2IH9A

A high-dose crystal structure of a recombinant melanocarbus albomyces laccase
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
559
structure length
559
Chain Sequence
EPTCNTPSNRACWSDGFDINTDYEVSTPDTGVTQSYVFNLTEVDNWMGPDGVVKEKVMLINGNIMGPNIVANWGDTVEVTVINNLVTNGTSIHWHGIHQKDTNLHDGANGVTECPIPPKGGQRTYRWRARQYGTSWYHSHFSAQYGNGVVGTIQINGPASLPYDIDLGVFPITDYYYRAADDLVHFTQNNAPPFSDNVLINGTAVNPNTGEGQYANVTLTPGKRHRLRILNTSTENHFQVSLVNHTMTVIAADMVPVNAMTVDSLFLAVGQRYDVVIDASRAPDNYWFNVTFGGQAACGGSLNPHPAAIFHYAGAPGGLPTDEGTPPVDHQCLDTLDVRPVVPRSVPVNSFVKRPDNTLPVALDLTGTPLFVWKVNGSDINVDWGKPIIDYILTGNTSYPVSDNIVQVDAVDQWTYWLIENDPEGPFSLPHPMHLHGHDFLVLGRSPDVPAASQQRFVFDPAVDLARLNGDNPPRRDTTMLPAGGWLLLAFRTDNPGAWLFHCHIAWHVSGGLSVDFLERPADLRQRISQEDEDDFNRVCDEWRAYWPTNPYPKIDSGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Laccase-1
publication title A crystallographic and spectroscopic study on the effect of X-ray radiation on the crystal structure of Melanocarpus albomyces laccase.
pubmed doi rcsb
source organism Melanocarpus albomyces
total genus 179
structure length 559
sequence length 559
chains with identical sequence B
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2006-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ih9A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ih9A02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ih9A03
1A8ZA 1N68A 2HX7A 3T9WA 2WO3B 1IKOP 5E9NA 4DPBX 2CCWA 3AG4B 3EH3B 3TA4D 4GY4A 2GIMA 4HHWA 2ZONA 2VM3A 1GS6X 3TBBA 1CC3A 3FU8A 1ET8A 2TSBA 4E9XA 7PAZA 4DP5X 2P80D 3N55A 5AFAA 2PP9A 5D4JA 3DKHA 1CYWA 4KNTA 4KOCA 3UACA 2B08A 3WG7B 3X1GA 3ZBMA 1E30A 1ET5A 1SFHA 5I6LA 2AVFA 1M57B 1WA0X 2Q9OA 3FSAA 4G70B 4GXFA 5B3SB 1A65A 2IWFA 1GS8A 3FYEB 1BAWA 4BWWA 5AZUA 1BQ5A 1PLBA 2XXFA 1BEXA 3H4FA 4YSDA 1SDDA 3FQYA 2FQEA 1SJMA 1WS7A 4E9YA 1J9SA 5B1BB 5ANHA 4FA7B 1X9UA 3JTBA 5A7EA 2JXMA 1JZJA 2XV2A 2I85A 1OCZB 1ET7A 1NIAA 3ABGA 5F7BA 5FC9A 2AZUA 2BO0A 2RACA 1JZFA 1TU2A 3NSDA 6PCYA 1L9PA 2HRGA 3H56A 1BYOA 4YSQA 2BWDA 1NWPA 3T6WA 1KV7A 2N0MA 1NPJA 1JXGA 2DY2A 2W88A 1QHQA 9PCYA 3ZIYA 1WS8A 3UADA 1MG2C 1AZBA 3PAZA 2J57A 1MDAA 1R1CA 1JZEA 3H4HA 1KBVA 1AS7A 1BQRA 1J9TA 1MZZA 4YSCA 3S8FB 2FJSA 2QDVA 3RYMA 4KO6A 1BQKA 1A4CA 1E5ZA 2AZAA 2VSKB 4M4RB 2GBAA 3FYIB 3WKQA 2GI0A 3NT0A 5D4HA 2CUAA 4BDVB 2XX1A 1BYPA 1RKRA 2IDQA 3FPYA 1OV8A 1ILSA 3QJUB 1M56B 1T5KA 3ABKB 3QJVB 1PLCA 2Q5BA 3TASA 2UXFA 1I53A 1SHWA 3OMIB 3QJQB 3GYRA 2QPEB 1JVLA 4YSUA 2J55A 1WA2X 2B3IA 4PAZA 2VW4A 3SBRA 4HZ1A 2MTAA 4YL4A 1PZAA 2H47C 1JXFA 4YSAA 3ABLB 4HCGA 4HAKA 2EILB 3N2JA 4NERA 1L9OA 1M9WA 5I28A 1SHXA 4JHVA 3AZUA 1B3IA 2VSMB 1A3ZA 1AG6A 3DTUB 3NJJA 4DP2X 1E5YA 1EHKB 1GY2A 