO1B 3OF6D 4LEOA 2D7TH 3FQXB 3H7BB 3O3EA 5I1LA 1NBZB 4OZFH 2H32A 5BXFB 2B1HH 2Y06H 4NQSA 1MI5B 4NQDA 2GJ6B 2PYEE 1KJVB 1MFAH 3CJJA 2APWA 3MQIA 4RBPH 5JO5A 3WIHA 4KMTH 3KLHC 1FRGL 2J3SA 3GNMH 5AZEH 3TA3A 1EAPB 2ATKA 3BW9B 5IBUB 5I1AA 1CIDA 5INCB 3MRQA 4XXCC 5EU3A 2PO6D 2ZUYA 3MV8B 4F58H 5BZDA 4RRPA 5B38A 1DN2A 4GLRI 4XMKH 1JV5A 1DFBL 2EDWA 2JK5A 4RWHA 3DRQA 4Q9QL 4YDLB 2W65B 1Q94A 1FH5H 1A3QA 4NKOA 1AGEA 1HHJB 3UYPA 1I85A 4LDOB 1SEQL 1SMAA 3NFNA 1CGSL 2YD8A 2Y1VA 4NN6C 3QJFA 1PZUB 5ICYA 4Y5VB 3DXAE 3BP7B 3BOVA 3CSYB 3VMNA 5M7QA 4TSCL 5KSAB 5EOTA 1OTUC 5EU4B 5F7FA 4BZYA 5LBSL 1I7TB 1U3JA 5CEZE 5I1GL 1CU4H 4IOIB 1A4JB 3QIWD 4LL9A 2Z9TA 4XCFH 4X9FA 1MIEL 4HV8A 2QBWA 3FFCA 4Y1AD 2KH2B 5HHNB 4X80H 5DD5L 1WICA 3H9HB 4AQ1B 2X1OA 3MREA 4NC1E 4R8WH 5SX5H 4GMSL 1CL7H 4F15B 2W0PA 1J05B 4CUCA 5KTEL 1KELL 1FNEA 2HKHL 2VISA 4HKJB 3SE9L 4M5YL 1QR4A 4PY7B 5DQJB 1CK0H 5DEFA 5KJRL 2CUIA 2GQHA 5KVFH 4WUKH 4HWNA 4WW2F 4AMKH 1A7PL 2B4CC 3OAUL 1UM5L 3DTXB 1L7IH 5EFIA 1YNKL 4R9HA 5I18H 4Z7VF 3UPRA 3REVB 5F9JB 4YDLC 4JO3L 1M71A 1EVTC 3UAJD 1S7QB 2Y7QA 1CXIA 4ZFGH 1HYSD 5HJ3A 4J8RB 2CH8A 1X6LA 1T2QH 4KJYA 4Y5VC 2UUDK 4J3OC 4NQDE 1LDPL 1RIUL 1BZQK 3MRDB 2VTFA 1OOAA 3S37L 5KSAC 1I1AD 2CD0A 2ZUWA 1WWCA 4FTVA 5E1AA 3FT2A 4M43H 3QCTL 3MRPA 3PWNA 5IKCB 4Y1AE 5AD0A 1MCLA 1ES0A 3RDTB 2AXGB 2X6MA 5EC1A 3UO1H 1ACYL 3TFKC 5DYOA 3P40A 2A73A 3O45B 4BFEA 1QFOA 3WNOA 3REWA 2I25N 1HXYA 4U1LB 1Q9WA 3GSQB 3NZHL 1LP9E 3K1DA 3Q6GH 5KSBA 1ND0B 5K9QG 1H0DB 4U0RC 1CFVH 4EBQH 1V7NH 4NHUB 4P0DA 4MGXA 4M7LT 2JJTC 4HHAA 3BD4A 4JANA 1T7ZA 3GZKA 1JRHH 2V7HA 3DPBA 4JHAL 3ZKND 1HSAA 5HVFB 3TVMD 3N1GC 2XOTA 1FV1B 5C6WH 5EZOL 1D6VL 1IM9B 1PYWB 2VABA 3CMOL 3Q6FB 4HUVA 4EI5B 2Y36L 4OLWH 3VXQB 1CE1H 5IW1B 1CBVH 4OZHB 2XTJB 4GW4A 5C0AB 5EUOA 4IHOB 2F54B 1OP3H 4RA3A 5D7IE 3D18B 1UADC 5DMKB 5E4IA 3PDDA 4PGDA 4P46A 1NL0H 3P0YH 1MNUH 1ZE3C 4KPHH 1ZKAA 3MV7A 4KJPC 3QCVL 3RDTC 3SKNA 1JNLH 2PETA 5HDLA 2Z31B 4P5TD 1OLZA 4YNYA 3SEPA 5IJKA 4NFDA 4LSPH 4DFIA 4OQTA 5FF6B 3IGAB 1UB6A 3D39A 3UC0H 1AXSB 4GH7B 1QSZA 4W6WB 2X9XA 4F7EB 3P77B 4PG2C 4JFZH 4KV5F 3FZUD 4QRPB 3KPRB 5K59F 4P3DB 3Q3GB 2YBRB 3PQYB 1MCJA 3QEGL 1CFBA 3CPLA 3VGAB 2MTPA 1YEHH 2ADIA 3K4ZA 3UCRA 3L3OB 1IGIH 1VACA 5HPOA 4O51B 3D2UA 3MYJB 1X5LA 1NFDE 1WTGT 4OKDA 5F3HA 5TQ0H 3D69A 4UB0L 1G9NC 3RGVA 5CILL 4EI5C 4N8VG 1N8ZB 3TPKA 3GJEA 2FHFA 3SHSA 3S8WA 4MAUH 4TNVK 3QQ9C 1M1SA 1OTTC 4OFIA 4UDTA 4XWGL 3L5XH 3Q48A 1J1OL 1KJ2A 1IAIM 4HCRH 3O3DA 2JCCA 3GMLA 1VENA 3L3DA 2FO4B 2WWMC 4I8DA 4OFDA 1KLGA 3RZCB 4P2QE 2UZIH 4OLZL 5CD3A 4NJAH 4GBXB 1HSBB 3O6ML 1ZHNA 4PRAA 2DQJH 1S9WB 4TOYL 3VRIA 2FX8H 2Z31C 1FYTA 3GI8L 1XF1A 3H3KA 1MUJA 5D2LA 3HR5B 3QXDA 1CQKA 2P1YA 5CIPA 1F90L 2IGFL 2VQ1B 4U6YA 5KANG 4FQCH 5BZWA 2YEZA 1F4YL 5H35B 2BVPA 1RY7B 5CINH 3O9WB 4AG4H 3VD7A 3CVIL 4F9LC 5GS1B 4G7VL 2DJ4A 2CDFB 5EO1A 4YPGB 3UJTH 5IR1B 5C0NC 2HT3D 3S88L 4OCXL 2A0LD 5C07B 3C5ZD 5EUOE 2PN5A 4RZCB 4XNZB 4EXKA 2OJEB 1FYHB 4WU5B 1OSZB 2O93L 5GJSL 3MSPA 2DTMH 1NGZA 3QO1B 3EZJB 3EJZD 3DUUA 4MNHB 2CO7B 3ARWA 1MFBH 4XNQA 1ADQH 3O2DA 4XP4L 1J1XH 4AZ8A 4MD0B 1G6RL 4NJ9L 5TDNB 5CJXA 5JNYB 1QLFA 3CFEB 3SKOB 5GGQL 3T3MF 3TIDA 3W11C 3RZCC 1A7OL 2XQBL 5D1XA 4GBXC 1FLTX 2CMRL 2APFA 1NUNB 5D7JB 3IDGB 3T0AA 3UZVB 1Z9SA 2ZG2A 2NY2D 1XCQB 4LHUB 1EIBA 1YQ2A 4TPRH 4PGEB 5CSZA 4MB3A 4H5SA 4NQEA 4AH2A 3M8OH 1BPVA 2VZSA 1S7WA 1MELA 2DQIL 1I7RA 4X7EC 4D0BA 2BXZA 1DBKH 3O9WC 5CCKL 5GS1C 3WHXA 2AJYH 5DJ2A 4EI6A 1TQCB 4LDLB 3DOSA 1OP5K 3QISA 2R69L 1OP9A 1A0QL 5GS0C 1XT5A 5IEHB 5E8OB 5ID0B 4JY6B 4ZS7H 5J1AA 4XNZC 3CX5K 3HE7B 3MFFB 2XXMB 1YPZA 2P5EA 4P23B 2Z91B 3ME0A 2WANA 5ITFB 3MRGA 1T03L 4MQXD 2XN9B 1WZKA 4WCYL 4DGYL 1GHFH 5A3ID 1P5UA 2PKDA 4S0TD 1G7LB 2HRPH 2VE6A 1G7IB 2FLBT 3BEWA 1V3MA 2E6QA 5D2LE 5JDSB 1F8TL 1FGVH 4JN2A 3EOAA 1L0YA 3WDHA 1M7IA 3S96B 1KYOK 4BZ1L 5DHYB 2IBZX 4DTGH 3IAGC 1MEXL 1ZA3B 4UQ2A 2GK0B 1UA6H 1X5AA 1EJOL 2DM7A 1EFXD 4DN4L 4DVBB 5F1KC 1MJUH 4Q58C 3W9EB 1T89C 3O8XD 3DVGB 1U8LB 2ERJB 1D7FA 4OI7A 3HI5L 1I4FB 5L6YH 1FL3A 1LGVA 2W92A 4QF1A 4FZEH 4H8WL 3CC5A 3T8XA 4DEPB 5DD0L 1A3LL 1RHHB 5F3BB 5HHQA 4HULB 3LPGA 2VLRB 1TQCC 5T33H 4V2CB 3N50A 2A6JB 2JJSA 4MCYA 1HDMB 1CLYH 4ZYKB 4QHMB 5AZ2L 2CUMA 4X6DA 3RWEA 4D3CL 4NBZB 1NMBH 4JN1L 5DZNA 3PWUA 5JHDB 4PJFF 