2R4RL

Crystal structure of the human beta2 adrenoceptor
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
214
structure length
214
Chain Sequence
DIKMTQSPSSMYASLGERVTITCKASQDINSYLSWFQQKPGKSPKTLIYRANRLVDGVPSRFIGTGSGQDYSLTISSLDYADMGIYYCLQYDEFPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Beta-2 adrenergic receptor
publication title Crystal structure of the human beta2 adrenergic G-protein-coupled receptor.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2007-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r4rL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r4rL01
3ARXA 1QFHA 2VYRE 5C9JB 1T6VN 1I9JH 3O2VH 1FNSH 3VD9A 4C4KT 2JK5A 3EFDH 4R4NC 1QP1A 3MLXH 5C0JA 4LSRH 4HX1B 2XACC 1AGBA 3KHQA 4X98A 3TO4A 3U7AA 3LKRA 3QP3A 1ZLSH 2YHGA 5LWYL 2WMPA 1IAII 1XEDA 3FQTB 2HKFL 2X5PA 4LPTA 2J8UB 3QDGE 1D5BA 5DD1L 1XGYH 1MPAH 1F90L 2VQ1A 4P5TC 1KG0B 2JELL 2IQ9H 3ULVL 3VU2A 4X6DE 2WWKO 2AJ3A 1DVFA 4JO3L 2LAAA 4L1HA 1Q72L 4UUJB 3KLAA 4P4RA 3HE6D 3KPMA 4FTVB 5C6WH 5C07A 4CRPA 3QIBC 5MERA 1H9VA 3GK8L 3D69A 1NDMB 5KSAC 3GMRA 4FQXA 4KKBC 3SDDD 2HWZL 2ICWJ 3OZ9H 4X7SL 4YHOH 3I75B 3TA3C 3U7WL 1J8HB 3KPRD 1DP0A 1UGNA 5AZEH 3UAJD 3O6FD 4UT7H 3QEGH 3BIAX 3PP4L 5GRVL 1BBJB 1U3JA 2LU4A 3BEWA 1A9BA 4JVWA 3SKNA 2YSSB 4NO0D 3QPXL 3EJJX 4UOW1 5KVDH 3C5ZB 4TUOA 5FYJU 3MOQA 3TWCL 5IMOA 3FFDA 3WNKA 4IM8A 2Z0BA 4GG6B 4L9LB 3FB7A 4JHZA 3QXAB 4XCNA 5I66A 2I9LA 1IAIL 3IXTA 3RJQB 4QHLB 5H2BB 4BQBA 1S7UB 1TJHL 5BV7C 3ALWA 4X6EA 2XQBH 1CXIA 4F15B 4N8CL 1OCWH 2ICEB 3JUYA 2V2XB 2WZPD 1R5WB 4S1RL 1RULH 3DURB 3MOBL 3TLRA 3TP4A 4OLXH 4IS6B 1PKQB 5EU7C 3KDMB 1QFWL 4Y8DC 1SJXA 3DETD 4FQIL 3CH8A 3QULB 3RUGA 1BQLH 3MV9B 4KKAC 3VE0B 3BUTA 5F6HI 2EDWA 1UZ8B 2EYSB 1CGTA 2B4CH 2NY3C 5IVXB 2AQ1A 1MIML 3QUYB 5E6ZA 5F96L 5IFJA 1RIHL 1ZKAA 1B2WH 2GAZB 3W82A 2IH3B 4K7PL 3B8SA 4OD2B 5IT2L 3FB6A 1IAOB 4WUUE 3V5KA 3HCVA 1I8KA 4LU5H 5HGAA 5F3BB 3QQ4B 3IDXH 3SCMD 2VTFA 3LMJH 3TVMC 3H3KA 5FHAL 4MXQC 3VXUD 3BKYL 1JF1A 1FJ1A 4YO0A 1LE9B 2AS5M 1KB5L 1T1YB 3MV8B 1AGEA 3HNTL 5FGCB 1M7XA 3S88L 5LCVH 4OLUL 3OAZK 3U9PH 2J8UF 5ICYB 5I8CA 3FN9A 3UC0H 1N6QH 3RVUD 4NQUA 5GS0C 3QFDA 5KZCB 1HH9B 4JFDD 5DWUL 1NFDE 4S1SH 4OGAD 3O4LD 1UXWB 3OB0K 4LPXA 3OQ3B 3FMGL 4YDIH 4KKLD 5E00B 3T0EC 2BNQA 3LKSA 1PBYA 2AXGB 2AJVL 2H3NB 1S7VB 4FQQA 1HKLL 4YGAB 1OSZB 5FYKE 1T1XB 5IHBA 2IC2A 2DMCA 3P30L 4YHKH 3W0WA 1SYSA 3PHSA 4LRNH 1F13A 1KLFA 4R6UA 1MCNA 1ZHBB 4GAGH 4BZ2H 4RMQA 5CJOH 2ATKA 4RGMC 2X1OA 4PJAA 3VI4F 5E9DE 4NHCH 4PJXF 1MFAH 4AENB 1FIGH 2R1WA 2HTKD 4F33B 1QSEB 5DS8B 4KDWA 1FNFA 1NAMH 3I50H 3DMMC 4JKPH 4OBRA 4GG6F 3HNVH 2FO4A 2DQGH 2WBJC 4RAUA 5HD8D 4R2GC 1QR4A 3QDMB 3FOLB 3HI6H 2P46B 4HXBH 3P4OB 1KEML 3NGBB 5DC9B 3RY4A 1EUUA 1QLRA 2F9BT 5EIQA 2R0ZL 3OJDA 2ZG1A 5I1IL 3S4SB 1PVHA 3K4AA 5EOTA 5EBWB 4XPAL 4UIKL 5DHXB 1KPRA 5ANMA 3RVTC 4PRDA 4OKVA 1OAKH 4U6HB 4U7MA 3BYTA 5EO1B 5T3XD 3BGMB 4L29B 5IVXF 1BGXL 5B4MD 4HXAH 1ED3B 2JB5H 5EOCH 3WKML 2CKBB 5IK3B 1EGJA 1VGKA 3C8HA 1JNHA 2PW1B 2Y36H 2ZSWA 3NTCL 3RL1B 3BJLA 1U93A 4LCWB 5D7SH 5ENWB 5EUOE 4WVRA 2A0LC 4GW5B 5EO0B 4MCYA 1A1MA 4QHMA 3VRJA 3B5TA 1U8PB 5SX4H 1ZS8A 4LSTH 1C16B 5HHPB 4QRRD 3ARFB 4M8QA 1E4XI 1NANH 1PAMA 3NCFB 2A6IA 3TBSA 2X4RA 4MWFA 2Q8BH 3L95B 4Z6AT 2XKUA 3VRLF 3B6SA 3WKNA 2X42A 4A6YH 2F19L 1OTTD 3TV3H 1FLRL 2E3VA 4BKLA 3L5JA 3AS2A 2NY1D 2V2TB 1N3NA 2D31A 1HILB 3QAZC 3WDIA 3B2VH 3BSZL 5CS7A 5CGYD 1BM3H 2YPKB 3UTTD 1ZA3A 5I1GL 1VFAA 2E27H 4ORGB 4YDVB 1G6RH 1YEIL 3MO1A 2D7PA 4M00A 4G9FA 3ARED 3FZUC 1TPXB 3REWA 5J1AB 1IAIM 4ZODA 3KPSA 4ERSH 1KCVL 1XT5A 4L8SC 1II4E 2CDGA 4NP4L 4H88H 1G7IB 1V8HA 4LAJH 3QRGH 4H8WL 1U0QA 4U1NB 4NJ9L 3EGSA 1AJ7H 1U58B 4ZFGH 3RWEB 2VLJE 5JXAL 4QOKE 1JYXA 3CVHH 2Y07H 3SE4C 1QFWM 2W9DH 3EDFA 3J8F7 2BSRA 1HEZA 1Q8MA 1OD7A 2IBZX 5CKGA 1XIWA 5K9OA 1KTLA 2FATH 2GIYA 4ONHA 4PGZA 5KSUA 4YPJA 1CL7I 3FFCB 3UYRL 3LH2L 5E2UL 4HBQA 1CLOL 4C4KO 1IBGL 5JIHA 5GGRA 1MLBB 4XCEA 1EAPA 3RGVB 2Q7YA 1FV1B 3Q6GH 3L5XH 5TPWL 2D03H 1RUKH 15C8H 4L4TE 2BK8A 2YOCA 4P2OA 2QHLA 3VWKC 4YHIA 5HHXL 2G5BB 1D5IL 5F9OH 1MRFH 4JDTH 3PWNA 1XCTA 5IHUH 4MCZA 3FB8B 3PABB 4N1CA 3SGKA 4N1HB 2R69L 3IJHB 2R0WL 1I3GL 3DTXB 2JCCB 2ORBL 3VGDA 5EORH 4GRWB 1I4FB 3S8WA 3BMWA 5BS0A 5I75C 5F97E 4OLZL 2CLVB 1A6PA 1FZMA 4X6CE 3TPUB 3VFGL 1JJUA 3DI2B 5DLMH 2MTPA 4NKDB 1IGTA 3BKCH 1F45A 4U7KA 3QNXA 5HYSA 5IUSA 5D1XB 1YEGH 5GJTH 1DQLL 1H3XA 5DTFA 5I6XC 4Y2DB 4LDEB 2P24B 5DGQA 4WRLA 5DXWA 2DYPB 3HI5H 4X5XA 1OT2A 1IARB 4FNLL 3P0GB 3MRQB 4JFFB 3B3IA 5KTEH 1CGSH 4GAJH 4Y4HB 3D2UD 3FT3A 3L1OH 3MX0A 3E1F1 4JKWA 2A6DB 4K8RL 1GPOL 2ZJSL 5CJBA 4WI6A 1GIGH 5JPNB 4NJAL 3JV6B 1WBZA 2A6JB 3ES6B 3HE6A 2YZ8A 1MCJA 3Q1SH 4JFXB 4AEEA 4XNUH 3C60D 3UZEA 1WBXA 4NNPL 5FYJL 4O5LL 1QQDB 1T0NB 3FT4A 4OGZA 2X4UB 3SDDA 1FNEB 3ZDZE 4NYLA 4U1LB 2W0FB 4OZFG 3KPRA 1WAAE 3ARPA 4YBQC 1UCTA 2NXZD 4JANA 5D7IB 3O6FA 3MRFB 5CAYB 3DXAD 1LDPL 4OFIA 3MNVA 3DI3B 4NHUB 1D9KA 3HI1B 5E5MB 3EJYC 2UWEB 2ZOLB 1W0VB 1DTUA 2HKFH 4QKXB 3KPNB 2IBBA 4NO0A 5I76A 2RGSA 1MHCA 2DQFB 3QUMA 1CU4H 5DMGD 4M8VA 4X7TA 2VN7A 2B8OT 