3A6BL

Crystal structure of hyhel-10 fv mutant ln32d complexed with hen egg white lysozyme
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
107
structure length
107
Chain Sequence
DIVLTQSPATLSVTPGNSVSLSCRASQSIGNDLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYFCQQSNSWPYTFGGGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/hydrolase
molecule keywords Lysozyme binding ig kappa chain V23-J2 region
publication title Contribution of asparagine residues to the stabilization of a proteinaceous antigen-antibody complex, HyHEL-10-hen egg white lysozyme
pubmed doi rcsb
source organism Mus musculus
total genus 24
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2009-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3a6bL00
1U8PB 4G42B 4UIMB 2XZQH 2L4OA 2IAMA 1X5JA 3QPXH 3WLBA 3ARUA 3MLTB 2IF7A 3D85A 5BJTB 4M7JH 5I8OH 5TGBA 3CNKA 1DLHA 4EJ1C 4XPHH 5DDHB 1ZMYA 3ARPA 2H2PC 3GIVA 3G04A 4JY4B 3QIUC 2GI7A 3L3KA 2R0WL 5FV2A 4O9HH 3K1KC 3CX2A 2EDKA 1MCFA 4E0RA 3CPLA 2ITDA 4DZ8B 1RJYA 4FQJL 4DVBA 1JZ6A 1CDYA 4UT7H 5IB3B 1R24B 5CMAB 5KVDH 4K2UH 5CSZB 4MAUH 3GJFA 4JPVL 3TPUA 4L8DA 3QSKB 1CICA 3RGVA 1PJ9A 5JR1H 1GSMA 1EZVX 3VFRB 4ODVH 3BRDA 3C60A 4JHZA 4D9RE 2A6KA 4LCYA 3FHAA 3VMPA 5CSBA 4Y1AA 5CD3A 4NOBA 4YK4C 1J05A 1PLGL 5EWIH 3RJDA 1NMBL 5E99H 3HS0A 1N5YL 4KUZL 1JNHB 2AEPL 4I4WB 2B2XH 4N0UE 3DVGB 4P5TC 3TN0D 5D70L 1KOAA 3U2SB 1CT8A 4XZUA 5C0NC 2FGWH 3RAJL 4LSVL 4LEXH 4R4NC 4ZUSA 3QUZD 1JYNA 2VISB 4WIQA 2MNUA 3O2WL 2KUTA 1MCWW 5D93B 2AV1B 4N8VG 2NY5C 1GRWA 3RNQB 1NMAL 5H8DA 4I18C 5DQ9B 3C6LC 4J8RB 3QXTA 4A6YL 4XPAL 2WINA 3CCHA 4FG6C 5JDJA 2YD3A 3V5HB 1A7NH 1MLBA 3EO1B 4KMQA 4EN3A 1BBDH 5IVXE 1E28A 4RWYL 4Y5XA 4P2OD 4X7DC 3TBSA 1I4FA 2ZPKL 4NQEB 2VL4A 3N9GL 4JAMA 4LP4A 1XF3A 3MREA 4U6VL 2A73B 3UPRB 3O45B 4U1NA 5ISZE 3QQ9D 2XYCA 1AHWA 4F2MA 2OZ4L 4NN6B 4FTVE 4MNHB 1JPFB 5C0BE 1FVEA 4W6WB 1MRDH 4IOFD 4IHOB 1KENL 4I2XA 4IDJL 4OTXH 4PJAF 3ET9F 2DYPB 3RWHA 3TO2A 4XVSH 4LRIA 2CMRH 5CJXC 5JA9A 2RR3A 1JI1A 5TE7L 1AR1D 1Y6MR 4NN7C 1P7HL 5E1HB 1ZTXH 5F9AC 3GJFH 4JQVC 1XF5B 4JM2B 1VADB 2VIRA 3LDBB 5DSCA 1UM4H 5SV4A 3A6CL 4M7JL 3LS4L 3SKJL 3CSYA 1PVHA 5I8OL 2GJ6D 3NFPA 4CRPA 4GXUN 2XWTB 1X9QA 4MCZB 4X6DA 4CBPA 3DYOA 3RWCA 5IB5B 4ZFOB 3UBXA 3VXRE 3DRTB 2KQMA 1T83C 2SEBB 1R5IA 3BEVA 4PJXB 2C4XA 1FV1A 3P4OA 2PR4H 2XN9D 4G80B 1J12A 3VXUB 5IG7B 3BSZL 3CDFA 1RULL 3HG1B 3BQUB 4NHUA 4AEFA 5I1AB 5DJ8B 3ZZ1A 1GCFA 1CDUA 4RDQG 3AU1A 2LABA 2W65A 4K2UL 4MAUL 1BVKA 4NZDA 5T5NF 3QBTB 1AO7E 2V9RA 1HZHH 3T3MF 4KI5F 2QADB 2PXYD 4ODVL 2FNBA 1PEWA 5F9WC 5GGSB 1MCCA 2VWEC 1G9MH 3FN9A 4PJ5E 5DJ0B 4UV4H 1JWSA 1A6WH 4KRPC 2XTJC 4KJWD 5J1AA 4WHYG 4XPBH 4PGEA 4XNZC 5EWIL 3T3PF 5E70A 4ZAKA 3MBEC 3EJYC 5CZKA 1A1MA 4DUWA 2B2XL 3HB3C 3UPAA 1V3JA 4RFEA 2GTZB 4XAKD 1ND0B 5KSAD 1XR9B 3MRMB 3I6KA 4HEME 2I9LB 5LQBL 4LQFH 5EU6B 4R3SB 4XWGH 4NKIH 4ZTPH 5AYQA 2E7MA 2X4QB 5D7JD 5F6IC 4N68A 5J9PA 3SCMD 1FZMA 3DROB 5TE6L 5DMKB 5MEPA 3L95B 3EJZC 4J4PD 3ZDXE 3EZ8A 1EFXA 2HFFA 1JZ3A 3FO2B 1M05A 4L4VD 1X5XA 5GRXG 3MUJA 4Y0GA 4H0HB 4LOUD 2WNGA 3CDCA 4J3TA 3LD8C 1GOHA 5FO7B 1KPRA 2MMXA 2UWEF 1BBDL 5EBGA 1IGTB 5DURD 2R0ZH 1OAZH 4UB0H 3X13A 2D7NA 2Z8WC 4D0CA 4MS8C 3FFCE 5LXGL 3HPLB 3C6LB 5JW4N 1J8HE 3MRBB 4EIZC 1WZ1L 3N85H 3ME0A 5D6DC 4IM8A 1U8HB 4JG1L 1HWGB 4NYLA 4AZ8A 4D0BB 3KPRA 2HT3D 4NKDA 3VMNA 2V9TA 3UX9B 5JW3H 4XBPA 4XVSL 1KV3A 1H5BC 2CMRL 1QA9B 1ZLUH 3IGAA 3JTTB 4FXKB 1ZTXL 3IS1X 3VI3F 2JJVA 1UM4L 2R1WA 3AY4C 1UM5H 2WLYA 1A21A 2P49B 3L1OL 3KLAB 3KAAA 4HWZB 3MO1B 1QRNE 1QEWA 1ZVSA 3PHSA 5H2BB 3CMOH 3L5IA 1UJ3A 3U0TA 2OJEB 5BV7H 4XI5D 5L0QB 1UH3A 5L6YH 2UZXB 1B6DA 1U6AH 5CWSA 4GRLB 5FF6A 4BSWB 3D85D 2C3VA 1AQKH 1JNNH 1FL3B 1B6UA 2XKNA 3NCMA 1TJIH 4GG8A 4ZD3H 3PWNB 6FABH 4P59H 1CK0L 5D1QA 2BFVH 2XZCH 5JQHC 1MHPH 2ZCHH 2DLTA 4NGHH 4M1CC 1F4HA 3U7WL 1HZHL 4O51A 5IW6A 3EYVB 3GMNA 3BIBX 3O4LE 4C56B 1S78D 5D96B 1G7QA 1FYTA 4UV4L 4TTGA 3K8MA 4XPBL 3QUXA 4MNGA 3TPKA 1KJ2A 4HUUA 1FZKA 2Z4QB 3S37X 1J1PH 3RGVD 3FB5B 5EBWB 4LVNC 2J8UE 2WBJA 1CBVH 2EDBA 3BPOB 1FN4B 1DL7L 1HHGB 1TQBB 2FYYB 3C60D 1MEXH 2DIAA 3VH8G 2JCCA 3PP3H 4Y1AD 5FM8A 4LQFL 4P2YA 4X4YA 3HE7C 1MRCH 1BFVH 5BOZG 3KGRA 3TLRA 4UQ2A 4ZTPL 3H9HA 4PJAB 4XBEH 5EZLB 5JOPD 5IEKA 1WIPA 1Z3GH 4JHWH 1UKSA 3I3DA 4PJDB 4PJEA 4HS3B 5FCUL 1T21B 4Z95L 1LHZA 5F44A 3C8DA 3BI9X 1G0YR 3QFJA 2YN3A 2R2HB 1AE6L 4MQ7B 1A9EA 1TCRA 4GW1B 1TVBA 3WFCH 1IAOA 4OUUB 2XY2A 1WBXB 1F58L 5J3HD 3WIFA 2I26N 5IEHA 1T0PB 5F6IB 5GXBB 4YDLC 4EDWL 1MHHB 1OAZL 2R0ZL 3QUMA 4F3FB 1B0WA 5FYJE 4MZ2A 4UTAH 1Z9SA 3KYNB 4FQIL 1MSPA 5FUCC 4M9OA 4BQBA 3N85L 4FQQB 1Q0YL 2HKHH 3GJFK 4ONOA 3MV01 5IQ9B 1DANT 2YSSA 4LLVA 3MRHB 3HZMA 2JF1A 4EN3D 1R3JB 3LD8B 5TQ0H 1IGYB 4X9IA 2GAZA 5JW3L 2DI8A 5C07B 4R0LA 5M95B 1K8DA 1ZT4A 1JJUA 1MFDH 5MHSD 3Q2CA 1MI5E 2FJHB 2NY1C 2HMID 1DEEA 2BY1A 1OF2A 2G2RA 1UM5L 4OFDA 2VLJA 2CUMA 3V95A 3VMOA 5C2BH 4G8IB 4FQPA 2BSRB 2DKMA 3CMOL 2BCKA 1RY7B 5ESAB 1CFSB 1XGRA 1DLFH 1QKZL 2MKLC 3RWJB 1R5WA 1KJ2H 1ITCA 2FIRT 4HJJH 3BOVA 1U6AL 3D18B 4NQXA 4OFIA 4ZS7H 1YUHB 3B8YA 5DK0B 4BQ9A 3RWGA 