2R4RL

Crystal structure of the human beta2 adrenoceptor
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
214
structure length
214
Chain Sequence
DIKMTQSPSSMYASLGERVTITCKASQDINSYLSWFQQKPGKSPKTLIYRANRLVDGVPSRFIGTGSGQDYSLTISSLDYADMGIYYCLQYDEFPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the human beta2 adrenergic G-protein-coupled receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Beta-2 adrenergic receptor
total genus 45
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2007-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r4rL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r4rL01
4KHTL 4JN1L 4O2EB 4ZQKB 1YPZB 3QB7C 5F1SA 3IDIB 2IBZX 1AXSA 3O4OB 5LBSH 3T09A 5ISZE 1MCPL 2VDRH 2MTPA 5IFJB 3RBSA 2YWYA 4XVUD 4NKDA 4IIQC 1FRGH 5IF0B 3UAJD 1DQDL 5JIKA 4CDGC 3NTCL 3HCVA 4X6FA 5CHNA 3H3BC 4R0LC 1INQA 1BIIA 3THML 4LPVA 2HRLA 4ZUWA 4HG4J 4LLUA 1MCDA 4MB3A 2AEQH 4GRWE 1D5ZB 3C8KB 3LPGA 1YYLH 4XAWL 1ED3B 4GW1B 5IK3B 3HE6A 2AJSH 4U1HA 1K2DB 2AQ1A 4PGEA 3KPPB 1ZT7B 1ZGLP 1TTGA 4NYLA 4CW1B 1Q9WB 4OGYL 1TFHA 2X40A 4P2OB 5D2LE 3U46B 1KF9B 1I85A 5C9JA 4YDKH 1IEHA 3HZYA 1KXQE 3MRPB 1GJIA 3LKOB 3BIAX 3G5XA 5BJTA 5F7DA 7FABL 2J3SA 3LS5L 2AJXH 5FIEA 3D2UB 4PJHB 4JPKL 1FNHA 5SWSE 4S1RH 1MH5B 2CK2A 2EIEA 3AREA 2DWEB 5IESH 2WSKA 2R2CA 1VHPA 1LDSA 1WUNT 3WFEH 3EHBC 4Y19A 3IVKA 3ARDA 4ZTPH 2DOCA 5HI3D 43C9A 3CFDB 3TCXA 1HSBB 2CRMA 3TFKD 2XZCL 4I2XA 4Z7NE 2A9MH 5K9QG 3G6DH 5BS0E 2OTUB 5I1HL 4F9PC 4HSQA 5BMFH 1ZT1A 1UZ8B 2BZDA 2HRPL 3GJEA 4AT6A 3VXOB 1A8JH 3AB0B 3VXTA 1RZFL 4YHMH 2OK0L 1TVBA 4FFYH 2FIKB 3LV3A 3V4VH 4LMQE 4FQHB 5DRXA 1I9IH 3PHQB 2W60B 1GZPA 4WHDA 5D2LF 4K3EL 5FCSH 1SJHB 5DRWA 4ODTH 5MENA 4G3YH 4LSQL 2DJSA 5KSUA 3K1DA 1G7JB 5I8KL 1MHCA 1XIWC 3O6FB 2YSSA 4Y4KD 3GBNH 1JNNH 4JO4L 4WVRA 2FB4H 3QWOA 1VACA 1A47A 2G2RA 2Y5TA 4U4BA 4HUVB 1G7IA 1OVZA 2VKWA 1NFDE 3GIVA 3ILQD 2QKIB 4DQOL 1QFHA 1P4BH 1R0AH 3SDXB 3JWNC 1W72L 3VDCA 2E8ZA 3KPMB 1A14H 1NCAH 3JWDC 4PRBA 1NPUA 3QRGH 4PJ5E 4PJIF 1YNTA 2AJUH 1HCFX 5T3ZH 1KJ2L 4BKLB 1FGNL 2YBRB 5JW5A 5IW6B 4QTHA 1CXEA 5CZVL 2IAND 2X70B 4WUUA 5BVJB 1RPQA 3H8NA 2WP3O 5CINH 1RK0B 3FB7A 4JM2A 5C2BL 3NCJH 2I26N 3SO3B 3RNQA 2ICWB 5I1EH 5JZ7D 3EJZC 3U2SB 4LCYB 4JO2L 3ULVD 5T5FH 3AB0C 3FT3A 4JM2C 1V8HA 3MCKB 4HXBL 4FRWA 1T4KA 1PG7H 4FQ1L 3U36A 1NLDH 2R69H 2VWEC 1U58A 4DGIH 4WWID 3U4BL 1YJDH 1YYML 4FXGB 1BVLB 4XPGH 4JFFB 1AGEB 3RWFA 4QNPE 2DIBA 5D6CB 1JTTA 4FQHA 3OGCB 3L5XH 5AYQA 1TCRB 4NGHH 1WT5A 1R3KA 3MJGX 4OZGB 1XT5A 4KJQC 5ALCL 5F9JA 5T3XH 1BOGB 2R9HD 2BDNL 5TH2B 4FQCL 1LMKA 2H9GB 4PJ5B 4EXPX 2LV4A 3TWCH 1DLFH 1MPAH 2HRPH 3U7YH 2QR0B 1AC0A 2VABB 4CBPA 2FHFA 3T0WA 3PL6A 3SKJL 5JMOC 4E5XB 1G7HB 3KPQA 5HDQH 2VWEE 5T3ZE 5J89A 5LCVH 1NH6A 3GNML 1OWWA 4NM8H 4A6YL 1FJ1A 3ZDZF 3EZ8A 1IE5A 3GK8H 3SE9H 5F96H 4LSQH 3IYLW 2OZ4H 4LSRL 4O58L 4GXVH 1ZLSL 2PYED 4QEGA 3H9SB 3NH7H 2CKNA 1YEHL 3T3PE 2ZCHH 2VABA 2MQCA 1RZFH 5DC0A 4WUUE 3STLA 3MGAA 2CIKA 3IDXH 3MYZA 2V9RA 2VXUH 4QXTB 5I1HH 1KJ3H 4I3RL 1NL0H 3AAZA 3QEQB 4PGEB 2PXYC 1NGQH 4TTGA 4L8SB 3RPIA 2GJ6D 1MQKH 3K8LA 2XIDA 1REIA 2QADB 3P11L 3TBVA 4YDVA 2DICA 4JFEB 1N59A 1RZKC 5CKAA 3DRTA 5HYJB 1HSAA 1OB1B 1T2QL 2BCKA 4JHZA 1Q0XL 5HGAA 2WAHA 4N0YH 5E6YA 2XRAH 1KB5B 2Y36H 2CLVA 5I73B 3NZ8A 5K9KB 2XTJB 1QA9B 3S36X 3IJSB 3KNBA 2C3XA 4YHNA 3T2PA 2NY4D 1E4KC 5FGSA 2HVJB 3ARED 3ARPA 4NKOA 5I1DB 2IGFL 4XP5L 3OKNA 4MXQD 2Z31D 2P42B 2MCPL 3KVQA 2DMBA 1AGFB 2P48B 3RVTC 5J6GA 4G7VL 3GBLA 3ZSSA 5IR1B 5HGBA 4KK8D 3DURA 1IC1A 2XKUA 3VA6A 1J0YA 2Z92A 4GG6E 5HI4C 1NCWL 4GW1A 2PF6A 1PLGL 4HIHB 4HLZH 4WI8A 4XP4L 4Y4FB 4N8VB 1MLCA 4IMLA 1TJIH 4PJIB 2BHZA 1UXSB 2UWEF 3R8BB 4UNTA 4Z0XA 2A2QT 3QT2A 4JVWA 4PTUB 1YN7A 4ESKA 4N9GB 2JK5A 3VH8A 4F7PA 4WWKB 2H2PD 2AEQL 5D72L 4QCIB 5TE7H 4ZTOL 1T66D 2HFGL 2NY6D 1WWWX 4KRPB 2PETA 1NAML 1AGCA 1VPOL 3RKDD 1H5BC 3IKCB 4P99A 1M6OB 1WFUA 3C9NA 1MHCB 2NY4B 2MKWA 4OT1L 4RMUA 4KK9D 1QNZL 5ANMB 4K94H 1I7UA 3EYVA 3UTTD 3TYGH 2JB6A 2LQRA 4Z7UB 5C0AB 3GKZA 3BZDA 5LBSL 1D9KB 4DZBA 1ZLVH 4RZCA 4PP1C 1JWSB 3P9MB 4BFBD 4FQIH 4LLMA 2Z0BA 4JO1L 3WS6A 4AG4L 2DKSA 4F57H 4NN6C 3GJEB 1S9WB 1NCBL 4H0IA 3L3JB 2D2OA 5AD0A 5FM5O 4GSDL 1M6OA 3C5JA 2WP3T 3BYTA 4K55A 2EDDA 5DUPL 2FLRT 2YD5A 1AQKL 2EYTB 2XPGB 4HQQH 4CN4A 3RY4A 1LWRA 5FB8A 3P73A 2D7TL 2FECL 3BD5A 1F58H 1AXTL 4GKZB 3IXAB 3VGAC 3HUJF 1HQ4A 4Z0BH 2RFXA 4IS6B 3FCTB 5HHVL 4Z18A 1TJIL 2Z92B 3X12B 3GMQB 3ULUH 2AK4E 1EEZB 2Q8BH 1I1AA 1NCNA 4HAFA 4DUXA 5IKCA 5T3XD 4J3VA 3RVUD 1BZ7B 1I9EA 2HP4A 5HYFA 4OLXH 3RUGA 2R15A 3CDFA 1MFCL 4JG1H 5IVXA 3SDXF 5JIPA 2OZ4L 1JHTB 1CR9H 1SY6H 3N9GH 1BQHA 3TNNA 1HZHH 3U4AA 4YZFF 1PD6A 1TTFA 1U8JA 4LGSB 4XP6H 5HHVH 1N4XL 2KH2B 4FP8L 5GGVH 3OV6A 1D9KC 3EOBB 3F7PC 5JTWA 5C0BA 3JVGA 3QDJD 1QTYT 5T1KB 1PYWB 4YR6B 5E8PA 4XP1H 2X4OB 2HLAB 4J1UA 4U6HB 4X4ME 4KK5D 1QFWL 3U2SA 4LLVB 1T03L 3FN0L 1FVEA 2F53E 4QXGL 3ZYZA 4NFDA 3BHBB 4NKIL 4M48L 2APBA 3LEXB 4XXDA 5F9WC 3EDFA 4JFPB 1QBBA 3NABH 5DJAA 3TVMD 4HFWB 5FKPA 1T7VA 3LZFL 2OL3H 2AABL 3TBYA 3HB3C 4L3CA 4HJ0D 5INDB 4Y5XA 4Q2ZA 3MGTA 3LKRA 