4X0KA 3WL9A 1EFXB 4CNIA 3DVIA 2ATPB 3RNQA 3MRBA 1Q72H 2BHUA 2IAMD 1KLGB 4XAWL 3X3GH 1GAFL 2C1OB 1RIUH 2X1WL 3GK8H 4RAVB 5I1JH 4GFTB 1KGCE 4NIKB 3FHAA 1TZGL 1LO5A 1KFAL 2HWZH 4FQHB 4Z5RB 1TCRA 3U7WH 3NAAL 2C4FU 4I3SL 5EZOH 2VLLA 2Q76A 3U0WL 1I7ZA 1T2QL 1S9YB 5K59F 4NWTH 2DM2A 2X4TB 3NZHH 4JRYE 1F11B 2ZKHH 3OBAA 5J89A 2E8ZA 3B5HA 3WIFB 1EBPA 3QPXH 5FF6A 2JCCF 1FZKA 5C0AE 4GRWF 2FBOJ 4JB9L 4WO4C 3SKMA 4NQCE 4NQVB 1JFQH 1A22B 1IAIH 3ZKMD 3I9GL 3SCMA 1JPGA 5A2KH 2BJMH 3VXUA 1U8MB 2DD8H 1V3LA 1E4KA 3IDIA 3OR6B 4DUWA 4KHXH 2DQJH 3QHFL 2DL9A 2WNGA 4P59H 3TT3H 2YC1A 3KPOB 4MMXC 4A2MA 5CP7A 2B5IB 1WZKA 1J1XL 3DX8A 4GS7B 5L2JB 4ZNCD 2MOVA 4U6VL 4LLQA 1MVUA 4PJ5D 3MRRB 4X80H 1U8NB 4PY7A 3EDEA 2FH8A 4UMGA 3TBYB 4LLVB 4JFDA 4U6YA 5FKPA 4J3SA 3MNZA 4ZPTA 4I77H 5KSVB 3MNWB 3O4LA 1ZGLB 1MIMH 2XXCB 5TDOB 4Z7VE 2CDEA 5DA4A 5EZIL 1ZLVH 2BSSB 3SKJL 2AKRA 4R4FH 4KRLB 1K4CA 1T1ZB 5L6YH 2IPUG 4Q9QL 3G5VA 4PTUB 1SY6L 1URLA 1ETZA 1IGYA 5D7IF 1FH5H 5JW4M 1V5JA 3BKYH 4NO3B 5DJYA 5INDA 3MA7B 3VGAC 1KB5H 3EO1B 4M3KB 5F9JB 4NCC2 5J13C 5DFVC 4OFYD 2UWEF 3SGDI 1BIHA 3HNTH 1JUFA 4X83A 5F6IB 4OLUH 1F02I 2CLRB 2CR6A 3QG6B 1CCZA 3MTRA 4IMLA 3F7VB 4MB5A 5HYQA 1OAQL 4EUPH 4G42A 4U1HA 1D5ZA 5DWUH 3OPZH 5J3HC 1A64A 3FTGB 5IKCA 4ZTPH 4Q0XH 5JTWA 1MAJA 3A6BL 2Z92B 2AJVH 4QF1A 2BVPA 3U36B 1RMFL 5DEGB 1Q9OA 1AXTL 4PGCB 43C9B 5GRJL 5DJ2A 4ZUSA 3VXPB 1BD2B 3R4DA 4OZGA 1AE6H 3VRIA 2WQ8A 3O3EA 3WUWA 1NCBL 3FKUS 1OGAE 1WFNA 3SGJA 1AO7B 2C3XA 3CH1B 4D9RE 1H3TA 3JTTB 2HYMA 1K8IA 2QV2A 4J3WA 1AHWA 3EFFA 4GW4A 4PD4K 5TFSH 4QCIA 3X12B 1CD0A 5SX5K 1BJMA 1UEMA 1P4BH 1DQQB 2NNAB 5AZ2H 3MUHL 1VADA 1JPTH 2YPLE 2D3VA 5LGJB 5ABDE 1D7FA 4PRID 1P1ZA 4MA1B 1YEKL 2ICES 3ZYZA 4PRBA 3QJFB 4HKBA 5IP4A 1KEMH 2F54E 1A47A 4JQVA 3U48A 2R0ZH 3QUZD 5I1IH 4IMKC 4MQTB 2IFFL 3U7YL 4WI8A 5DVNA 4ZFZA 3V6ZB 3CFDB 2X6MA 5JW3L 5D9SA 2J6EL 1L6ZA 1HQ4A 3STLB 5F9AC 4UIKH 2MQCA 3K8KA 2Z31B 1N59B 2PXYC 4BQCA 4YXHH 3GMPB 3T04D 4QNPE 1KJ3H 3PG2A 3UBXG 2DWDA 5IB4B 2QQNH 1PSKH 3MRIA 1BQSA 3UTTA 4D9QE 5BVJB 1OGTA 2Q3ZA 3EAKA 2OL3A 1E6OL 4JFQB 1MHEA 2FJGB 2L7JA 4XMLL 1HXMA 3ULVC 1MFEH 5D6CB 1GGCL 1HHHA 1CT8B 4EN3D 2Z8VC 4LRIA 1KC5H 1WLHA 4WNQB 4Y5VB 4H1LA 3HG1D 4F3FB 2JJTC 2F74B 4HK3N 3R06A 1DN0A 4M61A 4WI3A 5GISH 3ARUA 4D0BB 4YE4H 3W9DB 4WHDA 3UTPE 3ULUL 1MCPL 4LBEB 1LEKA 3CFJA 5EA0L 4HGMA 3BZFA 3WO3B 1M7DB 3P4NA 2EDFA 3LKNB 3CFEA 4ZFFA 2R8SL 4DKEL 1BWWA 1S78C 4N8VB 3VWJB 1H0DB 3BMVA 3VD3A 2HG5A 1SYVA 3QUXC 4PJ8C 2VDML 3DIFB 3CDYA 1VACB 4GKNB 1DDHB 3BN9D 4Y5XB 3OJ2C 5E56A 3VFVB 3GSWA 4HUKB 1YEDA 3W39A 2HT3D 5DMKB 4OCMC 2OTUA 1A6AB 2BVOA 1CFQA 3G04A 4NP4H 1DLFL 3TN0C 2W9LA 5I17B 3T3MF 3X14A 4C57C 4L8CA 2AI0L 2VXVL 2XKNA 1RUML 2YPVH 3ZO0A 2OS7A 4XCCL 1OVZA 4YBHA 4UZGA 4FABL 1UWEH 1Q0YL 3LS5H 5IM7B 2JIXB 3QHZL 5F7YC 2VE6A 3GSOB 4K7FA 4M1DL 1E4XH 1JK8B 4L8SB 3OKDA 1ZEAH 1MRCH 3SDCD 4LPVA 4OF7A 3QDGD 4XAKE 3LH2H 2YXMA 5K9JH 5D1QD 4D0CB 3RP1A 1F6FB 2VZTA 1EA9C 4XPFH 4YFDB 5FO7A 5C0IB 12E8H 4GBXC 3IDMB 3D2UA 5HHXH 1D5IH 3RWGA 1DBKH 1LP9B 1S5IL 2E9JA 5IBUB 1RZJC 4ZS6C 1MEXH 2R0WH 1T6WA 1U8QB 5DZLA 4UDTB 3BPLC 3QCVH 5C2BL 3VXQA 3C60A 3WJJC 4PJHA 4RISL 4HZLA 1KT2A 3ZTNL 3HZMA 3F5WA 2OR8A 3VFGH 2V2WB 4HF5L 3VWKB 2QADC 2C4FT 3VH8A 5DSCB 3DXAA 5J12B 4XRCB 4BZ1L 4G7YH 1HNFA 3QBTB 5EWIL 3NA9H 1WK0A 3A0OA 4WTXA 4MS8C 5I75B 1CL7H 1JRHI 4PJXA 5INCB 5JHLH 1IL1B 1SBSH 1CFTB 5DEZA 2JJWA 1X7QB 2DBLL 3DARA 1J12A 2FB4H 3QXWA 3IAGC 3CCHB 4K9EL 4ELMA 2W60A 1GPOH 2ZJSH 3FRUB 3JWDH 4U1IB 1OY3B 4LGSB 3PGDA 1YYMH 2IAMA 1FVDB 3D87B 4HJJH 5IF0B 1J8KA 4KJYA 1F3JB 1GRWA 3RIFF 4X6FB 5FYJH 3MACH 3MBED 3R8QA 2V2XA 5KVFL 4G6KH 1MHPH 1WIOA 5FECB 2QR0B 1H3UA 4FRWA 5I8KL 2MSPA 1GGIL 4OF0A 5A2JH 5ESVA 4PGJA 2VZUA 4MD0A 3G5ZB 1WC7B 4HCRH 4TUJB 1MFCH 1CFBA 1B0RA 1GC1L 4CMHB 2G2RB 4WUUD 3CSYB 4U1JB 1NAMB 5DDHA 2BFVH 4TOYL 2H9GB 2WIMA 3IF1B 4LKCB 1Q9LB 3IKCB 1UFUA 2CIIA 4KI1A 3SQOL 3MLVL 3NFSL 5E7BA 2HVJB 2W65A 5IR1B 1IEHA 1DBAL 4HD9A 3ZE1E 5IMKA 2PTUA 3MLYH 2Q6WB 4TVPL 3GJFH 4XPTL 2P8LB 3KYKH 1PKOA 5D2NC 3MV8A 2VUOA 4AEHL 2O93L 3CJJA 1QFUL 4I3SH 4ZSOB 1ADQA 4PJ5A 3ROOA 3U0WH 2VXTL 3BEVB 3ZHDA 1U36A 1LP9F 3L9RB 4C58B 4PJ7E 5EZLB 5D8JH 5FYKD 2QQQA 4HV8B 4UB0L 4GRLC 2VABB 4YPGA 3QIWC 2HJKA 4JB9H 3EYFB 2XZZA 1XR8B 4R8WL 2AXGA 4H0GA 1A02N 4LARL 2VQTA 1WTLA 4JZJC 5CHNB 1IFHL 4YGVA 3IXAB 1JWUB 2PYEE 1NBQA 2B1HH 4UTAL 5E9DD 4LMQE 3V7AE 1H3WM 2XY2A 3LB6C 5DF0A 1U9KA 4M7LT 2ZCLL 3JVGA 4R7DB 2VDNL 4GXVH 4OFYA 4G43A 3PV6A 1G9EA 1TVHA 3G5YA 4A6YB 2ITCB 2FHFA 3P4MB 4TULL 1QO3A 4RBPK 3K2MC 4LP4A 4Y5YC 5HI3D 4FFWC 3MLUL 2NY4B 3BDYL 5CSGA 5ISZE 4H8WC 4M7LL 2MPAL 35C8L 2VZ3A 2I07A 1G6RB 4CVXA 5K9QI 1YPZB 4MA8L 3FO2A 1DQJB 2KZ1B 4N9GA 4ONFL 3QDAA 3ZLQC 4N1EA 4PJCE 1MCEA 4P4KB 3HMXA 1EHNA 4JLRA 2BOCB 4HS3B 4LCWE 2A9NH 2DBJA 4P46D 3GSUB 3VXME 5F1SA 2J12B 1FL6B 5CEXB 4FQ1H 4RGNB 1E6JL 2LTQC 4PRHE 4M93B 1A1OA 3TH4T 1JWSA 4TSCH 4J3XA 4U6HA 3RWJA 2VKWA 4QRPD 2DQUH 1FQ9C 3JWOH 2NX5D 3RZCC 1C12B 1LO2L 1WFUA 3LD8C 1MFBH 3MRDA 4ISVB 4WFEE 5TH2B 1B9ZA 3OXSA 5HHOB 5DGRA 3VGAB 1NBYA 4XCFL 5D1ZD 