2R4RL

Crystal structure of the human beta2 adrenoceptor
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
214
structure length
214
Chain Sequence
DIKMTQSPSSMYASLGERVTITCKASQDINSYLSWFQQKPGKSPKTLIYRANRLVDGVPSRFIGTGSGQDYSLTISSLDYADMGIYYCLQYDEFPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-2 adrenergic receptor
publication title Crystal structure of the human beta2 adrenergic G-protein-coupled receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 45
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2007-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r4rL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r4rL01
3I3BA 3BUYB 3GUTA 1OTSD 2B4CL 1QFWI 4ZG1A 1CDGA 1RQ5A 4PJDB 5FOBB 4JFFD 5T5NF 1G9MH 1HN1A 5I1DB 1C1EH 5TPWL 4GS7B 4CVZB 1YEIL 3PWNA 3UZVB 3LEVH 3FOMB 1PG7X 3LIZL 4QHNB 4GRLB 5T3XE 4JDTH 5F9WC 3GI9L 1CXLA 1KB5B 1OPGL 4CVWA 2Y6SC 5HGHB 3WEXB 5DJDB 2C3VA 1FNGA 2MQCA 2X1XR 2HFGL 4KRPB 2FX8L 1TITA 4OCNC 1VSCA 5C0CE 3W11C 1EHLL 1FZJB 4GBXA 3ZTNH 3UTZB 3HZYA 4YFEA 1AQKL 3D2UD 4Y4HC 4YJZL 5B3NA 3KPQA 1OCWL 3B43A 1REIA 1WJ3A 1AP2A 3GSQA 4PTUA 1VFOA 3ZKQD 4EOWL 3LMJH 5MP6H 2HP4A 2IQ9L 1I8KA 2VR4A 5FYLL 1EEYB 1FN4A 4QGYA 5EU6D 4WO4B 1HHHA 5D96B 3MRNB 3NIGF 4L5FH 3DX6B 2XA3A 5D1ZD 1JZ2A 3H9HB 1FG9C 4EXPX 1NAML 4I77L 1D7FA 2Z0BA 5B8CA 3C5JA 1J0HA 2HJFB 3DVIA 3ULVF 2CMRL 4E42B 3KXFA 3VFOA 2VQ1B 1CG9A 3QISA 2OCFD 4EI5D 1UB5A 4RRPA 1OWRM 3HE7C 2OXHA 1A9BB 4I3GA 2DD8H 5ENWA 3B9EA 1KB5H 1JZ5A 1I3UA 4DTGH 1OD9A 2W60A 3GI8L 5C7XL 5FGRA 5B21A 3GBLA 4ZPVB 3MROB 2JTDA 3IGAB 3IFLH 4F9LC 4MA7L 1QKZH 3FQUB 4HQQL 3CFIC 4HUKB 3V5KB 4PJCA 5F8RC 4JM2A 2YZ8A 3DVNB 1IGCL 3B9KA 2HKHL 4HK0A 2PW2A 3DNKA 4GLRI 4F7MB 1VPOL 2P45B 3RDTA 5C71A 5EUOE 4UTAL 3DRTA 1S7RA 1T5WA 4IMKA 5C08E 1G1CA 3C8HA 4Z7OF 2P24A 3S3JA 5A3ID 2R0WH 2LE9A 1CR9H 3BQUC 4JGMA 2CLRB 3CXHK 2M1KA 3SE8L 5E8NB 3ARVA 2AXHA 5EG6C 1XR8B 2VNCA 5ICZB 3HNVL 4Z0XA 2CXKA 5C0BA 2P8PB 2GTZA 2X4OB 1G7HB 4LASL 1PVHA 3TGXA 3P73B 4L4VA 3ARBB 4NJAH 1FNHA 2MKLC 2I9LB 2FR4B 5ISZB 3CC5B 1KC5H 5IF0B 4X4YA 5GZOC 3VXSE 2FL5B 3W82A 1WCQA 3TYFA 1N5AA 1BLNA 3C6LB 4QHMA 1FFOB 3CLEH 1J8KA 1LO2H 4K94H 2HJLB 2Y7QB 2F19H 3N9GL 4MAUH 4M7LH 3D85A 4NM8L 5F3BA 5DYOB 3WNPA 4Y4HA 2NY4C 3OJDB 2YMXH 5IBTL 4PJHF 4N8VB 1LE5B 3IU3B 5IB1A 5E94A 1NBVL 4ISVA 4ODVL 3LD8B 2C3GA 5BVJB 5D7KD 2P1YA 1A6VH 3OB8A 3PWPD 4KK9C 1EO8L 1CGWA 1FHGA 3BJ91 2BVYA 3L3IA 1I7RA 1ZLUK 4LVNC 2LV4A 5F1SA 3CFDB 3MRRB 1BECA 3OKNB 2BVPA 4JVUA 3GSXB 1EZVX 3QEHA 3R4DA 1N6QH 2H3NB 4HWBH 2D7QA 1VFBA 1T0MA 4NIKB 2DQEL 3O6LH 2PW1A 1KN4L 2A38A 5KG9A 1F11B 4X9GA 4TNVK 1CGYA 4MNQA 5MI0B 2VYRE 5HDLA 4EDXB 5IJVB 4U6HA 1XCTB 4MS8C 5EU3B 4FNLL 1DP0A 1DQDL 3QDHA 4XBGB 4FMFA 4UIKL 3SO3B 2F58H 2AQ1A 2BNRD 3MRFA 3BP4A 2ZUQC 1P7QD 5C0AB 5C3TA 2RIKA 1IC5H 2V2XA 4LARL 1RMFH 3D0LB 5BV7H 2DOCA 5DGRA 1DDHB 3TV3H 5SWZA 4QRTA 4F80A 1UWEL 5DJYA 5T33H 1OSZA 4MJ5A 1CICC 2HRLA 3EZJB 2L0DA 2YD6A 2A0LD 4N0FB 3QDGE 2VQUA 5EZIH 4APQC 3VH8G 1RIUL 2NMSA 3NACL 4GAJH 4IJ3C 1BD2B 5I74C 2YA0A 2PR4L 3FAXA 4QY8B 1A7NL 1DVFD 4Y1AE 5KVGH 4WIQA 1ZA3B 3KYMB 3V6BR 3NMEA 3AB0B 3OKEB 4U1MA 4K3JL 3T3ME 3PWUB 3LQAL 4TUJB 4GRWB 4R4NC 1MHEB 5ICXA 4N0YH 1PGRB 2HN7B 2CSPA 1GH7A 1JWSA 5F7NC 4K3DH 2DQCL 1T0NA 3DUSB 4FA8A 4NQXA 4YDKL 2JIXA 1BVZA 2VZUA 1YMMB 1K4DB 1NBZB 1LEKB 5TGBA 2NLJB 3JUYA 4LLWB 3RPIA 3ZYOA 5GS1B 5DD5L 1UCTA 1NBYB 5HVFB 3WS3B 3JWDH 3OG6B 5IFJB 4K71B 5KTEH 4QKXB 3QUKB 1A4KB 4JRYD 5AEAA 4TNVF 2DWEB 4H1LA 4Q9BA 2X41A 3KG5A 5C3LD 5JDSB 5FYKH 3Q1SH 4UAOC 4WCYH 3GGWB 4DCQA 4H88H 1OAKL 3MA9L 4OLXL 5F3HA 3X11B 4TYUA 4F33A 1EGJL 5HVHC 4XMLH 2A77L 4A2MA 5T1LB 5JOPE 1J0IA 3CVHB 1XF3A 3K8MA 1OGAE 2IFFL 3CU7A 4HMCA 1ZA6B 5TJWK 3IAPA 3W0WD 1QRNE 4QCIA 3O4LA 4X99A 5I1HH 4GRWH 4Z7WE 3G6JA 5D4QA 3U4AA 3ULUL 1ITCA 3VRLE 1R3HB 4YHYB 4LCIL 4JFEB 1WEJL 5CUSL 4Q6YA 3AREC 2I5YH 4JO1L 3CSBA 2XKNA 2D31A 4PUBH 4NWTH 2CIKB 5ALBL 5TDOA 3QDME 1CICA 3BKCH 4V1DA 3IVKA 3EAKA 3CMOL 5T1KA 4LOUC 4MXQD 1E6JL 4APQA 5E6IB 4XCCH 2FIRT 1ONQA 4U1HA 3T0EB 5I15H 2VDQL 1YJDC 3NFSL 1XFPA 4RGOL 2Y07L 1JGVL 4HWNA 4U6VH 3VD5A 1KTLA 4LU5L 4NJ9H 5F9OH 4MDJB 2YPLD 3CFBB 3FFCA 1YUHB 4P5TD 2BY2A 2A1WH 5T3XD 4B7LA 2ZKHH 3LVEA 3HG1D 4RAVA 4X6EB 1U95B 2R15A 4PJCF 5TF1L 5E6ZA 4RIRB 1GGTA 5IBLD 1BVKA 5FB8B 3QXTA 4PRBB 4U0QB 1D9KA 1HSBA 4LLUB 3CVHH 2WWMC 3ARDC 3NFPA 4OI8A 5E7BA 5SX5K 1G6VK 1MRFH 5E2VL 5J3HD 2X9YA 4FTVD 4JVPA 3TVMC 2BCKB 2YUVA 4JKPH 5J9PB 2A6KB 3N1MC 4O00A 3PABA 4LSSL 3HZKB 43C9A 4Q2ZA 5EZLB 2HA1A 1IMHC 3V6ZA 4AZ8A 2Z91B 3P3YA 1TZIB 3BD4A 1WUNT 4KQ3H 5HGDA 1MPAL 4ODWA 5TFSL 1T2XA 3LZFH 1RZ8A 5I9QB 4ENED 5JOFA 1GC1H 1N3NA 2AEIT 5DC4B 2XWTB 2P5ED 4M93C 3FFDA 1U8KA 5HJ3B 2FWOA 5D2NB 2DYPA 5HHME 2Z31B 2ITDB 5JLZB 4MHHI 2Q76B 3MR9A 5JIPA 4ZAKD 5F9JB 3FQXB 3KNBA 4AIZA 2Q86A 4NSKB 3PGDA 5I8CB 4ODUB 4S1SL 2D4FA 3DBXB 1U92B 3S6CA 4KJWC 1T66C 4QRPB 4XP4L 3SQOH 3LHPL 1OTTD 3LPGA 3BIBX 1YZZA 3MSPA 1KYOJ 4Y4FC 4JFXB 4L9LC 5FM4A 5DJXB 3TESA 3LN4A 1X6NA 1A6UH 1IC4H 1XCQA 2SEBA 5D2LA 3UTTA 1D5BB 3RZCB 4CW1A 5K9QI 3CFKA 3GJEA 1I4FB 4FFWC 1SJVA 