2R4RL

Crystal structure of the human beta2 adrenoceptor
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
214
structure length
214
Chain Sequence
b'DIKMTQSPSSMYASLGERVTITCKASQDINSYLSWFQQKPGKSPKTLIYRANRLVDGVPSRFIGTGSGQDYSLTISSLDYADMGIYYCLQYDEFPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-2 adrenergic receptor
molecule tags Signaling protein
source organism Homo sapiens
publication title Crystal structure of the human beta2 adrenergic G-protein-coupled receptor.
pubmed doi rcsb
total genus 45
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2007-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r4rL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r4rL01
4MA8L 4LDLB 1D6VL 4OZHE 2DB8A 5DMIH 3HZVA 5IQ9B 4L4TD 3IDMA 1I1AC 1P6AB 4KJYA 1HNFA 2A38A 4V1DB 3CFDB 2JJSC 3TT1H 1GGIL 3JTTA 5EO9B 1C08B 2XOTA 3SDAD 3N50A 4M7JH 4HKBA 3BEVB 1LE5B 1CQKA 1NJ9B 5GGUA 3QHFH 2VL4A 1GSMA 2I07B 5EIQA 5A16B 5HTSA 2ADGA 1EEZB 4GAJL 3DXAA 4FQXB 1IVLA 3VWJA 5B8CB 1SJEB 4I0PD 1U3JA 3F65A 4ZS7H 3TJHD 2P8LA 1IE5A 3MCG1 1FC2D 4MDIA 1KFAH 5LCVH 1CDJA 5FA3B 3SKJL 3VDAA 1G9NL 3CH1B 1ITCA 5E8EA 2AV1A 3W2DL 4YWGL 3FO1B 5J11C 1M7IA 2A83B 2X40A 3SDYH 3VGAB 1NUDA 2VZ3A 4LOUC 3QFDA 3QJFA 4LNVA 4MMZC 5EWIL 3D5OF 4Z7WA 4LEOB 4D0BA 4D9LH 2DAVA 3WFZA 5I6XC 4LVEA 3KPPA 1E4JA 5HGHB 5JW4R 1W0VB 4P2OC 3C5ZA 2ZCKL 2XY1A 1XIWB 4WHTA 3GDBA 4NRXB 3GMOB 1I8MA 4ZODA 4IOSD 3VJ6B 1JZ8A 3MTRA 2ESVD 4OZGE 3O11A 1OP3H 1KJVB 4WO4A 3T8XA 1ZKAA 4G80A 4G8GB 1TDQA 3P3YA 1KJMA 3GK8H 1U6AL 1DDHA 1RIVL 3HPLA 4TNWK 2AXGB 4RFEA 2WBJD 4OZGF 5T1LA 5T5NF 4NM8L 3JUYA 4N0YL 4DJMA 3CDGB 5F6HI 3HE6A 3B43A 4LVNC 2Q3AA 2YD9A 3RZWA 2EDWA 1BBDL 3PQYD 4JFOA 3BUYB 4XPTL 4ZFOB 3SDCC 3OJDA 4N5UA 2J4WH 2Q3ZA 1E6OH 1TCRA 5IUSA 4S0SD 5EWIH 2PF6A 1I3UA 3RX7A 5DQJA 5HDOA 2ZUYA 3QIWA 3D39A 1CXEA 3MROA 3BGMB 2AV7A 1U42A 3D1MC 3QEHA 4ZFGL 2FBJL 2PTVA 3RZCA 3PNWA 1EUTA 4QYOB 3DV4B 4F7TB 1X7QB 1SEQL 1HXYA 1Y6NR 5E9DD 3C2AH 3WSQH 2R8SH 4K8RL 3VH8B 2XG5A 4N1CA 4RFOL 5F1NA 3KLHC 3HE7C 3OBAA 1A9EB 2DQIH 2DQHH 3G08A 5DQ9A 5JOFB 1K8IB 1MFAH 1OTUC 2AJSH 5IJVB 4HIHB 5CBEA 3IXTA 5LG1A 1WZ1H 2VITB 4YXLL 4LPTA 4NBZB 1CFVH 5LBSH 4QNPE 7FABH 5J4MA 4Y2DC 3W0WD 1YDPA 5KS9E 3ARBC 1JF1B 2XY2A 2IH3A 4MA8H 4X6FA 2BSED 5BV7L 2BOCA 3FQRA 4LCWD 5E5MA 2ZG3A 3WFHB 4O51B 1CK0H 1I8LC 5EFIA 5T3ZL 4CDHA 3LS5L 1U3YA 3PIQA 5IB3B 2NXZB 2H1PH 1YN7A 4M7LT 3SGKC 2HG5A 1JHTA 1NC2D 1DUZB 5JHDB 4NBYB 1A7QL 32C2A 3OHXA 3O2WL 4AY0A 4FQ2H 3MBED 4PRHD 2MWCA 5HJ3A 1UENA 4PRAB 1GZQB 4ZSOB 3DETC 4J3XA 4X8XA 2R29L 3CLFH 1EHLL 3OSKA 4MA1C 4KKLC 4OLYL 3MQIA 3LIZL 5H37G 1PEWA 2FIRT 2GUOA 4LU5H 4EI5D 4ONGL 4YC2B 3VG0H 1KIRA 3LSOB 4UIKH 5I76A 4POYA 4NC1C 1I7RA 2EIEA 4LF3A 5E5RB 4QT5B 3L1OH 2DF3A 5F7UA 3ARGB 4KI5D 4QXUH 1X4XA 1DEEA 4PJ8A 1FL5A 1H5BA 1TETH 4L9LB 3SJVE 1WCQA 1Z5LB 5L2JA 5A43C 3KPSE 1UEMA 3WXVH 3IJSB 4PJDA 4ZUSB 3X3GL 1AQKL 1IEAA 4AH2B 1CGVA 2GSGB 1KELL 3VU2A 3CLFL 5JPMA 1PG7W 4Z77B 1CS6A 3U9PH 2H26B 4ONHB 4TUOB 1NGYB 4CJ0A 4G6FB 3BGFB 3GMOA 3KXFB 5I30L 4PUBL 1OWRM 3GSXB 1VB9A 1YN7B 2H6PB 3MRQA 4OV5B 4HJGA 5ICYB 3IDYC 5CEZE 1QLFA 3HAEG 4G7VH 4LLWB 3TVMC 3UO1L 4JE4B 4KVNH 3CVIH 5E2WH 4L8DA 2AQ3A 3IDXL 4D8PB 2B20A 5FYJL 3RBGA 3SDAC 4ERSL 2B8OT 3Q5TA 3TGXA 1QBLL 3UBXG 1S9YA 2QR0B 1K3IA 1IRAY 3K46A 1QLRA 3P77A 1NUFA 1J8HD 1Q72H 2X42A 4Z0XB 1HINL 2BNQD 2OR9H 1NDGB 3QAZC 1IC1A 3LSOA 3NZHL 6CGTA 1HHKB 4XC1H 4Z0BL 3Q5OA 4HBQA 3QDJE 1LDPH 4UIKL 4HWNA 2WIMA 1A6ZB 1KELH 3SGEH 2CR6A 4U1IB 1QQDA 3D0LA 4ETQA 1AO7D 1YJDC 3CFCH 3UTQA 1ORSB 4HDIA 3MGAA 4NN7B 5EO9A 3THML 3AY4A 4PJIA 3ULUL 4FQXC 4LOUD 3OKDB 3QUML 4KC3B 1FZOA 1X5FA 3DXAE 1SYSA 2X4TB 3X14B 1OAUH 2FECL 2CRIA 4XCNB 1T6WA 1DBML 4IIQB 1NUNB 1JYNA 5FYJU 3KPMB 1UG9A 4M02A 4ESKA 3I6KA 2SEBA 4XAKE 2D7TL 1CE1H 1NBVL 3W5NA 4I0PA 3TO4B 3S36H 3JV6A 1KULA 3MOBL 5EBWA 5DD5L 1JWUA 3IFPB 3QDME 3CNKA 2YMXH 4U0RC 3U4AA 2ED8A 2DLGA 1RK0B 1JYWA 1I8IB 3QAZB 3B8YA 4JPVL 2FEDD 4R2GD 2FJHB 4YGVA 5F72S 5EFIB 1NEZB 2BX5A 3HR6A 2EYSB 5DRZA 3LKSA 5BMFL 4JKPL 2VN7A 4PLKD 1QA9A 4NO0B 3HTLX 2P5EE 4ZS6C 3CGTA 3NIDE 2CPCA 2CLRA 3LH2L 2NY6B 3O6LH 4U1GC 4JJHA 3LN5A 5EC1B 3ULVC 1FL6A 3GO1H 2UZXB 4OLXL 5CUSL 1UB6A 4KRNA 4D9RD 1R3JB 4LIQH 4HD9A 2ZJSH 2X1QA 1HYSD 1BF2A 4GJTB 1P2CB 1A4KB 2FEEL 2APBA 5DK0A 4ODTH 5IOPB 4EUPA 3CZFB 3JTSA 2PKDA 3PDOB 4OQTH 4K9EH 1H8NA 2EC9U 1YEFH 1F90H 3L3IA 4E41E 1B6UA 3KS0J 5MHSE 2IPTL 1OL0A 1E4KC 1SEBB 5MENA 2VLRB 3NH7L 3IDJA 2GAZB 4MD0B 1E4KA 3MUZ1 4OZIB 4GKSB 4I3GA 5DA0B 1UYWL 3I3EA 3L5XL 4HFWB 3KYAA 4LQ1A 3RZCB 5H94A 4NN6C 3MRMA 3RBSA 1I1CA 3N0PB 4LSTH 4HPOH 4M6NL 4QHMB 3MLWH 3K1KC 3MJ6A 2F19L 4JN1L 2ARWA 3TBSB 4QRSA 4IS6A 3GSRB 1EJOL 4W6XB 2PO6D 1QYGH 4Q6IC 1ZGLB 2R4RH 1WC7A 3MFGB 4WI7A 3SKNB 3RTQA 2EYSA 5CBEB 5MENE 2P7TB 5FF6B 2IPKA 3VFVB 1GOFA 5C6WH 5FUZL 4NM8H 4N0CC 1FDLL 1IAKB 2QJDA 1F00I 3U1SH 1RUML 4W6YB 1RU9H 1B4JH 1XAUA 5I75B 3IFNL 1NLDH 4QXTB 3PDDA 2JJSA 5DZLA 1CICB 2EEBA 3L3GA 4DW2L 2CDGA 3QYCA 3SCMA 2GFBB 1BGXL 2XTJD 1X44A 1MIML 4PGZA 4K23L 4WTWA 4O5LH 3PGDA 4NQEA 5CZVL 3CPLA 4YE4H 3GGWB 1RHHA 