4I0PC 4PRIA 3LEVH 2HRPH 4Z0XA 1A3QA 1QD0A 5E95B 4NQTA 4O4YL 5I1DA 4HIXL 2XPGB 3SDXA 1C08B 1EZVY 2WV3A 1OF2B 1C16A 5CZKA 2CIKA 4POYA 1BQHB 3Q5TA 3RTQC 1NCNA 3QUZA 5KOVC 1RMFH 3T0VA 5I1CH 1CG9A 1XZ0B 1AD9B 1ZT7B 3OR7A 1ACYH 1FDLH 5DJZA 3DO7A 2BNUA 2X1QA 5JNYB 5LGHL 1NDGB 3FB5B 2HT2C 1C5BL 2EDLA 3DPBA 4XVTH 1V7MH 3IFPB 3BPNB 4FXKA 3MFGB 3BP7B 3QZWG 1CFSB 5ETUB 3MROB 4P49A 2GY7B 3NCEB 5CSZB 4PD4J 4PG9B 3MGTA 2X7LA 5ID0A 2CPCA 2R2CA 2EDHA 2NW2B 2LABA 4LIQL 2IPKB 3SGDH 4EN3A 4K8RC 2Y5EA 1NC2D 4U6TA 4IRSA 5I1AB 3WFDL 4ZUVA 2VLJD 3HG1A 4QOKD 4KXZI 5J1TC 1KIRB 2BZDA 2CSPA 4LLWB 1JGVL 2IFFH 3ZE2F 4MDIB 4KUZL 2HFGH 1T3FA 1BVZA 3IDJB 3F65A 3KYMA 3ARSA 4Q6IC 5CBEA 5SWSB 3ZHKA 3RDTC 1NGWB 3DUUA 4YHYC 3D9AH 5CZXC 1MH5A 3NCYP 1H15B 4PGDB 1J7VR 1YA5A 1YEEH 1ZT1B 3BFOA 4L4TD 4ZAKC 1SEQH 2IH1B 4QRSA 2BVUA 1E6OH 3P9LA 4GAYB 2BOBB 5DUML 2MHAB 4ODHL 1PZ5B 5DQJA 4MSWA 3T65A 3IDNA 1EAJA 3WFHA 4DZ8B 2DKMA 2X9XA 3OAYK 1DSFL 1G7MA 3MRJB 4XVSH 1MJ7L 4ODUA 4PP2A 3ZKXB 4NZTL 3TYFA 1HKFA 3HNSH 4Y7MA 2MQ0A 5AG8A 4PG2C 3ULUH 5KG9A 2FWOA 3IDUA 1UM6L 5H8DA 1S5HA 3RJDA 2VDRH 4Y16B 2ZG2A 4DGVH 5BVPL 3SE8L 5AD0A 4P3CL 4YIQA 4J6RH 5DZNA 4HC1L 4O2EB 3SDCA 4DKEH 2NY1C 3QDGA 5I8EB 4GXUN 2WUBL 5GGTA 5D1QA 1HWHB 4MNQB 4YFLI 4RIRA 4LF3A 2A6KB 3D3VE 3ZT6A 5I19H 5I73B 5TDNA 5BOZG 3HZKB 5FOBB 4X7DC 3G6JE 4X6DA 3S5LB 4LLDB 4WHTA 1AQDA 3G6AA 3JTSB 1RJLA 2GJ6E 1ZA6B 4JFFA 4OGXL 4S1QL 3TIEB 2BVQA 3AREC 4WIQA 1MNUL 4PS4L 1DLFH 1A7RL 2PKDA 5E8NB 2AI0H 1EGJL 3OGCB 3S36L 1CXHA 1HDMB 4YBLB 4HUUB 1LWRA 1Q0YH 3QUKB 1DUYB 5BRZB 2DLFH 2KBGA 1YN6B 1FNEA 1T5XA 3AAZB 4WFHE 1U3HA 1UACL 5BMFH 1VEOA 2UZYB 2WIIB 5J6GB 3E6HB 3KG5A 5EZJB 1N2RB 4FQ2H 2X2YA 1J5OH 1IRAY 1CF8H 3QXDA 3FONB 2ADIB 4PLKD 5DO2D 1GZPA 1I1AB 3HC0B 4NCC1 4OCWL 4LHQB 5FXCH 1FVEA 5F9WB 2VH5L 2XTJC 2ZCHL 1MCLA 4JHBA 3O9WB 3WN5C 1WF5A 1N8ZA 5ELIA 1KGCD 2ATPA 1Q1JL 2QQLL 1Z0NA 3MPCA 4IEFB 4I5BA 5IW6B 2HMIC 3KYNB 5C2BH 5HPMB 1SMOA 4RISH 5E4IA 3MBEA 5HYJE 1OD9A 4Z77B 3ZTNH 1YY9C 4OI7A 1T4KB 3LIZL 3Q6FB 1YDPA 3BP4A 3MUGA 4UBDC 4JRYD 5E8PB 1ZSDB 2YUVA 5T3ZL 3SDAD 3OMZA 1KB5B 2PCPB 4U2ZA 5E8EB 2D0GA 5C0AD 4TNWF 4OZFA 4NZDA 4NQCD 4ZO8A 2F15A 3WCYA 1BWMA 3P2TA 4Z8FH 4L8DB 4YDJB 4E9LA 2ERJC 4YZFF 4WUUA 1LK3L 2CLZA 3V7AG 4CMMB 4JPIA 5K9OB 1NC4D 5DRWA 1LE5B 5A1AA 2Z35B 1LO4L 1XGPB 1BP3B 4EUPB 4MA3A 5E08H 1VPOH 4Y1AE 2R9HD 5C2UB 5MEOA 4PLOB 2HLAA 5TDPB 4POZC 1SBBA 2PO6D 3S96B 1S7RA 3UX9B 4EI5C 2H32A 5IW1A 5A2IH 2P5EE 1Z5LA 3RHWF 1BAFL 1IJ9A 4PRPB 2IADA 5DUPL 4JQXA 4AMKL 1ZXQA 5KVFH 5EU7E 4XXDA 3B2UD 3OGOE 4HUXB 3L3OA 3DJ9A 2JJUA 1I3RB 2DLIA 1S7QA 4EDXA 3GSNL 3LQAH 5I71B 1NFDA 5GGVY 3PDOB 3M1BB 4HFWA 4WTZG 1KBGL 3F7PC 1BJ8A 1JV5B 4ONGH 5B8CA 4HWUA 2QLVB 3QEQE 2VDOL 3TBWB 3KS0H 1PLGH 4Z78B 1UA6H 1M6OB 1MI5B 2J88L 3QWRD 1RJZA 5JXED 3L7FB 1T2JA 4TOYH 2YD7A 4DAGL 4AM0B 1I8LC 1FFPA 3PHQA 1JRHH 5BW7C 2BY1A 3SQOH 3HRPA 3O41B 3MLVH 4GW1B 4P23D 4RFEA 4G8EA 3X3FH 5ESAA 3ARDB 5F88B 2R2BA 5E9DA 3NN8A 3PWLA 3MA7A 1JN6B 3HZVA 5D6DC 4R26L 2O5XL 4FQLL 3GIVA 3AM8C 4I48B 3QWOB 5F9JA 4TVPH 2BNRE 5GZND 2RAMA 4AEHH 4JHAL 1D6EB 2B1AL 2M8XA 2VXTH 3GNML 5JMOC 5GZOD 5D71L 4MAYB 4WU5A 4IRJD 5L9DL 3HKFA 3IDYB 1CVSC 4MLSA 4I18B 3LQZA 3NIDF 4OV5A 3SO5A 3T0EE 4ZFOL 1DJSA 1ONQA 5FV2A 2NY5C 5CILH 2GW5A 4LNVA 1FGVH 2Z91B 1QLEL 4NRYA 4RGOH 1TJGL 4R8WH 5DJCB 1EO8L 4LARH 1OGAD 2D0HA 4D9RD 1R3IL 4JREC 3QCUL 1GVIA 4Z95L 2C4XA 1AGFA 1IEAB 5BJTB 4RAHA 3RVWC 5CD3B 2YBRA 2GI7A 2HJLA 4R0LB 4JM2B 3VG0L 3QUML 4ZUTA 2HJFB 2EDJA 3V5HA 4MJ4A 2VDNH 2YPLD 4AT6A 4KK5D 5EUOA 3CPLB 3VD5A 3CFKB 2MJWA 4ZXBD 5C0BB 2GFBA 1QYGH 3UPRB 3F6LA 2OQJA 3O6LL 3ZE1F 3MLUH 3MODH 1WISA 4YHNB 3BDYH 5I0ZA 5D1ZA 4TNVF 4OJFH 1M1SA 1JPST 4JFEB 2FD6H 1X5FA 3H9SB 4JPWH 4JCLA 1M7IB 3O2WH 3BPOB 2JJSA 3ZT5A 4P5MB 1W0YT 4URTB 3VA2C 3BPCB 4LSPL 2AP2A 1QEWA 3V0VB 4RQQB 1AQKL 4JDVB 1ZK9A 2P8MB 4TUKL 5MHSE 3MYZA 1NCAH 4D9QD 3VFSB 5MENE 1N59A 3RVVC 4LASH 2L0DA 2EZ0D 5BQ7B 2VLRE 1A4JA 3H9HB 4YAQA 4NM4H 4NGHL 3EIFA 3EYOB 1FPTH 2G9HA 2QQKL 2F8VA 2YK1L 3VI3E 3ARGC 4V1DE 4XP1L 4OF8A 4XCFH 3L3DB 1NC2A 4Q9BA 4K94H 1H5BC 2JF1A 5F1OB 4HH9B 1N64H 1NLBL 3UTPD 3QEHB 2VLJA 2YD4A 4QOKA 2NXYD 3GRWA 4ODXA 4U1GC 2FHCA 3FO9B 1KV3A 4OI9A 3ALXA 4RFNC 4XPHL 3HMWL 5F89A 5DVLA 4FN0A 1OL0A 3HC4L 5LGHH 1PY4A 5ALCL 1C5BH 4ODSL 3QR2A 3FQRA 1F4HA 5EULV 5T1DL 3V0WH 5GS1C 3KLSA 4WDIA 5C0FB 4HWEH 2FYYB 1IKFL 1F4XL 2A74B 1JHKL 4L4TA 1T03L 4M02A 3BWAB 2YD8A 4CU6A 4F58H 1VACA 3MRNA 3ARBC 2R0LH 1NLDL 3GSXA 1JGUL 4IHOB 4H5SA 3UBXA 4CGTA 4K9EC 5IB5B 2VAAB 1QACA 2APWA 5ADPH 4NSKA 3SE3C 1NBVL 3L3JB 5ACZB 1LO0H 3RY6A 5J1SC 2DQEH 4X6CA 3O2DH 4MA7H 4DKAA 1M05A 1BLNB 3MXVL 3EOTL 3DOSA 3MLWL 5HPOA 5E6IB 4M7ZC 3BQUC 3IB4A 2DTSA 1S7WB 4PTTA 4WW1A 4XVJH 3KJ4B 1MWAA 1GC1C 3T77A 5IIEB 5JDSB 1J8HD 4KQ3H 2FJHB 4R90L 1I1YA 3QFJB 5FYLL 1A14H 5HGBA 3PWUB 3SY0B 1YEFL 4JO4H 3RDTB 5DK3A 1QBBA 5DC4B 5HVGB 5E2TH 2WINA 3CIQA 5T3XL 1DSFH 3QI9B 1J0HA 5IJVA 2Y25A 1QFPA 4P2RB 1UVQB 5KSBE 2MKLC 1X5ZA 4PR5B 1JPFB 3OHXA 4OV6F 5AYUL 1SM3H 2WBWB 3CDGB 5KVGH 3SKOB 4X99B 1WAAA 1B0GA 4XZUB 3KR3H 1UM6H 