4H25B 2VLKE 1KPVB 1SY6A 2NR6C 1CFSA 1YYLL 4DW2L 5I30L 4JRYB 1BM3H 4K8RC 1CT8B 3GRWL 2W59A 5C0JA 3VW3H 3SDDA 1H3UA 2BJML 3H9YA 3K4DA 2V5TA 4BSJA 4YHPA 3E6HA 4EVNA 1A9BA 5F1IB 5FM4A 4O2EB 4ZAKD 3FT4B 3OGCB 2YN3A 3INUH 4OKVA 2C3WA 3NIFE 1OHQA 3G04A 1QD0A 4EOWL 3MBEA 4JLRA 2YD1A 2H26A 2ERJC 3B9KA 4LLVB 4QHKJ 1JWUA 4UT6L 2YUWA 3T4YA 1Z5LB 12E8L 1AJ7L 4LLDB 4NDMB 2HT4D 1AY1H 2WLZA 4YQXH 4WO4A 2OL3H 1QSEB 2GJZB 1ODAA 5K9KA 1F3JA 5DC4B 5BO1L 2IQAB 4DUXA 4AEIL 3VRLF 2VDML 3QUYB 4JY4A 3WFEH 1OGAA 1V3LA 4MJ6B 4NNYA 5DMGC 1S8DB 3HRZA 1FAIL 4MQSB 1ZLUK 1DANT 4PGZA 4UV7H 1AI1H 4R96A 2RFXA 1R3JA 2X7LB 3O2WL 5DZOA 1ZLSH 1MWAL 5E8EA 3BGMA 3BPOC 2XZCH 4HKZA 4IOSD 3S35L 4KHTH 3THMH 1F58H 4HS8L 3BKJL 1P4LA 5L2JA 1MCEA 2BRRH 4NO0B 3FQWA 4X6FB 3KPOA 5FA4A 4JO1H 1NAKH 4M7KH 3QXUA 4PJ7E 1F11B 2WUCL 3O11B 1FC2D 3BAEL 1F13A 5C0RH 4PJAA 4UTAH 1KPUA 1B4JH 2DB8A 1EGJA 4A6YL 4GW5B 1DQLH 4PJHA 2VXVH 5KSVB 1BMGA 4QTIL 5T1KD 3RVTD 1DVFD 1FNGB 3LEXA 4X6DE 1B0WA 3JSSA 32C2A 3S7GA 5FB8A 4BH8B 1LO3L 3OHXB 3QIUB 1YNTA 5FOJA 2EDHA 3GMMA 4PJCB 4XP1H 2AGJH 4WWKA 5GIRA 3IFOB 3TCLB 3C6LB 5BQ7B 5FV1L 1QPPA 4XCEB 4LPTA 3J7HA 2D9CA 3VGGA 4CVUA 2B0SH 5DI8B 2CK0H 3QUYC 1WLHA 4YZFE 2BHZA 4XAKE 2LQRA 5IUSA 2F8XC 1JZ2A 2EDJA 3GHEH 4OD1H 1RK1A 5C0EA 5I66B 1KEML 2VQUA 5FECA 1MHEB 5AYUH 4M7ZB 2ZCHH 3PJSB 3CFJB 3OKNB 4EUPA 3MJGX 4KAQL 3EYSH 3VFGL 1T5WB 3KDMA 3NMEA 4OCYL 1DUYB 1TJIH 5AUMA 3GBMH 4ZS6C 4HUKB 2QKIA 3MRCB 3ECBB 4G6JH 2EDBA 1NCDH 4ONGH 4JFHD 1S7RA 4HS3B 3IETB 2BNRA 3QDGA 3K1KC 4X7SL 1YMMB 3V6OC 2CLZB 4UIMA 2IANA 3RKDD 1D5ZA 7FABH 1U8MB 4GRLD 4KI5E 3MLUH 5E5RB 3BVNB 3MUJA 3TV3L 4P3CH 4JQIL 5D71L 4P2YA 4PRID 1RIVH 1S7XA 2ZG1A 3P11H 4S2SB 4XBEL 2J8UF 4LSVH 4IRJB 4OBSA 4YHYB 4ZPTA 1NEZA 3QIUC 1ORSB 3FO2B 3QP3A 4ELKA 1I3RB 4P4RA 2VQTA 3C6LC 3ZYJA 1P4BH 4IJ3B 3X14B 2WM0A 4I0CC 4JFFA 3K80A 1AFVH 1OTSC 2OK0L 5FUCE 3DJ9A 3O4LA 5JIIA 1KCUL 3V4UL 3IFPA 2WIIB 4MD5A 4OJFL 2GCYA 5CBEA 4M7ZC 1VGKB 4PRHD 5DJZA 1Z9OA 4N90D 1RURH 5IVXF 3ARFD 3SDCD 1C5CH 3N9GL 3HS0A 1WFOA 1JTPA 4O2FA 1NBVH 1KCSL 2YHGA 4MQTB 3U0PB 4Y2DD 1MJ8H 3KPPA 1S7SA 2HVKB 5ABDE 4UILL 4PJHE 3K81A 4KKCD 4YBQD 5LKNA 3U7YL 1F3DJ 2LU4A 1CGYA 1TXKA 1HI6B 4G8IB 1YY8A 4FFWC 4S1DD 2P8LA 3KPMA 1X5IA 4F80A 1QHOA 1CXKA 3T2OA 3LEVH 1Z3GL 1NDGB 1J86A 2PXYA 1UENA 3IXAA 4E42A 2UWEB 2EE6A 2X09A 3OWEA 4M8VA 4ZUVA 1FZKB 4JFDA 2Z0BA 4AL8L 5FDWB 1DJSA 4D9RD 1KTLB 5TE7L 1BFVH 1LDSA 1UJ3B 3UTQB 1JPSH 1WBXB 1DDHA 4F7MB 1MRFH 5E08H 4IRJC 2XWJB 4YHYC 4F3FA 3CDCA 1QR1B 4I48A 5IGXL 1RFDL 4L4VD 4P2OB 4IJ3C 5ACLA 3CVHA 1NCNA 4PJEF 5JOPD 1IC4H 4PLKD 2NY1B 4ETQA 4AM0A 4DGVH 1WISA 5DWUH 5HYJA 4X7TA 4JFEA 4PRHE 4YHOH 4Z76B 4OF5A 2V9QA 2IFFL 4NQXB 1TVBA 2FD6L 3I02B 1FDLL 2F58H 2IANE 3PWPB 5DS8A 3WEXB 2H1PH 1NC2A 2QSVA 1MFCH 4JFQB 3CSBA 4LIQE 1G6RB 4YXHH 3DX7A 1R0AL 1C1EL 4PTTA 4BKLA 4EZMA 1JGLL 5BVJA 5K9QI 4KXZH 1DQMH 1UH2A 4K9EC 3CU1A 1NLBH 1QBML 4NO5B 4OIIH 1X7QB 1VFAA 4QRQB 3UPAA 1AHWB 1AGDA 4I3RH 1K8IB 1J11A 1HQRB 2Z8VC 4FQHA 4HJGA 4XPHL 4M8QA 2H6PB 4M5ZL 5DJXA 4D9RE 2QQNL 4I0PD 5MEQA 2NY5L 1NGWA 4P5KA 1CFNA 3H2WA 2DF3A 2B2XL 3GMNB 1X5KA 1F97A 4CBPA 3MV9E 3HNVH 3RNKB 2FATL 5IF0B 3BQUA 2ADGA 3MRHB 2FHCA 2Z8RA 4CVXA 1J7VR 1OWWA 3DUSB 3VFVB 1QLRA 4PJXB 5BJTA 3HR6A 4XMLH 1U8NB 5GRXG 1QA9B 1MCCA 4KUZH 3OPZL 4PRPA 3CFKA 4P4KB 2K1MA 1G9ML 3MZGB 2EE3A 4ZQKA 1W0YT 3VCLA 4M1DH 1BIIA 1AGCB 3MA9H 3ARTA 1YY9C 4N9OB 4NO2B 1ACZA 2R0WL 3BIKB 3FQTA 4PLJD 1EHLL 2H9GB 4JPVL 5MENE 3DMMB 5DDHA 1CLCA 1ZOXA 4CMMB 3FCTB 3KPSB 3UTTD 1D9KB 4YHNB 2I9LB 1MRCL 2X4NB 2P49B 3C2SA 4UAOB 5DT1L 5HGHB 1AHWC 2GT9A 3LZFL 2CXGA 1IAMA 3GJFH 4M4PA 5J11B 5D5ME 4NOFA 1UC6A 3TWCL 3BWAB 3T1FB 4HMCA 5HGBB 3BP4A 1XF4B 2HJKA 4MDJB 3MRJA 3H9SA 2BVOA 1SM3H 4TUKH 5DK2A 2BNQB 4LKCB 4WI8A 3HUJF 1IAIL 4I3SH 4KY1H 1AR1C 4XVUD 5GHWH 5KS9E 1SHMA 4RGND 1BECA 3LDBC 1XGPA 4K3DL 4RRPG 5B38G 3KPQA 4OZIF 4HDIA 4ODHH 3G6JB 3R8BB 4R26H 2E7BA 3CAFA 4Q0XL 4P4KC 4LCWE 4LPWA 4LK4A 4WV1C 1JPTH 1NANH 4Y89A 2VXQL 1A64A 3E3QE 5DD3H 1L6ZA 3RWGB 5I0DA 4YXKH 3QHZH 3NBNA 3VJ6A 1KNOA 4XZUB 2B4CH 1Q9LA 3LKQA 1ZLWK 1AD0B 4P9MH 5CFHA 3AXLA 2VAAB 4PGBA 3O6FA 1SQ2N 3CDFA 4V1DA 3ARGB 1RAMA 3QPXL 4LASH 4QT5B 2YPLA 4H88L 1PG7H 1YN6A 3VXSB 1FIGL 2MOVA 2NPLX 5JOFB 4UAOC 4Z7WA 1HHHB 4LQ1A 2ADFL 4HK0B 4UUJB 