3OAUH 3K2UH 3CFJA 1IGFL 5LBSL 5FECB 3D3VE 4ETYA 1KIRB 5HGBA 3AREA 3TPUA 5CBAA 5GGVL 5JHDE 4UQ3B 3K8LA 1UA6L 3TA3C 4PRPA 2LFGA 3IDNB 2KZWA 3O11A 5I19H 2VXVL 3LRGA 2PTTB 4MJ6B 3RGHA 1WBYB 3DTXB 4XXDB 4BH7B 3FB8B 4K23H 3OJVC 5D7LE 3ZDZF 4C56B 4G8GA 2X4TB 3KPTA 4NWUH 3UTSE 1CE6A 3MBEC 4FQHB 4YX2L 1YNLL 2HVJB 4OFVA 2GEEA 2Q1EA 4XZUA 5CJBA 3FT3B 3HLAB 3L95A 5IW6B 2R2CA 1J0ZA 1XGUB 1BIHA 4GG6B 2OTUA 2OL3A 3BP6B 2FGWH 4KROD 3LRSA 3MO1A 3QNZA 3I6GB 2F74B 3ARDA 3OGOE 4F7PA 1TETL 1ZGLB 1QPPA 2HLFD 5IV2A 3TVMA 1CLZL 2VO5A 5IK3A 1QQDA 4XBPB 3VXUD 4DVBA 3S36X 5IFHL 4RSVA 3C5ZA 5IHUH 3OKDB 5D72H 3LKNB 3OPZH 3QQ4B 1DQLH 3QDJA 4TSBL 2NY2B 2QSCH 5I1JL 4M5YH 5ANMB 2DKUA 2FJGA 2BZDA 5DD1H 3TJHD 5HHOA 4XVUC 5HDOA 3ALPA 4LVOB 5IVZA 4KJQC 2UWEF 4R8WH 1S7TB 4YIQA 1MELA 2GFBB 3SE4C 2Y25A 5JDJA 3QPXH 3E8UH 3V7MA 4DGVL 1HYSC 2PYEB 4MQSB 1BAFH 5IG7B 2YD8A 5E08L 4WJ5B 3QUML 4F15C 3PWLB 4NN5B 4CU6A 3RU8H 1YEDA 2A6DA 4P2CG 3VGEA 4ORZC 2R1WB 4L9LA 4MXWH 2DQGH 3IU4H 1ADQA 5TDNA 2DMBA 5TE6L 5TQ0L 2NY0D 4HPYH 3E6FA 1OTSC 1EBAA 4O4YH 3DV4A 4DK3A 3BE1H 5ID0A 1CVSC 3RWEA 1NFKA 2D7TH 3V7AE 2RFXA 1J5OH 4EDWH 2IAMB 1X5HA 3BPLC 2IALA 5GS3A 2AEPH 4JB9H 4XPHH 2ERJC 1BQLH 3LKPB 2ZZUT 3O45A 2YN3A 4PYHA 1HK6A 1PAMA 3PHQB 4Z7UA 3IDIA 2J88H 3GSNA 1VACB 5KJRL 4PRNA 4LP5A 1AKJB 1QSEE 4TSCH 3QUZA 2Y1VA 1KJ2B 3V79C 1MQ8A 3BI9X 4YDVB 4LMQI 1W8OA 3TM6A 5FO7B 4PLNC 3GSUB 4X6BA 2Q8AH 3ZO0A 1NCWH 4JANB 1IKNC 2YA1A 3F7YA 4I0PD 4LRNH 5DEFB 5E4EB 2XA8L 2A9ML 4NO5B 3QEUA 1YDPB 3HE6D 2QQLH 2WMPA 5E5MB 3X12B 1A21A 3FN0L 4HV8A 4E9LA 2G5BA 4H8WH 4PFEA 3VMNA 4F7TA 4Y5YC 1CLYL 2NTSP 3VXRA 4CADB 5IOPB 1K3ZA 5J89A 1U58B 3IS1X 1YC7A 1DUYB 5D1ZC 4ZDHA 3GMPB 1FLRL 4GMTL 3FONA 3KJ4B 5D6CB 2BVEA 2R0KL 3TCLA 5JA8B 1WFUA 2ED9A 1Q94A 3L7FB 4XMKL 5BZDA 5BVPH 3HAEA 2HWZH 4EI5C 4PJFE 4UINH 1Y6KR 5FA4B 1IFHH 1EVTC 2JKXA 1KCRH 4FP8H 5IMLB 2WBWB 3D1MC 4QOKD 4P5MB 1I85C 4K9EH 1MI5B 2JCCE 1GGUA 3SE4A 4E5XA 2C3XA 3DX9A 5DJCB 2GTWA 3WJJC 3BOVA 4KDTC 1CU4H 4H20H 1KJ2H 2KKQA 1BEYL 5F1IA 5JOPD 3RA7H 4XP6L 4C54A 3LKOB 4HGWB 1OGAD 5IHLB 4YHZH 3L5HA 5HBBA 3Q6GL 4L29A 4G42B 3S3PA 1QRND 1ZHNA 3FQWB 4QTHA 5DRWA 1QSFD 1FFNA 3C9NA 1FL5A 1M71A 2R2HB 4NN7B 5EBMB 5CZVL 5JNYA 4JFDB 5A3IC 5C0GA 4C4KO 4WWKB 1T21B 2G60H 4GSDH 4JFFA 5HY9A 1IBGH 3FCTB 5CJ5A 3OXSA 1CGUA 1EGJA 1CBVL 1EMTH 2G2RB 4Y4KD 4RMUA 3MJ7B 1MCWW 1JPTL 2X44D 5EN2B 3DHMA 1NANH 4PV9B 2DAVA 3RUGA 4S10A 3QDMD 1FGVH 4LCCB 5AUMB 4HUUA 4NO2A 5I76A 1JVKA 5AYQA 1F4WL 3MYZA 2N1KA 1MOEA 3VRJA 4LQFL 1LDPH 4F2MA 2AJ3B 4POYA 3P4LA 5C70A 3K4ZA 1IM9B 2R8SL 5FKAA 4DZ8B 4OTXH 3VH8B 2DQJL 3LKSA 1A7RL 3LPFA 2R4SH 2J8UE 3D2UA 2VLME 1UM5L 1IKNA 1F3DJ 5LG1A 1JGDA 5KVEL 4OAWB 5TDPB 1A0QL 4LQ1A 1L0QA 4KJYA 5J11B 3MRIA 1XGTA 4JFHE 4XVJL 2JLLA 5I71B 1WBZA 3L5IA 1S3KH 3MRDA 4MD5A 4NDMA 4X7TA 4AQ1B 2V5YA 3BAEL 5C0IB 4TPRL 5IM7A 4Y5YA 3LCYA 3SHSA 1I9JL 2DJSA 1BHGA 1PKQA 1V3LA 5HHVL 2BSED 4JZJC 1SBSL 3VI3E 1KTDA 1RZJC 4OQTH 5HHQA 4MXVF 1YPZB 4IS6B 3A6CH 4IM8A 1FORH 3BPNC 2K7QA 3VG0H 4PB9H 1I8IB 2IH3B 4ZO8A 2DRUA 3ILQC 4GRLD 3HS0A 1JF1B 4EI5A 5E99H 3LH2L 2IGFH 5DQDH 3P9LB 1AGCB 4WFFE 1FDLL 3QNXB 2CKBA 4YFLF 4UU9B 3H3BC 4JCMA 4RBPH 4D9QE 1I85A 1JHTB 3SO5A 2ORBH 2HTKD 1KPRA 5MEOA 3WJJA 1DBML 3H9SB 4MYWB 4KDTA 4CJ1A 3KLHD 3ARSA 1AXIB 3N85H 2OSLB 4KUZH 3HUJB 3EYFA 5GGQH 5F96H 1KLUA 4KVCL 2X4UB 2DTMH 4Q6IA 4E41B 1Z9OA 4ELME 1EJOH 3E2HB 1WWWX 4QO1A 2HFTA 3EYSH 4WO4D 4OLYH 1O7SA 3OKKB 4HH9A 3E0GA 3Q6FA 3HPJB 4PJBF 1VCAA 3MOBL 4GRMB 2VLRB 2G5RA 4NT6B 1DVFC 5B39B 1KJVB 1XIWB 2JELH 2P7TA 1RUQL 4YHML 2MNUA 2DLGA 1G0DA 4BFGA 1LD9A 1BBJB 2BHZA 5I1EL 3G08B 3GBNL 5HYFA 4AENB 4HIIB 4PRID 1FC2D 3SKJH 4TULL 2A6JA 1A6TB 3S4SB 2FYYB 5ESQA 4XNQB 2ICWJ 1EEQA 3GSVB 3OKMB 3L5JA 4UQ2A 4OGAD 3TC9A 3SDCB 4ZXBB 1JWMB 2LTQB 2FHFA 5IIEA 4PP2B 1C7TA 2MCG1 3F7RA 1BJMA 5GRJH 3STLB 3C8KA 4PTTA 1LP9E 4UV4H 4WY7H 3D9AH 3EDKA 2Z4QB 2KUTA 4PJAE 5DHXB 1W72L 3PWPA 1AY1L 5DJAB 4EQ2A 2B1HL 1I1AA 5E8PA 4Z7UF 2YD2A 1T1XB 2I07A 4HUNB 3RY5A 1E4XL 1NLDL 1PSKH 1E4JA 1QR1A 4J6RL 4JZJA 4UT9L 3ABZA 3QCVH 1UZ6F 2UZIH 1ZS8B 4X6FB 1NSNL 2NTFA 2XY1A 4U2ZA 3CK0H 1N0LA 2FLBT 3GJFB 4LHUG 4WHCA 1MRCH 1WVZA 3A67L 2ZUTA 4BZ1H 4DKAA 1FO0B 3S34L 4QXUH 3ARBD 3QH3A 4HXBL 1QUNA 5T1DL 3CDGA 7FABH 4OGXL 4PJXA 3RVWC 5IKCB 3NTCL 3BPOC 5L0QC 4G6FD 4WW1A 2ITCA 2RHEA 3RKDC 3T0BA 2IG2L 1Y6MR 3QXUA 1OAZL 1IGYB 2MPAH 5IEKB 1P7QA 2X09A 1GOGA 3EFFA 3Q48A 4GAFB 3M1BA 3QXWA 4HMEA 2AERT 3MCLL 2R1YA 4XPGL 3ME0A 4NC1C 4MVBD 4YPGA 5KSVB 3V8OA 1ES0A 1MLBB 4TUKL 2EYRB 3CSPA 4PJ7E 4RCAA 1QO3B 4JZNA 4D2NA 3WXVL 1LO5A 2X4SB 2HMID 1FG2B 2W59A 4XNZC 4R3SA 3F58L 2YSSA 1S7VB 2GUOB 2ZSVA 4WEBL 2IANE 4YHPB 3G5ZA 1J8HB 5IGXH 5CP3A 1E4KC 1JE6A 4KZDL 4R4FL 2VDKH 1MY5A 1CGVA 1DVFA 5HYJB 5A16B 3DYMA 5I66A 4LSVH 1U8IB 4IRJB 2A6IA 4DKEL 3WHE0 4BSVB 1S7WB 1MCWM 2E27H 3GJFH 4R0LA 2CUMA 4JDVB 3P4MB 1FO0H 4YO0A 3QJHA 1JGLH 1MSPA 4QWWD 4JJ5A 5EU7E 1PEWA 3PL6C 4M7KL 4DOHE 3QRGL 3SGEI 5J3HC 2FO4B 3HNSL 5B38G 4KK5C 3MGTB 2B1AH 4L8DB 4WNQB 1FBIH 1AFVH 4LLVA 1NKOA 3S88L 5F71A 1HH9A 2YKLL 4ERSL 3Q5TA 4OCXL 1RJLA 