3WIIL 3C9NB 4KROC 4KXZH 3KWWB 1KJ2A 3FT2A 3SE8H 4XNZB 3PWPE 4MYWB 4KRNA 5JIIA 3MQIA 5MEPB 4HUWB 2VR5A 3UTZB 1RZIA 3VGHA 4O9HL 3GJFB 5E8DL 1FORL 4W6YB 3MV9D 2ZG3A 5HVHB 3QT2A 4ZQKA 1IGJB 1NMCC 4PJ9C 3T4YB 5DJ0B 3FHQA 1X5YA 4NBXB 3CMOL 4U49A 3MLRH 3TO4C 3ZTJG 5JOPD 4YK4B 1U8LB 4F37K 3D0VB 3SQBA 4PS4H 2BVEA 3CX5J 4H26B 1VB9A 4N0UB 1ZT4B 5DHYB 3KPLA 1EGJH 2P5WB 1JGDA 2DIAA 5ITFA 4BELD 1QTYT 4OCYH 2GITB 1LHZA 4JVPA 3QIUB 1MUJA 3FQXB 1FZOA 3O6KL 4OAWA 2LV4A 3MRMB 1DVFC 2XZQL 3H9YA 4R97C 1R3HA 3W9EA 1YN7B 3ZSTA 5ALBH 4LHJB 1P7KA 5K33A 3U4EB 3SDAA 2YEZB 1BOGB 5I1KL 5CMAB 4KZEL 1Q94B 4K3DL 4PGBB 5C0AA 1WC7A 4IJ3B 4M7KH 3HPLB 1PG7L 4NQCA 2VMFA 1JBJA 5T5FL 3V6OC 1NC4A 4G8FB 3B9VA 3UTQB 2VH5H 5CUSH 1BIIA 2Y23A 5EPMA 5I9QC 2UUDH 2FL5B 4WCYH 3U0TA 3BE1H 2PO6A 3G9VA 2X89D 1KCUL 3ARRA 3UO1L 4P9MH 4CDGC 2C1PA 2V7NB 5I1HL 3Q48A 4XC3H 5I74C 5CD5C 1MCCA 2HVKB 3VFPA 3LPWA 1YYLL 3X11A 1LGVA 3BYYA 2XTJB 4J1UB 3AROA 1FNGA 2NW3B 1RVFH 5T3ZH 2IMMA 4JO2H 3HE7D 3QSKB 4FG6D 3QNZA 5HDBF 3V0AC 3RWIB 2HFFA 5T1LD 1OAYL 1RK1B 4OSUL 1JYNA 1G7JB 4IDJL 4JKLA 4YUEL 1QSED 1U92B 4M62L 2N1KA 4ODWA 2N4IA 2ENYA 2B39A 1ZWIB 2CRMA 4JFYB 1Y6MR 2PYED 3AB0B 5JXEA 5LJYH 4XCYA 2B2XL 2FLBT 3QDMD 3L6FA 2HKHL 3EOAB 3KLDA 4Y2OA 2D7QA 3NCMA 5IEKA 5DK2A 1R5VB 3UZVB 3RQ3A 1IVLA 5H35B 4M5YL 3FQUB 4P23A 2OK0H 1OTUC 5IMLA 5EFIB 1J18A 1BAFH 4Y19E 3TC9A 5DUPH 4AK1A 1DBBL 4AMKH 3E3QC 2EH7L 3PGCA 5F8RC 4ZD3H 1MIEH 1R5IB 4U33A 4ZDHA 4JRXE 1W72A 3EO0A 4E0RB 1NKRA 3RNKB 5ISZD 1D6VH 1QBLH 4U1SB 1TETH 4WWKD 4XNXH 3KLHC 4LSSL 5L2KB 3ZE0F 1ZVHA 3O4OC 2IQAA 4M9PA 3RPIA 4FXGB 2NR6D 3NCBB 4WW2B 5JHDB 4UV7L 5CFHA 4LCWD 3WIHA 1RZGA 5F1NB 3VXMD 1MFDL 1OGAA 2CO7B 1UJ3A 2IG2L 4PRHD 3S37X 3TBVA 5M94B 3MZTA 1S3KL 2OJZL 5KAQG 5F7MC 2C3VA 3MMEA 1Z3GH 1HNGA 2BX5A 5EIIB 3ZKND 4NQDB 4BH7B 1UWXH 4KY1L 4DVBA 5CWSA 3EYVA 2R1YA 1ZVSB 1A3LL 1HXYB 3JV4A 3ARYA 4WFED 4P2YA 4F7TB 4NPYA 1HWGB 2EE6A 1OSPL 4CVZB 2YPLA 3CVHA 2XN9B 1F58L 1S7TB 3O3DA 4ZXBA 2B1AH 3MOAH 4PRAA 3T2NL 3KXFB 3IJYB 2F54A 4E42A 3BP6B 4MNHA 4L3EB 1UXSB 1NBZA 5T1MB 2UYLA 1S7SB 2HTLD 2J4WH 4FQCH 5SWZB 1I8IB 2VUYA 3GMOB 3RL2A 2EYTA 3T8XB 1MJ8H 4QHNA 4JFOB 3D48R 1I7RA 3DVNA 3WFBL 1Y18B 4WHYG 2BP3A 3K4DA 3QUMH 4B7IA 2FX8H 3P77A 1RPQA 3TO2A 3T0BA 1AGCA 1L7IH 1ZOXA 3NIGF 2EDXA 1L7TH 4UNVA 3FFCD 1I1FB 3GM8A 2AV1B 5IG7A 4PG9A 1T83C 4BUGA 3H8NA 1R3LA 3THML 4JN2A 3O6LH 1MRDL 2CR3A 4Y4FB 3RGVD 1Z6JT 2ZUQC 1CICC 1OAUL 2P44B 4WGWB 2OYPA 1EVUA 1I9EA 1P9MA 1CBVH 1ADQL 1JGEA 1R3KA 1SJHB 1BF2A 3UDWC 4NBZB 1KIQA 1KN2H 3HRZB 1KJVB 3F7YA 5HHME 3C5SB 4RMUA 1JPSH 1BEYL 2DS4A 4U6XB 1S9VA 2Y7QB 4MJ6A 3B9KB 5C08B 2A77H 3IU3A 1CK0L 1U2CA 1IE5A 3TZVB 1I9IH 4WW2F 3VFNB 3U46A 4NGHH 2NZ9C 4XNYL 2E7HA 4MJ5B 4XXCA 2YK1H 4ZMAT 2ED8A 3QZWA 4QXTB 4XP1H 1EHLL 2H1PH 4XNQB 2EEDA 5FYKU 1NLBH 4FZ8L 4LLMB 3RWFB 3C8KB 5ICZB 3PGFL 1C1EL 4MDJB 5E2WL 4NKQB 2GCYA 1WCBA 3U2SA 1MY7A 3LZFH 3TH3T 2E5EA 4WV1B 5HI5D 1QSFE 1UB6B 1PW3A 3KAAA 1RUPL 4KTYA 4Y4KB 3V5DB 2X4NA 1NCWL 1ES0B 2H8PA 2E6PA 4E5XB 4F7MB 2CO6B 4O2FB 5T1DH 3D3VD 4LFHG 4YC2B 4JQIH 4NZRH 3P40A 2E7MA 1IKFH 1F4XH 1P53A 2R4RL 5J4MA 4N0RA 3EYQD 4KMTL 5J06A 2XKSA 1B3JA 2DF3A 1UM4H 1DE4B 1JGUH 4LLDA 4EI6A 2BSTA 5DJXA 4GKOA 2AEQH 1NUNB 2P1YA 4KDTA 5DD6B 4PJGE 5E8OB 3RAJL 2Q8AL 1NBVH 4OZIE 2PYFB 3ULSA 3DSFL 3O8XB 4QRUA 3OKEB 3A67L 2CKBL 1ZLUK 2M26A 1BVLA 2YN3A 4HGKC 4PJBB 4R4ND 2AJYH 5TE4L 3VI3F 5D2LB 4WFHD 1G9ML 1NCDH 4D9LL 3EOTH 4OKDA 1CFVL 4XP5L 2FR4B 4NC1C 3SGKC 3OB8A 1T7VA 3HHRB 4OZ4B 1BBDL 3LKOA 2AJXL 3QQ3A 1G7LB 3MCLL 4NQXA 1LK2A 4CW1A 1BQUA 4KI5F 5LKNA 4AEIL 5LG1A 4P5TD 2I60H 4NKOA 4PREB 4WY7L 1CE1H 2UZXB 1T22B 2Y72A 5F1IA 2AGJL 3LEYH 3PUCA 1U8HB 3G9AB 3F7RA 3O6MH 1YNTB 4F9LC 1YEFH 5GGVL 3KYOA 3QIBD 4L3CA 2H2SD 4OUOA 5T3XH 5KSAD 1FG2A 1N0LA 4KKBD 1PG7W 5E99H 1F3DH 1FG9C 5C0CB 1XF5B 4RDQF 3TA3D 1A6TB 5IW3A 3B5GA 4YHPB 3BD5A 4YXKL 1F5WA 1QRNE 3O45B 4N68A 2V9RA 2KZWA 1BX2A 1VKXB 2A73B 3SGEI 1KEGL 1E28B 4U7SA 1ZSDA 5FDWB 4G3YH 2FEDC 4G6JL 2FSEA 3OKOA 4PJFE 5L7XH 5LAXB 1P2CA 2VJXA 4O9HH 5GGSA 4LLUA 3VD4A 1WFTA 5FUZH 1HSAB 3IVKB 2ESVB 1KPUB 2ARJA 3CK0H 4PV9A 3VJ6B 4GKZB 4JZOB 2P5ED 3DX9A 5ID1A 7CGTA 5IV2A 2DI7A 4KJWC 1YNLH 5DJAB 3N85L 3N1QC 5HJ3A 2ADGA 3BD4A 1NCCH 4KKCC 2X89A 1OARL 2OL3H 1IGCL 4HG4K 2JK5B 3KVQA 4WFGE 4JFZH 2E9WA 4KKAD 5C0JB 1AGBB 1TIUA 5FA3A 1NGXA 2XZQH 2NY3D 1A21A 1B0WA 4X98B 3TO4B 2E6QA 3LKRB 3GUTA 5J0BA 2VO5A 4PJ7A 3WS3A 2P42B 4QHUA 3FN0H 5DI8B 3HE7A 4APQC 4OLYL 1D5BB 3D25A 5T1LA 3OKMA 1G1CA 2VQ1B 2YD5A 4FA8A 2AJ3B 2IALA 5TE7H 3TVMD 4PJBF 4MXQD 4ZPVB 5CEZL 2K1MA 2PYEA 3KLAB 4P4RB 2DQTH 2E7LC 4DW2H 3KPMB 5C07B 5C09E 4WJ5A 1IQWH 4GT7A 5MERB 2D4FA 3D69B 3GMRB 1EK3A 4FQXB 1G0XA 4N5UA 5BO1H 1KCUH 3ARDA 3WE6A 4HQQH 2CJUH 4MD5A 1T7ZA 1FYTE 5GS0D 3V52H 5D2NE 7FABH 1BZ9A 3FN3A 3C6LC 25C8L 1A9BB 3BEWB 2D7TH 1ZHLA 3SKNB 2J8HA 2KKQA 5ISZA 3T0ED 4P9HH 2OP4L 3EZJB 4TUOB 4WWKA 1U6AL 4Z0BL 3P11L 4KVCH 3HFMH 3ECBB 5IMOB 3FFDB 4M43H 4OD1L 4HJ0C 4OSUH 4CBPA 3C08L 4YUEH 5EOQH 3FB7B 4WEUD 4PJCA 4WTZA 4XCNB 5I66B 2I9LB 3IXTB 4MXWL 5KW9L 3VDAA 4X6EB 