5LQBH 3MOQA 3QFDB 1T0MA 1A2YB 3VFNA 4J6RH 4HPYH 5L2KA 5DEGA 1ONQB 2UUDH 4RMUA 2P7TB 2YA0A 1LO0L 4HUXB 5F7KC 5D2NE 4OGXL 3LEYH 1YJDL 1S9YA 1C12A 2XRAL 4KZDL 2WINB 1YEGH 5I6XB 4GKZB 4OZFA 1Y6MR 1FLRH 1KPRA 4FOMA 5L8JB 1T1WB 3DVNB 2BY0A 4KK8C 4XWOC 3ZE0F 3WFDL 5SX4H 1CTNA 1I1FB 3LKRB 3I9GH 4MJIA 1JPST 4X7DC 3HZVB 3LKOB 1LK2A 3WYRA 3X3FH 5K93A 1BLNB 3PWLA 2A6KA 4ZNEE 4LLMA 1MWAB 5GRJL 1Q72L 2A77H 3B9EA 4FP8L 1IC7H 3HE6B 4PB0H 1IEAA 4Q9RH 3H9SE 2C1PA 5IBTL 1P84K 2EH7H 2OP4L 3B2UC 3TO4D 3BRDA 2HFFB 3CLEH 1QP1A 3QG7L 2W60A 1JE6A 1GIGL 2R4SH 2V9RA 2DJUA 3V5KA 2ZCLH 3IS0X 3IDMA 2AJ3B 5C3LD 2E7LA 3MZTA 1J8HB 4Z7UB 4A6YB 1AE6L 3NZ8B 4FA8A 4L3ED 3P0GB 4PP2B 1RZFH 1J5OH 4E0RA 1XFPA 4KKAD 2AV7B 1YMHB 5IMOA 3HCVB 1U8KA 5I6XC 4JPIA 2NLJA 3P4NA 1IGTB 3DHJA 5E2UL 4XXDA 1L6XA 2EXWC 4V1DE 3T4AA 3WXVH 5KVGH 1CF8H 3R0NA 5L8LB 3RVUD 3R4DA 4RAVB 3BEVA 5EC2B 5TF0A 3QDJA 1MJJA 2AXHA 3T77B 3RWCA 1HH6A 3GIZH 4Z7WE 4QWWD 1WAAA 2F74B 3IRPX 4XRCB 5KBNC 4UV4L 3V7AE 3HE6C 1V7ML 5L2KE 5ILTH 2X1PA 2DD8H 1L9NA 1IL1A 1G9NH 3EYVB 5C09B 4ZUUA 3BN3B 3ABZA 1CVRA 4XP5H 3RU8H 1BD2B 4WU7A 4PJIA 4JREC 5IESH 3DXAB 2R29H 4QYOB 2ZUUA 4IIQB 3C09B 1XGTB 3WUWA 2GTWB 5E6YA 2ARJA 5IIEA 1MFDH 4CU7A 4WUUA 4CVZA 5IROC 5JA8B 5GRVL 1WF5A 2CLVB 4K7PH 1XIWD 4JDVA 3VDBA 1RJZA 1XZ0A 4HPOL 4KQ3L 1EFQA 3DSNA 3GM0A 2ZOLB 4MJIE 2F5AL 3AU1B 4O02H 1MCRA 3GBNL 1EEUA 1AQDB 2DLHA 3R1GL 4FXKA 5I76B 4Z8FL 2O5ZL 4YDIH 1GGUA 4JY5L 2D03H 3AGVA 2FSEB 4YPJA 1YYMH 4QXGH 4P9HL 3CSGA 4LGRB 4YDJB 5DD1L 2PO6B 1KV3A 3T2QA 2VDPH 2Y5EA 3IU3B 3MLSH 2P45B 4HW6A 2GTZA 1ZGLA 1KXTB 1HN1A 4WW2C 4Q97A 4M6NH 2DQFA 4NGHL 1N5AB 5ANMA 5FEBA 4AIXA 1MPAH 1K9TA 5ICXB 2LU7A 2FLRT 1WFTA 3DARA 3HZMB 5I1DB 2UYLB 4HJJL 4O2CB 3FO9B 4IIQC 4M1GL 2Z93A 4Y5YB 3C09C 5GGVY 4MHHI 2B7DT 2VLLA 3QIWB 4PJGB 5HHOA 4FXLA 5E2TH 5L0QC 2ICWI 4NRYA 4Y1AB 1DE4A 3OG6B 3V0WL 1E6OL 1SJEB 1OAQH 1HXMA 5JQHC 1X5ZA 2AKRB 4LLYA 3U30B 1WAAE 4XP9L 3TNNA 1CICA 4FG6C 3TEUA 3ARDD 3P4OB 1NGXB 5DMJB 4MB5A 1HE7A 4AIZA 1QSFD 1T22B 2WP3T 1T20A 1LP9B 2EDOA 4FHBD 5EBMA 1X5JA 4MA7L 4OCWL 2PO6C 2BHUA 2NW2A 3C8KB 5H94A 4IOFD 1IT9L 4U1SA 1EXUA 1ZA6B 4G6FD 5EU6A 5GS0H 4KZEH 2ZOKB 3GO1L 1S7UA 3D3VD 3Q5OA 1OP5H 2DYPD 4WUUE 3DO7B 3Q5YA 4JPWL 3G5YB 2CO6B 3EO1A 3MUHL 4LRIA 5FUZH 4ELMA 2XZQL 1T1XB 3WDIA 1R3HB 4QCIA 5DTFB 4NZDA 1KIQB 5I1JH 1I1AB 2W9EL 3NFSL 2FJHB 3V5DB 5D7IB 1QACA 4HIXL 4Y5YC 2KKQA 3K8LA 4PJDF 1KN4L 1B0GA 1A5FH 5GZNC 3QIWC 2DWEA 3BH9B 3IKCA 1R3KA 2LVEA 2FL5A 3IRZA 5TE4L 1HYRC 2AEIT 3MACH 4ZO6A 1RUML 3IF1A 2OZ4L 3WN5B 5ALCL 1X5GA 3U30C 1QSFE 3A6BH 1RQ5A 5C0GB 5IEKA 4JPKH 4JG0H 4D2NA 2M2DA 3P30L 2EC9U 3OG4B 5ANME 4NIKB 2YPKA 4ZOEA 5GGTA 3QZWB 4W68A 4UIKH 3TVMB 4EDWL 2BSRA 4I9WD 3L3KA 5C2BL 4NKMA 4QRUB 4LAJH 4NZRL 3QUKA 2HN7B 2P48B 1U3ZA 2V5MA 5E94B 2OR9H 1JN6A 1PQZB 1NFDB 2YR3A 4CMHB 2VYRE 4KJQD 5C0IB 5HHOE 3QG6A 1HYSC 2R1YA 1TCMA 4MS8D 3K8MA 1ZWIA 4ORGB 1U91B 5HDQH 3RL2A 2DL2A 4YBLB 4ODWB 3TPUA 3E6FB 5F70A 1ADQA 1BEYH 1NCBL 1DLHB 1PZ5B 5IHUL 3WCYA 4QKXB 3QHTC 3RGHA 3O3BB 3SKUD 2VN4A 5ACZA 5MERA 5E2JA 4AENA 2NW3A 5DJDB 4P5TB 1IGCL 3OZ9L 2AK4A 1MCDA 3FB7A 4DAGH 5J6GA 4XNYL 3HPLA 1XGUB 3Q5TA 2FBOJ 3PL6D 4HWBA 3FTGA 4ZUWA 4NUJB 5J12B 5IT2H 1I8IB 1TZIB 4JJ5B 2AI0L 3O3UN 1PEWA 1AKJA 3EYFA 4P5MB 4JRWA 1FRGH 2ADJB 4XAWL 4KUCD 2R2HB 1G9MC 1I9EA 2CJUH 1OF2B 4LPUA 2BSSA 1RU9L 3CH1B 4MZ2A 3U7WL 3BRFA 5A1AA 3V4VL 4X5XB 4CMHC 5B3JE 4Q9QH 2P43B 3ILPB 5E0QA 5GGVL 5E5MB 4HUNB 4Q6IA 3WNLA 2KUTA 4OCRL 3L5WA 2YMXH 1SEQH 4FTVD 4OZ4A 4J7RA 3T65A 2BVEA 4YBLC 5HYSB 1ZLUH 5HPMB 1MLCA 2QHLA 3BMWA 1IEBA 1SVZA 2C3VA 1BVKA 1RUKL 1MHCA 2FYYA 3AFLA 4K3HA 2YPVL 5E24E 5DRWA 2A74A 5LBSH 1AGBB 1T5XB 4PJBB 5I1GH 4MNQA 4UBDD 1ZVSB 5F7HA 1MREL 2BVUA 1MIEH 4P5TC 1P6FA 4NSKA 5DD5H 4Z78A 1JZ4A 1IKFL 2P24A 1GGIL 3D85A 4X4YB 4D9QE 5GZOD 2JTDA 3LH2L 3FZUC 2GUOB 5KTEH 5DQ9A 4JFPA 3GSVB 4XPTL 5DD6A 1YEJL 3ZL4L 3SE9H 3C5ZB 1MOEA 5IMMA 5KJRH 3EDEA 5J6HA 1JCKA 3CXHK 2VZTA 1A7PH 3QA3B 3KS0J 4C83B 1FNSL 3W9DB 3GK8H 5I1IL 5D7LE 5EU5A 4JO3H 3F7PC 1C5DA 3ZKMD 1X4XA 1JHLL 2VWEC 4JZJA 4WIQA 1WZ1H 1JWMB 1PX4A 4IBLT 3S36L 4E9LA 4GAYB 2J88H 2AK4E 3AS1A 2E7HA 4MX7A 3VA2C 1P2CA 3QUMA 4MXQD 5FGSA 3LQZB 1X44A 1WK0A 3ZE1E 3MV7D 3NABL 5DHVB 1G7MB 5GGSY 1VFUA 3QCTH 2NY2B 1SYVB 5FFLA 3D39D 3O6LL 3DYOA 4L3AA 