2X4NB 4M7JL 1OSPL 2J5LB 3KXFD 3NACH 3VMPA 5A2JH 1BVKB 2YPVH 1RURL 3NGBC 2W65A 2F8XC 4G6KH 2X70A 3C5JA 5E4EB 1K6QH 2J3SA 1P4IL 3EOAA 4LNRA 1FNSH 2DQJH 3FFCB 1D6VH 3IXAA 3UZEA 1QTYT 4JFDA 2VO5A 1JWMB 3L9RB 1ZWIB 2KUTA 4HPOL 2I27N 4P2OA 3BKML 1LK2B 4AENB 4H1LH 3T0EE 1J10A 3PWVA 4JHWL 3MR9B 3CD4A 4JFFB 1YMMB 5EBWB 3KPPB 3ZKXC 3AFLA 3TCLA 4YFLI 3DSFH 4UDUA 1D5XB 4NRXA 3FZUC 5F9WC 3FMGL 2GKIA 5D93B 2YA1A 1H8SA 3NPSC 1KSRA 5MERB 4ZTPH 3F12B 3C6LA 3ARTA 2NY4C 3HLAA 2DIAA 3V52H 2VDKL 5MHSD 1XGRB 4Y89A 1FFPA 2A6IB 3FONA 1G0DA 3CVIL 4RGNB 3D25A 2C3VA 5D1QB 1LDSA 3ARSA 3MRQB 3T0EA 4I3SL 1T04A 2WBJA 4ZD3L 4XP4H 5IB1A 5HPMB 5HYSG 3OPZH 5I76B 1RZIB 3HR5A 1SBSH 5IGXL 5D7JC 5J12C 5GS0L 3IAQA 1G7HA 2LE9A 1EFXD 3OX8B 1IL1B 2ENYA 4EJ1C 3VXME 1CFTB 4WDIB 4K3HA 3HG1D 3PDOA 1S78D 2DKMA 5SWZD 2UYLB 2MCG1 1P84J 1CU4H 3BAEL 5ITFA 1UM5L 4Z7NE 1A3RH 3B4NA 4ZO8A 3TN0A 1H8OA 5I1IH 4KK5D 4NDMB 1CE1L 1NGQH 1RJZB 3MV9A 4IMLA 4LP5A 4GG6F 1VKXB 3S88L 1F11B 4GW5B 5GS0D 2I9TB 5D7IE 1YMHB 1DQLH 1JGLL 3FT3B 4ZFFB 4FZEH 3KXFA 1T7XA 1Q9WB 4M7ZC 4J8RB 2EE2A 4OF5A 3THMH 2AKRA 3MJ8B 4YDIL 5F9JA 3S3SA 4IEFB 2QQLH 3ZYIA 1NCDL 1NGPL 2XXMB 1FZKB 3KYOA 1U91B 2ICWJ 2IPUG 2R1YA 3P73B 3VXRB 5C9JA 3S37H 2IH3B 5CJQL 1N64H 5C0EB 3O8XD 4X6CE 2AJUL 5GGRB 4NC0B 5DO2C 3L5WB 5IR1A 1UWEL 2ZG2A 4XVSL 1YEKL 2P24A 4JM2A 3F62A 4LMQE 4PTTB 4OT1L 3WNKA 3RZCC 5ACLA 1RZGA 4CU7A 3UTSB 3UROR 2YPLB 1KCRH 3NCYS 4MCYB 4UAOC 2DWDB 2R2EB 3BPCB 3MJ9A 1FBIH 2DYPB 4Y4FD 4RBPK 1QQDB 1O7VA 3HE7A 2D7MA 3LKNA 2KPNA 2OZ4A 1HZHH 2NXYD 3L5IA 3Q1SH 1OAZH 1XF5B 4YFEA 1FSKC 3JV4B 4D94A 3P40A 4PJAF 2CKBA 4JQIL 1L6ZA 1G6RB 2EKJA 1S7UB 1CXLA 4XCFL 2AGJL 2PO6B 1IGJB 3QO1B 1JFQH 1RHHB 1NAML 3Q5YA 4QHNB 4YR6A 3TO2A 2F5AL 5IFAH 3VMOA 1AXIB 1QACA 3UTTE 1F13A 3WUWG 5F7HA 4RX4D 4AEHL 3KVQA 1A3LH 3A6CH 4YO0B 1KTLB 3HNVL 4PB0H 4HS6B 4XNXL 4LPUA 1OTUD 2ZP0T 2WINA 4TOYH 5LXGL 4PRHE 1MNUL 4QEGA 4Y5VC 3KWWA 5JIHA 3O41A 3VXPA 2HT3D 4TTDD 2VISA 4P5KB 5D70L 1N5AA 4JKLA 5EUOA 4YXKH 5LQBL 5DI8B 5JORA 3QPXH 3QQNA 2P1YA 5GRJL 1TZGH 2AI0L 5C2BH 3B3IB 1JGUL 1JPSH 3O81A 4OAWB 1IC4L 3BMWA 4LMQI 3EDKA 1R3HA 2V5YA 1QSEE 5GSRA 4Y19E 3VXMD 1YNTA 4PJHB 3O6FD 3O3EB 4EDXB 5K59F 4L8CA 2D7NA 5JTWA 1RHFA 3TNNB 1JGEB 1IAMA 1MFEL 2DM2A 2NY2B 2FJGB 2PW1B 4IDLA 5EBMA 3LOWA 4CNIB 4XAKD 2CRMA 1U3HC 1RZ8B 5E9DB 2C9AA 3TBWA 4X7TB 1YY8B 4DK6A 3BKCH 3NCJL 2PXYA 4K94L 1HKLH 1LE5A 1Z3GL 2AGJH 3BYTA 5BCAA 3H3BC 2VDLH 2ZUVA 2W07A 1IAIL 4GMTL 2VAAB 1G7LB 3EFDL 4K7PX 3MNVA 4LCCA 4U0RB 4U1IA 4Z7VF 2DQTL 2QSCL 3PP3H 3PDGA 1KCKA 4OZIF 2GUOB 5CJXA 4Z7UB 5KVDL 2AK1H 1G9NH 2YWYA 4AG4L 1KT2A 3PWNA 1RJLA 4OZFB 2NY1B 2X4QA 4QRSB 3LRSB 4ZYKB 3WS3A 5JDSA 3MCLH 1TFHA 3MODL 2HKFH 5AD0A 4OSUL 1S7QB 4HBCH 5EZLA 4WEUD 1RI8A 4MX7A 4PJGE 5D7KD 5IFHH 4BA8A 4U1SA 3IDUA 2FCBA 5E6IC 1BWWA 4AH2A 1GCFA 2R1YB 3PP4L 5F3BB 1K2DB 1V3MA 5E6IA 4U6XB 4F2MB 4BH8B 2AJ3B 2MTPA 3GJFK 4MSWA 5JXAH 1ADQL 1ITBB 1INQB 1RIHL 4LAQH 2D9QB 2H32A 1XGQB 1Q0XH 4DZ8A 4P5TA 5EA0L 1X4YA 3CVHA 4G6KL 4RAUA 4XP1L 1BBDH 4X6CA 1E6JL 3BO8B 2ADFL 3G6DH 4NWTL 3GB7B 3NMEA 2XPGA 3HHRB 1K4CB 4L3EA 2GT9B 4POZC 5DUBB 4A6YA 3DYOA 3HE7B 2A1WL 3NA9L 4WFEE 4L3AA 5KG9A 2FX9H 3V5KA 4NJ9L 4H25A 1WCBA 4Y16B 3OKNA 1KEMH 4P23A 1TJIH 4HX1B 3FN0L 3INUH 2XKNA 3ULSB 1KUMA 3H9HB 1IFHH 1DUYA 4IOFC 1A5FH 3TP4A 2V2XA 1KN4L 5HGGS 3U83A 5T33H 3GI8L 4QTIL 3ARDA 1W0YT 4KVCL 1LO2L 1O5DT 3WHXA 3SDCB 2E7LA 2YK1L 3NCBB 2QQKL 2YD8A 4B7LA 1T03L 1DANT 5EZLB 2DBJA 2R0KH 3L7FA 4K8RD 4LLDA 1AH1A 2VRAA 2DOCA 3QG7L 4X6BA 1IEHA 3VFTA 4ZG1A 2JLLA 1DN0A 5J89A 4TSAH 4KI5C 5FCSH 2IAMB 5J9PB 3L5JA 2HWZH 1MOEA 1WBZB 3CDCA 5AZ2H 5C6TH 5MEQA 3A67H 3UMTA 4F3FA 5JIPA 1HHJA 3BKMH 1XIWC 4MXVF 2MFNA 1OPGH 3T1FA 3AREA 4IRSA 3U4EB 3MV01 4XP1H 2MHAB 2D2OA 4UZGA 2ERJC 1IKNA 3VG9C 2E6JA 4UB0L 4Y5VB 3W82A 1MRDL 1ED3B 3F8UB 3H9SA 3OQ3B 3WIFB 4D3CL 4M43L 5IK3B 1IL1A 2J8HA 3L5HA 3AS2A 1VFUA 4LSQL 5JNYB 3U2SB 5T3ZD 4OFVA 5C0EA 3GBML 3EIFA 4XP6L 2YPVL 2VUYA 3ZT7A 4P99A 4Z7WE 5C3LD 3DX6A 3BP7A 4FQQB 2V2TA 4X9FA 5F96H 1MQKL 1TQBC 4OLWH 5E6YA 3G6AA 1EEUA 1MHPH 2B1AH 2X4NA 3BPNC 3O6LL 5C0JA 4TQEH 3SE3A 2F8OA 1QKZH 2XI9A 1EFQA 3VFWB 1P6FA 1VEOA 5CEZH 4CJ1A 5GXBB 2WZPD 2EDJA 4LLVA 5CJOL 1KC5H 5KSBE 1REIA 1I9IH 1A7RL 1S5HB 4ETYA 3IJYA 2VXUL 1T1XA 4PJ9D 4CN6A 4P23D 1UM4H 1YY9D 4W81A 1Q9LB 2Z0BA 1Q94B 3OAUL 2YD4A 1NMCC 1F58H 1QO3A 1NFDA 3MV8B 3FAXA 1MRCH 1QSFA 3PXJA 4NQUA 2R0WH 2Y36L 2UUDK 5IJVA 4JDTL 2WWMD 4XCCL 1R3KA 5D4QA 3O41B 1QFPA 4TTGA 4YLQT 4HT1H 5GRJH 1BJ1J 4GW1B 4JFQB 4EN3A 4QHKI 4Z7QF 4KKBD 1YDPB 3WDJA 5DHXB 3KG5A 4XMLL 1MWAL 2A83A 4FTVD 5KSBA 4X83A 5F6IB 4OB5L 1ZANL 3LD8C 4L1DA 3RNKA 4WTZA 1L7IH 2P5WE 3CFJA 3VFMB 5KZCB 1S8DB 2DL2A 5BVJB 1EV2E 1D6EA 1R5VB 3MODH 1K8DB 2KH2B 1JGDA 5BJTA 1U8LA 3VXSE 5D96C 4JHBA 3S36L 3QA3A 3K81A 3TO2B 1CR9H 1IC4H 5SWQB 5KVEL 5C70A 3VXSB 5IHLB 2J12B 3AXLB 1JYXA 4ZO7A 2A0LC 3QUYC 3PP4H 3MYJB 3TN0C 3E3QE 2PCPA 3O6MH 3VXUE 5DJAB 1AI1H 1N6VA 5JPNA 3MLYH 2VERN 3LPGA 2CLVB 5TPWH 1BOGB 2BNQE 1MCPH 4BELD 4Z76A 5I30H 2DLFH 3GMMB 1GL4B 2YOCA 5D1XA 4J3WA 3FT4B 3TIDB 2HT3C 1XF4A 1U8QA 