1R3KB 1RZGB 5DMIL 4RX4A 2OCFD 2Y07H 4K8RC 1ZE3C 1FAKT 2A83A 3X12A 1XFPA 4HC1L 4U6HA 1KYOJ 1G1CA 1NAKL 3T0EA 5BO1L 2VZTA 5E00B 1HQ4B 3WUWA 5HPOA 5JW4N 5E9DB 3PE9A 3WNMA 2WBJA 1NLDL 2R69L 1T7XA 3MUHL 2R23A 8CGTA 3ZKXB 3UZEA 4HS3B 3BH8B 3BW9B 1F4WH 4PTTB 3EOTH 4MNGE 5AG9A 3DVGA 1FYTD 5HVFB 1GSMA 4YHPB 4H8WC 5DC4B 4NNYB 5MP6L 4NQDD 2L4OA 4CGTA 4ZUSB 3MNZB 5GS1A 3GGWA 2X44D 3H9SD 5EU6B 2R23B 1BX2B 3MLWH 5FGRA 4H1LB 2LTQB 4YHKH 3KPRB 4WHTA 1KV3A 4IMKC 5JPNB 3QRGL 4OAWA 2PYEB 4HH8A 3SKMB 1AGDB 4QRPD 2I60L 5KSAA 2FLBT 1NUDA 4PJ9C 4FG6C 3U4EB 3VWKC 1TQCC 2MCPH 5FYJL 4KZEL 4QRRE 2H6PB 4NCC1 3VXMA 3GUTA 4KQ3L 5IHBA 4EXKA 5D6CA 1WICA 1RJYB 1RMFL 1HHHA 4LOUC 5KVMC 5JPMA 2FB4L 4TVPD 2XA8L 2XTJC 1T5WB 4W6XB 3EDKA 4TUJB 4GXUM 5C7XH 2I24N 4JFED 4X6BA 1S8DB 4MCYB 1YPZF 3H2WA 4HWUA 4I4WA 4EOWL 4PBXA 3CX5J 4CL7A 1C12B 4Z76A 3TEUA 1NAKH 4PS4H 2WQ8A 5CEZL 5DJDB 1JGEA 5CGYC 4QF1B 4DVRH 4MAYA 1Z9LA 3SGDH 4U1MB 3C5ZA 4OCWL 3RA7L 1B9ZA 5IW3A 1S7SA 1RU9H 2H3NB 1LDPH 3HZYB 1OTTD 3MRPA 5DJXB 3OKEB 5F70A 5HSFA 5J11B 1LGVA 3SDAC 4NKIH 2P8LA 2VLME 5E5MB 1AGCB 2X7LA 1ZHLB 4XPTH 3WLWC 3MRNA 4FHBD 1XAUA 4LPCA 4MNGA 4QCIA 4P9HC 2BK8A 2Y5TB 3GKWH 1IGMH 3GMPA 3W81A 2X4NB 1WVZA 4PGDA 3MXVL 1XGUA 3SJVA 1WIPA 3FAWA 2ZKHL 4EI5D 1KACB 4RMSA 3ALWA 2ZNWA 4NUJA 1NJ9B 3VA2C 4N8VA 3ECBA 3DTXB 3FT2A 4B7IA 1AD9B 4DZ8A 3FL7A 3O6KL 2DQUL 2CDEB 5D1ZC 2AJXL 1HXMA 4LOUD 4M43L 4ZSOA 4JHWH 2ICCA 3QCTL 4ZUUA 3HCVB 3UTTB 4JFZL 5C0NC 5H94B 2VLJA 3C5JB 4N8CL 3EKCA 1RJZB 3L3JA 4DWHA 3QJFA 4M9OA 2YXMA 1VGKB 1YY8B 4EBQH 1G6RB 4QHLA 2HMIC 1DQML 1BF2A 3B5GA 3SKUD 2O26U 3RVWC 2UZIH 3BIKB 4O9HL 5AYUL 4KKCD 1T89C 3QRFM 3E2HB 3EOAB 3NIDE 5DUML 2YD2A 1JWMA 2WLYA 4HZLB 5C07E 2C1OB 3VE0B 5DHYA 4Q9RL 4AQ1B 4I18C 4YFLI 4DTGL 2YPLD 4UMGA 4Z7OF 4UT9L 2CJUH 4Q6IB 3V0WH 4NHCH 2ATKA 1R5VB 5ID0A 1UWGH 2NXYC 3T8XA 1T3FB 1UKSA 4OSUH 4P3WA 4Z7WE 1INDH 4C55A 4ZNEA 4N9GA 5HHME 2XZQL 4HT1H 3GDBA 3O6FA 5D4QA 3QDMA 1HHGB 4N90E 4ELMA 4MJIA 5C08B 3UJJH 3CH1A 3RZCA 4JB9L 1JPTL 4LSDA 4O2EA 1KIPA 3ET9F 3DIFB 5HHPA 4RMQA 2GW5A 4OZHB 2H45A 3QUXB 1DBAH 1WWAX 2AEIT 3WD5H 1YJDC 5B4MC 2GJZA 1KCKA 5DQJB 3QDJB 5LQBL 1KJVA 3QXDB 1LEGA 2X41A 1KB9K 1KTLA 5DR5H 1T4KB 1DBBL 4EN3D 5HYJE 3FQXA 3PJSB 4Z5RB 1I8KA 4HK3J 3TC9A 3KR3L 3QFJD 3MLUL 2NMSA 5BZDB 4LF3B 4IM8A 4PLNC 3CAFA 2X70A 3KWWB 4TTDD 2NW3A 5B39A 1Y6KR 5BV7B 1AE6H 3QHFL 3TNMA 3O9WB 1YEGH 2P7TA 1JI1A 2IBZY 4ODHL 5TQ2H 4NKQB 2NY1B 4JFZH 1GRWA 3CFCH 3DURB 3IDYC 3TVMB 4P59L 2X4TA 2P47B 4M43H 1D6VH 1CE1H 5JLZA 4G8IA 3LSOA 3UTOA 4KPHL 1I3RA 3D87B 3HPJA 5DF0A 4P5TA 1DL7H 4KKNA 4Y89A 1BJ8A 4XPAL 3JXAA 1JGLL 1L6XA 2BNUA 4JKPH 1JN6B 4BUHA 2AJVH 1G0DA 4AEFA 1Q0YL 5T1DH 2BHYA 2EYSA 3I02B 4TRPL 4WFHE 4LVHB 1U8PB 3WL9B 1XZ0B 4O51B 3EOYG 3BFOA 1W72A 2QQQA 4NKMA 3SGJA 2YKLH 4M62L 4DN3H 5GRUH 4C83B 1IAIH 4QHNA 2VDPH 2A83B 3QIBC 1FL5A 2K7QA 4MA7L 1YNLL 3T77B 4L8SA 2OTPA 3RWGB 1PDKA 4OCWH 2XA3A 4OZFH 3LHPH 2V2TB 1YEDB 1AKJB 3H0TB 3TZVB 1A02N 3PIQB 2JCCF 1XF5B 2J1KA 5TQ2L 3VD5A 1XGRA 1MAKA 4M6NL 5D96C 1FYHB 2MWCA 1MCOL 3LMJL 2V7HA 1FVEB 1TPXB 3QIUC 1FSKC 4PJXF 5D8JL 4LNRA 4JFFE 1KT2B 4YJZL 3WLBA 2QQNL 1MWAA 3IVKB 2EDJA 1DFBH 4TNVK 3RP1A 1TCRA 2MCG1 3SKJH 2JIXD 3FN9A 4WY7H 1R3JB 1S7QB 4NUGL 4LVOB 5A16B 2XG5A 3U7YL 1D5MB 5ERWB 2EE9A 4PJXB 3WFDH 5IEKB 1LD9A 4OZGF 2IPUK 3FRUA 5DS8A 4NCC2 2M8XA 4WFGD 4HIIA 3UTPD 3HE7C 3ULSB 1C16B 2P5WD 5IT2L 1UZ8A 1G9MH 2IG2L 3G9AB 4NO0A 2YD9A 5ITFB 3BJLA 1UB6A 3DRQA 4XCNB 4Z7WF 3WNNA 1J05B 2QADD 4QKXB 4ZG1A 2MQ3A 4HIJB 3DI3B 2KDGA 3VWKA 5IIEA 1BZ9B 1DUYB 3D2UD 4MD4B 1INDL 3HI5H 1J1PL 3JWOH 4APQA 4PD4J 1R3LB 5LWYH 4LP5A 4LIQE 3RL1A 5CILH 3IXAA 4KI5E 2AJ3B 2EDHA 3LEVH 3E6HB 4OD3L 5EOQL 2QV2A 4BQCA 4X8JA 5MEOB 2XN9E 4R90L 3UC0H 3O3UN 1FVDA 2QKIA 1E0OB 1E6OL 1J88A 4K9EL 2HJLA 1I8MA 3OZ9H 4L8BA 3P2TA 2MPAH 5CD5C 3VFWB 4M7LH 2H26B 1WZKA 5EWIH 4S0TD 4V2BA 1NMAH 5HJ3A 1DQMH 1OSPL 1JGVH 3ALXA 2VXVH 1JWSA 3P9MA 4CVZB 3VGBA 3VGAB 2ERJC 2E7HA 3KJ4C 3P4MB 1AHWC 3EGSA 5EZOH 5FYLH 5TQ0H 3TN0D 2XKNA 3V5KA 1WCQA 4PY8I 1I8MB 3TYFB 5CD5D 3GSNH 5ECJE 3GSXB 5TFSH 1ITCA 1PX4A 4PJDA 3I9GL 3BZFA 1FH5L 5GRJH 4EZMA 3CJJA 3MV8D 3DO7A 3SE9L 4QYOA 1S7TA 2BVYA 5TF1L 1N6VA 35C8L 5D7KD 3IU4H 1B0WA 4JHAH 1HZHL 4PB0H 4XBGB 5GS2D 2MFNA 5C08D 3MRRB 2FEDD 4HIJA 3HNSH 1S7WB 1F3DH 1LE5A 1ZSDB 2WWMC 4Z7VE 4Z77B 2ZUUA 2BNQE 4ELKA 4GFTB 5F1IB 1KJVB 1N8ZA 3ORJA 1XF4B 2B2XL 3F12A 4EUPH 2DQHH 1M7DB 1P9MA 4GAYB 3QH3A 1RU9L 3RU8L 2CXKA 3BGMA 3ZKQD 2EECA 4WNQA 4P4RB 5GS0L 3HZKA 2UYLB 5ALCH 1J8HB 5BRZA 4CVXA 3N1GC 2D7TH 2LABA 3G5ZA 4DVRL 3QBTB 1ZHNA 4NRZB 4R0LA 4NNXA 2R8SL 3W9DB 2ZCLH 1I8IB 2ZUXA 4M7ZB 3DUSB 4UT7H 1ZS8B 3VFVA 5CEXB 4RX4D 3I75B 1J5OL 3R1GL 3OGOE 1X6NA 2DDQH 1FNAA 5T5FL 4F33A 4WRLA 3MRGB 1AO7D 2VB5A 3E8UL 3HTLX 5A3IC 1F11B 3WN5B 5C0RL 4G6JL 5CBAB 1CT8B 2PUQT 5I1EL 5J1SC 2WIIA 3CXHJ 5E5RB 1DN0A 3S7GA 1JJUA 5HYQB 2VLKE 4IDJL 1S78D 1P1ZA 5CZVH 3MA9H 2CIKB 1OP9A 3REVB 3MJ9H 4XCEA 2F5BL 2W65A 3V5DA 5GS0C 4NKDB 4KK8C 4JJ5A 1NAMH 3Q5OA 1GPOL 4M5YH 1OPGL 1VFAB 1A1OA 3BGFC 3PXHA 3BW9A 2VDNH 5KVEH 4O5LH 4GO6B 4K7PH 