5C0FB 1YJDC 3KYKH 3U9UB 3IDNB 4LKXB 1FBIH 2VXTL 4HLJA 1NLDH 1V8HA 3EGSA 4R3SB 1B2WL 4UNTA 4HMDA 3QFJD 2Y5TA 2R8SL 3TBVA 1DP0A 1O0VA 2XA3A 4Y8AA 5CLTA 5IMKA 4WFHD 3LQMA 5IB3B 3T3PF 4EUPG 2HT3C 5B8CB 2A0LC 5F93C 4IMKA 1I7ZA 3I6KA 1JPGA 2Q8BL 1F45A 4Y4FA 43C9B 3S5LB 3RGVD 4JHAH 2H45A 5A2FA 4KTEL 3QRGL 4L8BB 3VWJA 2IADB 2V17H 4LLAA 4ZFOL 1D6VH 1GVIA 4ODXA 2O5YL 2YK1L 5FM5O 3OXSB 1UZ6E 3L9RA 3G6AA 1NGQL 3GSNB 4M62L 3MUY1 1W72L 3SDYL 4DZ8B 3NA9L 4FQ1L 5I73B 1ZT7B 1TZHA 1MCWM 1B9ZA 1VADB 1WIOA 1IILE 3VH8B 3QI9C 2ED9A 3BISA 5HHME 4O58L 2RCSL 5ID1B 1NEZG 3GMPA 5FO8B 1FYTD 3EO9L 1EFXB 2NY2C 3DSFL 5KSBF 1ULVA 3KYNA 2X4RA 3SY0A 2VDLL 3QWRD 2YKLH 3O8XB 2DBLL 1E28B 5IWLA 4NRZA 1JNNH 2PW1A 4BH7B 3QFJE 4Z0BL 4GG6B 2IG2H 5HHXL 3X17A 4LLQA 1R3LB 5B8CC 5HDBF 4RFEA 2DM3A 4QRTB 4WVRA 4L5FL 1RD6A 3LB6D 5I1CH 1RVFH 4OGYL 1A6PA 4NT6A 2WK2A 1I1YB 2CKBL 2YC1A 5EUOF 2BP3A 1IGMH 4MQXC 5EO9A 1MJ7H 3H3BC 1YECL 3MOAL 4M6MH 2D7MA 5A3IC 2XKNB 1Q0YL 4UB0H 2DQHH 3C87A 5DMYA 1IBGH 3KLDA 4R2GD 3OKLB 3RWIB 4N1EA 2EZ0D 5DQDH 3NH7H 4FFYL 4OM0H 3CFDA 3FO0L 3O6KL 3FAXA 2EXYC 1KLUB 2J5LB 3HB3D 5GRVK 2AQ3A 4ZAKB 3VFRA 5B22A 3WJJC 1J1OH 2IH1B 3AREA 1FFPA 1OW0C 1A6VL 4XBPB 2YSSB 4LGPB 2P8MB 2ICEA 1D5MB 3SKMB 4OLZH 2I07A 2VN7A 3IAPA 4GKNB 4M9OA 2EYTB 3I6LE 4ZXBC 2A83B 3MGAA 1CYGA 4TOYH 2J6EL 4MB4A 3GI8H 5ISZE 2ATPA 4MNGA 5C0BD 1S7VB 1PSKH 5BS0E 4U31A 2IGFH 3PDOA 1KTDB 2VNCA 1X4ZA 2NNAB 1HEZB 3CVIH 4G7VH 1FNFA 3LS5L 4PJ9D 2B20A 2AJUL 3G5ZB 3MRKB 3VFTB 4NQCA 2XACC 3RIAK 3F58H 3D0LB 3FB8B 3UMTA 4K23L 5GJSH 2JCCF 4KK6D 1BF8A 3OKDA 4IRSD 4OLUL 1HHGB 4HT1H 4H26A 2Z8SA 4HZAA 5CGYD 1GZQB 4NNPL 4TUJA 3UTZA 1VEOA 3CUPB 2J5LC 4GUPA 1G6RH 3GGWA 1M05A 3FONB 3L3HB 2O26U 4ZAKC 3TZVD 5JPNA 5IHLB 4X8XA 2SEBB 5D2LF 3NACL 3G5VB 2E7MA 3MLTA 5GGQH 4MDIA 1A7OH 4U3CA 1R5VB 2B1HL 2EKSA 2Y06L 2I9TB 3QCUH 3ZTJH 5T1KB 1DVFB 3VXRD 2VXUH 4HIIA 4KMTL 5HY9B 1BVLA 1SYSB 1HINL 3QDAA 4HKXA 4L9LA 4X6CB 3KNBB 5J3HD 3MLVH 3MNVA 5L88H 2EDYA 4LCUB 4M1CC 2JIXA 5CCKH 3TO2A 2BC4B 4F58L 1A9EA 1XR8A 4C56A 5IMLB 1WITA 1FVDB 1GPOL 4UU9A 2G5BA 1A0QH 4XMKL 1K4CA 5I8EA 5A16A 3QJHB 1ED3A 4L3CB 1P9MC 1D5IL 1KBGL 1UH4A 1T03H 3N1MC 1OD7A 1HHIB 1AR2A 3QDMA 5EN2A 4DZBA 4XH2B 3P9LA 4NO3B 2ZSVA 1HKFA 2IPKA 3G6DH 4M03A 1KG0B 4LVNB 4D8PA 3RPKA 3V8CA 5D72H 3QEQD 3ZSTA 4MNGE 1F8TH 4JG1H 3QUZD 1UWGH 5T1LA 3WSQH 2COQA 1CE6B 3X3GH 3MBED 5CD5C 2F9BT 1L4IA 1ZHBB 4GRLB 2R1WB 5D6CA 4N9GA 3MJ9L 3ZE2E 1SJHB 3MMEA 4JKLA 2IH3B 3U4EA 3QWOA 5IB5A 1R5WA 1MQ8A 4PRIB 4WO4D 1DVFC 4KK9D 3U4BL 3GSRB 1QKZH 4DN4H 4R8WL 1CL7L 4G9DA 2NZ9D 1HQ4A 1IQWL 2W0FA 3HI5H 5CJQL 1YPZF 1ZGLP 5I8KL 4GLRH 2Z35A 4H8WH 4I77H 5CP7A 2IALB 5HGAA 4X4XB 5DD0H 5KVFL 5TJWK 1WQVT 4HXAL 4WUKL 5JW5A 1VCAA 5ADPL 1I9JL 1CD0A 1N59B 3U2SB 3DBXA 3RWJB 3WNKA 4GFTB 2OTWB 1LEGA 4PRHB 2FWOA 4G6ML 1ZLVK 3M17B 4JN1H 3ARFB 3BZ4A 2QSTA 3SDCB 3IFLH 1A1MA 2C3XA 4ZFGL 4NZUH 4ZD3L 5LGHL 2P5WB 1T2QL 4Y2DB 1N26A 3RIAF 2IEPA 5I30H 4LOUD 4YHKL 5MEPB 2VZOA 2G9HA 3GRWH 4P2RD 1BZ9A 4M43L 3M1BA 2DMKA 4I1NB 4HFUH 4PJ7F 4GRLC 4CVWA 4KQ4H 3Q1SL 4OZFG 4NM8H 1CXEA 5IOPA 1A47A 1S9VB 5CUSH 1N5YH 3UO1L 2AS5M 4C56E 3BUYB 3QEUA 4EOWH 2HFEB 3WS3A 3Q6GL 4MJ5A 4X6DF 5F6HI 1AJ7H 1TJGL 3DX8A 4PJ8C 3IJHB 3KJ6H 3FQXA 4L4VB 1MHHB 1CFVL 4EBQL 3OMZA 1A6TB 5I1KH 4MCZA 1NBZA 2BY3A 3GBLA 1JRHL 1V3JA 5CHNA 3BPNC 5BXFA 1J1PH 2KQMA 2GJ6A 2NY6C 1KJVA 3F12B 4YZFF 5INDB 5DJ6B 1B0RB 5IV2A 3ARFC 4HZLB 3BKYH 3RVXD 2JE8A 4OLWL 5E99L 3WKNA 1CE1L 3A67L 5INCA 3O2WH 4Y2DC 1MWAH 1CFTA 1KGCD 3L5IA 4P2RE 5GSRB 4YBQC 3S35H 2BNRD 2G5RA 3LN5B 1FNLA 3BKJH 4J4PA 4PREA 4BQ8A 5JXEA 1J0KA 2HTLD 1OTUD 1L7TL 2BMKB 4K71C 3X11B 1HHJA 2CIKA 2WUCH 5C86A 3TCXA 3KXFE 3ZLQC 4I0PB 3SE8H 5DJ8B 3FRUB 3ZKXB 4OGZA 4Y5VA 3AVEA 4KI5F 4U1MA 5DF0A 3UC0L 5IQ9B 3CSYA 2D0FA 5KSAA 2ARWA 2DTSA 2E6JA 5EU4A 3VMOA 3L7FA 3LMJH 3C5JB 1EEYB 1I7TA 2LAAA 1QBAA 1KACB 5F44A 4JFFD 1LO3H 4IOIA 1A4JA 4JFZL 5HBBA 1LEIA 1JI1A 3ESVF 2P47B 3DGCR 5JW3H 2AJXL 4XPGH 5CJ5A 2EDFA 1WFUA 4Z7QF 5HHNA 1XEDA 5EG6C 1IKNC 2X4OA 4XT1C 3U6RA 1JNHA 4Z7OF 4CN1A 5BOPA 2EC9T 1IGIL 4WTZA 1H9VA 2H2PD 1U0QA 4MXWH 4ZFOB 1J05A 4FQ2L 4LAQL 1RULL 2LAGB 1I3UA 1KEMH 2NX5D 3EJYC 2R2CA 3LKPB 5DQJA 3GSWB 1W72B 3WUWG 3NCMA 1Z0MA 1TNNA 3UTTB 4DKDC 3SCMA 4PJAF 1EZVY 1II4E 4OCYH 3DTXA 4UT9L 2RIKA 4HCRL 