4N0RA 4YFLI 1TJGL 2EEAA 3QG6A 3VD7A 4WDIA 4H25B 3VG9C 4N90E 2VOTA 4OZGF 4NUJB 4IOSD 4RDQG 3TBTB 1N6UA 1UXSA 1D6VL 4DUVA 4WUUE 4ENEC 2AGJH 4L8BB 3HFML 4JRYA 1UB6A 2MCPL 5BZWB 3EIFA 4WI8A 4YNYB 5EC1B 1XZ0B 2BMKB 4RFOL 4OCWH 3EYQD 1YYML 5HI3D 5F1OB 1H9VA 5GJTL 3BIKB 5DD3H 1M7DB 1IKFL 4ZAKC 1BD2D 4H5SB 4M6AA 2BSSA 3O2WH 2OR8A 1ZLWH 2AQ3A 5IHZB 1KPVA 1OTTC 1MJJA 1QYGH 1D6EA 4TVPE 3L3JA 1SVZA 3JZ7A 4HZLA 3A0OA 5DJZA 5GHWL 1WTLA 5E8OB 4FFYL 3WIHH 4P3CH 1CE1H 3VXNA 5T1MA 1BJ1H 1ETZB 3IXAA 5IMKA 3UTPE 2GJ6B 1CQYA 1GGBH 3S96A 3I6LE 4QRSB 1HWHB 1MLCB 2W91A 4HHAA 4O9HL 5IHBA 1FIGH 1YMMD 3WFHA 4KV5E 1PLGL 4NKDB 3MLYL 3TYGL 4L3AA 3CZFA 1XF5B 4ZUWB 1OAYH 2QSQA 1ZHBA 4LEXH 3GZKA 4NRYA 2MMXA 4LPVA 2D2OA 4XP1L 3RAJL 1E4KA 4W6XB 4LVHB 1G7LA 3MC0A 1U93A 1XGRA 1EUUA 2VC2H 5BS0D 4P5TA 2AXFA 2BY1A 2KQMA 4HIHB 2EDRA 4NHCL 3D18B 2OK0L 3HG1A 1U8MA 2GSIB 1HI6B 5LWYH 2YHGA 4XNMA 4BELD 3QO0B 5F7MC 3IDXH 5T1LD 4H0HB 2R2EA 2RJMA 2AJYH 4KROC 5DK3A 3HC3H 2DQHL 4FQLL 4WU5A 4FQIL 3LN9A 2AXGA 3QI9D 3DARA 2E5EA 4FTVA 2HLFC 5CSZB 2VLMD 3F65A 5I1LB 4KY1L 1RUPL 4UNTA 3ROOB 3WIFB 4JFHD 4K3HA 2KBGA 5A43C 2DDQH 2XNAA 4JFED 4Y2OA 1GZQB 2V9QA 4FHBD 3ULSA 5D70L 4ZUTA 4J4PD 4P0DA 4X0KB 3W39A 2CH8A 2X10A 4FQPA 3TJHC 2Z92A 2Q87A 3QEQE 3QNYB 4OM1H 5E6ID 1M6OA 1TNMA 3GMOB 3T0ED 5IFAL 4G7YH 3GIZL 1BQUA 1F3JA 4OZ4A 5D5MA 3DGGA 1LNUA 4P59L 1PKOA 3O0RH 2IBBA 2FECL 5A2KH 4U31A 1A9EB 2VSCA 4ZAKA 3V5DB 2PO6A 4PJHB 5DEZA 1OL0A 3T65B 5FHBL 4HS3B 5SWSE 4W81A 4OKVA 4L8SC 3I02B 3MLVH 4M61B 3MACL 2V7NB 1AO7E 1IEBA 4OF8A 3H0TA 1WCBA 3X13B 2A73B 1TPXB 2WINB 3PXHA 3QR2A 3TN0A 4D9QD 3RL1A 5AWNH 4ZYKA 1A3QA 1F4AA 4PJIB 1X7QB 1IAIH 2NY0C 4A6YB 3NFNB 2ATKB 3OKOA 3WE6A 4WI3A 4XC1H 3KPSB 3BT2L 1OSPH 4MSWB 2VN7A 1P69B 3O8XB 4G6MH 3INUH 2EIZA 4K7PL 4OBRA 1C5CH 1I1RA 1RUML 3MFGB 1JGUL 1A3RL 1CL7H 4YHIB 4ZD3H 4CNIA 1HEZB 2DL9A 2XQBH 4KTYA 3WO4B 3Q0HA 1G6RB 3GO1L 4LCWE 5JPMB 3PJSB 4MA3A 4YXHH 1G7IA 5F9DC 1XAUA 4AIXA 5DI8A 4KJPD 3QWRD 2WAHA 4OV5B 1KBGL 2EIEA 2GW5A 3AVEA 4NO0B 5ESVB 3I6KB 4ZOCA 5LQBL 1P84J 1CDUA 4GXVH 3VXSA 3HE6C 2CRIA 3UO1L 4JM4H 3U0PA 5FGCE 2VMFA 3LQZB 4XWGL 3FO1B 3CPLA 5GGVY 5K9OA 3FT2A 3ZHLA 4G3YL 2CK0L 5KW9L 3UBXA 1QEWB 1KCUL 1QP1A 3EDJA 4J3XA 3BP7B 3H3PH 1UH4A 3RZCD 3EYVB 2YPKB 5JHLL 3IRPX 3QXDB 3VXUA 3HZMB 4YDLB 3FT4A 3RNKA 1A7PL 1AHWC 3H8NA 3TJEL 5GGSY 4RGNB 1OARH 4U1LA 4UB0L 4X83A 1DFBH 1YQVH 5I0ZA 4BQBA 5DRNB 1A6ZB 3VE0B 3FO2B 3U6RA 5HPMA 4PJ8B 2BOCA 4QYOA 1HHKB 1YEFH 3OSKA 4IEFB 3RHWF 5BCAA 1UG9A 3EBAA 4NQCB 3R0NA 2F8VA 4C56D 5TQ2L 3U7AA 3GUTB 2NR6D 5C6TL 3VFNA 2PETA 1JI2A 4OM0L 2IF7A 5FCUH 1ZT4A 4OCSH 4R2GB 4L3EE 4OCRH 2XZQL 3SBWC 1KENL 5TE4L 3PWNB 2E7HA 3RVTD 2YR3A 3SDDD 3MRBA 1HQRB 4WTWA 3ARGC 5EOCH 1JHKL 5DFVD 3EW3B 1G9MC 2C3VB 4GQ9L 4S1QL 4HF5L 1MFCL 2DWDA 1FNGB 4H0IA 4LDEB 5JW4N 4K07A 3LSOA 4P4KD 1NGZA 1YNTA 4HJJL 4FQCL 3BEVA 1ZEAL 3ILPB 4Y4KC 1VA9A 4X4MA 1GIGL 1Y0LA 4W4OC 3HZYB 3EO1A 3WUZA 1WWBX 4MQXD 2QADB 1AE6H 2OM5A 5ACMA 3SGJC 4YBQD 5I18L 1AP2B 3GSQB 4ZS6D 1J1OH 1TTGA 3P0VL 2YRZA 4MGXA 5BXFB 1S5HA 2BVQB 2J4WL 2ZCKH 4EBQL 3PP3K 3V5HA 1OAUH 3SDAA 4NFCA 1FN4B 2AJXL 4NZDA 3QUYA 4GXUN 4JFQA 5CCKH 1LO4H 4L1HA 1HHHB 1FVDA 4ZFOA 2P46B 4I0PA 3WFCL 5AZEH 2PYED 5B8CB 1ZLUH 3C5JB 4NBXB 3B5TA 4HC1A 1MCHA 5I8OL 2ENSA 4XCFH 4HCRL 3KXFB 1HDMB 1HCFX 3VFOB 1CG9B 5JIHA 5LCVH 1NMCC 4DGYH 2L7UA 1ZLSL 1UB5B 1IT9H 2O5YL 2EYSA 2HG5A 3AY4A 4XRCA 5ENWB 4U1JA 2VDRL 2W60B 1QBMH 2ESVB 3UC0L 2WWKO 5DEGA 3WFEL 4GS7C 2IAMD 4PJCB 4CUCA 4JM2B 4QXWA 1KNOA 4HK0B 4GRLC 2PW2B 4M03A 3S9DB 3VW3H 4J3OC 1OTUD 2UZXB 3RDTB 1MWAH 3DRTB 1S7RB 4N8CL 5EOQL 1T5WB 4QOKA 3U1SH 4QXTA 4KRPC 5DMYA 2HTKC 3BH8A 5EBWA 4OUUB 4HXAH 4KKCC 4WFGE 2DJUA 2E6JA 4Z7VB 1NFIA 3T0XA 1OGAA 4Z0XB 5CP7A 3QFJE 4ONHA 3J8F7 2P8LA 1QRNA 2VE6A 5J13C 4L4VB 1QSFA 3IJYA 3SE9L 3R1GH 1NGYB 4Z7WA 2R23A 4MJIE 3UTPD 4NN6C 1MCRA 3MREA 4FRWA 2IWGA 2W1NA 3TYFB 1N5AB 4WO4C 4QHMB 1A1MA 4Y4KA 5D96C 5EZJB 3BYYA 4F57L 1JTTA 5DQ9A 5D5MF 4W4OA 3D85B 5GISL 5F3BB 4D0DA 4RAUB 3QDMA 3CFEA 4NYLA 3GSWA 1FNLA 1F4YH 5K33A 15C8H 5K9JL 5IB1B 1ZHKA 5E94B 3HAEG 4ISVB 5BRZE 3TNNA 3MBXL 3NA9L 2I26N 1IVLA 4LBEA 4ZO9A 4NQSB 1J0JA 2CDGB 3V6OE 3V4VL 4K94C 3I50H 4LEOB 3KHQA 4KK6D 3L3IB 1I7RB 4O5LH 5JIIA 1HOCA 5TF0A 4OF6A 3DECA 1AD9A 2VLJE 3MLSL 4OGAC 1EBPA 1EEZA 2O61B 3MJ9H 4P3DB 3GMNB 3QEHB 4Q9QL 7CGTA 1PFCA 3T77B 1VFBB 1G9NH 2XQYK 2EIDA 4RWYH 2PW1B 5KG9B 3HI1B 3GBMH 4MNQB 1O0VA 4M1DH 4NM4H 1MEXH 2EDDA 2VIRA 5HHPB 4Y8AA 4JG1H 4N0UE 2AQ2A 4I18A 4RQQA 2X4PA 2BDNL 4M1CD 4WWKD 5FOBA 1J1PH 5C6PB 5B38B 5I1DA 1CDBA 2BSRA 2VTFA 1JPSL 1ERNA 3SKOA 4CVZA 1WIOA 4PJDE 4KXZH 1MQKL 5GGTL 2V2XB 2WUCL 1BX2B 4GRLA 1ZXQA 3ARBC 1MHPL 5FYJE 4LSUH 5SWZB 2VH5L 1KB5A 4QRTB 1FPTH 5DJYB 3BSZL 1OSZB 4MJ5B 3T2OA 1KUMA 1UQSA 1EV2E 1YEKH 5KZCB 2XN9E 4EXKA 2HTLD 3JV5A 1IGJB 1FZJA 1MAKA 3GSRA 5DD0L 1BFVH 2I27N 1JRHI 3VFGH 5BV7C 1R0AL 1EAJA 3S36L 3ORJA 3VD4A 2V9RA 4R26H 2VDNH 4ELKA 4RWHA 5DK0A 1VENA 1IAKB 3RX7A 3LD8C 3K4AA 5MENE 1Q8MA 1RV6X 1P4IH 2XY2A 3ZMRA 2HMIC 2PTUA 3F8UB 3T2NL 3QWOA 4IDJH 3BKML 5ICXB 3D3VA 1DCLA 3FZUD 