3MCKA 3VXMA 3K46A 2B2XH 4UTBL 1HHJA 2R1XA 1WVZA 3EJZC 1JWMA 4PRHA 2DM4A 2P49B 2ICWA 3K81A 3E2HC 4XTRC 3ZDYF 5T1KD 4OD3H 3CNKA 3DMMD 3H9SE 3RUGB 2D9QB 3V6BR 3DVFA 5AEAA 2HJFA 2WBJD 5J11C 3T1WA 4HPYH 2NY0C 4R2GD 4DOHB 4X6BA 2Z31D 2PTTA 1QBMH 2FIKA 5I30L 3RWCA 5IFJB 3C09C 5CCKH 4X5WB 4I0CC 1HQRA 5JZ7C 4XP9L 3FQWA 3FB6B 3V5KB 4OZHE 2KQMA 3HCVB 1I8KB 1MJJA 5HGAB 3MZGB 3G08B 4F57H 3OKKA 1F4YL 4ONOA 1J0ZA 1JF1B 4NNYA 3TIDA 1K85A 1FJ1B 3RVTD 4JFHE 4YO0B 5MHSD 2R4SH 2OR9H 3P4LA 4G9DA 3BP5A 5MEND 2OJZH 4LQFL 1ZHNA 2JTDA 1AGEB 2VLRD 1UKSA 3G6DL 4F7CA 3LKQA 5I8CB 1A3LH 3QFDB 2F5BL 4V1DD 4G8GE 1IC7H 2A0LD 5BQ7A 2YA2A 1A3RL 4TPRL 5FV1L 3CU7A 4RMVA 3QPQC 4ODBD 2BNQB 3LKSB 3RX5A 1AHWC 3TM6A 3VG9B 4FQQB 4U0RC 5C92A 5DD3L 4Z7WE 5GIRA 1C5DA 3W0WB 1SYSB 1A7PH 2O5ZL 1IC5L 2AK1L 3I02A 2J2ZA 5I8OH 3Q5YA 4NO5A 1TFHA 4AIZA 1HH6A 2ATKB 5EU6E 2EXWC 5IFAL 4NKMA 5JW5A 4PJAB 3RFZC 3UTOA 2C3HA 3WFBH 2R1WB 2OI9C 4HWZA 4IRZH 4NQEE 4XHQA 5TQ0H 4M5ZL 1INEL 4MJIE 3FZUD 5K9KA 2VERN 2FO4B 3BISA 4RAUB 3V4VL 2YKLL 3WHE0 5E2VL 3MLZH 3CSPA 3I6GA 3S6CA 3L3KA 4G6MH 1QLRB 1KELH 4BSVA 3OJDB 4TSBL 3VCLA 3IAQA 5KJRL 4U0QB 1A9EA 1PQZA 2EDEA 3LDBC 1KN4L 1OAUH 2AEWA 3OV6A 4LSQH 3VA6A 5EOTB 5DVMA 2Q20A 3D5OF 4X4YA 3JWNC 2FEEI 1ADQH 3NVQA 3RUGF 5EN2A 5IGXH 1KPRB 5I1LA 5ANMB 1ND0A 4PRDB 4ODTL 4OKVB 2VC2H 4B0MM 1CXEA 5JQHC 3D39E 2Y06L 3S7GA 3PL6B 1BEYH 3D3VA 1VGKB 1JNHB 1AY1L 3QH3A 1J9CT 2ZSWB 3G6JA 1OAZL 1U93B 3VWKD 5L88L 3Q3GA 4KJQC 1X5KA 2GJ6A 8FABA 4MCYB 1A1MB 3IKKA 4QHMB 3VRJB 1RZKC 4DZBA 5BOPA 3RKDC 1SVCP 3C2AH 1ZS8B 3S3PA 4M8QB 2NY2C 3H42L 1EHLH 2A6IB 4PIRF 5IROA 3TBSB 5DRNA 2X4RB 4MWFB 3B6SB 3PGFH 4XH2A 3PQYA 2DB8A 4QRRE 3HPJA 4R7NA 5B3JE 4BKLB 3PWPD 5GRYA 4QTHA 2FX9L 3S37H 2DDQL 3R1GL 1A0QH 1JMZA 1N3NB 2UY6A 4LCCC 2D31B 1D5MA 1GXEA 1NCWH 1B6UA 1ZA3B 2AERT 1VFAB 3BRGC 3MO1B 4HUVA 2VL4A 2JB6A 1LMKA 3UYPA 5HDOA 4L4VE 1N4XL 4HDIA 4G9FB 3IFLH 3IFNL 2R4RH 3REWB 3HMXH 4DQOL 2IPTL 3KPSB 4KMTH 5EUKA 2CDGB 2EXYC 4K2UL 3LKPA 1IGJA 5IMMA 1MELA 2KDGA 3QIBA 1KOAA 3UBXI 3EGSB 1QNZL 1S9XA 5KSAA 4PJAF 3RAJH 4XI5C 3EUUA 5DFWH 4LSVL 3DSFH 3TA3A 5HYJA 5JIPA 1QR1A 2BSRB 1HEZB 4YBQD 5EO9A 1I9JL 3O2VL 2XA8H 1FNSL 1XIWB 1AKJD 1KTLB 4ONHB 1J1OL 1G9MH 1YEHH 3EFDL 5KSUB 1YQ2A 3LN5A 2YA1A 4LSRL 3WJLC 3LQMA 5KBNC 2OR7A 3BGAA 1CLCA 3EJYD 3ZDXE 4DKDC 1BBDH 4FFVC 5GGRB 4XCEB 1ZLSL 1EAPB 2Q7YB 1WWBX 1HZHH 3GRWL 3B9EA 3UXFA 3GMMA 3REVA 2HFTA 4AEIH 3ETBF 4P2OB 1NMAH 4M1GH 1AIFA 1MPAL 4WY7H 1A5FH 1ORQA 2YMXH 4YHIB 2OZ4A 2B20A 2BSED 3PWNB 1XCTB 4Y1AA 3BO8A 4MCZB 1X4XA 1FO0A 2XTJE 4NFBA 1T7XA 5IFHH 4OBSA 3GJEA 5IQ7H 5JDJA 3W2DH 3ZT7A 5D7JA 2P5EA 5FKAA 3GHBL 5BS0B 1FZMB 3C5ZC 3U82B 1OPGH 4KUCF 5KVEL 4YHOL 5AZEL 2FCBA 4JEGB 3RIAK 1IGTB 3QNXB 4UT7L 5HYSB 1AC0A 1IM9D 4L9LC 1UM5H 4W6XB 5DTFB 4KRMB 3VXOA 4GKSA 1RUQL 3QEQA 4OZIF 3CZJA 1KEGH 1DBJH 4WFFE 4F15C 3P9MA 4X5XB 3NOIA 5I2IA 4WO4D 4G6JH 4O2CA 3B3IB 3O81A 2F58H 4WGVB 1MCDA 4QT5A 3FT3B 1HHKA 5TGBA 1NJ9A 1HI6A 5JPMA 3TVMA 4XWOC 1FZJA 1TENA 1WBZB 2XQBL 3HE6B 5ADOL 2W9EH 1G7PA 1OCWL 1DBMH 4HLZG 1WBXB 4HULB 4Y19D 3QUYC 2VZSA 5H94A 3FT4B 3N85H 2FGZA 1ZGLM 2G75B 4IBLT 3SDDB 1HIML 5FUCC 4NYLB 4OLXL 3RA7L 2BNRA 1U3YA 1F4AA 4JPKL 3KPRB 3IJSA 4P4KD 3C5JA 4JRXD 4JANB 5L8KB 3O6FB 5B38G 3GMNA 5HGDA 3CC5A 1BQLL 3MNVB 1KJMA 1L9MA 1KIPA 1D9KB 4NCDA 3OKNA 1A6WH 5HY9B 4Z7NE 3DV4A 2B4CL 1J10A 1GJIA 3TJEL 4FS0A 3I6LE 3T0EA 4NO0B 5DC0A 2OMBA 2WWKT 5I76B 1MHCB 2FECI 3QUMB 3WLWC 1I9RH 1N0XH 4WU7B 4LVHB 4OF5A 1C5CL 4X7TB 3SGEH 2ZPKH 4X0KB 3WL9B 4PV8A 4CNIB 4LU5L 4WEBL 3IDXL 3K74B 3RNQB 3MRBB 4XHJC 1FN4B 3MGAA 5DFVD 5GGTH 1LO5B 4HKZB 1TCRB 5T1KA 3NBNA 5LCVL 3U9PL 2VLLB 2Q76B 3DMMA 2DWEA 1I7ZB 4P2QE 1IEBA 1RUAH 3U6RA 5J3HD 1N6QL 2WBJA 3OF6D 4QRTA 3CLFL 4S1SL 2FIRT 4PPTA 4WTWA 4EDWH 2O61A 4GAFB 2OP4H 5FF6B 1FZKB 3SKMB 1UWGL 3C08H 4L4JA 3T0AA 3I6KA 4QHKJ 2WSKA 1BPVA 1K2DA 3K2UL 3SCMB 1JPGB 2MMXA 5KW9H 4JY4A 3VMPA 1UXSA 4YHKL 3VXUB 1KPVA 4LRNL 1BJ1J 4NQSA 3W11C 3IDIB 4BZ2L 3VFUA 5MENA 2YC1B 3NGBC 5CP7B 5JW4Q 2ED9A 1RJYA 1JZ5A 3SHSA 3DX8B 2AVGA 2VLRA 1MCHA 4NHCL 1MFAL 1MVUB 1FIGL 43CAA 4PY7B 5JR1H 4HGWA 1NAML 3I50L 4HK0A 2H26A 4CADA 1YY8A 2FH6A 4JKPL 4V1DA 4JFDB 4U6YB 5FKPB 3HNVL 3MNZB 4ZPTB 3TYGL 4KRPC 3O4LB 2CDEB 3HI6L 4Z7OE 4HXBL 2UZIH 4XBEL 3SOBH 2AV1A 5EC2A 3N1FC 3WSQH 2AKRB 3OG4B 4XP9H 5EBMA 1K4CB 3G5VB 4GJTB 5DD0H 2NTSP 3MBXL 2IBZY 1ETZB 2DL2A 1I7TA 4HAFA 1FNAA 1F4YH 1VESA 1JZ3A 5DJYB 5INDB 4TSAL 5D7LE 1SJHA 5TJWK 1JNLH 1CFNA 4LHUG 1OAKL 4OZFH 4S10A 4D2NA 4TYUA 2Z9TA 1JUFB 3ARFC 2N7AA 3WDJA 5EOCL 4IMLB 3ZKNC 5HYQB 3ULVD 2APXA 2V5TA 2Y36L 4G42B 2F5BH 2MCPH 4U1HB 1D5ZB 3MGOA 5D7SL 5IKCB 2XY1A 4RWYH 1YMHA 3W5MA 4OT1H 3ZL4H 4QF1B 2BVPB 1Q9OB 2J5LC 5DJ2B 1QSFD 4ZUSB 1TDQA 1Q9KA 1AR1C 2RCSL 4OQTA 3A6OA 4OZGB 1P5VA 3E6FA 4XGZA 3O3EB 3VRIB 3WUWB 1IC5H 4FMFA 1TPXC 4IRSC 4R9HA 1S78D 5E5UB 1UB6A 4UV4L 1K8IB 3QUXD 4PJ8D 1ZLWK 1AHWB 3EFFB 4GW4B 4QCIB 1IM3A 4OZHF 3DROA 4U0RB 1EZVX 5FYKH 5B22A 1BM3L 1RIVH 2V17L 1YQVH 2GY5A 1G6RL 4NN5B 4O2FA 4RFOL 2GKIA 5FGBC 4ZNEE 1VADB 3MRCA 2RB8A 2VZOA 3V4VH 1P1ZB 5E2VH 