3V7AE 3S96A 3D6GA 4HWZB 2YUWA 5L2KA 3MR9B 2W9EH 3KJ6L 5FUOH 3ZKXC 1TTUA 1ED3A 4NO5B 4UB0L 5ILTH 3D25B 3OAZK 2A6DA 3S36H 3NIFE 5IHZB 5IV2B 3NTCH 1D5ZA 5IB1A 3HE6D 3RKDC 1IGCL 1S5IH 5DUBB 1NFDB 3SDYL 4AEEA 4X9IA 2VZ1A 1G6RL 5HGHB 5B8CA 3PGCA 5A1AA 5GS3A 5I1KH 1NFKA 2AXGA 3RTQD 1PSKH 5JR1H 2NYYC 4O00A 1SHMA 4J6RH 3KPSD 4QLRA 1S7RA 4TULL 1NBYA 4F7CA 1I1FA 1JFQH 1YNLH 4LKCA 3BQUD 3RX8A 5J8OA 3NCYP 4N0YL 4QYOB 4KKCC 4U7MA 4WY7L 4M62H 4J1UB 4X9HA 4R6UA 5MEQA 5FAAA 2PR4L 3LQAH 4P9HL 1XH3A 4X9GA 3WUZA 2CRIA 4I3SL 2R1WB 2YC1B 5J13B 5GZND 2AJVL 4X99A 3WE6A 4AYFA 1QVOA 4JFXB 4LSSH 1W0YT 1V05A 1J8HE 4XMPH 2J5LB 5H2BB 3U6RB 4PYGA 1G7MB 3NN8B 5I18L 4HKBA 2IPKB 3O2WH 4QTIH 3ZE1F 4WEMB 3DOSA 4C56B 2BVEA 5CJBA 3MRMA 3RWIA 4ZO6A 3X13B 4XNQB 5L6YL 1HIML 5C0DA 1F97A 3WHXB 3S3PA 2BXYA 1OP3H 2QL1A 4OI7A 4YBHA 4OFYD 3WCYA 4X8JB 3FQWB 3O3DB 4ALAL 4PJDF 3N50A 4P9MH 4ZFZA 4O2CA 4WGWB 4GS7C 1CDCA 4Z0BL 1R5WA 2X9WA 3VFGL 1FQ9C 4XNZC 1VSCA 2PR4H 1AI1H 3MRQB 5IVZA 4FQQA 1MCNA 4ORGB 4LHUA 2AJSL 1AR2A 2MSPA 4NDMA 2VC2L 3MLZL 1KTDA 4UTAL 3MBEA 3QNYA 4P57A 1Z0MA 5I8EB 2LU4A 4PJ7F 3W39B 3IDJB 5K59F 1CE1L 3P4OB 4P46C 5FM8A 4NOFA 1U93B 2LAGB 3ROLB 3TN0C 3RVXC 2FYYB 3O6FD 5DRXB 5HYSG 2UWEB 2VAJA 2Z91B 4F9LA 1PJ9A 1TNMA 1G7PB 4M3KB 3CFKA 3ZT5A 4KKAC 3K2UL 3MACL 4AT6B 4I3GA 5KVDH 1JPGA 5EU7E 3FHAA 5MEPB 3TBWA 3KPLB 4H1LG 5JOFB 4Q2ZB 1WAAE 3C2AL 2AV7A 1G6VK 2AI0H 4M61B 3DTXA 2DYPB 3GSRA 4M93C 1FGVL 4XCFH 2EH8H 3O6LL 3BHBA 1NCDL 1WT5C 4M7JH 1UM6H 3HNVL 4X6DE 4U1JA 2DWEA 5D72H 4ZTOH 5TE7L 4PLKD 1U8OA 2ITCB 4F7EA 4WCYL 1J86A 1YEKL 2F54B 5J06A 1QPXA 3QUYB 5L8LB 3ZT7A 5ELIA 1MLBB 4HKZA 2NXZC 1RUML 3HMWL 3HZMA 5FYJD 2X1PA 5IJKC 1F90L 3MRHA 4OCSH 3MACH 5I15L 1W72H 1J87A 3DVNA 2B4CC 1K5NA 5C0RH 3KS0H 25C8H 3MJ7B 4PR5A 1G0XA 2EDXA 3UTSB 3R1GH 4HUMB 4GW5A 4S1SH 1RZ8A 3IDJA 3WFBH 5F7EH 5CBEB 4L8SC 3EHBD 5HHMB 2NXZD 3WBDA 3ARFA 3F7VA 4NBZB 4RGND 5DD5H 1BQHG 1QLFB 4G8EA 2G5BA 4ODTL 4M7KH 4JHBA 3SEPA 3QR2A 4P9ML 3GKWL 3MRIB 5I1AA 4AL8L 5MEPA 4Z8FH 3QIBA 3GO1L 5E7FA 3V6FA 3VRIB 4OZIB 3REWA 3GSOB 3OHXA 5JPNA 5D5MF 3PWPB 4UAOB 1Z0NA 4Q0XH 4CKVX 5EUKB 1KLFA 2D9QB 1FZMB 1A7OH 2YPKB 1A7QH 2A6KA 2DQCL 3JWDH 1C5BL 1JZ5A 2XQYK 1KEGL 5C0FA 1BQLL 1HQRB 4XC3L 1FPTL 2FHBA 3QUYC 4XPHH 5JZ7C 3X3FL 3LQZB 4O58H 4YIQB 4TOYH 4J3SA 3PWJA 3BP6A 4JM2D 4PS4L 3R0MA 4PJBF 3Q5YA 2R29H 2FO1A 4D9QD 3VI3E 4S10A 3QSKB 2ID5A 4G43A 4E41E 1FYTA 5LCVL 1K6QH 3O9WD 3W2DL 4NRYA 2IC2A 1IAOB 3KHQA 1MRDH 1IEAA 3QFJB 3Q3GA 3KPOB 4NZRL 4EUPB 3HB3D 4TUOA 3X3GH 3ZE0F 3BPOB 1FNEA 3BQUA 5IQ7H 1KOAA 4Y7MA 4BZ2H 5JR1L 4M7LL 3X11A 1UJTA 5KSBB 2OXHA 2KQNA 2LVEA 4JRYD 1MCIA 3MJ8A 4JN2A 4R4FL 5HGBB 3SCMD 1XGPB 2W0FA 3CK0H 4G43B 3ULUE 4Y19E 5J13C 2VJXA 1X5YA 4BQ8A 3HI1A 3UC0L 3VH8G 4AM0B 2DM2A 2Q3AA 2Q7NA 1OHQA 4NO5A 4D9RE 3FT4A 5C7XL 3QP3A 3WFCL 2W9EL 3K4ZA 4O51A 3U4BH 3WMSA 4PJAA 3UYPA 3VFTA 4UI2A 2QHLA 3NBNA 4PJ8D 3PQYA 3GSNA 4IRJC 1L7IL 3VRLE 1OQOA 5L2JA 1NC2A 3H9ZA 2FGZA 3NCJL 2MMXA 3K74B 5GS1C 1OP5K 5I17B 4HUUB 5IJVA 1QFWI 2IAMC 5EUOB 2B5IB 4UINH 2OR8A 4EKXA 2CR3A 3BZ4B 3VD7A 4DCQA 4OJFH 3MA9L 3RL2B 3I6GB 1U9KA 4GAFB 2HG5A 1GGBH 4R4BA 2QTEA 1YC8A 1C7TA 3E3QC 4M6OL 1AKJD 4UV4H 3JV6A 1UM5L 2AK4B 4KK6C 1FIEA 1T89A 2JKXA 2YUVA 3E8UH 3F5WB 3L1OH 2CMRH 3HUJA 1T03H 3ARUA 3I75A 3T3ME 4CU6A 1KC5L 2XPGA 5KVGH 2Z4QB 3BVNB 1QLRB 5DURD 4B53A 2XWTB 5F9AC 2R8SH 5MENB 4G42B 3W11C 4TOYL 4HG4K 1CGXA 3UO1L 1AXIB 2EEBA 3L3IB 3FOMA 4QHMA 3WHE1 2AV1B 1BPVA 4DEPB 1SY6L 1GHFH 2VH5L 4P4RA 2IADA 5I8CA 3VXOA 5D6DC 2G60H 3ZHDA 3QCUL 3Q5TA 2XZAH 4Q0XL 3D3VB 2XN9B 1JGUL 1OGAE 2DQEH 3T0BA 4P3DB 4GG6B 3IT8D 5EU5B 5AUMA 3WHE0 5T5NG 5KS9E 4MCZB 1VADA 5KSVB 4XMKH 1HEZA 4PRPA 5KOVC 3WKNA 1SYSA 1UWEL 3JUYA 4QRRB 3CSYB 5EFIB 5SX5H 3K46A 4NFBA 1JZ2A 2E7BA 4ZNCD 3PQYE 2NY2B 3ZDXE 3DARA 4I2XE 5C0JA 4LK4A 5GGVL 3HFMH 1WBXA 4PJBE 4A6YB 5BS0A 3VH8B 4XH2B 5E08H 4HCRL 4JPIB 5KSBE 4LCCC 1I9JL 4MDJA 4U6YA 2BY3A 1AQKH 2WW8A 4WO4A 5IESL 1U58B 1DJSA 5M7QA 1MFCH 4DEPC 2Z8SA 5D2NC 4YFEA 3ZTJH 1LO3H 1A4JB 4M5ZH 3QUMA 1S3KH 2H8PA 2X4PB 1PG7W 5DRNA 1A3RH 3CH8A 4GW5B 4OUUA 3WXVH 4ZPVA 4G42A 2HLFD 2XYCA 2YPKA 1ZVHA 3L3GA 4LRNH 2X4QB 5JDJA 5HI4D 4P57B 3B2VH 5JIHA 5C0CA 2A74B 1NKOA 4FQJL 4R2GC 4XT1C 3WXWL 1CFNA 4GKSB 4K8RD 4PJ9A 1KGCE 4L9DA 2R0WL 3QUMB 5FXCH 2C1PB 3N1QC 3QXWA 4ONHB 2RAMA 4QXUL 3ARTA 1B3JA 3M45A 1G0YR 5ICZB 2WBJB 5CEZD 3JV0A 1OW0C 2ARJB 1FLTX 1ZANL 1UA6H 5E00A 3OKOB 3LVEA 2YD8A 3G5VA 1NFIA 2C3HA 5DQDL 2AXFA 5IGXH 1WZ1H 4Y2DC 3GIZH 1OGAA 4PJ9B 4H26A 1JPTH 3C5ZD 3WIIL 4KDTA 3WIFB 3F8UB 4FQ2L 2XG4A 4G8GB 4PRPE 4ZO8A 1M05A 4RA3A 3RY5A 5DRZA 2HT4C 1MUJA 4LCCB 4PLOB 4CU8A 5DA0B 1FLRL 3PQYD 4NRYB 1ZVSB 4Y4HB 2IMNA 1UQSB 3L95B 3ETBF 3MFFB 1VPOH 2PO6B 2J8UA 2OL3B 1A6AA 4XX1E 4UQ3B 1D5XA 2CUHA 2IAMA 2WBJC 3NFSH 5CIPH 4KDTC 3GMNB 5I30H 4R97C 1NGXA 1N64H 5H35B 5FFLA 3GHEH 3MFGB 3H42L 1U8MB 3VI3F 5HVHC 3OL2A 4XNXL 5JNYA 2Y9RT 5F1KC 4OLVL 1PLGH 3B9DA 4QT5B 4YDJA 4MCYA 5FO9B 5AAMA 4HH9B 2X4SA 3V5DB 1FFNA 3CVIL 1T5WA 3DI2B 3SGDI 5D7SL 1JYXA 1G7LA 2AQ3A 3EW3B 4K3DL 4G8FB 3FO9A 4M6NH 2E3VA 2ADFL 