3BQUA 5LWYL 2BNQB 4JFHE 2WSKA 4HWEL 4GMSH 5DHYA 1OSZB 2MQ3A 3FT2B 1I8KA 3HMXH 3HS0A 3MLSL 1KB5A 1WWBX 2BSTA 2OBGA 4N8VA 3NN8A 4PB9L 2BVPA 1R3HB 4PJ8B 2F53B 1ZEAH 1FL3B 3MCKB 5JUEL 4JZJC 4YZFF 5ESVB 2VLKB 1N8ZA 2EECA 1WZKA 1CL7H 1JVKA 3EO1A 4EI5C 2F53E 1Q8MA 5HXMA 1MWAH 4BH7A 5J6HA 4PY7B 4ZUUB 2FJGA 2PW1A 5FCUH 3KPNA 4PIRF 4XCYA 5HHNB 2BXYA 4X4MA 5BV7B 12E8H 5C07A 1N5YH 2Q20A 4HPYL 1J0HA 2BNUA 2Y36H 5GRYA 1N3NA 5I71B 3L1OL 5I8EA 1I9RH 5INCA 1FL6B 4G8GD 4PBVC 5IT2H 4F2MA 4O2EA 4EN3D 4NNXB 3MLXH 3LKNB 4OB5H 4WFHD 1IM9B 2CKBL 2W9EH 3P77B 4RDQF 1A3LL 4KV5F 3RGVB 3DX7A 1DVFD 1F6FB 5GGRY 4LCWA 1LK3H 4XBGA 4QTHA 4JY6A 1OB1B 2DTML 2YBRB 4KK5C 1NJ9A 1DQLL 5D1XB 5DUBA 5J11B 5JDSB 4WHYG 3OPZL 4P2QE 1T0NB 1MRCL 2VQUA 1WT5A 3GMNA 3EYSL 4HH9A 5HYQB 4EIZC 1ES0A 2VOTA 5KVGL 4FFYH 1FBIL 4WWKD 2D31A 3S4SA 3REWB 4NDMA 5TDNA 1FLRL 5FHAH 4HIXL 3TZVA 2I60H 3GIVA 1BIIA 4YHZL 5GZOC 3VFRA 3L3KA 4OUOA 4Y4HD 1ZHNA 5HHPA 4LASL 3KR3H 2Z31C 1PGRB 1PKQA 4JANB 3SDXE 3ZKMC 3SDCA 4NO5B 3D0VA 5DD3H 2SEBB 3ARFD 3EO9L 2FR4B 1VGEL 3ZDYF 5J0BA 3V4VL 4G7YL 4YHKL 4L4TE 4QRPD 4K3EL 1ZLVH 4YPGA 1GC1C 5B39B 1MH5A 5C0IA 3O4OB 4XI5D 3KHOA 3KPTA 3VD4A 1SEQH 4DAGH 3WJLA 1CFQA 2V2WA 1ZV5A 4HMCA 4M1GL 3V4PH 3VRJA 3TJEH 1N4XH 1L0XA 1FO0B 1TVBA 4UB0H 2HVKB 1FNLA 4E5XA 5ACZA 4LBEA 4IRSD 2ZPKL 5HGBB 1RURH 3S9DB 4JVPA 1AGCA 1CDYA 3CPLB 4LFHG 4KHTL 1CFSA 3WE6A 3AS3A 3MLZH 1ZMYA 1UQSA 1F6AA 2XN9E 5I16A 2A6KB 2A73A 3C9NB 5CJOH 5FDYA 4I2XE 4NZJA 5I1DB 4U33A 1WQVT 5GS1A 4Y2DA 4L4VE 2CIIA 3NAAH 5SWZB 3H3PH 2FD6L 2HKHH 2YD3A 4JDTH 2AJYL 3W39B 3DI2B 1P7HL 3G6AB 5D9SA 2A9NL 1UXWA 3MNWB 1I8KB 3LRSA 4DOHB 4ZYKA 3PWVB 2HFEB 4UILH 4YWGH 3GBMH 4YX2H 3J7HA 2NCMA 3HI6L 1A7RH 3MOAL 4JREC 2BVOA 3DMMD 3MFFB 5HHMB 1GXEA 2WK2A 4APQD 3AU1A 4XP5L 1ADQA 2ZUUA 2AJZB 4TNVF 5E4EC 5IJKA 4UUJA 1MIEL 4ENEC 4OFKA 2VTFA 3V4UH 4Y5YB 4F7PB 2NTFB 5FXCH 4MJID 4NZUH 3CMOH 1OW0A 5HYSB 4XPAH 1WWWX 2P5WA 4FMKA 1KJVA 4QXTA 4PJ8C 4RNRB 4R3SA 4C4KT 1BVLA 2E9BA 5ERWA 4UTAH 3CFJB 1G7QB 4PLOB 3MXWL 2Z93A 1C1EL 1J05A 3U7YH 3L3GB 3FQNB 4R0LC 2VH5L 4JN1H 3K8MA 4KVCH 1RUQL 5C0BE 5L8JB 2UYLA 4AQ1B 3CMOL 2VUOA 4DGYH 3GSNB 4V1DE 5CEXB 1F4WL 4LLAA 3UTPD 3S4SG 1JHLL 3B83A 3MRDB 1OY3B 4WEBL 2WQ8A 3SBWA 4P46C 4I5BA 1A64A 2RFXA 3R06B 2VNCA 1NSNL 2PCPB 4X5XB 3MRNA 4JRYB 4MHHI 2VZ1A 3DO7A 2LTQC 4EN3B 5IW3A 4WI2A 2B5IB 3VH8A 1MF2H 2OL3B 4YHIA 1CGTA 4HUNB 2VB5A 3ARYA 4GAGH 3WEXA 1WAAE 3CLEL 4K71B 4DFHA 3DXAB 5DD5H 4DTGH 2VZVA 3TJEL 4MDIB 1VGKB 4N9OB 1QFUH 3EW3B 2O5YH 3M07A 3FRUA 3ULVD 3QIBC 5F3BA 3Q3GB 2QQQA 2XIDA 1Q9OB 1W72H 3C6LB 3QUMH 3B9DA 4JPWH 1P84K 3OKMA 2KQMA 2Q7YB 4PP2A 3MRBA 4YAQB 3QXAB 5CSBA 5HGBA 5HI5C 1EJ6A 2A0LD 4NN6B 3GZKA 3BEWA 4CVWA 3EJZD 2OX5A 3C5ZD 4JKWA 1VACA 3GIZL 4YBQC 1Y0LA 2V2TB 4LHUA 1CFNB 1RIUL 1HHKA 4N0UA 5FECA 5F89A 2FO1A 3IVKB 1MCRA 4JO1H 2D4FA 1FLRH 2HRLA 5FHAL 5I1LA 3QG6A 5C71A 3CK0H 3MUGB 4H25B 4JQVC 4QRPB 3OKEA 1S9XA 3QEUB 5GS1B 5C08D 3NCCB 2DQTH 3NCFB 1AR1C 3HI5L 4PRPB 1MLBB 3JVGA 5BXFB 3QXTA 4Y4FB 4ONFH 1TQBB 2VLLB 1S5HA 5D70H 5L2KA 1T2QL 3PWJA 1WBXB 3QZWA 4P2QA 3OKDA 1MAML 1VPOH 3PV6A 1W72A 2NY1D 4YFDB 2WUBH 5SWSE 4K94H 2G2RB 4UBDC 4YHKH 4MJIE 3C60A 1CICC 1KCRL 3IFOA 4PGDA 3BRGC 2HFEA 2QHLA 3QIWB 3QIUA 3SY0A 2LU7A 4Y4KD 4U1HB 2NY7H 4WENB 4XXCC 2AKRB 2AEPL 4NKMA 1MHCB 1QSFD 2O5XH 5TH2A 4PJCE 3SEPA 1MUJA 4HJJH 3VXNB 2HT4D 3X3GH 2DYPD 1UWGH 1YEJL 2ADJB 2JB6A 2HLAB 1FNEA 5L2KE 1ZXQA 2IANB 4YDIH 1NBVH 3RP1A 1IEBB 4XNZC 1Z3GH 3QI9B 4JB9L 4FQIH 4F7PA 4CW1A 4YEFA 1YEGH 3K2UL 4Y1AA 1BPVA 1QBML 3DX7B 2W60B 1PX4A 2Z31A 1PZ5B 1DQDL 4OKVA 1HDMB 4OGZA 4WUKH 5EOQL 5DR5L 3RIFK 4J3SA 4RWYH 1QFHA 2ATPB 1U8IA 2NY5C 2W0FA 4ZUWA 4X6DE 3AXLA 4EI5B 1CDCA 2XKSA 3BPNB 3QG6B 1XF2A 1FFPB 5I1EL 1CU4L 1EXUA 3SDDA 2GHWB 5HYEA 1XZ0B 1IGCH 1UWXH 5ISZB 5EZOL 3QPQC 2D03L 3CZFA 1O0VA 3QUKB 5DJ0B 2VDQH 4Z7OE 2DM4A 2FDBP 3C60D 3BMVA 4HZLB 4U0QB 4RWYL 1FIGL 2DQGL 2VDPH 3RGVD 3PWNB 5C2BL 3BZFA 4WW2A 1U8QB 2GAZA 1GZQA 1J0KA 4QXUL 4NQCE 3FTGB 5DEGA 4NKDA 1Q1JL 1MJ8H 4FN0A 4OUUB 5D1XD 4QRUB 3O2VH 4FQXA 5DMGD 4M6ML 2ILLA 4U05A 2J8OA 5CEYA 4NFBA 1GYAA 1VDGA 4XNYL 1U93B 4TRPL 1TLKA 2Q86A 4ORZC 2QLVB 5GJSH 2DQEL 4UNVA 1J1OL 4KRMB 4KZDL 4RMTA 1I9IL 5I1HL 4ZNEA 1Z2KA 2IGFL 3VXNA 1J87A 1UXWB 3LKRA 2V17L 2P5ED 4P2QD 2G9HA 2JJWA 5HVWA 5T1KB 2YXMA 1LDPL 2NX5D 5E95B 4G9FA 3MRIA 4DZBB 3T0WA 2DI7A 1Z9OA 3P4LA 2Z8RA 3I2CL 1INDL 5C07B 1HINH 1UA6L 2PTTB 5FM5M 1QLEH 4JFHD 1A6TA 3IRPX 1JGVH 4APQA 1DUZA 1QBMH 1Z9MA 3C8KA 1WGOA 3G5YA 4WI8A 1P7QD 5DT1L 3VXQA 3DVNB 5C08E 3OXSA 2R1WA 1DL7L 1IAIM 1I1YB 4LEXL 4Z7NF 2B1HL 3FQWB 1BFVL 4FXLA 1YEJH 4FZ8L 1MSPA 1IARB 1V7NH 4QOKE 3HFML 3WLBB 3VXOB 1S7SA 3I9GH 1C5CH 5DWUH 1RZ8A 2Z91B 3RGVA 3WHE1 3P0VH 3L3HB 1RUAH 1JRHL 1YMMD 3IRZA 3OMZA 1EERB 5F93C 4GKNB 5D2NA 2W38A 2APFA 5IFJA 3H42L 3HZVB 1Q38A 3MUGA 2X4UA 2I9LB 2F58L 5HDQH 4MMXC 3U46B 3ALXA 4PS4H 2QQLL 4Y4FA 4HWBA 5E7FA 1LE9A 2F5BH 5I9QB 5HVGB 3C6LC 5L2KD 3C6SB 1V8HA 4Z76B 4RAVB 1WUNT 1X7QA 1KGCD 1SBSL 5IGXH 1IC7L 1NLDL 3IFNH 2Y25A 4F57L 2R0WL 4NC1E 2DLTA 2YK1H 2NX5A 1TJGH 5E1HB 3PABB 1IM3A 