5ITBL 3ZYIA 4PRBB 4ERSL 4HKBB 2KUTA 4NUGH 2VR4A 3TN0D 4H88L 5KSBA 4JG0H 3I85A 4LVNB 2PW2A 4U1MA 4ZFZB 1AJ7L 1KN4H 3DECA 4ZFGL 3LRSA 5D9SB 5E6YA 3RGVC 3IRZA 1HQ4B 3ILPA 3CVHL 4DN3H 4YEFA 4HIHA 2VXSL 4J7RA 4X8XA 3PWPA 5CBAA 2FATL 5C0DA 1X5GA 1DQDH 4P5KA 4PBVC 2DWDB 4Z7WF 3UTSE 3MRIB 3UTTB 2YWYA 2VDLH 4M6AA 3UEZA 1OGTB 2OL3B 1MHEB 3Q6GL 3L5XL 1HXMB 3MRLA 4NUJA 3DWTA 4GBXD 1HHHB 1RUKL 2H6PA 2QSCH 5F9OL 4JDTL 4H1LB 2X70A 1OP5K 4ZS6D 3GBMH 3WXVH 5IHUL 2E7BA 2FGWH 5D1XC 3R06B 1DN0B 4M61B 4Y2DC 4ETYA 4U3CA 3FOMA 2XXMB 1RSFA 1LEKB 2QADD 3CFJB 3BZFB 3ZKQD 3P4NB 3CFEB 1AKJA 4Y4HC 5DLML 4ZFFB 2VITA 5IB1A 1JZ4A 1YEGL 5GJTL 1QVOA 2AK4E 2HG5B 1SYVB 2CGRL 2KPNA 4E41E 5IOPA 1WT5C 1NCTA 1UJTA 3QXUA 4ZTOL 5T33H 1HN1A 4MS8D 4JGMA 1CD1A 3HI5L 2X4PA 1YEDB 3CMGA 2PF6A 3W39B 1QA9A 1NSNH 4DQOH 5KTEL 1CGSL 2OTUB 2FZ3A 3L1OL 4JY6A 2BVOB 1CFQB 4OZGF 5GJSH 3G04B 2Q86A 2YUWA 4DEPB 5B39G 1AD0A 1U2HA 3X14B 3I2CL 4L8CB 5EC1A 2XKNB 1TXKA 4DUVA 2OTPA 3Q1SL 4WFGD 4XNUL 1ACZA 2ZUUA 1MCKA 3H6JA 4BQ9A 3PIQA 2VE6B 4K7FB 2I9TA 1J1OH 3OKDB 4UNUA 3NZ8A 1IM9A 1GGYA 4BQ8A 3INUH 2ZWLT 1UB5A 5DURD 1V7NL 3GRWH 5DI8A 1G7QA 5FO7B 4WO4A 1A6ZA 1CU4L 5F71A 1WWCA 1XH3A 3D2UB 1U95A 3RWGB 5C09D 3V6OE 3U30B 2I24N 5IVNA 1CDUA 2MFNA 1DANU 2IANE 2IJ0C 4Z7UE 4ZPVA 3KJ6L 3JUZA 4DGIH 1UH3A 3X3GL 3VXQB 3C60B 4P57A 1RIUL 4PJHB 1FYTD 5I1JL 3GHBH 1F97A 4HZLB 2H2SC 4Y19A 1KT2B 3HZMB 3F5WB 3AU1A 5GQBA 5KVEH 4PFEA 4D0DA 5JO5A 5BZWA 3VH8B 2NXZB 4JRXA 1ZGLP 5EZOL 4NDMA 1K9TA 3DXAB 4GUPA 2N56A 2XWTA 1U8JA 4NWTL 4XWGL 3NZHL 3T08A 1RUQH 3U9UA 3EOBA 2ZKHL 4GRLD 1MCRA 3BOVA 3QIWD 4PJXB 1I75A 1BREA 1EO5A 3DYPA 4GG8B 2P4AB 3ECBA 2B5IC 1JFQL 2FX7H 4GS7C 3S97C 3GI8L 4ELMB 2W60B 5C8JA 3PGDB 2IAMB 2CDFA 2BJML 1X5AA 5ADOH 3LB6D 2DD8L 3MA9L 4KJYB 1MWAH 4KHXL 5GRZA 3H9SD 2DQJL 5J7CC 4P59L 3TT3L 1WWAX 1HIMH 4G5ZH 3RA7H 4JPKH 3E3QE 1LEGA 4X80L 3D85D 5ESVB 4LKXA 4MD0B 4FFWD 4AH2A 1BZ7A 1J88A 3OF6A 4OM1H 4LIQE 3S3SA 1B0RB 5L0QB 4I77L 3TJEH 3NIFF 2VLKE 3DVGA 3ISWA 3OKLA 1KB9K 4I0KA 1B88A 3BHBA 5DDHB 2R23B 1VFBA 4X5WA 1OOAA 2CK0L 4R4FL 1C5CH 4YH6A 1F8TH 4JFHD 1XGTA 5F6IC 5L6YL 3WNLA 1W8NA 2M1KA 4WEBH 1KJ2H 2CIIB 3G08A 3TNNA 2WUCH 1FH5L 3PP3H 1DUZA 2W65B 1X5JA 4HJGA 5DJDA 5IMKB 1J87A 1B4JH 4LMQI 5TQ2H 3TPKA 5EU3A 3RZCD 4MQXC 4G8GD 3LV3A 2FRGP 2XT1B 4PJ5B 3ROOB 2I5YL 3O2DA 1UENA 4I0PD 4MXVE 4BH8A 3OPZL 3CLFH 3TJHC 5E24E 5EBLA 5DJ8A 1BOYA 3QG7H 2OMNA 1A7QH 2VOTA 4YPGB 3IFOA 4ZTPL 5GSRA 2HJKB 3RTQD 4Q0XL 4IMKA 2E9BA 3BIKA 4PJHF 1UWGH 4Z7QE 1K3ZA 2QSTA 4YGVB 5IJKC 4EXPX 1BFSA 4Z7NF 3K2UH 5EU6D 4RNRA 2R0KH 2HT2D 3N1MC 1P7QD 3BD3A 1AE6L 3E8UL 2MKWA 1HSBA 2PXYA 1P7HL 3IS0X 5FO8A 4NQED 4MA1C 2BRRL 2EKSA 3GM0A 2EO1A 2NQCA 4MJID 4C56E 4G43B 5TFSL 3PV6B 1TVHB 1MF2L 1DEEA 3G5YB 2ICWI 3AC0A 1KTDA 2DMBA 1QO3B 1P4BL 2NY6B 4P48A 4K8RD 4OIIH 5AZ2L 4TTGA 1JPTL 1J05A 3GGWA 4NZJA 4ELMF 3TYGH 3X17A 2P7TA 2Q7NA 3MRKA 2Z31C 2JJTA 1UH4A 4XBEH 4UINH 3R0MA 2E7CA 2I07B 4CVXB 4Z76A 3FO2B 4N9GB 2ZNWA 5I15H 3QFJD 1YMME 1SQ2N 4I4WA 3RVXC 3MBXH 3OWEA 1QSFA 4JLRB 2W38A 5DYOA 4NZUH 4YHMH 4RZCB 3RDTD 5M95B 2DAVA 4LLYA 2AXJA 4KRPB 1JMXA 3D39D 5CZXD 4TSAH 4JKMA 1A1OB 1JWSB 4MX7A 3DGGA 3RWJB 4YXHL 3QUXA 4Y5VC 4BM7A 4PJ8A 4LAQH 1KJ3L 4ZAKD 3BH8A 1QFOA 2UY7A 4NNXA 1TVBA 5JLZA 1CWVA 1PSKL 2QQNL 4LHUD 3MRDB 3PL6A 3OXSB 5F7KC 3HUJB 4IOSD 5D93B 4QRPE 1X6LA 2Q1EA 1MFEL 4KH2A 1NBYB 2NX5E 1CQKA 1FIEA 4PRIB 1KC5L 4Z0XB 1A6UH 5I1DB 2BVYA 4KK8C 5E03A 3CZFA 2WWMC 4PJGA 3BVNA 3SDXB 1IZJA 3TN0A 1GCFA 4OZIA 4PJEE 1REIA 2CIKB 3VWJC 2BCKA 5DJ6B 3QUZB 5GISL 5C0EA 1HCVA 1CG9B 1FFOA 4KHTH 4RRPG 2JLLA 4YE4L 1PZUB 4JJ5A 3OR7B 4Y5XC 5DJZB 2RCSH 1W72H 3DO7B 2BNUB 2DJUA 4QY8A 5DD5L 2CUIA 2XYCA 2UVEA 4Z7OF 1AI1H 1A7NL 3B43A 1NGYA 2NZIA 4FXKB 4UV4H 2GT9A 2Q3AA 1F00I 4KVNH 2ZZUT 4L4VD 1VEPA 1IC4H 4X9GA 4J3OC 5A16A 4ZS7H 2H2PC 2V17H 2J5LB 3QIUD 3MGTB 4RFOH 2X7LB 3WIHH 4UIMA 2R15A 5ID0B 3MV7E 1CTOA 4GBXA 1OP3H 4EN3B 2R29L 1DZBA 4IRSB 2HT4C 5ITBH 2CQVA 4W4OC 4ZUVB 3HG1B 1VFUA 4KTEH 2VXQH 3DUSA 1XGUA 4PJIE 3WJJA 3DNKA 2YPVL 1T3FB 1UWEL 3KYMB 1QRNA 3LS5L 5CBEB 4XPBH 2VXSH 5F7EH 5TE6L 1MCIA 3DUUB 1INQA 3WNMA 1EJOL 1A2YA 1E4XL 1PY9A 2QSVA 1MH5B 4QLRA 1WZ1L 4NC1E 1ZEAL 1MRCL 2B4CC 3BGFB 5DK0A 3LHPH 5K9JL 4PBWD 5I16A 2X10A 4PJFA 2EIEA 1FAIL 1K4DA 4QRSB 1BZQK 4XPFL 3P9LB 2CXGA 3VGFA 3MLTA 3VDBA 5CIPA 5DQJB 4U31A 3SJVE 1KULA 4MSWB 4XBPA 2DLHA 2O5YH 3T65B 3IDNB 2XTJD 3WFHB 3WLBA 1PYWA 4MNGE 1A7OL 12E8L 4HAGA 4IOIA 1G7MB 1I8MA 1DBKL 4HWBA 2VDQL 1CXFA 1DANT 4DGYL 3NFPA 4ODUB 4PP2B 5J12C 1MEXL 3TYFB 2HMID 5EB9A 1WV7T 3QCVL 3P9WB 5KG9B 2FWOB 3LCYA 5CZVL 1YY9D 4Z9KB 1S5HB 4NC2B 4I1NB 3WO4B 4UBDD 5DHVA 4KK6C 1MCWM 5AD0B 3HUJF 4AIXA 4YIQB 2A9MH 3MJ7A 4NM8H 2X4OA 4WFFD 5HGHA 3SDCB 4JR9L 3AS1A 2FLRT 3QDJE 3QDGB 2CGRH 4G7YL 5D1QB 1CE6A 4FQJH 4QO1A 2HP4A 1CR9H 1EEYA 4LF3B 4RIRB 4ZTOH 3SDXF 3NA9L 1CLZH 5TDNB 4LNRA 4UQ3A 2CRIA 4MQ7A 4X6DB 3GBNH 4WHTB 1CL7L 1AQDB 3VDCA 3G6AB 5JHLL 1RJLB 5MI0C 1SBSL 1J0IA 3CDCA 5JMRA 1Y6NR 2BVQB 2FB4L 5GRUL 4BSJA 2X09A 5C09A 2CD0A 2VLME 4OB5H 4F7PA 4POZD 1HK6A 1TLKA 4EI5D 4N0FA 3JWDL 