2RAMA 1JWSB 3OKLB 2HRPL 3TH2T 4XP9H 3B4NA 4NRZA 1CS6A 1T0NB 5JHDA 4AG4L 2JIXB 3GKZA 2EDNA 5SX5H 1S7SB 5TGBB 3HA0A 3O6KH 2VQ1A 5D7LA 1FNFA 5MI0C 4FZ8L 2XTLA 3NPZB 2DN7A 4PRIA 4QWWC 2IFGA 1PW3A 3CU1A 1J0YA 1QFUL 2VXQH 5J12B 4P46D 4LL9A 1T4KB 3IGAA 4H1LB 3H9SD 3SO3C 1R3IH 3FQUA 2VL4A 5KSUB 4DCQB 3UTOA 4A2LA 4HAFA 3DVNA 3WHE1 3QO1B 1RZJL 5F3HB 3JWDC 4JO2L 4X9FA 5F7YC 4F33B 1N5YL 5IP4A 4F7MA 4P9HL 2ZOKB 2WV3A 1VFUA 4KH2A 1XF3B 1ZVYA 3L3DA 1BM3L 4KRLB 5E6YA 1E6OL 2X1WL 2Z8SA 4QCIB 3O4LB 2WBJA 3EYQC 5HI3C 4HWBA 2Y36H 3G6JB 3O3DB 4S1RL 4F37K 1S9KC 2V7HA 5ICZA 5ETUA 2XRAH 4NKIL 1RVFH 2VLRD 3HI5H 3NCEB 4I0KA 4OIAA 3CZJA 3P73A 1WV7T 5IMOA 4HFUL 1XIWD 3A6BL 1Z0NA 1FZOB 2ZCLL 2DLTA 3AB0C 3S3SA 2XKNB 5T5FL 2D31B 3CC5A 4HZAA 5I1KH 2P5WE 3LEYL 4V1DB 3S37X 3IVKB 4YHLH 3IFNL 4U1HB 1FFOA 5ISZE 1NMBH 1FE8H 2WUBL 4K8RL 4ALAL 4IJ3B 4L3ED 1NDMA 4F7CB 4XP5L 4XVSL 1KTLB 1QVOA 4OJFL 1CFTA 4ODSL 1SEQL 2WSKA 1C5DB 3SDCD 3FFCB 1KCSH 4ZXBD 2JK5A 4OZHB 1KELL 1YNKH 1U0QA 3IU3A 4RAVB 2Y06L 5GS1C 2DLEA 3R8BB 4YHKH 4EN3D 5BVJA 4XB7A 3AU1B 4IOIB 3NH7L 4HT1H 1BVKB 1D9KB 1HSBB 5DA4A 5HVGB 3EOAA 1UKTA 2F53E 3GM8A 1IQWL 3CFDA 3MRRA 1GSMA 1WAAF 4HWZA 3JSSA 4OF7A 1WT5A 1UM6L 1AI1H 3PABB 5HXMA 1QLFA 2X42A 43C9B 4Q2ZB 1F11A 3V6ZB 5ABDE 1FL6A 1KTRL 1U36A 5HGDB 4ODWB 1RZ8B 1L9MA 5EU3A 1N3NB 1DL7L 1HQ4A 3FFDB 4WTZA 2FWOB 5IVXE 1ZOXA 3SKNA 2DYPB 1ZGLM 3L5XL 3WL9A 3MR9B 4U1NB 4YHYC 3KNBB 1VKXB 2Q86B 3PGDB 2MTPA 4YHNA 2ZWLT 1IZKA 1FAIH 5EORH 1JV5B 5HVHB 1CCZA 4CKVX 4J4PC 4HKJB 1GC1C 2BY3A 5C0AE 2J6EH 3JV6A 3QWQB 3RGVD 1E4WL 5ACZB 4TVPL 2R1XB 2XYCA 3DIFB 3ROLB 3UBXI 4CN4A 3IDMA 4JN1L 5JXAL 4N0FA 5E6IC 4C58B 3T0EC 3LN4B 1XCQB 2AJUL 2SEBB 5D2LB 1J8HD 5I1AB 5DR5L 4FG6D 1WF5A 1IQDB 3GJEB 5D1XB 5DVMA 4DKFL 3CFJB 4QY8A 5FAAA 5TPWH 4HCRA 4JPWL 5HYJD 3KYMA 4PJFA 5HGBB 2YD7A 1P7KA 3AREB 1YEIH 2D9CA 4Z7QE 5CBAB 3LIZH 3H9YA 4IRJD 2C26A 1B6UA 5D1QD 4C4KT 4TUJA 4PRPB 3O11B 3GI9H 3WXWL 1OPGH 4LRIA 4CL7A 1FNEB 3ZE2E 3UX9B 4WVRA 3DXAB 1DEEA 2FX8H 1CE6B 1EHLH 2HFFB 2A9NL 3VD9A 1YMMA 1NBZA 4XZUB 4WV1C 4JE4B 4PV8A 1BFSA 1E4XI 1OCWH 1ZVSA 2C7UB 1KJMA 1IARB 4LSRL 2B5IB 4YUEL 2ZPKL 4IHOB 5IFJA 3P30L 4EOWH 3LRSB 3QNZB 1JTPA 4AY0A 2IQ9H 4P5KA 5FYLH 4KQ4L 3SGDH 5IV2B 2Z31C 3TVMB 4AEHL 3MXWL 5BS0A 4KJPC 3MRJA 2OR9L 5IK3B 1QQDB 4BK4A 4DVBB 1NAMH 4I77H 3DJ9A 1II4E 5LGJB 3C5ZB 3T09A 2R39A 4Z5RA 3MLWL 2CMRH 3CVHA 3QDJB 4NZRL 3LN5B 3VGFA 4HIEA 3FO9A 3QI9A 4MMXC 4PJGE 2KZ1B 3QULA 5HDBE 1OT1A 2J8UA 2VLJD 5IVZB 4QTIL 2ADJA 5C7XH 3GI8H 3RZCC 4YIQB 2GJ6D 4Z7NF 4M1GL 3D39E 4YGAB 4HH8A 2ZG3A 5F7HA 5ITFA 4MA7H 5A2LH 1P4LA 5H8DA 4J4PA 2HKHH 1HNFA 5D7IE 5E9DB 1AIFA 2CIKA 2KDGA 3PHOA 4B5EA 5KVDL 1VPOH 1YEDB 2A6DB 4RFNB 4RISL 4UTAH 3T0EA 1HKFA 1QBBA 2VLKD 3E6FB 1V7ML 1R3LB 2A2QT 2NR6C 3DV4B 3THML 5ID0B 4FXKB 4MDJA 3KPMA 5E00A 3SE8H 1YUHA 3RWEB 1CYGA 3MRQA 2CDEA 2RFXB 3HNVH 2CGRL 1U95A 1EERB 2NW3A 3WLBB 3O45B 3RVTC 3IRZA 3SDDC 1YEHH 3VFTA 2XN9D 3IDIB 5FB8A 1VGEL 2RBLA 5DFVC 4PRNB 2VXTL 4KKLD 1XF1A 1RULL 3QXAA 3K74B 2YA2A 3QUZB 4TSAL 2DQIL 1E0OB 2BCKA 3DSFL 5J9PA 4J23A 3ARYA 3EHBD 3N9GH 2W07A 4NM8H 1K6QL 4X6BB 3HZKA 1H3PL 4WV1A 2B2XL 5EZLA 3F7YB 4HK3J 5IBTH 3HMWL 3KLAB 2MHAB 4YBQC 4ZS6C 1NBVH 4ELMA 4ODVH 3REWA 5ID1A 1ORQA 5I1GL 3CXHJ 5IB5B 1EO8H 2X70A 3D69B 4HV8B 4LHJB 5C07B 2G5BB 5EOCJ 3ZKND 4F7TB 3JV4B 3U7YL 5JLZA 5GGRY 4HUVB 1BF8A 3VXRB 5F9JA 4NSKA 5D2NE 2FH6A 1I7TB 4ZDHB 4PRDB 4RGMB 3FONB 3G04B 2AAVA 1GJIA 4NN5C 2DQEH 4X6CE 1Q94B 1KN4H 3QZWG 4NBZB 5BZDB 4JFXA 4H8WC 3HAEB 1FCGA 4QRPE 2NZIA 5DJXA 1MCBA 2W9DL 3HTLX 3UJJL 1JUFA 5DS8A 5JR1L 4OCLC 3UP1A 4O58L 3RZCA 1OAQL 1H8NA 1RZIA 1DANT 4FNLH 5FCSH 4UNVA 1DQDH 3HMXL 3KPSD 4GKOA 1C16A 1MCNA 4E5XB 1LP9A 3DX9B 2GTWB 5KS9E 4MA8L 4WRLA 4BUGA 4AIOA 3K1KC 3TH4T 3NIFE 3PGFL 2IAMC 5DHYA 4LARH 1Q0YL 2EH7L 4DVRL 4L29B 2VZSA 1UWEH 4J3VA 1ZHNB 1OTUC 2PTTA 4QTHB 1NMAH 5DRWB 3DTXA 3C9NB 1FL5B 3DUUA 4XXDA 4BH7A 4K9EC 4LF3B 2VQTA 1M05A 5F8QC 3V52L 4S0TD 5JNYB 3MV9D 2IH1B 3NCJH 1RIUH 5C0GB 5HY9B 2QKIB 3B2VL 4GG8A 2I60H 2PR4H 5DO2D 3HLAA 4NO0D 2B8OT 1A7NH 5IW6A 5E4EC 3CSGA 3RUGB 4OZIE 3SDDA 3BP6A 4NO2B 4Y16A 1EUTA 4M6MH 5GSRA 1LK3H 2F54E 5HYQB 4K3JH 5LVEA 2D4DA 4O2CB 3VRJB 4F2MB 3LQAH 4X7SL 1L7TL 1ZGLA 4GG6E 1CZ8L 3UBXG 4P4KA 3HAEH 4U3CA 5FKAB 4JKKA 4HPOL 2XXMB 3LKSB 5EO1A 2DQCH 2FIKA 4KU1A 4YDKH 1JGDB 4PJ7A 1UWGL 3KJ4C 4KJYB 4OF3A 3S97C 1ORSB 1XGTB 1K8DA 4QRQA 1MCEA 2IANA 3QRFM 5DD5H 2HJKA 3BO8A 3LQMA 3ZDYE 4F58L 3U9PL 2GK0A 3PWJA 4Y5YB 4GRWF 4KK6C 5IM7B 4ZQKA 3TEUA 4W70A 2R0LL 1PKQB 2ZUWA 1DQTA 3SPVA 3KLDA 1KTDB 5K59E 2PYEA 1OAKH 3MA9H 4OLXH 4R2GD 2FB4L 4KDWA 1EGJH 2XZCH 1F58L 5J6HB 1K5NA 2XQYG 3HS0B 1JWUB 1P5UA 2IFFH 2CKBB 3S5LG 4NN7C 4M7JL 4WWKC 4JAMA 3CH8A 3SKUD 5BQ7B 5MEOB 3ULUH 5FK9A 3O6ML 4KAQL 4DWHA 1HHIA 3STBA 4XBEL 3MA7B 5DRZA 2IAMA 2H26A 3JTTB 4WUUA 3L3GB 1WEJH 5CUSH 4LCCC 5HHNB 2IEPA 2E7BA 5EU4A 3EOTL 2QADD 3SDXB 4JO1H 3EYFB 5F88A 5HGAA 4RZCA 2OJZL 2FH8A 1KLUB 5ALBH 4HLJA 4Q6IB 3CMOH 4OGYL 3TZVB 1E6JH 4GW5A 2VDQH 2HTLC 3NFSH 4ONGL 5DZNA 4RGOH 5KANI 2Y07H 1JGVH 2BVOA 5BOPA 1YY9D 3GSUA 