2R4RL

Crystal structure of the human beta2 adrenoceptor
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
214
structure length
214
Chain Sequence
DIKMTQSPSSMYASLGERVTITCKASQDINSYLSWFQQKPGKSPKTLIYRANRLVDGVPSRFIGTGSGQDYSLTISSLDYADMGIYYCLQYDEFPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the human beta2 adrenergic G-protein-coupled receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Beta-2 adrenergic receptor
total genus 45
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2007-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r4rL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r4rL01
2JJTC 2FB4H 1VSCA 5DK0B 5BRZA 1D5MA 1F90L 4UQ3A 4JY5H 1FLRL 4TRPH 5CEXA 4MCZA 4UZGA 4I3RL 2HFEB 3GJFB 1U8IB 2GJJA 4JFED 1F58H 2RJMA 3CU1A 4J12A 2CK2A 5AYUL 3VJ6B 4RRPG 4P5KA 4JVUA 3MCKA 4EDWH 1DVFC 2R29L 1DQLL 5C07D 1JGEA 2DLHA 3LV3A 5D5ME 1CYGA 1W72A 1P7KA 3VGEA 1QBMH 1Q9KA 4WHYH 5EO1B 1NFIA 5TDNB 1UA6H 5FYLH 4WU5A 3IDNB 4A2MA 3QEQB 5EZIL 3H9HB 3VI3F 3BEVA 2X4PA 4K3GA 2RAMA 2GK0A 4L8DB 4KJQC 4JANA 1A2YB 4JB9L 3VRIB 1YJDC 1AHWC 5K33A 4WFHE 2H2SC 3L9RB 4ODWB 3ZT5A 2LVCA 3FFCA 3QUZC 4LRNH 2O5ZL 1CD8A 3L3IA 1G0XA 4PJGA 4J3SA 3L3HA 4NUGH 2D7PA 4NP4H 3VGBA 3VXUB 4J8RB 7FABH 3REWA 1Z5LA 5C3TA 1FFPB 1ITCA 1M7IA 4MA1B 5BZWA 4XNQB 3CFEB 1OP9A 1CGYA 1G7QB 5DD0L 4IDJH 5IFHL 2ZUTA 1LO2H 4X7EC 2ARWA 4I18B 1EO8H 3AY4A 35C8L 5F70A 3L7EB 3ARWA 4L3ED 4LSVL 3QXDA 2LU4A 2PKDA 2OTPA 4A6YL 5JOPE 2FL5A 3QUKA 5EOCH 5DUBB 3S37X 4XCEA 5GZOC 1NSNL 5I75C 5C0CE 3W82A 3BZ4A 4NKOB 4FQ2H 5ETUA 3WNPA 2JJVA 1IL1A 2BC4A 3T0VA 4ZQKA 4GKZB 1LILA 3WIHA 5FDWA 5D2NA 1ZLSL 5IHZB 3RL1A 4XH2B 1U8MB 4Y19D 4KJYB 3MUZ1 4MVBD 5GRUL 3VH8A 4EUPG 3EYVA 2N56A 2GKIA 3KR3L 5DD3H 5F3BA 1WISA 3AXLA 4K3JL 2CRMA 2V5MA 4TTGA 2GTWB 3IS0X 3QULA 3EJYD 4BK4A 1M05A 4ZDHB 5ACMA 4KAQL 2DWDB 4G80B 2ADFL 4IIQC 3D3VD 1U8QA 1K4DB 3LKNB 1T22A 2Y25A 4PJ8B 2ICWI 4NRYA 3INUH 3HUJB 2CMRL 1UCBL 3MZTA 5EO0A 4JFEB 5DZNA 2CDFB 5CJOL 5AZ2L 1M7XA 5DJ2A 4HUMB 2EE6A 4LOUD 5GRZA 2OTWA 3SO3C 4MNQA 3JUYA 2ESVB 4XBGB 4RIRA 5DJAB 3VFNB 2VH5L 4NN6C 1K5NA 4P2RA 1UB5A 5E94B 5C0AB 3VXQA 1G7PA 1HE7A 1F00I 4ISVB 4TUJA 5IEHA 3NAAH 1A6ZA 1CFQA 4JGUA 4PJIB 4CVXB 2G2RA 1N0XH 2EECA 2VR4A 4JPIA 5IMKB 1IBGH 1WK0A 4JPVH 3VXPA 3GHEL 4KDVA 3HRZB 1MIEL 4YWGH 4K94L 4APQC 4RMVA 3HLAB 5EUKB 5GJSH 3PWNB 3C6LA 3MCLH 4NQXA 4ODHH 4QRRB 2YPKB 4UTBL 1J7VR 1EXUA 1X5FA 1M6OA 4C59B 2FR4A 5B8CB 2C3GA 4HH9B 4PJBA 1B88A 1ZHLA 4OTXH 5D1XC 3T0EA 2EDXA 3C8KB 3S5LA 4DAGH 2IH3B 4PJAF 4CGTA 4NCC1 1YEHH 4LPVA 2LAAA 4F7EB 1RZ8A 5J56B 3SY0B 3HMWL 1AJ7H 3RNKA 1PLGL 1GC1H 4F7MA 3EYQD 3VFTB 3QUYD 4D0DB 2I9LB 3KYNA 4CADA 4XBPA 2H2PD 3FT3A 1RZGB 1U92A 2NCMA 2HMIC 3O6LH 1LEIA 3IKCA 1MCWM 4JO1H 4KKBD 3R8QA 3QXAB 2CK0L 2FEDC 2H32B 4QRTA 4JG0H 4CRPA 2KZ1B 3MYJB 2OR9L 4UOW0 1OVZA 5EA0H 5I1CH 3L3GB 3QISA 1TNMA 3BQUC 3RI5K 3NA9L 3PQYD 3BKYL 1RIHL 2FNBA 3CD4A 5BMFL 4ZUUB 1QSFB 2RR3A 1UXWB 5LVEA 5KOVC 2OBGA 3D25B 1NSNH 4EDXB 4M43H 3QUYC 1P7QD 5CBAA 4PJDA 3HC0B 1J8HE 5T33L 1NBVH 3KPLA 1HCFX 5GGTA 2PCPA 5GS0C 1CICC 4NOFA 1JF5A 3FOMB 1IC4L 3SDYL 4G8FA 5L9DH 1HILA 1I8IB 1A6TA 2WBJA 5FHBL 4FZEL 2QV2A 4OLZL 5HGGS 2NY5L 3O9WA 4K3JH 5DYOA 2DQGL 4G5ZH 1HINL 1OPGH 4Z9KB 1TCRA 4LAJH 4YIQA 4U1IA 5MERB 3D2UA 3GBNL 2ATPA 5L6YH 4TVSa 3T0EE 3GMPB 2A9NL 3RDTC 3BN9C 2OZ4A 3L3OB 4R4FL 2B7DT 3MLXH 4NSKA 3HS0B 3IAPA 4PRBB 3SDDC 2WV3A 5KZCD 1OM3L 4BQ8A 1MRCH 3SDXB 2XV6B 2Z8RA 1NBZB 1FZOB 1U3ZA 5TF1L 3V8CA 5E00B 5CUSH 4OBRA 4I3SL 3HN3A 2VH5H 1FIGH 4XP4H 3QDJD 4HBQA 1MUJB 2KKQA 5TFSH 4QNPF 2EDEA 4MAUL 2A0LC 1S5HB 4DZ8B 3IKKA 1N5AB 4OI9A 2EKSB 3Q48A 5JO5B 2B39A 5DMGD 1QVOA 4UIMA 3AS3A 2IMNA 1L7IH 4OTXL 2DQJH 4WUUB 3TCLB 2X89A 1XF4A 5J6GA 5KVEH 1HQRA 1OT1A 4HMCA 4LLYB 1QFWI 4Z95L 3S7GA 4QOKE 3CJJA 5GGQH 3GIVA 4TNWK 2VXSH 1MHCB 3IRZA 3IU3A 4QYOB 4XC3L 3ARYA 5EORL 3U4EA 1TTUA 5GS0H 3QIWA 1JWSB 5DGQA 2YD6A 4JFDA 5E5RB 5MEPB 4Z7QF 3OF6D 1NAMB 1PJ9A 4ZPVB 3SQBA 3F7VA 1CL7I 5F1OB 4ENEC 1FHGA 1ZA6B 1NJ9A 2IQAA 4UV7L 4JQVC 2PTTB 4G6AC 1TTFA 3L3DA 1KCUH 4PTTB 3R0NA 3BT2H 4IRJD 4I3GA 4Y1AE 1R5IB 3CZFB 3SDXE 4XZUA 4DKFL 5C2UB 1L9NA 1FE8L 5KS9F 4GRMB 3NMEA 5GIRA 3TO2A 4AMKH 2YXMA 1C08B 4MMZC 1I1YA 1VEPA 5C0DA 2B1AH 3WO4B 2W9EH 2OQJB 1FVDB 4M7LL 2IADB 5J1TC 2DF3A 1KPRA 3A67L 5KAQF 1BBDH 6CGTA 5I0ZA 4XCCL 1FJ1B 3N50A 1FFOA 2EDJA 1N6VA 4FFYL 3HNSL 1CIUA 5D96C 4D0CA 1AE6H 4F3FB 1XGTA 3PWLB 3TT3H 1FNLA 3LIZL 2AJSL 1AGCA 3EW3B 1IGML 3K4DA 3GSWB 4K3EL 1VADA 4FQHA 1ZTXL 4PJ9D 3WO4C 1QRKA 2J2ZA 2WINA 1RULL 4KJPD 3QAZB 2AJXH 3ALXA 2VERN 3MLPA 5DZOA 1I75A 4PP1D 4UDUA 3TWCH 5GHWH 3VFVB 3FKUS 2BK8A 4Y5YA 2Z8WC 1YEKL 1EEZA 1VESA 4HFWA 1G84A 4X6DA 5IP4A 5HY9B 4YHIB 3TT1L 5DRXA 5BV7H 4LEOA 5CIPH 3EDDA 4YC2C 3N0PB 3VG9C 2NW2B 1A3LH 1RFDH 1AD9A 4FFZL 3BPCB 2GEEA 4I0PD 2GI7A 4X7TB 2UVFA 3V6OC 1LO5A 1QHOA 4MA7H 3RPIB 4U1SA 4CU8A 3UTTD 4MAYC 3P4NA 3RIAK 1G7HB 2C3VA 2YPLA 3IFPB 1OTSD 4OFYD 1RUKH 1YEFL 1H8NA 4JREC 1YDPA 1L7IL 5D7SL 1YQ2A 3ZE0E 2DQJL 3GMNA 3GSXB 2FWOA 3HAEH 4BELD 1WAAE 3BOVA 4PJFA 1JZ2A 2J88L 2LQRA 4NCC2 1GJIA 