3A6BL

Crystal structure of hyhel-10 fv mutant ln32d complexed with hen egg white lysozyme
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
107
structure length
107
Chain Sequence
DIVLTQSPATLSVTPGNSVSLSCRASQSIGNDLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYFCQQSNSWPYTFGGGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysozyme binding ig kappa chain V23-J2 region
publication title Contribution of asparagine residues to the stabilization of a proteinaceous antigen-antibody complex, HyHEL-10-hen egg white lysozyme
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/hydrolase
total genus 24
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2009-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3a6bL00
2OZ4A 2FJHA 4GT7A 3TA3D 5HYQB 4HZLA 3RKDD 4H8WC 2Z9TA 1D5XA 3RWFB 3LKQB 4G7YL 1AC0A 3LS4L 4P5KA 4X98A 3BAEL 3BUTA 1OAUH 4YHZL 3OXRA 4HJGB 4K8RL 3VXSA 1VPOL 1AD9B 4LLMA 3KPPB 4AT6A 4DCQB 5B22A 2WIIA 5BVJB 1E4XL 3MJ9H 3BJLA 3LS4H 1U8QB 5C08E 2ZCHL 3REWB 1T1YA 1CE6A 2F5AH 1XR8A 4NOFA 5TH2A 5CGYD 3UPRA 2OJEA 1MEXL 1CU4L 4K8RH 2HLAA 1CGSH 3FB7B 4E41B 3VA2C 3O3BA 2OK0L 2HT2C 3JWDC 4OD3H 4KVCL 5C0IB 1A64A 1Q72L 4H25B 4CU6A 4OBRA 5I1IH 1KOAA 1ZLWK 1E4XH 3I6GB 1HH6B 4Y5YC 1F02I 2E7LA 1J18A 1ZOXA 2BVEA 4Y7MA 3GI9L 3ARFB 3VXUD 1WAAE 5ID1A 2VRAA 2W59A 2Q76B 2WBJB 2ATPA 5JXAH 4Q9RH 1IC5H 4S2SA 1MEXH 1CU4H 6CGTA 3BT2L 2DQDL 1QFPA 5JNYA 3PL6A 3TN0B 4ZYKA 4L5FH 5H35B 2GHWB 5EBLA 1QUNA 4ZFFB 1G6VK 1OPGH 1U8IA 1FFRA 1U92A 2VXVL 2FIRT 4M93C 2H2PC 1IT9H 4U0QB 4N0UE 5M7QA 1Q1JL 3TBTA 3T3PF 4GRWB 3SCMA 5BVPL 5GQBA 3A6OA 2DQDH 4GKSA 2NY0B 2NMSA 1LK2B 3C8HA 4HUWB 3G5ZA 3FONB 4N1EA 4MXQC 4OKDA 3LEVL 2EDKA 5GGUB 3KLHD 3SKUD 3BN9D 4JRYA 4DQOH 4MJ2A 3ULVF 2ZCLH 4EDXA 2P24B 4R9HA 4Y19E 5KVDL 3CFDB 4NQVB 3ARDC 3MLYH 1FGNL 5INDA 4HULB 4PJ9D 2HWZH 3DECA 4XNXH 5FM5M 3T1FB 5I6XC 1J12A 2YXMA 3BSZH 4M4RA 1PSKH 3SE4A 3QWOA 3CDGB 1ZVYA 1VGEH 4IBLT 3SY0A 4LSTH 4JQVA 1A3LH 4XC1L 3X13A 1CT8A 1IBGL 5KVDH 3BQUD 1HI6B 3SGEI 1TDQA 1G7LB 3DSFH 2YBRB 4LGPB 5BW7A 5DJXA 4A2MA 1E0OB 2GYSA 3C5SA 4YZFE 4WVRA 5KSBF 5BOZG 3DARA 4QTIL 5JDSA 4E0RA 4OD2A 1C7SA 2OS7A 1EJOH 5DK2B 1CICC 1F00I 4OF7A 2AJSH 3E0GA 1OTTC 1KT2A 1VDGA 3VRJA 3MBEC 3EYQC 5MERB 1E6OL 4NQSB 2J8UF 4HW6A 5JPNA 4PG2C 3HPLA 1YPZF 5GGVL 2ESVB 4JY4B 4GAJH 1UWEH 3I84A 2ICWA 1JZ7A 3KPOA 3MGOA 2APFA 4KK8C 4P5TB 5T5FH 4I3RH 1F8TH 2D7TL 3UYRH 1NGZB 4U3XA 5IG7A 1TTUA 2E6PA 4OFVA 1BIHA 5GIRA 1GC1H 1C12B 4NJAL 4BH7B 2XNAA 3DMMC 1JPST 2NQCA 2H32H 4PRDB 3FFCB 3FN9A 2VQ1A 3FHQA 5CINL 3RP1A 1OTUC 5JOFA 3EOTL 4IRJC 3CPLB 5GGVH 5I1DA 3WO3B 3NAAL 2F5BH 5BZDB 1WTLA 4JFZL 2F53D 3JV0A 1U8PA 4K23H 4ZUUA 4UIKL 1S7TA 1JGEB 3EO0A 1IGMH 4ZDHB 3IVKB 2FD6L 5MEOA 1PDKA 5CINH 5HD8C 4XRCB 2C3HA 2BY3A 1PW3A 3C5JA 1I8KA 1QRND 2E3VA 3S36L 5EC1B 3QIUC 4ODXA 1CZ8L 2ICWI 1RMFH 3LB6D 3OKLA 2DIJA 4FFYH 3DX8B 1CLZL 5BS0E 4HFUL 1K8DB 4PP1D 4UIKH 2OR7A 2K3TA 3MRMA 4OSUH 4NRZA 4KRLB 3FRPG 4QHLB 1FNGA 4K3JH 4GMTL 4FQPA 2H8PA 1UACL 3TA3B 5F7FA 1JP5A 2OTWA 4R90L 4HSQA 3ZLQC 1F4YL 2X9WA 5GZNC 5CSGA 5IQ7H 1T80A 2XN9D 4X4ME 1CLZH 4O9HH 2HA1A 5J12C 2R29H 3ZHLA 4XB7A 5I73B 2MQ0A 3U0PA 5JQ6L 3HZYA 4NQXB 3WO4B 1DDHB 4JHBA 2X1PA 2VDMH 2G5BA 1NGQL 1OAZH 1U8KB 4QHNA 1SYSB 3QIWD 1I1CA 2JCCA 1F4YH 5FYLD 3I75A 1RURH 1UFUA 5EO1B 4LSSH 1WT5A 1X5KA 5GGSB 5JQ6H 4Y4KC 1CLCA 2DQJL 3U82B 5CJOH 3FB6A 4NM4L 3O4OC 4P57B 3WHE0 3F6IA 1MJ8H 4WUUD 1NGQH 3QUXA 5GGVY 2VDRL 1A6AA 5D1QD 2A83A 4JM2D 3FZUC 4ZS6D 1C7TA 4DVRH 3QEQA 4JJHA 4P4RA 3CGTA 3VXUB 1JFQH 4M6AA 2F19H 2CXKA 2VLJA 4QYOB 3SQOL 5IP4A 4NM4H 1P4LA 4HS3A 4PTTB 4G9FA 3QQ3A 4YXHL 1Y0LA 1BZ9A 1HYSC 1UEYA 3HKFA 2VDRH 3OQ3B 5FHBL 3WXWL 2CKBB 4H26A 4JO4L 3C8DA 4BH8A 4YIQB 3IAGC 5IB4B 3CUPA 4ONHB 3SDYH 1G0XA 4NFDA 1WV7T 5D2NE 3H0TB 5DUPH 4X6CB 3FQUA 5DJDB 1JTOA 15C8H 1UZ6E 3ZKND 2YKLL 4B7LA 3AM8A 5HHOE 2R1XB 4YXHH 4M6OL 1T20B 1JIBA 2ERJB 3X14B 3HNSL 4WHTB 1EO7A 4CADA 1P69B 4Z7VE 5F93C 5DS8B 1VHPA 4JO4H 3TIEA 4NM8L 3QO0B 1SBSL 2B5IC 4OI9A 3RVVD 4JO2H 4XPAL 1R5VA 2IC2A 5A1AA 3QQ4B 3IETA 1IKFH 4BK5A 3QZWB 2EXYC 1B0RB 1S7WA 3MUZ1 3NTCL 2YKLH 2AABH 4RGND 5D7LD 2GTWA 4PIRF 5IGXL 4ZOEA 1TTGA 5AYQA 4PJ9B 2IJ0C 3H3BC 3EYSL 4HJ0D 4PB9L 4JRYE 4PTUB 4U1HA 4G80B 4P4KC 3ARSA 2EDWA 4NM8H 3QR2A 1SBSH 4LCWD 4XPAH 3HI6H 4G42B 4CW1A 5DMGC 2R2HB 4HIJA 4X8XA 3BQUB 1MI5E 5FYKL 2APWA 2IAMA 1L7TL 2MOVA 2R1WB 3NTCH 4W6WB 5IGXH 4NCDA 3UTTA 4MJID 4JLRB 3RWJB 4LHUA 3IFPB 1ZEAL 1JMXA 2PTTA 4LKXB 2DD8H 4FZ8L 2CLVA 3SGEH 5KVEL 4HIXL 3OKNB 5EOCJ 3KJ6H 3H7BA 1EO8L 4OCSH 1QSEE 4PRAB 1URLA 4XPTL 3ULSA 2GK2A 3HNTH 1T89C 5BJTA 2X4UB 1X5XA 4U1NB 1VFBB 5TQ2L 2BSED 4HDIA 5B39A 1NGYA 1NCUA 5E00A 3L7FB 3JWOC 4NKQB 4GBXD 4UTBH 43CAB 3SKMA 3MLVL 4OQ1A 5HI4D 5KVEH 1DQTA 2VLKE 3U2SA 3P3YA 1B9ZA 3NIDE 3E8UL 3D1MC 5HGBB 5ITFB 1K4CA 1VSCA 4ZMAT 2HRPL 4S1SL 5TQ2H 1QLFB 3GMOA 2LV4A 4WV1A 1O0VA 4BSWB 43C9B 4CJ1A 4OZFG 2DWEB 3QCVH 3VWKA 4G8IA 5ICYB 1CWVA 5B3JE 4AEIL 2F53B 3BISA 5B38A 3ILPB 5GZOD 3B43A 4MD0B 3TBYB 1KCLA 3VFSA 3CLFL 4KJQC 2OTUB 3EOBA 4YH6A 3LPWA 1EVUA 4HPOH 3L9RA 2R0KH 3QH3B 