4PJXF 1A6ZA 5GRVK 4OGAC 1NC2A 3F58H 3PQYE 4CU8A 3LEXB 3MGOB 2WBJC 4QKXB 4JB9H 1LO4H 2X05A 4QHKJ 3BW9A 3DV6B 4Q9BA 5JW5B 4NSKB 5DJ2B 2NZIA 3MCKA 1A3RL 1FL3A 1EZVY 1FFRA 1RMFL 1JPFA 3U7WL 3Q48A 3D9AH 1N5AB 1G7MB 5D7IB 3SDCD 1P9MC 3FO1A 4RCAA 1MRDH 4Z7VB 4NQVA 4XCNA 4LVOC 3BP4B 3F7RA 3JWOH 1CT8A 4X6FB 3QI9A 5E2TH 1U6AH 1UXSA 1NLBL 3BIKA 4CVZA 1UWXK 1KTDB 4PPTA 4S1SL 3VRJB 1NSNH 2BMKB 3QEQD 3VA6A 3VD3A 4R90H 1NDGA 2WUBL 2AW2A 5EORH 4NM4L 2YXFA 4L8BB 1A1NB 4C57C 1FFNB 4EZMA 5DGQA 5E94A 5E70A 2FJHA 1AQDA 3GKZA 3H7BB 1CGSL 4LKCA 4RFEB 1ADQH 1BFTA 3SHSA 2E8ZA 1CFTA 3MRBB 4NRYA 5EUKB 4MLIA 5CD5D 1AGFB 3VG9B 3HE6B 3WIHL 2JELL 1BIHA 3NACL 2YN3A 6FABL 3SPVB 4H26B 1HSBA 1P69B 2WAHA 4QXWA 4ODUA 1LVEA 3HZYB 1A1OA 1EGJA 2D0HA 4QCIA 3DGGB 1SJVA 4AM0B 1WJ3A 2YEZB 3CSPA 2A6DB 3KPMA 3CXHK 2HKFL 2NY0D 4PJFA 3V0WH 1CXIA 1FIEA 3WFEH 2BCKB 4GUPA 1IJ9A 4LAJH 3BP6B 1JNHA 1LEKA 1X5HA 1NCCH 4S1SH 2Y07L 4JY4B 4GQ9L 3QRFM 4EUPB 5C0GB 1QFOA 4Y8AA 3BN3B 1INEL 1WZMA 2A1WH 3NA9H 3FZUD 3IU4L 3TEUA 3L3IB 1IGIL 1J1XL 5IBUB 1EEYB 5FUCC 1QFUL 2G9HB 3LKQA 1CGSH 3GI8H 2Q76B 3P4OB 1TITA 5EG6C 1QRND 1AFVH 5K9JL 1HHJB 1A5FL 4D9LL 4PRNA 1V3KA 3V79C 3P0GB 1FYTB 2QL1A 1F3DH 4BUHA 1TVDA 4RQQB 2YKLL 1IKFH 4LLWA 2NY3B 3D39D 5D7LB 3SJVD 4Y5VA 4RMUA 2XZAL 5HYJE 3WKML 4FXGB 4UINH 2IANA 3QWOB 1KCLA 3INUL 1BQHG 3OR7B 2HRPH 3SGEI 1NCCL 5FKPB 5ILTH 4XP5H 3FQNA 3OKKB 3L5XH 2JCCA 2EKSA 4MGXA 4XNMB 2VR4A 1MCNA 4EUPH 5MEOA 1UZ6E 2H9GA 3RDTB 2ZCKH 1R5WB 3ARFA 1HSBB 4Y5XC 1HHHB 1NGWB 2HTLC 2XFXA 2ID5A 1GGCL 1MHEB 2Y06L 3WE6B 4DGYL 3IFLL 4FTVA 5DRNA 1U8IB 2F54A 5FO9B 5B38A 3F58L 1UZ8A 5B3JF 3R8QA 4P9HC 2GFBA 5FYLD 1D7FA 5AEAA 3QUMA 1JK8B 1Y6KR 3BDBA 3K2MC 4GRLB 5F88B 3VW3L 3SDDD 3QQ9D 2EDEA 3QUKA 4WV1B 5I66B 1J7VR 5CWSB 1DUYB 3D85A 1MUJB 1D5IL 3MV9B 4YDJA 1AJ7L 3MC0A 1A9BB 3BQUC 2GSIA 1JL8A 5KJRL 2JB6B 4X9HA 2HTKD 5EU4A 5F9OH 1FL5B 1H5BB 2NY1C 1IMHC 4J2XA 4MNGA 1K5NB 1S5IL 3TT3H 2I60L 4ZNEE 4MD5B 1WFOA 3L7EB 2BNUB 2AK1L 5IB2B 1EHNA 4XMPH 2XA8L 2ZCLL 1C5CL 4KPHL 5DJDB 1PEZA 4BYHA 1ZE3C 1HEZA 5I1HH 2XQYG 3CFKB 4JRYE 2GTWB 3QQ4B 2H45A 2QTEA 4JGUA 4EEEA 3KYKL 1TQCB 5J9PA 1X5YA 1N2RB 3GSNL 2W9DH 4P46D 1I7ZA 1H0DA 4OD3H 4WCYH 3U0TB 4EI5A 4KTEL 3T08A 5IVZA 2AXFB 5MI0B 1T5WA 1OQOA 5D5ME 1WAAF 1X6NA 2CRYA 4HG4K 4LGRB 3UC0L 1Y0LB 1NGWA 1W8OA 1FNAA 3OAZK 5IMKA 3UCRA 2QHRL 4BK5A 4KGJA 4JDZA 1KIUA 2DJSA 4QXGH 1OAYL 5AUMA 3NCYP 5EC2B 1KJ2L 4GKZB 3OAYH 4QF1B 4LHUD 4W4OC 1P2CA 5J12B 2VIRB 2DMBA 4EXPX 3T77A 4KROC 3WXWL 2CO6B 5ADOL 4UQ2A 5IB1B 3LRHA 5F7EH 4GXVL 2HFFA 1NAMH 5E4IA 1RJLB 3QCVH 2E7BA 1ZT4A 2PXYD 3QI9C 5T1KA 4I5BB 4PJEE 1DBMH 3SN6N 3L3DB 3MV7D 4PGBA 3EHBD 2BOBB 2ICEA 3ROOA 4JPIB 4NO5A 4LLVB 5IMMB 4MJ5A 2VLME 1AC0A 5I2IB 2BNRB 3FAWA 1RQ5A 4PRPD 4FQIL 3MRGB 4F15B 3CH1A 4PLJD 2F9BT 5DSCA 5GZND 1OAQH 4ODWB 3TVMD 4ZO9A 1EEYA 1CFBA 3MBXL 4UT7H 1CLOH 2F58H 5HDQL 3HNVH 5EZJA 3RI5K 1UJ3C 3ZE0F 5T3XH 3ZT6A 4KKCC 4D0CA 2AJ3A 3R1GH 1HHIB 1QRNA 1QNZL 3ESUF 1CFQB 1MJUH 3N85L 1EBAA 5KSBF 2H32B 1Q0YH 4C56E 3QWRD 4H88L 5DUPL 1KG0A 1I1AB 3KYMA 3T04D 4JRXB 4EDXA 3ISWA 3N06B 3BXNA 3PF2A 3K2UH 3QUXC 3V5DB 3FO2B 1YC7A 3C2AL 3WSQL 2APVA 5FCUL 2VZOA 2LAAA 1YNKH 3QI9D 3QEQA 2HT2D 1LE9B 4BQBA 4DCQB 2GK0B 1T7WA 2P24B 4JM2B 4RSVA 5I15H 1IGFH 3O4OC 4JJ5B 3GMPA 4RAVA 3RJDA 3F5WB 5ESAA 1N0XL 4QLRA 3RL1A 5GGVL 5T3XE 4KROD 5SWQA 5CBAB 4IMLB 4LCCB 3PWLB 4X98B 4R96A 4NJAH 3QCUL 3QUMB 5DVKA 4XHJC 2EIZB 3PNWB 4WFGE 5IMMA 1IKNC 4MDJB 1DBBH 5C0CA 4GSDL 1IQWH 5ILTL 2GQHA 2VWEE 4CGTA 3KLDA 1S7UA 4RIRA 1GZPB 4M5ZL 2FEDC 4ODSL 5GS2D 1YPZB 4Z7VA 1NKRA 5TDNB 3O9WA 5H37H 1XGUA 2IQAB 4M1CC 3WS3B 2YEZA 2NLJA 5D1QD 2DD8H 4XAWH 5JW4N 2DM7A 2L4OA 3J8F7 4XNUL 5C0RL 1N5YL 5J57B 2NW3B 2H26A 4P3DA 4MB3A 3TPUA 4DTGL 3VXPB 25C8L 4KJWD 1A2YB 4U2ZA 2CXGA 1HHGA 1G1CA 1SBBA 5BZDA 3V7AE 1AGDB 1M6OA 4OCSL 1JNNH 4MVBD 5HHXL 5IJKC 5C0CE 1MF2L 1HILB 1NAMA 1CDHA 1XF1A 1OAYH 3F12A 2V2WB 3TBVA 1QKZL 3W11C 3CC5B 3S98A 3D3VE 3EOTH 1G7QA 1ZGLA 4G3YL 3NA4A 2IF7A 5D2LB 5DJXA 5T1DL 1YQVL 1MVFA 1QLRB 3E6FA 1YEHL 5C3TA 3OZ9L 2F74B 4JLRA 3MXVH 3NIFE 3QSKB 3N1GC 3VJ6A 5DJ8A 5ELIA 3DARA 3ZL4L 3KGRA 5T3ZH 3MACL 3EYQC 3SDDC 4GG8A 3EKCA 3JBG7 3MREA 3RDTC 2GY5A 2BY0A 1UZ6F 5DURB 5HGAA 4DQOH 5I1DA 3VI4E 3P4MA 2IBZY 1XGTA 3CK0L 2AK4A 4IBLT 5C08B 1XCTA 3W2DH 1YY8A 5MEOB 3KLAB 2WLYA 4AQOA 4GXUM 3EAKA 5GSVA 1HHHA 4W4OA 1TCRB 3ZKNC 1C16B 1VEMA 5CEZL 4TSBL 1EX0A 2IAMD 1GHFH 3LB6D 4TSAL 2M8XA 3GMNB 4ELKA 4U1MA 5C09A 3NFSL 4R7DB 3WUWA 4K8RH 1BD2D 3TBTA 1L7TH 3FFCA 4NQDD 4J12A 2Q86B 2FHBA 2VLKD 1P4LA 5IV2B 3MRLA 1DN0B 4NKQB 1C1EH 3LQZB 3TZVD 1EK3A 5GS0C 4DQOL 3UX9B 2I5YL 2G60L 2VKWA 5CMAB 4YE4L 1K6QL 2P48B 1WZLA 2X4PB 5E9DA 4OF3A 5IKCA 2R4RL 1G0YR 3VE0B 5DTFA 5HYSA 3E6FB 3MZGB 1EA9C 1R5WA 4JFPB 3OB0K 1SY6L 3GMRB 3MXVL 2AEIT 5C0AB 1T0MB 1JZ3A 4N0UB 5FECB 2XACC 43CAA 2R2EA 4OGYH 4BH8A 1S9KC 1MIEH 5LJYH 1GIGL 5DHVA 3D39B 1VFOA 3PL6A 3IDMB 3V6FB 3F5WA 3VA2C 3N1PC 1XGPB 5IHZB 3QDGD 1NGZA 2X7LB 3DETD 1WBXA 3QZWB 4P2QB 5JHDA 5EU6D 3RFZC 3MOBH 5F96L 4M8QA 1GPOL 4N5EC 2APTA 1FO0H 5HYJD 1TNNA 3MO1B 1K8IA 4NQSA 4XNUH 