4NQEE 3PHOB 3L95A 2VC2H 3RP1A 4LP5A 4Q0XL 1J8HB 1SYVA 3B9AA 1AXIB 4N0UB 3O2WL 1INEL 1ZT4A 4LSTH 5C0FA 1UKTA 1CBVL 1BJ1H 4K8RD 1QYGL 5BO1L 4TNWF 5GGSA 4QTHA 3QDGB 3O4LD 4DGIH 4XNYH 3K4ZA 3T77B 4RDQG 4HIEA 4R4ND 4G42B 3MRNB 1A5FH 4J3VA 4GMSH 3ULVF 2VE6B 5DJDB 1NAKL 4E42B 4HZAA 1U95A 3MLZH 4IOSD 5AWNL 4JJHA 5MHSD 3LKPA 3QO0B 1MFDH 3L7FA 1H3UA 3CSGA 4JY4A 5DC0A 3WUZA 1NBYA 2B1AL 2BOCB 3UJIL 3MJ9A 2K3TA 1F6FB 1U3HA 3D85A 4GKSB 1YNTB 4NQUA 3WUWB 1DQQB 4H88H 2NY7H 1ZT7B 3M45A 4FP8H 4YPGA 3LEVL 4JHWL 4KDTC 3BZEA 1RQ5A 1T7VA 1ONQB 2CLZB 1HQ4A 5FF6A 4RX4A 1A6UL 1NC2D 1G9NC 4Q6IC 1XF5A 4Z7VA 5GGRA 5A2JH 4TVPH 1RMFL 5B38B 1BHGA 2CRZA 1QSVA 4CW1A 1ULVA 5I8OL 2VMFA 3P73B 1Y6MR 2LE9A 1WWCA 3VGHA 4I5BA 4JZJB 5KVFL 4NQEA 1N6QL 1N26A 2DD8L 4PGJA 4XRCB 3ULVH 1HSAB 3LS5L 4UU9A 2X7LA 3WN5B 3PDGA 4HWEL 3QEHA 4QO1A 5KSAB 1UENA 1T80A 1UWGH 1P1ZA 3GKWL 2G9HA 5DQJB 5EIIB 3BH9B 1MJJB 2NLJA 4WWKD 4QRRD 3Q6GL 3ME0A 1BFOA 3QIWD 1QFPA 4JG1H 3PE9A 4Y5VA 5C86A 1OP5K 1HZHL 2YWYA 1CL7H 1T21B 2GTZA 3P4MA 3ARGA 4LLQA 1LP9B 3MGOA 2P1YA 5DHXB 1B4RA 5D8JH 1J0IA 1NMBL 1HYSD 4HAGA 1NC4D 1GGUA 3KWWA 4ORGA 2NY3D 4RQQB 2BXYA 4I2XB 5C0ND 3VFSA 3BYYA 4U1KA 3RWDA 1U9KA 1A3QA 4OKVA 4XNUH 2AJUH 2EXWD 1R24B 2OJZH 1KBGH 4CVZA 3RX5A 1KC5H 1P4BH 5ILTL 4PJGE 1QYGH 3CFBA 3EYSH 5BO1H 2Q86A 1I7TB 3KPNB 3D18A 4POUB 3F58H 3WS6C 2EIBA 1M7DA 2QHLA 3DYPA 4F9LC 4PY7A 2XZQL 1B0RA 3EJJX 2X4UB 3P0YL 3KDMA 1DE4A 1X5LA 1MFEH 5EU7E 1YMMA 4NT6A 4RGMB 43C9B 5IT2H 4O2CB 1LO3H 3AUVA 5EU4B 3WN5C 4PJHF 1JGDA 1S9XA 2F19L 3O2VL 1SJXA 2PUQT 1T5WA 1QFUH 3DYMA 5IBTL 2DQEH 4NC1E 5JNYA 2Y07L 3NPSB 1QA9B 3B4NA 2IBZY 2GJ6E 1KTKE 4YHKH 4OQTH 3TZVD 4XPBL 3VA6A 3BSZL 1CR9L 1JGLL 2NX5E 3EDEA 5ADPL 3H42H 1H3GA 2VABA 1RUAL 3GZKA 4WWKA 1U42A 1I7ZB 5HYJA 3T8XB 4NBYB 5HYQA 3LMJL 4GRLC 1MCOL 3MFFA 4QTIL 3IAGC 4LCYB 4MDIA 1IM9A 5C09B 3QUMH 3QAZC 3WFEL 3BN9D 4WTZA 3S88H 3QYCA 4HWBH 1MF2H 4AIZB 3D18B 4LSPL 4XP9L 3C60D 1CLZH 3U4BH 1HH9B 4HLZH 5T3XL 3KPSE 3S3PA 4WDIA 4TTDC 2H1PL 5AG8A 3IDIA 4ELKB 3BP5A 5EO9B 4JFEE 1QLEH 4U1KB 3PWJB 3RWDB 4EDWL 2NW3B 4KTDH 4JHZA 2DQHH 2CJUL 2IGFH 5F97E 1DQLH 3PL6D 3DARA 5I74C 4DK3A 1DL7L 4JG1L 3MLSH 3RZCA 4BFGA 1N4XH 3R06B 2BRRH 3KJ6H 2XKNB 2P24B 2R1XB 1NUNB 4UBDD 1JUFA 1W0YT 2W59A 3DRQA 4LCCA 2X4NB 4H26A 4P2RE 5A16A 3LD8C 2QQQA 1J0KA 1L6ZA 3QQNA 2AV7A 3WHE1 1RK1A 4PRID 2EH7H 2F74A 2F8XC 4L3EB 5FKAB 4Z8FL 4YJZL 5FYJU 5FA3B 5F7KC 5J3HD 1JF1B 1NC4A 1HSBA 1BP3B 3QG7H 3VW3H 5DQJA 3KG5A 3MNZA 5EIIA 1FL6A 3EKCA 3LQZA 3CLFH 4OLUL 1K2DB 4L3CB 3H6JA 3QEHB 4OGZA 1Y6KR 2HJFB 2R2EA 3PWPD 5HYJE 4Z7UE 5ILTH 4UQ2A 2VNCA 1FVEA 3BKMH 3VD7A 2VAJA 3QFDB 2WBKA 5K9JH 1A6PA 1YN6A 2PYFA 4P2OD 4X5XB 1I9JH 4W4OA 1CS6A 1IVLA 5GISL 1BZ7A 1R3IH 1VFMA 2FBOJ 3GO1H 2HVKB 2YA1A 3P73A 4K9EH 3QXWA 3O6FD 3JXAA 2M2DA 4ZUSB 1MFEL 1NGYB 4LLVA 3O3BB 4GOSA 3B6SB 4OGYL 2RHEA 2QADB 2VISB 4WI9A 3WIIH 3TPKA 1KYOK 5C0EA 6FABL 1OQXA 3K80A 1QFUL 1ZT7A 4XPAH 4H0HB 4WHTB 1SVZA 3RWIB 4JEGB 1NCDH 3MX0A 4L4VE 5D6DC 2WWMD 3U7YL 4PGBA 3TA3A 1PBYA 2MPAH 3KYMB 1V3JA 1RIUL 4L4JA 5C0CB 1MCLA 1I8KA 5GZND 3O9WC 3L5IA 4ZPTB 4D0BB 1FQ9C 5IF0A 5T1LD 4XVUC 2CRIA 2WBJC 5HVGB 4E42A 4G9FB 2J4WL 4RFEB 2CKBA 4MWFB 2EDQA 2V2XA 4N8VB 3VG0L 1J8KA 4OZFB 3WFEH 4PJHB 5E4IA 3RVXD 3T3ME 3ILQD 4DKAA 3FB5B 3QDGA 5CEZD 1FLRH 3I75B 4XP9H 2VDQH 4LPCA 5GGSB 3FRPG 1S7WB 4GW5A 2NMSA 1NLBL 2F54E 2UZYB 3WFHB 2EEDA 3WV0A 1F58L 3ARDA 2OX5A 2DJSA 5AYUH 4G9FD 3BQUA 2FCBA 1CG9A 1U3JA 5I8KL 3HZMB 2UWEA 1P2CB 5JXAH 3PWUB 4L4VB 3O6KL 3GSXA 3IGAA 2P43B 5GSVB 3MLSL 3RVXC 4PG9B 1TVHB 5E5MB 1G7HA 1AGDB 3CMOL 4FNLH 2WM0A 4KQ4L 3NAAL 4PRAA 3ORJA 4FTVA 5I1AB 3GSUA 1V5JA 1IBGL 4MXQD 3DO7B 3DO7A 1LO5B 1WZKA 2NY6B 1CDJA 4UDTB 3W81A 5B22A 3FO9B 2UWEF 2EC8A 3L1OL 1G6VK 4HWZA 5D93B 1INQA 4HBCL 4X6DB 3K3QA 3DURA 1TVDA 3PWUA 4L4VA 1P2CA 5ELIA 3RGVB 3VWJD 1CG9B 5EBMB 4UNTA 5D5MB 3LKOB 3JWNC 4AH2B 1EEZB 5F1NA 1MH5A 3TPUA 3BRFA 1AR2A 7FABL 3TBTB 3D0LA 2V2TA 3SDXF 3MRQA 5DHYA 2QR0A 1S7WA 2RBLA 1QTYT 3MC0A 3IFOA 4JFDD 5IR1B 2WUBL 3KS0H 3EHBD 3EFFA 3GSNB 4WUKL 3MRMB 4X6DF 1IEBB 1IGIH 4NUJB 1J10A 4ZYKB 5TQ2L 5C6TH 4NM4H 5B3JE 3CSPA 4F2MA 3W5MA 1VACA 4FOMA 3DWTA 4Y19B 4OT1L 3F62A 1GSMA 4D0CB 5F9WB 3VA2C 3V7AG 3F5WB 4Q7DA 3I6GA 4I0PA 2VOTA 1GGIL 3MRGB 3EYUH 5C9KA 5C0AD 4G9FE 1RIVH 3SQOL 3MV7B 4OZIA 1BQHB 2YPVH 3VFMB 4HUKB 3PIQB 4YFEA 2R0LL 3B9KB 1RIUH 3HZKB 2VISA 4HLZG 1QPPA 4ZS7H 4GG6E 4NJAH 5DTFB 1OPGL 3F12A 4JAMB 4POYA 5BVPL 4QHNA 5DK3A 5CGMA 1YPZA 5JHDB 5DJ0B 3F7VB 1YYLH 5SX4H 1V05A 1NAMA 4WV1A 4J1UB 5MEPA 1OAYL 4ZFFB 5DC9B 3IYLW 4N0YL 1E4KC 2O26U 4UQ2B 1TDQA 3ULUL 3IU3B 3B2UD 4QYOA 1S7SA 4Y16A 3THML 3DTXA 3QCTH 4GFTB 4CDHA 4JFXA 1DBKH 2W60A 4GAJL 3W39A 1K2DA 3ZKMC 5TF1H 4Q9CA 5F6HI 4LLYA 5HHMB 3P9WB 1AP2B 4DK6A 2ITCB 3TCLA 4U6VL 3ARGC 3QO1B 1WAAF 1LK3H 2YSSB 4X7FC 2DTML 3K8MA 5T1MA 5CJQH 4OKDA 3Q1SL 2ZCHH 4MJIA 1F42A 1X5HA 1AKJD 5GJSL 5F3HA 3IVKB 2X9XA 5FYKD 3BDYH 3C60A 1D6EB 5F6IC 3RZCB 4GRLA 2PO6B 1DBJL 2XPGB 3ECBB 1FZMB 2OL3H 4H25B 5DD6A 2XWJB 1W8NA 2WLYA 3BP5B 5EO9A 3T4YA 3UTPE 3UBXA 2JK5B 4HS3B 4WI6A 2JCCB 