5I6NA 1F56A 1W8EA 3FSWA 2E86A 4A68A 1PAZA 1HAUA 1N70A 1PCSA 5PAZA 2BWIA 2ZXWB 3PAUA 1NIBA 3UAAA 1J5CA 1PNDA 1RZQA 2FQGA 2GSMB 2PP7A 3NJNA 4AKQA 1J9QA 4BWTA 2UXTA 4KO7A 4DP0X 3PPSA 4E9WA 2XVBA 1TKWA 4EF3A 1AR1B 1ZDSA 2IDTA 5LDUA 1ZDQA 1PLAA 1PY0A 4KNSA 5B7EA 2WSDA 3EHBB 3U25A 5I5MA 2IH9A 3PCYA 2YARA 2BW5A 2IWKA 1ZPUA 1AACA 3PXLA 2FT6A 3OD3A 3IE9A 3NSFA 3L45A 4HHGA 1KDJA 2FNWA 4UAHA 2UX7A 5IY5B 4N8UA 4G71B 1E65A 3X1FA 1OCRB 3X2QB 1NIEA 2VM4A 3ASNB 3X1NA 2PPAA 2HXAA 3AG1B 1OCCB 3UGEA 1XMEB 2PPFA 3X1BA 5D4IA 1AS6A 3TU6A 1IUZA 2PPCA 2DWTA 1VLXA 2PLTA 1V54B 2AFNA 5I6MA 1MZYA 2GC7C 3CG8A 1BXAA 3EH4B 3PAVA 2J5WA 2FQDA 2YQBA 4X4KA 4YSOA 2QDWA 1JVOA 1KDIA 3HB3B 4BDVA 3GDCA 1IBZA 2CALA 2YAFA 4L0PB 2DV6A 1NIFA 1EZLA 2W8CA 4AZUA 2CBPA 4KOBA 4QKTA 3WNJA 4DP8X 2HX8A 2ZWNA 3SBPA 4WKXA 4PCYA 1OOWA 1PZBA 2JKWA 3OMNB 2BZCA 1GSKA 3NJLA 4A2GA 1GYCA 5B1AB 3CVBA 4NB7A 2R7EB 1OCOB 3CVDA 2X88A 4G72B 1XB3A 4Q8BA 3WNIA 1BXUA 4NAJA 1L9TA 2YAOA 2XV3A 1GR7A 3V9EA 2PPEA 3T6VA 2BP0B 3NJIA 1TEGA 1AZUA 4AI7A 4JKNA 2FQFA 1ID2A 1FFTB 1NWOA 1ZV2A 2H3XC 2XXGA 1AQ8A 1QNIA 2FWLB 3QPKA 5I6OA 1QLEB 4CSZA 2PCYA 3DIVA 2BHFA 1TEFA 4BWUA 4A2DA 1DYZA 1KCBA 2XLLA 4UANA 4A67A 3NJFA 1GY1A 2I7SA 3NP3A 2HX9A 4RH4A 1GS7A 4M3HA 1OE3A 1NTDA 2IDUA 1J9RA 4F7KA 2DYRB 3NJGA 2NRDA 4AKOA 5B1JA 2DYSB 1UATA 2IAAC 3NYKA 1OE2A 1L9QA 1V55B 1JZGA 3FQ2A 2VW6A 2FTAA 4KO5A 3EH5B 2JFCA 3QJTB 4GYBA 5B1KA 2H5UA 3AW5A 1AZCA 3IN2A 4DP6X 3MBWB 3AG3B 1KCWA 5I26A 2EIKB 4YSRA 3SQRA 2GB2A 3NP4A 3SBQA 5PCYA 1PNCA 3CDZB 2XU9A 4YSEA 1MG3C 3OM3B 4DP4X 2VMJA 1ASQA 3ZDWA 2XX0A 3QQXA 1JERA 4TXVB 3S3CB 1DZ0A 2CJ3A 4YSSA 8PAZA 2GC4C 3FSVA 1SNRA 4DPCX 3QJRB 1AZRA 2I7OA 4K9JA 2MRYA 4E9QA 4QLWA 1NZRA 2HRHA 1ZIAA 3CVCA 1IC0A 4W1TA 3ZX1A 1ILUA 1V10A 5TK4A 2R7EA 3CZUB 3S3DB 2UX6A 1XB8A 2HLEB 3BVDB 2IWEA 3QJSB 2YXWA 3FSZA 4ZK8A 4YVUA 2YAPA 1AS8A 2BP0A 3AY2A 5I5JA 3WI9A 4E9RA 1CURA 1AAJA 4BXVA 3FT0A 4G7RB 3WKPA 2IDFA 2OCCB 3NJHA 4AX3A 1FWXA 1AANA 4A2FA 1AZNA 3OMAB 2QT6A 5F7AA 7PCYA 3G5WA 1SFDA 1YLBB 3NJMA 2VN3A 3FU7B 4DP7X 4UF7C 2LLNA 4G7SB 3FS9A 4W9ZA 2DWSA 2QPDB 4BK5C 4E9VA 1AIZA 4CSPA 3T6ZA 1WA1X 5B7MA 1XB6A 4GP5B 1A4AA 2XWZA 4GP8B 1CYXA 1SF3A 4DP1X 1OE1A 4HCFA 4F2FA 1NIDA 1L9RA 3FU9A 2YAHA 4E9TA 2Y1AA 2PPDA 2EIMB 1WAEA 2X87A 3OQRA 1GW0A 3IBOA 4GP4B 4HALA 2YXVA 4AKPA 2IH8A 3MX0B 3PLYA 1HAWA 2PCFA 1KYAA 4BXSV 3UAEA 3T6XA 2BP8A 2FT8A 4G7QB 2GHZA 2OJ1A 1ETJA 1E67A 2J56A 2Y69B 2YAEA 3S3BB 2AANA 5B1JC 3X1EA 1IBYA 3KW8A 5I6KA 3NJKA 3ASOB 2CAKA 5I6PA 4YVNA 2XYBA 4KO9A 4HCIA 1KGYE 1W6WA 1PF3A 3JT2A 1L9SA 1JZHA 2ZOOA 3AG2B 1ZIBA 3CDZA 2A3TA 4YSTA 6PAZA 3FQ1A 1HFUA 1SDDB 2YAQA 3IN0A 1NICA 2P80A 4MFHA 2YAMA 2WO2B 1ASOA 1PMYA 