1NBZB 1AQKL 1JNNL 3G08B 1SHMA 4XTRC 4CMMA 5E95B 4XC1H 1HSAA 5EUKB 6FABL 4P59L 1GAFL 1YN6A 5JPNA 2XZCL 5A2JH 2D2OA 2VLKB 3QULB 4NRYA 5KW9H 5DO2D 2BRRH 2V7HA 2V5MA 1F8TH 2YS4A 3P9WB 2AKRB 5J6HB 4RFOL 4L8BB 2E9WA 1I8MB 5LKNA 2FEDD 4PJHE 1QFWI 4UIKL 2CJUH 3E1F1 1WF5A 2V2WA 4X99B 3VXSE 2UWEB 2HT2D 43CAA 1P7QB 1X3DA 2HRPH 4PY8I 1KCKA 5FO8A 3FRPA 3O9WB 1J1PL 1FFOB 3T65A 3EGSB 3WIIH 1AFVL 1CBVL 3GM0A 4ODHH 3QUMH 4LLDA 3GMQB 2Z8RA 3B9KC 3GGWA 5AUMB 4JFFD 2N56A 1INQB 2UUDH 4NFCA 1BFOB 1MRCL 2IANA 1BFVL 5AWNH 1JGUH 1IGML 3K7UA 4ZAKD 4XBEL 2F8XC 5DQDH 1G0DA 1SYVB 3MJ8A 4RGND 5DD3H 5IFJB 1Z3GL 2C1OB 1FL6A 5DS8A 3ARXA 4JO4L 2AK4E 1Q94A 3UTSA 3HRPA 4YHKH 1S7VA 4HUVB 4JFDA 3EAKA 1K2DB 2YD7A 3PE9A 3I6GA 1LD9A 1YEKH 4WHCA 1T03H 5SWSD 1LO4H 1FVDA 3T0EE 3BGMB 2P8MA 3TT3L 1U93A 4KTEL 3WFCL 4GRWF 1JI2A 1I8KB 4NCC1 1OTTC 3F7YB 1L6XA 4K8RC 5T33L 2LE9A 5IQ7H 1QLEL 1EFXD 2P42B 1ROWA 2BVYA 2VAAA 3FT4A 3PDOB 3UEZA 5HBBA 3BKCH 4LHQB 1BWMA 2DIBA 1DFBH 5CJ8A 2HKHL 4NKMB 4LLUB 3BP5A 4WEBH 2BVOB 5SWQB 4JO3H 2MPAH 32C2B 3CSBA 4UQ3B 5TQ0L 3X14A 1OSPL 1NCTA 1GPOH 4OI9A 1AGBB 3S96B 2DM3A 1IEAB 1T0NA 3QXDA 3Q5OA 3MLZH 4L4JA 5D7IE 4NO5A 2ADGB 3H3PL 2ATPB 5EU4B 3ULVF 2AABH 4P2QA 1VESA 4IOIA 2F53E 3KPRD 2HTKC 5FK9B 2ZSVB 3EYQC 5CBAB 1U95B 4LGPB 1FNFA 4WW2C 4NQSA 2GSGA 1DLFL 5CZXD 1NH6A 3X3FH 5EBLA 1KJ2L 5KSBF 4LPXA 4LHUG 4ELMA 5J06A 2PUQT 4G3YL 4XWOD 4LSUH 3BUYB 4P2CG 4ZS7L 3LB6D 1MUJB 5CZVH 5C1MB 3V6FB 1H3VA 3AMKA 2YPLA 1UXSB 4HPYH 3C5JB 1A1OA 2A38A 4Z7UE 2RB8A 4YHYC 1LDSA 3TGXA 3NABL 4U6XA 4M93B 3CFDB 3ROLA 1NFIB 4TVSa 3WUWB 1PD6A 2R56H 1S9WA 1F8TL 5I1KH 1I1AC 2Z31D 1IGFL 1ZHKB 4KV5F 5FOBB 1T5WB 2P45B 4XXDB 3UTQB 4GLRI 5IB2B 3MV9A 3IDJA 2HTLC 4Z5RA 1JRHL 1NC2B 2DQGH 5D1QD 1MAMH 2HRPL 2BK8A 1IT9H 3MCKA 4KROC 2A1WH 3QUML 3VGBA 1RZ8B 3B4NA 4Z76B 4QHNB 2D7OA 3TFKC 1B4RA 3RIFK 4QRTB 4N5ED 2XFXA 4JRWA 4OGZA 4FXGB 3QUXD 5AWNL 3SKOB 5BRZA 1ZLSH 5F9JA 5FGBA 4OF3A 2Z35A 4M4PA 5DQDL 1RURH 3BPCA 1A7RH 4XMLL 5DD3L 3UDWA 3GRWL 3RY5A 2WBJD 1QUNA 1WCBB 5DUBB 3VRLF 5D6CB 4KJYB 3FOMB 4YHKL 2OTWB 2ATKA 2G5BB 2PYFA 2VSDA 3K4AA 1MLCA 1U3YA 5IBUB 3QWRA 1T03L 1LO4L 5BMFH 2V2TB 1UB6B 1PKOA 1XIWD 4LSRL 4JVWA 2IFGA 5T1LB 1F3JA 2FHCA 4V2CB 5F96H 1Y18A 1EA9C 4MNQE 1WITA 3EYFA 4XT1C 3IXAA 1I1YA 5IQ7L 3V5DB 4IBLT 3TVMD 3LHPH 3AROA 1LDPH 2FHBA 1QSEA 3MRNA 3KPSB 4PJGE 3QFJD 3BKCL 4LBEA 5INCA 4BFBD 3E6FA 3IFLH 3OL2A 1ZHNA 4UAOC 3EZJB 4WEBL 4YDIH 4PY7B 5IBTH 3B3IB 4YDKL 3WO4C 1CVSC 1GPOL 3KG5A 3ESUF 4FQXB 4WEMB 2QJDA 3G5ZB 2X41A 2FECI 1BQHG 3MLZL 3UC0H 5JHDA 1KCUH 2AABL 3JTSB 3OG6B 4ZXBA 2GSIB 1IKFH 1KCRH 1T0MA 1I8LC 2VDQH 3TYFB 4IIQC 1T7XA 3VXNA 2A0LD 2AJZA 3AS3A 3IJHA 1ORSA 5KJRL 1HQRA 1VERA 4KTDL 4P3WA 4M7ZC 1LO3H 4HFUH 4TSCH 3ZTJH 3T0WA 2GJ6E 4LSUL 4DK6A 3RUGB 4Z8FH 2R2EB 3U7YH 3VFTB 1YN7B 3QI9C 5BQ7B 4KK9C 4QHKJ 1S7XB 2FH6A 5F97E 1SY6A 3RHWK 4X7TA 1RIHL 3JV4A 3KWWA 3LRSB 3BH8A 4NBZB 2XN9E 1NSNH 3AS1A 3Q1SL 5DJXA 1BJ8A 2BSSA 5MENE 3MA7A 3GMOA 2R56L 5I1KL 1AXTH 3VG0L 4M1GH 4Q6IB 1UXWA 3VI4F 3G6AB 3HUJA 4U1MB 5E6IC 2BVQB 2I60H 2YRLA 4DZBB 3MCLL 5ENWA 2R1XB 5GRYA 3BN3B 3ILQD 4GRWB 1A8JH 4GAYB 1OD9A 1A14H 1LO2H 3KYAA 4NQTA 3S3JA 2VL5B 3VFGH 1AKJA 4G6AD 4FQ1L 5SWZE 2GITA 4KH2A 2E7CA 5T1MB 2A1WL 4PJBF 4GMSL 4XCCH 1RVFL 4YXKH 3L3OB 3P2TA 4ODUA 1CR9H 5D8JL 1ZLSL 4BSVB 1HWHB 4YHOH 2R69L 3CH8A 5FDWB 2IH1A 1RURL 4G6KH 5F3HA 5DJ6B 4YDVA 3G6JA 5EFIA 3UP1A 3UYRH 1VFAA 5EZOL 1UGNA 4OCRH 2FIKA 1XGQB 3CX5K 4PJ8C 5DHVB 4F15C 3KNBB 3UJIL 4WFHD 4XCFL 1QO3A 2IAND 5C0DA 5BMFL 5EBMA 1FBIH 5ANMB 2OSLA 1U0QA 1RZGB 2E6JA 2JJTC 4FFYL 3GUTB 2UY6A 4L4VE 1DBML 4QXGL 3ABZA 4MD4B 1KJVB 1EAPA 1JK8B 1QD0A 5KSBB 5KVGL 2R39A 1ZEAH 1DDHB 1JF1B 3UTSD 4XP4H 5J13B 5JORB 3LHPL 1UWXH 2E7LC 4X6EA 2NY4D 1LDPL 4GBXC 1JE6A 1MPAH 1NGQH 4JFDD 1RZIA 4ZSOB 3ZDZE 2Q87A 4DW2H 4KWUA 2Q86A 2IMMA 4YDJB 3IFLL 1T89C 2H2SC 2N4IA 3CFCH 3VRIA 3MRDA 4WU5A 4YDIL 5BZDA 3CZFA 5HY9B 4Q58C 2EDYA 5KS9E 5HI5D 2VZ3A 4HFWB 3RFZC 4JQIH 3OZ9L 1SY6H 4XGZA 1OP9A 5I15H 3ULUL 2O26U 4L3AA 4HAGA 1T1ZB 1JTOA 3DJ9A 1KCUL 2ILLA 3AXLB 5ALBH 1A3RL 2BNUB 2IADB 1I7UB 1IKFL 5DJCA 3WUZA 4LARH 4UAOB 5F89B 1VACB 5I2IA 2P24A 1NFDB 2HA1A 4WW1A 3RZCC 3GEWB 4RA0C 4Y2OA 4KJQC 4P4KA 4HFUL 4TSCL 3WNPA 5EO0A 3SDAA 4PRHE 1EHXA 4HS6B 1E27A 4JQXC 4P2QD 4FQ2H 4Z8FL 2X1WL 4OF5A 4X6CE 3NIGE 5AZEH 3NBNA 1HHHA 3ILPA 2VLMD 3V4VL 5EIIB 3RY6C 4K3JH 1A0QH 1K8IA 3OKEA 2C4FU 1JZ5A 5BW7C 3KXFA 1FFPB 1XH3A 1MCEA 1A9BB 1CDGA 1ZGLB 5DGQA 1KLGB 1S9YB 4YQXH 2YPVH 6CGTA 3IU3A 1KPUB 1QG3A 3WDHA 2YPLD 3NACH 4PJ7F 4JCMA 2EIZB 2I24N 4LU5L 3V52L 3SDYL 5GS2H 5IGXH 5DFVC 3TWCH 4RA3A 5EC1A 5KSVB 3ULUD 3RX7A 3GJEB 1D5IH 1LO2L 3D39A 4W6YB 5E08H 1FC1A 5C0CE 2OI9C 1INDH 2XG4A 1VFBA 4NM4H 1OGAE 4L9LC 4XH2A 1QZ1A 4OCSL 4XCCL 4YXKL 1K5NA 3MV9D 3OXRB 1CR9L 3UJJH 3SBWC 4BFIB 4UDTB 4YHOL 5L2JA 2NW2B 1Z9OA 2KPNA 1OSZA 1F02I 1FC2D 3TNMA 4LCUA 4KY1L 3FJTA 4Y1AE 2VDRL 1HSBA 5E2VH 5F93C 3V6BR 3UYRL 3ZE2F 4NQDB 4WFEE 4P57B 4KKBD 5AAMA 1J1XL 1MF2H 2P8LA 5BRZD 1FBIL 1WWCA 1XGTB 1AH1A 5CGYD 1OP3K 3BP6A 2VN7A 1PDKA 5T3XH 1LILA 1U8LB 1IGJB 4XP4L 3QNYA 3PL6A 4NNXA 