3UO1H 1TZGL 3G08A 3IAQA 5HJ3A 1HH9A 5IROA 4ONHA 5GS0L 4F37K 4J6RH 4JDVB 2WMPA 3HE6D 4JKMA 4H8WC 2VLME 2DYPB 4PBVC 3MXVH 3G6DL 1WFTA 2I07A 4JG0L 5J12C 4MDIB 4U1IB 2CDGA 4NM4L 3PABA 1OGAA 1S78D 5I1CL 2W65A 2D7NA 3WXWH 3SOBL 4HPOH 1NGWB 1L0XA 1MCJA 2NXZC 3MUGA 5IROC 2VDMH 1XR8B 4NKDB 4AMKL 1J87A 1A6TB 1SMOA 2HH0L 3OAZH 4RGMC 3DROB 3QUXD 4PJ7F 5JOPD 1PG7W 5JNYB 3EYUL 1ZKAA 5ESQB 5IJVB 3QDJB 2ADJA 1S9XB 1JNJA 4MNGA 4FZEH 2R0LH 4JVWA 3HPLB 2MFNA 4IMKA 5DJXB 4F7TA 3VRLE 4IM8A 4JFZH 2AXFA 2OJEA 3LN9A 2Q7YB 4G5ZL 3CXHJ 4OF5A 4G9DA 4K3EH 1S7RB 2VDRH 1MNUL 4EBQL 4BFIB 3BEWB 2X4UA 3MYJA 4FQQB 3MRKB 4X9IA 2H32A 2N7BA 4PJEF 3TJEH 4PBXA 2PXYD 2BNQD 4K94C 5IK3A 1RZGA 1U92B 3KPNA 1I7TA 4XBPB 1ZVYA 4XWGH 1HYRC 4LDEB 4F7MB 4NQCB 3RNKB 1R0AL 1ND0B 4U3HA 1R24A 1KJVA 4OKVB 1GOGA 4MD5B 3VXSB 3CVHH 1YA5A 3PXJA 4I3SH 1L7TH 3VXTA 2VLLB 3UYPA 1I3GL 1UADC 4ZO7A 4R26L 3GMRA 4UV4H 4L4TE 4H1LG 1SJVA 2EDKA 5MEQB 5HGBA 2UV3A 2V17L 4R90H 5JW3H 5EUKA 4LLQB 3AM8A 2GT9B 4PGCB 2D03H 4JRXB 5DJ8B 1QFWL 1FFQA 4CVXA 3U0PB 1A6ZB 2JJTA 2YZ1A 1JWUB 4WY7H 1YEEL 4NCDA 1G7PB 3SE3A 1OLZA 1UB5B 5E94A 1K5NB 3ZHDA 5D1ZC 1LP9E 5I1LA 3A6OA 3BH9A 3QDJE 3S97C 3VI4F 1NBQA 2EDLA 1NGPL 1H3PL 1D5ZA 1JWUA 5HDOA 3CXHK 4EI5C 1IAIM 2D7QA 4XMLL 3AB0C 4Q0XH 4R2GB 2BVOA 1GGBH 4OSUL 3QHTC 2FX7H 3O2WH 4JRXD 5AYQA 3UYRH 5ID1A 3QI9C 2FZ3A 2GHWB 3SE3C 1HH6A 4DGVH 4MJID 4PJGF 4NQEB 3GMRB 5HYSB 3LKNA 3UROR 1U8QB 2GITB 4N0RA 5F7EH 1FNGA 2VDOL 1PG7X 1EMTL 4M48H 1KN4H 3DVGA 1M05B 5TQ0H 1X4XA 3QCVL 3P11L 4X98B 3BUYA 1C5BH 5JOEA 2Q1EA 3Q5YA 3EOBA 4LVEA 1XF5B 2AABH 1ND0A 4LHUA 1JFQL 3HCVB 4N5ED 4WCYH 1MFDL 3EYVB 1KB9J 1UJTA 5HGDB 5SWSD 4QY8A 3RL1B 1WLHA 4HCRL 1YMME 3RPKA 1DQQA 1EDQA 2CLRB 2W9EL 3ARGD 5IHUL 4U2ZA 1ZGLM 4GKZA 1U8LA 5FDWB 2HKHL 4BUHA 1F4YL 1LWRA 4L4TA 4BFIA 1ZLWK 5HTSA 3LN4B 3LKPB 2VZVA 5C08D 1J8HD 2VKWA 4XPTL 2FL5B 3CFCH 3F7PC 2K9UA 3W11C 2JCCF 3NVQA 1A8JH 4ZOCA 2V9QA 4OFPA 2E9IA 3PP3K 4GXUM 2IBZX 2VE6A 4ODTH 3U0WH 4I18C 3SDCA 3MJ8A 4G42A 2F54A 5ESQA 3ZE1F 1TZIA 3TJEL 1WZLA 1YEGL 2VDNH 3T4AA 3KYAA 3U9UA 4HD9A 4KI5C 3VGAC 5HHXL 2P5WB 4QTHB 2FH8A 4NKDA 3VXUD 2AJXL 4HKBA 4U7MA 1P9MA 5BZWB 3KHOA 3IB4A 3QEUB 4IDLA 3GJFH 2W92A 1Q9WB 3VE0B 4J8RA 1WCQA 3VXUA 2I26N 1GGCL 1CTOA 2QHRL 4YQXL 2GJZB 4JFOB 4G6KH 1JNNL 3AREA 1AGEB 4NQTA 3CFDB 2F58H 2DJ4A 5EUOB 3Q6GH 2P5ED 2FWOB 2YUZA 4PJAE 3D9AL 3FFCB 3IT8D 1OT2A 1PKOA 5AG9A 3QDHA 1PD6A 4JANB 1YC7A 4NNPL 4YHYB 4Q9RH 5HJ3B 2ZKHH 2H6PA 3CH1B 4F8TA 3P0VL 5C08A 1C16A 3AU1B 5D8JL 1A4KA 1U6AL 1A7RH 1EBAA 3U46A 1JHKH 4YHNB 1NFIB 5HPMB 3MOBL 1ZAGA 2ORBH 2KH2B 3PDOB 4ONFL 3T08A 2BSTB 1TENA 4CMHC 3FQTB 3GI9H 5I9QC 4RMQA 1LDSA 4X6BA 3OTTA 5DJ6B 4Z77A 4YHOL 4XMLH 3Q3GA 5C0BD 3G9AB 5GS0D 4Y5YB 3EAKA 4Y5XC 5DMJB 4OV5B 5JUEL 5AD0A 1Q0YH 2J3SA 4M8QA 2P8LA 1WGOA 3JV6A 3CFIC 4YZFE 1BEYL 5I1JH 1D5MB 5E2VL 1FH5H 4X5WB 1HOCB 3LQAC 3QWRA 4FQHB 5DK0A 4DN3H 5JPMB 1AP2A 4GMSL 5F7DB 3OKKA 1EMTH 4M48L 3BP7A 4P57A 1NCBL 2X6MA 1AGCB 4M6OL 4YDKH 2B8OT 3CK0H 3IXAA 3W39B 4IEFB 3W5NA 4HK3N 3WJLC 2C7UA 2AABL 1TETL 2Z91A 3WFDH 4HT1L 4RNRB 1IGCL 5FCUH 2ZZUT 3ROOB 2PXYC 3QXUA 2FJHA 2M1KA 4YXLL 4GH7B 5EC1A 2UVEA 5L0QB 2VLJA 4F15C 2WQ8A 5JHDA 2XTJD 5LGJA 3G6JF 1GPOL 3TGXA 1L4IA 4K71B 2WWKO 4JAMA 2Q6WB 1CR9H 1ORQA 3H42L 2B5IC 5F9AC 1A6UH 1F4WH 4M7ZB 4PS4L 1Q72H 1P84J 4WEMB 3SDCD 4BH7A 1EH9A 4RAHA 1XIWD 3ABZA 3VG9B 3RL2B 1MCOH 2BHZA 1NJ9B 3O6FC 4M4RA 1UVQA 2X4TB 2OK0H 1T1WA 4MCYA 2APXA 1C12A 5HHME 3W9DB 1Z9SA 4LSPH 4OLWH 3IF1B 4L4TD 4PUBL 3ULVL 2HAZA 1G9MC 3LVEA 2IFFH 2BSSB 3MJ6A 5KANG 3WJLA 1MHCA 3QI9D 5IGXH 4O9HH 4NYLB 4ZUVA 4HXAL 2DLFH 5I76B 4BKLA 2H41A 4F2MB 3RWFB 4RWHA 4TNVK 1YN7B 1JNLH 1OB1A 3FB8A 5DQDH 1IEBA 4MMXC 2K1MA 3EFFB 5E8NB 3U79A 4ZFGL 1D3CA 1KJ2H 1KOAA 3O6MH 1ZLVK 4P4KD 4MJ4A 1ERNA 4KFZC 2EKSA 4RDQF 4N1HB 3DJ9A 5D93C 3EJZC 4NN5B 4UAOB 1INDL 4M93B 3QNYB 5L2KE 4OBSA 5IG7B 1KIRB 3S3JA 3HE7A 3RGVA 1J18A 1K6QH 4UUJB 4BQCA 5E8OA 4OZIF 1FG2A 4YDVA 4K23H 4OM1L 5L0QC 3ULVD 2DYPD 5FUCE 3SCMD 4LHUG 1AGFA 1NBZA 5JDSB 1WBXA 5DUMH 1KBGL 3O2DH 4OCMC 5K9KA 1P4BL 2ZUQB 1MY5A 2JIXA 3FAXA 5GGSY 5HHVL 3NGBC 4MJ6B 4PRAB 5J1AB 4YEFA 1QQDB 5K9JL 3K1DA 1TVHA 5FA4A 5ID0A 2ICWA 1WBYA 1FH5L 3T04D 5MERA 3DI3B 4RWYH 5HSFA 3HZMA 3LZFL 1U93B 4KKAC 3TO4D 5ACLA 1T1ZB 3BQUB 4PJCB 4JM4H 1IQWH 3ARDB 1WV7T 3LCYA 4RGNE 3TN0B 2Y5EA 4PJIE 4O02L 2WBJB 4PP1C 3O2VH 4MNGE 4E41A 3FOMA 4POZD 1K4CB 3E8UH 3WSQH 4XPAL 5IVXF 2FEDD 5K93A 2OM5A 4KKCD 4S0TD 1Q9LA 4AQ1B 2ADIA 4G8GE 3DX7A 4OZFA 1KGCD 5BW7C 3FAWA 4YDLB 4RFEA 3UZEA 4U1LB 3B5GA 4L8SB 1D6VH 3V6FA 1RURL 5EU6E 3HNVH 1OOAA 3VWJC 3GIZH 1H3WM 1HHKB 1DUZB 1JHLH 2VZTA 3BFOA 5TF0A 3H3BC 3V4VH 1AXSB 3M1BA 3KPRD 3ULSB 2A1WH 1B0GB 4QRTB 3CFJB 1J0JA 3QXAA 4OF0A 5B3JF 3IKCB 3IS1X 5FYKE 3OKDA 3FT3B 5L2JA 3CDCA 1FL5B 1C8PA 5IBUG 3SY0A 1ZHNA 2Y5TA 3O4OB 4WTZG 1AQDB 2NY3B 1JMXA 3L3JB 1WFUA 4KMQA 5IJKA 5IB4B 4JO3L 3GRWA 2V7NB 2YN5A 2GJ6B 4H1LH 4H8WH 3DMMA 2V5SA 3BE1L 4NKIH 2F5AH 3RBGA 2ZJSH 4QHMA 2VRAA 1KB5B 4HH9A 1P4LB 4PJBB 3SKOB 5IB3A 3RNQA 5B8CA 2FYYA 2EIZB 1DDHB 1F11B 4YH6A 2YPKA 1CFSB 5IVNA 