5C0RH 1NCAH 3GSUB 3TT1L 4WEMB 2UY7A 3HRZA 5DO2D 2YPLE 4HS6A 1LP9A 5FYKH 4KZEL 4HK3N 1LEGB 4X99A 1W0WB 4HWBL 3H6JA 3ARBD 3G5XB 4I9WD 3TA3D 3S35L 3LQZA 1T20B 4F7MA 3BIAX 1JE6A 5DMJB 2FX7H 2KZWA 4PP1D 1JPFB 3NTCL 5ENWB 3CUPA 5T1LD 4ODHH 3O3EA 4JCMA 3BKYH 1J1PL 1U58A 4HCRL 4M1GH 1F90L 2X4OA 5JXAL 4Z18A 1DDHB 5DRZB 4LEXH 3SCMB 4D2NA 4OLXH 3MRKB 4KKLD 5CUSH 4FQHB 2N56A 1H3XA 2XWBA 4Y16A 2VIRA 5FKPA 1I4FA 1BWMA 4P57B 4RDQG 3TFKD 3WHE0 1K3ZA 7CGTA 3M17B 3O3BB 3QH3A 4KMTH 4YC2C 5J13B 2MHAA 1GAFH 3HZKB 3BPCA 3EOBA 3MRJA 1IBGL 2O93L 2N1KA 1FORL 4JFEA 5FYJE 4JGJA 2C1PA 3ARDB 1NEUA 1KV3A 3MNVB 3EDDA 4NT6B 3JTSB 2AK4D 4OIIH 2B0SL 3HCVB 1XR8A 1KOAA 1OM3H 3T2NL 1KENH 2VLJA 1UCBL 5DLML 2K9UA 4K55A 4N1HB 3UZVB 3RWFA 5L6YH 4C4KO 3WIHA 2HFTA 4WUKL 5EOQH 4H20L 1D9KA 1UACH 3QPXL 5F8QC 4YDVB 4MNQA 1EO5A 2FYYA 4ZDHA 4Y2OA 3GHBH 4MDJA 3MV8E 1ZHLB 4FQ1H 4HUWA 2HKHL 4X6DB 1AY1H 5EIIB 3VGFA 3RAJL 1SQ2N 2F5BL 4MAYC 1IQDB 3G5YB 2OL3A 2OQJB 1XF3B 1HI6B 3WUZA 5HD8C 3MLTB 1NFIB 1FG2B 1G9ML 1CL7L 4F37K 1F45A 5EN2A 4KI5E 4G43B 1MFEH 3HZMB 2IALA 3ARBA 1ZA3B 3QDMA 2NXYC 5HGHA 5IWLC 1KLUA 2LTQB 3MV9E 4EN3C 1VGKA 1A0QH 4EBQL 3WS6A 3HMXL 4F58L 3R1GL 4PLNC 3OJVC 1QZ1A 4F33A 1ZGLM 5LGJB 1GGYA 4YHZH 4MNQE 4N8CL 4JO4H 3T8XB 3BO8A 1FZJB 5C8JA 2ZOKB 2FHFA 1RK0A 1XGYL 2FSEB 1YQ2A 4MS8C 1EVUA 1XCQB 4LRIA 4FXGA 1HQ4A 2P5EA 3FB5A 1HH6A 1F6AB 3MLRL 5DRWB 3EYQD 1WEJH 3QDJB 2EH7H 3NIFF 2CR3A 2PW2A 1FRGL 3LS4H 4NHUB 4WUUA 4LSUL 1G9EA 1INDH 4JFFE 5C2UB 1YEKH 2M26A 1CD0A 4JO1L 4MNHB 2ZG1A 1BECA 4Y1AE 3ZDXF 3JWDH 4HS3A 5A2LH 4BQ6A 1VFMA 4JEGB 1FAKT 2OI9C 2ZUQB 3MSPA 5IG7B 1QSFB 3I6KB 2EDNA 2A6JA 2FYYB 4O58L 1IGML 1X5KA 3RWEA 4R26H 1BX2A 4S2SB 4MJ5B 1LEGA 5FGBC 3H0TB 4URTB 1C7SA 3VI3E 3X11A 2PUQT 1AY1L 4PD4K 5GGSY 5EB9A 1XH3A 1T22B 1ZVHA 2EXWD 4C56A 4LSVL 1XF3A 4ODBD 4AIZA 1T1YB 1HXMB 2CJUH 1FZKA 3IDJB 3FN9A 3DPBA 1H15B 2EZ0C 4IJ3B 2EZ0D 4JFFA 1BJMA 3EBAA 2R2BB 3BVNA 5F7EL 3UYRH 4HWZB 2LABA 4JO2L 4RFNC 1RIUH 5B4MC 5D71H 4U1JB 4YHNA 1OT2A 3DYPA 5BV7H 3DECA 1OAKL 5LGJA 2OXHA 1QVOA 4G8IA 1WVZA 3CZJA 4HW6A 3AB0B 1K2DA 4GAGL 1CFVL 5IMOA 2R2HA 1IM9D 1MWAB 3HLAB 2N7AA 5ISZD 4QRTA 3UYPA 4PGEA 3GMQB 1FSKB 5FO8B 1HYSC 1FORH 1INQA 2AXFA 3FOMB 5IEHA 3BKJH 4HUUB 3LDBC 3WKMH 1S7SB 5ID1A 3TBYA 3AS1A 2HH0L 5CZKA 1AC6A 1WT5C 2N4IA 3O3DB 2VL5B 4QRQA 4CAGA 3OF6A 1TPXC 2ATKA 1KB5L 1EVTC 2AVGA 4NQXB 2XPGB 4RISH 2DQUL 3PG2A 2XZZA 1G7HB 1A7QH 1CK0L 1JV5A 4EDWL 2OM5A 3EZJB 4IRZL 4HXAL 3U46A 4JM2F 4Z7VE 4Y0GA 1AE6H 2E8YA 2NTSP 1U8OA 3KDMB 5DZNA 2VN4A 4HCRH 3VWJB 5B8CA 1WCBB 5I1GH 3O6ML 3VXUD 4Y2DB 4X5XA 3VXRE 5ANMB 5C0GA 4RMRA 3V6OE 5EU3A 4JM2D 3PGFH 5F7DA 4LCWB 2QQNH 2A2QT 5F7NC 4GBXB 3W9EB 1NGXA 3DBXA 4P5TD 3ZE0E 1ZLUK 5HHQB 1JF5A 4PY8I 4BZ1L 1A6PA 4Z7WB 1QO3B 1NKOA 5E8NA 3FT3A 5EOCH 2J8UB 2VE6B 4KDWA 5I74C 4OZGA 5F9OL 3LRGA 5CJQH 3CU1A 4KMTL 1ZVSB 4FQXD 1AGEA 4B41A 3L7FB 1NMBL 4JFQA 3GIVB 1QVOB 4G8IB 2I24N 3L3JA 3TNNA 1Y6MR 4QHUA 4X8JB 4K3JH 4PP1C 5JPMB 5KSBB 3HZMA 4L4TB 4P48A 3HI6H 3MOAH 1U8KB 1EMTH 3B9EA 5IW1B 3SKOB 5EU7E 2RCSH 2QQKH 1JI2A 3I50L 4UT9H 4LSSH 4YHOH 5IVNA 1ROWA 1D5BB 4IHOA 3UBXB 3ESVF 5FYLH 3TO4D 3LZFH 3PHQB 3LKPA 5D6CB 5D7JB 4RGMC 5GRWA 4BSJA 1K9TA 5DUMH 4PRHB 4M8QB 2H2SC 3T0DA 1BVLB 2F53D 1T5XB 4KU1A 4NN5B 5IQ9A 3VXUA 2F54B 1F4HA 2O26U 5E2TL 1RUPH 1WTLA 5GJTH 2EDFA 1OGAA 2Z9TA 3WLBA 3MROB 3EOAB 3MPCA 3SDXA 4QHLB 4NO0D 4HKXB 2IG2L 3NABH 1BOGA 4MNHA 1WIOA 4CMMA 1ZHKA 5I1CH 1DR9A 1HYRC 3LPWA 5CP3A 2WBKA 4ZFZA 3M8OL 1P7KB 4MD0A 4M9OA 3F6LA 5LGKA 5T33L 1JZ5A 4ODVH 2YWZA 1GPOH 3T2OA 4L3EE 4KV5E 4JY5L 4DN3L 5GGVY 5TGBB 3SKJH 2BK8A 5DJYA 5DK2B 2ESVB 5ALBH 3SKMA 1AR2A 2R23B 3VCLA 5E9DE 3QNZA 4XCEB 1MH5B 1Q94A 2RIKA 2X1PA 3WEXB 3HAEA 3G5VA 3P4NB 5ETUB 4ZUVB 2Q76A 4JM4L 4QHUB 5D6DA 3KXFE 5F7FA 3WNNA 5C07E 5CINH 4NN5C 3FQRB 5CIPB 4FQJH 3TM6A 3IS0X 3N9GH 2NW2B 1R3LB 4P3CH 1FN4A 1I4FB 3U1SL 5C6PB 2YUZA 1JWUB 3CSBA 3TYFA 3O3BA 1FYTA 1MRFL 1JNJA 1KB9K 3EYUL 3QXVA 4ZUTA 4JFPA 3NH7H 2OQJA 3FO9B 4UV7L 2EYRB 3RVXD 2BFVH 1CTOA 2C4FT 5HJ3B 4WO4B 1UADC 1V7NL 1FNSL 2DQJL 5D1ZA 4HHAB 1LNUB 3G5ZA 3I6LE 5T1LB 3QNYA 2PYEB 1EXUB 2R2CA 5DD0H 1JGDB 5BJTB 2GCYB 1F4XH 1S7TA 4PV8A 1V7ML 4HKXA 15C8L 4IRJA 1IAOB 2ZSWB 2YPLA 3PL6D 3Q0HA 5C0BB 3DO3A 2YBRA 4G6ML 4KY1L 1RD6A 4RNRA 1IC5L 2V5TA 1AQDB 3B5HA 5EBLA 3SOBL 3ARGA 1KCVH 1BVKA 2AV7B 3QEHB 4OD1H 2ICEB 4E9LA 4NJ9H 4P5MA 3TNMA 3ES6A 3CFDA 4I77L 5DD1L 1RZ7L 1RUPL 4HH9B 5HYQA 2YS4A 5CEYB 1EZVX 5TGBA 3EOTL 1X5IA 3LEVH 3B8SA 5I66A 3PQYB 4OLVL 4TSCH 1IGYA 4HQQH 1A9BA 2D7TH 3KYNB 3LD8B 2F8VA 3BQUB 5K9KB 1CL7I 3O2VL 3BN9C 1OAKH 3LKRB 1N6QH 1WFUA 3ZSSA 3MV7E 5C7XL 5I1AA 3MRRB 2HMIC 1X6LA 2RCSL 2YD5A 3HFMH 4QGTA 3DROB 2Q87A 1WK0A 2FH8A 2ITDB 1L9NA 5I73C 4OCXH 5J6GB 1R5IA 4KMQA 4G6JL 1JNLH 4RWHA 4OFIA 5BMFH 5C8JB 4X8JA 3KJ6H 4AT6A 1N2RA 3BKJL 3QISA 3UBXI 1QSEA 4WIQA 4X4YA 3DUHA 3QUZB 4BFGA 4BQCA 1B0GA 4K7FA 2QBWA 5IVZB 4HIJA 1OHQA 4I9WE 3UJIL 1ZTXH 3NZHH 2CIKA 1JZ6A 4TVPL 5GSRB 1MREH 5HHOD 4J1UB 1IAKA 4HPYH 3W81A 5EULV 5FEBA 1KJMB 5FFLA 4FZ8H 3OHXB 5KS9F 3RWCB 4ERSH 4N8PA 4JZJB 3D0LB 1A6VL 2RHEA 