2NX5A 4PJ8B 3VD7A 4DW2L 3LQMA 3P11H 3QWRD 2BOBB 3MRJB 4PRNA 5T3ZH 3UTZB 1ZWIB 4XXCA 5B38B 3J7HA 4MDJA 1SEQL 2J1KA 3R0MA 3ULSA 4Z18A 3RQ3A 5C0IA 3FO1B 4OJFH 5KANI 4NO2A 2CR6A 5F1IA 1YNKH 4I0PB 4YFLI 3MV7D 2CLZA 2APXA 4M48L 3BDYH 3G5VA 4F7TA 4WUUA 3QH3B 4P2RE 1JZ4A 1N8ZA 5IMMA 1K4DB 5JHLH 3PWPB 1MIMH 3VXPB 1H0DA 2BVUA 1GC1L 3ARGD 1UVQA 2DN7A 4K23H 5D7SL 1HXMB 3LKPB 1MHEB 4PJBB 3AREC 3BXNB 1LO0L 3DI3B 5F8QC 4FQ2L 4P5KB 5KZCD 2HP4A 4PRIB 1QLRA 3IKCA 3Q3GA 4ZXBD 4CUCA 4MXVE 2WWKT 1V05A 5AZEL 3U83A 2EDLA 1OARL 3W39A 4U1JB 1S7WB 2FO4A 2X70B 3BHBA 2KKQA 3H7LA 4MD0B 1ED3B 3QEQB 3ARVA 4K3JL 2ICES 5I0ZA 1A0QL 4D3CH 1JCKA 1I1FB 5LAXA 3BD3A 1J11A 3MRKA 4XNXL 4HKJB 2YPVL 4KRNA 4AH2A 3JSSA 4BA8A 5C92A 3VGAB 3WL9A 4LRNH 3L3GB 3K8KA 1AY1L 1ZLWH 3TWCL 3C5ZC 3CVHA 3SE8H 5JZ7C 1JYVA 3HC0A 4MXQC 4MX7A 5ADPH 4NM4L 4MJ4A 1ZSDA 1FIEA 2X4UA 2YMXH 4MD5A 1WLHA 5JTWA 2QR0B 5F3BB 5F7YC 5K9KA 4OGAC 1IZJA 1PG7L 2JB5L 3MRPA 3UJJL 5F7WC 1RFDH 2EEAA 3CAFA 4F7EB 5FGCE 1IKNC 1U8PA 1QSFB 1F97A 2Q1EA 4G42A 4UIMA 4R26L 5I1EH 4JFFE 4K9EC 1AKJD 3BWAB 5E2UH 5E2VL 2OM5A 2E8YA 4OLWH 3MLTA 3RBSA 4L9LB 5BJTA 4DKEH 3O2VH 1J0YA 3IAPA 1BHGA 3P4MB 3MLUH 4RGNE 1V8HA 3B2UC 2YD4A 5IFAL 5DLMH 3R06B 1MF2L 5DDHA 5F9DC 5HTSA 3L5WB 1LNUB 3NCYS 4YGVB 3QHTC 1V3KA 3GKZA 5JXEC 4JY4A 5T3XL 1JV5B 4M7LH 5SWSE 4ZUUB 3R4DA 5GS2D 4DZ8A 2X4RB 5IB3A 1R24A 2GY7B 4K7PL 1KCSH 3T8XB 4Q9BA 5DI8B 5CMAA 5J6GB 2W9EL 5CSZA 5F9OL 1DSFL 2IJ0C 1U42A 3W9EB 4C4KT 4S1DD 1K3IA 3X3GH 2A9NL 4EIGB 3QWQB 4ZNEA 3VFRA 4LVOB 1UADC 1UEMA 3O6KL 1YMMB 2XXCB 2N1KA 3BDYL 3MODL 3E2HB 4PJ7B 3U79A 4TYUA 1QNZH 4X80L 5CP7B 1JNHA 2EDRA 4I4WA 5JHLL 4NNPH 3HMWH 3W0WB 4F7PA 3DVGA 5K9OB 3QUZC 2M8XA 3UTTB 3U2SA 1ZV5A 4H0GA 4NZRL 3BD5A 4LPYA 4QNPE 3CVHH 3LPGA 4K23L 2VISA 2YXMA 1BQUA 4JKPL 3ZKNC 3HRZB 4BK5A 3FQNB 1BF2A 1NCNA 2D7MA 5T3XD 4LQ1A 4PY8J 2J7LA 2N7BA 2AV1A 1UWGL 3NAAL 4TPRL 3RNQA 4IRJD 5DFTA 5DQ9A 4J8RA 4P4KD 3CXHK 2W9DH 4GMTH 3SDAD 4NWUH 1JTTA 1ZANL 3AREB 4WFFE 4XNQB 1MJ7H 4OD2B 4P2OC 3V5HA 4H8WL 2BSED 3EO1A 1KJMB 4LRNL 1C12B 1Z0NA 5INDB 4O02H 3QDMD 1E4KA 2D4FA 3R8QA 3QQ9C 4NQEA 3DURB 3D6GA 2JK5B 5IOPB 1IAMA 2A73A 3UPRA 3O45A 3L5HA 3KXFD 5FM5M 3O2DA 3B9DA 4MNHA 1JPFA 1XF1A 3BD4A 4L8SB 1YY8B 4ZUTB 4IHOA 2ED8A 1AR1C 3LAFA 1NBVH 4UNUA 2DYPA 1JGDB 4ISVB 4U1LB 3VCLB 1RUKH 5KSUB 4Y4HB 1IM9D 4U05A 1VHPA 1XF5A 4JM2A 1VADA 3MFFB 4YH6A 3V4PH 3F12B 2A83B 3O2VL 4M5YH 5I30H 5JLZB 1I9JH 2XWTA 4MCZA 1SMAA 5DGRA 5IB5A 2VXTL 4ZFOA 3OAZK 2J4WH 3DRTA 3W82A 2SEBA 2VZOA 3DVFA 4PJXA 3WD5H 1FQ9C 4X4ME 4G80A 4N0YL 4U49A 3VXUA 4EXKA 5IG7A 2X4OB 3QJHB 5B3JE 3HG1A 3BQUA 4IJ3C 5I1AA 5DJ8A 2DMCA 5F7LB 4QT5B 1IC4L 5IK3B 4HUKB 2VLRE 3QFJE 4H1LB 2COQA 4DN3H 3X3GL 1QBLL 5GGSA 2XTLA 4ZOAA 4PP1D 5DJ0A 1JWMB 2G60H 1WK0A 1E4WH 5B39B 3V2AR 3V4UH 1Q72L 1NGXB 1QNZL 4TUKL 3PP4H 5I1LB 3WHXB 3U82B 5KSAC 4WUKH 3TV3H 4W4OA 1ACYL 2GTZA 3PGFL 4HK0B 1ND0A 1U3HB 1XR9A 4LEOB 2QQLL 3MRMA 3CVHL 2EC9T 2I9LA 5DUMH 3AGVA 2X2YA 4LSQH 5EU6A 4R3SA 3SCMC 3STLB 4WUUD 3O2DH 2A6JB 2X4QA 3KS0J 4TTDC 2EECA 1GJIA 3FT3B 1YY9D 4HWNA 4NQCE 4Z7OF 1H3PH 3DROA 5ELIA 1VEOA 5DMKA 1S7UB 2YD9A 5K9QG 3L95A 4LOUC 3FO2A 1MFAL 4QCIB 4QY8B 4UUJB 1TIUA 4GMTL 2QHRL 1JFQL 2IMNA 4Z6AT 1MJ7L 1RZJH 1WWBX 2NTSP 5FO7A 1DBAH 3V8OA 1IGTA 4O02L 4HMEA 4YEEA 1BBJB 4LK4A 2NY3C 3HPLA 3C6LA 1QBMH 2MKWA 4P46D 5D9SB 2VUOA 2EZ0D 3MLWH 4NQUA 2X4SB 3MRBA 1OW0C 1TZGH 2VDPH 4LKCB 5TF1H 1U8HA 4G7YH 4GAFB 4D0BA 5I71B 3DO7B 4JM4H 1NBVL 4GKZB 1NGZB 2BDNL 1QA9A 4GH7B 3JTTA 4Y16B 4FXKA 4WY7H 3QDGE 4HC1A 2CKBB 3KLAA 4HWZA 3MO1A 5I30L 4XI5C 1P7KB 1T1YB 4NDMB 4PJIE 5CJ5A 5H2BA 4BM7A 4PFEA 2IAMC 3WLWC 2OJEA 5CINL 4GG6F 5HHOB 5CJXA 1NEZB 2XV6B 5GHWL 2R23B 1FH5H 1V3MA 5EZJB 4WFHE 2J4WL 1P5VA 4GRLA 3IDMB 1PW3A 3WD5L 4C55A 5I6XC 4BSWA 2HLAB 3QO0B 5IWLA 3NCFB 1UJTA 1P4BL 2QSQA 1FL3A 4U1IB 2Z8SA 4B7IA 4I9WD 1FLTX 4QRRD 4JFEB 3PWNA 1OLLA 4I3RH 3IRZA 2ZCKL 3FO0H 1FVCB 4WEUD 4MDIB 3RIAK 4JFDE 4DN3L 1J87A 4OGYL 2F19H 1JPSH 1YYML 4IRSD 1UACH 3EYVA 3HZKB 4C56A 4EUPB 5DHXB 2V17H 4NPYB 2G60L 3CDGB 4HZLB 4E42B 4E41D 3EKCA 4F57H 2BNRB 3ISWA 1CICC 3RGVC 5TFSL 5E56A 2Z4QA 3PP4L 1H8OA 4MQXD 3C60C 3N50A 3FB5A 5EBWA 5HYJE 1S9VB 1FN4A 1QPXA 2NY2C 3B9EA 1HHGA 2FYYA 3ZE1E 1NANH 5DUML 2WWMD 3TBTB 5ACLA 3MLVL 2AJSL 1M71B 3FFDB 4PJAA 1CFQB 5EZLA 3FRUB 3H3BC 4APQD 4L4TD 2HH0L 1A3LH 5JO5B 4PJDA 2VH5H 3HNSL 1F6AB 4HS3A 1T21A 3R0NA 4OLXL 4DAGL 4XP6L 4AG4H 4PUBH 4WO4C 3ZL4H 4NRZB 1P84J 2R2HA 3JV0A 1CE6B 4MQ7A 4ZPVB 2IQAB 4GW1A 2WW8A 4OUUA 1WBXA 4YHPB 1G9MC 1DBAL 1XR8B 2AXGB 1MHHA 2E3VA 2MCPH 4F3FA 2BVPB 3BE1L 2IPKB 3KYNA 4JRXE 3IJSB 5HD8D 1JUFB 2NY0B 4R4FH 2YPLE 1QBML 1WZKA 3RNKB 2VDPL 4FQQA 5I1DB 1L6ZA 5TF1L 4EN3C 4ONHB 3ULUE 5IQ9A 4Y5VC 2WUCH 3MRHA 4D94A 2XXMB 1R3JA 2DM7A 1IGYA 1G7IB 5C07A 2J12B 4NQED 1AHWC 3MQIA 1KSRA 4Y8DC 2A9MH 3KLHC 3FN0H 1EEUA 1GGCH 2FJHA 5SX5H 4OLZL 4WY7L 1Q9LB 1JGLH 2QKIB 3MLYH 3KLSA 4H25B 1X5LA 2YA2A 4M43H 2V9QA 4YFLF 4G8IA 3RL1B 2BSRA 2VSCA 4X6FB 4ONFH 2W91A 4WGVB 3AAZB 5ESAA 1CFSA 4ETQB 2ZOKB 3RWJA 5HVHB 1FJ1B 1FH5L 4OZHF 3D18A 5DK3A 1ZLVH 5K93A 5BRZE 4JM2D 1YUHA 