2PR4H 5IW3A 1RUQH 4PJHF 3D0VB 3REVA 3JWDC 2DDQL 4HBQA 2UZIL 4NJAL 2D7NA 1S7QA 5D8JH 4KTYA 5BOZG 1C08B 2XV6B 4I0PC 3ZKXC 1OT1A 3TBTA 4J8RA 2FX8L 4BQ9A 5FHAL 2VB5A 4K7FB 1MI5E 2ZNXA 1O7VA 2V2WB 2VDRH 2GJ6E 3MRDA 3TV3H 4JQIH 4HG4J 4RGNB 4YDVA 1JGUH 4XBEH 1BBJB 5CINL 4AG4L 3VD4A 3SDXE 1FO0L 4W4OC 1FZJB 1G9EA 1WBZB 3UJTL 4RNRA 1A4KA 4ENEC 2DM2A 1JYVA 4UZGA 1IAOB 3MV8E 3O45A 4AEFA 2OK0H 5ALBL 3T0DA 4U1LA 2DTML 1C5BH 3O4OB 3OAZH 1KCUH 1X6NA 3GSQA 4PFEA 1CDJA 1NC2D 3W5MA 3GI9H 4OJFH 1ND0A 2ICCA 3D5OF 4R4FL 4PLJC 4LSUH 1H0DA 4A2MA 2ICWB 3U0WL 4PPTA 4NHUA 2ITCB 3O0RL 2X5PA 1BQUA 1PY9A 4N0FB 1JMXA 1UGNA 4CL7A 3V52H 2E27H 1FV1A 2HVJB 4BSVA 2X4PB 4UILH 5FO7A 1IM9A 4OSUH 3U7YH 1PYWA 4ETYA 2ZSWB 5EDXA 1FP5A 4B5EA 1J8KA 5F9AC 4YHML 4EI5A 5HDOA 3AB0B 3VXQA 3QQ4A 5IW1A 5LJYH 4Y4KA 1JWSB 4TPRL 2UY7A 4IHOA 2EDKA 2F54A 3WIFB 3NN8B 1ZSDB 4AL8H 2BRQA 4XVUC 3D18A 4W70A 4RGNC 1J0YA 3HMXL 2VZVA 2GFBB 2AJYL 1D5XB 5MEOB 2GK2A 5C9JB 3VA6A 5C7XH 4FFZH 2IBZY 1ZK9A 2Z31A 4ZS7L 1BZ7B 1EV2E 3LS4H 2IMNA 3IGAA 3I84A 1AXSA 3PP3H 3JWOL 5F6HJ 3E8UL 1XCTB 1QQDB 3LRSB 5JTWA 3P77A 2IFFH 1GHFL 5GGSB 1RZKL 4G6AD 5L8KB 4NCC1 5I16B 2E9BA 1K5NA 5EZIH 4XPAL 5TDOB 4NHCH 3QQ9D 3TO4B 3JBG7 1FGVL 3L3OA 3PF2A 4O51A 1SVCP 5BVPL 3MYJA 3LCYA 4KTDH 1UA6L 3HPJB 3TN0C 4JQXC 3UP1A 2WWMD 4F7CA 1JGVH 1BQHB 1MJUL 5D5MF 4XPHH 4L3EB 4M5ZH 1Y6NR 2DQGH 5T3XD 4DFHA 5I19L 1RZJC 3W81A 1RSFA 2NXZC 1Z2KA 4HFWA 2YOCA 4FZEL 3P9WB 2FO4A 3QBTB 4GBXA 1HSBA 4QY8A 4PD4J 4C4KT 4FQJH 4YUEL 3T0EC 4G42B 3VFUA 1CDGA 4D9LH 1NMBL 3OPZH 4OV5B 5IG7B 3CZFB 2VQ1A 1KEGH 1G9MH 1N6VA 3O6FD 4BUGA 4HC1H 1RPQA 4OF6A 5H35A 1NFKA 4NUGL 4N0UB 3O9WA 1XGYH 4L8SC 5GS2D 1TQBB 1QO3B 2VERN 2CDFA 2YPLD 3OKOA 4YPGA 3ZKQD 4OZHE 1EHXA 3T0WA 3ROOB 5EB9A 5C0AE 1GAFH 5ICZB 4JPVH 3TO4C 3MCLH 4RZCA 2B5IB 4F8TA 2OJEA 3L7EB 5E2WH 4WU5A 3AS2A 3BJLA 3QQNA 3INUL 4CADB 4F7PB 2YN5A 4FQPA 3DO3A 3ZDZF 2DI8A 1R24B 4RBPK 2X4UB 4U1HB 3W11D 5FO9B 3EKCA 3TWCH 1XIWB 1HH9B 4MD0A 3NGBC 5TDNA 3VXOB 4KKAC 4NN7B 3I75B 2J4WH 1AY1L 2VDNH 5JNYA 1U42A 3CFEA 2OL3L 3LHPH 1DBML 1TITA 3C6SB 3L5JA 1F3DH 3OJDB 3SDAD 4NOBA 3TF7C 1GGBL 4QRPE 5D7JA 2AVGA 3IDGA 3KPRE 3PQYE 4NYLB 1MVFA 1XCQA 3WFEL 4LHUA 3RVUC 2MMXA 2LE9A 4PGEA 1T89A 5ADOL 1NC4D 3X12B 2O5XL 4QWWC 2R0ZH 1TZGL 2VXQH 3A6OA 4U6XA 1TQBC 3ZTNH 3T04D 4N0RA 4ISVB 3THML 1Z9MA 1KULA 5E8OA 4PBWD 5ID0A 4JY6A 4KDTC 4Y19A 3QPXH 3HE7A 3V8OA 4PRDB 3MFFA 4JO1L 5FYLD 1NAKL 4M7KL 4QNPF 4P23A 4H88H 3NA4A 2Q76A 2Z91A 4G9FD 4G80B 3LSOB 1FIGH 1ZXQA 2XN9A 4S11A 5SX5K 3UX9B 2ADFH 2QQLL 4UTAL 4Z0XB 5BMFL 1W0VB 5HI5D 1B4JL 1XIWC 1G7LA 5DEZA 1DQLL 2VXVL 3FAWA 1G7IA 1Q0XL 3ZO0A 4YHZL 3NCEB 4NN7C 1K4DB 3WE6A 1LO0H 3ALXA 2HJLA 3P9MB 2MNUA 1KCRH 3ARDB 1ORQB 3S96A 2AGJL 1YJDH 4IS6B 3K8KA 5DHYA 2XRAH 4KZDH 3LV3B 1ZA3A 2CKNA 2GK0A 2NYYD 4LVHC 2GEEA 2CK0L 1CGUA 4U0QB 5C07E 3GHEL 5CP3H 4OD1L 4RGOH 1U8LA 3WFDH 2J8UA 5BW7A 4G6FB 5AYUL 4XCYA 2EIBA 3MLPA 2DLFL 3D3VB 4LEXH 4LSSH 4Z7WF 1RHHA 5F88A 1U2CA 2DYPB 5F3BA 1LE9B 4POZD 5GRJH 1P1ZB 2IFGA 4FP8H 2A6JA 4OAWB 3FOMA 1HDMA 5C0CD 4ZYKA 4QHMA 4ONGL 4K8RD 5IBTH 4G9FE 3SPVB 2OP4H 3LN4B 1AD9A 5TGBA 1KIPB 3TJEH 3O3EB 4UMGA 4H25A 5T5NF 5KW9L 1KPVA 1GIGH 1LO4H 2H32B 4NQSB 4JRYA 3FMGL 3MLUL 4LGSB 5DHVH 1CT8A 4J2XA 1VB9A 1NPUA 1BFOB 2ITDB 3BYTA 4WW1B 1A1OB 1RIVL 4XNUL 2EYSB 5C6TH 3P11L 1T83A 4ZTOL 2BOCB 4O2EA 1QNZH 5I1AB 3FT4A 3D25A 2DMCA 1A1NB 5CKGA 3E1F1 1IGYA 2WAHA 5BZDB 5E2UH 3IDJB 2VDQL 2EIZA 4P59H 5B38B 5E8NB 1ZHKB 1JV5B 1UZ8B 4IOFC 3DRQB 3VD5A 2MKLC 4LLVA 3PDGA 1NH6A 1Q94B 1Z5LA 4NKQB 4DKAA 4LLDA 4NDMA 1AGEB 4R0LC 2VOTA 5DMGD 1RURL 1MH5B 1OP3K 5J06A 3HI6L 2XN9E 2EO1A 2IQAA 1C5CL 2F15A 4OFYA 5CEYA 1NBVL 5C0CE 4UV4H 1MJ8L 1R3IL 1V7MH 3QUYA 4I13B 4MSWB 2QHRH 1CGTA 3GSNH 1H3VA 3MCKB 4RX4D 5LAXA 1EA9C 2X7LA 4XHJC 1QG3A 1RZGA 4OD2B 4S1RH 5H2BA 1A8JH 4ACPA 2LV4A 3MREB 4QOKD 3ARBD 3T1WA 1INQB 1HZHH 4X6FA 3JTTB 1RZ7L 3IDXH 1FNEB 1IAKB 1VFMA 2VISB 4L4TD 3PL6B 2F5AH 3OKYA 1F11A 1FO0B 3GBNH 3O11A 1JK8A 4CNIB 5DEFB 2EDTA 5LCVH 1WAAF 3WHE0 3BZFB 3UBXI 3KLAB 2VLRE 1IC4L 1KJMA 5EFIB 2FZ3A 4DGVL 4GW5A 4P9HH 5EU6D 5KSVA 5DD1H 4YHOL 5SWZA 1FNGA 5FUOL 3ULSB 4JM2D 1I85C 3OHXA 3BIAX 2DIBA 2Y7QB 3QIUA 5JHDE 1YUHB 3FFDB 4PJIF 4PJCA 5HJ3B 4LPCA 3HLAB 2LABA 3IFOA 3C6LA 3TCLA 2H1PL 4AK1A 1MFCL 2BNUA 