5IMLB 4HUVA 4Q6IB 4HGWA 3T0XA 1JPST 3OKLA 1I7TB 4G42A 5J13C 1VGEH 4P9ML 2IWGA 4C56B 1LO3H 4R26L 4ZFZB 3KYNA 4PJIF 2E6PA 4BZ1H 1NCBH 2HFFB 3V8OA 4NO3B 4AG4H 5DUPH 2XV6B 4OFDA 2XA3A 1ZLSH 4U1KA 4P4KC 5BXFA 4WV1A 2FL5B 1AD9B 1I1RA 3B9KA 3RWJB 3MJ8A 4V1DD 1R5IB 3VXTB 3IDIB 4FG6C 3B6SA 2R15A 1MJ8L 3VFRB 4MWFA 1A4JA 2GW5A 5F3HA 4ONHA 3CC5A 2EH8L 5HYIA 2FIKA 2JIXA 5BO1L 1OARH 5E2UH 4KKCD 2HFGL 4PGCB 5DQDL 2V5SA 4UV4H 2VDQL 2Z4QA 1UVQA 1UACL 2LFGA 5B3JE 2CDEB 2HH0H 4YUEL 3PHOB 4EBQH 5B39A 1W2KT 1T89A 4U1GB 3CFKA 4LLQA 5EO0B 2BOCB 2P8PB 3S37X 3V2AR 4R8WH 4X4XA 2E7CA 2E27L 2XZQL 2DYPA 3H7BA 2OSLB 1B0WA 1U92B 4PG2A 2UZYB 3IKKA 5E00B 1KTRL 3O8XB 4NHCL 1S9YB 3P2TA 1RZ7H 1G6VK 1D5BA 1NQBA 5AYUL 1QSED 1DLHA 4WGWB 4MYWB 4RX4A 1AHWA 3QDAA 3DVIA 4H8WL 1QBBA 5KSAB 3MLVH 1H3WM 1NGXB 4D9RE 1KB9J 2J6EL 1ZT7A 1DFBH 5TPWL 5FGBA 3T1WA 4JQXA 3PWLA 1ODAA 1HK6A 1QEWB 2ICWB 1U95B 3OAUH 5C0CB 2HAZA 3QXWA 3IKCA 1NCNA 4N8VB 2ZCLH 3OB0H 3EUUA 5I19H 5MEPB 3TN0B 1TTGA 3NPSB 5DRXA 4PYHA 4HV8B 1EHAA 1UM5H 1JHKL 4XPHH 2RJMA 4DGVL 5L7XH 3BHBA 4PY8J 2P44B 5F97E 2NX5B 7FABL 2DQFB 3TIEA 4OT1H 1KYOJ 2HLAA 2H2PC 1YNLH 4J4PD 3FRPG 1U8NB 1Q0YL 2V9RA 1QSZA 2BOBA 4NPYB 4JDVA 2YPKA 2VMFA 3T2PA 1S9WA 4B7IA 2W0LA 1JPTL 1SYVA 1TJHH 3BH9A 3AVEA 2HWZL 3QJHA 2CDEA 2G5BB 1LO5B 2Z8WC 5JW3H 1G7IA 3P73A 2NQCA 5D7LA 2CQVA 3ELAT 1UKTA 2UZIH 4KHXH 4X6EA 2CDGB 4OM1L 5DXWA 1I9JL 4UIMB 4DVBB 2CMRL 1KLGB 4HJ0C 4KDTC 1TTUA 5ISZA 4OLEA 3RPIA 4OZHA 3SDAB 4XVSH 1RK1B 1F58L 3BXNB 1A7PH 1N7MH 4CMMB 2V2XB 3TT3L 2CLRB 4DUXA 1A21A 3IT8D 3ILQD 1DQQB 1MFAL 3TO4C 4FS0A 1OM3L 3T2NH 3RY6A 3P9WB 3KJ6L 4KJYB 2IEPA 4I77H 5DD1H 5HGAB 2C3XA 3TC9A 2EDOA 1XT5A 2X4SB 1DCLA 2GJ6B 3VI3F 4NQTA 5FHBL 5GRUL 2PO6A 4KK9D 4DFIA 4RA0C 4JN2A 3VMNA 2HVJB 2ERJB 5GSVB 1C5BL 3D18B 4NYLA 1LO2H 4UOW0 4ELKB 3ARGD 5BS0E 4CADA 1YEEH 4I1NB 2ZKHL 4WFED 1RFDL 2EE6A 1D5ZB 4DUWA 3GSVB 1FGNH 1PFCA 2WLZA 3NN8B 3SDYL 3UTSD 2VR9A 1SJHA 2VQ1B 1ZS8B 3MV11 4AL8L 4K3DH 2VISB 1YJDL 3B9KD 4NCC1 5BRZD 4PLJC 2B0SH 2X9XA 4QHMA 4RIRB 4KTDH 1CDBA 3X14A 5JORB 3H3PL 4U6TA 1S7WB 3MLUL 3MRFA 4WUUD 1AP2B 3VXRD 3FB8B 4E0RB 1GIGH 1NMBH 1PY4A 1PW3A 2F15A 2ICES 4EIGB 2HTKC 4L3ED 2AJSL 1RVFL 1XGQA 4NSKA 1BD2B 1ONQB 4NWUL 3RDTD 2Z91A 5IKCB 4RZCB 2R39A 4X9GA 3WO3B 1E28B 4F9LC 4R4FL 5J6GA 1ZGLP 5SX5K 5DFTA 3HR5B 5ALCL 1AFVL 5ANME 3V8CA 3BP4A 4C58B 1DLFL 1ETZA 4GG6B 2O5ZL 1NEZA 3F7PC 4DAGL 4OQTL 1PYWA 1OGTA 2B5IC 2K7PA 4Y16C 2EIBA 5KG9B 2XG4A 5BVJA 2CSPA 1DVFA 4DUVA 5KS9B 4RGOL 2VZUA 3IU4H 3QXUA 3MA9L 4KAQH 5IFHL 4X7SH 1G9MC 2HN7A 3T0BA 4PTUB 5DMKB 2QADD 3A67L 5C6TL 3QFJE 3KPOB 3IETB 2HP4A 3PABA 3NABL 1OTSC 4MA7L 4L3CA 3B5TA 1QG3A 4FNLH 4PJDF 3RWDB 3CCHB 4BFBD 1Z6JT 1MIMH 3MJGX 4YDLC 5JO5A 5IEKA 2YC1A 5SX4I 2NZ9D 5DK3A 4UINL 3UTTD 5TDOA 5GISL 4M93C 4ZXBB 4KRPD 2BRQA 2R9HD 3MRPA 4Y4HA 2R0ZH 3W0WB 4WU7A 1PQZB 4ALAL 2BSSB 3KLSA 2PXYC 2W0PA 5JHDE 2BP3A 1MCFA 3U0PB 1N26A 4ZNCD 1NBYA 3VFMA 3MJ9L 1GJIA 1HHIA 3BP6A 5BOZG 2J6EH 5DJCA 4TUOA 2BSTB 4IIQC 4UILL 2QSVA 3FB7A 1S7RA 3GM8A 1CLZL 3GKWL 5TE6H 4K23H 1JBJA 4N0RA 4OZFG 4AEIL 1BEYL 1MCDA 1YPZF 5F70A 1ND0A 4HC1H 5EU5B 2Z8VC 4IS6B 1EPFA 1D5MA 4LSVH 4Y5XA 2E7HA 4JPKH 4Z7OF 3TVMA 3KPSB 1IT9L 4D0BB 3ZT5A 4CW1B 4GFTB 4JHAL 4LPCA 1DQTA 5JQHC 3O9WC 1MVUB 4UNUA 5D1ZD 1QPPA 3OKLB 5GIRB 5IWLA 4U1LA 5CGYC 2DKUA 3D25B 4TSBH 2GCYA 4RQQA 3S36X 5CGMA 4YHOL 3TFKC 2BVYA 5F6HJ 4OF7A 5GGSB 3O6FC 4QHNA 4YR6B 2RB8A 3F7YA 4XMKL 2HFGH 3FO0H 1CLYH 4P2RB 1ACZA 3UXFA 2EDDA 2OR9L 5EBLB 4UDTA 5F1OB 1QUNA 2YZ1A 4Y2DD 4R96B 3OR7A 5DURD 3OGCA 4JY4A 3C09C 4NT6A 1JIBA 3TNMB 1WIPA 3STZB 5TDOB 5DMYA 1YYLH 3E8UH 4MQSB 1ZEAL 2XFXB 5CP7B 5KOMC 3CFCL 5GZNC 1T1YA 5L9DH 4MZ3A 3QUZC 5TE4H 4HFUH 2UWEA 5JW4Q 5AYUH 4LSRH 3KAAA 3EYVB 4Q6YA 4JKPH 5F9WB 1KCUL 1ZS8A 5BS0A 3EHBC 3QRGL 4U6YB 2H3NA 1ES0B 3DMMA 4U1NB 4KXZH 3DROA 5AYQA 4PJFF 3HE7D 1HI6A 2KDGA 3V0VB 4P46B 3VFSB 3SCMD 2P8MB 1G7JB 1KIPA 5M94B 3MLRH 4J4PA 3UAJD 4N68A 3LN4B 4PR5B 3HPLB 3RAJH 4BZ2L 4NPYA 2C5DC 1HSAB 3VWJC 1CD1B 3GHBL 3LMJL 5B39G 2B2XH 3HC4H 4BSVA 3WNOA 2YSSB 1ZA6A 2NY0C 4RMWA 3U82B 3LV3A 3GSQA 2F54D 2R1WB 1FZJA 2EE3A 4AIOA 1U3ZA 1P9MA 3MREB 3VGHA 1F97A 2Y7QB 4IRJD 3OV6A 3QDJA 3DIFB 2R1XB 1HIML 1FNGA 3WO4B 2E27H 2XZQH 5HPOA 4OTXH 5FYKU 5HHOB 1NAKH 4OLUH 4U31A 12E8L 2D4DA 5CBAA 3ARXA 4HAFA 3QEQE 4ZAKB 3RY5A 5BS0D 2HJLA 1MI5A 3EGSA 3T4YA 1VADB 5HHOE 3RWIA 1G9NC 1FJ1B 2ED7A 5GGQL 2X5PA 1UH3A 3QIUB 1QBLH 2NY3C 5BO1H 5DZOA 2P42B 4LPVA 5EUOB 5H94B 5EBGA 4C55A 2LU4A 2G75A 4JFED 3ALWA 2RR3A 3DVGA 3WDIA 4OGXH 2DMCA 4M5YH 3BPLC 5HDLA 4OLYH 1XH3B 4ZTPL 2BJMH 1JTOA 1DJSA 1S78C 4BH7B 2O5XL 5BZWA 4QXGL 4CN4A 4FXKB 5D1QC 1T80A 4U1JA 1SJHB 2VQ1A 1B2WL 1X5LA 4NUGL 1MCPL 4GW1A 4I3SH 5IBLD 5C0NC 4PJ5B 5TDPA 1PZ5A 2GYSA 3ZKND 4R7NB 4NNYA 4M48H 4PJXB 3U30B 1OT1A 1Q9OA 1T0MA 1HQRA 1IAII 5JOPE 4OCXL 2DI8A 1QFWI 4UUJB 4Y88A 1DN2A 2PR4L 2JK5B 4TNVK 3DSNA 4HWBH 4PJ5E 1EH9A 2P8PA 3P9MA 5I16B 2OJZH 4YAQA 3OKNB 4P23B 2B4CL 4K7PL 5E00A 4LCIH 3QQ3B 4OZFH 1II4E 2JE8A 1RZGB 3G6JA 4U2YA 3LQAC 1H5BC 1HCFX 3QT2A 2D03H 3VFUB 2NY2D 2DQIL 2DQHL 4KJPC 5KJRH 