3LMJL 5DK0A 2OR7A 1H3XA 1NBZA 3G08A 2HJLB 4MJ5B 4GW5B 3AS2A 1FDLH 4N9OB 5DO2C 5EUKA 3NFNB 3FO0L 5GGVH 3I9GH 2VLKA 3QULA 3WDJA 1MAJA 3OAUH 2FEDC 4ONGH 4RCAA 5J6HA 2AKRA 3ARRA 1YC8A 4GRMB 3CK0H 3O6MH 4L8BA 1I8MA 3VXUD 3MJ6A 2V17L 5EOCJ 4OI7A 2EYSB 2ARJQ 3HG1D 3BQUD 5I9QC 3S4SG 1BD2B 5E8EB 4U1HB 3PQYE 4X99A 2UWEA 3MRQB 2H2PD 1GH7A 3MV7E 1P7QA 4HULB 5IVXF 1HHIB 4N9GB 1WUNT 3O9WA 1FFOA 3EGSA 4K71C 3QIUD 2QADD 1OTSC 3GMQA 5BV7C 5GZND 2NY5L 4YX2H 4WI7A 4ZAKC 5AUMA 1INQA 1BFOA 1T1XB 4GT7A 4KQ4H 3VXOB 2WQ8A 1SYVA 3NFSL 5KBNC 1B90A 4WTZG 5IFJA 1Y6KR 2C1OA 1LQSR 4UNTA 1FNEB 5I18H 3GSVB 1FORH 4LLMB 5AAWA 4HUXB 4PUBL 4HUVA 1K2DA 2CDFB 1WJ3A 4LSSH 5EU6D 4ZMAT 5GS1B 2B5IB 4ORGB 3BGMA 3RWIB 3QZWB 4JVUA 3K80A 5DT1H 4NO3B 3AM8A 4HC1L 1I8KA 1V3LA 3VXMB 3F7YA 3S97C 4X7FC 4GG6B 2ADIB 5F1NB 4LPWA 3Q5YA 4FFVC 3RPIB 1G7LB 4R4FL 1NAML 4HX1B 3PDOA 4R4ND 3KYKH 4WO4B 4OCLC 4NKMA 4LLUA 5TQ2H 5IJKA 3D2UB 2BVOA 2A77H 3LZFH 4Z7QE 5SWQA 4UQ3A 32C2A 1X6LA 1F2QA 1J5OL 1XMWA 1AGBA 2QL1A 3S96A 1IEAA 3D0VB 4WFGD 2DQEH 3C6LD 2A9ML 4QGYA 1GGCL 2ADGA 2E6QA 5EU4A 2ATPA 3RL2B 4AQ1B 2O5YL 2EH7H 1JGLL 3O6FB 5HYSG 5HYFA 2B1HH 4Y5VB 3U4EB 4M43L 1KB9K 1SM3H 2ZSVA 5CZXC 5FK9A 5CBAA 5HSFA 5C7XH 1U95A 5MERB 2DBLH 4ONFL 1J0HA 4HIIB 5TDNB 3RDTB 2NYYD 3LB6C 3QNZB 5FOJA 1GHFL 2IBZY 4ALAH 4WI5A 3H9ZA 4N1HB 4Y4FB 1MAKA 1C5DB 3BUYA 4I3GA 3OKNB 2DOCA 1MUJA 3V6FA 3I3EA 1T2QH 1UXSA 2CRMA 3C5JA 1FDLL 2J6EA 2OL3B 3NIDF 4IRZH 1ZXQA 3S98A 3EIFA 3QEUB 1T7YA 2AJXH 3O4OC 3OGCB 4P5MB 4W81A 5GGVL 3I9GL 4KQ3H 3CFDA 4LCCB 3OAUL 1NFIA 3VXTB 4GRLD 3WUWA 3ZDXF 2FO1A 3OKKB 5DFWH 1ZS8B 1ZHKA 2Q20A 3CK0L 4OD1L 5FOBA 1RZKH 1T5WA 1WAAA 4XNYH 4XXDA 5D72L 3UTQA 5IB2A 1N4XL 5D1QC 1A5FH 3JV5A 5IT2L 3KPQB 2BP3A 1NC2A 4OLYH 3B6SB 3IETB 1N7ML 4JFPB 4DQOH 4M1DH 1N5AB 1JZ8A 2RGSA 1TENA 4L3EE 3V0WH 4DWHA 4C56D 1RZ8A 5HVGB 3QUXC 4I3SH 4YX2L 4Z76A 4QHNA 2VERN 3QNXB 2D03H 4QRTA 3WS6A 1EBAA 2CDGB 1EHAA 2PTTB 4FXGA 4LLAA 1P6FA 3SKOA 4AJ0A 4HBCH 3MOBH 2WBJC 4KQ4L 1CL7H 1OAYL 1YEIL 4BFGA 3M45A 2R0LL 4PB0L 1ZVHA 4UT9H 1VA9A 2EIDA 5CKAA 3OBAA 4E5XB 1L7TL 1WCBA 5DUBA 4ZODA 5D6CA 4KJYA 3FOMA 2OTWA 3RVWC 2G5BA 5T3XE 4LSSL 1JZ2A 5L8JB 4HKXB 5DJAB 4KRPD 1NCCH 3STBA 4OT1H 5E00B 1UB6A 2V2TA 4OLVL 5DZNA 5T1LA 4G7VH 5GGRY 3OJDB 2F58L 4N0UB 3HB3D 1KGCE 4DEPC 1UA6H 4LNRB 4XVJH 3V5DA 3BYTA 4OZHB 4YHZL 1YEFH 3DSFH 5D2NE 3KPSA 2P5WD 3QDME 2Z9TA 1SBBA 4P3DB 4AK1A 3GHEH 2NY6B 2A77L 4PY7A 3UTPE 3QDHA 1KCVH 3B3IA 4R2GB 2J6EH 4FQXA 3EJZD 3G5ZA 1NLBL 2C3WA 1BZ7B 1PX4A 3JTSA 2EH7L 3EOYG 2V5RA 2GSIA 4WNQB 2VQ1B 4R0LC 3RWEB 2FH8A 4JY6B 1SM3L 2PCPB 3TYFA 3HE6C 2FX7H 3CLEH 3HPJB 3M8OL 4YBHA 2BSTB 1EJ6A 5IVXB 4POYA 2DBLL 5C07D 1Q1JH 1VFMA 1RJCA 3QIWB 4HPOH 4M5ZL 4MS8D 3DMMB 3GSNB 4DVRH 4P23B 1ZOXA 1DQLL 2J8UF 1JHKL 4KI5D 1S7TB 1B4JL 2R2EA 35C8H 4UINH 5KVEL 3VFTA 2Y07H 1YN7A 5BQ7A 4FTVB 1JGVH 5C0BB 1S7XA 2M1KA 1FGVL 5EUOE 1NGWB 4KHXH 1K85A 5DRNB 5C08B 3LRSA 4IRZL 4OZIE 4TVPL 1IQWL 4TOYH 4U3XA 2J88H 5D71H 4Q6IA 3ILQC 3G6AA 4U1MA 1RZKL 4XNYL 2BVQA 1BEYL 4TSBH 4DZBA 2R1XA 1A5FL 2DQUH 2XI9A 1H15B 4LPUA 4RGMC 4U1KB 4G6AC 4GAYA 1IC7H 1IEHA 4OLYL 5EO1B 4TSAH 3O4OB 4DQOL 1X5AA 2VL5A 4M1DL 3S34H 1FE8H 3VXRB 3DYPA 3V0WL 5T1MA 3HKFA 1LEIB 3MUHL 4I3SL 2DQCL 3L3OA 5LGKA 3K81A 2D03L 1II4E 4X5WB 4BSVA 3MOBL 4YO0B 1P7QD 5FDWA 1B88A 1CL7L 1BF8A 3O9WD 5DJ6A 5EULV 4UT9L 2X10A 2VTFA 3EDDA 3QXAB 1V5JA 3U4BL 3BPLC 2AEQL 1XGQA 2HLFC 3O3UN 3DI2B 2Z92B 4L3CB 1PBYA 5DHVA 3RJQB 3KNBA 2IGFL 2X1QA 4PJ5B 1CE1H 2G75B 4OT1L 2DQIL 4TVPD 3MLSH 4N1EA 5ANMA 4G7VL 4R7DB 2E27H 1RZGA 3GUTA 3WNLA 4CMHB 2NY4C 2FDBP 2BY2A 2AEIT 2APFA 2JIXD 1L9MA 4MD4A 3SGEI 1KJVA 1JK8A 5KSBA 3FO9B 4XVJL 1DDHA 1JF1A 3QWOB 3HNVL 5JORA 1MFEH 1YQVH 4OIIH 4ZSOA 5I73B 3DX8B 1QBAA 2YUVA 4YDJA 1YDPB 4YAQB 4ZQKB 4LLQB 3GHEL 4LVEA 5HY9A 2DMBA 2WZPD 3ZDYE 3H7BB 1G6RL 4HFWA 2ZCLH 2FATL 2FLBT 1A4JB 3HC4H 4XX1G 1T1ZA 2ZUXA 1I7ZB 3WIHA 4XC3L 3AXLA 5DJYB 5ID1B 2BNUA 2NR6C 2IADA 1I7UA 4KVNL 5F89A 1VACA 3GSOB 2IWGA 1NFDA 4DGVL 4YXLL 3BMWA 5LGHH 4KUCD 2R0KL 4GRWH 3VFSB 1JVKA 3FFCB 4DVRL 3GI9H 4YC2C 1GZPB 1UT9A 4NNYB 1YMHB 2Q7YB 4JPWH 4YJZL 4HS6A 1KNOB 4OI8A 1J8HB 2GK0B 1S5IH 3MUGB 5DQJB 3NA9H 1Q0XL 5K59E 5A2LH 4HS8H 2GUOB 1I8LA 5IUSA 4KKCD 2P47B 3ZYZA 5EIIA 3HE6B 3L7FB 2QV2A 2W59A 1QP1A 5IP4A 1YEDB 2IBBA 1FFPA 2YD8A 4I9WE 5FA4B 1A9BA 1ZGLA 4QRRE 4NRXB 2NY1D 3C09C 2J88L 1KLGA 1NBQA 1S9YA 4MLIA 2R29L 1KPUA 1OPGL 5KN5B 2EIZA 4K3EH 4LVHB 1FYHB 3ULVH 2DQUL 1QRNB 3DUHA 5DHVH 1QVOB 5KSVA 1ZAGA 4QKXB 3GJEA 3CXDH 1R3IH 4KZDL 3F8UB 1MCNA 3S34L 1SBSH 4E41E 3B5GA 3MYJB 3MJ9A 5I1IH 5FECB 5I0DA 3ZT7A 3T2NL 4TNWK 2GT9B 4TNVK 3C6SB 4PJFE 1ES0B 3OXRA 3BPNC 1U3JA 3GSUB 4UDTA 4XTRD 4BFIA 3K74B 4RGMB 4P9MH 4ZNEE 2DTMH 2NW2A 1NC2D 5EA0L 1MRFL 3JVGA 1UH2A 1CXFA 2BNQD 4PGCB 2A6IB 5D7IF 4K8RL 4NQDA 3O4LB 5FGBC 2EIEA 5DZOA 2G5RA 5CGYC 2X9XA 4L4TE 4MJ2A 5JMRA 4P57A 2UY7A 2GIYA 4YXHL 1CE1L 3QPQD 3UDWC 3U0WH 3WIHH 5GZOD 3THML 2AJVH 5J12C 3MLSL 1S7RB 1XGTA 5DHYB 2VC2H 2E27L 4CL7A 2AQ1A 5CD5D 1KIPB 4XRCB 2ORBL 4F9LA 1U8LA 3QXUA 5LWYH 2J8UB 4HKBB 1IGJA 3DETC 2VZVA 3AFLA 1MFEL 1YQVL 