3BPOC 3MZTA 3SO5A 4UUJB 4MS8C 4TUKH 3HC0A 6FABL 1QRNB 3SKNB 1N8ZB 3PV6B 1QG3A 5DFVD 2HFFB 4OLXL 4X6BB 5GSVB 4QHUA 1A4KA 2D31A 1TTFA 1U8NA 1S7VB 2GK0A 1CI5A 4M7JL 4M8QB 5D7KD 4Z76A 4RIRA 3PQYA 5GS2H 3U4BL 3CC5B 4ONOA 4Z5RA 4MZ3A 3MR9A 5EUKB 1KCSH 2R1YB 4YE4L 5F7LB 3BWUC 4LRIC 3RDTA 3U30B 4X7SL 5D2LE 1C5DB 3NIGE 4O2FB 4P0DA 2XN9B 1HWHB 4MCZB 1BEYL 4U1JA 3HR5B 1D5ZA 1Q9WA 5DI8B 1JGLH 1I9RL 3D5OF 1OSPL 1K4DA 1LO2H 2FJFA 5C08D 2EC9T 5AYUL 3U9PL 1AHWC 3TT3H 2UWEF 1JGDB 3N1MC 5LQBL 4KTDL 3G6DH 2DKMA 1P84K 1RZ7H 4M61A 2C7UB 2RFXA 1TNNA 4ZNCD 5KVFH 4R0LC 3QIWB 4FTVE 2YUWA 3P4NB 3ZT6A 4J6RL 4HWBA 4MQXC 4NZTH 3WJJC 2Z0BA 4MD4A 1G6RB 3QCUH 5IHBA 1H5BB 5FO9B 1HIMH 3KYOB 1EXUA 3DRTA 5FF6B 5AYUH 3U9PH 2JCCE 3ZL4L 4JANB 2E7HA 4WUUB 2I27N 3MXWL 4KTDH 4P2RA 5D1QB 4JM2B 4F7PA 1A7NL 5L2KD 4KK6D 4FQXD 2AEIT 2GTZB 4JQXC 3VGBA 4K9EH 4P23D 4KHXL 1B90A 3MFFB 3VFMA 3T2PA 3TEUA 3RX8A 1MQKH 4E5XB 1IAKB 2VABA 3QUKA 1PG7W 4AZ8A 2D7PA 3ZL4H 1MSPA 3O2DL 3ROOB 4DGVL 1BGXH 3OAUL 1S7RB 1I1AA 2VO5A 3FOLA 5ILTL 1JZ6A 1AXSB 1OTSD 2PXYA 1JWSB 4C83A 1I8MA 4KHXH 3F7RA 4PRBA 5F9OL 1FSKC 1RHHA 4Y5XB 4X5WB 5F71A 1ETZB 4EIGB 1CYGA 1Z5LB 3UO1L 1TENA 4O2EA 2A77H 3HE6B 1QLEH 4K94H 5C8JB 3L3DA 4IM8A 5KSAA 5DRZA 2GCYB 1KLFA 5MEND 4IHOB 1CIDA 3BZFB 3VXMA 1R5WA 1UH4A 2ICWJ 3HUJA 4PJHA 3KR3L 1NEZG 4OZGF 4FFVC 1CXHA 4M3KB 4LOUC 5GS0H 1FLRL 1NCCH 4WU5B 2PO6C 4RGNB 5D7LB 1N0LA 3UO1H 4HXAH 4ZUSB 1NMCC 3HAEA 3WLBA 1NEZB 4JFED 4KDVA 4RSVA 1FFPA 2EE3A 2BSSA 1GJIA 1CGVA 3N85L 4XNYH 4LCWB 4PB0H 2F9BT 3GO1H 3KPRE 1WCBA 3Q6GH 1MH5B 1I7TB 4JPVL 3KR3H 3LOWA 1KFAH 4JKLA 4ODUB 3K2UL 1ZLVH 4HK3N 5CSBA 4Y8AA 3CVHB 3GSVB 4MJIB 1TNMA 4K71B 4AM0B 1UC6A 3W5NA 5IIEA 1FZMB 4PG9B 2KDGA 1G9NC 5D1XC 4M7ZB 5GSRA 5C2BL 1OW0C 5HHNA 4RGOL 4RMSA 4U6XB 4PRHD 4JPVH 3WS3A 4JPKH 5HJ3A 2DIAA 4TYUA 3AVEA 4JFQB 2XTJD 5AZEL 3JSSA 5C7XL 1AJ7H 4Q7DA 2VYRE 5IVZA 4AENB 4X7DC 4YXLH 1IRAY 4X8JB 5JOEA 2V5YA 3MV9E 4PLKC 4GBXB 2NY5H 4K3HA 3FKUS 5C2BH 1LO3H 2EKSA 2VH5L 5GRVL 5BQ7A 2VAAA 4FXKB 1JPTL 4MJ6A 4WFFE 1RK1B 5EOTB 4F57H 3LRSA 4KWUA 3V5DA 1EMTL 1KLGB 1UH2A 3RUGA 2AK4D 5J06A 1B2WH 3T0VA 2QQKL 3KYNB 3WFCH 3OR6A 3RWCB 2VH5H 3HNVH 2FX8L 3TBSA 3NCEB 4M03A 3PGFL 5DLML 4MHHG 3TCLA 2E27L 4WI2A 1D5BA 3BKJL 1EMTH 1KJVA 3UXFA 4MJ5B 3NA9H 3BEWB 3GUTB 2QQKH 5BOPA 1MY7A 2ZKHH 4GKNB 4Z7QF 1ORSA 4RNRA 3WIHL 4PJ5A 2LAGB 3DUUA 5DLMH 2IALB 5C0CA 4Z0BL 4M02A 1RAMA 1F2XK 1P7KA 3BKJH 2HH0H 5A40E 3GSOB 4ZXBC 4EXPX 3M17A 3FO9A 4IOIB 1OGTA 3FQTA 1KNOA 1CLOL 1L7IH 4WTZA 3VXNB 4XVSL 4PJXA 1BOYA 1SVCP 5GJSH 5F21B 2BXYA 3AREC 2B1AL 3X3FH 2CIIB 3WIHH 3B3IB 3PQYE 4FRWA 3VH8A 4TNVF 5B4MD 4Y4FA 4UB0H 3SJVA 2EYTA 3G5YA 4FP8L 3RWGB 2AJZA 2VDLH 1S7XA 3WNLA 4Q6IC 5CEZE 5C08B 3NPSB 3HCVB 4P46C 5JMRA 1CLOH 3VXSD 1WICA 4XVTH 1DQQB 1FJ1B 3HRZA 2ARJQ 2AERT 1DBML 3SE8L 2R56H 3D2UA 4YHML 5AZ2H 1RJZB 5EN2B 2F74B 4PJAB 1NGWA 4L4VA 4FP8H 3LPGA 2Z35B 4RGMC 4PUBL 2G2RA 1IKNA 4JGUA 1KCRH 3V4VL 4QY8B 2VC2L 3SDDA 4LPYA 1NGPL 4EUPA 3SDCC 2EXWC 3MLXL 4HWEL 4PPTA 4QRTB 3MRBB 3JBG7 2EDHA 4XWGL 3WKML 4JKPH 5L2KB 3BJ91 4NO5B 1KYOK 1UWXH 2VKXA 4FQXB 1IM3B 1YEGL 3VDBA 3BIAX 1W72L 4P23B 2YA0A 5A16A 3G5XB 4M1CD 5KSUA 1HHHB 2ZZUT 3MRHA 4ZUVB 2FECL 1KIPB 5CEZH 5E4EC 3V4VH 1MCJA 4N0UB 5FKAB 1MCRA 1WBZB 3VDCA 1NGPH 2QQQA 3PL6D 4QXTA 3MLXH 4HWEH 3T4AA 3VMPA 2HT3D 4GW5A 1TPXB 2AJUH 5IROA 1HK6A 2CRYA 4YFLI 4XWGH 3T0BA 2EZ0D 4MGXA 4F2MB 3LS5L 3UP1A 3TT1L 4F15B 3OXSA 4PJEE 2I5YL 2VXUL 1TJGH 2D9CA 3GHBH 4BA8A 4KV5E 1YUHB 1T5WA 1MCWW 1GZPB 1I4FA 2BVOA 3IXAA 4WUKL 2MCG1 1BLNA 3BPNB 1KLUA 1F11A 2FEEI 1TZGL 3G6AA 4HWBH 2OSLA 2VTFA 3F7YA 5DQJB 1Y6MR 1NBZA 2AAVA 2FZ3A 4NPYA 1CFBA 3TT1H 3GHEH 3VD7A 5ICXB 5MENB 2A74B 4NQDE 1WEJL 4G8GE 3MCLH 4G6MH 3MJ8A 1FE8L 1QA9B 4HKZB 1P1ZA 1HZHL 1SEBA 5L7XL 5IHZB 3RY6C 3UJTH 2DKSA 5E94B 4YWGL 1TVBB 1T1WB 2ZNWA 3MOAL 4JFEB 1WFOA 4GRMA 2H32B 2UYLB 1HSBA 1WZKA 1TQBC 4JDVB 1AH1A 3RVTD 1AE6H 5T1KA 3E2HC 3BHBB 1OL0A 4IIQB 5IVNA 1J8HD 5LGKA 1HZHH 4LLUA 3GSQA 5DRWA 5L7XH 3GKZA 3Q1SL 1T03L 1UCBH 3MOAH 1UJ3B 4NQEE 5EWIL 2DJSA 3RL1B 3QHFH 3OG4B 2ZCKL 2DQTH 2DLEA 2X44D 3T0EE 4JQIL 5D1ZA 3PWVA 2AXGB 5I75B 3BESR 5J1AA 3QPQC 3S88L 4PRHB 5D5MF 2XTJB 5FHAL 5GISL 3SDXF 3C09C 1EBPA 3QG6A 4WI7A 3QJHB 2PR4L 2DS4A 4YC2C 1A2YA 5E7FA 1CFTB 3KXFA 2Z93B 4IS6A 1OP9A 4WENB 1ZT7A 1S9VA 3M1BA 3QNYB 1KC5L 4L3EE 1LDPL 4JFDE 4JQIH 1T04A 1A1MB 3NFNB 2VMFA 1ROWA 3TJEL 4E42A 5C71A 1NFDE 1N5YH 3SBWA 4X4XA 1U6AL 3BKYL 1QSZA 3PNWA 3G6JB 2AK4B 2DMCA 2Y23A 4W6XB 5EUOB 4YGVB 4HH9A 2Y5TA 1HHJA 3EJJX 5I2IB 2QADD 1YY9D 2J4WL 3I85A 1KC5H 4L8SA 4X7CC 1RZIB 1P7QA 1BMGA 1U8MA 3BZ4B 2Y6SD 5IFHL 5ID0A 3CZFA 2WUCH 1XF2B 1YNTB 4TOYH 4LIQE 4XP9H 1U6AH 3RNKB 4RMVA 5C0BA 4MB5A 4Q9QL 3RIAK 5CJQH 4JZJA 5IVXF 1CIUA 3UTQB 5DJ8B 7CGTA 2R9HC 4XCEA 3VXQB 4XMLH 3O9WA 4FG6C 4MXWH 4FXGA 5IFHH 2PUQT 1T6VN 4X6EB 4LIQL 2D7MA 5CBAB 2VLMD 4I18B 5E1AA 4K3GA 2ITCA 4GKZB 4LSRH 2W65B 3GEWB 3MNZB 4HKJA 2PTUA 1R24A 2FJHB 4GAGH 4HZLB 1ERNA 4HQQL 4Z7UE 1NQBA 2ZUSA 3QQ9D 5J9PA 1D5XB 5CUSH 1NDMB 1PEZA 5LBSH 1N64H 1S9XA 1H3GA 5BV7B 2YMXL 1FZJB 1S7QA 3OXRB 3VXSB 1DBAL 