4S1QL 1V7NH 1CU4H 3O6MH 5M94B 5EC2B 1ZA6A 4HJ0C 4KKAD 5JXAH 3VXRA 4AIXA 1MRDL 2APWA 3BI9X 4PJGF 1WV7T 2MHAB 2I9TA 1EFXA 1EZVY 4NZJA 3IXTA 3SE8L 3EDEA 3OAZH 1ONQA 1V3MA 4X9BA 1NANI 4N9OB 3GRWA 3PUCA 5J9PA 5D7LE 1OM3L 3BIBX 5JA9A 1CXHA 3O4LB 4HH9A 4EQ3A 4MQ7A 4UDUA 2J6EL 1SM3H 4D3CH 3INUL 3NACH 3BKJL 2YHGA 5AZ2H 1GOFA 4OZHE 1IM9A 4MNQE 1U8PA 1MCKA 4GMTH 3QHTC 1N7MH 2OQJB 1J18A 3P11H 3LOWA 3UROR 4OQTL 1JN6A 3WLBB 4NM8L 2PCPA 4EQ2A 2ED9A 4OZFA 4G6FD 2MOVA 2CRZA 1F3JB 4K23H 3C60C 4OM1L 3ES6B 3MRDA 1I4FB 4HXAL 3HZMB 3BRDA 1Q1JH 5FYKE 1AKJA 1DLFL 1MPAL 3H0TA 1OTSD 3SQOH 4WI5A 1ZMYA 2R1XB 2VQ1B 5A2FA 5HHQB 3PABB 4LP4A 1RURH 1UCBH 4UOW0 1L9NA 1KPVA 3KPMA 3TF7C 4YWGH 5TE6L 2MKLC 5T3XL 3N0PB 5E5UB 4JRXE 4QT5A 1AP2B 1BD2D 3MV8A 5EBMA 2X1WL 3LS4H 2I25N 2XTJD 1YN7B 2D31B 2G9HA 2I9LA 4LVNC 4DVBB 3ZTNH 4M6ML 1KTKE 2VLLB 1F5WA 1MHEB 3SDDB 5JW3H 3TO2B 1KBGL 2ZOLA 4G6FB 3P30H 4U1IA 1KCSL 1SYVA 3OAYK 4QRSB 3HE7D 4DAGL 3MRLB 1WWBX 1QRNA 2F58H 4NM4H 3ARFC 4M5YL 3RUGE 2UWEA 1NDGA 1UENA 3TLRA 2CLRA 3IETB 3DIFA 4PUBL 1H5BA 2QADC 2HVJA 3MJ9L 3TFKC 2XNAB 3UBXG 1N26A 5T3ZL 1WZ1L 4J8RA 2A6JA 5L9DL 4MJIB 5ESQB 2VXSH 5J1AB 3K81A 3DSFL 1SJVA 1T21B 2NY6B 1ZAGA 1MFNA 1AR1D 5HHQA 2DQTL 3LKNA 3BKCH 3S35X 4P2QE 1P4BL 1A4KB 3EYQC 5GJSL 3FMGH 1R5IA 4JDTH 3RWJA 3EO0B 4FTVD 2LAAA 1N5AA 2CJUL 1BIHA 3TYFA 5DC9B 1TQBB 4AIZB 4L3EB 5GRXG 3QXDA 3O9WC 3ULVH 2Z93B 4LLAA 4D2NA 4GKSA 2CKBB 5A40E 4ZS6C 4X7TA 3OJMB 4Z7UF 2Z91A 1EBAA 32C2B 5ADPL 5EBWA 1J1XH 5SX4H 1C5CL 5ALBL 2E7MA 3TJEL 5AUMB 1E4KA 3VXPA 4GQ9L 3Q6GH 1U91B 2A1WH 3T04D 3C6LC 2P5EB 1LEKA 4LCWD 4TNWF 5CJXC 1AFVH 3QJFB 5E8DH 1AQDA 1FO0B 1A4JA 1Y0LB 3REVA 4Q9CA 2W9LA 2NXYB 3QH3B 1P7KA 4YBQD 2G5RA 1Q9LA 5FA4A 2HKFL 3HNTL 1MVFA 4K3JH 5E4IA 2FATH 5D1XA 2ZCKH 5E1AB 3AXLA 1R3HB 4TQEH 1RJLA 4K07A 3NFPA 4F9LC 1ZLUK 1A3QA 3OXSB 4KUZH 4YHIB 3ARQA 4YXLH 3BKYL 4G8EB 3NAAH 5HHXH 1Q9OB 1U8HA 1Z3GL 2BY1A 4IDLA 5D1XD 1FG2B 1L0YA 1X4ZA 2C1OA 4GXUN 4ZTPL 4XWOD 3F7VB 4PD4K 1CD8A 3IFNL 2VZSA 1INQB 3BKJH 3CDGB 4JVPA 2Q7YB 3MRKB 5C0ND 2W9DL 3GSVA 4X6FB 1NGXB 5IVXE 1G7MA 3KYMA 1XR8B 4MA8L 1MJ7L 1UQSA 1GOGA 3ULVE 3FRPA 3OPZL 3DMMD 3RVWD 4KMQA 1F8TL 1FDLL 1K4DB 3IDMA 4W70A 5F9OH 4ZSOB 1YMHA 4MNHB 3MV9B 5C0BE 2OR9L 2HJFB 1SJEA 1AXTH 2IQAB 2GQHA 3O41B 4HDIA 3AREC 3VGEA 3NIFF 2IPTH 3PL6C 5DJZA 1KC5H 3FQUA 3ARBC 3Q1SL 1A6PA 2PTTB 4K9EH 2AXFB 5IHLB 3SPVA 5JUEH 4BFGA 1EHLH 5IMMB 1CXIA 5IW1B 1X44A 4OI9A 4AENA 3RWCA 1JCKA 1ZTXL 2R39A 1INEL 3LN4A 4AMKH 3QZWG 2YEZA 5E4EC 4JFEA 4LMQI 4N8PA 5F1NA 1LO5B 3V52L 5HPMA 1G9NH 3DVFA 5E2JA 3FZUC 4DUVA 5CSBA 5SV4A 1HKLH 1F6AB 2A73A 4JREC 2DWDA 4OF5A 5GGQL 1WEJH 3O8XB 1NFDA 2C1PA 5B22A 1BWWA 3O9WA 1W8NA 1A6ZB 3NIGF 4PV8B 3SKNA 5C0DB 4U0RC 2GYSA 1AGDA 1S5IL 3RWEA 3CLFH 1I75A 4L4VE 2Z8WC 5CSZA 3BPOC 3WNPA 4R2GB 4Z7OE 2DQJL 2GAZA 4JM4H 5IJKA 3RQ3A 4NOBA 1ES0A 1WFOA 2D7PA 4K7PL 3H9SA 3RI5K 1VFAA 3T0AA 3GMMB 5EU4A 1JNJA 2EEDA 4OLUH 3MBED 3MV9E 2WV3A 4X99B 3WE6B 3QXUA 4IIQA 4PJHF 1MCCA 2P8PB 5K9OA 2R1WA 1BF8A 4NQDE 1XGPA 5D7JA 5SWZD 1KELH 2PKDA 3FOLA 4ZUVB 5DT1L 5JMRA 1QFUH 2AERT 3A67L 3RRQA 4YGVB 2EO9A 2W59A 1WFTA 4HC1H 4ODUA 3AFLA 4A2LA 4YDLB 3O45A 1WCBB 5SWZA 1MREL 4OZIF 1DEDA 5CEZE 1E27A 1SBBA 2OXGA 4MWFB 5FO9A 5BOPA 4Z7VF 4FABH 4WTZA 4NO0B 5E4EB 2DDQL 2AEPL 4KK5C 4XPFL 2VDPL 4KTDH 1HDMA 1EHLL 2ZJSH 4TVPL 4M1CD 5TPWL 3H3PL 3LD8C 4PJ7E 5K59E 1MLCB 5ACZB 3TN0A 1XCTB 5F1OB 4MMZC 1T0NB 3QIWA 5IMLB 5IQ9B 4PGZA 2VXQL 2Y06L 1A6UL 2VE6A 2VN7A 2AK1L 3GI9H 2QBWA 4HHAB 4HS6A 1A6VH 5J6GB 5EO9A 2BFVL 2G9HB 2I9LB 2JIXA 1G84A 1FFOB 1RZKL 3CUPB 1FZOB 3STZA 4H20L 5E8NA 4L4VA 3UBXA 3C60A 3EYOA 8FABB 2PW2B 2VDKL 1UWXK 2HT2D 1X7QA 3EYQD 5F7KC 4PPTA 2E9IA 3P77A 2ZCHL 4KTYA 4N0UA 4HMEA 5EC1A 4HGKC 3ARDC 4JFPA 3QQ3B 1NGZA 3C6SA 1P9MC 5FOBB 1ODAA 3OXRB 3EYFA 3GB7B 3SGKC 2YMXH 1PX3A 4L3ED 3ULVL 1I7ZA 1VFOA 3TM6A 1JWMB 4HZLA 5GGTH 4D0BA 3VCLA 2P5WE 1ZV5A 5T1LB 3GSNL 3BIKA 4WEBH 2AS5M 2E8YA 3VFVB 3QA3B 2QSVA 4NZUL 3D69A 2FZ3A 5SWZE 5KANG 3MRFA 4L4TD 4WTXA 3IAPA 3O6FC 1UM5H 1EERB 2VKXA 2YD7A 1I85C 1FNGA 2FJHB 3QI9B 4G7YH 2LE9A 3QUZB 2ICWI 5ICYB 5DRNB 5D1QA 2V2WB 4Y4KC 5FM5M 5ESVB 1SJHA 1FIGL 4XCCL 5DRWB 1OSPH 3BUTA 3L7EA 3EDDA 2MHAA 2I9TB 1EEZA 3TIDB 1EFQA 4NJ9L 4NGHL 3V6ZB 4PRHD 3RIAK 5IB4B 2BHUA 1RQ5A 5E2UH 5C0CD 1F4HA 4OBRA 5H37H 4N1CA 2NCMA 4M1DL 2P7TB 2Q7YA 3RZCB 4HWBH 3WFZA 4OT1H 2EH8L 1KUMA 4OD3H 4CMMB 2Z8RA 3H7BB 2FJFA 4OZ4A 4JO2H 4Z7WA 1J1PH 3JWOL 4PJ9D 3A0OA 3GI8L 3RGVB 4MB5A 3WIHH 3W0WB 1FAIL 5FYKL 3OJVC 1ZKAA 5MHSD 4KVNH 4KZDH 4AEHL 4HFUL 3ARZA 1X5JA 2XN9A 2HH0H 2RB8A 2Q6WB 2JJWA 3BN9C 2BNQB 4ODXB 1P7QA 1YQ2A 4QOKA 1OTSC 2B20A 2J8UB 3KXFD 2JCCE 3VJ6A 3BDXA 1OCWL 4MX7B 1H9VA 4MNQD 3I2CH 1X5AA 4G7YL 3WEXA 1MAML 2F58L 1XF4A 4JFFA 3RWDB 3QYCA 1W72B 2HTLC 4MSWA 2EDLA 2IPUG 2P45B 3CH1B 1T1XB 1Q9KB 1HH6A 2YPVL 1J10A 3I6LE 3QISA 1UXWA 3MLPA 4UILH 1Z6JT 5F88B 4U1KB 5GZOC 4JHWL 5D1QD 3BPCB 5DEFB 5IM7B 2F74A 4FFVC 4M00A 3RJDA 2EIDA 2YC1A 3EUUA 4AQOA 3JV6B 1UACH 2Q1EA 3FB6A 3CSBA 4WHCA 3PV7A 3SDAA 1JRHH 5CSZB 4F80A 3MRCA 4MB4A 1MCOH 3LMJH 3V7AG 3RWEB 