4MS8C 1T7YA 5HI4D 4U6VH 5EIIB 1OY3B 5DI8A 5KSUB 3RY6A 5E1AB 4FTVB 1DQML 3MRPB 4F2MB 3SJVD 1NLBL 4OIIL 3PWNB 5I66A 2V5SA 3RBSA 3OR7B 1X5HA 1XGQB 5AD0B 2V7NB 3PJSA 3CFJA 2Q8AH 3C8DA 5E5UB 5SV4A 1JHKH 4WFEE 4M1GH 5EC1B 5EUKB 1T5WA 2NZIA 4QOKE 5DYOB 5JUEL 3S98A 4E41D 2A73B 1DUYA 3GEWB 3IXTA 1QRND 4PS4L 3MRCA 2DN7A 1INDL 3ECBA 1XAUA 4JRXA 3V0WH 2NY4D 3HAEA 3V7MA 5EIVA 3IETA 3VXUA 1QSEE 1UQSB 1YMMA 2WW8A 2EEDA 3KG5A 5JR1L 4MA8L 4M93B 1HSAB 1U6AH 2XI9A 4HGMA 4HLZG 3QXVA 2EDNA 3BVNA 3BZDA 1MAJA 1OARL 4PR5B 3DV6B 4U1JB 3LRGA 1OTSD 4M1DL 5LXGL 4PV8B 3MA9L 4S2SA 3SGKA 3ULVD 2R0KL 1A6ZB 4IRJA 4JGMA 4K3JH 1ORSA 2DRUA 1I3RA 3V79C 2VSCA 3S3PA 1C16A 2OSLA 2D7QA 3GO1H 15C8L 3X14A 1MAKA 4JPWH 1MQKH 4PGDB 4OD3H 4KWUA 2WIIA 1KB9J 1M7DB 4G43A 2V9TA 4LSDA 1VGKA 3MV7B 3SO5A 3KR3H 3SKNB 4E41E 2Z8WC 3UTSD 3V6OE 3L95A 2VL5B 1KN4H 1QRNE 4YXLL 1SM3L 5FGRA 4TUKL 4UBDC 4Z18A 2HVKA 3D39B 1BOGB 3WJLA 4Z5RB 4I3SL 4ZTPH 5D4QA 4NKDB 1HI6A 4G8IA 4PTUB 3SE4C 2FGWL 4YWGH 5TE6L 1N0XH 1AKJD 5GZOC 5DGRA 4PJCE 4JE4B 3QFJB 1MLBB 3CPLB 2UWEA 1FZKA 2ADIB 4ODHL 1P7KB 2MHAA 1FQ9C 5F3HB 1UJ3A 3UTQA 2FB4L 3G9VA 1WBXA 4YXKL 4F7MA 3RGVB 2BSTB 3QHZL 2XWJA 4RIRB 2DLGA 2E8ZA 4EDWH 3GJEB 1DEDA 1RZKC 3EFFB 4GS7C 2JJWA 4P2OA 4C58B 3JVGA 4LASL 5B3JF 4FQLL 3GMLB 4P46C 1GSMA 2VDKH 3WNPA 2FJFB 1UFUA 1ZHNB 3B4NA 3UTSE 4L29B 4NQXA 1Y18B 1YMME 1NCAH 5FYJH 5KG9A 3I02A 4J6RL 4HPYL 1NCBH 1FYTB 3PWPA 3WEXA 5IHUH 3PUCA 5IJKC 4JFQA 1G6RA 1LMKA 2AJVL 2ZUQC 1FC1A 4TRPH 4WEUD 3MJ7A 1G0DA 4ZO8A 5BZWB 1FL5B 1NGPH 3PNWB 5IBLD 2M26A 5MP6L 1X7QA 1YEGL 4U2ZA 4FMKA 1AHWA 4QEGA 5EO1B 4GSDL 2H6PA 4HKBA 1MIML 2AI0H 2R1XB 3I9GL 4WY7H 4LBEA 5B39B 3GMNA 5K9JL 4ODUB 4X4ZA 3RGVC 5IF0A 1TFHA 4O4YL 4ZFFB 3X3FL 3MRHA 4JO4H 2MJWA 2GSIB 3DUSA 3VFVA 2Q6WB 3RWDA 3U0TB 3F7VA 3U48A 3V4VH 1U8NA 2C3HA 1QA9A 2EH7L 1TJHL 4PB9L 4R2GB 3QIBA 1UKSA 5GGVH 4P4KA 1QLFB 3CLEL 3DX6B 4GXVH 4OCRH 3TIDB 1CXHA 2R4SL 1FORH 4G8GA 5IM7B 4IEFB 1U3HD 2ZCLL 4J3WA 3BIKA 3EFDL 2W0KA 4XNMB 3ZE1F 5IW6B 4BSWA 4GAJH 5HHPA 4PYGA 2H9GA 3DMMA 4H5SB 4CMMA 5DSCB 5GPRA 2ZZUT 1J5OL 1WEJL 1D9KA 1JHTB 1A02N 5KOVC 2I9LA 2X4NA 1KC5L 4XGZB 1AR1D 5C0BB 1IKFH 3AUVA 3FJTA 3VE0B 1A3RH 2FDBP 1TVHB 3DVFA 3T1FA 5HGBA 1ZT1B 3CCHB 2HFTA 5DURD 1CR9L 4NM4H 3QT2A 1YPZB 4Q6YA 3BT2H 2BNQA 5IBUG 4PJ9B 3LB6C 3NIDE 5TFSH 3FN9A 4N5ED 2F53A 4XPTH 1YEJH 3GIZL 1GOHA 2E9WA 3W82A 2Z4QA 4UTBH 5T1DL 1OAKL 2VE6B 4MJ2A 5ESAA 1FNSH 4IRSB 3G6JA 1R6VA 3DUHA 4R2GC 1XF2B 4GQPH 3EOAB 2VIRA 1M7IB 5J13C 5I74B 1J18A 2R29L 2R39A 3MRRB 5D1XC 3RWGA 4ERSL 3TZVB 4OLEA 4XZUA 1TTUA 5C70A 3TESA 1PVHA 5J9PA 1H5BB 4JKMA 3NABH 1U3YA 3GRWA 3JWDH 3ARGA 5EA0L 1K2DB 3EYUL 1G0XA 3GB7A 3WFBH 3WFCH 4O00A 4O02L 1MCBA 4QF1B 4TSAH 5T3XL 2KZWA 3CC5B 5JOFA 3T8XB 3MJ8A 3VXRB 4JDZA 1LE5B 1HHHA 2VUOA 5HHQB 4WTZG 5HYIA 4HK0A 4UUJA 3JV4A 4PJXE 3QFDA 5FKPB 5JMOC 1ZHLB 1B2WH 1J9CT 2FCBA 4FQQA 2R8SH 2M1KA 2P7TA 1DQJB 2VDPL 3MLSL 4JVWA 4Y16A 1CFSB 1EBAA 4GKZA 4OT1H 3EDFA 1X3DA 4KVNH 1LILA 4O9HH 5C0JB 5DJ0B 4KK6C 1T1WA 3DVNA 4MQ7A 5T1MA 2W91A 3E6HB 3MO1B 2O5YH 2YK1H 3KPSE 3LKRA 7CGTA 5CGYC 4X8JB 3HZVA 1NSNH 3LKOA 4M62H 1W72H 3H3PH 3B2UD 4JM4L 3TZVC 3QEQB 1JMZA 1BLNA 5EBLA 1MWAA 3QUZB 3X13B 1H5BC 3HE6A 1N4XH 3MBEB 4JLRB 1GC1C 4O58H 4XHQA 4U6TA 2H26B 1JWUB 3T4YB 1INEL 3C8HA 3EO9H 2ESVA 4WO4B 3DSFH 1DSFL 1AO7D 3QEHA 1F3JB 2VDLH 3RIFF 2OBGA 4I3GA 4PJDA 5AAWA 3VD3A 3B3IB 4Z0BH 4JY4B 1H15B 5J3HC 4P57B 1J8HA 3D1MC 5D7KE 5IFHH 4Z7UA 25C8L 4A6YA 3G6JE 3G08A 2EXWD 4H20H 2OXHA 4R4ND 3HRZB 4PP2A 4NQCD 5TDPB 2AV7A 1BF2A 3HCVA 1R3JB 5GS0L 4L5FH 4I4WA 4KZEL 2PYEA 4S0SD 5JZ7C 4HKZB 4OGYH 3DGGB 3VXTB 3BKML 3SDDC 5L2JB 3TYGH 1YECH 5F21B 5GGUB 5FA4B 5EC2A 4P2RB 3VXSE 5I1JL 1WIPA 3O3AA 4KC3B 4WHYH 1ZANL 1G7PB 2F74A 3FO0H 3O6KH 1JUFA 1A5FL 3CMGA 1KPUB 4G3YH 3MBEC 5JORA 2X4QB 2YRLA 4AEHH 1JFQH 1T3FB 3B9KC 3S4SB 3KS0H 3LEXB 3QNZB 3QXAB 2DQEL 5C09A 2VKWA 3MACL 3P3YA 5FB8B 1T6VN 4WO4C 4KK9C 1BD2A 3GMMB 3G5XB 3DXAA 3ARRA 3OKEB 1UYWL 3SQBA 4JPKL 4JG0L 4NWUH 2Q7YA 1XGTA 2J6EH 1DR9A 3OF6A 5F9OH 1A7RL 2A9ML 2DS4A 2PCPB 4KMLB 4UIKL 5C0EB 4LRNH 3KPLB 2ZOLA 1AC6A 3AU1A 4G7YH 1AQDA 4GW1A 5I76A 1YEFL 3KJ4B 1MCFA 3LPWA 4U6HA 3RWFB 5KVDH 3KDMB 3Q0HA 3QDMD 4GAFB 2IF7A 4U1KA 4KRLB 1IZJA 4NC2B 5FUCC 2QKIB 5DLMH 4K23H 3BZEB 3EBAA 5I75B 2OQJB 5HDQL 