2FATL 2Z35A 2D3VA 5E6ZA 3HRZA 5ADOH 2V5YA 1OAUL 4KZEL 2AJYL 4U1MA 4R2GD 4PJIA 3DX8B 4DGYH 2PR4H 1U3YA 4OZHF 5BOZG 4ISVA 5IEHB 4E41E 3V7AE 1ZANL 2I5YH 4J7RA 4HBCH 3RVVC 3DV6B 3QG7L 4EI5D 3QDME 4JRXE 1A9BA 1A6VH 1MI5B 1Q0XL 1EHLL 1D5BA 2NY2D 4JCLA 4XX1E 5FUOL 3A6BH 1W0VB 4RCAA 1OARL 4R7NB 2VQ1B 1ZLWH 1HNGA 1JUFB 5DFVD 2HKFL 3BESR 1P53A 4G6FD 2A6IA 3SE9L 4NHCH 3TNNB 1T22B 3RVTC 1KFAH 2ZOKB 1MJ8H 3LRSB 1FVCA 1KIQB 4KK8D 3WXVL 1BAFH 3HI5H 4WEUD 5B21A 4JM4L 2AI0L 4E0RB 1A7QH 3CH8A 2AJVL 3NCCB 5HVFB 5HHOB 3VH8B 1WIUA 4Z76B 4KJYA 4PRNB 3HC4H 4KPHL 1CT8B 5BCAA 4XCFL 3UJJH 5GSRB 3NFSH 1TJGL 4MSWB 2AEQH 3RVTD 2IAMA 2BC4B 1DN0B 1IM9B 4NKOA 1JRHL 4PRNA 3B3IA 1J5OH 1BMGA 3AAZA 4RZCB 5LWYH 1A3RH 1I7ZA 3QUKB 5HYJB 4HWUA 2OXGA 3KPRB 1MQKH 3CIQA 3HHRB 4BZ1H 3VG0H 1PQZB 4D3CH 1AY1H 1AO7E 1QA9A 3TNNA 3QDMA 4IRZH 5EU5B 2HT3C 1V8HA 1P4IH 1HEZB 3TVMC 5D7LA 3ZDYF 5EU4A 3ALWA 5C0NC 1AHWB 3QI9A 4YK4B 1A1OB 4Z7UF 1MVFA 4GAJH 3I50H 2HLFD 1DBAL 2GJ6D 5EH1A 3L3HB 3VXNB 3TLRA 3RWCA 5DHVA 2QKIA 2IF7A 1DE4B 4ONGL 3SE8H 5AAWA 5JXAL 1OGAE 3BE1H 4KDWA 5M94B 3P4LA 4OUUB 4ODWA 4XGZA 4Z5RA 1KIPB 5D9SB 1A2YA 4KRLB 4Y4KD 3T3PF 5A40E 4Z78B 2W9LA 3ZKXC 4LQFH 3LSOA 3BEVB 1FFRA 1MPAH 2BZDA 3S36X 1NLDH 4M03A 4LVOC 3F7YA 2PR4L 5B39B 3TV3H 3VFSB 2ITDA 1MFCL 1CDUA 2X1OA 2F8VA 1W72B 5KSBA 2VLRD 3MODH 1KSRA 1YMHB 2GJ6A 2V7NA 3L3JA 3C5ZB 3GSNH 4NP4L 4Y8AA 3MGOB 1LP9A 4M1CD 3REVB 3EO1A 5EWIH 5C0IB 2MOVA 1V7NL 1TMCB 1WQVT 2E9JA 5FDYA 1X6LA 3DO3A 4M00A 3LN5A 1DBBL 2J7LA 2MTPA 4M93C 1RV6X 3G6DH 1EO5A 1AGBA 2XG5A 3GJEA 5ESAB 4NN5C 1UKSA 2G9HB 1P1ZB 1QSEA 3O0RH 1OAKL 5GZOD 2RCSH 4BQ6A 2HFFB 3MREA 4OT1H 3V6FB 5F9WC 1HSAA 2BY2A 1OTUD 4P5TA 4FQ2L 2ICCA 4HG4K 3KPMB 3RRQA 4R4NC 2AEWA 5I19L 4LAQL 4NQCD 5ALCL 1Q9LB 4W81A 1NPUA 3BGFC 1R3LA 4HMEA 3M07A 4UINH 3OMZA 3QB7C 3CAFA 5GRUH 4AENB 3PP3H 4HF5L 1Q8MA 5DR5L 1TJIL 2DICA 5JIPA 4MD4B 4PJBE 4JRYA 5TE4L 5FF6B 3OKOA 4KXZH 1T2QH 4AYFA 2E7LA 5I1KH 2I9TA 1IGTB 5BVPH 2XTLA 5BV7B 1DSFL 4N8CH 5KSBE 2ED7A 1WBYB 1UH3A 1BF8A 4MXVE 2CH8A 1QQDA 2BOCA 1MCWW 2NY6D 1UM5L 3ZO0A 1J1PL 3QO0A 1WIOA 2R1WB 3QCTL 5HGAA 5T5NG 3PQYE 1JZ3A 3KPSA 1U95B 5KVDH 3MRDA 5FYKL 3JV4A 2C3WA 3U1SL 1NC2B 4RFOH 4AEFA 1I3GH 2NY2C 2XICA 5HYSG 1NGQH 3T77A 4R26H 4IRJC 2CIIA 5IW6A 1QSEE 4PIRF 4WW2F 1JTOA 4WI3A 1X5XA 4U1JA 2FLBT 3GHEH 4XVJH 4DFIA 1MIEH 1XR9B 4YWGL 3LRHA 2ZCHL 1J8HA 1SYVB 1JPGA 4WU7B 4HCRA 4YHZH 1GZPB 5TE6L 4EXKA 3AMKA 4PJFB 3SE4A 3MODL 1DBJH 5FKPB 1YN7A 4K7FB 2NY3C 2C3VB 4OD3H 3RWFA 3X12A 4V2CB 2PN5A 3ZYOA 4KJPC 3DGCR 4QCIA 5I76A 4XPFH 3IFLL 1NCNA 3UYRL 2XQBL 1HHIB 2BMKA 4QRQA 3TN0D 3CDGA 2W9DH 3OX8A 4OGAD 3STBA 4EUPA 2RFXB 2KQMA 2MKLC 5H94B 3SGKA 4K7PY 1C12B 4GW1A 4LEOB 4UNUA 2W38A 1L0QA 1T3FB 2W0FA 4UB0L 4LNRB 5DD1L 3RVUD 2X1XR 1XGRA 1MCPH 1T0MB 1OAXL 4PJEE 2YS4A 3F8UB 1MCNA 1Q94A 3IXTA 2XWTA 1JFQH 1NCTA 3VMNA 1S9VB 2YZ8A 5TH2B 4JJ5B 4LARL 5EU6B 4Z7QE 4HCRH 1OP3H 4HZLA 3N1FC 1S7UB 5D96B 4JN2B 1JZ5A 4R7DA 3G5YA 3S36H 2FEEL 3ARTA 1FC2D 3OJ2C 1CF8H 1HHJA 3GSWA 4OCRL 2VR9A 4RNRA 2IG2H 1XGQB 1AFVL 4QT5A 1ETZB 1RZFL 4W68A 1UT9A 2Y7QA 5I1KL 2W91A 2H3NB 5JORA 2NPLX 2YD9A 3IDUA 2XT1B 2VDRL 3WNMA 3EUUA 2XI9A 3G5YB 2FGZA 3GBNH 3H3KA 1C1EH 5E70A 1S7UA 3S35X 2VIRA 1ZWIA 2VDNL 4HZLB 3MRCB 4IJ3C 4DUVA 3TO2B 3BXNB 4L9DA 2ICWJ 3NABL 1R0AH 4FQPA 1G6RL 3CZFA 4GRLD 4U4BA 3KPTA 5KBNC 3OSKA 3C8DA 4Z77B 2WK2A 2WSKA 3V0AC 4WW2B 2AK1L 2WP3T 4EQ2A 3UTSD 1KPUB 5AUMA 4DZBB 1A64A 3U1SH 3B43A 1BZ9A 3GGWA 2W0FB 4M7ZC 5T3ZH 5C70A 4O4YH 3CXDH 2JELL 3D9AH 5EZJB 5IQ9A 2EDHA 5H2BA 4XP4L 4UT7L 4UAOC 3D0VB 3O8XC 3OX8B 3CDGB 3G6JE 4KU1A 5C08B 4LF3A 4AEEA 3U4EB 1DQJB 2H6PB 1PKQA 3OPZH 3O3AB 2VXVH 2G5BA 1BQHG 4QCIB 5EN2A 4Y16C 2DM3A 1T03L 3PDDA 5J6GB 4RGND 3VXMB 4JFHE 1IC5H 2IQ9H 1SY6A 2XFXA 2VJXA 5CCKL 1AGEA 3NTCL 1ED3B 3AREB 1H3PH 3L6FA 3WFBH 2GJZA 3VFGH 2FX9L 3HMXH 3WO3B 4DCQB 5GGQL 4HV8A 1LDPL 1XR9A 1KELH 4YZFF 4KMTL 1OAZL 3K8LA 3NH7L 1AR1D 4S1RH 3OHXA 2XZZA 4BH8B 1UYWH 3U9UB 1QBLL 1A7OH 2CIIB 5IW6B 2D7OA 4JY5L 3X17A 5FGCE 3V5KB 3RY6C 2R0WH 3W2DH 1II4E 2F54B 5IQ7L 2AQ2A 5F7EL 2BSRB 3O4LA 3SDCB 2Y4SA 3OR6B 4P3CH 5IVZB 4PR5B 1JN6B 1NCBH 3GJFK 5E00A 1KCUL 1FBIL 1TPXC 5CIPA 1CXEA 3WLBA 2H9GB 3OKNA 3JZ7A 4P23C 1UWEL 4OCYH 1I3VA 4NNXA 2VDPL 4HT1H 2R29H 4L8CA 2Z4QB 4G7VL 5E8PB 3MYZA 3BJLA 2DOCA 3C5ZC 1HYSC 1T89A 1DZBA 4L4TB 3L3OA 4F15B 1U8LB 4M7LH 2VXTH 3RIAF 2J8UE 4KH2A 3D2UB 4WW1B 3WNKA 4JFYB 5J89A 3V0WL 3MRPB 1A14L 3QUZA 5IHBA 1VGEL 1XEDA 2Q8AH 5L2KA 4PJ7B 3QHZL 4ODXB 5I73C 2OI9C 1G9ML 3MLRH 4G8GA 3EOBB 4IRSB 4UTAL 4UIKH 4X98A 2EDRA 4GG6A 4YAQB 4GRWB 1A1NA 4QXGH 2Q3ZA 5E99L 3BN3B 4DUWA 3QEQD 5HDQL 3KPLB 1RZJH 4LSDA 1AI1L 5CSGA 2QL1A 3LHPL 1A9EA 1XGUB 3EYOB 4U0QB 2R4RH 1HH6B 5SWQA 2FIRT 5DURB 2FZ3B 4PTUA 1SBSH 1H15B 4O9HL 3UTOA 2PW2A 4HXAH 4U49A 3WE6A 4YQXH 3FB7B 4YBQD 3TVMB 1NDGB 1B4JL 1BBJA 1GRWA 3FQNA 2X70B 1D5IL 5IMMA 1RY7B 4H5SB 5I1LB 1MCFA 3AM8C 1MFNA 4K3DH 5I18H 4MA3B 1LEIB 4NC1C 5D7LD 4JO4H 3KYNB 4CADB 3EDKA 4LLUB 2XY2A 4NNPH 2H26A 5DJ8A 4FN0A 3GI8L 4NZUH 2FO4A 2R4SH 2GT9A 4PGCA 1E6OH 2Y23A 3EO1B 3FMGH 1IGJA 