4DPAX 2FT7A 4WTQA 5TK2A 3IEAA 4DP9X 4A66A 1URIA 5I5IA 3WIAA 1SF5A 3EF4A 3FPXA 4P5RA 1RCYA 2PP8A 3NSYA 3KW7A 1NDTA 2UXVA 1FA4A 2BP8B 1CUOA 1JXDA 2OV0A 3HEIB 5EHFA 3TBCA 1J5DA 2EINB 4F2EA 2UXGA 2BZ7A 1ADWA 1JOIA 2XUWA 1ASPA 4P5SA 3NSCA 4A2EA 4FAAB 2EIJB 4A2HA 1BXVA 3C75A 1A4BA 3D12B 1PZCA 1AG0A 5B7FA 3S8GB 1RZPA 1KBWA 3T71A 3ABMB 4HIPA 3V9CA 1W6LA 4N4YB 4YSPA 5AKRA 1X9RA 3FU7A 1OF0A 1JZIA 4KNUA 4E9SA 1NPNA 2TSAA 3BQVA 3UABA 4JHUA 4ENZA 2HZHA 2BW4A 3ERXA 1NINA 4Q89A 2IDSA 3GXUB 1AOZA 2XV0A 2VW7A
chains in the Genus database with same CATH superfamily
4OLUL 5HPMA 4LF3B 3T9WA 3HR5A 4HU2A 3VG0H 1S7TB 1IKOP 5DZ9A 1H5BB 3EOBB 3RILA 5JYLA 3D85A 1KLFB 1RUKH 3LKQA 3A23A 4HLZG 1RJYA 4U1SA 2ESVA 1UD6A 1NCAL 3HG5A 3TCLA 2ZYIA 1YJDH 3NIDF 5DHMC 4I89A 5IWLC 4O58H 2Y5TA 4GO9A 3I9PA 2R59A 3NFSL 2HRPH 3K8LA 2N3JA 2FWOA 3E0GA 3MACH 4IKNA 3X1GA 3ZZSA 5LLIC 3RNQB 5KYWA 5TPWH 1AD0A 4H2CA 1GS8A 2XCMC 1G6VK 4LARH 1FJ1A 2PW2A 2VR6A 2PWFA 4YR6B 5AZUA 1IBGH 3ZGHA 4GSDL 4HT1H 3PGCA 4Z76B 1ZVSA 3K5RA 3DIFA 2A4EA 3V52H 1J1XL 3PL6D 3WO4B 4PRHB 5I75B 4KXZI 2JTYA 5K9QI 4IBWA 4P5KA 4QTIL 3BUYA 4DAGH 4HIIA 1UB5A 2IPUK 3VDBA 4HUCA 4Y2NA 2MIZA 2W0FA 2Y1VA 3AS3A 1NANH 2GUOB 5FCSH 3W0WD 3WBDA 4DF9A 1EZUA 2X3CA 4GMSH 4IRZH 2QVIA 4H0GA 1TJGH 2ZNWA 4WJ5A 1O75A 1TU2A 1R5WB 3LPWA 4OH2A 4PRID 4R5XA 5IMKB 2J8UB 3IPBA 3C5SB 4MNQA 2JI3A 1F3JA 4LHUG 5T3XH 3B2MA 3BEWB 2GFBA 3KPRA 5E1AB 2HFFB 4CVUA 1XF4B 3VH8G 3O6KH 4QMEA 4TNWK 3ARDA 4HJ0C 4ZW6A 2J4WH 5I1EH 4JPIA 3LDBB 4K3EH 1BQKA 4FDWA 3NUKA 2OZ4H 2QGDA 4JRYB 4PJEE 5AW6B 1QSEA 4I0PB 4JKLA 3WNKA 3NTCH 4WSJA 5IBTL 5C6WH 4IRJD 2YIHA 5M94B 1LO0H 3NA9H 1YEHL 3H3BC 4XCFL 2IDQA 3FPYA 4QF1B 4ELKA 1INDL 1J0HA 4J3XA 4NBZB 1TTUA 2ZSVA 3S97C 2ITCB 2HJKA 3ARVA 3FN3A 2DL9A 4PJ9D 2OL3B 1HHGB 3QI9B 4FA8A 5HXMA 1PQZA 2O93L 2PCXA 1OQOA 2XWJA 3H8NA 1URZA 1PSKL 1KJMB 3I9AA 4P5MB 4FNQA 2J55A 5D4QA 5C2BH 5T5NG 5L2KA 3CH8A 1FNGA 3CSFA 3CX5K 5E2WL 5F9DC 3FTYA 1BIHA 3GM0A 3K0YA 2DQTH 5FS5A 2J1KA 5HHOE 4TSBL 4DVRH 3Q44A 4HU8A 1RAMA 5A3IC 3LN4B 1L9OA 1SXZA 1D6EB 1A7QH 4R90L 1OSZA 3UROR 5BXFA 1NGQH 5C70A 4GEIA 5CHNA 5B38G 3HVDA 3GJFH 4L1TA 1A6ZA 1T2JA 3B2UC 3BUBA 3IMSA 1AG6A 2Z4QB 3H2PA 1GY2A 3RPBA 2E27L 3FO1A 2DLFL 1FG9C 2Q86A 4GB9A 4N0UE 1MWAB 3FCTA 5F96L 1DVFD 5I8OL 2ZUYA 4PRAB 4K7PX 3EJUA 5HYJD 1P69B 3QXWA 4FQQB 3WL9A 3O8XD 5FYLD 1R46A 4G6FB 1CU4L 2AJ3A 4H88H 5T1KA 4UWQB 1QG3A 1AI1L 2VLJD 5F1SA 4Z7NE 1OAUL 2LU4A 4JQXC 3SD2A 3TEZA 4DQAA 4MDIB 3V9FA 1PY0A 5IQNA 3H9HA 3ECQA 5ICUA 4L29A 3MV7B 3U25A 2VLME 1OL0A 2OS7A 4I18C 4TLTA 2IBBA 4XP1L 1ZPUA 1OVZA 1IC1A 3BQUB 4IW4C 2J25A 4YK4B 4QRPA 4UAHA 2UX7A 1ITBB 3B9AA 4NUMA 4G71B 4XT1C 3SDXE 4FQ1H 5MEPB 1KB5L 