1TZHA 3I2CH 4AYFA 3S35X 1YYML 3RBSA 4BYHA 1ITBB 4PJDE 1KNOA 4HJJL 3LOWA 3T3PF 4FXLA 3V8CA 1AH1A 3RZWA 4CMHC 3DYOA 3M8OH 1FYTA 3MACL 1RV6X 4G6KL 5D2NA 5DRXA 2G75A 1MHPL 5DUBA 1T5XB 1EPFA 2AJSL 5J6HA 5A3IC 1U3HB 3WHXA 3CXDH 3ZYJA 3I3EA 4BFIA 4F8QA 3I6LD 4BFBD 4HCRL 3T0WA 5HY9A 1MFCL 3QXDB 5KN5A 1V7NH 1GZPB 3KGRA 4GRLA 5CLWA 3QIWA 1CDCA 1FVEB 1TITA 4FFYH 2BY0A 2XN9D 2BFVL 4JZJA 1C7SA 4WU7A 1N8ZB 3HLAA 5IBLC 3HC3L 5E4EB 1SEBA 3KJ6H 4XMKH 4TNWK 1FN4A 4I5BB 1JTTA 4PB9H 3QO1A 3KPQA 2X4QA 3MBEB 3MLYL 1NEUA 3D0LA 4P2QD 3D18A 1UYWH 4HKZA 2E9IA 1YDPB 3KYKL 3BP4B 3MUGB 2RIKA 4F80A 5CJXC 3D85A 3LEXA 4Y5YA 2WP3O 4OZFB 4XWGH 5F93C 4BUHA 2GTZA 5B38A 3DX7A 3RHWK 4WUUB 2CLZB 4OZHA 5D8JL 2ITDB 4JPIB 1XF4A 5DRWB 3U4BH 3P73A 1MCWW 4N5EC 4MA3B 1JZ8A 2BMKA 3NPZB 5MEOB 3GI8H 3BT2H 2EDOA 5GRVK 3QJHA 4ELKA 2HLAB 3RVWD 2B0SH 1S7RB 3NABL 2H32B 5IW1B 2W59A 2B1HL 1Z5LB 3LSOA 4I3GA 5ILTH 5DZOA 3MA9H 4XP6H 4LCUA 2NY4C 2V5YA 2IADB 3MUZ1 1EXUA 1X4YA 4S0SD 4XXDB 3L3OB 5D5ME 1YZZA 1Z9MA 4LQ1A 3RZCA 4GXVL 1S7QB 3ESVF 4EDXB 4G8GA 1NFDB 4X6DF 4G8IB 5EU4A 4HFWB 1L0QA 1UJ3C 4P4KC 1FSKB 5B8CB 1OLZA 4I0PA 3B4NA 4RGNC 5C08D 4Z7WA 4I2XE 4M93C 1RJZB 3TZVD 4JGUA 3C6SA 1KTKE 5F7LB 3RTQA 3EO9H 2CK0H 3RWDA 1KB9J 4LEOA 5D7LD 5KOMC 1FFPB 3PHQB 5IVZA 2FNBA 2OBGA 5EU6A 4KV5E 2F53E 2A9NL 3DX6A 4G8EB 4PY8J 4RFEB 5ESAB 1ZHKB 1P7QA 3RY5A 2R2BB 5E9DB 3NN8B 4FQ1L 3PWLB 3RVVD 5FB8A 4HKJA 4NQEA 4KAQH 3HZVB 4U05A 3STZA 2WAHA 4TSCL 1ZLVK 3GIVB 4HIIA 3VGEA 4MJIA 2DQUL 3K4ZA 3JWOL 1AC6A 1MFBL 3ARGD 5FYLE 1XMWA 2I5YH 4Y4KD 4WU5B 1TQCB 3TCLA 3KNBA 3LQZB 4OV5B 3VXSE 5HYEA 3TEUA 2PR4H 3LEVL 1ONQB 2HRPL 2DTMH 3K8MA 4M6MH 5GGRY 3BZEA 1HYSC 2QL1A 1FFQA 1OW0C 5DEFA 3BPNC 4NRYB 4XMPL 4B50A 5GS0L 1GHFL 5I1CL 3HAEG 2NMSA 4Q6IA 2MCG1 1UKQA 1ACYL 1FDLL 1AGFB 1SJEA 2DKSA 3VXRE 1I85C 2V6HA 3E8UH 2YBRB 3D39A 3NH7H 4XVUC 2HJLB 4TNVK 2R2HA 1WUNT 4XVTL 4ZUTB 2BRRH 3V5HB 5J56B 1V7ML 1RZ8A 3BWUC 4ZO9A 4RCAA 4N8PA 3AS0A 2PN5A 4O51A 4M6OH 4ZAKA 4AT6B 5FO9A 3T4AB 1MF2H 5EUOB 1UG9A 5I18H 3ARBD 3IU4L 4LHUA 1K6QH 4IDLA 2GFBB 1RU9L 1KLUA 5JIKA 2OQJB 3ZMRA 1U91A 3SKUD 3CAFA 5D1ZB 1ZE3C 3IYLW 5EDXA 2BDNH 5F7DA 4QRRA 1V3MA 4PG2A 3GO1H 3OTTA 4HFUH 2ZSVA 4ALAH 4LPCA 1Z2KA 2HFGL 4MXVF 5D96B 1NFDF 1QEWB 4CL7A 3WFCL 3PDDA 4JPVH 4LPUA 1XF3A 1NEZG 3UCRA 3BQUD 5KS9E 3UTSD 3D9AL 1HYRC 4N0YH 1A4JB 1F6AA 2HH0L 4L4VA 1YEEL 4YAQB 4L5FH 2QKIB 3ZKXC 1SEQL 3EYSL 2G9HB 4JDZA 1X6NA 3MLSH 4O02L 4D8PA 3EDJA 1B4RA 4Y16C 1NC2B 3AREA 3CVIH 1NUDA 1NMBL 3O3BA 4QXGH 1T0MA 2VLJB 4XVSL 4QOKB 1FBIH 4ODXB 5ESQA 4EBQH 2ZP0T 1KYOK 5FGRA 4KC3B 2W0LA 3HNSL 3VW3L 3LN4A 4KROD 5I73C 5F89B 2AEPH 2GSGA 1RD6A 5DRZB 3BAEH 4LDLB 4UT9H 5DD5H 2VDRL 4JHWL 4E41D 2AK4D 4DGVL 3L3HA 4I9WE 1A7NH 3FQRB 4J6RL 4NRZA 2G60H 4WDIB 1BMGA 4L4TB 3C87A 4JY5H 3GMLA 1OAXH 3F58H 1K8DA 1NFKA 4TQEL 4EJ1C 5I19L 3OXRA 3MRNB 4PJ9D 3GSXB 1YJDH 4H5SB 3UBXB 4YBLC 5CEYA 3TO4D 1SY6A 3EZ8A 3PWJA 2R29H 3WN5A 1IGMH 5H37G 4NSKB 1GGTA 2LFGA 4P0DA 3TFKC 3CXHK 5DQ9A 4X6CB 3W81A 1M05B 4KJPC 3M07A 1DVFD 2J8UE 1X5IA 5EUOF 1I1AC 3SBWC 2GQHA 5TE6H 5HYIA 5C07D 2DLFL 1J0JA 5IESH 5F9WC 1EJOH 2F5AH 2L4OA 1WZ1H 3BJ91 4PTTB 4WW1B 3O9WC 5BMFL 1MWAB 3T77B 4OCXH 4FTVE 4BA8A 1FAIH 4FQ2L 1J5OL 1I1YB 1CF8L 2XQYG 4OQTL 4ZUUA 5HGBB 4OLWL 4L1DA 5SV3A 2IAND 4W6WB 2Y5TA 1J8HE 4FFZH 1A7OH 2WINB 3WHE1 1CLYH 5IJVB 4F8TA 1FFNA 2VDQH 3RI5F 4DGYH 2RQ8A 3OHXB 5HGGS 4G6FD 1OM3H 1TMCB 5CD5D 3NPSB 5F3HA 1GZQA 3DGCR 4LSDA 4ZOCA 1B0GB 1GGBL 3RKPA 5B39A 5CZVH 1QUNA 1KJ2B 3FT2B 5AG9A 3AGVA 2H45A 4GG6E 4X7FC 3FQNA 3V8OA 2X4SA 4JR9H 2YWZA 1OTSC 3VFWA 3Q5OA 1RZIB 5D7KE 4OUUA 1J0YA 4Z8FL 4ZQKB 5BZDA 1JHTA 2J3SA 1NUGA 1PKQE 2NPLX 2J6EA 3OG6B 5AWNH 4GG8A 4ZUWA 4OFPA 5E08L 5GRUH 1I8LA 3MV9E 5I71C 1VPOL 3AFLA 5BW7A 1OTUD 2AXFA 2A83A 3PNWA 3KPLB 5IVXE 1JGDB 5ITFB 5JOPE 4OFVA 3HZYB 2EC9U 1GOGA 2YUZA 1EEUA 5D6DA 1MUJB 1FZOB 4OAWB 5FUCE 5GS3A 1MJUL 3RWHA 1ODAA 1ITCA 2Y1VA 4P2QA 5EIVA 4KMLB 5MI0B 1R3HB 3W9EB 2AJSH 1A6VL 3GIZH 2GJZA 1P7KB 3LQAL 4JRYB 3SDAB 3KLHD 1AGDA 3MXWL 2VLKD 4PYHA 5C0AB 4OCSH 4ONGL 3QO0A 4U4BA 3L3IA 4NQCB 3LPGA 3ARDC 1NUFA 1PLGL 4JFPA 4UAOB 1NL0L 1UA6L 1NC4B 4X6CF 3MV8E 5FGCE 1UEYA 4XC1H 5D72H 1KACB 3VRLE 2R23A 1BIIB 5EPMB 3O11A 3A6CH 2VKXA 2HA1A 3HC3H 1VA9A 3DO3A 2BNQD 2XWJA 3LY6A 4GMSL 3U0TB 1X3DA 2PO6B 1JRHL 3MR9A 4MAYC 2NYYC 3X3FL 3IDYC 2C1PB 3HR5A 3P0YH 5IB2A 4I18C 3VFPB 4HEPG 4OLVL 3X11B 4K3JH 3CUPA 5HHVH 3HB3C 4HMDA 1Z0MA 2DQCL 1FNGB 4UQ2A 5MP6H 1CIDA 1Z9SA 3QNZB 2HFFB 1T20A 2LAGB 1MAMH 1QG3A 4NC0B 4ODWB 2DM7A 5E5RB 4R0LC 3HR6A 4JM2C 3ZDZF 5CILL 1YEJH 1FGVL 2OJEA 3GJFK 1WAAF 4RGOL 4XCYB 3L6FB 1QSEE 4JN1L 4S2SA 3VFMA 4K71B 3H3PH 5IEKB 5D7LA 5DK2B 2KH2B 3I84A 3NABH 1D5XA 2EO9A 4C56D 4P23B 4QGTA 4S1DC 5E2JA 5IMLB 3QDME 5DR5H 2C9AA 3PGCB 2OZ4H 3GKWH 4ZDHB 1W72B 3EO0B 5IVOA 3IGAA 5BV7H 5M7QA 3BPOC 4C54A 5F21B 1FO0H 3CFCL 3TBTA 1QYGL 1CGWA 2EH8H 3L3GA 4NN6C 5IQ9A 2IQAB 4UT6H 1CICD 1H5BA 3MODL 1DL7H 3DUHA 3RPIB 5BXFA 4OJFL 1YMMD 1UKTA 4JAMA 4JGJA 3ZTJH 2FD6L 3GSQA 3QQNA 4JPWL 5C3LD 1RZGB 3O2WL 3CSBA 4ZOEA 3GSVA 2OCFD 1OGAB 1CN4A 