5GRUL 1MFEL 2ZG3A 2C4FT 4TPRL 2C3VA 4QKXB 3SJVE 1A9EA 4AT6B 4XHJC 2WIIB 2WW8A 2A1WH 4QRUA 4M6NH 3AMKA 4LAQL 4D0DA 3B83A 3ZDZF 1PYWA 1T1YB 1DN2A 1CE6B 1E4WH 2VERN 2M2DA 1LP9F 5HHVL 1XR8B 4N90E 1T5XA 5TH2B 3UPRB 1DBKL 4Y5YA 2OJEB 3CU7A 2BDNH 4P99A 2HLAB 1FL3A 4EI5C 2OMNA 5GRUH 1MFEH 3O3BB 3ZE2E 4R26L 1M7IA 3QUXD 3UZVB 2YPVL 5GS0D 4XCYB 3I02A 1FIGL 3W39A 1FRGL 4XXDA 3QEQD 4P2QA 1FQ9C 3GB7B 5ID1B 3NH7L 5GJTL 4V1DE 1INEL 5MP6H 2VLJD 3U7WH 4S2SB 2Q6WA 1K3ZA 2K1MA 1IGIL 4WU7A 3RY5A 4LEXH 3QXUA 3PL6B 4G9FD 5CEYA 5JIKA 1J10A 3WS6C 4QRQB 1G9ML 3KNBA 5E08L 5HYJE 1FIGH 1U8IB 4LSPL 4LLQA 1U92B 3VE0A 4P49A 2XIDA 1TITA 4UNTA 3NH7H 1HHKA 5GJTH 4XTRC 3JV4A 3TBTB 2V17H 2YOCA 1P6AB 1TJHL 1U91A 4GKSB 3KDMA 3NZHH 5D8JH 3G5ZB 4JJ5A 1KCUL 2IQ9H 4HLJA 3ARDA 4PJDA 2D4FA 2A6DB 5DZLA 1AXIB 3AGVA 3PJSA 3V6FA 1NBQA 3QRGL 4F9LC 5KW9L 4EDXB 1CXLA 3VI4E 1BHGA 5EZOH 1IGJA 1A7QH 5FDYA 1CDBA 5E99L 4K3EH 4HCRL 5DDHB 1Z0MA 1WITA 3GMNA 1KCUH 4K2UH 2NY4D 4UTAL 5I0ZA 5KTEH 5FCUH 3O6MH 5DK0A 5MEQA 3K1KC 3QWOB 3H9SE 3DURA 3SY0B 4YBQC 4QRSA 2EYSA 1F4XH 4IMLA 3X13B 4DZ8A 25C8H 4YHYC 1EEUA 2NXYD 5DEZA 4JGMA 1C5BL 2IAMD 2HP4A 3QJFA 1J8HB 3PDDA 5E99H 5I8EA 1IMHC 1VEMA 3C87A 2WINA 1OD7A 3UTTD 1MHCA 1V7NL 5DJXB 4JKKA 4Z95H 2LQRA 4LHUD 3NCFB 4QTHA 4ZAKC 3TC9A 1EAPA 5CGTA 2PW1A 1JK8A 4MQSB 2QQNH 2YEZA 1D6EA 3MBEA 3F6LA 5JDSB 4ONFH 5LKNA 4E0RB 1F4WH 1L0XA 2BVQA 2MCPL 4RMRA 2E6QA 4LP4A 1U41A 4PG2A 2M8XA 4JFOA 5DD3L 3U1SL 1C5BH 5E2VH 4LEOA 1T2XA 3MO1A 4CVUA 1KIQA 2CK0L 3QEHA 2RBLA 4R2GD 4X80H 3NBNA 4HUVA 3L3KB 5JPNB 1AO7A 3UC0H 5K9QG 1FYTE 3HPLB 3NIFE 3DMMA 4OZIE 1C16A 2ICWB 3KPOB 3MGOB 3WUZA 2FB4H 2R39A 4OIIL 4IRJA 1CR9L 5DD3H 3MREA 4GS7B 5GIRB 1EEQA 1KEGH 1JGUH 3MMEA 5MI0B 3VG0L 1ZGLM 2VXTL 5IFJA 1K9TA 3GDBA 2VQ1B 1HDMA 3VWKD 5JOFB 3OBAA 2QADB 3MSPA 3ZSSA 3S35L 5T3ZE 4HPYL 5I1DB 3WIFA 1JZ4A 2B0SL 2FH6A 1GOFA 1U8PB 3BRFA 4OIIH 1HHIA 5CSZA 4RDQG 4HLZH 1IM9A 4GXUN 4M9PA 4ZUUB 5L9DH 4D3CL 1S7TB 1M7DB 4ISVA 3QIUA 3EO0B 4U1IA 4HIEA 4BFEA 3WNKA 2BK8A 5IFAL 3H3KA 1RZKH 4XP1H 3C5JB 1I8KB 3S35H 1MFCL 4GKOA 1LHZA 4WNQB 4KKAD 3RTQC 5DRXA 4AQOA 2YD2A 4ODXB 1GAFL 3EYUL 3OKLB 4XPBL 5SWZE 4QOKA 4HIHA 3UTSE 1NJ9A 1AIFA 4D3CH 1H3WM 3MRMB 1FC1A 3FAXA 5E2UH 4NRZB 2B2XL 3H9HA 1FNGB 2E7BA 4PGBA 1T4KA 4F8QA 1I9EA 3MV8E 1UM4L 5T3ZH 1CVSC 3RDTD 3P11H 3AY4C 4G8EA 4WFGD 4XPBH 4ZO6A 3VU2A 1DANT 3TYGL 1WTGT 4R6UA 4NZUL 1Q9KA 4I9WD 3U0PB 1KXTB 3HZYB 4RFOH 1XFPA 3MJ7B 3VMOA 2B2XH 2P8PA 1OT2A 2P49B 2G5BB 1GIGH 3B9VA 4Y4KA 3Q6FA 1EHNA 4QHNB 2A2QT 5ISZA 3ABZA 3QIBC 4XWOC 4APQD 1S7SB 3I75B 1A7RH 3TYGH 2ZJSH 3WSQL 1KF9B 2J3SA 4NZRH 5FGCE 1RUKL 2HT4D 3FB6B 5GRVK 1I9IH 1VFAA 1PG7H 1RVFH 3QUXB 4P2RD 2NY2D 5HHQA 1OOAA 1A6AB 5CZVH 4O02L 4ZPTA 2A83B 4OBSA 3S96A 4H8WH 4ZTOL 1T1ZA 1Z3GL 1G7MB 4OGZA 4U6YA 3A67H 1NCBL 3PP4L 4KKCD 3QEQB 4P4RB 1OAQH 4WW2B 2P45B 2QJDA 2CLZA 1A3RL 3KLAA 4LSDA 2VLJB 2ICCA 4ZO8A 5EORH 2OL3A 1ORQA 1P4LB 3BI9X 4HS3B 2P5EA 4X6CF 7FABL 4G9FB 3QQ3B 1Y0LB 1BZ9B 1J7VR 5CP3H 1I1AD 2VISA 3QEGL 1ZSDA 4H26B 4BH8B 2W0LA 3QYCA 2PXYD 4POUB 4DTGL 2CUHA 1U2HA 3B5HA 5T5NG 1A3RH 1NUDA 3FQUB 4PJFE 1QPXA 1JF5A 2X9YA 3HTLX 4WI8A 4BFIA 5E6ZA 5C09A 3T0DA 4M48H 1H3TA 1KN2H 7FABH 2GJZA 5F72S 3L7EA 3JWDH 1AQDA 3IT8D 4L1DA 3MTRA 2PNDA 4C55A 4M6ML 3TIEB 1EH9A 5EA0H 5KSAD 2X1WL 5E8NA 3ULUC 4P3WA 5EOCL 4HFWA 1B3JA 5LGJB 2FX9H 3ZDYF 3VXMD 2EDXA 3VFOB 1PLGL 3IETB 4P4KA 4Z0XA 2AXFA 1S7WB 3JXAA 2DQIL 4GG6B 4PJDE 2JK5A 2EE9A 2BVPA 4GMSL 1S3KH 3BUYA 1K85A 4F3FA 2NY4B 4EJ1C 2FHBA 2MKWA 4M6MH 2NPLX 4LHUG 4DKDC 2VQTA 4OB5L 3E1F1 5FUCE 5HVWA 4CW1B 2NXYB 4HIJB 1JVKA 1L9MA 4HAFA 5J0BA 3ARUA 2IAMB 3V95A 5BV7L 2AK1H 1XCQA 1NCNA 4LMQI 1N6UA 4LSQH 3UTTB 1NCAL 4OF8A 4LHUB 3R0NA 3BGFB 1T89A 2PTTB 1LD9B 2CLVB 4Y16C 5B39G 2NY1C 5CD5C 3H7BB 1VEOA 3D48R 3ULSB 2VSCA 4CKVX 1J0HA 3MA7A 4NC0B 4KI5D 2Q87A 1AY1L 3V5HA 5BJTB 2O61A 5DQ9A 4Z6AT 5CCKL 1DUZA 3FQRA 1KJ2A 4X4ZA 1O5DT 5CJ8A 5HHMD 5SX5K 4HDIB 5B39B 2HKFL 3UTPE 4R2GB 1NGYB 5E00B 3LQAC 2BC4A 4LPTA 5ACLA 1ZTXH 3SKMB 1AQKH 2DIBA 1KEMH 2X6MA 3TVMC 3EFDL 3U2SB 2XQBL 1E6JL 3EYFA 3MZGB 3VFGL 3LN9A 1AY1H 2UY7A 2A6IA 3O41B 2ZUQC 4YEFA 1ZGLP 3GMOB 1KJ3L 3OPZL 1AO7E 5B38G 5LWYL 4WV1B 1MCNA 1N0XH 2BJMH 4KUZH 3P0GB 3T0WA 4PBWD 2VN4A 5J7CC 3VWKB 3PWNA 4G8IB 4PR5A 3BW9A 1IAMA 2NY3D 2VLRE 2XZCL 2A9ML 3SOBL 1AGBA 3WDIA 4OTXL 2XQBH 4PY7B 4BZ1L 3S3PA 5B38B 4NKDB 3MRJA 4MWFA 1MWAA 3C60C 3PDOA 2FYYA 3EOBB 2W60B 4OZHA 3MV7D 1FNAA 3L9RB 4G5ZL 4TTDD 4PJIE 5DD1H 4B0MM 4JZOA 1VFOA 3OF6A 3SOBH 3HC0B 4I77L 2NZIA 5I8OH 4PJ5D 2JJWA 3GBNL 5C0CD 5E5RB 4QHUB 3FCTA 4LRIA 3K2MC 2HMIC 1U8NB 2GK0B 4POZC 3S5LA 4M62L 2I25N 5HPMB 3IU4H 12E8H 5C0GA 1KENH 4Z5RB 3MR9B 1AGCA 1LEIB 3RDTB 3ZE1E 2CK2A 3V5KA 3F5WA 4H88L 3W11D 2BHUA 3IDGA 5A2KH 1LE5A 1AHWA 2CRZA 2DQUL 2QSCH 1WFTA 4Y4FD 4K8RC 4NKIL 4U1JB 2HN7A 5DHYA 4ZFOA 1Q9WB 3KPMA 5E56A 5GGQH 4GG8A 4J3TA 1K4DB 4R0LA 4XH2A 3FMGH 2FJFB 5DQDL 4NNYA 5EB9A 4ZUTA 4LSUL 4NUJB 3UJIL 3WJJA 3MRDB 5DRNA 4URTB 1JBJA 2JIXA 3V7MA 4M61B 2RFXB 4IDLA 3RWEA 1HXMA 4HC1A 4APQB 5I1KL 3V0WH 1FV1A 3JVGC 4OLEA 4W81A 5L6YL 1MHPH 4L4VD 4TVPE 