4LU5H 2EDOA 4JANA 2APBA 2DIAA 4JHWL 5IB4B 3Q6FB 4TRPL 2ZP0T 2I24N 1F45A 1QOKA 5J11C 5I71C 1YDPA 1P7HL 2I9TB 3TBVA 1V8HA 3NA4A 4JDTL 4ZMAT 1QFOA 2R56L 3KXFD 4NC2B 3X12A 5TF1H 3MRHA 4G43A 1LD9B 3CGTA 12E8L 2Z93A 3M07A 3PDGA 4MZ2A 2ZG2A 2BK8A 3VFUB 3BRFA 3KS0H 3FZUC 5E2VH 2XTJE 3V0AC 2A6JB 4X5LA 1Y6NR 4WGWB 1INQA 1DUYA 3KPLA 2ESVD 5ESQB 4UQ2B 1A6PA 3GMPA 2WQRA 4CRPA 4PG9A 2X40A 4LSSH 4NQDB 4JM2D 1BGXL 4ODHL 2JJWA 3C8KB 4G8EB 3WUWA 5IESL 2QQQA 1ACZA 3RBGA 1MPAH 3PWPB 2LAAA 1J05A 1V3JA 4MMZC 1KJ3L 5TFSH 2EH8L 4ESKA 1MCPL 1I1AB 5E8PB 1NGPL 4P46C 1A1NB 1QR1B 3C60A 4RFEA 2G75A 4X98B 2LU4A 3ARFB 3DX8B 3BPNB 4HGWA 2NTFB 4S1SH 1MI5E 2EIBA 1MFAL 1LEIA 1AR1D 4LHUD 4XP4H 3IFOB 5FYJL 3LHPH 3G5YA 1HH6B 2WP3T 3CDGB 5EBMA 3TP4A 3T08A 1GPOH 4PJXB 4C83A 4ODBD 3IB4A 3D39D 4WWKA 5AYUL 1CD0A 2ITCB 4AH2A 3E2HC 2K7PA 1HXMA 1OVZA 3MJ7A 1CF8L 4JFDE 5EN2A 1IGFH 5LBSH 3EFFB 4PRHB 1NCAL 3F62A 1JF5A 3QHTC 5ITBL 3M1BB 2R1YB 4FN0A 1XIWC 5GGVH 5IBUG 3WDHA 1ES0B 1NH6A 1UA6H 1J1XL 3IFPA 4N5UA 3LS5L 4PIRF 2VXVH 1NFDE 2UY6A 3CFCL 4JZNB 3GMRA 5MHSE 4R3SB 1BREA 2ICES 2YSSB 5BOZG 4Y0GA 2ZSVB 5GRVL 3NZ8B 3G5ZB 1PX4A 3HC0A 5A2IH 4YX2H 3KVQA 1TJIL 1YNLH 3SDCC 4ZXBC 2LTQC 3MLZL 2E8ZA 4FQ1L 4LAQH 2HFEA 3P40A 4X4ZA 5ERWA 4EN3C 2A6IB 2B0SL 4M62L 4S2SA 4R0LB 5DHVA 4MNQD 1BQSA 4U3XA 2APWA 2WLZA 4BFIA 1JNJA 3U46A 4XPTL 2FEEL 4QRRE 1L4IA 1TETH 4Z0BH 1NCDL 3MV8B 1KLGA 4JJ5B 4I5BB 3D25B 4M7ZB 1ITBB 3CLEL 5IVOA 4KI5E 3RWHB 2H2SD 4K94L 2YD5A 2NPLX 4X80L 1CLZH 3VMOA 4LLVB 1YPZA 4ODXA 4PBWD 4QNPE 3MQIA 1P6FA 1PYWA 5IFHH 1VFAB 3FN9A 4WFEE 1RJLB 1TJHL 1F42A 2DTSA 2IH3A 4WDIB 4PJEB 1VEPA 5FHAL 2GY5A 1D5IL 4TSBH 4HKBA 2P8MA 1NUGA 5I1JH 3V0WL 1UXSB 5GQBA 5ELIA 4UU9A 3QQ9C 1ZTXL 1IAIM 4JRYB 1UB6B 4P46A 1JHTA 3MV01 1P1ZA 4KMQA 3H9SA 2NXYB 2VAJA 1DBKL 4WENB 2F5AL 2WBKA 1X44A 5EULV 1I3GH 4AEEA 4HAGA 4DGVH 2BSSB 5KAQG 3L3HB 5C0DA 5E08H 1J7VR 1KOAA 2V5TA 3MJ6A 1KPVB 2E9WA 3RGVC 2X4UA 2FSEA 4ZPTA 4ZODA 1D6EB 5MERA 2OZ4L 2HT2D 3TFKD 3L3JB 4HZLB 4OF5A 5DJZB 5L0QB 5TE6H 1VGKA 5TQ0H 2PF6A 2CK2A 1HZHL 4D0CB 2DF3A 1HINL 5KSBE 5T1MB 4E41E 3IXAB 5IMKB 1KULA 3OKKA 4MLSA 2F58L 4MD4A 4M48L 2N7BA 3HPJA 1KG0A 1U8LA 3HC4H 4GRMA 5E2JA 4HHAB 2C4XA 3MNWB 1XIWA 3MNZA 3WFHB 2E3VA 3QSKB 4IRJC 4R96B 5D1QC 2IPTH 5KSAA 2BNQE 4NHUA 3CZFB 4J3TA 5I8EB 5JUEL 5KJRH 2W0PA 4AENA 3HMXA 4NRYB 1UGNA 5DFTA 4M7LT 5BO1L 2FYYA 2QQNL 1MFEL 4L3EA 1MCIA 3MV7E 1TQBB 3SDCA 4PGEB 4P5TB 2AXFB 1KXTB 4P57A 3STLA 2XOTA 4Y5XB 3HG1B 3IDUA 3LPWA 1J87A 1T22A 4JQXA 4I2XE 2XA8H 2Z4QA 2A9MH 4QRUA 4EN3A 3GDBA 4GAGL 5DJAA 2R2EB 1TQCB 4WU5B 2AXGB 2AEWA 1A02N 1T1XA 3FN0H 4S0SD 4JFZL 4X8XA 3CLFL 5GZNC 2DM3A 4LHQB 3Q2CA 4X6FA 2CJUH 5KANG 4TVSa 3GJFA 1FLRH 1A14L 3QIWB 4GMTH 2XNAB 1Z5LA 1FO0A 3KPPB 4JGUA 2R0KH 3V4UL 4ZUTB 5JZ7D 4ZNEA 4XMKH 4PG2C 4X7CC 3W39B 3P0GB 3MMEA 2Z92B 4V1DD 3U79A 1JFQL 4Z8FL 2H41A 2WWKT 4OKDA 2JJTC 4U6XA 1F3JB 1IGYA 4OZ4B 3DGGB 1LNUB 5IEKA 1H5BA 4ZAKB 5FYKL 1OP5K 3VXPB 4MDIA 2PO6B 4CGTA 3FFCD 1BEYH 2LABA 1EFQA 2CXGA 3QIUD 3RGVA 2AI0L 5DZOA 1D5MA 5T3XH 3Q6GH 1JNLL 1IEBB 3MRGA 1WCBB 3QZWB 3FHAA 3TN0B 3RL1B 4ZYKB 3T0WA 5CZVH 5EO9B 4B0MM 3CNKA 1D9KD 1J8HA 3V7AG 4Q7DA 3WE6B 3ECBA 1CDIA 3C5SA 1CBVH 4XHJD 5HYJA 1JPTH 5GRYA 2ENYA 5A16A 5CIPB 3VD3A 2EIZB 4IRJA 3E3QC 1WZMA 5D1QA 4BSVA 4KDVA 1F8TL 1F4WH 2FLRT 3K4DA 4JDVA 4LQFH 3OZ9L 3P4MA 4XPAL 5F7EL 4HDIA 2XZAL 1P6AB 4KKLC 4CNIB 1G7MB 2FO4A 4JQIL 2DQDL 4MA3B 1G7IB 3MGTA 5GRUH 3UXFA 3ARWA 3F7QA 2DQJH 3VFRA 1A7RH 1KTKE 5FKPA 3EHBC 1QHPA 5DI8B 3UPAA 4ZOBA 1UM5H 3SOBL 3PP3H 3EFDL 5KVEH 2H6PA 2A1WL 4P2YA 1KCLA 2XPGA 1A0QH 2GT9A 5C0ND 4MJIA 3HKFA 2OJEA 2PXYB 3I2CL 4NUJA 4XVJH 2FEDD 3T3PE 5JO5B 3B9VA 3VXSB 3BGMA 4KROB 2H8PB 4R7DA 4O2FA 3U0PB 5FYLD 1BQHA 2XTJD 3CPLB 5E2TL 5K9OB 3FT2B 5BZWA 3BAEH 4TPRH 2DS4A 3UBXB 3MODL 2BMKA 4XCNA 1KYOK 4LIQE 1I9JH 4N8PA 5DVKA 3PV6B 5HHVH 1CIDA 3N1GC 3RIFF 1SBSH 4H5SA 4XNXH 3VXUB 3X3GL 5D1XD 4G9FD 2BVUA 2VLLA 5JIKA 3FT4B 3RNKB 4U1LB 3PQYE 4PG2A 3RTQB 3CVIL 5CIPH 1TPXC 3LH2H 4PRPD 3EDFA 1UEMA 3VGGA 4Z18A 5HPMB 1FDLH 1WICA 3U6RB 3QHFL 2BOCB 4QYOB 5E8OA 2VLJA 2JJTA 3ELAT 1L0YA 4M6NL 5EU5A 5F6HI 2GJ6A 3DXAD 4JDZA 1DQJB 3MV11 4NQEE 3RI5K 5I2IB 4NCC2 1MLCA 3NIGE 2H1PL 1FV1A 1F6AB 3WJLA 2WM0A 1IGML 4P2QE 1YPZF 1IM3A 1E27A 3ESUF 4YWGH 2GK2A 4ZUWA 1WWAX 3ULVE 3WKML 2EDTA 3OAYK 4KVCH 1MIML 4HWEL 2VLKA 3DVGA 3RZWA 4X5WB 2NY0B 3S5LB 3VRIA 2DWDB 1QSZA 5F7LB 2EC8A 5ADOL 3QIBB 3TIDA 1YNTB 2OP4L 4JPKL 3BEVB 4LGPB 4IOFD 3D18A 4PY7A 3MOBH 5DO2C 5AG8A 3C5ZD 1RZFH 4Q74A 1E28B 3EO1B 3P77A 2Y5TA 2VZVA 2YXFA 1RUQH 5I6XB 2XN9A 3QDGB 4YHMH 4G6JL 1RK0B 4WFHE 3HUJF 2F5BH 3DROA 3DI2B 4WEMB 5I1EH 5E2UL 3GBNH 3CX2A 5CSZA 3V5HB 3L7EB 4Z7OE 1XGQB 4TULH 3SDAB 3AM8C 1EHXA 3QUYB 4Y1AB 4JFQB 1EXUA 4YDLC 1I75A 4I0PB 5MENA 4RGNC 3OKYA 1I3VA 2MQ0A 4X0KA 5EIQA 3AUVA 5E9DD 4ZSOE 2FGWL 1ACYL 3H9ZA 1W72H 1CD8A 1CFQB 1NGQL 4KI1A 1AY1H 1WIUA 1MJUL 2CD0A 1KF9B 3S37L 4KI5D 2B1HH 3IXTB 1NANI 1E4XH 1NLDH 4LSDA 4NP4L 4KWUA 4PRAA 4XRCB 3ZL4L 4J6RH 5F93C 4NKQB 4UT9H 4WFED 4P3WA 4M3JA 3EO0A 2L7JA 3MCG1 3H42L 5DEGB 4HS6B 4PGDA 4HS3A 