3KJ4B 2AK4B 1I3GL 4ZQKB 2M2DA 1H9VA 1NCWH 4YHLH 3RKPA 1BEYH 3MRGA 1C08A 5CCKH 1CGUA 1RZFL 1UJTA 5JA9A 3PV6B 5F7DB 4KH2A 3LHPL 4ZOAA 3EDFA 1EBPA 3G5XA 3ZHLA 3AREC 3VWKD 4XP4L 5CKAA 4OF0A 4P4KA 3BX7C 3CSGA 3NIGF 4RRPA 5JHDD 4OLZL 1QSVA 1S7QA 2R0ZL 4TSCL 4KTEH 4POUB 5J1SC 1MI5D 2JJUA 3U30C 5D7JD 4O00A 3AB0C 3RWHA 2CLZA 1IFHL 5IB2A 2P8MA 4D3CH 5B38G 2DDQL 5FYLE 4AIZB 4LDOB 5DEFA 4OLVH 4PY7A 5E5UB 4ZUUA 2HJKB 1ZAGA 3DSFL 1H3TA 2KQNA 5JHLL 5CD5C 2GITB 1PYWB 4L4TA 1CD1A 4U7MA 3QUZD 4NZRL 2P7TA 1MCKA 4P3DB 2L7UA 1QFWL 3FCTA 2WP3T 3RTQD 3A6BL 2GK0A 5KW9H 5DVOA 3CVHB 4LBEB 1A2YA 2APXA 4L3EB 3PHQA 3HUJA 4EKXA 1EO8H 5I9QC 2VDKH 5FV2A 3WYRA 43CAB 5EU5A 32C2B 5HSFA 1I8IA 4HUKB 3LCYA 5IQ7H 4JDZB 2ITCA 3OKMB 4PRID 4PJGB 4AMKH 4J6RL 4Q2ZA 5CJXC 5ALCH 5ID0B 1UM6H 3SQBA 4QGYA 4HDIB 4GKOA 3MLWL 2H32H 5FKAA 1FO0L 4XVUD 5A3IC 4ORGA 5KN5B 5CZXC 1OAXL 4PJEA 1FPTL 3PWUB 4GW4A 3V4UL 4PV9A 3HC3H 5E2VL 1JPGB 3FQTB 1VADA 5EORL 2X6MA 3D48R 3ECBA 3RVWD 3V0WL 3HRZB 1D5ZA 1TJIL 3O6FA 3TCXA 3X12A 3MNZB 2D31B 3FOLB 4KDTA 3OGOE 4ZFGH 5EIIA 3PWJB 1MPAL 3B9AA 1AGDA 2BVUA 2ESVA 4ZPTB 1PSKH 5I0ZA 3D69B 4PJDB 2UVEA 4ODTL 4WO4D 4NGHL 5FUZH 4AEIH 3WO4C 3K74B 1NMAL 1AD0B 2E5EA 3D9AL 1PDKA 1VFBA 1DLFH 1X5XA 4PJBF 3RGVC 3WDHA 4UT6L 3IXTB 2BRRL 1KLUB 3NCEB 1EJOH 2V7HA 4L29B 3VXMB 4ELME 2PYFB 1RFDH 2VITA 3ULUD 3V0VA 1TCMA 5FM5O 4Z7UF 4J3UA 3KPRA 2XRAH 1NCUA 3F7YB 4Q9RH 3ZHKA 2NYYD 4QRRB 5JMRA 2BNRE 5CD3A 3ULVH 4JR9L 2NNAA 1LGVA 3QFJA 4HEPG 3FONB 4JPVH 4CBPA 5EU6B 2YRPA 3GSOB 3T0VA 2QADC 3G6JB 1IAOA 1EDQA 5ECJE 2Z31B 2DKSA 3H9YA 3GFUA 4PJBE 5ESAB 4PTUA 5AAWA 1KBGL 2C4FU 3MUJA 4P59H 3V4PL 1T5XA 1YEFL 1AKJD 2VXSH 3C09B 1BQUA 1DBKH 1TVHB 4OLZH 5A1AA 1AXSB 4NZDA 5EA0H 4KJQD 3TYGH 3NFNA 4I4WB 2R56H 3BDXA 5IW6A 4OI7A 4UTAL 1UB5A 1T1XB 2F53A 4JAMA 5I0DA 4NQCA 4GXUN 5HHOA 1G7PB 4KK8D 4PREB 4O02H 3MRLB 3ZL4H 3BZDA 5FK9A 4LRNL 1MNUH 4G6AD 3O9WB 4WGVB 4OI9A 4G7VL 5K9KA 2P49B 1TJHL 1C7TA 1NFDB 3U0PA 1OCWH 4NZRH 2EC8A 1E4XL 3TPUB 4L9DA 3HMWL 4YNYB 3LEYL 4NRZB 3QEGL 3G04A 5IF0B 5F9JB 2LU3A 2XNAA 3WV0A 5D7SH 3ME0A 2ZNXA 4LCIL 3B9KC 1N4XL 3KPRB 4XC3L 2MCPH 3DRTB 5I1JL 2W0FB 4ZUWB 4FRWA 2IALB 1D5MB 4Y5XB 4PGEB 1T20A 4QRTB 5GJSL 5BZWB 2ARJA 5EBMB 5D71L 4F9LA 4G9FB 3WS6C 4GBXD 3H2WA 2DQCL 2NTFA 4XWOC 4M48L 5CIPH 3W0WE 4AEFA 3LKSB 5DVLA 2JCCB 1T66D 2PTTA 3QDGA 1T0PB 1YUHB 2EDLA 4IRSB 5IHZA 3HUJB 4KQ3L 3CX5K 1YQVH 5EPMB 3ORJA 3WBDA 4XP9L 1NLBH 2AEWA 3RJQB 1MCJA 2W92A 1JV5B 1LNUA 3G5ZB 4HHAA 4XVJH 2GTZA 3BZ4B 3NCJH 5BW7C 3RWCA 4Y19B 5BRZB 3WJJC 2PN5A 5BW7A 4Q6IA 5I1LB 3MRKA 3MZTA 2GJZB 4O58H 3CXDL 4WFFD 2CRZA 3BGMA 4QY8B 1ZT1B 4ZSOE 2UWEE 4OQTA 4WUUB 5DJAA 5JPNB 3REVB 1UB5B 4Z7UA 1K4DB 2FWOB 2BVTA 4PV9B 4HLZG 3ZDZE 2BVQA 1TETL 1W72B 2GK2A 3BESR 5C9KA 4UQ3B 5C0DB 4L4VD 5CP3H 5C0JB 3FT4A 3TIDA 5L8LB 2DD8L 3C60B 3DOSA 4HCRA 1BBJA 5JO5B 4DEPC 5HI4D 1YMMA 2OJZL 2J8UA 2VE6A 2VR5A 3O3AB 4N0FB 1JWSB 4OBSA 4APQB 1MCOH 3VXTA 1ZVSA 5JW3L 5I8KL 5KZCD 2BZDA 1JYVA 1PQZA 3SE8L 1H3PH 1B0RB 4KKNA 4LEOA 2GTWA 5JXEA 3VFPA 4NQCD 4MLSA 4Z7UE 5H2BA 3T0EC 4J3OC 4FQPA 2YRLA 1RSFA 4PG9B 3C8DA 5TQ0L 2J8UF 3OAYK 1CBVH 3KPLA 5FOBB 3VXMA 4LLYB 1SY6A 4LIQE 4X5WB 1SMOA 3RWHB 5IROC 1KIQB 1M7DA 1ND0B 1CQYA 1NCDH 1NGPH 4JRWA 5E2UL 5F6IC 1PZUB 1K4CA 3DURB 4NQDE 1D5IH 4KK9C 5IEHB 2FZ3A 1OOAA 1IZKA 3GSNH 3QUZA 2FRGP 5CJ8A 4H5SA 2A73B 3O3DA 4YK4B 3GSOA 9CGTA 3O4LD 4R4ND 4R97B 2H9GB 3RKDC 2BMKA 2CIKB 5EO1B 1FZMB 3WN5C 5L0QC 3Q6FB 1A6UH 1AO7E 1KXVC 2DMKA 2IMNA 3VGDA 3QRGH 4LVOB 3WKNA 1D9KD 4M3KB 5KSUB 1L7IL 3K0WA 4CADB 5ADPH 2BJML 3OKOA 3DUUB 4QRPA 3NFNB 4I4WA 2CKBH 3RGHA 2A77L 4S1QH 4JAMB 3TH2T 4HT1L 4PJFE 2C7UA 1U8HA 4ONFL 3S4SB 4JKKA 3U0WH 2OR8A 4OM0H 4KZEH 4OZFA 4JFDB 3TIEB 1ZLWH 1U36A 1BAFL 2WNGA 2D0GA 5ICXA 3VXRA 5E8PB 5DQDH 2DQGH 3HS0B 1ZA3A 3QDMB 3VI4F 1AO7A 4XRCB 4XMKH 3L7EA 1FN4B 4UNTA 1SMAA 2X41A 1GGCH 4F3FB 2CUHA 1AKJB 3LEVL 4F9PC 4GLRI 2VAJA 2QKIB 4UDUB 1KGCE 4PJHF 3G9AB 4OZ4B 3T65B 1V05A 1A1MA 3K4DA 3ARDC 1LD9B 3ULVL 2P5EB 4X80H 1IEBA 5DHVH 5DVMA 35C8H 1CYGA 2GJ6D 2A6IA 4HXBL 4HK0A 2UY6A 3HB3D 5BVPH 1HN1A 1CLZH 4LRNH 4WEBH 2R9HC 2JIXD 3RKDD 4U6HA 2DIJA 3IU3A 3QZWG 4A2MA 3RIAF 2MKWA 1ZK9A 1KJ3H 3EOBB 4K07A 2ZNWA 3DX9B 3TN0D 2OSLA 2PTUA 5GRXG 4PJBA 1K85A 2VH5H 5JOPD 3FL7A 1OTSD 3QWRA 1XGPA 2JB5H 4TVPD 5HHMD 1JUFA 3FO0L 5HHVH 5D9SB 1GZPA 3OJDB 2XT1B 2IADB 4WJ5B 3X17A 3UTPE 3BZFB 4WW2B 1KCVL 5HVHC 3O8XC 4LCWE 1DANU 4UMGA 5L9DL 3S35H 1ACYL 3O6KL 4NWUH 3GSVA 3HC3L 4OZIE 3EDJA 1WFTA 4WHTB 4ZFFA 5DSCB 3SGKA 3V7MA 5DRXB 5D8JH 5C92A 3PL6C 2KKQA 4I2XA 3BWAB 2FJFA 4F37F 5EZJB 3KS0H 4XBEL 5MEND 1YZZA 4FMFA 4YEEA 4M61B 1LK2A 4AENA 3QWQB 5HHQA 5FDWA 3VFNA 4Z78B 2VXSL 1I1FB 3RRQA 1PKQB 3QIBB 4NO2A 5D93C 4CNIA 1RMFH 3U7WH 1B0GB 3B2VL 1F4YL 4B0MM 1U3HB 4N9GA 2Q8AL 1QA9B 3CX5J 5I6XB 1D5XA 4PRDB 4HK0B 5CILL 3BUYA 4D9QE 1RZKC 1MHEA 5KTEH 3OXRB 3JVGC 4XXDB 4L8BA 3V7AG 4IRSC 1W72L 1P53A 3S8WA 1FHGA 3QDGE 1MJJA 2FD6H 2OXGA 4L8SC 4OD1L 1MFCH 4IRJC 2BERA 4HMDA 2HN7B 1RK1A 4V2BA 3QH3B 5KS9A 1LEIB 3D85B 3AMLA 4ODXA 4WI9A 3CFEB 4XVTH 3C08L 2OS7A 4BJLA 4XNQB 3VFWA 