4GFTB 4MD4B 1TFHA 1QYGL 5CLTA 1EHXA 4JQXA 5DQDH 1J8KA 2GSGA 4N5UA 3SDDD 5HSFA 3ZYJA 3UJIH 2XPGA 1FCCA 1NL0L 4OQTA 4P2RB 2CIKB 2NY2B 2AJYH 5DC0A 1FIEA 1UM6H 1NFIA 3HC4H 2H45A 2MQCA 4F7PB 3OKYA 4A6YA 5DVNA 5CMAA 2IANE 4HKXB 3RWIA 5DHXB 3S6CA 5F3BA 5K9OB 1KTLB 3BH9A 3RU8H 3VFMB 4MD5A 3WFBL 5D96C 3X12A 4UQ2A 5E8DL 2VABB 5I1EL 3D39A 3QUKB 4QLRA 5FOBA 1U8HA 3MXVH 2HG5A 1FORH 1J5OL 4KQ3H 1I1AB 5ADOL 2CH8A 4BKLB 5GS1C 5DYOB 3T2NL 3UROR 1QSFD 2PXYB 4C83B 4JFFA 1I8MB 4TVPH 4HJJL 5JR1L 4PRBB 1BAFL 1RHHB 3O2WL 4LF3B 4MA1C 1LO5B 3EDEA 1JPSH 4NOBA 4KKLD 2DI7A 4O2EB 4H5SA 4X5LA 5ADOH 4OCXH 2PO6A 3STBA 3K46A 2FO4A 4ELMF 5C0ND 5KSAB 5DRZB 3L3HA 1EUTA 5HDBE 4R97C 4S1QH 5TDOB 2W9DL 3HAEG 3O81A 1R5WB 5C09E 4L3CA 3HUJB 4PJHB 4ZPVA 3L5XL 5F7EH 3O2WH 1YNKL 3DVNA 3UPAA 5HTSA 1B4JH 1J87A 3HAEB 5DR5L 2W07A 3WLBB 1CE1L 2BSSB 3OTTA 3AAZA 2OL3H 2DL9A 2Y07L 4K3DH 1WCBB 3L5XH 3HMWL 5D1XA 5T1KD 3WN5C 3C5ZD 1OW0A 2XA3A 3EIFA 4NDMA 5SWSD 1MCCA 1R0AH 3MPCA 5JPMA 4LCYA 2AJ3A 5IIEB 2M1KA 1YYLH 1CE1H 1XZ0A 1KPRA 1WSST 1GC1C 5HHNB 5D1ZD 1BQHA 4M5YL 2COQA 4LLDA 1DSFH 2FRGP 5JUEL 3WS3B 2IPTL 2X4RA 1S7UA 3SEPA 5IK3A 3AB0C 4LVOB 4PJGE 5HHMB 4BZ2L 5DT1L 4FZEH 1C08A 2ARJA 3KXFD 3RIFF 3H9YA 1NUGA 4BUGA 3QUYC 2H1PH 5BQ7B 3ECBA 2VAAB 5EIQA 4MJ6B 5F1NA 3JV6A 2VL5A 2ZUYA 3LRSB 3RL2B 1YNLL 1XT5A 1TQCC 1AFVL 3V5DB 3GMRA 3RUGB 1IEHA 5I1HL 3F7QA 3ZE0E 2JJSC 3GJEA 3D3VA 4N9GA 2NY3B 2H2SD 3OR6B 5JHDD 1F90H 5D6CA 1P7QD 4WO4C 4I48A 3TBSB 3ZTNH 4JM4L 3LD8B 1XF4B 2HVJA 1TETL 3T77B 3DJ9A 1KTRL 4L4JA 4YDIL 1DQDL 1RJCA 3RPIA 3TCLB 1D5BB 2IFGA 1LE9A 4PYHA 4HBCH 4QXGL 5C0BD 5L88L 2R2EA 4KRPC 2YD5A 1KJVB 5FDWB 3MV7B 4ODWA 4LDOB 4FQJL 2ICES 1F4AA 4JDTH 3DXAE 1DTUA 1NC4A 1OAYL 4LLWA 3PWPE 3QDAA 2ENYA 4UBDD 1F3JA 4KROC 4QRPA 3GSXA 1YYML 4N0RA 4OGYL 4ZXBA 5KVGH 5TPWH 5HHPA 1ORSB 4X5XA 3RVWC 4AL8L 3HFML 4XPGH 2WZPD 4PJ5B 2F58L 4WTZG 3DUUB 4XX1G 5C0CB 4YDIH 5KG9A 5BZWA 2HRLA 3LMJH 1P7KB 1CK0H 2BHZA 3IDYC 3M17B 4MMXC 3AREA 1I3UA 3FO9B 3QA3A 2VITA 1OGTB 2CMRL 3VH8G 3FQTB 1KNOB 1OAYH 4GRLC 2H9GA 2VDQL 4OIAA 5ANMA 4PJXB 3ALWA 3HG1D 1YYMH 1X4ZA 3ZYZA 4PJBA 2YPLE 4Q6IA 2NX5A 3E6HA 4P46A 1AI1H 1KB9J 3VH8B 4Y4FB 4M43H 3S3SA 4DUWA 2AJZB 3DVFA 4GSDH 2XWTA 3IU3A 5E9DA 4PJAF 3QDHA 4FQLL 1UENA 2R15A 1QFHA 4AG4H 3FRUA 3BP5A 2VDQH 2QR0B 5HBBA 3GIVA 3HRZB 1MWAH 4OFKA 3O11B 4CN6A 4JRXB 2Y36L 4XBGA 4JHAH 3FN0L 2OMBA 2F8OA 4WFED 1PY9A 4EUPG 1BOGA 3WFHA 4QNPE 2GJ6A 3SDCA 4IOFD 5HYEA 2HT2D 4JRWA 1NGWB 4L4VB 1AP2B 1QEWA 5J89A 5EC2A 5J8OA 3FT2A 3QDJE 2G2RB 1WISA 5BXFA 2VLLA 2VUOA 5TE7L 3SDDB 4LGSB 4EUPB 1G7IB 2DJ4A 4FQCL 4RBPH 1Y18A 5GRJH 5LXGH 4DZBB 2Y36H 3FN0H 1KB5A 3G04A 4D9LH 3I6LE 4DEPB 4QHMA 2B4CL 4P2QD 1YEHL 2EDLA 1FO0L 5KSUB 2A73A 3MRHB 3QNXB 1I7ZA 1MVUA 1UQSA 2VDOL 5F3HA 4YDLB 1CXEA 2DLIA 4QXTB 4AH2B 3T4AB 5I18H 4GW5B 4WY7H 5IM7A 1U9KA 4LVNC 3OXSB 5F9JA 1QSFB 4NQCD 3RHWK 1BIIA 1FO0H 1ZA6A 3IFLL 4B53A 1I4FB 3IXAB 3TV3H 5IHUL 3J7HA 1BLNB 2HJFA 1S9WA 2BP3A 4RAVA 1KLUB 5BMFL 4HC1H 1IGFL 1F11B 4UT6L 4WGWB 2KQMA 3G6AB 3LHPL 5D2NC 3F7YB 5IT2H 1NBZB 3V7AE 4NHCL 5EIIB 2FZ3B 4QRRA 3ARDD 4YX2L 1MFDH 3RY6A 1F4HA 2LU3A 5C07D 4P5MA 2BNUA 4TRPL 5ITBL 4OQTH 3KLSA 5DO2C 1QBLL 3EW3B 3MJ8B 5IHUH 1P1ZB 3GBML 2R23B 4NKOA 4A6YH 3SCMC 4NWTH 3B2VL 4XCFH 1ES0A 4NHCH 1U8OA 4GRMB 3W0WA 5DSCA 4Z7NF 2Z31C 1HSBB 1MFBL 4NCC2 1T1XA 3VXPB 5T1KB 5FYJU 3C5ZB 2CDFA 5I74B 3GBMH 3GSQB 4HZAA 4LLUB 2C3GA 5SWSB 1FDLH 2ZPKL 4FN0A 5DGQA 1CICD 1B6DA 4KHTH 4IMKC 1OTTD 3VFNB 3VFWA 1DLFL 1T21A 3MBED 3EYQD 1LDSA 1J1XH 1MCPL 5D1ZB 2AXJA 3PWVB 4U2YA 3MYZA 4JREB 5J1AB 1T66C 3L3GA 4TULL 4OCYL 3AS1A 5CBEA 3WJLC 4D9RD 4PGCA 2LAAA 5KJRL 1A6TA 4KK8D 3WFEL 3BYTA 1GRWA 1A2YB 4OLUH 2VWEE 2VDKH 3G6JF 5IBUG 3KXFB 1AO7D 4IS6B 1FVEB 1H0DA 1ZT7B 2C9AA 1IAIM 5EUOF 3M1BB 4Z7OE 1MCPH 1T04B 2AEQH 4PJCA 5KSBB 1OTUD 5CILL 2AV7A 1DL7H 4TULH 4IRJD 4E42B 4XP6H 4X4XB 5DC9B 2LABA 4XNUL 3QG7L 2OX5A 1KBGH 3TN0C 5IBUB 1KACB 3ARTA 3PNWB 4TN9A 3TF7C 2FCBA 2XOTA 3DX7A 3EKCA 5C9JB 4N0CC 2DM3A 2O5YH 2Y5TB 1HHJB 5EOQL 3IDUA 1G9NH 1JWUA 2OCFD 3CH8A 3IKKA 3N9GH 5JHDB 4FS0A 2EC9U 4L8SB 2X4QA 3C2SA 1P7QB 4PGEA 1OARL 1ONQA 1U8MB 5HD8D 3CZFB 5ID0B 1YPZB 4ZSOE 1IM9D 4MVBC 5C0BB 2X09A 4Y1AA 4QWWC 2W0FA 1U3ZA 2ORBL 2BNQE 4YHNA 1YEIL 2J5LC 4JZJB 1PZUB 3HC3L 3V8CA 3GMMA 4XCEB 3T04D 1FN4A 1BFVH 4FXGB 4Y0GA 4QOKD 3FHAA 4ZFGL 1BVKA 5ETUA 1RZJL 1ZHNA 5A2IH 2R0ZL 2X9XA 1I3VA 1KELH 2J88H 2AGJL 5E1AB 4U3CA 2QQLH 2ITCB 5GZND 2ORBH 1MUJA 2AVGA 3BX7C 3MGTA 4OKVA 1R24B 5D9SB 3HG1B 4KZDL 3TM6A 3D25A 2RCSL 5J9PB 3H3PL 3NFSH 4JFPA 3V52H 3DROA 2XY2A 1CDCA 1S9XB 4IJ3C 2IH1B 1DUYA 2AGJH 5DURD 4HG4J 2NLJB 1NDGA 1NGXA 5DWUH 1JYNA 1S7QB 4V2BA 3K4DA 4PJBE 2FBJH 3BD5A 1QLRA 3IKCA 1ZLSL 3OZ9H 4Y4KD 5CJ5A 5ISZD 1NCDH 4EI5A 1JNHA 5E9DE 4JY5H 4WI3A 4D0DB 1MIEH 1PYWB 3QISA 4ZOCA 4HS6A 1RZFL 1T5XB 3S8WA 4Y5YB 1DQLH 4I2XA 2D7OA 1XGTA 1FL3B 2Q8AL 3JTSA 3O6KL 2UVFA 2XZAL 4HUUA 3IJHA 4DGYH 1X5GA 3CXHK 4LASL 4MAUL 4XXDB 4P2QB 1HYSD 4QT5A 2MNUA 3WS6A 4ZQKA 5DD5L 5LG1A 4Y5VC 4Z7WA 1BWMA 4K94C 4HUKB 2Q6WB 1YMME 4WU7B 3QUMA 2Q8AH 2P5ED 3DV6A 1BD2A 5CEYB 4CDGC 3PGDB 