4OIIL 3JWOH 4PJ8A 5FHAH 3V0AC 5B38A 2BOBA 3MRJA 3UTZA 1ZWIA 4BZYA 2NXYB 4KK8D 3MMEB 5T1LD 3GB7B 4WDIB 2VE6B 1CDIA 3CMGA 3FO1A 5KANG 4I0PA 3HUJF 1U41A 3HC4L 4NIKB 1ODAA 1KTRL 5J11C 2O61B 4XHJC 4M4RA 3KPSD 3MOQA 2CXGA 4JPIB 3LKQB 3MNVB 4NQEE 3QH3A 4IS6B 1T89A 3H9SE 4JHAL 1CLZL 4MMXC 2PNDA 1K4DA 5FB8B 1YECL 1L0QA 3PWPA 4K8RD 3VXPA 4FOMA 3LKRB 5E7BA 4FQXD 1KXVC 3GDBA 1AGEB 2R4SH 4ZXBC 3GI9L 3MSPA 1HXMA 1MHEA 3LKPA 4PJBA 3BXNA 2D0GA 2VDKH 4AIZB 1S5IL 4C54A 4P5KA 4PRIA 3NA9L 2IALB 3MJ9H 2W0KA 5DXWA 1N64L 5I74B 4U1JA 4MQSB 1S7WA 4MD0A 1ED3A 4HG4J 3QEQA 3SGKA 3VWKB 1I1FA 2EDQA 4YC2B 1FL5B 1MI5B 3IXTB 5IBLD 4HKJA 3T4AB 1JL8A 4JQXA 4NP4H 1VGKB 4DCQB 1T04B 5DMGD 1E4XL 3NPSC 5GS0C 4K3EL 4AL8L 2HTKD 3L3GA 3QXVA 1DANU 1R3IL 2X42A 4DTGH 4WV1B 1KN4H 2WIIB 2Y5EA 1A7OH 3D87B 1WGOA 3WDIA 4QOKB 1D6VH 2AJYL 3DECA 3D69B 4LSPL 5GISH 4R6UA 5I1IL 4OFYA 1S5HB 3CVIH 2QR0A 5F3BA 3TBWB 1IBGL 3PJSB 2VO5A 3O3DB 3FQXB 3OJMB 4PIRF 2LQRA 2W38A 4F7EA 4P9ML 5ITBH 3H8NA 5I1JH 4JFXB 1QSFA 3IU4H 4FXLA 3BWAA 3QG7H 4RBPK 1LMKA 1I1AD 3BKMH 4L9LA 4S2SB 3P4MA 3L9RB 3TF7C 1EDQA 2BOCB 4PJHB 4PLKC 3R06A 4BH7B 3SBWA 4R97B 3WIHL 3BZ4B 1NMCB 2AJVL 3VXSB 3L5WA 4ERSH 1LNUA 5L8KB 4MXWL 5CJBA 4YGVA 3UCRA 1RZ7H 3DXAE 4GFTB 5EU6E 1JV5A 1MCIA 1LEKB 1UZ6E 5LWYL 1QBBA 4ZUUA 4Q9QH 3OTTA 3F7VB 3TBYB 3NA4A 5E8PB 3TFKD 3RA7H 1WIUA 1JN6B 1TJGH 2X4RA 3L5XH 3OR6B 4H88H 1OAKH 5FHAL 3HHRB 4G8FB 4Y4KC 1JRHI 2DKSA 4S1DC 1ORQB 5F7UA 3T8XA 2ID5A 5DI8A 1K4CB 1YA5A 5J6GA 4OM1H 2DQDL 4N8CH 2HKFL 5T1KB 3W9EA 1QFUH 1HCFX 3J8F7 4G9FE 3VGGA 2Y25A 4MA1B 3QR2A 4N0RA 5E7FA 5HHMB 5L2KE 3QEGH 4PJ7A 2I25N 4G8GD 2XZZA 1QHOA 5CP7A 3T0EB 4U6HB 5IVNA 3W0WA 5K9OA 4YE4H 5E4IA 5JOFB 2CRIA 3UTTA 1FRGL 4GAJH 4UV7H 4QRSB 4H20H 4RZCB 1QYGH 1FHGA 1MIEL 1UYWL 4K3DH 2RJMA 3HRZA 4AM0B 3PIQB 5BVPH 3FQNA 5FXCH 2PYED 4K7PY 4V1DE 2EH8L 4P4KC 3NCBB 2B0SH 4XVUD 4FFWD 3ESVF 4RMSA 3SDAC 15C8H 3QCVL 2QSCL 1KLUB 1KT2B 4ZOEA 4G6JH 4DJMA 5JUEL 1VGEL 2W60B 4XBGB 5D7IB 1X5FA 1BLNB 2P48B 3AREA 4Q0XL 4D8PB 1CLYL 1AIFB 3LKOB 4OD2A 1UENA 4XNQA 4OF7A 1A6VH 4CJ0A 5F88B 3I75B 2F53B 2KDGA 4U7SA 1KJMA 1C12A 5E8OB 5INDA 3UJTH 1CGXA 4OM0H 3EFDH 3DURA 4PRAB 1PQZB 4Y5YB 2DF3A 2JK5A 5IOPA 3ES6B 2V2XB 3B9AA 5I1CH 3ZDZF 3QI9D 1YY8A 4L8SA 4ZUTA 1ZHLB 3NPSB 5IHLB 1X5ZA 5CJQL 5BS0E 5ITBL 4PRPE 1JGDA 4ISVA 4U1LA 4BELD 5I1JL 1YYLH 3VCLA 3V7AG 1FCCA 5KS9F 4M7KH 2C26A 3HAEB 3JBG7 5EZIH 3KPPB 5KSUA 4Y4HA 3IU4L 2X6MA 2UZIH 2W1NA 4L8CB 2WBWB 3Q6GH 1YC7A 3MFFA 4Y2DB 1CFTB 2VZUA 1BIHA 3F12A 2A83A 2P5EE 1MCBA 3SO3B 3BJLA 4Z0XB 5JLZA 4M6NL 1OCWH 4YWGH 2BC4B 2Q76B 4NKQB 1BAFH 3WMSA 1IL1B 1MVFA 4ERSL 1A22B 2VWEE 2DRUA 4IOSD 1ZHBB 2XTJE 1WC7B 3L3DB 5D5ME 3RVTC 1KEMH 4PJAE 3GO1L 2HFEB 4NSKB 2XG5A 2X4OA 3QJHA 3ARYA 4KDTC 4B7LA 4NC0B 1VPOH 4H88L 5I75B 1ZT1B 4X6CF 1OHQA 1FAKT 1JPTH 3BJ91 3MXVL 2R8SH 4QT5A 4W68A 4OM1L 5IK3A 1CGVA 4N8CL 3SPVB 4FMKA 2P5WE 4H1LA 1LO5B 2VXVH 3PL6C 5JXEA 2APBA 5E8NB 2V7NB 1M7XA 3FRPG 4XP9H 4LMQE 4YPJA 3DVNB 4XXCC 4JGMA 1BJ1J 1JWMA 1PZ5B 2EC8A 4PJ8D 3QEGL 5B39A 4Y4KB 1IGIH 4MYWB 1NGXA 5I1LA 3W2DH 3WHXA 5L88L 1VKXB 1P5UA 3BAEH 3HI5H 4MNQB 5MEQB 4I0PD 4GAJL 2VNCA 4HK0A 1U3HA 4NWTL 4H20L 1I3VA 4LEOA 5B22A 3LPWA 4E9LA 4K3DL 1TPXC 4J3SA 4QRUB 3MGTB 4PJGB 3STLA 5BVPL 2A6JA 1AGCB 4FZ8H 3FT3A 4Z7VE 3P0VH 2PW1B 5HXMA 3D1MC 1KYOJ 1S7UA 4M02A 4ORZC 4JFZL 5LBSH 1IAIM 4QCIA 4G6JL 4QY8A 4UUJA 2ZUQB 3T3PE 2YUWA 8FABB 1YEJH 4OGXL 4WI8A 3N06B 1RUQH 2AXJA 4PRID 12E8H 5D1XB 1A6VL 1HK6A 3VWJB 2DLHA 3VW3H 2DQJH 3UJTL 5JDSB 1YNTB 5GGTA 3RZCD 1BBJA 4KJQD 3QT2A 3PG2A 1DQDH 2MQ0A 3GBLA 3AMLA 5D9SA 4AENB 3LEVH 1JHTB 3NOIA 2X4SA 3F58H 4LKCA 3UZVB 1C5BH 3F62A 3N1PC 1QFWH 1N0XH 3OQ3B 4A6YB 1TMCB 5E6ZA 2F5AL 3DO7A 1J9CT 4GKZA 1WICA 1NGZA 2EYRB 1MY7A 4M7KL 5D2LF 2VKWA 5EZIL 4Q2ZB 1ZKAA 1TJHH 4Y16A 4PG9B 2OS7A 4H1LH 4OFYD 5EO9B 4IDLA 1EMTL 2CIIB 5MENB 3LEYL 3WXWH 2XICA 3HFML 2CKBA 1AD0B 3TJEH 1P7KA 1T1YA 3MNZB 4NDMA 1OCWL 2DJUA 4FQCH 2PN5A 4PRBB 5GQBA 3OHXB 5HHOA 2PXYB 3MXWH 1NEZA 2BERA 3HI6H 2R23A 5EZJA 3HZVB 1JHLH 4OUOA 4F80A 5A2IH 1A6UH 3IDMA 3KR3L 4TVPE 5SWZB 1KEML 2HLAA 3QO0A 4KRLB 4BFEA 3ZLQC 5DC9B 1TVHB 1D5XB 4U1IA 4PTTB 2QEJA 3Q48A 3O0RH 2FBJL 4MXVF 4JFEA 4UBDD 3IRPX 1F45A 1JPTL 3VFWB 4J7RA 2GJZB 1FVCA 4XP1H 3L6FB 4MDIA 1MVUA 1XGYL 3NPZB 2B7DT 3ZTJG 4P0DA 4PYGA 1EFQA 2FJGB 4KZEH 3HZKA 4UDUB 4AMKH 4EUPA 2IQ9L 4NPYA 5D7JB 3F7PC 4F9PA 3CDGA 4HZLA 4E42A 1OAQH 2BNRA 1YJDH 1HH6B 1IGIL 4R4BB 3PDGA 2HVJB 2HFGL 4J1UB 2P8PB 1X5IA 4OFVA 4XMKH 1AJ7L 3BAEL 1F4YH 4L4VB 1S9VA 3EYUH 1PSKL 1J1OH 2FGZA 5GGTH 1J0JA 3WFDH 1KG0B 2W0FB 5E2TH 4RISH 3TBTA 5DURB 1KFAH 1WQVT 1H8NA 3BDBA 1M71A 3FFDA 1CFQA 3FRUA 4FZ8L 3GMRA 5FUCE 3T1FB 3W0WD 3QCTH 1OGTB 5KS9B 5JO5A 2ITCB 3MOAL 3UTTD 1F6AA 3TJHD 1KN2H 5LBSL 3N1QC 5DJDB 4NRZA 3T0VA 1A47A 1YEJL 1CE6A 1EO5A 3NGBB 4ZPVA 2IQAA 1RUQL 3H42H 12E8L 5EU7C 4PBVC 1KACB 1KXTB 4YHPA 5I1GH 1KTKE 4EI5C 1F4XL 1XR8A 3QEHB 5HD8C 2AXGA 1SVZA 2CKBH 4LCWB 3U0PB 2ED9A 1Z9MA 2BVPA 1GOGA 3VGHA 2W92A 2IPKA 1NCUA 3U9PL 2NY7H 3IJSA 1JUFA 3WHE1 4JE4B 3EDFA 4RMQA 5HJ3B 3CFBB 3LEVL 3FB6B 4N0CD 1B2WH 3RNKA 