1NSNH 4R2GC 3O2VL 3FMGL 2V7NA 3A67H 4PJHE 3X13A 1S9WB 3S34H 4M5YL 4HXBH 3VJ6A 5T1DH 4PJIA 3EJYD 4OGXH 2ATKA 3BKYL 3QUZD 3HR6A 3KPSA 1CVRA 2IG2H 4QXTB 5EBWB 3SKMA 3DVFA 5C09E 3QPXL 2GITA 5CD3A 2V5MA 3G5VA 5AD0A 1NFIB 2R69L 3MCLH 4JRXE 1OGAB 2NY5L 5IWLA 1ED3A 5CP7B 2QADC 3L3OB 4YDJA 4KTDL 4TUKH 2P8LB 1QRNB 2VE6B 4I4WA 2CRMA 2DQGL 4Z7WB 3WXVH 2R23B 5JPMA 5EPMB 3MV9A 3PJSA 3KLSA 3F58H 5L88L 2FATL 5C07D 4WEBH 4Y19E 1ZWIA 1YY9C 5KVFL 4KZDH 4R4FH 3BGAA 3QHZL 3RIAK 5DQ9B 1MCJA 4NO0A 4Q9RL 1YC8A 3QDMB 3CFEB 4NYLB 3GSWB 4L4JA 2OZ4A 2PN5A 5IBUB 4DKEH 2XV6B 1ZHKB 3TNNB 1L0XA 1QD0A 1X5ZA 2IC2A 1U42A 4OD3L 5C6WH 1QEWA 1EO5A 3MV7D 1PJ9A 3AM8A 4M7KH 3QRGH 2YPKA 1EAPA 3HNSH 3WHXA 1HOCB 1IE5A 5E4IA 2W92A 3S88H 2YKLH 4ERSH 3RJDA 4OCXH 3BX7C 4JHAH 5I73B 2D3VA 1MCQA 4JM2C 5DUPL 5LJYH 4WHYH 3AMKA 2ICWA 3VA6A 1D6VH 3FRPG 5DMIL 3RDTC 2HKFL 1N8ZB 4IMKC 3HFMH 2MCPH 1LK2A 2VIRB 2UYLA 5EWIL 1RURL 1MHCA 4I18B 4RQQB 2X4PB 4RFOH 3G5XA 2QTEA 3BDYL 2BP3A 5GJTH 4NQCE 2BSRB 1IKFH 2ICCA 2Y9RT 4O02L 2AKRB 4W4NA 3SKOB 1TIUA 1K9TA 1G9NC 4PGBA 3QA3B 3MXVL 3LAFA 1IC7L 1AR1C 2AV1B 1B0RA 2F9BT 1HQRA 4JREB 1TZHB 1UH2A 5IVXA 4LSTL 5HHMB 1FIEA 1UM4L 1OB1A 1Q9OA 5GHWH 4GW4A 1UQSB 3ULUD 4FFYH 2P49B 1X5XA 1B0WA 4HUWA 1I1FA 1OW0C 1MNUL 3BUTA 5EA0L 4KPHL 3ILPA 3WFBL 5T3ZE 3GSRB 1WBXB 3DV6A 2BFVL 1NL0L 2FBOJ 3DHJA 4O9HH 2VITA 1T2QL 1MWAA 1PLGH 3TYGH 3MLYH 4ELKB 5DK0B 5J13B 5GRVK 4D9RE 4UTBL 4LSQL 4PREB 5BXFA 2BVQA 4GKNB 4LCYA 4NN6B 5F7WC 3QWOB 1R3KA 4XP1H 3RAJH 2W38A 3D3VB 1S9VA 1CFSA 3F7VA 2Z8VC 4NRZB 4OCYL 2EXYD 5JHDB 1G1YA 3GRWL 1MCLA 2OI9C 4NHCH 1KEGL 1B3JA 1CWVA 1CDYA 6FABL 2ADIA 5CJQL 2OK0H 5KOVC 4XC3L 2Q7NA 4M9OA 1HDMA 2OTWA 1TTUA 1K2DA 1A22B 3I9GL 5D7LB 3L9RA 4NNYA 3UTSB 3W5MA 2DQHH 4FQLH 5SWQA 4FQIH 3B8SA 2FJFB 5EO0B 3T04D 4PRIB 2D9QB 4LDLB 3TO4D 1BPVA 3UJTL 4FFZL 3RL2A 1INEL 2ESVA 2H2SC 3MGOA 1RUPH 4KY1H 4S1DD 4BSJA 1QR4A 1IL1A 3ISWA 4D8PA 4FABL 1EIBA 3WDJA 2OLDA 3RWDA 4N1HB 5D70H 5BJTB 2XG5A 4LKXA 4PGJA 2EC9U 4PJCE 1AGBA 4OLZL 3L3DB 3TZVD 2YC1A 4UI2A 3U9UB 1JN6A 5IFAH 1V7NL 3GIZH 1FFQA 2WBJB 3MJ9A 4OUUA 2HH0L 4P59H 3ZYJA 1SQ2N 1A8JH 4OQTL 4Z7VA 3D5OF 4DGIL 5FO9B 3B6SA 2V7HB 3RWIA 2NZ9D 5ETUB 5AG9A 1J18A 4LHUA 1FH5L 1UCBL 4LDOB 5FHBH 5DVOA 1OP3K 3LKRB 3MACH 5IMOB 4C55A 1NGYA 1ZMYA 4LMQE 3SQBA 4ZFGL 5C0BE 2HT2C 3TFKC 1SVCP 2ZOLB 3D39A 1RIHL 2GSGA 1F00I 3M17A 4G6FB 3K81A 1OW0A 5L9DL 2ORBL 3SN6N 5L2KE 5EZJA 2RQ8A 5BV7B 1NDMB 5D7IA 1QVOB 1UT9A 4U05A 1CFTB 3C08L 4RAUA 5I1IL 3DRQA 4NQDD 3V8CA 2JK5B 4K7PH 1V5JA 3ZSSA 1RUMH 2J8OA 5CSGA 3ZKMD 3WUWG 1A3RH 2PCPB 5GS0L 3A6OA 4NQSA 2IPKB 2CDGA 4O2EA 3U4EB 4LEOA 4EZMA 1I1AD 3GO1H 4PJIF 5J12C 2W9EL 4G8IB 3LV3B 3EOAB 1BOYA 2X1OA 1DUZA 4MZ3A 4LKCA 5KOMC 5EZOL 4P2RE 4YPJA 2O61A 4HWZB 3ARFD 4P3DA 3GMNA 3L3KA 3GFUA 3KPRE 3T77A 4MNGE 1QFWL 1QLFB 1FCCA 1AC6A 2J2ZA 5LQBH 3LKQA 3HI1A 5FV2A 3UO1H 1FL6B 3U0WL 5BW7C 4XWGH 5HHPA 1HIML 3O2DL 4NFBA 4G3YH 2CK0H 5KW9H 4CJ0A 3UZEA 3ZYZA 1KCUH 3TBSA 1HQ4B 5B38A 1WZKA 3ZDZE 3BDBA 3TH3T 5IEHA 3SKNB 5JHLH 2BVTA 5DF0A 3WL9B 2LU3A 3EJZD 1A7PH 1AGDA 4PRHD 3TJEH 4YHNB 1BX2A 1NCNA 4UB0H 5JZ7C 2EDQA 3D9AL 2CUHA 3BP5A 2CLZB 3S7GA 3JV6B 3ZHDA 3WYRA 1F5WA 3UEZA 1T6VN 4OV6F 2ATPA 3IDMB 3H7LA 5SWZE 3ARZA 3KHOA 5TQ2H 1AXSB 1IGJA 4YH6A 4HG4J 5C6TH 1CIUA 4OM0H 4X6CA 3SEPA 3UMTA 2Q20A 3CK0L 3UTQA 5E2WL 2ZUUA 4PJFB 2XZQH 1P7KB 3EKCA 1KENH 1PY9A 1IAKA 3E6HA 4KGJA 5TE4H 5FV1L 1FRGL 2OYPA 1G7PA 1QBLL 4Z9KB 1MREL 5EFIA 1JHKH 1MCOL 1D9KC 1TXKA 1TVBA 5DK2B 3MV8D 4GQ9H 4S1QH 4HF5H 1MFCH 3OKLA 1DEEB 2UWEE 1KV3A 5CGYD 1MF2L 4HJJH 4FQCH 1ZEAH 2H32H 2HT4D 2R9HD 4DQOL 4XHJC 1S7SA 1GIGH 4OD2A 4AT6A 2ZUVA 4PV8B 3BRGC 2WK2A 1ZVSB 1FP5A 5I18H 1KJMB 4CU7A 5JMRA 3P0VH 4HBCL 4P2OD 2J4WH 2W0LA 4EBQH 4P5KB 1T4KA 4XAWL 4HSQA 2EXWD 1R5WA 2AJXH 2NXYD 2EDFA 2XG4A 3CDYA 1AQDA 4TNWK 5BS0B 4D0BA 4OZIA 5KSUA 1AC0A 3MRJB 1NPUA 2DQUL 3QO1A 4YXKL 4M00A 4TUOA 3P11L 1IAII 3O3UN 4U6TA 5E8DL 5C0NC 2J8HA 1WFOA 4K2UL 4Z5RB 2FEDC 2ZOKA 3DURA 5I8OH 5BW7A 4HCRH 4URTB 1LO3L 4HIEB 3FO9B 5I8KL 2XTJC 3P0YL 3QI9B 3QULB 1ZLSH 4YLQT 2O5YH 2NCMA 5HYEA 2J8UB 3TNMB 2AVGA 1MH5A 2ADJB 1X5JA 3O3DA 4U1SB 1CL7I 4G7VL 5D1XC 3UC0H 4HD9A 4J3SA 3O4LE 1U91A 4K7FA 3WFEH 5ITFB 1W0VB 2RGSA 2QLVB 4YXLL 3NIDF 1P4LB 5GIRB 4Z7QF 1FZOA 1EFXD 4V2CB 3MRLB 3H3KA 1AIFB 1BBDL 3PHOB 2AGJL 1S8DA 4N8CH 3UAJD 1X5IA 5EOQH 1JIBA 2D03L 1YA5A 2BOBA 3NBNA 2DKSA 4OT1L 4YZFF 4F7CA 1CN4A 3KPMB 5E00B 1C5DA 1T1WA 1QNZL 3BZFA 2J6EA 4RAHA 3O2WL 4OZHA 3MRQB 1RU9H 2CDEB 2QEJA 4HIXH 3QIUA 4HJGA 4OLEA 2DBJA 2NW3B 1WSST 4JM2F 1N4XL 1QYGL 5A2FA 3AU1A 4UZGA 2B5IC 4Q58C 3SE9H 3O41B 3VFTB 4IOIA 1RZKC 3VFSA 1TENA 5C0CD 3KYNA 5DQJB 1A47A 4LNRA 4M5ZL 3QXAB 1NDGA 1UENA 5CEXB 2NY7L 1MUJA 4M4RA 4J12A 2X4NB 5E7FA 1CXKA 4IOFC 4F57H 5IVNA 1H3WM 1Z9MA 3G9VA 3MOAL 5DD6B 3C5ZC 3FOLB 4WV1B 3QIWD 4Z7VF 1T1YB 3MFFB 4XWOD 5K9JH 1Q9WA 3DGCR 4OLVL 4XX1E 4ELMB 3MBXH 3NA9H 1CGSL 3REWB 5ID1B 4PJ5E 1ORQB 4HULB 4GJTB 4MCZB 4U4BA 3V4VH 4XVTL 4LIQL 3MLTA 1GZPA 2IADB 2X70B 3WFDL 1JHLL 4U1NA 1R5VA 3MLSH 1VKXA 2PO6D 1JV5A 4PGZA 2VDLL 4HKJA 1QLEH 4Q9QH 3GM0A 