3T0EB 4IMLB 1G9EA 3EJZD 3GSXA 5J6HB 4OGXL 4XVJL 3OJDB 1BFSA 2D7MA 5GZOD 3BZ4A 3RPIB 2OMNA 4PLJD 1O0VA 5EUOA 4XPTL 4QHNB 4ZOCA 4P5MB 4J3WA 1IQWL 4KJPC 1A7QL 2DQCH 2WUBL 4IOFD 5EU6A 5MI0C 4UTBL 2IPKA 1BLNB 1LDPL 4NZDA 4Z7VA 2NTSP 2EDRA 4NQXA 5HJ3B 2EYRA 2L7JA 3DVGB 3SPVB 5JOPD 3NCFB 1JK8B 4UU9B 5CZKA 4NT6A 4JZNA 2DQFB 3MUY1 1Z9OA 4XVJH 2XTLA 2CLVB 2O5ZH 1NBVL 3PDDA 2R0KL 3VXQB 1BFOB 1K4CB 5C0EA 4LLQA 3OSKA 4N5EC 4XPAH 5IQ9A 3FFDA 3TIEB 1JF1B 12E8L 3D3VD 5MEQB 2DRUA 4HX1A 4HPOH 1T20A 2PXYB 4PP1D 4U3HA 4OCXH 2JCCA 1NSNL 1QUNA 2DKMA 1NGPH 1XGUB 1IM9D 1KCUL 1CGYA 3HMXH 2Y4SA 2IALB 2AJYH 2Q76A 3BAEL 1FO0L 1XF3A 4X4MA 3QEHB 1W0WB 3ARVA 5FYJH 5ABDE 3KHOA 2RGSA 2P24B 4X0KA 5EU5A 3EO1B 4OD1L 3E1F1 4LEXH 5GS0D 3T8XB 7CGTA 4ZDHA 43C9B 3F58H 3HMWH 5KSAD 4WU7A 2JTDA 3VFUB 1IGJB 2VLKA 1QOKA 2DQDL 5CUSL 2D03L 3VMNA 3P0GB 1TVHB 4CNIA 2CDFA 5IFAH 2YK1H 2VDLH 1KXTB 4GBXA 4FQLL 4M8VA 4XPGL 2J88L 2FD6L 3GI8H 3VXUD 2X42A 3QPXL 1OARH 3S9DB 4ODBD 3THMH 2VZUA 4E0RA 3B9KD 4WHYG 3KXFE 3BVNA 4R4NC 2HKHL 5CJOH 3BZEA 1N2RA 5B4MD 4OLWH 1YEFL 3UTSE 2VLJD 4JQXA 2P5EA 4E9LA 1YUHA 5FKAA 2EYRB 3PHOB 1SEBA 2ZSWB 2VTFA 2FWOB 3D0VA 3PV6B 4WUUB 4R3SB 4W4OC 4LDEB 3UTZB 4FQJH 3CCHB 5BV7H 1DSFL 5F71A 1BECA 5DZNA 1DBMH 4KKLC 1KJ2H 1FZJA 4JCMA 4XBPB 5EBLA 3BH9A 5D1ZD 3S37L 3LKQB 1IAKB 2G75A 4X7SH 1J12A 3C9NB 3MRMB 4YDIL 3JVGC 1NMBL 3I6LD 3FHQA 1WIUA 2EDQA 1AGEA 1AGBA 1ZANH 2E27L 2J4WH 2R4RL 4DTGH 5JUEL 4ONGL 5DJAB 3GJFB 4HUVA 1CK0L 3LEXA 1HI6B 1A7NH 4AENB 3K1KC 2X4UA 4RIRA 1MJ8H 1R3IH 1S9WA 5DSCA 1WC7B 3RNQB 3BQUC 4NN5B 1T2XA 4F58H 4HJJL 2CLRB 4I18A 4LCIL 5LGKA 5D7IF 5C0IA 3MSPA 4JM2F 2FBOJ 3I3EA 3LIZL 2H2PC 2DD8H 3PDOB 2W60A 3F12B 2FX7L 2VL5A 3LPFA 4O4YL 5IVXF 4JG1L 5IROC 43CAA 3DUUA 2CSPA 3QUYA 3IF1B 2DBJA 4ODWA 3TA3B 4ONFL 3QCUH 4R8WL 4YQXH 4X5LA 1KCUH 4MVBC 1WC7A 1E28A 4QY8B 4I9WE 2FH8A 4PB0L 4ERSL 4PJIE 3UZQA 3X14A 5FF6B 3SY0A 5JQ6H 2WINA 2KZ1B 1FV1B 1HH9A 1BGXH 3G6DL 5HGAB 1G7IB 3VXSD 4HJJH 1S9YA 2A9ML 4FOMA 2DYPA 3RGVA 3TT1H 4LSVH 1W0VA 1KLGB 2P5EE 2QHRH 3RPKA 2VRAA 4POZD 2BSSB 5BW7A 1CG9B 1ADQA 3B5HA 2P44B 3BP5B 4HAGA 5I0DA 4KKBD 3FO0H 5DZOA 5BW7C 5KZCB 2J4WL 1IGTA 4Y5VB 3O0RH 3AROA 3P4NA 3U48A 3DETC 5A2LH 1AGFA 4PJCE 4M6OH 4Y2DD 4LGPB 4RBPK 4S2SA 2OM5A 2C3VA 3WNKA 5CD3A 3GZKA 2RQ8A 3EO9H 4TVSa 5C71A 5IUSA 4L3AA 1A3LH 1BAFH 3TJEH 3TGXA 3LN9A 1M1SA 3OZ9L 1H3WM 4TUJA 1LD9B 2FZ3B 2WWKT 2GSGA 4WFED 4OGYH 5F7NC 5JHDB 3OKMB 3CC5B 4MZ2A 1P2CA 3GUTB 1FL3B 5T3XE 1P4LA 2PW1B 4MAYC 3U83A 4NHUA 4MXWL 5C07A 3LB6D 1BFTA 2FJGA 4P5KB 5B3JF 1R24A 3MYJB 1A7PL 1FV1A 3B8YA 5HGDB 4PJIA 3B9VA 1ORSA 1PGRB 5CIPA 4JANA 5E8EB 5DFTA 3UYOD 3T77A 4HIIB 1GZQA 1GL4B 1T20B 3VXSE 5JNYB 4NUGH 3T2NH 1MLBA 4HBQA 4NKMB 1XIWD 3OKNB 5F6IB 1VFBB 4U1MA 1NC2D 3L5WA 1NGPL 2EDOA 1AR1C 4P5TD 1GVIA 1QSED 3FT2B 2CIIB 2Y36L 2J8OA 3LS4L 4LFHG 4PYHA 1CBVL 1QA9A 1DP0A 1L7TL 3VFUA 4E41B 1CXKA 1PZUB 4XNMB 3IRZA 3MNWA 4FQXB 2V9QA 5DMJB 1IQDA 2AGJL 1I9RH 1BBJA 1NDMB 2EE3A 2P24A 4IRSB 4X0KB 1ZHKA 3GSRB 5I66B 4ELMF 3G5YB 3HR5B 4PTUA 1I1YB 4YGAB 1UXSA 2DIJA 1KEGH 5MERA 1NGQL 5E5MA 2X10A 5F9OL 3MLVH 3BP4B 2WUCL 3X3GL 3D39A 4H25B 3I3DA 4LSUH 1U92A 3WDIA 4A2MA 4RQQB 1D7FA 4X80L 2NNAA 4Q97A 1IC5H 2PW1A 1G7PA 3HLAB 1A5FH 3L3KB 1E4WL 5E2TL 1NBZB 1XIWB 5C0BD 4JKMA 3CXDH 4L4VD 1T7YA 1SEBB 1N7ML 4H8WH 2EYTA 5IMOB 4EJ1C 4JKPL 4HUWA 3FQTA 1BP3B 2D7QA 4UOJA 1B6UA 4HUXB 3I9GH 4K71C 5CS7A 3ISWA 1AGBB 4PJGE 3SE4C 4CN1A 5C08E 1MF2L 1T1ZA 2HJKB 3CU1A 3L3KA 2AJ3A 4H0HB 2FIKA 3LV3B 1FYTE 5HHPB 3TWCL 4K8RH 3ARBB 3LIZH 2HFTA 3BWAA 2Z35A 1Y6MR 4PJCF 2WUCH 1JGVL 2YPLA 4R3SA 2Q86A 3P73B 5EDXA 2CR6A 1A6UH 4PJFA 3T2QA 2VR9A 1FL6B 4X4XB 1I1AC 4XZUA 5CGTA 3CSYA 3H42H 1N2RB 4LLYA 3MREA 4QRPE 4RISL 5INCB 5IB3B 2YSSB 4CRPA 1HEZB 4G8GE 1ORQA 4JKWA 1T22B 4PRPB 1B0GA 6FABH 1YJDL 1YYMH 3OGCA 4TVPH 4XWOC 1VDGA 4M8QA 2QQKH 3Q6FB 3RWFB 1YEEH 1Z5LA 1QPPA 1DANT 1RZ7H 4YDIH 3ARFD 5B8CC 4PJAE 1B2WH 3BKCL 4RMRA 3O3BA 1QHPA 5FYLE 1L9MA 1U8QB 1DBML 4QHLB 5CCKH 5ESVA 1PKOA 4X6CE 3S4SA 4HKXA 1GZQB 3QUZA 3D3VE 2NY3D 3WIIH 3BDBA 5L9DH 2XZQH 3LKRB 1N0XL 4Z7VB 4D9RD 2CO7B 1U0QA 5FA3A 1IEBB 3OKDA 1LVEA 4HW6A 1KEML 1FIGH 3SOBH 3V6FB 3VRIA 1QR1B 4OLWL 4LEOA 3H7BA 4POUB 4XNMA 3EFFB 3P30L 2BVQA 4YDVB 3OX8A 1AY1L 2JELH 4P48A 1RHHB 1P4LB 4KJWC 3IGAA 4LSPH 1BVLA 1LP9A 1K8IA 1BM3H 4O9HH 3MBEC 3TIDA 4GLRI 3V6ZA 2IH1B 1NCWH 4XBPA 3LH2H 1I1RA 4LEOB 4BZ1H 1MCRA 4QRUB 1QR1A 5I1JH 2PO6D 4QXTA 5T33L 1P7HL 4Y4HD 1UXWB 2YPLE 4Y16D 1PEWA 5L6YH 3HPJB 1DBKH 4JVUA 5SWSA 2BRRL 3RWDA 3DMMA 2H32H 3SGEI 4YHML 1OAUL 3LRGA 4GLRH 3BRGC 3T3PF 3IGAB 1WK0A 4GBXB 5C07B 2HAZA 4LBEA 1Y18B 2N7AA 4XP9H 1GGTA 2R0KH 1YMME 4I4WB 3FB8A 1MCQA 3K0WA 3SDAB 4XB8A 4P0DA 3BOVA 2RHEA 4ZFOA 3X11B 5FDWB 3KXFB 3ZYOA 2E9WA 4WIQA 1SM3L 5CMAA 3JTSA 1ZWIA 1I3GH 3BN3B 3V0AC 3SY0B 5FF6A 4OFYA 3U4EA 2DB8A 4J3OC 4YUEL 3O2WL 3SGKA 1EH9A 1YN6B 4WW2B 5JQHC 5DZLA 1CD0A 1FZKA 4RZCB 2HT2C 3MRJB 3BRFA 4NC0B 1NAMA 1OAQH 5H8DA 2SEBB 4YDKL 2DM7A 3GMOB 2DQIH 1IGTB 3QHFH 3L3DA 1XCTA 4C58B 3UPRB 1K4CA 3W39A 4PRIA 5EORL 5D7SH 3I3BA 3V5HA 3V2AR 1JGDA 2KPNA 