4GRWE 4WTXA 3U0TB 5FM5O 1RZ8B 4Z0XA 5I16B 4IOFC 2IH3A 3A6CH 4M7KH 1DLHA 1IILE 1BQUA 1DVFD 1DLHB 2J88H 3AY4C 2CXGA 1ZHLB 2HP4A 4X9FA 3MV7D 4OGXL 3U4AA 1AQKL 4AK1A 5JW4R 4NJ9H 3LQAH 3QR2A 5IIEA 1NMCC 1LD9B 5HBBA 5EU3B 1INEH 1KELL 1U0QA 1EVUA 3S35H 2MCG1 3NH7H 1MCEA 4Y5VC 3AS1A 3UZQA 3OAUL 4WI8A 2AP2A 4PJXE 4XNYL 4XGZB 4Z5RB 1A7OL 3GMLB 5T1DL 4ESKA 4PJCE 1KEMH 4CAGA 4GLRH 5C0JB 1I8MA 2ZCLL 5CJOH 2CR6A 5AZ2H 3ARBA 1KXVC 2V5TA 1BBJB 3FQNB 1NDGA 5DVOA 3RWCB 2C4XA 3MXWL 4YDKL 3SPVB 1SJHA 2XN9D 4MNQB 3U82B 3V0VA 3T65B 1A1OA 2PW2B 2OTWB 1CICD 5E8EB 3MLZL 1UWEH 1H15A 4F7TB 1YNLH 1AHWA 3HPLA 5FCUL 1IEAB 4X8XA 3QT2A 5E24E 3UPAA 3P40A 3WSQL 3VXME 1CDIA 4JRYE 2CO7B 1PQZA 5LQBH 3H9SB 4W4OC 3V0WH 2O5XL 5D2NE 4X4XB 1EERB 2VLKD 4OJFH 3RX7A 4EI5A 5IVXA 2VYRE 4PS4H 3WJJC 3AXLB 5F3BB 1G9MH 3MLRL 3PGFH 2X4RB 3AAZB 4RZCA 1JI1A 2W65B 1E4WH 2DI7A 2EDWA 3PABB 4XH2A 4HJJL 2FB4L 3WFCH 4WNQB 1PG7H 4AJ0A 1RZJL 3RTQD 3OB0H 3GK8H 5ETUB 1JNHA 4PP2B 4QKXB 3BZ4B 1CT8A 3EJYC 4HS6B 4JM2D 4Z76A 1PLGH 1WEJL 2Z4QA 3IDXL 4P9HH 2CR3A 2DL9A 3MBEB 4KWUA 4U7KA 3ARDD 2VITB 5LBSL 3OKNB 3T2NH 2JK5A 5F1SA 4E5XB 2H9GA 3WLBB 3T4YB 2IAND 3L7EA 3LPGA 4JFPA 2ZUXA 3B9KD 3LKQA 4PJXA 3OR6A 4HGWB 1FZMA 3X3FH 2PO6A 4I18A 5DO2D 3LRSA 5SWSA 3SDCC 1N7ML 3MTRA 3QIUC 4JFQA 1NCAL 2ID5A 3O6ML 1LO4L 3C60B 4FQLH 2HTLC 1UCTA 3QDAA 5DJCB 4F33B 4Z7WA 1CN4A 5E08L 1Z5LB 4HV8B 4BK5A 2CKNA 3OAZK 2WBJD 2X05A 4JPKL 5HGHB 2CO6B 1KCSH 1BFTA 2NXZB 3VXMA 3KAAA 5DO2C 5ECJE 3L9RA 5HI4D 2FDBP 5EIVA 1EEUA 4RGOH 5GGTL 1GZQA 2WIMA 1FYTA 3MRFA 3MV8B 5IKCB 5KANI 1A7PL 1RJZB 4ERSL 1LQSR 2P4AB 4OGAC 1DQJA 1YY9D 3WHE0 4ZS6D 5JXEA 2CKBH 4J2XA 2Q87A 5E9DD 1DDHA 3BO8B 5IM7B 1NKRA 3F58L 2A6JA 5EZJA 1YPZB 2WZPD 1T83C 1O5DT 3DMMB 4ZAKB 3BD5A 4POZC 1VPOH 4NIKB 1MIML 1AQDA 5IV2B 4OCSH 2FH6A 3DIFA 4F37F 3HZKA 3TP4A 1ZV5A 1LO3L 3RY5A 3BXNA 1FLTX 5A2LH 3T3MF 5CEXB 1QD0A 5L2JB 2D31A 4HGMA 3ZT6A 4EZMA 3QUXA 3WLWC 3QIBA 5GS2H 5SWSE 2D0HA 4PJAA 3UJTH 4PREB 5BRZB 4OZHB 4M4PA 1VFBB 1QKZL 3ULSA 1H8OA 4XHQA 5JORB 3UP1A 3BD3A 4M5YL 2HJKB 4BQBA 3JWDH 1ZSDB 4BZYA 3UTQA 1NMCB 3JTSB 4K55A 4ELME 1TPXB 5C08E 4OM0H 1CLCA 3RDTA 4HUWA 1EAPA 4P2QB 1ZA3B 3I3EA 2YRZA 4OZ4A 4HJGB 5KVEL 4XXDB 4P3DA 1ADQA 4H1LA 4P2RD 1AY1L 2CIKB 2EE2A 3OKMA 1WWWX 3EYFA 3TJHD 1MEXH 5E7BA 4XP5H 3INUL 4HWBL 1EV2E 3OXRB 2VXSL 3MBED 2VDLH 2NTFA 1WEJH 4KROD 4FQIH 5FUZL 3TBTA 3TN0A 3BGAA 5F7HA 2VL5B 5T1LB 1ZGLP 2WANA 4Y4HB 5LBSH 2DKSA 1Q94B 5IWLC 1T1ZA 4JQVA 3H2WA 3SGDH 1EPFA 3L5JA 3DURB 2ZJSL 3VXRD 1QG3A 1LE9A 4HUVB 1DL7H 3PQYA 2VN4A 4B5EA 1HNFA 4QHLA 5SWZD 1JMZA 1UKQA 4PLOB 4TUOA 5J1AA 1SEQH 2K7QA 3DGGB 4MJ6A 2X9WA 1N0XL 4QRQB 2JIXB 5KSUA 4GLRI 1T5XB 3S4SB 4B7LA 1FGNH 3IJHA 4FG6D 4Q58C 4ETYA 4OFIA 3GSUB 4M6AA 4GAGH 1NLDL 4KZEH 2Z31B 5JDSA 4B0MM 2NNAA 1MCBA 3TZVA 3VMPA 3KJ4B 3ULUD 4WFGD 1FG2B 8FABB 3MRHA 3R4DA 5FKPA 4JZOA 3SGJA 3MRBA 2JB6A 4JRYD 5JDJA 1QO3B 2A77L 3MMEA 4P99A 5I30L 3V2AR 2XA3A 1KIRA 4U6HB 3D39A 1A6AA 1FRGL 4AIXA 3QHFH 3A6BL 1I7UA 5JA8B 3T3PE 3B9EA 4ERSH 4WFED 4LSUL 1V7NH 3QUMA 1CGTA 3DX6A 3WFZA 3T0EC 5KG9B 1RUMH 1EO7A 3FB5A 3ZDZE 3L3KB 4M61A 5B39G 1P7QB 1SM3L 4G6JH 1R3IL 1NC2A 3PJSA 4L3EE 4JQIL 4U1HB 3JV4B 3RU8H 1U3HC 5EA0L 1ZLUK 1S7XA 4LLMB 3DUUB 5DRZA 3RKDD 1MIMH 1RIHH 3QQ9C 5IF0B 4P9HC 3SN6N 3ZKMD 3RVVD 3DMMC 2DQDL 2IH1A 2UWEE 4P49A 3SDDA 1JRHI 4O51A 3T09A 1GCFA 1S3KH 4PGBB 2VQTA 1R3JB 1R3KA 3QG6B 2XG4A 2EE9A 2MHAA 4WHTA 2QQLL 4KXZI 3JWDC 1FPTH 3D69A 3FT2B 3MLWL 2VLJE 4N1EA 3DVNA 5JMOC 5FHBH 3C5ZD 2G60L 2I9TB 3J8F7 4TSBH 4FQJH 1A3RL 2L4OA 2EXYC 2IALB 1F3DH 3TIDB 4QRRE 1NGYA 3ZTJH 5ICYA 3C2AH 2J4WH 1X44A 3AC0A 5DI8A 1C7TA 1GHFL 4BZ1L 1CICA 2HVKA 2UUDH 1EJ6A 3MOQA 2YD7A 2YK1L 3RY6A 4XNMA 4IRZL 3BWAA 2A9ML 5FYJD 4N68A 1QUNA 1M1SA 5I1GL 4LSRL 1XCTA 4LSTL 4HUNB 4XP1L 5TGBB 4PJXF 1I1FA 1NMAL 5FECB 5GGVL 3MR9A 2G75A 2MCPH 4YE4L 5C9JA 2D2OA 2YPLD 3ARED 3LQZB 5EBLA 3AGVA 5JTWA 1QSEB 3FO0L 1FL6B 4K2UL 4R96A 1GAFL 3MNZB 3CUPA 3P9MA 1NC4B 1HSBB 4ONGH 3SE8L 1I3RB 3BPLC 4R6UA 1OSZB 1I9RL 4B41A 4EXPX 1WZ1H 1NGQL 1XAUA 4L3EA 5FKAA 4J3XA 1RK1B 3BAEL 2DWEA 1DQML 1SEQL 2X2YA 3LB6D 2ATKA 4U3XA 1F3RB 4H26B 1LNUB 5ITBL 5DEGB 2J1KA 1EEYB 3NZHL 3Q3GB 2QSTA 2YD3A 2R1XA 2P24A 4OLVH 3MA9H 3BH8B 3K4AA 3WLWD 4KTEH 1MVUB 3ES6A 4XMKH 1YMHA 3N1PC 1F02I 5KSBB 2YPLE 3C08H 2BSTA 1NDMA 1ORSB 1OW0C 4HIIB 3RUGB 5B39A 5HPMA 4KKAD 1A4KB 1FRGH 2EDOA 5CP7B 5FYJE 1UZ6E 3CNKA 5KTEH 2ERJC 3LDBB 4LDOB 4HUXA 3WDJA 4OF7A 2WUCH 5F7UA 1NEZB 4JGMA 1EFXD 2DD8H 1A6WH 2VDKH 3UAJD 3VD5A 5CP3A 2X9YA 3CFDA 1MREH 2QKIB 1GL4B 4GMTL 5DHVB 4CJ1A 5EPMB 3VXNA 4A6YB 5I1DA 1NCWL 1CDBA 1FAIH 1T7YA 5D7IB 5CLWA 3C2SA 4DKFH 3QI9B 2VABB 4ODSH 5DK2B 3GKWH 3MROB 3T1WA 5D2LB 2M8XA 3IJSA 3T4AB 5F1IA 3GBML 4CJ0A 1HWHB 1HZHH 4OFYA 4HKXB 1PKQE 4MJIE 4FFYH 4Z7UB 4O2CA 2YD5A 4ZG1A 2D7TL 1RZFH 3O6FA 2J8UA 1WBZB 1IGFL 1T2QL 4YO0A 2DJUA 4KVNL 2IFGA 3FN0L 4PY7B 4MSWA 4OCWH 2V9TA 2UY7A 4BJLA 1OTUC 3UBXI 4LSQH 3H7BA 5FGBA 5IFAL 1J1PH 4S1DC 1TITA 1T7ZA 3NABH 3OG6B 3X14A 3RBSA 4U1GC 2I60L 3VFRB 5E2UH 4Z7NF 2VLRB 4QHUB 4CN1A 4NFDA 1U8JB 1BECA 5I66A 5FYKH 