5DD0L 2C4XA 2VABA 1I1AD 1VFAA 4HKZA 3UAJC 1XR9A 4S1RH 4Q58C 3ARUA 3QIUD 2A6KA 4P5MB 1C8PA 5AD0B 5HI3C 3DHMA 1IGIH 3L95A 5F7YC 1SJXA 3VD9A 2VLJB 5IROA 4QWWC 5IQ7L 3KWWB 5J06A 1K4DA 4LIQL 5CEZD 4WWKB 4HBCL 2KBGA 4L5FL 1KEML 4HIEB 3HI1B 3ZZ1A 4OIBA 1M7IB 5BV7C 3ZDXE 3OWEA 4WU5B 4WU7B 4DGIL 3D87B 4LCYB 1I7ZB 3VFNB 2X09A 3WFHA 4MQ7A 1FPTH 35C8L 5DJ2A 2R2BA 3BVNB 5IB4A 4Y1AD 2BY3A 4PJ7B 6FABH 4BSVB 3ZE1F 5KVMC 3FJTA 3SGJC 3CFIC 3S6CA 2V7HB 4L29A 4OZ4A 4AYFA 3MV7A 4J6RH 3HB3C 4Y4KB 5FGCE 2AJZA 1Z9LA 4YBHA 4KJQC 1I9JH 3DUSB 1LP9E 5DMIL 1T03H 4DN4H 3VFPB 2J2ZA 4YHPA 4O2EB 25C8H 2IAMA 5HY9B 5BRZA 2BC4A 2PR4H 1CD9B 4HK3J 4WI6A 3ZSTA 4EDWH 3FOMA 4TRPH 3ZTNH 4FFYL 2O61A 2DLIA 3PL6B 1BD2A 1RUKH 3IF1A 1TQCC 5JW4M 5I1GL 5F7MC 3QXAA 2VL5A 4I13B 4BFIB 4NQDA 5DJ8B 1DLHB 2X7LA 3LQMA 3U48A 3UTZA 5D1ZC 3LVEA 3STBA 4PRIA 3SBWC 4MAYA 4JRYD 1FVDA 1HQ4B 1R0AH 3PWPB 4Q74A 4NIKB 3BIBX 1VFAB 3S7GA 4MCZB 4S1QL 1F42A 4XB8A 1E0OB 2W9EL 3L95B 1O7SA 2ZCHL 3V6ZA 1J1OH 4ORGB 2VDMH 4XPFH 2VWEC 1HH9A 1S7XB 4KI5F 4G8EA 3O2DH 4IRJB 4XPBH 5GGUB 2G2RA 4JO3L 2YHGA 3L9RA 3NPZB 4ZFOL 3EJYD 5FA4A 5IVXF 4ELMB 4U1MB 4X98A 4Q9QL 3KPQA 4NCC2 2NW2A 4Y4KC 5E99H 3RHWK 4N0UE 1BREA 3ARPA 4NKOB 4PBWD 4R2GC 4P23C 1PAMA 4OQ1A 5BS0B 5E6ID 5GRUH 1KG0B 4MD5A 4CVXA 1NCWL 4YHLL 1B6DA 1T22A 3RY6C 1Q9KB 2OTUA 1HIMH 3GJEA 3MV9D 4KVNL 1ZSDA 5J6HB 4U1SB 2NLJB 1VESA 5D1ZB 2FIKB 5GS2H 1JN6B 4R8WL 4NP4H 3NZ8B 1LO0L 4HWZA 5IW1A 3U7AA 3P0VL 3SO3B 1ZA6B 4LGSB 3QQ3A 1DSFH 3PGCA 4E5XB 5ACZB 5D1QA 3RVTD 1QFWM 1YUHA 3LKOA 4WY7H 4X6CB 5KSAD 5ESQA 3T3PF 5IMOB 3P11L 4ZAKD 1OARL 4CN1A 3LS5H 2DLFL 4JQVA 4W68A 2YZ8A 1Q72L 1OF2B 4DVRH 3WLWD 1WICA 1CXFA 3V5KB 4QOKD 4C56D 4HF5H 3CVHH 1VENA 4A6YH 5IM7A 4BSWB 4JFOB 4XBGB 1E4XI 3IDXH 3PQYA 1CDGA 4FP8H 4OCRH 1ZLSL 1R6VA 2HVJA 4EI6A 1E4XH 1CWVA 1BVZA 3UO1H 5ICXB 1WBYB 1AGBA 3VWKA 2E9JA 5HI4C 1FYTD 3NVQA 4LU5L 1H3PL 3BT2L 4NQED 3MX0A 5T3ZE 3MYJA 4RRPG 1IGCL 2WW8A 5L7XL 2I9TA 3DVFA 3ZLQC 3ZE2F 3MLXL 1AXTL 1AJ7H 1ZHLA 4H0IA 5BZDB 2XN9B 3WFBH 1WEJL 1I85A 2QHRH 4YXHL 4KDVA 5T3XD 4LLMB 2WUCH 2CKNA 3T65A 2XZCH 1X9QA 4GRWE 1A9EA 5SX5H 3OB8A 3FB8A 1FFQA 4KK6C 3MRIB 4H20H 2E9IA 3W9DA 3MLVL 1RZJC 4H1LA 4PJHE 3GKWH 5TE6L 1QRNB 1S9VB 2WANA 5I71C 1NGQL 3SO5A 5JXED 4MA3A 4JZOB 2F74A 4JLRB 2FL5A 4GAYB 4Z95H 3SE4C 1J11A 5HD8D 2V5MA 3KYKH 3VXQB 1DSFL 4D9QD 4YQXL 3S88H 1EAPB 1QRNE 4NHCH 3UTSA 2EYTA 3D3VB 1A6TB 2FGWL 3CSYA 5C0IB 3EO1B 2ZOKA 4KPHH 3F7QA 5D7LD 5ADOH 1NH6A 3DURA 3U4BL 4HUMB 4PJCA 1JRHI 1WC7B 4FQ2L 3P9MB 3IF1B 3UC0H 4H0GA 2DTSA 1U3HA 4N9GB 4RA3A 4ZD3H 1U0QA 3VFVA 4G42B 1I7TA 2R29H 3VFOA 2ADIB 2FX8L 1KLFA 1I75A 4NCDA 3I6GB 4WNQB 2BHYA 5CLTA 4XHQA 5C0AA 4HGMA 1QPXA 4XTRC 3KPOA 5HVFB 2IFFL 5K9JH 5A2FA 4Q9QH 2X44D 3PJSB 5I74B 3FT2A 5IFJB 4M6AA 4Q0XL 1OD7A 3MA9H 4KAQL 5F44A 5GRVL 4ODHL 1WWCA 3CIQA 3REVA 3NOIA 5EOTA 1N0LA 3GMLB 5I1IL 3DRQB 2AEPH 1MPAH 3AROA 4PJIB 4MA1B 2VXVH 3U9UA 4C83B 1P4LB 5LCVL 4BQ8A 2J4WL 2X1WL 3CDFA 3QUYB 4ODXB 1VCAA 4PJIE 1CZ8L 3QEGH 5DDHB 3GSUA 3BE1H 1BLNA 2HLFD 1MHPL 3B3IA 2FHCA 5B22A 4AEEA 1AO7B 1CN4A 2Y9RT 1S9VA 2NY4D 1RVFH 4GT7A 3U36B 5M7QA 1A14L 3JUZA 3E8UL 3SKMB 4ODWA 5HYJA 3HI5H 4L8CB 3FN3A 4E0RA 5I8OH 3KPRD 1T21B 4WU5A 5J3HD 1FGVH 3SE9L 1UXSB 3L6FB 4X4XB 4TULL 4F7EA 2O5ZH 4XVTL 3V6OC 4AZ8A 1WBZA 2J6EA 3NIDF 1KBGH 3BKYL 4U7KA 3D0VB 2ZUSA 4JFDE 5BQ7A 3AM8A 4YK4C 5ICYA 1K8DA 1LP9F 3EZ8A 3SDXF 1OD9A 2WP3O 2D3VA 3QNXA 2PXYB 2AS5M 3MV7B 4P59L 2MKLC 4R3SB 2FSEA 1J1XH 3D39E 3P0YH 4LARL 4LHUG 4U4BA 3ZE1E 4RFNB 1DVFC 5E8DH 2NMSA 5HY9A 1T2XA 3WCYA 4V1DA 4N0YH 3HPJB 4DCQA 3P4MB 3K1DA 4QRRD 4X7DC 1ZHBA 5DK0B 4ZXBD 4PRPA 5MEPA 1S7TB 1XMWA 1BFOB 3DV4A 3REWA 5DMKA 5GS0H 4PJEB 1FE8L 2ZUWA 4MXWH 2VYRE 4AL8H 3WNLA 3P0YL 4LARH 1IKFL 2GJ6E 4KHTH 8FABB 1A7BA 4MAYB 4NFCA 2X4UB 3TF7C 3GRWL 3MR9A 2FEEI 2OLDA 3MRNB 2DQDL 1OVZA 1N6UA 1QBAA 2P8LB 1WAAA 2VC2L 3ARED 1F4AA 2Y5TB 3VWKC 4NKMB 3FOLA 3JWDC 5FM8A 5MERA 1KN2H 4FHBD 1LILA 4PRPE 3MV8A 3WFEL 1KF9B 1JCKA 4MWFB 3W9DB 3IDNB 5JDJA 3TH3T 1T83C 2ARJB 5T1MA 3A6BH 5KW9L 3P4OA 2AQ1A 1S7VA 4WHDA 1G6RL 4I0PB 5HHNA 3M1BA 3O45B 3NFSH 2W9LA 1EAPA 3V95A 1RUQH 3RWGB 2X10A 4OKVB 5HYFA 5JZ7C 4UT9L 2NZ9C 5FYKL 4U3HA 1M4KA 5EN2B 2UZIL 4KHXL 4R0LB 2A9ML 4YZFE 5D96B 3TBYB 4YHYC 4UU9B 4GG6E 2ZUXA 3BRDA 3VFOB 1I8LA 5F7KC 3UYOD 1AIFA 4NZUL 4NQXA 3IJHB 3RWFB 1MFBL 2H8PB 2XICA 2AXHA 4F57H 5KSAA 2AABL 4WI5A 4ZAKA 1FYTE 3KR3L 4K7PY 1TVHA 5FYKD 5GJTL 4O2FB 5F1SA 2X70B 3C5JB 5L2JB 4K9EL 3U9UB 4MJ2A 3Q2CA 1D3CA 1NFIA 3K7UA 3H3KA 4P2OD 3BP5B 3G5VB 1JRHH 4ZUVA 5E03A 2Q8AH 3M8OH 2ZPKH 4S1DC 4WRLA 2NY5L 5DMGC 3SY0B 3I9GL 5DWUL 1FNFA 1C12A 1DP0A 5CJBA 1NC4A 1MEXL 2VLMD 1FVEA 3QXDB 4OM1H 2F54E 4R97C 1OP5H 3U0WL 1RZFH 4M7LH 5BRZE 1G1YA 2ZOLB 3STLB 3LKOB 4YNYA 4M7KL 3UTTA 3QJHB 1G7JA 1KIPB 3IGAB 2FX9L 3QQ4A 1UFUA 4RMVA 1UH4A 3JZ7A 1A4JB 2UV3A 2WUCL 5D8JL 3WIFA 1BQSA 1CDUA 5SV3A 4F7EB 2EEAA 1EEQA 1JF1A 5SX4H 1VFBB 4GO6B 3PIQB 1IQWL 1OGTB 2FLRT 1LWRA 2QR0A 2XTLA 4FQHA 1H3GA 1E6JH 1JHTB 5J1AA 4AEHH 3IJHA 4LQFL 3T0EB 5IMKB 3L3HA 4G6FD 1WSST 1EMTL 1YN6B 5GS1C 4PJAB 1T1WA 4HKJA 4XWGL