3CX5K 3KJ6H 5FUOL 5ESAB 4KVCL 4B5EA 5K9KA 4NQSB 4ZXBA 2BERA 3QPQC 3DXAD 2NLJB 1JWUB 1K8DB 1H15B 2ZCKL 4F37F 4PREA 2EXYC 5ETUB 2UY6A 1FC2D 3C09B 2K3TA 4LASH 4WI9A 4G9FB 1YDPA 1CLOH 1AO7E 1DDHA 3BPNC 4WEUD 1CE6B 4FQXD 2W92A 4WU7B 2VDQL 3WHXA 4YHYC 4IRSD 2XKNB 1IAKA 2ITDB 5K33A 2A73B 2D0FA 1G6RH 3FOLB 2PN5A 2R1XA 2VQ1A 2XICA 1UH3A 3GSWB 3L9RB 1EUUA 5T1LD 1RULL 3MX0A 4O02H 4UIMA 4HKBB 5FYJU 4RSVA 2O61B 5D7IB 3X17A 4HT1L 1WISA 4JDVB 2IFGA 1MI5D 1QYGL 5B38A 1EEYB 4EIZC 1TQBC 2BP3A 3VRLF 5CP3A 1OAZH 1EXUA 1X6LA 3WJJA 3FB5A 4BSWA 3ARXA 1D9KD 4JY4B 2J8HA 1N6QH 4OTXL 4FZEH 1ZT7A 4NN7B 4HC1A 5C0BB 5BVJA 1IM9B 1M7XA 2BRQA 5BV7C 1VEPA 4WUUD 4MLSA 2CPCA 5E8OA 4ETQA 3DHMA 4EDXA 5IOPB 4KGLA 3O11B 3HAEB 3IU3A 3MREB 2F19H 3T1FA 1D5IL 3QFJE 4KHXL 3VXTB 5D2NA 2ESVD 3TPKA 1A6WL 2OL3L 4YXHL 5IIEB 1ZT1B 1F8TH 4WO4C 3MRNB 5CCKL 2OTUA 4JPVH 4PRIE 3UTZA 3PNWA 5I71C 1AH1A 1X7QB 1U8OB 2P8MB 3EJYC 1DCLA 1G7LB 3N1PC 3HZVB 3HUJE 3MNWB 4U49A 1BOGA 2W9DH 2QQKL 5GXBB 4CMMA 3VXRE 4Y19B 4X5XA 5JOPE 2X4OA 3O3BB 3QIUA 2R29L 2BOBA 2V7NB 1I8LA 4P4KD 4E42A 1R3HA 1I3UA 5I19L 4U1NA 2B1HL 1FFPB 3DYOA 2EDEA 3OG6B 15C8L 2IAMB 1RK1A 4LU5L 3LPWA 5GRZA 4OZHA 4MNQA 1CDBA 4E5XA 4HKJA 1CVSC 4HS8L 1A7OL 4P2RD 1H3VA 5KTEH 1HQRA 4FQPA 1U3HB 1U41A 5D1QB 4KRPC 4K3JL 4ZDHB 1BZ7A 3QUML 4GUPB 4MD0B 3QI9A 2W0PA 3V8OA 2WM0A 2BX5A 5K9QI 3CDGA 5IW6A 3EBAA 1JPSL 2G60L 1CS6A 4P5MA 3VXRD 3U0WH 4L29B 2WIIB 4KJWD 2NY0C 2EZ0D 1AHWA 1TMCB 2A1WL 4BSVA 4DOHB 3DGGB 1Q9OA 3SKOA 3QIBB 4RMWA 2UY7A 3RZCD 4EDXB 1NQBA 2A0LD 4P4KB 3FTGB 4DUWA 4RWYH 3RWJB 1RJLB 3CU7A 4PREB 3CIQA 4XMLL 3NCYS 2X1XR 3BKMH 3W9EA 4ONOA 4D3CL 4F9PA 3LN4B 3L3OB 2FJFB 3U9PH 1ZA3B 1MHHB 5EIIA 5IMMA 2YZ1A 4U2YA 2NPLX 3FT3B 4XGZB 3FAXA 4HBCH 4KRMB 5KG9B 3NIDF 3NA4A 3HI5L 1XGQA 5I15H 4WNQB 4LSUL 1F42A 4UUJA 2NY4C 1GH7A 3VMOA 4JZOB 1P7QD 2VXVL 4L4TA 4OLZL 4RRPA 1MCEA 5D7LA 2NNAB 4BELD 4BH7B 4PV8A 3VWJD 4AH2A 3KPPA 2H8PB 2P49B 1SYVB 3PWPE 5HYEA 2DWDB 4PJAF 4Y16A 4RAUA 1V5JA 3UDWA 3C6LA 3D85D 1CBVH 4R90H 1OGAD 4GJTB 1DQLL 1KB5A 3WFDL 1VCAA 1N6QL 5A2JH 2VLRA 3FB6B 1BBJB 1NDMA 1FAIH 4XAKE 1TLKA 3WUWG 1IEBA 3BD4A 2I07A 3ZTNL 1FHGA 5GGSA 4LBEB 2V6HA 4HWEL 3VG9B 2CXGA 3M17A 3BGFB 2C7UB 1FRGL 3UPRA 5A43C 2NY7H 3SJVD 2OS7A 2F53B 4M1DH 4YGVA 5I1GL 1KCVL 2NZ9C 4NZTL 1NAMB 2V5MA 5CAYB 4PRDA 4YC2C 1PQZB 1MNUL 5TE4H 1RURL 1QHOA 1BQSA 4XNUL 3WDJA 3S5LG 3K4AA 3G5XB 1L4IA 4U31A 3TO4B 2VZOA 1JI2A 1QSEB 2Y7QB 2X4RB 4ZFFA 3QIWD 2PCPB 1Q1JL 3BO8B 2WZPD 4H88H 5CLTA 3V0VB 4APQD 3ESUF 2X89A 2R2EB 3MUGA 1WLHA 3D9AL 5FDWA 2APFA 1AP2A 5CJ8A 1RZJH 4PJCB 1VESA 3HPLB 1U42A 3E6HA 1EFXD 3R06B 4JFOB 4YHZH 5J9PB 2R0WH 2RFXB 4BQBA 1JZ4A 2APTA 2ZUSA 3F7YB 2AK4A 1YECL 2CLZA 3PGDA 5IBUG 4L4TE 3EO0A 4ZO7A 1WGOA 5FK9B 4ZAKC 3C8HA 1BQLH 4RBPH 5JQ6L 2YN3A 4IOFC 3T4AA 3N9GL 5AEAA 3K7UA 1LO5A 1RUQH 5HPMB 4ONFH 2F15A 2ZPKL 1B0RB 4Y5YC 3RX5A 4P2QA 1OGTA 4OZGA 1PW3A 1NC2B 3RIFK 3PG2A 4MA3B 3UCRA 4QNPF 5GRVK 3IF1A 3HRZB 5KTEL 3TESA 4F7MA 3DX7B 4OF0A 5A16A 3KPSE 4ZODA 4Z7NF 2VE6B 5T1MA 4I77L 1K8IB 3C5ZC 4LAQH 4Q6YA 3GMMA 5E03A 5IMLA 1K4DA 3BEVA 1BFVH 2DLFL 1NJ9A 1ADQL 4L5FH 4U7SA 3GBMH 1BQUA 4MQTB 1EVUA 4GG8A 3MLRH 3QIUD 4PJFF 2XZAL 3TBYB 1AJ7L 3PNWB 4YZFE 2CD0A 4C4KT 1NMBH 4FXKB 3CX2A 3PWUA 5DGRA 5LGJB 4BKLA 4AG4H 4F57L 3T0EE 4J8RB 5C86A 4NP4H 1OLLA 2R0ZH 2K9UA 2I5YL 2G75B 3G5VB 4YK4B 3L5HA 1IGFL 5ILTL 4W68A 4NQVB 4GG8B 4UV7L 4C57C 5EO0A 3TYGL 1PYWA 1YEIH 4L9LA 5GSVB 3U1SL 3ZYJA 4N8VG 3ZYIA 3OJ2C 1DBBH 1DVFC 1Z5LB 3VI4F 2CMRL 2H32A 2R4RH 2OLDA 3VXNA 1JUFB 2E5EA 1NEZB 4XGZA 5KG9A 1N5YH 5DJYA 5CINL 3DSFH 3RDTA 4JDVA 2VL4A 3VGGA 4GAGH 3SJVE 1T1YA 5IFAL 4LHUG 2XQBL 1FGNH 1UJ3A 1MRFH 1P84J 4EI6A 5CUSH 4EDWH 2RBLA 4P46A 1NUNB 5LVEA 1FZKB 2H1PL 4MQSB 3VJ6B 1A14L 3HG1E 2I5YH 1C7SA 3F6LA 1RZIB 4S1DC 4DAGH 5J3HC 4LGRB 3KPSA 1SQ2N 1A3RL 5SWQA 4PV9A 4MDJB 4WHTB 3K8MA 3UJIH 4M5ZL 3FO9B 1OD9A 3HMXL 2G5BB 4GMSH 5A2IH 4IOIB 5EOCH 5D5MB 5J4MA 4Q9RH 5BZDA 4DW2H 4NJAH 4CU7A 5DK2A 4L5FL 5F72S 1VA9A 4FQLH 3T0EC 2COQA 5DTFA 4HPOL 3IDUA 2FBJL 2YD4A 3TCLB 4POZC 2D03H 2ZKHH 3FFCB 4KRNA 3RDTD 1ES0B 3JUZA 1NGWA 3FQUB 1F4AA 2F5AL 4UDUB 4QHKI 3DVIA 2BOCB 4QOKD 1OW0A 4LQFH 2C3VB 1RHFA 2OP4H 3DXAE 1P7QB 3L95A 1VERA 3BMVA 1PQZA 2GFBB 2OSLB 3EYSH 2V2WA 5JA8B 2BC4A 1KJ3L 1ORSB 2E6QA 3O8XA 4F15C 2IH3B 3FKUS 4WDIA 3HAEG 5DJ6B 3VXPB 1H8SA 1MAJA 2DQUH 4GS7B 4MJIE 3W82A 3WIFA 3IU4L 4ZFOB 5HY9A 3MOBL 3FB8B 1DUZA 4X7EC 2PTTA 5J6HA 1J9CT 1JHLH 2DTML 1Z3GH 1YEJL 2HG5B 3OKMA 4X6CB 5H35A 3A6BH 5TQ0L 4XP9L 1CGWA 2WBWB 1EO8H 3QG6A 4PJBA 4UDTA 5DO2D 1D5XB 1LEIA 4R7DB 5CHNB 1J0ZA 3HI6H 3MLTA 4UILL 5EUOF 2EDWA 3OKDB 1TDQA 4U3XA 4XNZB 2ZSVA 5I1DA 1QP1A 5IFJA 4AIOA 4YLQT 1UM4H 4X7DC 3H9HB 2O5XL 5L7XH 4PBWD 4U2ZA 3Q6GL 2NY0B 2Z4QA 2FEEI 3QEGH 2XXCB 3DXAB 1DQTA 3HUJB 2OTWB 1J1XL 2ZUTA 3TBSA 3RWHA 2KUTA 3ECBB 3M1BB 3O3AB 1FCGA 1FVDB 4PB9H 1ONQB 1YDPB 3WS6C 3EOTL 1RIVH 3EJJX 3MRCB 5IBLC 1EFXB 1JRHI 4LLYB 1Z9MA 4M6AA 3RY6A 2X05A 1YY9D 3I6KB 4WWKD 3IAQA 4KRPD 1BD2B 2ICES 4FFWC 5IFHL 5D71L 4L1HA 4OQTA 3B3IA 2H1PH 1KIQA 2H3NA 3DRQB 5A2KH 2GJ6A 1MRFL 