2APVA 2YPVA 5ADOL 3A24A 1NIEA 4DWHA 2UWEF 4HFWB 5BUGA 1UA6L 1KTLA 1V3JA 4HPYH 3QHFL 4R5TA 5CO1A 2MCAA 1U8NB 3R06B 3X1BA 5D4IA 5FOJA 4CU6A 3FZUC 4Y9EA 3LNFA 1OF2A 4M48H 4N5ED 1HL9A 1JPTH 3EFDL 2XYCA 4QRQA 4U1LA 3QWRA 4TYUA 2FQDA 2GI7A 3MNZA 4Z7VF 4X4KA 3ZYJA 4P9HH 3JSSA 1KN2H 3PGDA 1AE6H 1TKWB 3QZMA 1YMMA 2YFNA 3ULUD 5J6GB 4LCIH 2JELH 2YN5A 3R19A 4R7XA 2QQNH 2D7TH 3L1OH 5JZ7D 2WVUA 5IF0A 2J8HA 1PKQB 3K4AA 4NZJA 3TPUB 1AO7D 3T3PF 5GHWL 1JWUB 1F3DJ 1NCDH 3GSUA 3VXME 4PGEA 4WI5A 4Y19D 1I7UB 1PAMA 4DVBB 1PZ5A 3MJWA 3WCYA 1BYNA 5CJ8A 5DWUH 3IXTA 2Y7MA 5I1LB 2JSFA 4Z7AA 4R7DB 4D7BA 5DU7A 3ZTCC 3QO1B 2E8YA 1DE4A 2R56L 4IOFD 5DQJB 5J8OA 1Z9OA 2CA3A 3EF7A 3FAXA 5IR1A 3H42L 4XNDA 2P5WA 4NUJA 2BSDA 2QVFB 3WTYA 1KGUA 1GYVA 3N43F 4Q52A 4Y4FD 3T3ME 2E5EA 1R3LB 1TEGA 5K1VA 4M5YL 1JHKH 1OT2A 4QHUB 1JRHI 1WTGT 1NWOA 1YPZE 1P1ZA 2H6PA 2J1WA 1J05A 2CDEB 3QPKA 5DJ0B 5I0ZA 2ETWA 2DTML 3QG7L 4TKWA 4NCC1 4BFIB 3D4GA 2FEDC 4MCMA 3KPSE 4JM2F 3QNZB 3NGBC 4YQXL 4JO1L 3WD5L 4PGBB 3O6FD 4NC2B 2F19L 2VDPL 4OKVA 2H32H 4E41E 1L3WA 3GSNA 1GHFH 3NACH 2IGTA 3MQIA 5JLZA 1RU9L 3NJGA 4KPHL 2Z8WC 2VLLA 3MRBB 2BCMA 4UUJB 3STLB 5AZEH 5JQ6L 2OA9A 1W16A 4K0OA 5D1ZC 3CN1A 5ITFB 2ODIA 1UATA 2PWHA 2VJ0A 4ZMPA 1IEBB 1Z0MA 2GBUA 5KWYC 4DNLA 4FLHA 1KNOA 2GJ6E 4S1DC 3BXNA 3N06B 4MJIA 1NGWA 3CXHJ 3GB7B 1WP6A 2XWEA 4ECNA 1UEMA 3H6JA 3V5HB 1IO4C 5GZOD 4Y4HD 4FG6D 4Y5YC 3GTVA 4BUGA 3NA4A 3KYAA 1F2XK 1EUTA 2VIRA 3BWAB 2J6WA 3QXAB 1BVNT 3SBQA 2DWEB 5FV2A 3C5XA 2OMYB 4Z0XA 5I16A 4FQPA 4FTVA 4HJIA 4IKJA 4RZKA 5PCYA 4GKNB 1WWWX 1CVSC 2C9AA 4KK5C 4FZEL 2ENYA 3T0WA 3KL0A 2H7WA 3L8QA 1N8ZB 5SWQA 1ZWIB 2VMJA 1AGDA 3KLAA 2AMGA 3VGAC 5EUOA 2XX0A 3SCMD 3KS0H 3N41B 3VSUA 1RI8A 2B5IC 2QSVA 3MO1A 4AENB 3DJZA 3ARWA 3FHQA 3BVVA 3I3DA 4QT5B 4G8GE 5TE7L 1F4WH 2R69A 3LH2H 4OQTL 4RIRA 3V0HA 4PSRA 3AT0A 1LO5B 4JFHD 1R24A 4HK0B 1CR9H 4UDTB 5C71A 4WK0B 2Y25A 1IGFH 1U91B 3O2WL 4FYTA 1R19A 2Q7AA 4G7YL 3Q06A 2LFGA 3W1ZA 1FLRL 2EAEA 5IJBC 5KZCD 1QUNB 1U2YA 3EH2A 5GGSA 1OT4A 3BH9B 4M93C 4URTB 2DEYX 3WI9A 2YRZA 4PJEB 3QDGA 4W6XB 1TTFA 5I66A 1FWXA 2J2ZA 1QLFA 4A6YH 4S10A 1I9JH 3QPXL 1YLBB 3CWGA 4NQEA 5IG7B 5J9PB 4XMPH 2YC1A 5BS0E 3S4SB 2ORBH 3F83A 4GMTL 4HUWB 4J3OC 4IBSA 5ANMB 1XIWC 3CDCA 3HMWL 4JFZH 5ICYA 4WNJA 4XWGL 5F0MB 2BRRH 3U79A 1B88A 4KTDL 5D5MA 1TQSA 2KQNA 1XTLA 3DECA 5F6HJ 1BD2D 1KB5B 3KWWB 1RZKH 5HHOB 4ZNEA 4WFFE 5GJSH 5HDQL 1B6DA 2EIMB 2R29A 2YOCA 1FL3B 1ZLWK 1UJ3C 2VJXA 5BZDB 1DJSA 3IBOA 4BJLA 1E2WA 2Y6TE 1INQB 3RURA 1T20B 2CDFB 1MFEH 2W07B 3FO0H 3B2DC 3ARBD 4F8LA 1KB9J 2JJWA 1B90A 2A74A 1JWSA 4XODA 2BXZA 2ZE0A 3C6LC 3CFKB 3KR3L 1GGBH 4N0UB 1EZVX 2A73A 3ZQWA 4MMXC 1KJ2L 1UWXK 2Y7OA 2ZOWA 3OKDB 3ASOB 