5I1DA 1CN4A 4GLRH 1C5BL 1Q8MA 4PRHB 1QFWL 3ARED 4ONHA 5FHBL 1N0XL 1S9XB 1E4KC 2FX9H 2OTUB 2I5YH 2WMPA 5CLTA 1LE5B 4JPKH 4X6CB 4LKXB 4ZO6A 1NL0H 3QA3B 1DBBH 3KS0H 2XIDA 1G7IA 2GY5A 1Y6NR 2QQNL 4NN6C 2C9AA 2B1AH 2Y36H 1DTUA 3UROR 4ZFGL 2AP2A 1IAIL 1Q9LA 3CSGA 2QKIA 4O5LH 3MRLB 1HOCB 4H25A 4EUPH 1W0WA 3RL1A 2X1PA 4X6FA 2BNQE 1CD1B 5AZ2H 3AAZA 4ETQA 3M1BB 1RZJC 2ZOKA 4C58B 4JM2C 4MA8L 3LDBC 3OAYK 5JZ7D 2YPKB 3QUYB 5ICZB 3K4ZA 1FJ1A 3AB0B 2C7UB 5KG9B 1A6UL 4LCIH 4N8PA 5C0CB 1LWRA 1G84A 3D9AH 4QNPF 1OGAB 1D5ZB 5AD0B 2HJLA 4KPHH 4MQTB 4MJ5A 4GW5A 3RIFF 4ZUWB 2ICEB 3EOTL 3O0RL 1LEGB 3T0XA 2O5ZH 3NFNA 2D31B 3D3VD 4XP1L 1V7MH 3VFUB 1RPQA 5JIHA 2E7HA 3BQUC 4N90E 4KZEL 4GRMA 4HH8A 3C87A 4ODSH 2EYSA 5DVKA 3SJVE 5J57B 1J88A 3B2UD 1BD2A 1RJLB 1OAQL 3C9NB 4U1HA 5CUSH 5E8EA 5FYKH 4GXVH 3MRQA 5E1AB 4YHLH 1HHIA 2QADC 1NGPL 4N9GA 1F42A 5GZNC 4XMKL 5JXED 4WWID 1T6VN 4OLEA 2C5DC 4ZFFB 1UCBH 1NCDL 2VDNL 5E2TL 1KFAL 4TUJB 3BKYH 1T1XA 4AEHH 4W4OC 5HHXH 4O00A 3VXOA 4JR9L 1FNEA 5D2LB 5DYOB 3GSVA 5E5MB 4LLMA 4GO6B 1KN2L 1U3HD 4HUXA 1U91B 2CDFA 5IF0B 4OZ4B 3ARQA 2ZZUT 3H42L 5GS1A 4ORGA 3LQAH 3RWIA 4UNVA 3QZWA 4NJ9L 4NO3A 5I1GL 4P2RB 3VFPB 1EO8H 3MNWB 2CKBL 3VXMA 4GG6A 2ADIA 3NH7H 2YZ1A 4Y88A 4PR5B 3MTRA 3RPIA 4FFZL 2NY7L 5EIQA 1G7LA 3S36X 1WBYB 4HX1A 4WO4A 1LVEA 2Z91B 2EE2A 4MVBC 3I6LE 3ZKND 2FX9L 3EOAB 2NQCA 5GSVB 4X5XB 5B3JF 3D2UA 1A02N 4FP8H 1KEGL 4EI5B 5JNYB 5L9DH 3IDXH 1F11B 3TH3T 1I8IB 5DD1H 2DLFH 4I77H 1SEBB 2B1AL 2F5BH 3D0VA 4EOWL 4HCRH 2XKSA 3K3QA 3BZEB 1QSVA 3RL2A 1INEL 5F1KC 2D9QB 3GI8L 3O6FA 2CGRL 2YN5A 5JA8B 2VLLB 3FQUB 4Y5VA 3U4EA 3HN3A 1SYSB 2NYYC 2R15A 2YC1B 4PLNC 1KJ3L 4JY5H 3WFZA 3GSXA 5MERA 3GHBH 3I2CH 4HIIA 5TDNA 3RDTA 2F8OA 3S37H 1HINL 1J10A 3QNZA 1KULA 1TETH 5GRJL 1NUDA 4Y16D 4UTBH 4Y4FA 5ALCL 5HHVL 3WS3B 5CEZE 1C5DA 4LCIL 3OKNA 3D9AL 2IPUG 4YBQC 1KC5H 5L0QC 4PJDF 3O11B 4Z7WF 2DI9A 2OL3A 2XZQL 3QEUA 4GRLC 3OGCA 4P5MA 5HHOD 4D9QD 3QPXL 1DP0A 4LCCA 5IWLC 4JGJA 3VXTA 4JFFB 3P9MB 3SDCC 2ZJSH 3OKKA 2BZDA 3SDXE 1ZS8A 4XPHL 3ARSA 1T7VA 1WEJH 4ODSL 3NVQA 1N59B 1XF4B 4LASH 5FYKL 2NW3B 3KPQA 4RFNB 4GXVL 1A7BA 2F8VA 5TDOB 4POZD 2CIKB 2PO6B 3IETA 4JFPA 4O9HL 5C0EB 1N5AA 3BEWB 4ZSOE 5D96C 2FECL 3V6OC 2ADJB 4G8GE 5SWSB 4EBQH 3DOSA 3QNXA 4UT7L 1D9KC 2ENYA 2CDGA 5KVDL 2PTTA 2BNRD 1NDGB 1TQCB 3ZKMC 4AEHL 3TO4C 3QAZB 4PS4H 1HKFA 3BPOC 5JR1L 3RZWA 5GGVY 1TQBC 2W0LA 4NFDA 5CJOH 4KV5E 4HXBH 4ODBD 4E5XA 5F70A 4PV9B 2PYEE 1I85A 1Q9OB 2WP3T 3TIEB 5E99L 1EPFA 3LY6A 4HKXA 5EOCH 5DJAA 3VRJB 5E00A 3ARDB 4PJIF 3OJDA 2FGWL 5FV1L 4N0UA 3IJYB 2MTPA 3UTOA 3MJ7B 4LEXL 4C59B 4LNRA 4OZHA 3OWEA 5FYKD 4GSDH 4LFHG 4P3DA 5ICXB 1N6UA 1TZIB 2AK1H 4TTDD 1FNGB 2X09A 3VRLE 1RK0B 1RZFH 5DR5H 3W5MA 3CGTA 1VEMA 5DD1L 3HR5B 4WRLA 2OL3H 3DHJA 2NY0D 4Y19E 5F7DB 4QXUH 3A6BH 1BZ7A 1CFVH 1A7NL 5FKPB 3MV8E 1U8NB 3PGCB 4WNQA 4RIRB 2VQ1A 3RWEA 4JY6A 2PCPA 2VR5A 3U30C 3HPJA 2E9BA 2BSTA 3QDAA 3P3YA 5IVXA 4KI5C 3I2CL 1CWVA 5E94B 1A4KB 2H3NB 3QIWA 3U4AA 3S37L 2Z31B 2NY3D 1CGTA 1VDGA 3DMMA 3GSNA 4P23A 1CGWA 1TETL 4DKFH 1S7TA 1TLKA 4LF3B 3O8XB 4UTBL 3BRGC 1MRDL 2OLDA 4OTXL 3TC9A 3ZE1F 2YRZA 1QFPA 4FTVA 5DWUH 2RCSH 5C0BA 1F4WH 2YHGA 1KC5L 1IFHH 5CBEB 1NGWA 4MWFB 3OB8A 5A16B 5DRNA 2DL9A 3IDIB 4HWBA 5C08A 2RFXB 4NZJA 2CK0H 4LAQH 1O5DT 4X7SH 1MCPH 4W4NA 1F90H 2ZJSL 2BHYA 3ZHLA 4DGYH 1WEJL 4LLWB 3VGEA 3QP3A 4NCC2 4LASL 1H15A 3IT8D 2KZ1B 1P9MA 1FO0B 4U1KA 1C08B 1CFBA 1GIGH 2IAMD 3FAXA 4KK5D 4F8TA 3WLWD 5EO1A 1C1EH 2PR4L 3H2WA 5E8DH 5SV3A 3QDJB 3RKPA 3VXRA 3RRQA 3SDCB 4B50A 4A2MA 4DOHE 1LEIA 3H0TB 1XIWB 4YLQT 1E6JH 3GMPB 5D7LA 4S11A 3O9WC 4X5WA 3WFBH 3IKKA 4YO0A 4PS4L 2FR4B 1G1CA 3TVMB 3F6LA 3VI4E 5CJOL 3MROB 2VLRB 5KAQF 1EERB 3QXAA 1G9ML 1QLFB 5GGRB 3NCEB 1A6WL 4WWKB 2Z92A 4L3CA 1D9KB 4PJ5A 3WYRA 2G75A 3PUCA 3K1DA 1CICD 2YK1H 1RZKC 4R7DA 5CHNB 3TO4B 1FZJB 5FYJU 3F7RA 2ZG1A 4OZFB 4PJBE 1PAMA 2JJUA 5E4EB 1OWWA 2HG5B 4PRIE 5ID0B 2VDLH 3QWOA 4FABH 5JOEA 2NY2D 4XWGL 3RX8A 4G5ZH 4NKIL 4GSDL 1HYSD 3DX8A 4LP5A 3AM8C 3GSNH 1YDPA 4YAQA 1J0ZA 1UZ8B 4ZQKA 1K9TA 2XPGB 3ELAT 3C2SA 4LLQA 4Z7WB 3HC3H 3H6JA 3VXMD 3H7BA 4NQCB 4ODWB 2Z93B 4TN9A 1A4JA 3VD5A 4HWBH 1WAAF 2OL3L 2DDQH 1GOFA 4QXUL 3A6BL 5IJKC 4WO4D 1I7ZA 2ESVE 3VGDA 1CFVL 5C70A 5DJYA 5ITFB 4X98B 4YFEA 5ID1A 4CW1B 4UB0L 3D2UD 2EC9U 3HNTH 3UPCA 3GSOA 1IVLA 1MQ8A 3NCYP 3HTLX 1JZ7A 3T2PA 3VFSA 5IKCB 3FFCA 5AYUH 1GZPA 4NNYA 1YMHA 2Q7YA 3BYYA 3QUKB 1KNOA 1J8HA 2GK0A 4KKCC 2F54E 3O6FD 4GQ9H 3MUGA 5DQJA 1J7VR 1W8NA 2AEWA 4XMPH 5DWUL 2YD5A 4M8QB 1F4WL 2GUOA 1IFHL 1NAKH 3U30B 3HE6A 5E6YA 3L7FA 3UO1H 4NN5B 2OK0H 3MC0A 1PY9A 2CK0L 5A1AA 1YEDA 5IV2B 4HGMA 4X7SL 3KLHD 1CLOH 5FA4A 4Y4FD 1F90L 4NRXA 2ZUWA 1AC0A 2H32B 1CF8H 1AC6A 3QDGB 1B0GB 3EYOB 5KN5A 4M93C 1A6ZB 1P1ZB 5MI0C 3MZGB 1QRNA 5BV7L 5L6YL 4MLSA 2AI0H 1QVOA 4PJIB 5GRUH 5F1SA 1RI8A 1TXKA 2X44D 1HCVA 1FNHA 5IW3A 2VABB 5E8DL 1IGCH 3MYJA 1TCMA 5FECA 5F71A 3RVUC 1NCBH 2GT9A 3QJFB 1TJIL 4ZD3L 3SY0B 3C6SA 3KPTA 3F6IA 1ES0A 5E2WH 3S35X 1QSZA 2BFVL 3GSUA 3REVB 1MHPL 2ZCHL 4Z7QF 4NGHL 4KKAC 2GTWB 3ARWA 4M6OH 4FQLH 4EQ3A 3WS6C 4PGCA 2A6IA 4PG2A 5B8CC 1DQMH 