1GXEA 4RGNE 4HUNB 5ITFA 2NY1C 5HXMA 5L8JB 2W1NA 4GAGL 1ZXQA 3G6JF 2IADB 1EO7A 5DD1H 2P5WA 4DOHE 4ODXA 3K4DA 1HILA 4M8QB 4WO4B 4XRCB 3FFCA 2ZOLB 5DEGA 1DFBL 4LLDB 2W0LA 5JW3L 1TZHA 3MOQA 4PG9B 4IRJA 1TPXC 5I9QB 5IMOA 3IS1X 5IWLC 1QSFA 2HLFC 5JDSB 4I48B 2Y25A 5T1LA 2YMXL 3GRWL 3AU1A 3CFEB 3MV8B 5I8KH 3QEHA 5HHOE 5ESQA 1MFDL 4KJPD 4WW2F 3FQNB 5LKNA 4XCCH 3PL6D 4U1SA 4YWGL 4P49A 2PYFA 3H7LA 4OLXL 2EO1A 4FFYL 3CSGA 3RVVD 1BD2E 1BX2A 1YY9C 4WWKC 3SDCC 1EDQA 2VITB 2ARJA 1DLHA 4FFWD 4MVBD 4D9LL 1MF2H 5J12B 4JG0H 2IAMD 4LAQL 1X4YA 4P2RA 4ZO9A 1NEZA 5C8JA 1CLZL 3T0DA 5F97E 1CFBA 1XCQB 3TT1L 3VI4E 2FIRT 3FB7B 4ZOEA 1OAYH 5F3HB 4NQCD 4QGYA 4QOKE 3DX9B 3QZWB 4L4JA 1MCBA 4UQ3A 4QTHB 5FGCE 4ENED 1I7ZB 5DXWA 1HIMH 3I50H 5EOTA 1KB5H 2VLJB 3MFFA 4TSBL 3TBVB 5FO7B 3VGFA 5DHVA 1ULVA 2AEPH 1KN2H 5JLZB 3MGTB 5C70A 2W0FB 3LS5H 1G9MC 3QIBD 3HS0A 3CVHL 1FZJB 3RTQB 5KVFL 3CPLA 3UTQB 5I18H 1LNUA 3GMRB 1QSEE 4GRWB 4JR9L 3UP1A 5LGHL 3TBTA 4XMPL 3IDNA 5FO8A 3MRKA 4N5UA 4NWUL 1NMAL 4B41A 2VXQH 3A67H 5TDOB 1QNZH 1OF2B 3QNXA 4LLWA 4JRYE 5EO1A 1VENA 1F13A 1T1XA 4OFIA 5I74C 4DGYL 5D7JC 3PJSA 4OLUL 4Y1AB 4WDIB 5DFVC 5TGBB 5I30L 1NCTA 3S37H 4MAUL 4YIQA 2OL3A 4QOKB 2ARJQ 4JPWL 2DM3A 5C0CB 3C2AH 4XTRD 2ARWA 5CIPB 5C0FB 5F7YC 3MOAL 1KPRB 3GSVB 1CD1B 3P3YA 1UG9A 5EU3A 4DGVH 5CD3B 2FJGB 3DLQR 2EE2A 3G08B 4L8DA 4YX2H 5C09B 4YO0B 3OJDA 2HKHH 5CJOL 4NHCL 4JN1H 3L5JA 2FL5A 1RIVL 3GEWB 1NFIB 2V5YA 5JW4R 2VAAA 3JZ7A 1OOAA 3EIFA 3IFPA 1UA6L 4YPGB 4X8XA 4LCUA 2UZIL 2OJZL 4HK0A 3CK0L 4ACPA 2LFGA 3ARDD 2DKUA 5FYLD 2E7LC 4LAJH 1CF8L 3O4LD 1UM4L 3L6FB 1KIUA 3LEYL 5D8JH 3VRJB 3CFJB 1FORL 1QSEA 2Y7QA 4LDOB 4ZFFB 1MCWM 3ROLA 2DQIL 5BOZG 3EFDL 2AJZB 2BSRA 3NA9L 5LXGH 5I1LA 4P2QD 2VXUL 3WXVL 4LVNB 3I85A 4OQ1A 2ZSVB 4PGBB 4H1LH 1U92B 5F6HI 3EJYD 5JORA 3JSSA 1K2DA 4PRBB 1I3GL 1F6AA 1FN4B 3I50L 4Z78B 5T5NF 4R96B 4Q9QL 4U6YB 2R2HB 4K71B 3QEUA 3ZZ1A 3VFMA 1ZEAL 3MOBH 3QQ3A 1ZGLM 4JFQB 1WZMA 3LQAC 3OR6A 4EVNB 3QUKB 3SJVB 3TBSB 5EH1A 2WINB 1CDYA 5HBBA 3QXTA 5EU6E 3U0WL 4R4BB 5C09A 3LRHA 5IB2A 3I6GA 1LNUB 3B9EA 2QQLH 1VADB 5KSVA 3FN3A 4Q6IC 4UNUA 3TBWB 1FBIL 1K85A 3DVNB 2WWMD 3RA7H 4JQVC 1IJ9A 3CFBA 1PSKL 4ZAKB 1V3KA 3PDGA 3GJFK 4BA8A 2HLAA 4CMHB 2FWOA 5DJCB 1FNGB 2FJHA 1LEIB 1T0NA 5FKAB 4OZFB 5EU7C 35C8H 2QSCL 4X5WA 4OIAA 4KTEH 5DD5L 1YPZE 1FVCA 4Z6AT 3MTRA 1U6AL 3ARYA 5DLML 32C2A 1KG0A 1A7BA 1BM3L 1MJ8L 4Y2OA 5DJ0A 1S8DA 4TNWK 2GTWA 4O5LL 4X4YA 4FMKA 2HKFH 2ADIA 3D1MC 5GJSH 4ONGH 3NZHH 1YQVL 3GSOA 4HWNA 1P4IL 1MCWW 3OXSA 4KV5F 3PWNB 5LQBH 3KPLA 1TZIA 4OZIE 3GSQB 4JFDB 5CP3H 1CVRA 1A1NB 1Q94A 1Z2KA 5KN5A 3MLWL 4K7PX 4JLRB 5DEZA 4IBLT 1QKZH 4PUBH 4OV5B 2NZIA 1HHKB 2EZ0C 4GW4B 4KROD 4X4YB 5BQ7A 3ARFB 1N5YL 3M8OH 3QUYD 1IC7L 3GMLB 3QFDB 5EO9B 1IRAY 2EE6A 1MRCH 1KBGH 1S7UA 3LEVL 3UTSA 4U1NB 4QRSA 4MD5A 4YFDB 1A7RH 1YA5A 4E42B 1Z9SA 4TUKH 1NBQA 4J2XA 1J1OH 4PB9L 5TGBA 1UVQB 4FNLH 1H3UA 5L88L 4U3CA 4PRHB 4JLRA 1OSZB 2ED7A 2VDLL 4KROC 3MA7A 3O2DA 3UTSD 5F8QC 5KN5B 1P1ZB 4PGCB 3O4LE 1ZK9A 1W0VB 2DTSA 4HKZB 1LHZA 3LDBB 2R0LH 2R1YA 3MJ8B 1S78C 4AY0A 2FX9H 3S5LB 1BJMA 4ZSOE 3VWJC 3TNMB 3BEWB 4HIXH 1DN2A 3NZHL 4ZUTA 3U9UA 2NYYD 3ULUD 1WITA 3HNSL 4MJ4A 2VN4A 2AJYL 3P9LB 3DO7B 4OF8A 3C6LB 1TZGL 3VXNB 4KJQD 2NW2A 3E6FB 3MA7B 1QZ1A 2NX5E 3A6BL 5GJTL 3D25A 1J8HA 2NTFA 1NGYA 4K2UL 3HHRB 4LCWB 4ALAH 5GPRA 1PY4A 2B0SH 3S96B 3WFEL 2ZP0T 2GTZB 4LSTL 5GRVL 1JL8A 1TXKA 1ZVSA 4IRJD 3INUH 5F88A 4OF3A 3WFHA 1QEWA 4ELKB 4KI1A 2X4QA 5I1IH 1FPTH 4Y1AD 1E4WH 3UEZA 1CICB 4N0FB 4MSWB 4G6AD 1OTUD 5E70A 1BHGA 4UT6H 4ZS7L 4BZYA 5DD3H 2A6KB 3AS1A 4JAMA 3ZE2F 1HWHB 2Y5EA 1KPUB 4FTVE 1VB9A 2V17H 3ZL4L 1A9BA 7FABH 1IAIL 3WYRA 4CJ1A 3NZ8B 4OM1H 3IXTB 4KDWA 1IT9L 4S1QH 4H5SA 2DJ4A 2AK1H 1U8HB 1JYNA 5EWIL 1I1AD 2DQGL 1BBDL 5TDPA 2OJEA 3OKYA 4O2CB 3C6LD 3D85A 4KK9C 2KZWA 1QLEL 1S7XA 4U1LB 4HEME 1UWXH 3TT3L 4FG6D 3BP6B 2X4SB 2Q87A 4PJCA 2DM4A 4I0PC 5EZJA 1IVLA 1CL7L 4RCAA 5JO5A 3O3EB 3HG1B 1SJEB 1H0DA 3NPSC 2N4IA 1YMHB 4MNHA 4YNYB 1N3NB 1IC4H 2VMFA 1DBKL 3DYPA 3NA9H 3VFPA 3ULSA 4J3TA 4ZYKA 1X5IA 1A6AB 1T6VN 5EIVA 2KL6A 1QFWM 5ENWB 4URTB 3RTQC 3FRUB 5DS8B 3I2CL 2GK0B 1P84K 5GISL 3CVIH 4MHHG 4W4NA 5IBTL 4U6XA 5C0AA 4J12A 4YHKL 2GITA 5KOMC 4UNVA 5CEYA 1VKXB 4L1DA 1ZGLB 1GGUA 3KR3H 3QEQE 3SE3C 4TN9A 1QLRA 4XVTL 5DQDH 4APQB 4NDMB 4G9FD 1DUYA 3KLHC 3HPLA 5CZXD 1GAFL 2NR6C 2UZYB 1NEZG 4PJGA 4PJ8C 2VISA 3QNZA 1WBZB 3GMPB 2R2EA 4PJEF 3EYFB 5IBTH 2QQNH 2R2HA 2XXMB 1WWCA 1NGZB 4LLQB 2L0DA 4GOSA 3TO4A 1NDGB 5D96B 4KQ4L 5BRZD 3UJJL 5I6XB 4PRNA 3O11A 3ZSTA 4C56A 4P23B 3OF6D 5I76B 4PJFE 2HT3D 3FOMB 4QHMB 4MZ3A 2EDKA 4PJEB 3TO2A 1YMMD 1UCTA 1CFNB 4U0RB 4WO4D 1G9NL 5E8NB 3A6CH 3R4DA 2LVCA 3FO1B 1S3KL 1UKQA 3T65B 1JZ7A 3KNBB 3GBML 4Z9KB 3HE7A 4QHUB 4LPUA 2VDOH 5FHBL 1QLEH 4R7DA 4ORGA 4TNVF 4YEEA 1TVDA 2H41A 1T7ZA 3GB7A 3ZKMC 3ROOB 2EC8A 1D6EA 5GIRB 3U30B 4Y1AE 3LKNB 5GS0H 2F8VA 2H2SD 3B2VL 4A6YA 1FN4A 1BOYA 3V95A 4GRWH 2L7UA 2UUDH 4N0UB 5EC1B 5JORB 5DD0H 3ARSA 3LKQA 5KVFH 3IFLL 3WNLA 1P7KB 2BVOB 1CE6A 1RUPL 4OF6A 4HIEA 1NMCB 4JZJB 4LVHC 3GSUB 2XI9A 5GGRA 4HKXB 