4XGZB 5AD0B 1P0SE 3O3BA 2H0FA 3GMPB 3BAKA 3E8VA 4N26A 1CFQB 1YA5A 3VU1A 3AMLA 3LB6C 4Z7NB 2OXGA 1H3WM 1G5AA 3LIZA 4KKCC 2X9WA 3L3HB 1CGVA 1RVFH 2FBJL 1HFUA 2OI9C 1J10A 3HZKA 1D9KA 3FFCE 3PAYA 1N5AB 2HTKC 2QKIA 4F7EA 2YAMA 3AC0A 4OIAA 1G7QB 3UTSE 2AEPH 4I18B 3EYSH 2JXMB 5B4MD 2OYKA 5AW5B 3W57A 5K59F 3K72A 4S0TD 3WKNA 4A66A 3BP4A 5E8EB 3DVNB 3GZOA 4HIXL 1JK8A 2AJYH 3FPXA 4FJ6A 4OLWH 2YN3A 3IKCB 4P5RA 3SJVA 3VXRD 1WFIA 2UXVA 2VQTA 1FA4A 2BNRA 4RGOL 1JPFA 4KV5E 3ZE0E 1BVLB 1VGEH 3IYLW 5EZLB 4F8OA 5G5DA 2CR6A 5HHVH 2UXGA 5L88L 3L13A 5JPNA 1Y18A 4W9DC 5AKVA 4LP5A 3CBRA 1BMZA 3RVWD 3M07A 2M1KA 4ES9A 3LMJL 3BAEL 4HKJA 1U8HB 2CRZA 4IDLA 5EOTA 3S5YA 1JFHA 3KPNA 3SDDD 3BCFA 3FU5A 3DGGA 1DQDH 1DDHB 5E2UH 1PY4A 1MELA 2TSAA 3QDJA 4G9DA 2AQ1A 2V2WB 4NNXB 1I7RB 2TRYA 3VXMB 3GWJA 3SZKC 4ABVA 2VDPB 1NINA 1IAKA 4MWFA 4JZJA 4JKKA 2VW7A 2K1MA 1K9TA 4AUJA 5IQLA 5EU4A 2FYYA 1LMIA 3HG1D 1P4BL 2EDLA 2Z92A 4WHDA 1MCJA 4TUOA 4YNYB 4HWBA 4RLDA 1GGCH 1QI4A 5DEJA 4PBXA 1S78D 1UYWH 7PAZA 4ONGH 4YPGA 1OANA 1CXIA 4KX9A 3WENA 4OIIL 5C0EA 1CYWA 3CUPB 4KOCA 3UACA 3QG6B 1YSOA 4P07A 1E30A 5ICZA 2VXQH 3NSXA 4P5TA 2JK5A 3CAFA 3FSAA 5KVEE 1VADB 1KPRA 2GK0A 1XF5B 3P3UA 1HZKA 1BAWA 5H2BA 4PY8I 4GG6F 2OKMA 4WUKL 4LNVA 3KPSB 3D51A 1BEYH 2VLKE 3KPRE 3SB3A 1WZMA 4JFSA 3CFEB 4F7PB 1DN0B 1J9SA 3NGBB 3GMOA 4OBRA 4AZ8A 1KYFA 1LJMA 5GZND 2ZYSA 3LV3B 5IT2L 2IF7A 3FU0A 4KKPA 4P3DB 2VERA 2YRLA 4GRWH 4PPTA 5IJCC 4MX7A 3OXRA 4XMZA 4WJKB 3APMA 1NIAA 4QUOA 4JHWH 3QEUB 1QSEE 5H94A 1GW6A 3TP4A 4AT6B 3MZTA 3F7LA 4TLUA 1S9VA 1J86A 4RAVB 5ECJE 2VXVL 4HOZA 3JVGA 5CILL 4MLSA 2AV7B 4PTTA 4Z77B 2RTTA 2K70A 3IFLH 3TIEA 1YY8A 3T6WA 1I8AA 5B8CB 3HC3L 4OZHF 4JCMA 1QHQA 3B2PA 3QUMA 5EU5A 3PNRB 2G60H 3PAZA 4Y5YB 1LP9F 5L6YL 3H4HA 1MEXH 4HGWB 2XQ0A 4L4TB 4OV5B 2NUPA 1D5ZA 4BSWA 3WO3B 1U93B 2IFFL 2B1HL 4YL9A 1BFOA 1F00I 2EADA 3RHWK 3WS3B 5I8KH 5IHZA 3QULA 3D69B 4XWOD 5T1DL 2NY0D 3B7RL 1E4WL 4XHJD 5DDHA 2NTFB 3M1CA 3NVQA 3VGAB 1S7VB 4BKLA 1G9NC 4I2XA 4JPSA 1QZ1A 4J3VA 2JJSA 2B5IB 3ZGIA 4G8GB 1T5KA 3CXFA 1GCFA 2ED8A 3V6OA 1AXTH 1IBBA 3H9SD 1QI3A 1XH3B 3OMIB 2QPEB 2IH3B 2EDJA 4EBQL 3ZDYE 2R4SH 4HZ1A 2MTAA 3BSHA 4WO0A 1LNUB 4DGVL 4POZD 1QLRA 3QEQD 4LP4A 1KJ2B 1MQKH 4LCWE 4JFPB 3O3DB 1XGUB 4HAKA 4NERA 4NKDA 4OKDA 5I17A 4M93B 3WFHB 4LMQE 3B2VL 4ZFFA 4XO9A 2Z31D 2Y7LA 3HPJA 2IPUG 1I31A 1V3LA 3BT2L 4WW2C 4X7SL 4CU8A 1A4KB 1E0OB 4GFTB 3IFOB 2C5DC 2VDLH 1NUFA 3TEYA 5CLZA 3TVMD 1K8DA 1PCSA 4HA1A 4U33A 3OJ2C 1XIWB 2IH1B 3AMKA 1U8OB 5HJBA 1ETZA 5DFAA 3QIWA 2BCKA 4AIEA 1BAFL 4KO7A 3EXJA 4IRSC 2X0VA 1F97A 2NDGA 1A9EB 3E6FA 2VITA 2XWBB 5DEZA 1HSBA 5E00B 2ZIDA 1G9NL 2YWZA 3LPPA 3ROLB 3CJJA 5CSBA 1S7UB 4JPVL 1QEWA 