3QPQC 2GJJA 4L29B 3O4LA 5GZOC 2JB6B 1I75A 5FM4A 4BQCA 5CD5C 2WSKA 4JLRB 5C09E 1HH9B 1S7RA 2YK1L 1U8KB 5DHYA 3LRGA 4OCWH 1KIPA 4XRCA 4AYFA 2MFNA 3RUGF 1MEXL 2QQKH 5I8KH 2B20A 2J8UA 5C6PB 4HKBA 2VDLL 5HYJB 1OTSD 4G5ZL 4KK8C 4YR6B 5IIEB 1IQDB 2BMKB 3GSNL 5C0RH 5FUZH 3VG9B 2VB5A 4BZ2H 5DD5H 4JHWL 4OKDA 3MMEA 3C2AH 4BUGA 2D9CA 3GB7A 4OFKA 4PRDB 3ZE2E 4WDIA 2VE6A 3HC3L 4QGTA 2EO1A 4HV8B 4LGSB 1FNSH 5ICYB 2MOVA 4OQ1A 3UYOD 4HWBL 4EKXA 4KVCH 2O61A 1EH9A 4RAVB 2O93L 4JPIA 3LKQA 3MNVA 5I76B 5HDBE 1KB5B 4QTIH 4XCYB 4IS6A 2GYSA 4HBQA 2NY6D 5JQ6H 5E5UB 4UTAL 5LGJB 2WUBH 1KPVB 4FQXC 5FB8A 2C1PB 5FYLH 5IMLB 2YWYA 1ZLUK 4YBLB 3WJLC 4R2GD 2DWDB 3LKRA 4HGWB 2EDXA 3ORJA 4FFVD 1AGEA 4JRXB 1CIDA 2W07A 2YPLB 4U2YA 4AIZA 5IJVB 1X4YA 3G9VA 4GQ9L 4FNLH 4KKLD 2IALA 5DD0H 4XMPL 1L9NA 1ONQB 2XNAB 4QRPE 3D25B 1MFDL 3UO1L 3KYOB 4I8DA 2EYTB 2OK0L 5C0AB 5IBLC 3DMMD 2EEBA 3VWKA 1MCOH 2CPCA 5DMGC 4ZOBA 1FL5A 1MI5A 3IXTA 3T4AA 5C2BL 3D3VE 1VGKA 5BZWB 4J3XA 4DCQA 4FTVD 1T04A 5BCAA 5C0BD 25C8H 3T09A 2ZSWB 5FIEA 3BMVA 1PFCA 3EOBB 1S3KH 1RSFA 5C08D 2AI0L 5GRUL 4IMLB 4HJJL 4QHMB 4OD3H 4WV1A 2WIIA 3CFEB 4Q6IC 4QOKA 1IGCL 1HXYB 5ECJE 3D69A 3IAGC 1NC4B 1S5HA 3TBWA 1GGUA 4XC1L 3PJSA 1LP9F 3O3DA 3FQXA 3CDYA 3BT2H 1R3KB 5MI0B 3WO3B 5KW9L 4R9HA 2BRRL 3N1MC 4JFXA 3GSWB 4FQLL 3IFOB 2D7TH 1WVZA 4OB5H 1DQML 2OCFD 2CJUL 2FLRT 3PP3K 5F7HA 4S2SA 5AEAA 3L9RA 4CDGC 1NFDF 2VAJA 2BOCA 4PJHA 3DX7B 5D7LD 5FGSA 4BH7A 3EYFB 3BZ4A 3PQYB 3VXSA 4J2XA 3WIIL 1YPZF 3MV7B 4ODHL 3ULVC 4OCWL 1E0OB 3OB0H 2QQKL 2DBJA 1LEKA 4GKSB 1GGIH 1FYTD 4R7NB 4BKLB 1P6AB 3F7VA 5CEYB 5B8CB 3RI5F 3TBYA 5FYJH 1JGUL 5E8PA 2OQJB 1JN6A 4PJ5D 3OR6A 4Z0BH 5C0RL 4G8FA 1GZQB 4BZ2L 1ORQA 5DD5L 3VFMB 1EHNA 2CLVB 1K4CA 5EUOF 3RTQB 1F3DH 5J13C 2DMKA 3ARGB 5T1KA 2XA3A 3OF6A 4U33A 4OZIF 3MZTA 1YEKL 4LGRB 5KZCB 4JB9H 2PW2B 3R1GH 3DNKA 3V6ZB 3RVWD 2DB8A 4OLUH 3BZDA 3CXHJ 4QTIL 2X4PB 4L1HA 4UZGA 5DVMA 4U6HA 3T0EA 3VD4A 2WUBL 5FYLL 5JOFA 1BZQK 2LFGA 4QRSA 2J8OA 3QIBC 1DFBL 4HF5H 4RZCA 2LTQC 2Y9RT 3NZHH 3JWDH 3EFFB 4AM0A 3PIQA 1ZE3C 3LQZB 4FNLL 4XVUC 3WNNA 4FFWC 4JO3L 2MPAL 4PD4J 4GS7B 1YEGH 3JWOC 3GBMH 2Y5TB 1RUMH 5DTFB 2HN7B 2YR3A 1PKQE 4P49A 1KLUA 2UZYB 1KT2A 3FFCD 3OXSB 1YEHH 2GHWB 1MCOL 2W60A 4XBGA 5D7IA 1BLNA 3E6HB 1I9EA 3VFOB 1J8HD 4D8PA 3LKOA 1RHHB 3H9YA 2WBKA 5HHOE 4D9QE 5F88A 3I75A 2F53A 25C8L 4HHAB 1U8JB 5E8OA 3X3FL 1Q9WB 1S3KL 3HE6D 3U46B 1RHFA 1SJHB 4PRAA 1PQZA 4Y5YA 2HFTA 5T5NG 2ED7A 3R8BB 4JZJB 3ES6A 1L7IH 2VLJD 5CZVL 2V2XA 3VXQB 2VN4A 1N0LA 4QRQB 1T20B 4HPYL 4AEIH 3P0YH 4LDOB 5FYLD 1NCWH 4DGIH 1ZHLA 2VXQH 4NCDA 2WIMA 1A1NB 4JZOB 4L9DA 2LVEA 3MLRH 3WV0A 2ERJB 3VDAA 4PJ9B 1UFUA 3VE0B 3HAEA 1GGYA 3KPPA 3LCYA 3RIAF 1ADQA 4PJCE 4L8CA 2EE6A 4OB5L 3BN9C 3IYLW 4Y2DA 1CFTA 2EO9A 4JDTH 1RMFH 3FB7B 1NCAH 1ZT7B 2UUDK 3Q6FB 2E5EA 5BO1H 2DQGL 2R2CA 4Z0XA 2NXZC 2HJKB 1QTYT 1MAML 1XT5A 2BC4A 2Q76A 3JVGC 4D9LH 1EAPB 1IL1A 1K6QH 2QLVB 2X40A 4LNVA 3ZE0F 1IM3B 1IT9L 3C5SB 3HLAB 1E6OH 3CUPB 2XY1A 3QCUH 4OFPA 3BP4B 4U1SB 1ZHBA 3L3DA 1WC7A 5SX4I 1H8SA 1Z5LB 4L3EB 3ARBB 3GSRB 2HFEA 1IARB 3KPLB 1RV6X 3O4LD 4NSKA 1HYRC 4XAKE 5CKGA 1K3ZA 4RMUA 1ZT1A 5CLWA 1A7RL 3ZSTA 3DO3A 4F9LC 4NZTH 5FYKE 3SPVA 1LO5A 3MFGB 4BUHA 4N8VB 5E8NA 2V7NA 2FX8H 4KHTH 4JB9L 3DVNA 4EQ2A 2HLFD 1PZ5A 3G6DH 4OCYH 4YHIB 5F96L 4Y4KA 4IRJB 4I0PC 3U9UB 3E0GA 1I7RB 5C0GB 1VKXA 1CQYA 2YBRB 4MNQA 5E9DB 2AW2A 5MEQA 1SJXA 3O3BB 4JZNB 3UZQA 2OR9H 3NZHL 3JWDL 3OSKA 4GAGH 5D2NB 5HDLA 4QRUA 3MGTA 4PJGA 3IDYC 3QDMB 4U7MA 4X7EC 1LP9B 2PETA 5IBTL 4PJFF 1AGCA 3P30H 1YEGL 1F13A 5D4QA 2PW1A 1M6OB 1J0IA 1H3WM 3UC0L 5GS0H 5FYJD 2X4TB 3LVEA 4X9BA 3T77B 4XB8A 1YEHL 3QIBB 2LTQB 1KCRL 3HAEH 8FABA 4HK3J 1XGUB 2VDQL 1ADQH 4RNRB 1C7TA 5D1XA 1RIUH 2NR6D 3EDEA 5D1ZB 4N5UA 2GCYB 5ETUB 3VWJA 2BX5A 3SGKC 4QF1B 2CXKA 5JDSA 2KBGA 1IM9B 1BJMA 1BZ9B 1YNTA 4U0RB 5A2FA 1LO3L 4JG0H 1YPZB 3RWDB 4M6MH 3QQNA 5L7XH 2E7BA 2WQRA 2D7PA 3O3EB 1D6EB 4U4BA 3U7YL 3VWKD 4AENA 1JHTA 3LV3B 3VGAC 2VJXA 3EW3B 4A6YA 1FG2B 4Z7OE 4AEIL 1NCWL 4XVTH 1MCWM 1DZBA 5DVOA 3FMGH 1NSNL 5EUOB 3GZKA 2EYRA 2Q8AH 4G6FB 4RAUB 4OZIB 4P9HH 1AXTL 4R96B 4M1GL 4Q2ZA 3T2QA 4QOKD 4NUGH 4PG9A 5MENA 5EO9A 2I60L 2CIIA 4PPTA 3IFNH 4JDTL 1WWWX 1NCAL 3SDDB 1AD0A 3PXJA 1SJEB 3MNZA 2OZ4A 1A14L 4JFHD 2VR4A 2HVKB 4K3HA 4PRBA 3N1GC 2R0WH 3VFGL 1K6QL 1L0XA 3OHXA 1HILB 1CG9B 2PXYA 4FRWA 1E6OL 3HZYB 3QCUL 3HZVA 4ZPTB 5HGHB 1OAXH 4JANB 3P77B 5SWZA 1OT2A 3WUWG 1BPVA 4UBDC 1OM3H 1TVHA 1Q38A 1D5XA 4IMKA 1U2CA 2BRQA 4PTTA 4QHLB 4JPVH 2NXZB 4G6KL 3IF1B 3VFWA 2GJZA 4NQVB 5B4MC 4CVXB 3L6FA 3FTGB 4H5SB 1NUFA 4WJ5B 4OCRL 1O7SA 5JOPE 2FJGA 4UDUA 1PLGH 3OX8B 1HDMB 1IEBB 1CIUA 3TA3B 1JF6A 4XX1E 1T4KB 5D7JA 1N5YH 4KUZH 3O6LH 3KPNB 5GGUB 4EI6B 4KDTA 1C16B 4OCYL 5JIKA 2EDNA 1HH6A 2EDDA 5IVZB 1X5KA 3STZB 4R4BA 3EJJX 2HVJA 4LVOC 3IVKB 4J1UA 2H26B 2P8PA 1DQJB 1ZEAL 5T1KD 3OF6D 4LSVH 5JPMB 3MV11 4L4VA 1MPAL 1NGQL 3D0LB 3E2HC 5H37H 3IKCB 3DETD 3VU2A 2OR9L 5HHMD 1KG0A 2W0FA 3I02B 4GAGL 3CFCL 1CCZA 4HUMB 1MCHA 3ARZA 2EDHA 1U92B 2WWKO 1TFHA 5IBUG 3TJHC 3P30L 4A6YH 5H35B 1BFTA 4XPAH 4JQIL 3WNOA 1SY6L 3ETBF 3T1FA 