5IEKA 3OV6A 4Y2DB 4XMPL 1K8DA 3I6LE 1FNGB 4X7SH 3RHWK 4RQQA 1IT9L 3VXRA 2ZOKA 3KWWB 1IC7L 1KB9K 3HMXA 2JELH 4XWOD 1ZLUH 3UMTA 4NGHH 2C1OB 3BAEH 4WUUD 4KRPD 1EHAA 4MQXD 4LNVA 2QJDA 1XH3B 1HXYB 2YD4A 2JB5L 2GTZB 3NZHH 2AJ3A 4KK6C 4WEBH 1D5ZB 3CFKA 5D7SH 4YFDB 3RKPA 2C26A 5JHLL 3RKDC 1F3JB 3WBDA 1MJJA 2OL3L 4M5ZH 5ANMA 2VZ3A 5E6IA 2RQ8A 4QRSA 1UGNA 1LHZA 4P46B 2AK4D 5KSAA 1GYAA 5EOTB 4ZAKD 5DRNA 1E4XI 4JRXA 3DUHA 2X7LB 3GMQB 5DJZB 3C9NA 4J6RL 2XWBB 4X80H 2EIZA 1BQLH 3HC3H 2OLDA 3FN9A 4QHMB 1AO7A 3QNZA 2VLLA 3VXTB 4ETQB 1MCPL 4LU5L 4HHAB 2AV1B 3QA3A 4YXHH 1CFNA 1QHPA 3FHQA 5D2LF 1CGSL 5FK9A 5F71A 4KTYA 1JYNA 2Y5TB 1F4XL 5FHAL 3OQ3B 4ODSL 1T0PB 5J12B 1X5KA 1ONQA 2CJUH 2JCCE 2M26A 4G7VH 4PJ8D 3TCXA 4XI5C 3BZEB 4H20H 1FL5A 5I2IA 3WS6A 2EYRB 5L8LB 5J9PB 5C07B 2BRRL 3KJ6L 2VXTL 1SJEB 1B0GA 3TBWB 2VTFA 4GXUN 4FQQA 4FHBD 1PSKH 4P5TC 1AXSA 4G9DB 3MV9D 3ARFB 4K8RL 4Y2OA 3MRIA 4ZO8A 3WJJA 2XIDA 5FOBB 4Q74A 4KGLA 2CUIA 2NX5A 1RMFH 4L8SA 4K7PH 4NWUH 9CGTA 2E8YA 4QXWA 4S0SD 3QEGL 5ACZA 4QXGL 3QDJA 2ILLA 5KSAD 3O4OC 2W0KA 1IM9D 1MJUL 4ZSOB 4NN7C 3RY4A 4OLUH 3M17A 4I9WE 5CILH 5ANME 5F7YC 1K4CA 3DROA 2NXYD 3OR7B 1F4AA 4JCMA 1SEBB 2DI9A 4PRIB 1CI5A 1XR8A 1H0DB 3ZDZF 4HK3J 2BDNH 2YXFA 3BKML 4NQSB 3MUGB 4EUPH 2OP4H 4PJCA 2BP3A 2P8MB 2GFBA 1OGAB 5I8CA 1HHGB 4WW2C 3SCMA 4Y88A 1UH2A 4XMPH 1LEKA 3H0TA 2H32H 2OR8A 1WFOA 2YMXH 1WTLA 4JLRB 1TQCC 2BNRE 1YDPB 3CXDL 5ID0B 3LKSB 1G7LA 3IFPA 4NPYA 4UT7H 1XGYL 5KSVB 3P4NB 2Z0BA 2ZUWA 1CL7L 1YEDA 4GJTB 3NGBB 4ONHB 2E8ZA 3KXFA 4G8IA 3FOLB 2E7BA 1EUTA 3BPCA 2JCCA 4HS3A 1AGFB 1EX0A 4KHTH 1BJ8A 1JHTB 1OHQA 4H25A 4Z7WE 5E8OB 3ECBA 3QIUA 4L3AA 4FXGB 5IVXE 3OXSB 4LCWA 2F53A 1F2XK 4HFWB 3MUJA 3HE7B 1J0ZA 5IG7A 3WFBL 1JBJA 3QNYA 4D9LH 4OZFG 3ULUC 4OSUH 2XKSA 4HJ0C 4P59H 1D9KC 2FX7L 3DVIA 4KKNA 2G5RA 3VFVA 4KMTH 1YUHA 2VAAB 2BVYA 4E41D 5E2TL 4R8WH 2DQFB 3KS0J 2DL2A 5BQ7B 3HNTH 1X7QA 3PV7A 2QEJA 3TH3T 2BNUA 3QWOA 1OB1B 2ITCA 2JJSA 2XZQH 3FB8B 3WDHA 4C58B 4B7IA 5D2NC 4P4KC 3QCVH 1HXMB 4KUZL 4DVRL 5E1AB 2AKRB 4RX4D 2FSEB 1VKXA 5MHSE 2CDEB 1PYWB 4F3FA 5B3NA 2ZCKL 3BUTA 4KJWD 2CUMA 3GRWH 1S7SB 1T04A 4WCYL 2OR7A 4Y16B 1TZHA 5DMKB 3O6KH 4H20L 3VXOB 1U3HD 2DQEL 4KROB 3ZYJA 5DS8B 4FNLL 3WKNA 3EOYG 3HR6A 1UVQB 1X4YA 3V8OA 4GRWH 3SGEI 3U9PH 1C5CL 3FT4B 2HLAB 5JA9A 1RZKL 2O5XH 3LPFA 2GUOB 3VCLA 2Y36L 5SX5K 4CL7A 5GJTL 5J8OA 3RVWC 1RUAH 3CFCL 5DGRA 2HTKD 2NQCA 3QHZH 5CEZH 4UIKL 4MJ5A 3B9KA 2Q6WA 1E4WL 5BS0E 3VFMA 2IQAB 3MV7A 4OZIB 1PDKA 5GRWA 2HT2D 4QRUB 5E2JA 2BVPA 1JWSA 1RI8A 3ROOA 1TXKA 3IETB 5I15H 1TZHB 5L88L 2QSCL 4KC3B 3S6CA 2HTKC 1PYWA 1VFAA 1U8HA 1VKXB 2FSEA 5E1AA 1H9VA 3STZB 1RVFH 4PPTA 3S4SG 2VUYA 1IGIL 5F9DC 4ZFZA 1PFCA 4BSWB 5JPMA 3X3FL 4DEPB 1MFBH 2H45A 3MRMA 5IBUB 4Y19E 3GSNA 5J57B 2O93L 3ISWA 2B0SL 4HPYH 1XMWA 5BW7A 4QLRA 3JV6B 1LO4H 2YD2A 4M8QB 4U31A 1ES0B 4ORZC 5DHYB 3GI8H 4NZUL 4XVTL 4Y4KC 4YHML 1U8PB 3FMGL 3JVGA 5HHQB 4JR9L 4X83A 1C7SA 1U6AH 2OS7A 1HWGB 4AH2A 5DJ6A 32C2B 1EJOH 2EH7L 2IANE 4AT6A 2W07A 1XIWA 4Z8FH 2F53B 3RJQB 1KCSL 3I3DA 4OZGE 4S1QL 3RVUC 3LQMA 3WKMH 1MWAH 3LQAL 4YHNA 4D9LL 4RGOL 3AU1A 1CLYH 1C16B 1EZVX 1NFDF 3CH1A 3TJHC 4X4MA 4G8IB 4M1GL 3ULUF 2FX8L 2VLJD 2P48B 4G7YH 4KKBC 5C6PB 4FTVB 4NSKB 1QLRB 4Y4KB 3VWKD 1UG9A 5CZKA 3LS4H 4NPYB 1BEYH 1YYMH 2J5LB 3GMPA 4UOJA 3CLEL 1E28A 3TBVB 1KEML 4OCLC 5AZEL 5EUOA 2RB8A 2ZCLH 4M7JH 3SKJL 3SCMB 2VLKE 3HUJF 3HI6H 4JFOA 5GRVL 4ZMAT 1KJ2A 1YQVH 4WFHD 1BGXH 3O9WB 1FFNB 3QEUA 3WFHA 3PP4L 1W8OA 1H0DA 1G1CA 2IANB 4GG6F 1SEBA 2NY1B 2P5WA 4U6VH 3EFDH 2FBJL 3NACL 2NYYC 1IAMA 1MRDH 1NCCH 1T1XB 4QNPE 3FRPA 1S8DB 2YRPA 2DTMH 4N8VA 4F7PA 5ICXB 1XIWC 3Q1SH 4G9FA 2R23B 3D25A 4X0KB 4M5YH 5CEZE 2BOBA 4OJFL 3JWDL 3MV8D 3VWKA 4GBXC 1RHHB 4ZUUA 1OW0A 5CEZL 4P23A 1QBBA 3LN4A 3KYMA 3RZWA 2Z9TA 2VWEE 3NCBB 3TA3B 3OKYA 2ZPKH 1OLLA 3TBWA 5FV2A 2ZNXA 5H8DA 5D7IF 4Q9QL 1NL0H 2OK0L 4XTRC 5KJRH 4LCIL 1QSFE 1TQCB 1AD0B 1MEXL 5C07A 1KTDA 5I2IB 5INDA 4CUCA 4N9OB 3NCFB 4D9RE 2IC2A 3X13A 1A7NL 4NRZA 5DFVC 4IDJL 4LHUB 1XZ0B 2YOCA 4F7EA 3KYOB 1MAMH 3B6SA 3O3BA 1KG0A 4ZUSA 1KJMA 1EK3A 1PZ5B 4HHAA 3DVGB 1BZ7B 3T0EB 3VDAA 2GITA 4X5XA 5L2KD 3WXWL 4I1NB 2PYFB 2NY4D 1WITA 4HPOL 1WF5A 5DD5H 4NQXB 1RPQA 4WI5A 5ID1B 3VXPB 2PXYA 3I9GH 2F54D 4GAGL 4MB5A 4GRWF 5D72H 5EU6D 5CZVL 5E6YA 2YHGA 3KPPA 3CSYB 3GHBL 4P2RB 4F58L 1ITBB 4S1QH 2FJFA 2Q76B 2ZSWA 5CGYD 4KKLC 2F74B 3CC5B 4JFZL 2BY3A 2B5IB 1T7WA 2KPNA 4PBWD 1FNSH 3TFKC 4NNYA 3NIGE 1Z3GL 1CCZA 4I4WA 4EBQH 4NZDA 2R2HB 3V5DB 3LEXB 4MA8L 1IAII 5HGBB 2WUBH 1ROWA 2XKNA 4NRYB 4HXBH 1KN2H 2BNQA 3NIFF 3PNWA 1K4DA 3PWVA 5KAQG 1E4XH 2HT2C 4PJCF 4MZ3A 3ARFC 2DBLH 3CX2A 5EOCJ 4JQIH 5I8EA 4Y2DA 1VPOL 4HGKC 4QOKD 1DLFL 4TPRL 4QHUA 3RWJB 3UXFA 2QQNH 4AL8H 3E3QC 3G04B 3OAYH 4Y4HD 2HMID 3NCJH 1S78C 1D9KB 3UTSB 3HE6A 5GXBB 5IW1B 5D1QD 3RIFK 1MRDL 1NCCL 2WNGA 3G5VB 1NFDE 4LPWA 1IL1B 1DQTA 4LCYA 3BEWA 5ABDE 1S7RA 3MFFB 4OI8A 1Z9OA 4CNIB 4AEIH 3GNML 1VHPA 3SBWA 3PWPE 2AXFB 2OJEB 3MBEC 3V6ZA 4PJIF 3QXDB 2FHFA 5DJXA 2YKLH 3RWGB 4YR6A 2ADJB 2ZG3A 2E9WA 4WO4B 1JYWA 3ZYIA 1U8NB 3FFDA 2OXHA 5GRYA 