5INCB 5ACZA 2R1XA 3DIFA 3ROLA 3DYPA 3HC3L 4RFNC 4OUOA 3TN0D 4UNUA 4P49A 1W8NA 1JUFB 3W5NA 5DS8B 1RJYA 3CIQA 5I1AA 4JKMA 1A3LL 3GRWA 1NAMA 1T0PB 2BDNH 2CO7B 1RZIB 1IQDA 5D1XA 4G9FA 5E8EA 4ZS7L 5C1MB 1JPSH 1C16B 3RFZC 2BC4A 3PDOA 1A1OB 1LP9B 3Q3GA 3OB0K 3UTTE 4PJAB 5F1NB 3OXRA 1MQKH 5GGTH 3ZT6A 2WUCH 3KPNA 5DHYB 1KXQE 3ULVL 3U82B 1MY7A 4DEPC 5C08D 1MHPH 2VH5H 2DKMA 2XKSA 3EJYC 5J8OA 3BSZH 1FNEA 3DUUB 2FX7L 2VDOL 1M05B 4X4XA 1YN6B 3DXAA 2FGZA 4N9OB 3QUZC 5EC2A 2APXA 4YE4L 2VDPH 1W0WB 4OQ1A 3O0RL 2HFFA 1FVCA 5FUZL 3W9EA 5DD0H 3U4BL 1DQML 3Q5YA 3MLPA 4NUGL 4OLUL 2P43B 4GG8B 4AMKL 1Z2KA 1EDQA 1R0AH 4G8GE 3S36H 2CDFA 2PXYD 1EH9A 2C7UA 4XMPL 3SDDB 4Y16B 4IHOA 5CILL 3VXSD 5GSRB 5AWNL 1BQHG 5DC9B 1U41A 5L2KD 3T2NH 4RDQF 1P84K 3BKMH 2CR3A 2VWEE 1FLTX 5DT1L 4P4KB 1Q0XL 3OHXA 2HRPH 3OJ2C 5EO1B 4AG4H 5LGJA 3RVVD 2FIKB 2GAZA 4RGMC 4PJ7B 4AL8L 1NFDA 2DLIA 5C0JB 3LQAC 3LN5A 4M02A 1OHQA 3OR7B 3RTQD 1K8DB 4QRQB 2IANB 2J3SA 2HJKB 5CJXA 4FZ8H 1KGCE 2XFXB 3BO8B 4U3HA 1GOFA 4I48A 4HWUA 5F97E 2GK0B 4P2RD 1QFUH 3PWJB 5LKNA 4ZQKB 4BKLA 1U8NA 5HHOE 3SPVB 4JR9L 3WIIL 4R90L 1P2CA 1KIPA 1OP9A 4N5ED 4PJBE 2ZCHL 2ICEA 2MKWA 1ZK9A 5J7CC 1ODAA 5E9DA 4JO2H 1N5YH 4GXVL 2BSTA 1UJ3A 4P9HH 4ZFZB 1CFVL 1FSKB 4DOHB 1K5NB 4X6DA 2Q6WA 1QTYT 4OB5L 1E6OH 1R3LA 1IGIH 4IRSB 2JF1A 2EO9A 3X14A 1R24A 4FXKA 4JAMB 3KDMA 4OIIL 4A6YL 5I75B 3QIBD 4MB3A 3NPSC 4S1RH 5FK9B 2NY3D 1HHIB 1AR2A 1OLLA 4NKIH 1RY7B 5DRZB 2H26B 4WUUB 3WLBA 4DAGH 1RD6A 4HFUH 5EU4B 3O2DA 3A6BH 5A2JH 2ZCLH 4OCMC 3VXOA 5F88B 3QDGD 5HGAB 4RZCB 1JPGB 5T5FH 1I9RH 3LEYH 4HKZB 4WW2A 4GW5B 2K1MA 2VN4A 3IFNH 3ULUC 1AXTL 4Z7UE 1MVUA 3SDAD 1JPFA 2WUBH 4K8RH 3BQUD 1G6RL 3QUYD 4Y1AD 2BVOB 3CXDL 4XP5H 4XVSH 4OJFH 4ODSH 2DM2A 1SEQH 4BH8A 3G6JF 4KZEL 5IB3A 1LMKA 3RJQB 3SY0A 3KLAA 3VWJD 2MHAA 4PS4L 2Y06H 1BIIB 4CDHA 1U3HA 4WUKH 3TBVB 4DJMA 5IB5A 3MRHB 4G43B 5B4MD 3D69A 2VR9A 2Z93B 3NH7H 4KXZI 5C07A 4P48A 5H94B 3JV4A 1SJEA 4HUVA 1B9ZA 1I1YA 4PY8I 4WI5A 2Y5EA 1INQB 1IQWH 1K85A 3KPLB 2EXYC 3U0TA 1I7TA 4PRDA 2GIYA 3FB6A 3S35L 4UILH 4PG9B 4M3KB 1UM6H 3G04A 1YEEL 1UACL 4PP1D 4OZHF 5JMOC 1GGIL 3WUWB 2ARJA 2X1QA 5CEZE 1NCBL 2AXJA 1J05B 2X89D 3MV7A 1IJ9A 1UJTA 1MFBL 3AFLA 1NLBH 5IMMA 4G6AD 4S1DC 3C60B 4RFEB 5FFLA 3C87A 3L5XH 2G75B 4XNYL 4GUPB 2AV7B 1ZT7B 3IF1A 4PJ9B 1GOHA 2PNDA 1XR9B 4LGSB 1DLHA 2EE6A 1LEIB 4ACPA 4PR5A 6CGTA 5FUCC 1E4WH 3G5YB 4TVPH 4LF3A 4Q6IC 4JN1H 5JXAH 3TZVC 4S11A 2IH1A 3KYAA 4BK5A 4C83B 3VCLA 4Y2DB 1LWRA 1FYTE 2AJUH 1RUAL 4ZO7A 4AH2B 2QKIA 5DR5H 4GFTB 5T3ZL 1N0XL 1QBML 5C0FB 1HXMB 5DJ0A 2DL2A 4KKAD 4XGZA 4DKFH 1WC7A 4JFFE 4JPWH 4FQXA 3QEQB 3TWCL 3JWOL 2JB5L 2DI9A 5HYQA 2HVKA 5J4MA 4O2CA 1M1SA 2LQRA 2YBRB 4OZGE 3AAZA 3DX7B 4U1IB 2D0GA 3IFPB 5DWUL 3UROR 3WXWH 2IBZX 3BKJL 4R7NB 4JQVC 3GMRB 4ZOEA 3ZHKA 4L9DA 2MJWA 4PLOB 5SWSB 2KQNA 3HC0B 5D2LF 1G0YR 1VDGA 1AO7B 1RUKL 3BXNA 3ZE1F 3ALWA 1YEJH 1I3RB 1ORSA 4JEGB 2HFEB 4UUJB 3ZKMC 5ERWB 4S2SB 4LSRH 3NCFB 4YUEH 2ZPKH 3T0AA 5DHVB 3P30H 3QPQD 1U8QA 2C4FU 4BFIB 2KL6A 3U46B 1I1AC 1IEAB 1G7QA 5SV4A 5ICYA 1KLGB 2X9WA 4KQ4H 1U8PA 4AEHH 3MXWH 4YEEA 4Z77A 3VXME 2AK4E 3F5WB 2OR9H 5I17B 3T1FA 4ODXB 3ARFC 5EU6E 5CKAA 4G8FB 4LLQA 1PYWB 2MOVA 3SCMD 3KYKL 4PJ5D 5J6HA 3MLWH 4AYFA 1JWUA 4LCWB 4HKBB 2P8MB 3HI6L 1ZT1A 3EYUL 4YFDB 3HCVB 1FFRA 5HHMD 4N9GA 3TO4A 5DC0A 1V3MA 3BZDA 5F7KC 5LAXA 4P46B 1QZ1A 4QTIH 5BQ7A 1P1ZB 3V2AR 3L6FA 4HBQA 4QEGA 4M1GH 3MA7A 1C7SA 1J9CT 3EJZC 1IRAY 3JTTA 3L3GA 2EE3A 3BEWB 5HHNA 1H3TA 5C0DB 2V2WA 3SDXA 4XAKE 4LFHG 4CVUA 1OP5H 2YD9A 3STZA 2FSEB 4ZPTB 5GGUA 5KVDH 4RISH 2OBGA 3TZVA 2VZOA 3FB7B 5MERB 2A0LC 4YDIL 1AJ7L 1VGKB 5DHVH 2F8XC 1V7MH 3D3VD 5FUOL 1IZJA 3THMH 1A4JA 5IB4A 3PQYA 3VDCA 4MD4B 1TDQA 1C12B 1KG0B 1U8LB 5JHDD 3IDGA 32C2A 3HR5A 4UT6L 5BMFL 1YY8A 4JZOA 2CGRH 3MNZB 2I9TA 5DDHA 1IGTA 4MAYD 5GS2H 5D7LD 3M8OL 5KSAB 4NHUB 4R0LC 2NYYD 3UTSD 2BXYA 3GMQA 4JQVA 43CAB 1VGEH 3WNNA 4LOUD 3VFUA 2VXTH 4UOW0 4X6DF 1RULH 3VMPA 3JBG7 5ACLA 3RKPA 4GH7B 4M7ZC 4TSAH 1N64L 2GJZA 4JKWA 2DQIH 2C1PA 3DSFH 4L3EB 4P2QA 5CGYC 1BFVL 1HSAB 4Q9CA 3M45A 4JG0L 1K6QH 4NQDA 1H3PH 4P57B 3RWFA 2B2XH 3TBYB 4GKSB 5DFWH 1T22B 3HMWH 4G8EA 5D6DC 4XNUL 1S7UA 4QRUB 1K4CA 1PQZA 4EN3B 4I3SL 2P42B 3BD3A 5GGSA 1TVHA 1NQBA 3PWVA 2Q7YB 5I1GH 1UXWB 1SYSA 4YK4B 2CQVA 1A1NA 5D7KE 1TZGH 3K80A 4EJ1C 1A7OL 3PWPE 2WBJD 3VGHA 3T2PA 2NXYC 2VL5A 4X98A 1H3XA 3LRHA 1OY3B 3ARFA 35C8L 3DX8A 2VKWA 4RX4D 5DTFA 5E1AA 1UYWL 5DUML 3NABL 2VDMH 3IFOA 4QHLA 1Z5LB 2R0ZL 4JFPA 2DM7A 4DUXA 4RMSA 1HH6A 5HI5D 1CTOA 3RNQA 3CX5J 3MMEB 2W9DH 4KUCD 5FF6B 1BP3B 3UJJH 3CD4A 5JR1H 4O58H 5IQ7L 5L7XL 4U6XB 3BH9A 3HMXH 3AXLA 1T83C 3U7WL 2VRAA 1H5BB 5CS7A 4PRHA 4MA8H 4ZSOA 3WS6A 4MDIB 4R6UA 2O5XL 4L4TE 4C59B 1XGYL 1CGTA 3DPBA 3PGFH 4B50A 2NY1D 2BNRE 1Q0YH 3G6AA 3QUXD 3SGDI 2EH7H 3T8XA 4DVRH 3RGVB 1D5MB 1S78D 3WNLA 2EE2A 3MRGB 4WEUD 4LSPL 2V17L 4MXQC 4M8QB 3UAJC 4IMLA 4HLZG 5IQ9A 3V52H 3NZ8A 2BRRH 2W9LA 5CFHA 5L8KB 5JW4M 1DLFL 3OAYH 3TT1L 3ECBB 3QUMA 1TQBC 3B2VH 3C5SB 4P5TC 1MFDL 1RVFL 4GO6B 4Y5XC 1NCCL 3BMWA 1YN7A 5D1QB 1QSED 4U1GB 2D7OA 3FB5A 1TQCC 