2EIZB 5DJDB 1UJ3B 2WIIA 5I1GH 1SN0A 1PD1A 4JFOA 4DPRA 2XETA 1M05B 5T1MA 5GIRB 3UG3A 2HYMA 3AFLA 3WIHA 4PBWD 2YOAA 5TF1H 3OD3A 2IXQA 4JAMA 5IESH 3BZEB 3C6LB 1KCVH 1DL7H 2BIIA 4MMXB 4MAZA 1YN6B 3Q01A 5LBVA 4WCYL 1A2YB 1HINH 1KN4L 4ALAH 2DQJL 4HKXB 4TUJA 1JGIA 4JM2D 4DEPC 1MPAL 5D6CA 1A3QA 3HLAA 5FKPA 2ZF8A 4NWUH 3OG6B 3PU7A 1IV8A 4LSRH 3KWXA 2OI9B 4UQCA 1YYCA 3U7YH 3ZPDA 1UM6L 4BFNA 5CN3A 4FFTA 4R8WH 2E9IA 4K3HA 2WTOA 3UTSB 1QRNA 4ZPVA 3SGKC 5D1QC 3SPCA 1BQLL 3VNZA 3WAKA 3S88L 3JWNG 2IGFL 3PHQA 1JZ5A 2FUQA 1S7SA 4KITB 3QRFM 2DW5A 3PXJA 5TE4L 1A14H 1IKNC 2W60B 3SBPA 2EO9A 4WVRA 4JM4L 4WKXA 3SYAA 1MRDH 1PZBA 3DPBA 1FUNA 3MV9A 4A2MA 1IAIL 1SVZA 3WGUB 3ZE0B 2JNZA 4HUUA 4RFNC 3US1A 4HUNB 3O9WD 4Q2ZB 3FL7A 1LO3H 4R7NB 2Z35B 1NA8A 4ODUB 1T22B 4IYKA 4H1LH 4CL7A 4MAUL 2VNCA 2ENQA 1F4AA 5GGTL 2ZP0T 2P49B 3PL6C 3Q43A 4FADA 4ZTEA 2CM5A 4P2QD 2YAOA 3CCHB 3ZY7A 1GR7A 2GTWB 3GF8A 2X3AA 4XE0A 5BRQA 2R27A 3NEOA 3T6VA 4GT0A 5AYTA 4AE1A 1IB5A 4W81A 4QHMB 3S96A 3TJEH 3ECVA 3MLZL 3T65A 3WJLC 1T1XA 5DO2D 2VXUH 1MVUB 3TS8A 1Z5LB 2YEZB 2AS5M 4CSZA 3OR6B 3OKOA 1PG7H 5AQ0A 3V5DA 1XSIA 2X4QB 2WUCH 4I3RH 4Y7MA 4ZFGH 4KZDH 4XPBL 2YD5A 5D6DA 5HYQA 3VRLE 1ANUA 1W0VA 1KIQA 2CK0H 5GGQH 4YXHH 5CCKL 4TSAL 1O6TA 4HIEA 1UA7A 2R1WA 1V7ML 5MI0C 5HJ3A 2BVUA 1OE3A 5KBDA 3D33A 4MXVE 4JPKL 4X6EA 1J9RA 3GRWH 3NZ8B 1GZQB 5LGKA 1DQTA 4NFCA 5D2LF 1MREL 1BZ7B 2NRDA 5L2JA 2XPYA 3O41B 3RI5F 2RBLA 3KXFE 4IRJC 2UZPA 1FP5A 2ICWA 2AERT 2EEAA 1DBKH 2KPNA 3VRIA 1V7NH 5E99H 1KBGH 4LSSL 2X4TB 4ICWA 4WU7B 2YD2A 3CXDH 3MBWB 3VXQA 4BUQA 5F7FA 2OPCA 1FNSH 2JVUA 5I8CA 1JPSL 4YHKH 1X7SA 1HHJA 1QFPA 4FFYL 5LNEA 1BGXH 2R8SL 1FVEA 4OCXH 3TN0A 3EXLA 5FF6A 4HXAL 3OPZH 3EZ8A 2VDNL 4R0LA 5JNYA 1P4UA 1NEZB 2X4UB 5ESAA 3QQXA 2OXHA 4RZCB 1ND0A 4X99B 2VKXA 4JG1H 5D7LB 3UPAA 3CFCH 4ZMAT 4OJDH 1G1KA 5D72L 1YYLH 5TDNB 4PB9L 4YHPB 4ZS7L 1Z9MA 1BLIA 4YZFF 3CPLB 5FUCC 4U6XB 3CN2A 1AC6A 3U1SL 4PJAB 4OF3A 2PWEA 3O8XC 3IFPB 1A1NB 5I82A 1JN6A 1NGZA 4QXVA 5D5ME 1MVFA 4FS0A 3EHBD 4N2DA 2CHXA 4FXLA 3MUGA 4ZNEE 3SPJA 1KTBA 4ANXA 1MJ8H 1RZGB 3WXWL 3R1GH 4ANWA 3MA7B 5DRZB 3WKPA 1Q9LA 3Q2WA 4AM0A 5HVHC 1FDLH 3ASWA 1CGXA 7PCYA 3EGXA 5EC2B 3TESA 2ZOKB 2W95A 1S7XA 5KVGH 2ITDB 4PJ5E 3KPLA 3QNXA 4QEGA 1AKJD 3SQBA 5AAMC 4FG4A 4AQAA 2CO4A 3HI6L 4PBDA 4HLJA 2WXLA 2F53A 5IFJA 1QFUH 1F6FB 4D0DA 1A6AA 3WLBA 3VO0A 1OAYL 3E3QC 1NM4A 1R3KA 5E9DD 4G8FB 1RMFL 4AEEA 1UHVA 3ZDYB 3LYRA 1SF3A 3S2CA 3W3BA 3PWPA 2GEEA 1P5UC 4XMXA 5AW1B 3IT8D 5T5NF 2EABA 4LCWB 1CPUA 1L9MA 1CE1H 4S1SH 3C2AL 3K6FA 4YEFA 4OGXH 4MKTA 1ZLVK 3MV8B 5DK2A 3L3IA 3OQRA 4LU5H 2VRQA 1S5IH 3JZ7A 4ZS6D 3AWEA 2ZCLL 3AB0C 5FHAH 4AKPA 3MROA 3RVTC 2IH8A 3MX0B 1Z6JT 1HNYA 