4P46B 5I15L 1OGTA 5KS9A 3UYPA 1NLDH 2ITCA 3CH1B 1QSED 3BGAA 5GS0L 3T04D 4WI4A 5D7KD 4JN1H 1T7WA 5ALBL 5HYIA 5DJDA 1S7QB 4XHJD 1U58B 4LARL 1BJ1H 5MHSE 3MPCA 3IDYB 2ZPKH 3KYMB 3N9GH 3IDUA 4WGWB 2APWA 3QEHA 4LCWA 3U0PA 4OZGF 3DYMA 4JG0L 4N0CC 4I2XE 2OZ4H 4NJAH 2ZUTA 5JHDD 4M6ML 3BVNB 3TZVB 5DRXB 5HJ3A 4HG4K 3CFBA 3FB6A 1UZ6F 4IDJH 4PRHA 3PWLB 2OTUA 1S9XA 4ODXB 1LE5A 1WZLA 2VITB 1NFKA 3MGOB 4X6CA 1HKLH 4LKXA 2F53D 4XVTL 2P4AB 1NDMB 2ZUSA 3QA3A 2B8OT 5EN2B 3FMGL 5IM7B 1LGVA 3WN5C 2Q8AL 3DIFB 2Y72A 4P9HL 5C6WH 3A6CH 3BFOA 4X6DE 3LS4H 3SKJH 4C57C 4L8SC 2VXUH 4YQXL 4NUGL 4KDVA 3DTXB 3JUZA 3NACL 4QRRB 3MRLA 1AP2B 1HOCA 3IFNL 5IGXL 2VZ1A 1HIMH 4HIXH 3WHE0 3F7QA 1RQ5A 3E3QC 4O58H 4RRPA 5GS0D 4Y4HC 1D5IL 1CD1A 5IFHH 1BOYA 4NO0B 5E08L 1WISA 3IFPB 5E5RB 1MCKA 1VSCA 4I48B 4IRSB 3M1BA 3PHOB 1INDL 2YPKA 3QUYA 5ICZA 2XQYG 3BSZH 2C7UA 4IEFB 5KG9A 1RULH 1OAXL 4E41B 5C0CA 1E4XI 4Y2DD 1OGAA 2F9BT 2XKUA 1D5ZA 1JIBA 5AD0A 1OM3L 1ZVYA 1CTOA 3MRRB 4ZUWA 2ICEA 4PJFB 4XNMB 3VH8B 2X9WA 1LEGA 3EYSH 2D31A 3VFUA 2YRPA 1KTDB 2WLZA 4C4KO 1EO7A 4MJ6B 2XWBB 1UWXK 4JDVB 1QACA 1EZVY 4QHKI 4PYHA 3BIKB 3O6LL 4APQB 1RJLA 3C9NA 4L4TB 3OKMB 4F7PB 4PLKD 4OZHE 2NLJB 5E1AA 3MX0A 3MRGB 1PG7W 3RBGA 5LQBH 4ZFFA 1Q9KB 5TF0A 3LN4B 3P11L 5T3ZL 5C2UB 4TUJA 2VUYA 1QQDB 4Y4KD 5TE6H 2JKXA 4OJFL 2M26A 1S9KC 1YNKL 1BOGB 1U3HC 4MNQD 5D2LA 1NLDL 5DYOA 4X6BB 5E5MA 5FKAB 5ESVB 4JN1L 1U91A 2ICWI 5HI4D 3PXHA 5IF0A 4OZ4A 3KDMB 3FKUS 1JGEB 2K7PA 3KJ4B 4P2RA 5LXGH 3H9SB 1MIML 3VFPA 1GXEA 3KLDA 3MNWA 3TCLB 3KPRE 1YJDC 1WZ1H 4NJAL 1KB9J 4JG1H 4PR5A 3QQ4B 4J6RH 4NC1C 1WBYA 4B53A 5TH2B 5CIPB 1I7TB 3FB8B 5D5MF 2Z91A 2GFBB 5C08E 5I16B 4HUNB 3EOAA 5GSVA 1FLRH 4X5XA 5D1XD 3VWJD 1HKLL 4EI5A 5JNYA 2ZUUA 2QTEA 4D3CL 3Q5TA 4MA3B 1F11A 1I8IA 4CN1A 3NN8B 4W6XB 1EGJA 1EUTA 1MJUH 5T3ZD 1SEBA 4DUVA 1FG9C 3BZEA 3L1OH 4C83B 4OF8A 2VXUL 5I71C 3U36B 3LN5B 4U1GB 2H6PB 2VLLA 1HIML 3FQUA 4HIXL 1SYSA 2YC1A 2J3SA 4YZFF 4O58L 1M7IB 3SE8L 2H8PB 4XCEB 4J3WA 5IFHL 4Y16C 4NC2B 5EC2B 3WN5B 5ADPL 2QBWA 3SN6N 2YMXL 1SVCP 5D7LE 2IH3B 3WS3A 5H94B 1CDHA 4UT6H 5MEND 1MNUH 1RFDL 4JRYB 2E6PA 1CK0H 2BY0A 2P7TB 1BECA 3D39D 3BKJH 2DI7A 3O11A 3EYSL 5I1EL 1FYTE 3U7WH 3V8CA 3V79C 4JFOB 4EDXB 3QIUB 4Z7VF 4Q6YA 2CRYA 5E2UL 3SGEH 4MNGE 3EBAA 2E9IA 4OLWL 1MCJA 1ZGLP 4JFFA 4DKEL 3P9MA 5ACZB 2YZ8A 3MLUL 1AD9B 5SWZD 3IDGB 5DLML 4MJIB 4POZC 1XZ0B 5T5FH 1N59A 1XF4A 2BXYA 2NW3A 2JCCE 2NZ9C 5TDOA 1A7PH 5HPOA 4OZGB 3CU7A 2CIKA 2PO6A 1DL7H 2RIKA 4M7LL 1U8QB 4YUEH 4YEFA 3BEWA 5C0EA 1HHKB 3DXAB 1DE4B 2B4CH 4AQOA 4F9PC 4EXPX 2ADJA 5ACMA 3RVTD 5SWSA 4YK4B 1JWUB 4PJEE 3NIDE 2X5PA 4BK4A 5AG8A 4UU9B 1KCSL 1D5BB 1NDGA 2IPUK 4AT6B 3ZKSD 4M6AA 5ILTH 5K9QI 4P5TB 5FCUH 4Z95H 2X4NB 1FGNH 3M17B 1EV2E 3QXWA 5B3NA 1BM3H 5CS7A 3PL6D 5C0FB 3X12B 1AE6H 4PV9A 4A2LA 5JW5B 2NX5D 5E0QA 2P46B 4G9FB 3X11B 1EGJH 1F58H 1Q9OA 3TIEA 2FEEI 4EDWH 5L2KB 3VRJA 4X8JB 4NNPL 3HMWL 1UKQA 5B38G 4FQIH 3ARDA 4I18B 3SGJA 1CZ8H 4LFHD 3IJYA 4CVWA 3MJ7A 1Q0YH 2DJSA 5HYQB 1F00I 1A3QA 5M7QA 4J6RL 3ARFC 1LK2B 1KYOK 4J23A 5CFHA 1XAUA 4QTHB 4LHUB 5EH1A 1JP5A 5IROA 5ICXA 1FLRL 3OKLB 3LPFA 2Y23A 1ZLWK 3SOBH 1TZIA 1FNGA 4V1DB 2NY0C 4LCWD 1RK0A 2VLJE 3KHOA 1KXQE 2W9DL 4GUPB 1AI1H 3HR5A 1MJUL 2ZG3A 4KJPC 4NWUL 3V7AE 5FYLE 3OJVC 5F7DA 2Y1VA 4H26B 4Z78B 5FKPA 5HGDB 4JKWA 4PRHD 1U8NA 3PGCA 4RIRA 1NAMB 1QKZH 4HLZH 1BWWA 2VOTA 4NN7B 3ZSSA 5E94A 4S1SH 1A4KA 2H3NA 3LQAC 2Z31A 3NIFE 1BMGA 3L5JA 4CN6A 4LF3A 3G5YB 3O8XA 4I5BB 4UT6L 1MNUL 3WBDA 4YNYB 2HT4C 3P0GB 3MLXH 1R6VA 1GAFH 4TNWF 5CBEA 4TNVF 4MWFA 4AIXA 4D2NA 5HVHC 5A16A 5C0JB 4KUCF 1RUKL 3IDIA 1D5MB 2DL2A 3BKJL 4Q9RH 2RFXA 5BS0B 2DJ4A 4PRPB 4KK6D 3WNMA 4RFOH 3QUYD 2EXYD 3V4PL 1NEUA 4UIKH 5C0CD 1H3TA 4M5YL 1OGAD 1URLA 1I9JL 5DVLA 4LLWA 4KK5C 5T5FL 4OV5B 2P5EB 3HI1B 1FO0A 1C08A 1AFVH 1A7PL 3LKSB 1QR1B 2IANE 1N2RB 4JN2B 4YUEL 5F9WB 3QDJA 3EUUA 2B4CL 2EDOA 3A6OA 4KRPB 3SDCA 2XTJB 5D5MB 2AJ3B 3H0TA 1I3RB 1IGMH 1XIWA 4XNZB 4X4MA 3UTSE 3MBEB 3OJ2C 4WFED 3GMPA 4WHTB 4JO4H 5ILTL 3EO0B 2FR4A 1FGNL 3TVMA 4Y7MA 1P53A 5MP6H 3MROA 2VLRA 1BM3L 2P5WB 5GIRB 43C9B 5DA4A 5IHBA 1QLFA 2AQ2A 2LU4A 5GGRA 1Z0MA 3V6OA 3BO8B 5HGBB 3EDKA 4WWKA 3TT3H 1E4WL 4KTEH 1EGJL 1XF2B 9CGTA 3V4UL 1TTUA 1O7VA 1D9KA 1BQHB 1U8IB 3SO5A 5T33H 4K94H 4WUKL 3TV3L 3TO4A 5CHNA 4O2CB 1QLEH 4CGTA 1FZJA 5C8JB 4OZFA 3V5KB 2KL6A 2I07B 1JNJA 1CZ8L 4MAYC 1HYSC 4HH9B 4PTUB 1JPGB 2HG5A 3CD4A 5ID0A 4LSQL 5GS1C 2B5IC 3GRWA 3O2DL 4QYOB 1BGXH 1OSPH 1WCQA 3QHFH 1UZ8A 1H3PL 3F5WB 2XPGA 4P2QE 5IHZB 3SOBL 4P2RD 1X6NA 4GKNB 4Z7WA 1A2YB 5GJSH 4Z7VB 4NQCA 4ODWA 2Z93A 3H3PH 1AI1L 2VLME 2DQFB 3KPMB 1KCLA 3ARFB 4Z7NE 3EHBC 1DVFC 1RZJL 1WWAX 4ZOCA 3P9LB 5ITFA 4X98A 1RD6A 4ELME 4CW1A 1UC6A 3FZUD 4OSUH 3A67H 1H5BB 4QHUB 4EI5D 3MUY1 4QOKE 5EB9A 4CADB 4G3YH 4S1SL 3MLWL 2Y6SD 4ZFOL 1TZGL 8CGTA 1FO0H 3O6FC 5IKCA 4G7YL 2YUXA 4PGJA 1HE7A 3QUKA 3VFVB 4F33B 4JFHE 3CFIC 4JM4L 3WE6B 3MLXL 3NABH 3RDTC 4M8QA 1G7PB 2ENSA 3T0BA 1OY3B 4Q9RL 3MV9E 4Y4FC 1F6FB 1YNLH 1IGFH 5IMKB 3ROOB 3L3IB 5IV2A 4XB7A 1E4JA 2H32A 4JVPA 3QDGA 1JRHH 1B0GA 1A6TB 3EYOA 2DYPD 1A6ZA 1P1ZA 4ACPA