5IB1A 5DTFA 5KBNC 4LLQB 5MHSE 3VE0B 4JO3L 4MAUH 2PF6A 3X11B 5JHLL 4NQCB 5K9JH 2BY0A 1I3GH 4O4YL 1HHKB 5E0QA 3JV4B 4QEGA 1XGUA 5HI5C 1U91B 3KDMB 1JN6A 2CR3A 1DE4A 3MLSH 4JJ5B 1WZ1H 4F9LA 4JFHE 3GMLA 1TZHA 5JW4Q 2EXYD 1CTNA 1DQMH 3ARDB 3CX5K 4LPUA 4JO3H 3IRPX 1U36A 1IAII 1D9KC 1E28A 5C07B 3V4PH 5I6XB 3PJSB 4ONGL 4JFXA 4AMKH 4P4KD 4RWYH 1VFUA 2X1XR 5EU3B 1NLBL 2K9UA 1KB5H 4QRRE 3TA3C 4KPHH 4J1UA 5DMGD 3MJ6A 4L8BB 2FX7L 4OM1H 4F37F 1MCDA 5DK0B 4FNLL 3DURB 2WM0A 2VR4A 2EYSB 4IMLB 1P6FA 4ZAKA 1NLDL 1K6QH 1Z9OA 2ADIA 1IQDA 3QJFB 2NY5C 4NJ9L 1L6XA 3CAFA 3DI3B 5I66A 2CGRL 1FFNA 1CICB 4MMZC 4QTHB 1EAPB 2PW1B 3MLZL 1JK8B 2DM7A 2YEZB 1D6EB 3MBEB 3TBWA 1NBVL 3GSRA 1IGYA 5ACZB 3FOMB 1C1EH 5IBTH 2BVQB 1NLDH 2HTKC 4X6DA 4CBPA 3MOQA 1KCVH 3BZEA 4LEOB 1ZV5A 3MO1B 1OVZA 2D0HA 2K7PA 4M3JA 2CGRH 2G5RA 3QEHB 4HUVB 5F1KC 1AO7B 1RIHL 1C16B 5E8OA 1N5AA 4G9DA 3EOAA 3LN4A 5A3IC 1EGJA 4NBZB 1C5CL 4JHWL 4IRJB 4Y4HC 2I9TB 1ZA3A 3MREB 3MMEB 4U0RC 4WTXA 1WWBX 5AWNL 5IFJB 1A4JA 5FKPA 1O7VA 4PJCE 3DO7A 2HLFC 3W2DL 4O2CA 1OAXL 1RIHH 4F9PC 1NAMA 2XWBA 3WIFB 4D0CA 3OJDA 3FO0L 4WFHD 5ICZA 4RDQF 1HHIB 5CSZB 4Q0XH 1IM9B 4MS8D 4NO0A 1MRCH 5JORA 3TNNA 4ISVB 3RTQA 2V9RA 4U1IB 4NQTA 4HIEB 5I1AA 3NIGF 3L6FA 4F8TA 3BO8B 1QBMH 4X9IA 3T3PE 1TLKA 3OF6D 3BN9C 2VXQH 3PGCB 1MJUH 1A8JH 1ND0B 5DRXB 1ZLWH 4QOKB 4HIHB 4ODTL 1INDL 1NJ9B 4YHKL 3B5GA 2P5WE 3AY4A 1EFXA 1J1OL 1F45A 1MCEA 1VEPA 1EAJA 2HFEA 1Q0YL 1U93A 4G8EB 3S7GA 3T1WA 2EKJA 3O3DA 1EFQA 4W6YB 4YJZL 1U8JA 4GJTB 1OB1A 1RIUL 3UTZA 1RULL 2P8MB 1INDH 3ZSTA 1Q9KB 4I4WA 2JCCF 2FJGA 3CDCA 5DURB 3QIBA 5DMIL 2DQHL 1QHPA 2HTLC 2P8PB 4N8VA 5F6IC 3ULVL 4MQXD 1JNNL 1FBIH 3HS0B 1Q0YH 2JIXD 2DDQL 4Y4KB 1SJHA 4ORZC 5ISZB 3O3EA 4JB9H 3O4OB 1YN6A 4MNQD 2GAZA 3V0AC 4HF5L 4M1DL 3P9MA 2G60L 5FYJD 4XGZB 2XI9A 3FQNB 1GGTA 1QKZH 5SX4I 1W0YT 3DBXB 4NIKB 4X0KB 3EGSB 4HHAA 1JNNH 1SEQH 5HGAB 5HVFB 2VJXA 4ZPTB 2OJZH 3PABB 1HKLL 2J1KA 3MRFA 2NTFA 4S1RL 3S96B 1T1ZB 3DGGB 4I8DA 4U6YB 4MNGA 5EU5B 2P4AB 2IBZY 4XVJH 4I2XE 4HKBA 2J8UE 4UQ3A 2CLZB 4DKFL 2EDQA 5C86A 3KLAB 2V6HA 2I07A 1A7PL 5EZIL 3FB5A 5DUBA 5FK9A 3D39D 2OL3B 1ORQB 1F6AA 3LY6A 2P5EB 5TE6L 1P5UA 2VISB 2YWYA 1HKLH 4JR9H 5FFLA 4GQ9L 4PV9B 4S1RH 1ZSDB 5IB2A 2UZYB 1JTPA 4FQQA 4JVUA 1WWAX 1RIVH 3OJVC 4JFFD 3U0WL 5T5NF 1Z9LA 1UYWH 3JUYA 4FFWD 1A7PH 3GSNA 2YUXA 2OI9C 4QXUL 4J3WA 1XGYL 2B5IB 4BFIB 1EV2E 5KS9A 1IEBA 4CVWA 5ENWA 2VDNL 3ARBD 4XBEH 3L7EB 5JOPE 1D3CA 2YD6A 1AQDB 3LKSB 5TE6H 4LOUD 2PO6D 1F3DH 5E8NB 4HFWB 4YBHA 3LKNA 4J3UA 5GRWA 1MPAL 3GRWA 4DN4H 4P4KB 4Z0XB 1OM3L 2IQAA 2AXFB 4QXUH 1BECA 1R3JA 2JK5B 4EQ2A 2BVPB 3WFDH 3O4LA 1GHFL 5LGHL 3QDGA 3BUYB 5ECJE 4F3FB 2F54E 2V9QA 1UB5A 4KJWD 2DICA 4UT9H 1T0PB 5F89A 3MACH 3RVXC 4OUOA 3HR6A 2YK1L 3QUMH 3ZKQD 1MPAH 4N0YH 5CD3A 4PD4K 5D1XD 4KMTL 3KHQA 1RUAH 3CZJA 5GRZA 1OM3H 3QUZC 1I3RA 1XCQB 2FR4A 2Y72A 5GGRA 4OZGB 1IZKA 3K1DA 2YN5A 1H3XA 5TQ0L 1J0IA 1LVEA 4X4YA 3KAAA 4UILH 2CKNA 5D7IE 5E1HB 1T83C 2SEBA 5HGGS 4PLKD 3KWWA 3V5HB 2O61B 4NUGH 3TVMA 1DUZB 3FQRB 1KJ2B 3T0EC 2XRAL 1FNSL 1NMBH 1V8HA 4ZNEA 4JM2C 3TJHC 3OGOE 2BC4B 3N1QC 1A1NA 4X6DE 5J6GA 2FDBP 5CZXC 2O5ZH 1OAKL 4H20H 1ED3A 3EYFB 2DBLL 3UBXA 2Y06H 3C9NA 3GSWA 3UZQA 1JHKL 5FAAA 1JE6A 1Q9OA 4BM7A 1PJ9A 3U48A 4DOHB 2OP4L 3C60A 3D3VD 2NNAA 3PWNB 4PR5B 3UMTA 3BW9B 4Y2DC 4ODSH 1AGBB 1I8LC 1A0QL 5C0AA 1CDIA 1FL5A 1MJJA 4KI1A 2EDNA 3MRJB 3BPOB 1FNFA 1MWAB 4N5EC 3PDOB 4R4NC 4BELD 4F7CA 4XT1C 1T2QL 1SBBA 3HE6C 4OZHB 4PRIE 1F3DJ 1V3KA 2DLHA 3WHE1 3S37H 1X5FA 2QHRH 3GGWA 5DJ2A 3S5LG 4JZOB 4QRPD 4JN1L 1L9NA 2NR6C 4ZXBD 5JTWA 4XP4L 3VXOA 1XCTA 1M6OA 3UBXI 1MCKA 2YRLA 4O58H 5IEHA 2EO9A 2OR9L 3P77A 5TDPA 3S5LB 2EDYA 3BP4B 1T2QH 3QCTL 4OF0A 3RI5F 1CLYL 2PYEA 1VFMA 5C0GB 2YD8A 3ZTJH 4MQ7A 4CRPA 1AGCB 1EGJH 3WV0A 1MHEA 3V5KB 4XP4H 3F5WB 3X3GL 2NX5D 3WHXB 4XZUA 4P46D 1BJ1H 1LE5B 1AHWB 3F7PC 4YXKL 4ZFOB 4FQ1L 2HN7B 4U7SA 5DHYB 3KPMB 4GG8B 4HK0A 2XKSA 4LU5H 4R0LB 4XH2B 3R8QA 3DUHA 3QCTH 1IJ9A 3BVNA 1NAMH 4ZUWA 3JVGA 3IGAA 5I30L 4NNYB 5BRZA 1YJDL 4ZUTB 1TCRB 4ORGA 1RU9L 5DRNB 2ED9A 3RX7A 1NSNL 2B8OT 3GM0A 2JIXB 1IZJA 3KPLA 2X7LA 3FN3A 3X3GH 5IV2A 3RWEB 1IFHL 1HILA 2GJ6D 4WEBH 1VCAA 2EXWD 4MNQB 4FQ1H 3O8XC 2V2TB 4BQBA 4KJYA 1GGIH 1IILE 4U7KA 3IFNL 4PS4L 4P3CH 1YJDH 4JPWL 1RU9H 3VXRE 4YDJA 1NSNH 1LGVA 2EIZA 2R0WH 4WDIB 2IGFH 3EYOA 2AJXH 1GGCH 4A6YB 4WWKC 1SY6L 1E4XI 1IFHH 5CMAB 5SX4H 3RWIB 1WAAA 3I50L 4KMLB 1O7SA 2FLBT 5F3BB 5FB8B 1Q0XL 1UXSB 5ELIA 3BH9B 3EFFA 3D85A 5I1JL 4DJMA 3EJYC 4MD5B 5GS1A 5A2FA 4DUXA 3X12B 5CHNA 3IFNH 1XGPB 3D39B 3P4OA 1IKNC 4MA8H 5FOBB 1MIMH 3LPFA 1U8HB 1BP3B 4TQEH 1FSKB 3REVA 1PKQE 2HG5B 2YD1A 4MNHA 4WIQA 3LEXA 1FZKA 1FZOA 5EZLB 1J05A 1QR1A 3I50H 3V79C 4JFFB 3GMQA 2C3WA 4TUOB 5I1LA 3MGAA 3C2AL 1NKOA 5DD0H 1G7QA 3BH8A 5F1SA 3FT4A 5DZNA 3HUJF 5DUMH 5FA4A 4PRPD 3OR7A 3ARBB 1OCWH 1ZVSA 3SDAC 2PO6B 2FO4B 1MLCA 4G3YL 3S4SA 4X9FA 1SM3H 4O51B 1NMCB 5HGHA 5KS9E 4L3CB 4Y19A 4ZPVB 3C2AH 3QHZL 3GZKA 5EFIA 3DVNB 4LSVL 4L29A 1T0NA 3FAWA 3DETD 1XF5A 3WEXA 4OFIA 1GCFA 2EIEA 1ADQL 3WN5A 3W0WD 2M26A 3AAZB 4GW1A 3SPVA 5EO9A 3SO3C 5D1XB 2AV1A 