2Y07L 1VJSA 3FCSB 3I85A 3F3HA 3QFDB 4WW2B 1KC5H 5JW4N 4Z7UA 4RDBA 2CJTA 3FRPB 4P06A 2DH3A 1A25A 2C7FA 1LQSR 1ZVHA 5FYLL 1YEJL 3RL1B 2DWDA 2GJ6D 4MBRA 3HHMA 3CLFL 4G1EB 3KBHE 3ZKND 3NJKA 4XNYH 5FDYA 1N0LB 5KSBF 3MOQA 1AGFB 3CFQA 4JVWA 3SJVE 1JFQH 1RIHH 3AABA 5CBEB 2FECI 4U1IA 4LRIC 3UL4A 4UQ2B 5E5UB 2C9XA 1T5XA 3MJ7A 5F9WC 5FO7A 4CJ1A 4QY8B 4AY0A 1D3CA 2FH6A 2B1AL 4JZNB 4BGLA 2NNAB 3B1UA 1BBJA 3CIAA 3EJPA 4NI6A 4RFEA 4F58H 1YYML 5JOPE 3ULVE 1N7ML 3GK8H 1F11A 4AG4H 1JZ2A 2FT7A 4E36A 1HJBC 1AHMA 1HNGA 1PG7W 1E50A 1V3KA 1CFVH 1KLGA 1S9XA 3QDJE 2A0LC 1BJ1H 5FFOA 1S8DB 3RNKB 1WBZA 2OCJA 4G83A 2AV1B 2NUTA 3KL3A 3OGCB 1NBZA 5AENA 5A2CA 4NAMA 1T4WA 3PDOA 4POYA 1C7TA 1MXGA 2YK1L 1XAUA 2XUWA 5ICXA 4DEPB 4FF9A 2F18A 3N6YA 1QWHA 5JXEA 2VR8A 2AVGA 3LSOB 2EIJB 2NMSA 1AG0A 2AQPA 3CXHK 3DRQA 1EQWA 2IPTL 4G6KL 3VXPA 3O6FC 1HXYA 2KLTA 3V0DA 5D1QB 5TQ2L 4M8UA 2D7MA 2YMTA 3QJFB 1TYEB 3AQZA 4I4WA 2VDRL 5DZNA 4OSUH 4HETA 1WC7B 5BS0D 3VE0A 5EWIL 2FSEB 3AM8A 3AY4A 1LM8V 4LP8A 4IU3B 4JO2H 5EUOF 3U4BL 3VD5A 1QBMH 1LO2L 4HHAB 1NBCA 4E5XG 4PTUB 1PBYA 4RFNB 1X9QA 5KTEL 1NGPL 4ZSOA 1QBBA 2OQJA 2V37A 4Q6IC 2ATAA 3EG9B 3SPVB 3LXUX 4WWKA 1SY6H 3W39A 2AF2A 2O5XL 2CA4A 1U8CB 3PL6B 1FZMB 3EH1A 2Q2LA 1KGIA 4JANA 3MLRL 4ELME 2GSGB 3V7AE 1EGJA 5EPMB 5CR8A 2GITB 2YD4A 1KJ3L 3MJGX 5E08H 3H3KA 2CXKA 3ATEA 3MLUH 5AVRB 3NZHL 3X12A 3W0WB 4YPJA 1KXVC 5DO8A 1X5FA 4U7SA 4AE0A 4W68A 1OGTA 1IGTA 2HTLD 4PRIB 5T1LD 2DM7A 2F68X 3GS4A 3UYOD 3O45B 4WO4D 4JFXA 2VDNB 2UY6A 1J1OL 1ZLEA 2O61A 1TCMA 2XXFA 3H4FA 3TBSA 2ZUWA 1SDDA 2OP4H 4MMYA 1HH6B 4YHNA 2DLIA 1EJOH 2IBZY 1KGCD 3MNVA 3IGAA 3REWB 3RZCA 4FA7B 1XF3A 1X9UA 4JCWA 3Q1SH 4Z18A 1MDTA 5SX4I 3HRPA 4LESA 5MI0B 1KELL 2XN0A 3CV5A 3I74A 4XP4H 3HA0A 3K2KA 2EVGA 5ALBL 1IC4L 1K3IA 1U58A 3HW7A 4QAMB 4JDVA 4ZUVA 1TPXC 4AVHA 2RAMA 1OZUA 3QBTB 4X5LA 2XN1A 4IRJB 4MD0B 5A2LH 2HRGA 4DGUA 3D2UA 4HWZA 4CMMB 5SWZD 3RVUC 1LO4L 4YHML 1EXHA 1EEZA 4ZMNA 1KV7A 1DFXA 1KB9K 2N0MA 3G5XA 4PLKD 1S5HA 4L3EE 1LL1A 1KV3A 4TOYL 4HPHA 3FT3B 4HBQA 1Z3GH 2FJSA 3HZMB 5DZLA 5SX5H 3D85D 3K4ZA 4LLMA 4XI5C 2ESVD 2VSKB 4N6RA 5H37A 2WW8A 1IAII 4JY6B 3GIZH 3FT9A 3WKQA 1CL7H 5C09A 2BSRA 3JV4A 4UQBA 2CUAA 4QRSB 5IP4A 1I8LA 4K8RH 5HD8D 2CLRA 4NBXB 3S35X 1ILSA 1ERNA 4HBCH 4YHYC 3VJ6B 4NN6C 4M1CC 2Q7YA 3KVDD 5IGXL 4B7LA 4E5XA 4PLNC 3RFZC 1RZIA 4LGSB 1RUPH 5G2NA 3QXUA 1DP0A 1QSFE 4PRDB 1YUHA 1SDAB 2NNXA 4PHXA 3SKJH 1YNTA 4DKAA 2X05A 1GMIA 5EOCJ 5DUMH 2R1YB 3V4UH 1I9RL 2WK2A 1K4DA 1J5OH 2B77A 2YD7A 3O8XB 3QQ3B 3LKSB 3PQYA 4BQ6A 4YSAA 5MEOB 3VFRA 1ZHBB 2VLJB 1GH7A 4PLJD 1FGVH 1T6VN 4J8RA 4XH2A 3NIDE 2BVQB 5LBGA 1O6SB 5FUZH 5HVHB 2VSMB 3CHOA 3PXHA 1QWUA 4XP5L 4PJ5B 5MENE 4EAEA 