2PO6A 5DXWA 4FABH 4LOUC 4WWID 5C08D 3V6FA 4OLUH 2BNRB 3IU3A 3C5SB 4NN6B 4AIOA 5LVEA 4K8RL 2GITB 4UIMB 5J57B 4HGWB 1D5ZB 4NNPH 3UDWC 4EN3A 1G7QA 4K94L 2EDDA 2GSGA 1N5AA 3NACH 4U1NB 4Z7UE 1I3GH 4AYFA 1CXLA 1S7XB 5SV3A 3HZYA 2XKSA 1X5XA 2O61B 4DAGL 3MNWB 5ICXA 1F6LL 3HZMA 1VSCA 4WWKC 5I1DA 2UYLA 4O2CA 1FCCA 3FO9A 5IT2L 4Y5YA 5CZXD 3VDCA 1AP2B 4NPYB 4JFFB 4G8FB 4DQOH 3QIWA 4FG6D 1EO8H 3T08A 1HINH 3SDXB 2ENSA 4JHWH 5D1ZA 3RBGA 4Y1AA 1HNFA 4OZGB 3ZDXE 1ZT4A 5EIQA 3OV6A 4MD5B 2CJUL 1SJEA 4JKPL 2EKJA 5DJZB 4E5XB 4NQUA 3QO0A 2AKRA 4OCSL 1D6EA 3KJ4C 1GPOH 3HS0B 1MVUB 3WO4B 3P4OA 1F2QA 1NGXA 3MLYH 3MRMB 2NX5B 4NNXB 3BJ91 4J3VA 3RVXC 1NFIA 1T22A 3KPPB 4AT6B 1LP9A 3QUXA 4ESKA 3SGEI 4Z7VE 5EOCJ 1JGEB 5C08E 5I75C 1D5IH 1KBGH 4XCCL 2UVFA 2YMXL 3GJFK 2L0DA 4X9GA 5C09E 3C8KA 2P8LB 3KPMB 4K07A 1BD2E 5ENWB 3OX8B 3VI3F 1ZA6A 4OUUA 1X9QA 4URTB 2HTLC 2ZOKA 1IVLA 3TGXA 1UEYA 1YQVH 4U7MA 1JJUA 3UEZA 2RAMA 3C60D 5IVOA 3CSPA 3G5YA 5GZND 2QQQA 4N1CA 1DDHB 1VESA 1EJ6A 2YD7A 3MJ9H 4F3FB 3RNQA 1KXQE 2F19H 1FFOB 1U58A 1E0OB 1LNUB 2N7BA 4LHUG 1KIQA 3RTQD 5B4MC 1I1AA 5GRUH 2FJHA 3V5DA 5D7IA 3U4BH 4OCNC 3IKKA 3OSKA 3CVHB 2C1OB 2G2RA 2DIAA 5J1TC 4JDTL 1GZPA 3BH9A 3U9PL 1NJ9A 4RWYH 4ETQB 4OI8A 1IQWH 5CJQH 3P4MA 4X7TB 5I8KH 4NN5B 4U0RB 3EUUA 5GISL 2FECI 4HXAH 3ISWA 5D1QA 4KU1A 1FN4B 2H2PC 3WN5A 1I9IL 5ADPH 1I9JH 1BAFH 3WO4C 3RWHA 4PBXA 1NC2B 2DQDL 3GK8L 1D3CA 2ZP0T 2X4SB 4G6MH 2JB6A 4BKLB 5SWQB 1EEZB 4RMSA 4MA1B 1WZ1L 3QZWA 1KIRB 4J4PD 2J88L 1VFAB 4QHUB 5LGHH 4ZD3H 5JXED 3TVMA 4QRUA 4Q7DA 4RMWA 4U3XA 4YHKH 3MGTB 1QFWI 4FQHB 2ZUTA 2HN7A 5E94A 5DJXB 3RHWK 2X10A 1NFDA 2APVA 1NGWB 4PJGE 1A7NH 5C0IA 1U8OB 3HNTL 5L7XH 2QR0B 5IK3B 2Y6SD 5M95B 4ORGA 4HBCH 1U91A 3Q1SH 3KYKL 3VXPA 2XY2A 3DYPA 1FBIL 4F33B 2IQ9L 1QLRB 1NLDL 3BH8B 1RZIB 3E6FA 4ODWA 4YC2B 5BCAA 5CAYB 1MCKA 1ZVHA 3WMSA 1DLHA 5EZLB 4BELD 3H6JA 5FM5M 3O3BA 3CFKB 2BHYA 4P2QA 1TJGH 2W9LA 4NN5C 1LQSR 3OR6B 1Y0LB 1I1CA 5DJDA 4KV5E 2VMFA 5K59E 4Q2ZA 1TPXB 1XGUA 3KGRA 3BRGC 3FQTB 1QZ1A 2V17L 4IDJL 4NUJA 1I8IA 2EH8L 4UOJA 1TZIA 5DDHB 3IT8D 2VRAA 2A6DB 4MMXC 3SCMD 1EVUA 5E4EB 1A14L 4P5MA 3VGDA 4MA1C 5D9SA 2H2SC 1FZOB 5E99H 1U92B 3A67H 1T1YB 4RGMC 1OF2A 5DJCB 1F6AB 4CKVX 3CH1A 2ID5A 3MRFB 3MRJB 4X5XA 5DK2B 1FPTL 5E5MA 1L7TH 4HXBH 1VGEH 2YKLL 4KGLA 5TF1H 2H32H 1XGPB 2R0LL 5HYSA 2ENYA 4LLWB 1JNNL 4YC2C 3FB5B 5HPMA 5ERWB 2IG2L 1WUNT 3TBSB 3WIHH 4X83A 4YFLF 2WWKT 3OJ2C 5DR5L 3TT1H 3EAKA 4QXTB 2R2BA 3NCJH 3PHSA 1T5XA 5A43C 4PJBA 3RKPA 1U8JB 2XNAB 1ZS8B 5I1CL 2AJXH 1RVFL 1KNOB 1TPXC 5IQ7H 4YH6A 1IGML 4JR9H 3AXLB 4PGBB 1MJ7L 4X4YA 3O6FB 2CXKA 4WFGD 4M6ML 1W0WB 3L1OH 1AIFB 5E4EC 5CP3A 4G6AC 2DQHL 4FQ2H 4LAQH 2YPLB 1RULH 1YN6B 1IBGL 1YC7A 4WI7A 3GSVA 5FGBA 5DQDL 3MUGA 3C5ZA 4CGTA 3NH7L 4OM0L 3PIQB 2VSDA 2GY7B 1P7QD 1N6QL 1QVOA 4NC0B 1WBYA 1IGJB 3QA3A 4QHKI 4F57H 4UT9H 4C83A 4K9EL 4HAFA 3W9DA 4Y4KD 4U05A 3ULUF 3KAAA 4R7DA 3UBXB 2GYSA 2AERT 2DDQH 4H1LB 3T3ME 1PBYA 1DBJH 1U36A 1JWMA 3FQRB 3PP4H 1HCFX 3RHWF 3NTCL 2MCPH 1T0NA 5FHAH 1KCKA 4EIZC 3LQZA 4IDLA 4DUVA 5DHVA 1PSKL 4CDGC 1MF2L 3B83A 3ZMRA 3SDAB 2EE9A 1IFHH 1LD9A 1FO0H 2VAJA 1L0XA 4PLNC 1JI2A 5I17B 1NC4B 2A6KB 3IDNA 3JZ7A 1TLKA 4LLMB 1JIBA 4PGCB 4XPFH 4YE4L 5E9DD 3F58L 3O6FC 4QLRA 4LARH 4R3SA 2F8VA 1ZEAL 5DVKA 5ALBH 4X4ME 4X9IA 4M4RA 4QRRD 4HT1L 1B90A 5IB3A 2VWEE 4R4FH 3QNYA 2W60B 1UM4H 3U0WH 3A0OA 2CDEB 4TQEL 3DURA 3ZHDA 3O0RH 3S5LA 5BRZD 3W0WD 2R15A 1EEQA 1FCGA 4G9FB 5F6IB 5E8PA 1DN0A 2AV1A 2IADA 4L8BA 3HAEG 3OBAA 3FB6A 3QI9D 1IGFL 2K7QA 2VLKA 4PJBE 4XCNA 4YHMH 3JXAA 5HYQA 2ICES 3U82B 3QCUL 4DZ8A 5IMOB 1U8KB 4TTDD 1YDPB 3WFZA 1ZT7A 4JPIB 5JQ6H 4AJ0A 5EBWA 3VH8A 3TIEB 2VXUL 5CGTA 1QSVA 3SDAC 5ID1A 3KPTA 3MLVL 5L88L 5FO8A 2FIKA 3BEVB 3HMXH 3JV6B 2HG5A 3FRPA 1EFXA 1BOYA 3RWCB 2WQRA 2V2XA 1QHPA 1UKTA 3O8XA 4LFHG 1U8HB 1KCVH 1YEEL 2AEQH 3BP5B 4PRNA 1BP3B 2YD5A 4GG6A 4QRRE 3JWOH 1R3LA 3E8UH 2G75B 1NKRA 1YC8A 1UXWB 4PJIB 3G6DL 1J10A 1RZKH 5C0CB 4QRTA 5FGCE 4OZHF 3MR9A 4YHIB 3WUWB 4HMEA 5D72L 3DNKA 2ARJB 4XPAH 3DLQR 5F6IC 5JDJA 2EXYD 4JG1L 3WSQL 1UWGL 3BPCB 5BVPH 3X3GL 4TNVF 2DQTL 4JFXB 5FOBB 3CXDL 1VKXB 2XKNA 2IBBA 4DKFL 5HI5C 2XZAH 3QQ3B 3OKLA 4JZNB 3RWIA 2G60H 3VFPA 1P6AB 1QKZL 1ZMYA 4LNVA 4ZXBD 1KLUA 4HGKC 1NMCB 5I19H 3O41A 2IAMA 5FYKH 2IH1A 1K85A 2PTVA 