2PF6A 2A9MH 3BX7C 4LSRH 5D2LA 1CGUA 4RAUA 1PX3A 4PRHE 1NMAH 3CFEA 5JW5B 2FGWL 3I6KA 2P7TA 4MHHG 5D7IA 2C4FT 1HHHB 4ZSOE 3ULUE 4JO2L 2AK4E 3DHJA 2APBA 4JO3H 3H3PL 3FONB 3VFOB 2DYPA 3P11H 4GW4A 3BKYH 3NCYS 5EULV 1ZOXA 5HDBE 1B6UA 2F9BT 5FYLL 5C3LD 3VRIA 2LU3A 4QEGA 4LRIA 5E9DB 3VRLF 4HK0A 2PO6C 3QJFB 2LTQB 4JB9H 1GOFA 4WU5B 3UBXB 3UTSE 2BHUA 3RIFF 3RUGA 1KCKA 1F4YH 5DD6B 4ODBD 1IC4H 1JPSH 1UEMA 2P49B 3SDYH 5IOPA 2XPGA 4DKEH 3LV3B 1BPVA 5CD5D 5IUSA 1SYSB 1TJHL 3UO1L 3MOAH 1Z3GH 5DEGA 5BS0D 2HJLA 5E1HB 3ARGB 2HFEA 2OSLB 5T1MB 1GIGH 4NM8H 4Y16D 2ATKB 4PRHD 2XNAB 4MVBC 1T66C 1VGKA 3ZKXB 4UQ3B 3QO1A 3MLXL 1MHHA 3QZWB 4GBXD 1VDGA 1CIDA 4GMTH 4TPRH 5C9JB 5EIQA 4WGVB 4L5FH 4KJWC 2DLEA 1I4FB 4JFXB 1SYSA 3WD5L 3U30C 3BP4B 2FECL 4UU9B 2VDML 1W0WB 1PX4A 2F58L 4XRCA 4DVBB 5EU7C 3BWAB 3NFSL 2ADGB 2DIAA 5DJ0A 4OB5H 1OL0A 1FPTL 3MLWH 4QHNB 5BXFA 4OD1L 2ZKHL 1V3MA 5DI8B 5JHDD 2XACC 2G60H 3F12B 2N7AA 3GFUA 5TE7L 3KYKH 4PB9L 3TH4T 3E1F1 4PGDB 5KS9E 4GW4B 5T3XE 3LKRB 3VFOA 3HFML 3B9KC 4RAVA 1BQHA 4WWKC 3H9SD 4M3JA 5CHNA 4GKSA 3MRGA 3SDAA 3NBNA 4M6ML 1YY8B 2P47B 3I6GB 1EHNA 3I6KB 3F5WA 4JKPH 1KLFA 5EORH 1DCLA 4G43A 3UTTB 1DTUA 4Y19A 2I60H 1NKOA 5I1EH 4MJ2A 3U7WH 1N64L 3W11D 1U8NA 3VWJB 3VXUE 4P46D 4FMKA 4XHJD 4NUJA 5LCVL 4XAKE 4YR6B 1I9RH 4XVSH 4Y0GA 3L5WA 1U41A 4ZO6A 4LKCB 3NIDF 2WWMC 5B4MD 3IFOB 5IR1A 4F9PC 3ZTNH 4Z7WF 4RMWA 2QR0B 3V95A 5C0FB 1ZT4B 1W72L 2BNRD 3QDGD 4KRMB 2D03L 4M62L 4N0UA 1A47A 3UC0H 1IKFH 1A6AB 5F1NB 1N3NB 3TPUB 3LKOA 4WEBL 2EDFA 1JJUA 3PHOA 5EBMA 1MFCH 1QO3A 3PUCA 3PV6A 3TYFA 1IE5A 3QUXC 4DKEL 1D9KA 2MJWA 3IDYC 3GMNB 1BFVH 2EZ0D 2ZOLB 2OI9B 4P4RB 1BLNA 1RZIA 1BVZA 1A22B 1CDYA 3KLDA 3RWJA 5F72S 4UDTA 1QBAA 3OB0K 2AJSH 4S2SB 3IJHB 2F53E 5I1AA 1X5GA 3LOWA 3MRJB 2VLKA 4HC1A 4ZNEA 3DGGA 1AD9B 3JBG7 3WHXA 4X8JB 2MNUA 4X4YA 1AGDA 2E27H 5E5MA 3HC3L 4HX1B 5DRXB 4LIQE 4HUVA 4WVRA 2XZCH 3IGAB 4XPGL 1F6AA 3FZUD 4YXHL 1MREL 1P69B 1CD9B 2YBRA 2AJZA 3WYRA 4KRPB 4NZRH 1A1MB 5T1LA 2VL5A 3CC5A 4LGPB 4YNYA 3WIFA 4GW5B 5CINL 1FORH 2NTFB 2A6DA 2LAGB 5BV7L 2Z92B 1JP5A 2CIKA 4FFZH 4FQXA 5C09D 2PXYB 1M71B 2A73A 1ZHKA 1D5XA 2DM4A 5DR5H 3HZYB 5HVWA 1XGTB 4N0UE 3GSVB 4S1SL 5C07E 5TE4H 3UTQB 1PZUB 4JFHD 4KVNH 4R4BA 1FFOB 4L8SC 1RD6A 3VXSD 4U1NA 4PREA 1ZS8B 12E8L 3RWIA 4OCWL 5FGBC 2XXCB 1ZK9A 2CRYA 3KYOA 4ZFOL 3RTQC 5BS0A 3D39E 1AKJB 4NO0D 1H3XA 3F6IA 3P77A 2BXZA 3X13B 4IOIB 3MV9E 3BGMB 1SBBA 2OP4L 4MQXC 5IV2A 1AD0A 4PTTA 1BIIA 2DAVA 5DLMH 1ZA6A 3VGGA 5D70L 4GQ9L 4U2YA 3VI4E 3SJVB 3BO8A 3QFDA 5IM7A 3O8XA 4JFDB 3VWKB 3FCTB 1FVEB 4KGJA 4LKXA 3MGTA 2CLVA 3HG1A 4PJBF 5C09E 3Q6FA 2GCYA 2W1NA 5ICXA 1XT5A 1HI6A 1GZQB 1JYVA 3UJIH 4NZTH 4N5EC 1QACA 4N90D 5DSCB 4TULL 5F89A 1H8SA 5TDOB 1XF4B 3MA7B 4C57C 5IFJA 2VXUH 3QPXL 3SJVD 2AAVA 2Q3AA 4C56B 1IGYB 3MQIA 1D6VL 3MV9B 2AV7B 3SEPA 25C8H 5D7JC 1KJ2B 2FHBA 5C0CD 5A16B 3DRQB 4LCCB 3RJDA 4Z7WB 5DJCA 4F33A 4ODUB 3PGDA 5CKAA 1NANI 1MUJA 4ALAH 2ZG2A 1E28B 1F90H 3TBVA 5A3ID 1Z0NA 3TFKD 5I1JL 4X4ME 3BMVA 5SWSB 1JYXA 3RAJH 1FNEA 2D7MA 2KUTA 3TYGL 4UV7H 5CSBA 2QQKL 2EYSB 4DVRH 1MCRA 1FZKB 3DV4A 1FV1B 3IDIB 4ELKA 1A0QL 1FZOA 5C0RH 4HWNA 4HIJB 3FRUB 2NXZD 5FHAH 5HYJD 1QEWA 3MBEA 4FQCH 3ARFD 1ZXQA 1S5IH 3PWPA 32C2A 3GM8A 1UA6L 1IEHA 1GPOH 1WC7B 5HI5D 1U8PA 2B1HL 3BRGC 4CN6A 3T8XA 5HYQB 4AM0B 5T1KA 1AFVH 2VZOA 4GBXA 4DGYL 3TO4C 3TT3L 4NWUL 5D1XB 4OCXL 4PY8J 4OZGA 3MPCA 1YMMD 8CGTA 1ZGLB 1PEWA 1I8IA 4B53A 5EZOL 3BPNC 4ZFZB 4BSWA 5DXWA 4PRHA 1RZ7H 2XRAH 1MCDA 1T7XA 4NUGL 1U8HB 3CSBA 2DLTA 3L5XH 4PJDB 1RULH 4PUBH 5HD8C 2FJGA 1P7HL 5GGRY 1KCVL 5L88H 3EYSL 4PV8A 1QSFA 3V0VB 1SJHB 4PRPD 2FD6H 2P5EE 4L8BB 1R5VA 3K74B 3L3GA 4OQTA 4HKJB 1N2RA 4QXTB 3KDMB 1NCUA 1CD1B 4JDTL 1YPZF 2O61B 3FQWA 5D1ZB 5T3ZL 1CXKA 3GMLA 3T0WA 3UAJC 1A3LL 5IT2L 4XBEL 3CFBB 4OLYL 5HD8D 4OZHE 3OPZL 5JIKA 4XPHH 4NQED 4CVZB 1HCVA 4XCFH 3CVIH 3C87A 4XTRD 4XP6H 2Y07H 4KHTL 3VXMD 2ENSA 5D1ZD 3W0WE 4I2XA 3C8KA 2OMNA 3S5LB 3VXOA 2CUHA 3FB6A 4ORGB 3UZVB 1MI5D 3HI1A 1T04B 2BCKA 2DB8A 4U7SA 2FR4B 1EXUB 2LABA 4CMHB 2CDEA 3KNBA 3PWNA 5LAXA 3MO1B 1JGVH 4JPIB 5IMKA 3D85D 4KAQH 1I85A 2BNUB 3QWOB 3FJTA 3ESVF 2DQFA 2K7PA 3HPJA 3HNTL 4M6NL 2QTEA 4PGZA 3ZKNC 5HVHB 2L7JA 1TCMA 1T83A 1I85C 3MLTB 4XBGA 2DDQL 4KUZH 5T1KD 2R39A 3WE6B 1A0QH 4ENED 3OZ9L 4XAWH 1QLEL 2ZSVB 3D6GA 4KTDL 5DJ2B 4EVNA 5SWQB 4OZFH 3MJ7B 2CDFA 3QIUB 3BD4A 4PGEA 1CK0H 2B4CC 3NACH 3ROLB 1N4XL 3F7RA 1JHTA 1NFDB 4UILL 4I5BB 1OP3K 3VXRE 5GGUA 5HHNB 5I71C 4Y2DC 4G80A 4FP8L 3FOLA 4ZTOL 4LQFL 2Y36H 3K81A 1MPAL 1YEDB 1A4JA 1YC8A 2GTWA 3MCLL 4X6EB 5T5NF 1RURH 4IRSA 4NN6B 3BIAX 5C2BH 1BD2E 2HRLA 1JHLL 3ZL4L 5L2KB 1UM6L 2MKWA 3LKSA 1PEZA 4OCXH 2FIKB 4ZXBA 3QUZB 2EC9T 1U8MA 3MRPA 4JFYA 2CGRL 4WW1A 5FO7B 5IHZA 4IS6A 1YNTA 4I2XE 3WUWA 5K59E 1MSPA 4Y4FA 5E8DL 1XGPB 1E6JL 4FQXD 4JY4B 4TRPL 3L7FB 1BWMA 4OLEA 1J0HA 1KCVH 3OKLB 1DUYA 1IM3A 2QSCH 1URLA 3O3DA 3OR7A 4QHKI 4P5MB 5D7LE 1OP5H 3O6LL 4JFFD 4UT6L 1U91B 3M17B 1FCCA 2FD6L 5DJDA 1MJ7H 4Z0BL 3GO1L 4FFWC 2OR9H 5F8RC 4Y8DC 5D7IE 1OD7A 2V2WA 2XXMB 4WIQA 3R8BB 3R0MA 5FOBA 3OHXB 3MRIB 1G7QA 5A2KH 