1UJ3B 2CXKA 3TBVB 4U1KA 4MJ2A 1W0WA 4V2BA 4GH7B 1Y0LA 2C3VB 1GL4B 3MMEB 3OJMB 2D2OA 3S35H 2R2EA 4RZCA 4HBCH 4PLJC 4DVBB 5CWSB 3DLQR 1NCAL 1XCQA 1NAKH 2R1YB 3EYVB 5GS1A 5ACMA 4NWUL 1BVKA 2XNAA 3JV4B 3NACH 1WEJH 5DMIH 3TCXA 4LASL 4NPYB 2NZ9D 2YPLB 3CVHB 1OQOA 4NM4L 2AABL 3ARBA 3O3DB 4WWID 4ZXBB 1RZ7L 4PRAB 1FPTL 2YRZA 3IETA 3HUJA 1WIUA 4MHHG 2F54B 3U79A 1CD9B 4E42B 3SE3A 4K94L 1N64L 4MNHB 5E7FA 5HDLA 3T1FA 1NBZB 2C7UA 2UYLB 4XMPH 2YN5A 4U2YA 4WI2A 5DJ6A 5GS0H 1GHFH 5C9KA 4P3DA 3RL2B 2EYTB 4OTXL 5T3ZD 3N9GH 4QHNB 5HTSA 1I7RB 3VXTB 3DVNB 3BQUA 4Z7VF 5LGKA 3V6FA 3UTSA 3V0WL 3P77B 3TO2B 3MV7D 4HWEL 1AGCB 2BXYA 5CINH 3FAXA 1NGZB 2AV7A 3WEXA 3N1GC 4OQ1A 1FL5A 3IU4H 5F6HJ 4F58L 5IG7B 4UILH 2D7OA 1RU9H 2R0LL 2YD9A 3AXLA 1R3LB 4JN2B 2VL5A 4YR6A 1G7HB 2MQ3A 5E6IC 3JWDC 3FFCE 1HINH 1F2XK 5ADPL 5FCSH 1MCOH 1FYHB 1HOCA 4QWWD 2NXYB 3KJ4C 1JGEB 4NN7B 4K7PX 1R3KB 1LO0L 4HWNA 1UQSA 2DQEL 3O2DL 4MA7L 1KIQB 1KCRL 2LVEA 1OP9A 2NTFA 3OSKA 3WFCH 1QPXA 3F7YB 1T89C 4E41A 2AK4A 3QCTH 2C3GA 2HN7A 1T04A 4RRPA 5IROC 1S9VB 4MJ6B 1MLCA 4KU1A 3PHOB 3QI9C 3IU3B 4XVJL 2ZOKA 4LSUH 1MHHA 2HH0H 3SJVD 3IDGA 2JCCE 5TF1L 4GRWE 4M7JH 3U46B 4NKIL 4KQ3L 3EYSH 1A14L 2W92A 3K80A 4PJ9A 3QZWB 4LGPB 3RBGA 4NRXA 4O02H 1FHGA 1N6UA 5CEZE 4JO4L 4MQSB 1NMBH 4XNZC 5E2TL 1YECL 4X7EC 1JHLL 3TF7C 4LVEA 3DRTA 2GCYB 1WCBB 3U2SB 2YRLA 3GEWB 1VENA 5IEHA 1SM3L 3U0PA 5KVGL 5EU5A 4YNYA 6FABH 3VW3H 5HVHC 1EMTL 3KR3L 1KYOJ 2ZUVA 4JFFE 2X4NB 2H8PB 1QFWI 3QDJD 4JHWH 2P8PA 5F44A 5FK9A 4HIJA 4OF6A 3ILQC 4YK4C 4PRNA 2FEDD 1T2XA 1PGRB 5J8OA 4F2MA 3F62A 2VWEC 4TQEH 3V6OA 3OX8A 4YX2H 2VLMD 1I1RA 3CSGA 1D9KD 3QIUC 1HCFX 5KS9F 4EI6B 1WQVT 2BSTB 2IANA 5DJXB 4Z7UA 5D7IE 3MLRL 4HIEA 4QTIH 4QGYA 2VIRA 4X7CC 4KJWD 4QNPF 1JF5A 4ZOAA 2CMRH 4BSWB 3F12A 3ULSB 1P4IH 4KKCD 4QRUB 2GEEA 4KPHH 5JUEL 1BVLB 4GSDL 2UWEE 4HKXA 4IJ3C 1JCKA 5GGQL 5ICXA 2EC9T 4OCYL 3CXHJ 4WHYH 4M48L 4M6NL 3LKOB 5F1KC 3QQ3B 1XFPA 5ALBL 4NQXB 5D7JC 4APQD 1LK2B 4CW1B 3SO3B 4J4PC 3BH9A 1AFVH 1MQKH 4NKOB 1MCQA 1MSPA 3SDYH 4M7KL 5ERWA 1KXTB 5F1IB 1LEIA 1I3UA 2V7HA 1BHGA 4OQTH 1T7YA 4OLWH 2MWCA 3ORJA 1H3PL 3KYOB 3HS0A 2VDPH 1C7TA 4L3CB 5CUSL 1FG2B 3TESA 1IGIH 2VSCA 4WCYL 9CGTA 1S7XA 3BE1L 1L0XA 3UYOD 3MREA 3OAZH 4P9ML 4YHLH 3JWOC 1GGBH 4XC3L 5C6TL 5JA8B 1TNMA 3C6LD 1T21A 4KQ4H 1BX2B 1R24A 1RZJL 1WITA 3AB0C 4ORZC 5CSBA 4AEFA 3EBAA 3OB0H 4C83A 1RVFL 4JO2L 3FO1A 3DBXB 2VLKA 1I7UA 4HJ0D 2FSEB 3OKOB 4CVWA 1P2CB 1DR9A 1S9WA 5GGSB 5HI4D 5BCAA 4LLUB 2ZCKH 2PTVA 4Q9CA 3H0TA 3EKCA 4EOWL 2ITDA 1MCSA 2ARJB 4PV9B 1IQDA 3EJZD 4QRQB 1JGLH 4DUXA 3DX9B 4K3EH 4R3SA 5ID1B 5IV2B 1UC6A 3I3BA 5GGUA 5HJ3B 4XTRD 3S4SG 2ADGB 4GQPH 1BFVH 5JQ6H 1FL3A 4XNMA 2VDKH 4KTDL 2OK0L 2DJSA 1N5YH 3CFBA 1RURL 3DV6A 5AUMA 2NY0D 5FA3B 1MJUH 1BECA 1NGXB 4WW2C 3GUTB 4ZD3L 1MIEL 1A6VH 4HWBL 4PJ7B 1LILA 3GMQA 3WS3B 5GHWH 4QHUB 1LO3H 4G8IA 5CKAA 4LVOB 3HE7B 4K55A 1AXSA 1D6VL 1QBLL 3MXWH 3NCCB 4P3WA 5C0RL 3D25B 1TETL 4XNXL 3ZKSD 5JZ7D 4UNTA 5T1LB 3OKMB 3BKJL 4JO1L 4X9IA 1NL0H 2IALB 1CD8A 3VMNA 2PYEB 3N1PC 1P69B 2F53D 4WJ5B 4GXUM 2W1NA 4H20L 3U1SL 4G80A 4XBGA 4GMSH 4HC1A 2XOTA 2WBKA 4LDOB 1Q9WA 1Z3GL 4C56A 4LP5A 3ESUF 1ZHKA 1OB1A 3WE6B 4MD5B 3MJ8A 4GMTH 3SPVA 5FYLD 1BZ9B 5JW4R 4OLVH 1TQBB 4YXLL 4JM4H 3E0GA 1IKNC 3QPQD 5JOFA 1ZHLB 2DQCH 4XX1E 3VXSD 4DN4L 5IB3A 2BY2A 5ISZB 1T83A 3BI9X 4KK9C 1DEDA 3MOAL 1BD2E 1JE6A 4WWKB 4KDVA 4JE4B 4YWGH 1AO7E 3OJVC 3G5XA 1CICA 3T3ME 4PJCB 1XF2A 4NBYB 1YMMA 1S8DA 1JZ7A 4WEMB 3MCKB 1WBYA 3VXRD 1KCSH 3VXMB 3ULUC 1T5WA 1HHJB 2R1XB 5D70H 3K1KC 5SWQA 3UDWA 4JN1H 2J4WL 4FQCL 3RX8A 1JWMB 2HLFC 2EXWD 4L8BA 4PRHB 2XRAH 2V9TA 4EQ2A 2ICWB 1MJ8L 5IWLC 5MEQA 4JKKA 4P46A 3JZ7A 4KI5C 4Y4FC 5HHQA 4YDKH 4YDLB 1PX3A 1N5AA 2FX8L 4QRPA 4X6BB 3EHBC 1L7IL 2PTTB 3T4AA 2FIKB 2NX5A 3D6GA 4K23H 4G7VH 2X05A 3RWCB 1L7TL 2OSLA 3CFCH 1CGUA 3CLEH 1J11A 1EVTC 1LNUA 4M1CC 4PJEA 1HQRB 1P6AB 2APFA 3FQWB 1MJJB 3OKKB 3B9KC 1YUHA 3WBDA 1CBVL 4NNYB 3TIDB 3TZVC 3N50A 4G9DB 3BP5B 6CGTA 2YZ1A 4YJZL 4HMCA 4MVBC 4OGYH 1ZHNB 4PJ7F 1KN2L 3WS6C 4NN6B 2AJZA 1ZMYA 1YNKL 3HAEA 4F7CB 1JPSL 3LKQB 5C71A 4MD4A 4NWUH 3L5WA 1BFOB 2A77L 4RMRA 4UDUB 3MV7A 4KJQD 4GOSA 4H25A 1I9IL 5GS2D 2QKIA 3RKDD 2AABH 1RZ7H 4WV1C 2NY2D 1TJIH 5E1AA 3VFOA 4Y4KC 2VISA 2H1PL 4PJIA 4O58H 5GIRB 5FCUH 4HS8L 1B6DA 2LQRA 1C5DB 2DQDH 4ZO7A 4YC2C 5F8QC 3LZFL 3I02B 3RU8H 4I9WD 4NO5B 3GSNA 4AIZB 1HH6B 2Y9RT 4OTXH 4NKMB 5JW5B 1RK0A 5DRZA 3WNNA 4DVRH 2R56H 4HWZB 2ADJA 1QSVA 2WM0A 4H0HB 2I27N 1T66C 5K9KB 1NEZA 4JQIL 4NZRL 3I3DA 4PJCF 3SJVA 3O8XC 4FZEH 1A4KA 4X4XA 5F7WC 4CVUA 4MNGA 2EXYD 3I6GB 4F9LA 3L3KB 1UM4L 4LCYA 2R39A 2OTWA 4BSVB 3VCLB 2HRLA 2AEQL 1A9EB 1F2QA 1PQZB 4XI5D 2XWBA 2X1XR 5DQDH 2GJJA 3VFTA 5C1MB 2W91A 1N7MH 5CJQL 2HAZA 5JW4N 4X4YB 3TT1L 5EN2B 3RIAF 1MREH 3BUYA 5I1LB 2GK0A 2IF7A 2AJYL 1ND0B 4JCMA 4HUNB 2IMNA 1KCRH 1U8IA 1NCDL 5ACLA 5FA4A 3LQAC 1UCBH 1UT9A 4FFVD 2K7PA 4HK3J 2GTWA 5A2LH 3QDJA 3LN9A 4FTVD 1WFOA 1LP9E 4YEEA 3MRPA 3D3VB 2GYSA 2NY7L 3QH3B 1INDL 3M17A 3UJJL 4ZFOA 3G6JB 5TF1H 2I60L 3Q3GB 3CGTA 2GJ6B 4NKIH 3TNMA 8FABB 1CE1L 4DZBB 3LEYL