5LAXA 1RFDH 5JA9A 1UKSA 3L95A 4NDMB 4GXVH 3ORJA 3QPQD 4KI5F 5JPMB 1EO5A 4LCYB 4F7EA 2AJ3B 1X44A 5IW6A 3N1GC 3D87B 1XF3A 2YPKA 1XZ0B 3OKKA 1HINH 1KPRB 3GSNH 1FPTL 4LLDB 3SKOA 2UWEE 3GJFH 5E2WL 5F7HA 1RUML 4KDWA 4RAHA 4LLVB 4RFNC 5EU6D 2N56A 2VZVA 3QUYA 2X4RB 1S7UB 5IK3B 3A0OA 4WCYL 4OM0L 4WRLA 3L3JA 4KK6C 1C08B 3RUGF 1OQXA 4P23C 2ZOKA 4D9QD 3ECBB 2Q1EA 1IEAA 1XF1A 2JJSA 2FIKA 1NPUA 5F1NB 3JV6B 1RUMH 2VL5B 5E2JA 1REIA 4UV4L 2Z91A 4ZG1A 1A14H 3MLUH 4WO4A 3GMRB 4WCYH 5D5MB 4JG1H 3IDJA 3GJEB 3D3VB 3P4LA 2N1KA 1UA6L 4NN6C 2AKRA 3X17A 3KGRA 5ADPL 4PJ8C 1ZANL 4AIXA 1A47A 1TJIL 4I48B 3PDGA 1KPUA 2HVJB 1OF2B 1LE9B 4UV4H 3RPIB 3GMPA 2R9HD 4KJPC 1K2DA 2CDGA 4Y1AD 4FG6D 3CVIL 4LQFL 4LLWB 4MA3A 4NYLA 4TSCH 2IPUK 5I1GL 3D18A 2VR5A 4QRPB 5ADPH 3GSXB 4ZXBB 4MAYA 1ZANH 3LKRA 4K7FA 1H3PH 4OGXH 5EPMA 4PJ7A 4X5XB 1JJUA 4RQQA 1T7XA 1I1RA 1TJIH 4GRLA 4PJXF 2PYFA 5I8KL 4LP5A 5BS0A 3VJ6A 5KG9B 5C2UB 3QA3B 2VITB 4HXBL 1F42A 4POYA 1MAKA 5JW3H 4J8RB 2VUYA 5ANMB 4KY1H 1V7MH 2N7AA 2Q20A 3BP6A 4C4KO 4Q6IB 3VRLE 2NX5B 4HEPG 3E6HB 4P46B 4X4MA 2BXZA 4RRPA 3D0LA 2PYEE 1PX4A 4I5BA 4YFLF 3U36B 3SGKC 4NFBA 4XHJD 4AEHL 3ZE2F 1CN4A 2CJUH 3AROA 4EIZC 3P30H 5IUSA 2XWTB 3IU3B 3QFJE 4MDIA 4C58B 3NOIA 3L3IA 2XZQH 3HN3A 3FRUB 3BP5B 4RGMB 3GIVB 4NC1E 4L8DA 4DN3L 4U1MA 4LRNL 5KVMC 4P2OC 3O3UN 1S78C 3EAKA 4HMDA 4EI5D 1BOGB 4G6JH 2GJ6B 4XNMA 4XC3L 2QEJA 5BRZE 4JPIA 1QEWB 4AEHH 1WBXA 5EC2B 2ADJA 4NN7C 3FT2B 5BXFB 3BXNA 1DR9A 2VLLB 4NKMA 4BYHA 3P2TA 4G7YH 4F7TA 5A2LH 3BAEH 4OLZL 1Y18B 3DTXA 1YMHA 3K81A 1KB5B 3G04B 3O45B 5GGRY 1CGXA 1P4IL 2DOCA 3TFKD 4QHMB 5CFHA 1CVRA 4YHZH 1AC6A 1VPOH 3KPSA 1CGWA 2A73B 1PBYA 1MRFL 1FLTX 1I7ZB 1G7JA 1X3DA 1KCKA 1MVUB 1UQSB 5F3HB 1LP9B 4NSKA 1BD2D 4XTRD 1A6VL 2ZCHH 4FXLA 3S9DB 5IM7B 1CGTA 3WE6A 4HWZA 2R8SL 3VI4F 4IEFB 3WL9B 5F9JB 3SE9L 4Z77A 3RGVD 3OKOA 5D2NA 1BIIB 2XQYK 3F58L 2OK0H 1J88A 1ZA6B 4Q2ZA 2DYPA 4KVCH 2HJFB 1S9WB 1Q72H 5FM5O 4DAGL 4RAVB 5HHOA 4PRPB 3GI9H 1A6VH 1OHQA 1JRHL 4Z7VA 2KBGA 5I17B 1F58L 5EULV 3U46B 3MBXL 2ZUXA 5FCSH 3H6JA 1UCTA 3BT2H 2BSTA 4C56E 1BBDL 1KGCE 2BNUB 4U6TA 2UUDK 3DI2B 4Z7QE 5E8EB 1ULVA 4YBQD 2MPAL 4NKOB 2Z31A 5JW4M 3H2WA 1TQBB 2VXVH 5D72L 2VR9A 1KJMA 1Q1JH 1ES0B 3CSYA 1JRHH 3KPPA 5DD6B 5B4MC 3HA0A 1U8OB 4L8CA 3W0WB 5BV7C 5DSCB 4N8CL 5BVPH 4M8VA 5ACMA 1BBDH 2X10A 4ZAKD 3RJDA 5E5MA 1T1XB 4IMKA 1MI5A 2BVUA 1MFAL 1U8QA 2CDFB 3REWA 3L5IA 3VGAC 4AYFA 4BSVB 3C6LC 2ADGB 4H1LH 3LEVH 3TCXA 1MCOL 3I2CL 1MF2L 2DAVA 5FUCC 3WJLA 1OGAE 2EIBA 4KTYA 1DBBL 3VFWB 3C09B 1UEMA 1T21B 4H25A 3VCLB 1QSEA 1FGNH 1W8NA 4YC2B 3PWJA 3L3GB 2ITDA 4CN1A 4KDTC 5EU6B 5CBEB 2OYPA 3I6KA 4XC1H 1R3HA 1IBGH 4HD9A 2F15A 3T2QA 3TN0A 4X7FC 1H0DB 5H35A 2FWOA 2VLKA 4C4KT 1WFUA 1CBVL 1CDYA 3HZVA 4JVPA 3OGCB 4YLQT 2GFBA 4U6HB 1GYAA 1FNEB 2GITB 3DX7B 2EZ0C 3R0MA 3LIZL 3U6RB 4JKMA 4QTIH 1NAKL 3VWJC 3JZ7A 1LK2A 4HUWA 3ZDXF 5FGRA 4W68A 1H15A 2X4QB 4PGEB 1ONQB 4NCC1 2DN7A 2EEBA 1J0YA 2XT1B 1E6OH 4XNQA 5HDQL 5DZOA 5GGUA 4NO0D 2W9EL 5HHXL 4KZEL 4AIZA 5IWLC 3RTQD 3TPUA 1KPVA 4Y1AB 1A6UL 1T7VA 2NYYC 2W0FB 2D0FA 2HFGL 4WGVB 1NBYA 2D7TH 4EVNB 1R3KB 2IG2L 3GMMB 2DM2A 3V0VA 1X5YA 1JL8A 4NJAH 3WYRA 3CDGA 3QXVA 3B9KC 4HUXA 3K8LA 5ETUB 1ZHNB 5HHXH 4XBPA 3EOTH 1G0YR 1EFXD 1A6UH 3WBDA 3NAAH 5CEXA 3OKEA 1G7LA 4PP2A 1MUJB 4PJ7E 4JFZH 4ODHL 3MGTB 4OKVB 5D2LA 2EDJA 3I3DA 3L1OL 3D25B 3UJJL 2Q8BL 3UCRA 5TDNA 2WSKA 5DJCB 2FD6H 4FABL 4JFPB 5ALCL 3DROB 1BF8A 3QIBD 4XWOD 1NDGB 1NGXB 4K55A 3S36H 4ODHH 1CZ8H 3IKCB 4HFUH 1HOCA 3TH2T 1D5MA 1N2RA 4FTVA 4EI5B 1JNHB 4C54A 2WUBL 4JY4A 5ALCH 1JPFA 4GMTH 4HS6B 4KMQA 2NW3A 1UACH 4WI9A 1V5JA 2BNRD 2EDOA 3VXTA 1LEGA 4R90H 1XGTB 5IESL 4L3AA 3O2DA 3BRDA 3W82A 1B88A 1XGRA 4PRDA 4Y5VA 4L4TE 4XAKE 2O26U 4HUUB 1IC7L 4PRNA 2X4OA 4UT7L 5CIPB 3SDXE 1KXQE 3P0VL 1RZ8A 4KVNL 2W91A 3MUY1 1MAJA 1IQWL 4QT5B 1AXTL 3MUGA 2WAHA 4ZQKB 4CAGA 3O3AA 4Z7WB 3IJSB 1W0VA 3KHOA 3WIIL 3OKDA 4AY0A 3AC0A 1V3MA 4ZDHA 2I9LA 3IVKA 5ALBL 3DV6B 1BD2B 3PP3K 3ESUF 4NHUB 5IB1B 1I7UA 3T3ME 3KPSE 1X9QA 3P0VH 2DQJH 2VN7A 2P42B 3RGVB 2WBKA 4MA7L 1IQWH 1ACYL 4PJDF 3B9AA 3VFUB 5TE4L 5L8JB 3ULUD 4ZD3L 1K8DA 3WIIH 1D9KA 1MCSA 1KYOJ 3S34L 1BM3L 2E8ZA 3TGXA 1TZHB 2JELL 4I3GA 2YZ8A 1V3LA 4U1GC 4G6AC 3U79A 3ZHKA 2NW2A 3TA3A 2FATL 3SQOH 5IMLA 2BVTA 3LV3A 4HX1B 5IVXE 5MEPB 2V2XB 4JFXB 3F12A 5E24E 5JXEC 1WIUA 5FHBH 3WXWH 1GGBL 1SMOA 3ZT7A 2DTML 4J1UB 4NQXA 3P73B 3O4LD 1DDHA 3QDGD 3DUSA 3QQ9C 2X5PA 4NRYA 4YK4C 1U8KA 5FYKE 1U3HD 3JTTA 3KPRA 4HIIA 4ZAKB 3PV7A 3HB3C 1NKRA 4U1KA 1YEEL 1QO3B 4M6OH 5EO1A 5TFSL 2ADIB 1IQDB 4Y16D 5JIPA 3HNSH 2NY1D 3NFPA 2E7MA 4D0BA 5BCAA 5DHVH 5I66B 1FFNB 4P57A 3TBWB 1NCWL 3GSRB 3KYAA 1B6UA 1CCZA 1K3IA 2N4IA 2AI0L 4H0GA 3FO2A 3NCYP 3EYSH 4B7IA 4PB9H 3TVMD 4E41E 2YZ1A 3ZTJG 1M05A 5E2TL 3ZDZE 3GM8A 4Y4HA 3BKCL 5F8QC 4DFHA 3MV9A 3IAPA 5L0QC 1KXVC 2KUTA 4WW2C 5FYKH 1CD8A 1L7TH 5E8OB 1N5AB 3A6CL 1G84A 3EOAB 4I3SL 3D0VA 2A6KA 2IWGA 4F9PA 4GAYA 3OAYK 3DPBA 1ZEAH 2ZP0T 3VRIA 4FZ8H 4X7EC 1A4JB 5T3XD 1T22A 4HIXH 5FKPB 1YEJL 3H8NA 3BKCH 1EO8H 1QBAA 3NN8A 3C60D 1N26A 3HMXL 4UU9B 3DO7B 4XPTH 2EYRA 1II4E 4O2CB 3DOSA 