1FDLH 2Y06L 3TBYA 5A3IC 4P3WA 1M7IB 4YHMH 2EIEA 3LEYH 2L7UA 4NRXB 4ZTPH 1SJEA 3CPLB 4YFLF 3S37L 5TPWH 4PG2C 5HHOE 1ZANH 3K7UA 5J9PA 3JWOL 1FO0A 4JM2A 1AXTL 3CDYA 4HF5H 4ELMF 1T0NB 1KNOA 5EN2B 5LG1A 4NKMB 5FK9B 3OGCA 2GK0B 1BD2A 4HQQH 2FX8H 5D1QB 1OARH 1Y0LA 3MV01 3P3YA 5IMLA 5JXEC 1KLUA 4JKKA 4PJ5B 5DD0H 3QNZB 4N8CL 5IFHH 3GKZA 4NHCL 2YD1A 1IFHH 2DQUL 1P7KB 4R4FH 1LMKA 4M6NH 2ZWLT 4HIHA 4MXQC 4U6XB 4Q6YA 4PJ9A 1WSST 1Q9OB 4GG8B 3LPWA 1NLBH 2IAMD 5GQBA 1NH6A 2XQYK 2R2BA 3HI6L 4P5KB 1OSPL 5DRNB 3VJ6A 1BAFL 3HI5L 1HKLL 5FB8B 3QQ4B 4F7CA 4PLJC 3HZVA 1U8IA 4UDUB 2AJVH 5ANMB 4ZOBA 1I9IH 2NZ9C 2E5EA 2P5WD 5FYLE 3BDBA 3AB0B 3RX8A 2Z8SA 4NHUB 2ZUSA 3I02B 3TA3D 1BX2B 2Z8VC 1KEGH 4MAUH 4NO3A 3B8SA 3MFGB 2Y7QB 4GAFB 3GNMH 3HR5A 3PL6C 3KXFE 3PWLA 1ETZA 2E7HA 2C1OA 3GM0A 1XGQA 5TE6H 3ZE2E 1KXTB 4IMLA 3L1OH 2YC1A 4IRJA 1CFTA 3O3EA 4Q9QH 2CD0A 1FCGA 2VLRA 1KGCE 5EBWA 3VFRA 2PTUA 2EDYA 5C0DB 3SGDI 1C08A 4JKLA 4J3TA 4TNVF 5TH2A 1J1OH 3VRJA 1CLZL 2GK2A 3IDXH 4P9HL 2E6PA 1CQKA 1S9VA 1RAMA 1WVZA 3R1GH 4OIIL 1R5WA 1CE1H 2VB5A 2R9HC 3I50L 2DBJA 4MQTB 3RI5F 4UB0H 2PTTA 1LE5A 3VFWA 3HG1E 4OF8A 1T3FA 1UXSB 3EGSB 2GY7B 1FP5A 4YLQT 2X09A 4KK9C 4I0KA 3DBXB 4C56D 2E7LC 1HDMB 4D9RD 4BSVB 2BNRA 3V5HB 3ELAT 3ZHKA 4H0GA 5I17A 2Y6SD 2Y06H 5CJ8A 2BMKB 1ZHBA 4G8EB 4WWID 2NY6C 1PY9A 4LARH 3GMMA 4NFCA 5IBLC 1CXLA 4YGVA 3TEUA 1JWMA 1S7QB 3S37H 1WFNA 3KVQA 5TPWL 5HPOA 4QXUH 1C5DB 3SJVE 4I48B 1HQRB 5CKGA 4Z7OF 1B2WL 3RWHB 3I85A 4LBEA 1FO0L 2UYLB 3TM6A 1AXTH 5IB1A 1NUGA 4OAWA 1CDGA 4UIMB 4KK9D 3O9WD 2FHCA 3ETBF 2E7CA 4XB7A 4NJAL 1T20B 3PL6A 1RJYA 1X5IA 1B0WA 3U6RA 5J11C 1N5AA 4DZ8A 1FZJA 1S5HA 3E6HB 2HT3D 4NM8L 4JRWA 2AVGA 3TNMA 1C1EL 3C5JB 3BPLB 4J4PA 1ZLVH 1MCCA 1QR1B 3G6JB 5F44A 5H35B 2CK0H 1UQSB 4JQXA 3ZLQC 2P42B 3KJ4C 3TN0C 3VGFA 3ULUH 3MRDB 1DLFH 4LPTA 1IKNA 3ZSSA 4PJEA 3IDYB 5HGAB 4Z6AT 3OGOE 1ORSA 2BVEA 1CVSC 5DEFA 1KUMA 3D39D 3QH3B 4PRBA 6FABH 1R3HB 2HLFC 1PW3A 3EO0A 2E7MA 2HVJA 2ICEB 1WCBA 5ISZB 5DFTA 4LHQB 5GPRA 4LAQH 5ALCH 5I19H 2QSQA 2AGJH 2ATPB 1NCDL 1KT2B 1X3DA 4CMMA 5CBEB 3S96B 1NGXB 3RHWF 1BVKB 3D1MC 3OKOB 1TJIH 4K7PX 2P44B 1CVRA 2RGSA 1SHMA 2DWEB 2X89D 2VLMD 4LLDB 3P9LB 4OM0L 2R0KL 4AENA 4CKVX 5SWZA 3KPQA 4P2CG 4R96B 4RISH 3FTGA 2PCPB 4PRPB 4LLAA 2VC2L 4BA8A 2BFVL 3KPMA 2XTJE 3O41B 2DM2A 1LK2A 3MR9B 5FAAA 4EDXA 3MNWB 5D1QC 3BP6B 3R1GL 4LCWD 4LIQL 4MNHB 4J3UA 1VERA 3MREB 1RUPH 3MLUH 1K3ZA 1N64H 5FM4A 2E6QA 5IQ7H 1BVLB 3GSRB 5FV1L 3H3PH 2A74A 1AGBB 4X7CC 2GSGB 5EUOE 5TJWK 1FIGL 3ZKQD 3CVHA 3FN3A 5DJYB 1J86A 4LPUA 3RDTD 4I77H 4MQ7A 4YHPB 4CN4A 3UBXG 1KT2A 2DQTH 2MHAB 2R56H 2P5WE 3P2TA 5ISZA 2ICEA 4Z7OE 1NGZB 4QOKB 2NY1C 4C4KT 1JPSL 2HVJB 3G5XB 4FQ1H 5MENA 4MLIA 2Z31C 1SQ2N 1VGEH 5DWUL 4XAKD 2VSCA 4RRPA 4TOYH 4YBLC 4QRRA 4TVPL 5J3HC 4XPFL 3IFLH 4OLXH 5ESVB 3PHQB 3GSQA 3V79C 4RGNC 5IESH 1S7XB 4LLMA 5E99H 1DEDA 2OZ4L 4U1HA 3PJSB 3S9DB 2G2RB 1I1AC 3I2CL 1E4KA 3QQ3B 4NDMA 1KIPA 1EFQA 4X99A 1I9EA 4KVCH 5C0AA 3VXQB 4Q2ZB 5ITFB 2XZCL 4CVUA 3TNMB 3MRRB 5DJAA 3VFNA 5C6TL 3LS5H 4PJDF 1OAXH 4FG6C 2Q8BL 3HAEB 1QOKA 3ARSA 2NY0C 1I7UB 1VFOA 3O4LE 1QNZH 1RJYB 2GW5A 4U6HA 1UWGL 1FYTD 1K8IA 3MUHL 4OQ1A 1J05B 1FN4A 4IIQB 1D5IH 4LOUC 5JW4N 1FORL 1HEZA 3QZWG 2UYLA 1H3TA 5EO0B 3DVFA 1U2CA 3MRHB 8FABA 1CZ8H 4PJ8A 4GSDL 5I71B 3FL7A 1S7QA 1BBDL 2V17H 4P48A 4YGVB 4DQOH 4M1DH 4HEME 1E6OL 3O11A 3QRGH 4DWHA 4TUOB 4WY7L 1YEEH 2MMXA 1HDMA 4JHAL 3A6CL 4M7KL 1LE9B 4X6FA 3FQRA 3DUSB 1JV5B 1KTRL 5I1IH 1LE5B 3GB7A 2VO5A 2YUWA 1KENH 1J9CT 4V1DE 1YYLL 5DHVH 5GSRA 4ZQKB 2HFGH 2OJZL 3UPCA 2JF1A 4J4PD 4YHLL 3DXAD 4OF6A 4R3SB 2EDBA 4P2OC 3VRJB 3ILQC 1N0LA 4LIQH 1WWBX 3ARBC 3OAUH 5J1SC 2HN7A 3OXRA 1T89C 5T1DH 1WWAX 3U7WL 4N0FB 4H1LB 4P3DB 4HJGA 4OZ4B 1F45A 1TQBB 3WDIA 4R0LB 4GQ9H 4RMSA 4XVSL 3DSFH 4KKLD 4NO0A 2P5EA 1LK3L 3EOAB 1KCRL 1RFDL 4G6FB 3JTSA 3S5LG 1ZSDA 4PY8I 2VQ1A 1CD0A 4R7NA 1FFPA 5ITBH 1G7JB 2F19H 4KUCD 5FYLD 5T3XD 3REWB 5IBTH 3BIKA 3VGAB 4NZTL 1IKFL 1YEIL 2R69H 3HRPA 4PJAB 4O2EA 2EDDA 2ARJQ 4JGJA 3MA9L 4CU6A 4XNXL 3QPQD 1BFVL 3C08L 4YPJA 4PV9A 1NANH 2JJWA 1Q38A 2EDTA 3WMSA 3DX8A 2YA0A 4MLSA 5EC2A 1TZGH 5F7MC 5IESL 2A83B 4ZOAA 5KTEL 1EA9C 1Q9OA 3QEQA 3S34L 3QUML 1CFSA 3I2CH 4GKNA 1EFXB 1PG7L 5E2WL 2FYYB 1YEGH 1EAJA 3RNQB 4JZJC 3GK8L 1KB5A 4V1DB 4MA1C 3KPOA 4OF3A 5FIEA 1YECL 1FYTB 3MRFB 3MV8A 5IKCA 4NKMA 1UZ6F 1ZHNB 2AS5M 1BREA 1NQBA 4MCZB 3VXSE 2E6JA 2DQCL 4JM2B 3TA3C 3ZE1E 3OKDB 1CZ8L 3WNOA 5HGHA 1JL8A 5ERWB 3CPLA 2XQYG 1MCHA 4X6CE 2X5PA 3NFPB 1G0DA 3LEVH 4JHWH 1UC6A 3SO5A 5EG6C 2A6KA 1N6UA 3Q5TA 4P2YA 4IHOA 1D9KD 4EJ1C 5JLZA 4BYHA 4XCNB 2V2WB 3FFCD 2XY1A 4U1LA 3ZMRA 4R0LA 3NFNB 4O5LL 3RUGE 1V3LA 4HGWA 3IJYA 3VW3L 2ADIB 1GXEA 4N0FA 5HDQH 2APFA 3DXAB 4E5XA 5D7KE 4Y1AB 2VITA 1HIMH 4XWGL 1DUYB 1UJ3C 2R4RL 3BDXA 1Q0YL 3OJDA 5GS3A 4R3SA 5GS2D 4HS8H 2CKBL 1IQDA 4L9LC 4JY6B 4HWEH 4WO4D 5D7JB 4U0RB 2APVA 2B4CL 1U93A 4WNQA 1B4JH 1X6NA 2IBGA 4FA8A 1MHPH 5EFIB 3DUSA 5I73B 5C0GB 4X6FB 2FIKA 5D70H 2GY5A 3X11A 3SO3B 4UV4L 1OWWA 5C7XH 5HVHC 1KCRH 1TETH 3WFDL 4EI5B 3QFJD 3O11B 4DW2H 3H9SA 1WBXB 4YXLH 2OL3B