4PJ7A 2YSSA 4XBPA 2P8MA 4I77L 2NYYC 1PW3A 1D5MA 3LKNB 3SKMA 4OF3A 1QTYT 5EZJB 2GTZB 2EYTA 1ZGLB 3GIVA 3RUGB 1T6WA 4WHCA 4YUEH 2A83A 2ED8A 3OKMB 1CN4A 3TT3H 3IYLW 1R5IB 3IFLL 5F97E 2HWZH 4XMPL 1KTDA 4POZC 4NZUL 1HEZA 4NUGH 5CWSA 4Y19D 3BPOB 1H3GA 1T7XA 2QQKL 4ODVH 4YIQA 2Z93B 3G5ZA 3MRKA 2QJDA 3V6ZB 3VFTA 1KJ3L 1KJ2H 4HK3J 4K94C 1P9MA 1IMHC 3PV7A 4HFUL 5E00B 3GMQB 4KQ4L 1HXMB 1WT5A 1QOKA 4NM8L 4WHTB 3E2HC 5CUSL 1N5YL 2E9IA 4QOKB 3ARBB 1MFNA 3CUPA 2B39A 1G7HB 1I8MB 1SJVA 2FECL 4JZOB 3L3HA 1NMCC 3CU7A 1ERNA 4L4TB 4GMTH 4KKLD 2SEBA 4GG6E 3AAZB 1K8DA 4ZFZA 3G5VA 3KJ6L 4J3XA 3WDJA 3LAFA 3SBWA 1DBMH 5I1KL 5H94B 3DIFA 5ELIA 1Q9OA 1L9MA 1R5VA 5D70H 5JW4N 2DMBA 1J1PL 4B0MM 2I9TA 1GGBH 5EU6B 2OZ4A 3QNXB 4M1CD 4I18A 2PYFA 2OX5A 1CDUA 1I8LA 1N3NA 4JM2B 2QSQA 3KYMA 5ADOH 1QFWL 5HY9A 1SYSA 3BKYL 2O5XH 1TZGH 1P69B 2YUXA 3B6SB 4X6CA 3KNBA 4ELMB 4L8DB 3ZZ1A 4LCUA 5IB2B 3O2DH 2QEJA 2YWYA 5GGRA 2BC4A 5EH1A 5IMLA 3F7QA 1FVDA 3IFNL 1DEEB 3SJVB 5C3TA 2DWEB 2VJXA 3QJHA 4LCYA 3IKCB 1HCVA 1R3KB 2RR3A 1CFQB 4L3CA 4KK5C 2PF6A 5CJ8A 1YN7A 3ORJA 1HHIA 3SE8L 4E41B 2VH5L 3U46B 1CWVA 5IJVB 4XH2A 4NO3A 5CD5D 2QQLH 3ARBC 1QRNB 2AJSL 3SGJA 5BMFH 3I6GB 4V2BA 2NY4B 4PJ5D 4YHZH 1Q0XH 3LMJL 3BXNA 2NY3D 4QTHB 1CE6A 4B50A 5JW3L 4XPGL 4J3TA 1MCNA 2IH3A 3L3KB 4NKMB 1B88A 1I8KA 1U41A 2XG4A 3QUKB 2CQVA 3GSRA 1A6UL 1QYGH 1OT2A 4JM2C 4P99A 2D2OA 4MXWL 1JZ3A 1B6UA 4EIGB 1ZWIB 3HZKA 5AAMA 2CDGB 4BA8A 3RL2B 2IALA 1TCRB 5HI4C 2DLFH 3PHQA 2I5YL 4GG8B 4HH9B 4BK4A 1OCWH 4UQ3B 4OGAC 3VFOB 2OCFD 3RWJA 2CRYA 2PR4L 3PXJA 1RUQL 5EPMB 2OTWA 2X42A 3TBWA 2EDQA 4PRHA 5FYJD 3M17A 1I9RH 5MERB 5D8JL 3WKMH 3OB8A 4PG9B 3ARFA 3SDCA 3UTSB 2NW3B 1U8PA 4KGJA 4O5LH 3SE3C 5KW9H 4ODTL 4FNLH 4F9PA 3ARVA 3N06B 4YR6A 3HPLB 2KDGA 3FMGH 2VDRL 2MPAL 3CLFH 5C0DA 5MEPA 1MCSA 1AGFA 1GC1H 2NY4C 3E0GA 3ILQD 1JGUL 4XNUH 1AKJB 3EYFB 5I15H 4G6KH 5D6DA 4ZTOH 3OKKB 3W39B 4X6CE 3QAZB 3QWQB 5F1OB 4PJ8D 3PGCB 5SWZD 1S9VA 3AY4C 4P3WA 5D93B 4OIBA 2H8PB 2VDQH 3BUYA 3ULVC 1BGXH 2HFEA 4PJEE 1C5BL 2WUBL 4EQ3A 2HH0L 1NCWH 3MV9A 2NY6D 3GI9L 4YFDB 3EYQD 2L7JA 4Q6IB 3VFSB 3GUTB 2Y23A 3IJHA 1ZV5A 2FEEI 2Q3AA 3L5WB 4LSUL 1MHHA 1SY6H 1DQDL 3FN3A 3HI6H 1KB5L 1CG9A 2E6PA 5EO0B 5AYQA 1OSPL 4OF8A 2P5WD 3V52L 2E27L 5IB1B 5F8RC 2C3VB 4Y4HD 1KTRL 1BVKB 1R3IH 2OM5A 3B43A 4JFHE 3F12A 3FN0L 5FYJE 4OSUL 3P0VH 5DJ6A 1FGNH 5DRWB 1B0RA 2A74B 2AQ1A 3FHQA 4HZLA 3KPNB 5FK9B 3STZB 4NSKB 4JRXD 4D0DB 3GSOB 1BIHA 1LO2H 4Z78B 5MENA 2P24B 2DWDB 4I5BB 3DHMA 2K9UA 4P48A 4PRIE 4ZMAT 3BE1L 4OLYL 2ILLA 4FRWA 5SWSD 2BK8A 1RV6X 2CPCA 3VXMD 3EO0B 3GSUB 3GMOB 1PJ9A 2BXYA 1RZ7H 2BMKA 3X11A 3QAZC 4HAGA 3UJJH 4FFZL 5C7XL 5IMMB 5D5MA 4I0PA 5J6HB 5DJ8A 3FRUA 3NIGE 3SQOH 1VPOL 3R06A 3EZ8A 1OQOA 3K46A 5D93C 5FAAA 1F02I 3LS4L 4DCQB 3MLZL 4LU5H 2R2EB 4N90E 5KS9A 3C5JA 1EEYA 5I8CB 4Q6IC 5FUOH 2UY6A 5DRXB 3EJYD 2P5WE 4Z95H 3F8UB 1EUTA 1P2CB 3QUMB 5EZIL 4NHCL 1WZLA 2IPUG 4LCWA 4Q9BA 2VZ1A 3RVVD 4RQQB 4LPYA 3LY6A 1U3HB 4ZFOA 4KTDL 3T0BA 1N64L 4LNRB 2OYPA 1JGDA 1JGVL 2X4TB 3LKPA 3GSWA 1W72A 2QLVB 5JIKA 4UNVA 3EW3B 2CRZA 2DQGL 4LMQI 1KT2B 5JUEH 1FNHA 2RHEA 3FOLB 5IBLC 2Y5TB 4PS4H 3D0VA 4JAMB 3TBVB 1INDH 2DQUH 3V6BR 3IDIB 2XTLA 5IMKB 3LDBB 4L4VE 1CDCA 4X6BB 1MRDL 4FQJL 1C08A 3I6KB 4PJCF 3BP6B 5DURB 5JOPE 4MA8H 4QXUH 2ZCKH 1VA9A 5JR1H 3G9AB 4D9LL 4K7FA 4ENED 2V2WA 4OZIE 5E6IA 4WV1B 1OARH 2EDLA 4TUOB 5D2NA 1KEGL 2FEDD 3BPLC 3MX0A 4HC1L 1KXVC 2D7OA 4M00A 5LXGH 3N1PC 1BBJA 2R0KH 1XGYL 4JZJC 5LGKA 3S97C 1S5HA 1LK3H 2VDOL 4RAHA 4HIJA 1WBZA 1IC5H 4K55A 1IQDB 3ARSA 1TZHB 4YFEA 2R23B 1GAFL 4DOHB 5E7FA 3HHRB 2HT2D 1IAOA 3PABA 15C8H 3MCLL 3IVKB 3VFMA 5CSGA 5GJTL 2CKBA 1E4JA 5E2WL 3HC0A 3HC4H 5DJYA 1U3HC 1EMTL 3KYNB 4YLQT 5EOQL 2CLRA 4ZNEA 1A7QH 1U95B 4WGVB 2ICWA 3HG1D 2ITCA 1CD1B 4NRZB 1RUAH 2PW1B 4YXLH 4N0FA 2EICA 1Q38A 1JF1B 2J4WL 2VUYA 2VDNL 2HVJA 3FQNB 5FCUH 2X4PA 3VG9C 4L9DA 3GMRA 3LHPL 3N1QC 3GKWH 4LVOB 5CJOL 1LO5B 2ZSWA 2FGWH 5TE6H 2J8OA 5CEXA 4GRMA 4IMKC 4LSTH 3H9ZA 4GRWB 4Y4FC 4NT6B 1JWSA 3I3DA 1FSKC 2J6EA 4N5EC 3WIFA 2APXA 1ZSDA 3NN8A 4XB7A 3ZE0E 3CX5J 3LQAL 2R0ZL 4EDXA 1NAML 2FB4H 3SKJH 1OPGL 4QGYA 1UCBL 2QADD 2GFBA 5D96B 1ZTXL 3ZTNL 3RI5K 4J12A 5MEOA 3QIBD 4FQXD 2E7CA 5C9JA 4GQ9L 5H8DA 3CFDB 4LCIH 1E4WL 1WC7A 2VZ3A 3UTTE 2YUVA 3H42H 4G8GD 3VFRB 5KANI 1BZ7A