1NAMB 2KZWA 4D0CB 4WHTA 5C0AD 3OJDB 2A9NL 2ID5A 3WIHA 5HGDA 5ICZB 1QFWL 4GRWE 3UTOA 4JZNA 4YUEL 4NO0B 5JO5A 5JORB 3TNNB 4M7LL 3RTQB 3CFCL 3MLVH 3QZWA 5I1AB 3T0AA 1RD6A 3L6FB 1YEJH 5GRXG 2HMID 3E8UH 4POZD 3QDMD 3AU1A 2N7BA 3B2UC 4OZFB 5I9QC 2HRPH 4S1SH 4PTUA 3KYKL 2J12B 3ILQC 5J13C 1SJVA 3PXHA 4YFDB 4G42A 4M7LH 3CFCH 1EFXB 2O5XL 2NY4C 3AS0A 2XFXB 4K8RD 2HFEB 5K9KB 4AEIH 4M1GL 2V2WA 3GJFK 3T8XA 3RPKA 3RWJA 1J1PL 3IFPA 1U93B 5DJZA 3CLFH 3S97C 4N8VG 5FM8A 1JHTA 4P48A 3O3DB 2UVEA 4GRWH 1U8JB 1Q9LB 4ZO7A 1OB1B 3UTZB 3TNMB 3N1FC 2GJJA 4I4WB 2FJGB 3QIBB 6FABH 1W2KT 2W9LA 4U1NA 1VFBA 2X2YA 4N8VB 4Q9CA 4PV8B 4NBXB 1HWGB 4OLXH 1J1PH 2BFVL 1SJHB 4YQXL 4M7JH 3O3EB 4U2ZA 2AEWA 4YGAB 4NP4L 3TP4A 2GAZB 3U4BH 1W72A 3AFLA 4OF6A 3P9MB 4N68A 4ETYA 4YE4H 3MRCB 2BNRB 4X7SH 5FO7A 1NUNB 1QLFA 1U3YA 4LLYB 3LKOB 2B4CC 1BEYH 3QAZC 2ESVE 4HUMB 2BFVH 3BGMA 1I9RH 1N59A 3B6SB 5K33A 5I8CA 1OSPH 3U0TB 2NTFB 1EK3A 4MNGB 2F53A 3STLB 3V8OA 5LQBH 4MD0A 3D85D 1BVZA 3RBGA 3MLPA 3FFCE 1NFKA 4R3SA 3FB5B 5DUBB 5FK9B 1JNLL 3NPZB 1F6AB 3QQNA 5ESAA 4J6RH 4PREA 5HDBF 2VXSL 2O93L 5E6YA 2AEPL 3D9AL 3J8F7 5IMOA 2EH8L 4FQQB 4PJEA 1QHOA 3SKNA 2BHYA 1N8ZA 4X9BA 5F1OB 3MXWH 1MQ8A 2FECI 4CNIA 3LN5A 4KQ4L 1A7NH 1TZIB 1IEBB 2GIYA 3UYOD 5B21A 4KKAC 2VXSH 1FFQA 3ALPA 4QO1A 4BQ6A 2ZUWA 2BOCB 4MXVE 3IDNA 4YHLL 2MTPA 1CL7L 1C8PA 3LKNB 4NQDA 5I71C 3ZKXC 3O2DH 2BOBA 4G8GA 3BOVA 2XN9A 4U6VL 4Y19D 4MCZA 5EBWA 1DEEA 4DGVH 5E5UB 2IQAB 3OAUH 5DI8A 5LCVL 5ILTH 1R3JB 3MV01 3WXVL 3SKJL 1JZ5A 2V7HA 3TLRA 3O4LB 4ODVL 2JLLA 3QDGB 4CMHC 2PW2A 2HKHL 5F9OH 3QUZA 1UB5B 4ZS7L 32C2A 5F89B 2C7UA 4YHLH 3WNPA 1U3HB 3GNML 1V05A 5EG6C 3QIWA 5F1IA 4ELMB 5CD3B 4U6VH 2NY7L 3HE7C 1F2QA 4LCIL 4GAFB 4Y16B 1DP0A 1YEDA 2NY1B 1T83A 1ZS8A 1KN4L 2YA2A 3MODL 3B9EA 4APQC 4NQEA 1BWWA 3DYMA 2V5SA 3Q48A 2HKHH 1MRDL 4ZS7H 3UZEA 3T0EA 4X4YB 1FLRH 1PQZA 4JM2A 1QNZL 1UB6A 2B39A 2FEDC 2DQEL 2GTZA 5IQ9A 2NY7H 3KWWB 3QUYD 3TVMB 1B0GA 3WDJA 2DLFL 4NGHL 3UBXG 3N85H 1I85A 3MODH 2J6EL 4X99A 2ZUQB 1HH9B 4YBLC 3VA6A 5J6GB 3K2UH 4L3EA 3VXUE 4JFDA 1U2CA 3MLWL 5H37H 1XIWC 3IYLW 1QNZH 2KH2B 2YC1A 5IJKC 1ED3B 2DQEH 3UBXB 1NFDA 3C9NB 2VWEC 3L5HA 4Y2DA 1I8LA 3GSWB 1MAML 5DJYB 2Z8WC 4CDHA 1Q9OB 3IFOA 2ENSA 4WO4D 5F7UA 2DLFH 4Y5XA 4X5WA 4TSAL 4LGRB 1CFSA 1CDJA 3C60B 4RGOH 2J6EH 1CFVL 2NNAB 5ERWA 3CDYA 4OZHF 1M1SA 3R1GL 3OB0K 1DBJL 3HE6A 3CJJA 5AZEH 3MLWH 2IF7A 5C0AB 1FL5B 5C7XH 3CH1A 1MJJB 3L5JA 5T1LA 4X6CE 3ARGC 4Z8FL 4KROD 3IDXL 4IHOA 1MAMH 1PD6A 4F7CB 1MNUL 3RVWD 3ELAT 4WU5A 1BFOA 2CKBL 1JPTH 3GGWB 4NZDA 4JG0L 5DJ2B 3QDMB 1RZJC 4ZUSA 4WHCA 3B4NA 4MCYA 3ZKMC 1N7ML 3VXOB 1XCTB 4D8PA 5L8KB 1NEZA 1M6OB 2E5EA 1DEDA 2BSRB 3GFUA 5BS0D 4LCWA 3NVQA 3P77B 4OLVL 5TDPB 5D93B 3EOYG 4ODUA 1IE5A 1OQOA 2FX8H 2CKBH 1HE7A 3ZDYE 4MQ7B 5TF0A 3PGFH 5GGTL 3RZCC 3D69A 5E8PA 5DJAB 2E27H 4EEEA 1FZMA 4Z7UA 4CVXA 2WMPA 1GH7A 4XZUB 4OI8A 2DQCL 3RBSA 1A1OA 5D7JC 1QD0A 4HK0B 3W9EB 3MCKB 2A0LD 1SYVA 1Z0NA 1A21A 4ZUWB 5KOMC 4RAUA 3IGAB 4AEEA 1IGCL 3O8XA 4ORGB 4WHYH 5GGTH 1X6NA 4Z0BH 3NMEA 3KPLB 2X7LB 5IV2B 3V6BR 4XMPL 4OV6F 4TNVK 1HILB 3OKMB 2WBWB 5DFTA 4X7TA 4XVSH 1RK1A 4HS8L 2VQUA 4WWKA 4U31A 3T65A 3DHMA 1QFUL 2XXMB 2JB5L 2B1AH 2CLRA 3T09A 1P5VA 4Z78A 2EIZB 3GIZL 5D96B 5GGSY 3EYOB 3P4MA 1R3LA 4V1DA 3EFFB 3D85B 4B41A 3VXMB 5J6HA 4YNYA 1DBMH 3SE8H 4DGIL 5EO0A 4YHMH 3P4OB 2Z92B 2JB5H 2ZSVA 4M5ZL 3O6FC 4I0PC 3SE3C 3TZVC 3REVB 2XYCA 3NABL 3H42L 4MJ5A 4MA1B 4MNHB 1HQRA 5HYJA 3GIZH 3LEXB 2F53E 4HG4K 1FZKB 3GI8L 4PUBH 1J05B 1BQLL 1CXKA 4P3DA 3U4AA 2BX5A 1S9YB 2VC2H 2XA8L 3GMQB 4GQPH 5I1LB 5F96L 3SDAA 3HHRB 2DYPD 3OAZH 2IALA 3CFEA 3LCYA 1PGRB 4XCNB 4TTDC 3S4SG 1G7QB 3BH8B 3FQWB 1WFNA 5HHOD 4R97B 3WKMH 2XG5A 4HCRA 1AD0A 4IOIA 1YEGH 4MSWA 5FA4B 5SX5H 3T08A 3AS2A 3OR7B 1QRNE 1W72H 5C3LD 1FG9C 3GI8H 4XNZC 1ITCA 3SCMD 2GSIB 3S4SB 1BF2A 4YHOL 8FABA 2CIIA 3CCHA 4Y19B 1GZQA 4CVZA 1OP3H 5EFIB 3RWGA 4L29B 3HI1A 1T0NB 3LS5H 2C4XA 2Z31D 1XF5B 2HAZA 2HVKB 3WEXB 2I5YH 4OI7A 4KK9C 2VXUH 3WN5B 3GK8L 4JRYD 3MRGA 5FA3A 3QT2A 1DQQA 3H9SA 2XN9E 4ALAL 1FJ1A 4WUKH 3V9FA 5C0RL 2QLVB 1NCTA 4J23A 4DVBA 3W9DA 5EO9B 1TZGH 2F74A 4ZFZA 1MI5D 4WI4A 2AV1B 5LAXB 5C0EA 3MRRB 2Z35A 5DF0A 5F70A 5I1CL 3L95B 2XWJB 1T66D 3B5TA 3EBAA 4F7EB 3GK8H 1WEJH 2CRMA 5FYLE 4XCCL 3M45A 3EJZD 3AB0B 2YPKB 3PIQA 3OKKB 1FE8H 3RNQB 4ENEC 5L2KA 1QSED 2LVCA 1IM3A 3SKOB 1RUQL 2GKIA 4YWGH 4P23A 3LQZA 2PCPA 3G5XA 3QUYB 1Q8MA 3OX8A 2G9HB 5KN5A 4WUUE 3HZKA 5HY9A 3L3JB 5H2BB 5FYLL 1TQCB 5DEGA 4XCCH 1FYTA 5AD0B 4ZTPL 2ZOKB 2VLKD 4OZIA 3CK0L 4HMCA 1G6RL 5LVEA 4N0CD 2FIKB 1ZT1A 1RUQH 3Q1SH 1LEKB 1T03H 4KFZC 2Z91B 4PJ8A 4XMKL 2RGSA 3P9WB 2ZUVA 4WO4B 5EWIH 1HQ4A 3W5MA 1D7FA 2ZCKH 5GS2D 4BFGA 4MVBD 3ARZA 5FYLH 4WI5A 3MLTA 3S88H 4ZTPH 1XH3A 2DF3A 4JE4B 4QWWD 5FHAH 5GISH 3CK0H 3DV4A 4LKCB 2PR4H 1KPUB 4OCNC 3IB4A 1GOGA 4KROB 3MCG1 5GPRA 3BD3A 4S1DC 2P8LA 1K2DB 2CDGB 1WUNT 1P4BL 4LLAA 3ULUL 1LDPH 4MA3B 4NYLB 2GQHA 3HLAB 5IHZA 3TJEH 5E94A 3D18B 3IDYB 1T1WA 5F7YC 2H26A 4OT1L 3LKRB 4K7FB 3BKYH 5EPMB 4RQQB 2LU7A 3G08A 5SWZA 3L3OA 1PZ5A 3UTSA 1A9BA 2UYLA 3MRNA 4HGMA 2VB5A 4PJBF 5BS0B 