3ZT6A 5EUOE 1UB6B 1R6VA 1MCSA 1CCZA 3DX8B 5D70H 4D0CA 1QSFB 5K9JL 1GGIH 4EN3A 1SEQL 2FO4B 4MJ5B 3DYMA 3U0TA 4X7TB 4HCRH 4NQCB 4YBLC 5HI5D 2Z93A 4F58L 4OZFG 2X1OA 3QPQD 2Q6WA 3GNMH 1MI5A 3BKYH 1R3IL 2OX5A 3NGBC 3W9EB 3UXFA 4JG0L 2FECI 3SGJC 5E2TH 4KAQL 5GRYA 2VDOL 5FHBH 4ETYA 4GT7A 1XH3B 5E9DA 3H6JA 4QRTB 1NC4D 3PL6B 2CDGB 1QACA 1F6FB 3QDGA 1HHKA 1AFVL 1XGTA 3VXSB 5J1AA 4J3XA 3OKLB 3G08A 3VG0H 4TULH 3A6CL 1RZJC 3REWB 3IDNB 3KPOA 3O81A 2X2YA 5BXFA 4P5TC 5TDNA 1QFPA 5K93A 2VUOA 3UO1H 3Q2CA 2OYPA 2HTKC 1M7IB 4QRPA 4HJGA 4CMHC 2V5TA 4LARH 1E4XH 1GGYA 4BK4A 4O2FB 5DUBA 3P0YL 3SCMC 1UYWL 1A1MB 2C26A 3ABZA 3GMNA 4Z7UE 1A9EB 5EZIL 2YD6A 1RIUH 3IJYB 4Y1AA 3QZWA 3PP4H 5GGSY 2ESVE 3PQYB 4YAQA 1F4YL 2XZZA 4Y5VC 2VDNL 1QRKA 4OLYL 1JUFA 2D0HA 1M05B 3O41A 4HDIB 2VNCA 4O02L 4NNPL 4OJFL 1RK0A 3IDMB 4P5TB 1CICD 4PRDB 1OGAB 5L7XL 3F7RA 5HYIA 1IM3A 2KQMA 1X5XA 4G6KL 1S9KC 2HJLB 3RFZC 1KCLA 4WTZG 4U6VL 1WSST 1CIDA 3SCMB 2Y6SC 2EH7L 4NSKB 1FL5B 3QEQD 2YEZB 5I17A 3BAEH 5I66A 3RWHB 3RZCC 4YDJB 5C0CE 3KYKL 4RAVA 3OBAA 1P53A 5E9DE 3GSNB 3GBNL 2ZG3A 2JIXB 4IHOB 1HXYB 1JHLL 5B38G 3AS2A 5E6ID 1F4XH 1KENL 2ZG2A 1FYTB 2X7LB 4G3YL 3MXVH 1TZHB 3FQXB 1RJZA 5CKGA 1KSRA 2Y07L 1O7SA 1JNHB 5DJ8B 3L3DB 4NO3A 3VGDA 3GJFH 4PRNB 2X89D 1NUGA 4Q9BA 3TV3H 2JJVA 3D5OF 3EZJB 1Q38A 4UDTB 4MA7H 1XMWA 3NABL 1JPSH 5FECB 2DL9A 3CD4A 2FYYA 4KMLB 4DN3L 4YHOH 4MQXD 2WQRA 2V17L 1IFHH 2WUBH 4B0MM 1IQWH 3TV3L 4MWFA 2MQ0A 1IL1A 3BESR 3D39D 1B88A 2XZCH 1CFQA 4WI6A 3QO0A 2JB5L 3NH7L 3O45B 3QULA 1MJUL 4PGJA 4L3EA 1OTUC 5C09D 3ELAT 1N6UA 1ZLVK 1JV5B 3ARDB 1KENH 1JRHL 4EOWH 1BGXL 1T83A 4KDVA 5D1ZA 2NY3C 3ROOA 5J0BA 3QG7H 4BFEA 1RVFH 2K1MA 3F7YA 4P2YA 3SKOB 5BRZB 3O3AA 3KPNB 4X98A 1UEYA 1MOEA 1LEGB 1EVTC 4B7LA 3WFBL 5KS9F 4P23D 3B5TA 3MCG1 1G9NC 3L3HA 3U7WL 4KQ3H 1C1EL 3S35H 2ED8A 5HD8D 5KAQG 3FO2B 2EH7H 2OP4L 1YEGL 4U05A 1U91A 4D9QE 3QAZC 4P2OD 5FUZL 5E8DL 5DVNA 3B9KB 4K9EC 5F21B 5T33H 1U3HA 4I0PD 2FDBP 3WO4C 5JO5B 1ZHBB 4JE4B 3QJHA 5EZJB 4KHXH 4WUKL 3D0LA 4XBEL 4M03A 3VFWA 2IQ9L 4PTTA 3KPNA 4HLZG 2DMCA 1JMXA 5LJYH 4YE4L 1PVHA 2R4SL 3PWVA 4P3CH 3CDYA 3DV4A 2CDEA 4JPIA 3PWNA 4FZ8L 4L9LB 5AWNL 4D0BB 3QIUB 4Y5YB 4S1SL 5EO1B 1L6ZA 2ADIB 1MWAB 3QULB 4TPRH 3MXWH 5DJ0B 1S9XB 1HH9B 4X7SL 3QUXC 4OAWB 5JXED 1IL1B 4P46B 2P4AB 3B2UD 3MCLL 4HULB 4QY8A 4JAMB 5B39G 2FH6A 5HDBF 1QR4A 3L3GB 4XTRC 2NY1D 5DMIH 2F8OA 4F7TB 5DURB 1M71B 5IGXL 1EZVX 4GRMA 5IT2H 3QO1A 4OM0H 3AVEA 1LK2A 4OKDA 3QQ9D 3CFKB 4WI4A 4MNQB 3TH3T 1OARL 5EN2A 1MWAL 1P4IH 4IMKA 4L9LC 2HFGH 1RAMA 6FABL 1XGYL 5DI8A 5EPMA 1MFAH 3ZLQC 1WF5A 5DVKA 3NCCB 2AP2A 3OG4B 4YE4H 5DMKB 1EXUB 3KYOA 1WBXB 3QUXA 3UTPE 5E56A 4WUKH 4X5XB 2XACC 1JNNL 4UQ2A 3QDAA 4TSAL 4XZUB 1SJXA 3PWLB 4LNRB 1CGTA 4P46D 4XI5C 4G7VH 4H0GA 1UFUA 3S5LA 1PBYA 2CGRL 1BZQK 4MXQC 4GG6A 1IAOA 3AY4A 2H9GA 2HA1A 2IGFH 2IH3A 1BEYH 2VERN 4M3JA 1FO0H 4R4ND 1Q9LB 5FDYA 4QRQB 1CT8A 5FUCE 1U8QA 1MIEL 4R2GD 1FL3A 1A0QL 3C09C 4UTAH 3D39E 2NW3B 1RVFL 1HE7A 2XRAL 4F8TA 3SO5A 3PWJB 4TYUA 3KGRA 3G6JB 3GGWB 4NC1C 4LF3A 5F7UA 4WW1A 3VDBA 4LSSL 4OZGE 2OQJA 3PF2A 4I77H 3KLHD 2GIYA 3MV7A 2EEAA 3V4UH 1NBVH 4YHPA 4ZMAT 3OAYH 1QG3A 4P2RB 5C8JB 2DLTA 1UWEH 2ZUWA 1XR9A 3FT4B 2E9BA 1OF2A 4D9LH 2DLEA 1ZEAH 3F62A 2HVKB 3BH8A 3N06B 2SEBA 1RJYA 5C92A 3BT2L 2ZJSL 1PKQB 3TBTB 2ZPKH 3VXRB 1D9KA 4DZBB 3VXMB 3ZKND 1U8LB 3LSOB 1NCBH 1DN0B 2DN7A 4DKEH 1A6ZA 4JQIL 3MRIA 4J6RL 1RZIA 3CZJA 1NCUA 1FNEB 4YH6A 3VD3A 4XNUH 4XVUC 3MV8E 1S7WA 3HN3A 3BP5A 5LXGL 1WBYA 5I1KL 2J6EA 3HE6C 5EU3B 5C1MB 3RZWA 2AXGB 1I1YA 2IFFH 4G9FA 1F4XL 3KWWA 4PRHE 5HGHA 1JF6A 2VLRB 1UACL 1RIHH 4IRSA 1J0IA 4DKFH 5IW1A 1RZ8B 4FQXA 2C9AA 1A22B 3FFDB 1KYOK 4PGCA 1YNKL 1EO5A 3MLUH 4ODVL 5C0EB 4DKAA 4XHJC 4H88L 3T2NL 1RY7B 3LRSA 1U3ZA 1MHPL 2DQFA 3WIHA 1II4E 2JJTC 5FEBA 2Q3ZA 1JIBA 2ZG1A 3CFBB 4C56D 4I0PB 2VSCA 3C08L 4WW2C 5DRZB 3MLSH 3QXAB 3WD5L 1KIQB 5DMGC 4QF1A 1A7PH 4NPYA 1CGSH 5D93C 3GFUA 4U1JB 3BDYH 4IDJH 1EAPA 2FGWL 4HWEH 1T2JA 4MXVE 5C3LD 1S7TB 1HI6A 5FYKH 4XC1H 1ZOXA 5GSRA 4DGIL 4CAGA 1F4WL 4P23C 4X6DF 1KN4H 2ADGB 2HN7A 3MXWL 1IGYA 3MODL 1CL7H 1RIUL 3HR6A 3ULVC 4OB5L 2GT9B 3V5KB 1ZVYA 3R06A 4JFOA 3CSPA 3TT3H 3CMOH 2GTWB 4JQVA 1SYSB 4JCLA 3C60D 5ESAA 3S37X 1V7ML 1LP9E 4NNXB 1H3TA 3MC0A 3TVMC 4JRWA 4HF5H 4U0QB 2ICWJ 5IQ7L 4FFVD 2AJUL 3V6OA 4JFHD 4CVXB 4JR9H 4ZFGL 4W6YB 3P0VH 1E4JA 5J12C 5E6IC 4HKJB 4ZFOL 3IDXL 3LB6C 1I7RB 5F89B 1RK1B 1K6QL 1NANH 3FJTA 2Q20A 1T3FA 5C6TH 5DJDA 1MJJA 3J8F7 3U7WH 5I1AB 2ATKB 3MGOB 2ITCA 4WU5B 2ESVB 2F54D 5IB5B 3PGFL 1N5AB 2B7DT 3AU1B 1X5LA 3I84A 2B1HH 1MVUB 3F5WA 1U3JA 5CJ5A 4IOIA 1GGIL 5GSRB 1T6WA 3OR6B 1KG0B 5HDQL 1J05A 1IGML 1T7WA 4PG9A 2QSTA 5TFSL 3WJLA 1HOCB 5C6PB 3QQ9C 5GRWA 1G6RA 2V2TA 4R7NA 3WJLC 1A2YB 2P5ED 2EXWC 5EZOL 1H5BB 2Q8BL 3KLAB 3MJ9A 4NQDA 3IU3B 1HKFA 5KZCD 3UYRH 2APVA 2AW2A 4ZFGH 4FQCH 4YXHH 1JF1A 1TJGL 3MRBA 5GS2H 4L4TB 2F8XC 3EOBA 3B6SB 4UUJB 1I8LC 1T1YB 5ADPH 3WN5C 1XGQB 1LQSR 4AEIL 3U79A 3ARBD 5TDOA 4OCNC 3RNKA 2ICWA 3HZVA 4EIGB 1S7RB 4N5ED 1G7QB 4J7RA 4U1LA 3VXMD 3WO3B 3B9AA 4ZFZB 3UJIL 5EOQH 1I3RB 5FHAL