5IBLC 5LGHL 1N7ML 2E7LC 4HDIB 1AD0B 4X7SH 1L7TH 2PUQT 3MV8A 2J12B 1CZ8H 3P4OB 4I5BA 3D25A 5D8JL 1BMGA 2O5ZL 3RWHA 4HPOH 4GXUM 3VFRB 1BOGA 5FKPB 3QFJB 1EX0A 2NX5E 2ZNWA 1VFAA 1T1ZA 4FOMA 1T5XB 2H6PB 5MEQA 3QIWC 1RK1A 1UWGH 2Q3ZA 4PJEA 2XPGB 1DZBA 2GT9B 5D6DA 4MJIB 3AS1A 2OJEB 1PG7L 3TO2B 4YHKL 1BFTA 4P2OA 3RUGF 3BGMB 4Y19A 5L6YL 4R7DB 4O2FB 4R97B 2CLVA 1CFBA 3QT2A 1BQHB 5IJKA 3U9PH 5HHXL 2NXZB 3D0VA 1SMOA 4XCNB 4CVXA 2R0LH 3ULUF 4JRYE 2PO6C 2EDWA 1MVFA 2VLLB 3L3HA 4IBLT 5GRWA 1JP5A 5BRZB 2FB4H 3B3IA 4X7FC 3QAZB 5ECJE 3Q5OA 1F58H 2R4RL 1IAOA 1SEBA 3TN0C 1BZ7B 3WFZA 1EA9C 2VLJB 4M7JH 4D0CA 3FQRB 5EU5B 2H2PD 1T83A 3W0WE 3ZDXF 4BZ2L 4HK3N 4JDZB 5CBEA 2X7LA 3O6MH 4KAQH 4TQEL 4XBEH 2W0KA 1GHFL 3MNWA 1FV1B 4DZBB 3TIEB 1EFXA 4RMRA 4R96A 1IM3B 1E27B 3EOTH 4NNPL 4ORGB 4DN3L 3JV0A 1A7QL 5I8EA 3FL7A 1U9KA 2OJZH 4ONFL 4NC1E 3IJSA 2EDBA 5FDWA 4OGYH 4F7EA 2VLKB 3DVGB 3QEGL 4RMVA 1CFNB 3VRIB 1IILE 4ONGH 4D3CL 4PGEA 3O4OC 3TIDB 4HUXA 3PUCA 2OXGA 4JHWH 4Y5XA 1H3UA 1Z6JT 2H9GB 4PY7B 4TRPH 5EIIA 1JNNL 2PXYC 1CXHA 2YPLE 3T3PF 3P77B 2Y5TB 1XGPA 1HKLL 2XN9B 1FFPB 2R56H 3HG1E 1HHGB 1L9NA 2E7LA 3SDXF 5C0CA 12E8H 3VFVB 3DROB 3B9AA 2M2DA 4QT5B 5CEYA 3W9DB 1A5FL 1DJSA 1WWCA 3BWAA 5JW4R 3BWUC 1ZANL 1EXUB 4FTVE 3RVVC 4BSWA 3QIWA 3SE3C 5MENB 3KPPA 4IIQB 3MRMA 1BGXH 4ODHH 3GSOA 1F97A 3RTQC 2J7LA 5H35B 5IESH 1VHPA 1X4YA 1KJ3H 4HFWA 2EH8H 1CDHA 3OMZA 1MCPH 1JCKA 3VXMD 2AK4D 1NGPH 5CGMA 4PRAB 3NN8A 3VXPA 2P5EE 3EO0B 3EDEA 25C8L 1J88A 5D5ME 4N5EC 2WIIA 4PGDB 4UIMB 1L6ZA 4OFKA 4WFFD 1MFAH 1PBYA 4LP4A 4N68A 5FYJH 4QHUB 3QZWA 5LGKA 3VJ6B 4TTDD 5EO9A 3OJMB 4NO3B 2FNBA 1FL3B 4P23A 1U8JA 2Q8BL 1ZSDA 5AYUH 1N26A 2OMBA 4DW2L 1S7XA 4ZTOL 3QIBC 1HILB 3SKMB 5CWSA 1CF8H 2AEQL 1YJDL 4KVNL 2NY3C 1B0GA 2GITB 1EHNA 4LK4A 4POZD 3PNWA 4XAKD 5CD3B 3G5VB 5CIPA 2UUDK 3DMMA 1FNSL 1DE4B 5AD0B 1NCAH 4NCC1 5EUOA 5ITBH 1KB9K 1Q38A 1GGCL 4JFYA 5C08A 1ED3B 3BJLA 1BWMA 4YDJB 5I6XC 4NPYA 4U6YB 4PB0L 1J1XH 4I4WB 3LS5H 5CKGA 4OLWL 1G7MA 3CFCH 4FQ2L 2OL3L 3MV9B 3K2MC 1F3DH 1RZKL 4PJXF 1EPFA 3SDAC 3C09B 2YEZB 2IQAA 2ZJSL 1ZWIB 2ILLA 3QUYC 4CMMB 3OQ3B 1TJIH 1C08A 3F7PC 4I0PC 3MLZH 2PXYA 4FQ1H 4OIBA 2P5WB 3MOQA 4PGCB 3VWJC 1PEZA 5TH2A 5JO5A 5F1KC 2H8PA 1MIEL 4UV7L 2B0SH 1YEHL 2YK1L 4M62H 3ARUA 5GSVA 5L2KA 5B4MC 1QA9B 1XH3B 3GNML 4XPTH 4K3EL 2FHBA 1NCDH 3PV6A 3AY4C 1EAPB 3ET9F 3WHXB 1OM3L 4X80H 4MB5A 4P4RB 1NC4A 3GHBL 3SE3A 1NEZG 1RHHA 2R29H 1TJHH 3VXUE 3LS4L 3RTQA 5FHAH 1J12A 4PP1C 1D5IH 1SM3L 1Y18A 4DFIA 3FJTA 2ICWB 1Q9KA 3V0WH 5F6HJ 2F53B 4P2RA 1ZTXH 2Z8WC 1LK2B 2UYLB 4G6AC 1MHCB 2J5LB 1ADQL 1DQJA 3KPRA 1DBKH 3G5XB 4MNGA 5I2IA 3WBDA 2F5AH 2D7PA 1F6AA 1CT8A 3WNMA 4PGBB 1W72A 4HEPG 4K7PX 2VUYA 1B0RB 3I85A 1N6VA 3BMVA 3ILQD 2AK1L 4Y16D 1UC6A 4PJEF 3WV0A 3RWGA 5JPNB 5IVXB 3HE7A 2OZ4H 2DBLL 4X5WA 3S5LA 4WHTA 1OB1B 1Q9OB 1OP3H 3CDCA 1F4HA 4GW4B 2Y23A 3GSNL 1HZHH 4HUWB 1HINH 3QIBA 1I1FB 1OD7A 3BDXA 4L4TD 4R4BB 2NW2B 3LEXA 4I13B 4KKAC 4F9LA 1GRWA 4M48H 3WNKA 1JI1A 1A6AA 3DV6B 1E28A 4XPFL 2VITB 4JPIA 4Z76A 2X2YA 5D7SL 4ZTPL 1MWAB 2EEBA 3QDGA 4X4ME 1RK0A 2WNGA 3BD5A 4OBSA 3P9WB 2IAND 5FO8A 1NMAL 2EZ0D 4IRZL 5JUEH 4X7DC 2AABL 1NAKL 3GK8L 4LCYB 3L7EA 4K8RD 4QF1B 3NCYS 3PP4L 1XGQA 5LXGL 1R3KB 3NCJL 1CD1A 4U7SA 5BO1H 3BQUA 4Y1AA 4X9IA 2QQNH 1MFEH 1SMAA 1S9VB 1QACA 3R0MA 4OD1L 1CFSB 1GAFL 3F7VB 3VI4E 2UZYB 3UYRL 2I60L 4FQQB 1MJ7L 5I73C 3V4PL 4DN4H 3UDWC 3VWJA 2ADIB 3GIVA 3NGBB 1F13A 3P9MA 4MJ4A 3GB7A 2EICA 4M6ML 5F44A 1LK3L 5JTWA 2OTWB 1K2DB 1CFQA 4GAGH 5CEZL 3L9RB 2UWEA 1UEYA 4NNYB 3QPQC 3IAGC 5SWQB 2JJUA 3IXTA 5FDYA 5FYJU 4HX1B 1UWXH 4LPUA 2NX5D 4JFZH 4IRSD 4I18C 4QXGH 3MRPA 3RL2B 3VFMB 2HYMA 1NJ9A 3MGOB 3CLFH 4NCDA 4NQVA 4N90D 4HS6A 1IL1B 4D8PB 3SCMC 1A14H 1B88A 1CDJA 3D87B 4WUUD 1NKRA 4NFDA 1S9WA 3RWDB 3V4UH 4JREC 4LKXB 3J7HA 2X89A 1AGBB 3U48A 1JFQH 4Z8FH 2D0FA 2YC1B 1Z3GL 1JN6B 4NZUL 1TCMA 3H6JA 4EI6B 1I9IL 3UZQA 1OOAA 1CD9B 4J3UA 3BW9A 4QOKE 3KLHC 1WAAE 1X6LA 3FO0L 3B6SB 1OF2B 3RWIB 2OQJB 4LHUB 4ODTL 4YHOL 3L3OA 4PJGB 4TVPD 2XZCL 4X5XA 2AI0H 3B2UD 3MNVA 1JNLH 1CXFA 5CLWA 2XICA 5EPMA 3RVWD 4RA0C 1IAMA 3D39B 3EUUA 2GSGB 3I6LD 3M17B 5L8LB 1QSFE 3NZHL 3RKDD 3WMSA 1EO7A 3K0WA 3MLXH 1PZ5B 1AGEB 1ZVHA 2QQKL 4UDTA 1JYXA 3GMMA 1KCVL 5D7IB 3W2DL 5B39G 5ILTL 5L2JB 3DRQB 3CSYA 1SYVB 5DXWA 4MAYC 4TOYL 1F8TH 1T03L 5JQ6L 4YQXL 2NYYC 1H15B 3OZ9H 4EVNB 4XPAH 5F7EH 4OFIA 1MJ8L 2G9HA 4MNHB 2XZAH 4O2EB 3REVA 3WD5L 3S4SG 4JQIH 2DQDH 3QJFA 1WZ1L 4G80A 4NZJA 3O3AB 3C60D 4KMTL 1DUZB 3WN5B 4LKCB 2OI9B 3SOBH 3UDWA 5KN5A 3EFDH 4PJ9D 1UVQA 3L3KB 1W2KT 3I2CH 4X9BA 4AEIL 1KPUA 3SJVE 2RCSL 3LKQB 5EUOF 2VAAB 4UOW1 2VWEC 1BF2A 1N8ZA 4MCYA 5E2TH 1A2YB 3MLRL 2NQCA 1QPXA 3ZKSD 4G9DA 3PL6D 2XIDA 3MODH 4Y2DD 3C6SA 5J57B 2CKBL 2WBJC 3TBSB 4KK5D 1EHAA 5IEHB 2AKRA 1PD6A 3JTSA 3X3GH 3QA3A 3SCMA 2E8YA 1AGDB 5EUKA 2AV1A 4PJ5A 2YRLA 3QEQD 3KJ6L 4WI4A 5IR1A 1U6AL 4Z95L 1TZHA 4F9PC 5HI5C 3NAAL 3CVIH 2LVEA 4GAYA 3BP5B 1X9QA 5F7UA 3BN9D 3LDBB 1DSFL 3QFDB 3O3EB 1OAXL 2ATPB 3QHFH 1S9YB 4M6NH 4CAGA 3T0DA 1NCTA 1I8MA 4ZUSB 3H2WA 2FZ3A 4MB4A 2ZNXA 4HLZH 1WBXA 5SWSD 2AJSH