2CSPA 1DVFC 4RGNE 5D7LE 2APVA 2QSTA 2J4WH 4RRPG 3CSGA 4YHIA 4IIQA 3F62A 4U1LA 3SGKA 2YSSB 4UV7L 3MC0A 3MV8A 1I8IA 2YN3A 3TPKA 3BE1L 4LCWE 3BP6B 2BZDA 2CPCA 2VNCA 2NY6C 3C5ZC 3PHOA 3RL1A 1JTTA 3D0LB 2ZOLA 3H7LA 4Q9QH 5TGBB 3ULVC 2DQGL 2Z4QA 5D70L 4QGYA 4P2OA 3DIFA 2DMKA 3THML 4MJIE 1OLLA 4MDIB 3L3IB 2FH8A 1N4XL 4IRSC 4RISL 5IVOA 3QJHA 4P5KB 4LIQH 4X98B 1JMZA 3K4AA 4U1MB 5CP3A 4FTVD 1CFTA 4R7NA 4UNUA 4XPHL 1GPOL 4XNMB 4F58L 3NFNA 4LLMB 1X5HA 2DQGH 3UX9B 5FV1L 1MLBA 1L6ZA 1CD1A 1WBXB 3CVHL 2ADJB 4FQIL 1JZ8A 3V4UL 3M8OL 2E6JA 3EYVA 1S5IL 4HQQH 4NKMB 2AK4A 2BERA 4F7TB 2R4RL 3DTXB 1UWGL 1YMHB 2CUMA 3PE9A 3R8BB 1A5FL 2YMXH 1GVIA 3TH3T 3BZ4A 1DBAH 1YEFL 3CVHH 1R3IL 3M8OH 4TPRH 4LVNB 5FXCH 1S5IH 4NNXA 5KAQG 5IHLB 1IC4L 4NSKB 2Q3ZA 4LAQH 5T3XL 5HI5D 5HHVH 1ZHKA 3VFPA 2ATPB 1DBKH 5DJ8A 4KC3B 4Z77B 1FFOA 5D2NB 1JYVA 1YEFH 5JNYB 4PJFA 4R26H 4ZYKB 4Q2ZB 2DYPB 4X6EA 1R3IH 5EBLB 2YPVH 1IL1A 3EHBC 3WLWC 5HHOB 1D9KD 3ROLA 1FRGH 4U1SA 4L9LC 3BRGC 3IXTA 4Z7VB 5C0JA 5IMKA 1INEH 5INCA 3SCMB 2X70A 1IGIH 3KS0H 5D7KE 2BSTB 2EECA 4MZ2A 3MJ9L 3FJTA 1NDMA 3KPNA 2F5AL 1G9MH 1BBJA 1A7OL 5F44A 5E08H 1JF1A 4LSPH 4WI6A 2Z31B 4UAOB 3ZHDA 1FZJA 1CGSL 1KJMB 5HVHC 4JRYB 5KANI 3CSYB 2JJTC 2J8OA 1PEWA 3VGGA 4E9LA 3C6LA 3K7UA 2H3NA 4OD3L 1XR9A 2C26A 4L8CB 2ZNXA 1VENA 5DJ6A 1TJHH 4EDWL 5I1IL 5INDB 3KPRD 5E5MB 3TYFA 1MCWM 1W0WA 1MI5B 2QKIA 1A7OH 3QXAA 3PWLA 3M07A 4WW1A 5JXAL 4Q9RL 1IC5L 2YXFA 2HTKD 4KDTA 1CT8B 3I3BA 3QRGH 5KW9H 5F7NC 4IOFC 4L5FL 5A2JH 1PG7X 4PJAE 4OLYL 3MRQA 1SQ2N 4XCYA 3QO1A 5TF1L 1OPGL 4EDWH 1QSEB 4HCRH 3PWJB 4XI5C 2ITDB 3DX9A 1VESA 3C5SB 1CF8L 1IT9L 3GB7A 4G8FA 4UTAH 4PJCF 3OWEA 1U95A 3I6KB 5A3ID 4Y4HD 3NCCB 3OL2A 1R3HB 3MV9D 5L2KE 4OD2B 1EZVX 2FWOB 3DWTA 4OLYH 2VLKB 3ZYOA 5JMOC 4QRQA 5TF1H 1KT2B 3VRJB 4WFFD 3BP7A 3VWJA 2HLFD 1V7NH 3BEVA 3HZVB 2AW2A 1CF8H 2GFBB 4DQOL 2APXA 1XGQA 2ZCLL 5CKGA 4J3XA 1EEYA 4I0KA 3MLYL 4ZO9A 2MCPH 2HWZL 2VLRA 4XNXL 5IWLA 2EDRA 5IG7B 3U1SH 3BSZL 1H15B 1PSKL 1KTDA 2J5LB 1VGEL 2XNAB 2A6DA 4LSTL 4XNQB 2R0LL 2CK0H 1A3LL 2IH3A 4AIZB 4J4PC 1KPVB 3TPUB 5GHWL 4H0HB 1N3NA 3MOBL 3B9KA 3DSFL 2Z8VC 4PJIA 5DDHA 3KS0J 1NBYB 3WMSA 5MENE 1CR9H 2ATKA 4LHQB 1OY3B 3V0VB 3BPCA 3VG0H 3VGDA 2VXTH 1S8DA 5MEOB 4HUXB 2R0LH 3QB7C 4XBPB 1EJOL 5GHWH 4HPYH 3QBTB 3MOBH 2AJSL 5CEXB 1J8HA 3OKEB 4PP2B 1AGFA 2B0SH 4IJ3B 4JFEE 1DLHA 5D2LB 5DVOA 3EDDA 2QBWA 4YDVA 2GEEA 2HTLD 2Q7NA 5TDNB 2ED8A 3PQYD 3TIDA 3TO4C 5M94B 5IFAH 1YJDC 3NA4A 4GAJL 5J11C 1UWEL 1ZHLA 5FEBA 2H8PB 5T5FL 3UYRL 1RK0A 1F8TL 4I3RL 5CEZD 5DMKA 1MFCH 4XB8A 2OTWB 1A6ZA 4Z7NE 1GC1L 2PETA 5DVLA 1GAFH 1WZLA 3EYUH 4L9DA 5F9WC 1HOCB 5ABDE 3L3KA 1D5MB 1N2RB 4FTVB 1SJEA 4P9HL 4PRHE 1HEZA 2F5BL 1ZLUH 4BJLA 2XTJE 2CD0A 2ZWLT 1JPFB 1QP1A 2NW3B 3BIKA 1UM4H 4K23L 3VXTB 4FA8A 1LEGB 3DLQR 3LAFA 4LNRA 2JCCB 1IGML 2R2BA 4Z7WF 1XGRB 1X4YA 3BPLB 4Y5VB 1FVCA 4NZUH 4PRNB 2X4OB 5CWSA 1EEZA 3MQIA 2IANA 4P9HH 4DK6A 4YHPA 1RZ8B 5EBGA 5B3NA 5JIIA 1WWWX 1RMFL 3G6JE 3MUGB 2CRIA 2AK4E 3O3AB 4FFYL 5EUOE 1W0VB 4S0SD 1M7DA 3OKDB 4MDJA 1MCIA 2D4DA 2GT9A 2I9LB 4OSUL 1VACA 3FTGA 1I7UB 1AR2A 4K3JL 3WSQH 2W0KA 1BZQK 2WIMA 1TCMA 1KG0A 1RUKH 2VAJA 3VG9C 4WNQA 5EDXA 5IQ7L 5CGMA 3H9ZA 4O9HL 3UAJC 2R29L 4O02H 1J0KA 3ZZ1A 1H8NA 1D9KB 5K9QI 4ZTOH 1Z3GH 3CUPB 5E4IA 3PP4H 1NCBH 2VDML 5JXEA 2YR3A 2EICA 5H37G 3CD4A 4LCCC 3PF2A 1OAZL 2NW2B 4NQDD 5IMLB 3LV3B 2GUOA 4G8GD 3F12B 1RURL 1WC7A 1X5LA 3S98A 4LSSL 3LZFL 1P2CA 4CADB 1QSVA 3RVXD 3QEGH 4XHQA 1YN7A 3MJ7A 5CJOL 3DUSB 5D7IF 1JI1A 4DTGH 1R5VB 1MJ8L 4NC2B 4NRYB 2MFNA 1U8LA 3QUZD 1VADA 3LH2L 4OUUA 2GTWB 3JTTB 3KPRB 4QHKI 1S7SA 4HIIB 5D4QA 4DVRL 4U1KB 1DQJA 3VXSE 4CMMA 3LZFH 1JFQL 3C8KA 4U1HB 3NFPB 2OZ4L 2F19L 4X6DF 4OFPA 4D0BB 5EOCH 3QWQB 2BMKA 4LVHB 4YR6A 4NQED 1EJ6A 1PLGH 1PY4A 3T0ED 4N0FA 2DQIH 3LH2H 1FHGA 3TJHD 3QRFM 1B0WA 1G7MA 4AK1A 3E6FA 4GMSH 3FO2B 1T2JA 3SDYL 4WW2A 1H3UA 2QHLA 4OGAC 4PJGA 2OZ4H 5DUPL 5CZXD 15C8L 1M05B 4P59L 3FB8A 3CMOL 2WP3O 4Y4HB 3MV9B 4OB5H 5C0DA 2X1OA 3F8UB 1AGDA 3ZO0A 4U0RB 3OAZK 1X6LA 4L3ED 2WK2A 4JFDD 2AQ1A 5CP7A 5BV7H 5I76A 3D0VB 2EDFA 1NCAH 2A6KB 4Y2DD 1PVHA 2B20A 4JO2L 4YAQA 4LQ1A 4GAYB 3VRIB 1IKFL 3VW3L 4WHYG 3RVUC 4P59H 4YEEA 1T22B 3BKML 2IPKA 3CMOH 2AABL 3NN8B 4N5ED 4R4ND 2EYRB 4AIOA 1K4CB 3QZWG 3UDWC 3HE6D 1OP3K 5EU7E 1QVOA 5CCKH 5T1LD 5HGDB 4ETQA 2HKFH 4JZNB 2NR6D 5LGJA 5JO5B 3HI6L 3I9GL 3NCYS 3VFOA 4OJFL 5F88A 3VW3H 3DXAA 3EFDH 3BKMH 4GG6A 2P44B 3PWPA 3CLEL 1E6JH 3AU1B 3VFGH 3VFSB 4WWID 3OPZH 1KJ3H 2DD8L 5LWYH 5IKCA 3RAJL 1G7HA 2BY2A 3KJ6L 1S5HA 1OSZA 4OCSL 4RMUA 3I9GH 1LO0L 1RSFA 2XZCH 3CNKA 3HNTL 4OJFH 2A9MH 3P0YL 4OTXH 1T6WA 4BZ1H 3CLEH 3QFDA 4XVUC 1UZ8A 2V2WB 1VA9A 3T8XB 1A4KB 2D31B 3A6BL 2YPLA 5DJZB 3OHXA 4UTBL 4Z76B 1MJ7L 1JHTB 4RIRB 1LD9A 3PQYB 5F6IB 3RAJH 3C08L 3QXDA 3IS0X 1J8HE 1F5WA 4G5ZH 1LO0H 1JZ3A 4UNVA 3P0YH 4I77H 4LCUA 3HPJA 1NANI 3K80A 3O8XD 4L1HA 3GBNH 3SJVD 4MB3A 1D5ZB 3A6BH 3VFTA 3QCVL 4RMWA 1MJ7H 3CXDL 4M62H 1X5AA 1W72B 3C08H 3INUL 4U7MA 1FO0A 4N90D 4NC1C 3QDJA 4WWKD 5FO7B 3K74B 4DK3A 3D2UD 3O41A 4H88H 5FECA 1MOEA 4PLJC 2P43B 4MQTB 2DQUH 3DVGA 1R5IA 4NKIH