4PWKA 5ESQA 3DPDA 2GBTA 4XPGH 4HC1L 5IB1B 3CFUA 3LEYL 3KYKL 5PAZA 3TBYA 1P7QA 2W9LA 2ZXWB 4MNQD 3MJ9L 2V3EA 3FBKA 3G6JF 4KRMB 2FLRT 2G9HA 4YDJB 5DZAA 1JTTA 2AJUL 3PHOA 4PWEA 2LABA 4CNIA 3BVXA 4LKXB 3UBFA 4DP0X 2AJXH 3KPRD 1HOEA 1Q94B 4X7EC 2WZ5A 1P5UB 3PWNA 4G42A 1ZLUK 4L37A 2YBRA 4GKOA 4R26L 2WSDA 1FNAA 1KJVA 1XH0A 3RVWC 2YMXL 5I5MA 2PNDA 2JWYA 1SLWA 3AB0B 5E94B 1C1EL 4RMTA 3V95A 4ZX6A 2DLTA 4J4PC 3PXLA 4HHGA 12E8L 5EBMA 4Z7WB 3AXLB 4XNAA 4GSQA 4KRPC 2DLHA 2ZICA 1FHGA 2A6DA 4HJJH 5EIIB 5IFAH 4AYDC 3WTVA 5HHME 1FFNA 5KYNA 4PQXA 3UDWA 4TUKL 2Q10A 3HBGA 4QNPF 2AQ2A 1YNLL 2D31B 4P46A 1RIVH 3MV9E 4Y1TA 1P53A 2DQEH 3NRFA 4NQSB 3OKKA 3IRZA 2VDRB 2AFNA 5L2KD 5F9WB 3WFCL 2OZ4A 2OMTA 2H1PL 2X53A 4LPVA 2A83B 1HSAB 1HEZA 3OKLB 4OF7A 3IMTA 2WLIB 2BIOA 4AEIL 3GXIA 5BPPA 4I48B 1EJFA 4MJJA 1JNLL 1M2VB 4N90D 4NO2A 3EGDA 5EULV 1TTRA 2ICCA 4WI0A 5JIHA 4L9LA 2G3NA 3RGBA 4I1PA 4WFGE 1S78C 3BZFA 4HIHA 2FEJA 2PW1A 4ZAKC 4PJHA 2CMRH 2R0ZH 3N1PC 3TXAA 1PPIA 4M7JH 3VGEA 1ZCRA 2HKAA 3F2LA 4PCYA 4Q7DA 1F5WA 5IROC 3IU4L 2V9TA 4PWFA 5CGBA 1I1AD 2BC4B 4N8CL 1G6RL 2ARJA 1S9WB 3U0PA 3ENEA 3VM7A 4Z3EA 2APXA 3TC9A 1CCZA 1CGWA 5F3BA 1QTPA 4UILH 1LD9A 2L7QA 4YDVB 2X88A 1MFDH 3DO4A 2R15A 3ARTA 3CBJB 3STZA 1BXUA 1WVZA 3T2NH 4KUZL 1QFHA 4W9CC 5GZNC 4HJ1A 3O6FB 4PGZA 1SM3L 3OGOE 5A2JH 3DHUA 3SGEI 4BK5A 2WWKO 4JKNA 1L5GA 4FKEA 1MW2A 1G0DA 2ZKWA 3HI5H 3M1OA 4K5NA 4IDJL 1N67A 1BZ9B 1IGYA 1T5WB 4LCCA 4QRPD 4X4YB 3MRLA 3SODB 3BPCA 5IOPA 4H8WC 4IMKC 5D7IA 5I6OA 1OEZW 1NLBH 4DKTA 3DJTA 4EIBA 2X09A 4K07A 1OP5H 1MIML 1HCYA 3EJRA 3L4WA 4GRMA 4EO5A 3V6ZA 1MCIA 4R96B 1RK7A 1CGSL 1U42A 4V1DA 2CR0A 3VXNB 1QFWL 5GRYA 4PRNA 1PYWA 3OWRA 4N24A 1D5IH 3A6BL 1NAMH 4I3SH 4ELMB 3QCTL 3N85H 2HT4C 3NPZB 4HUXA 1FORH 1WFJA 1YMMD 3FQXA 3M1BB 1MAML 4N9GB 2A9BA 4NRYB 1IGML 3RWGB 8FABB 2HUEA 3MRHA 4U6HA 3K7UA 1ZLWH 1V55B 2VSDA 4KZCA 1FAIL 3MLYL 3LKOB 2D4FA 2VW6A 1EV2E 1SBSH 3F7QA 3EJSA 3P77B 5BRZA 2H5UA 3S5LA 2FYVA 3GSVA 4HIJB 5DF0A 3V5KA 2NW3A 2APFA 1JMXA 1YN7B 1I1FA 1X5LA 1G7IB 2G2RA 1UH3A 4FEIA 3AT8A 3NP4A 5E6SB 3L5IA 2W0PA 2F5AH 3ECBB 3IS0X 3HIZA 3VXOA 4H8WL 4OF8A 4LPWA 4RMBA 5K39B 2P5WD 4LLYA 5BUPA 2ICEC 2I26N 2D2CC 2GG1A 1XMWA 4GT7A 2N56A 1WWCA 3QCVH 2EDXA 2X42A 2Z31C 5I1JL 5DS8B 3O3EB 1R33A 1TPXB 3HMXA 4PJGF 3BD4A 3TF7C 1U95A 5GGVH 4ZX3A 3CVCA 3T3PE 4PUBH 1N64H 4MZ2A 5HYEA 2F53E 3PWJA 3LRSA 4L3EB 4GKSA 4N0FA 3V0VA 1JWMB 4K7FA 5JQIB 4PS8A 3QJSB 3O3AB 1T0NA 3QZWG 2L7UA 3EFOB 4FERA 2AK4A 4JY5H 4S1RL 3MRDA 5EOQL 3U6RA 3FQWA 3P3YA 5FYKE 4XVTL 2XVKA 4YO0A 4N2NA 2H26A 1U3HA 3FFDB 4MDRA 4MB3A 5DHVA 5EA0L 4Z7IA 1J5HA 4A2FA 4DGYL 2NY5H 5AVUB 1T1WA 1U4FA 1EFXA 1ZLSH 4UIKH 5FO9A 4NUGH 1CBVL 4PGCB 4Z7UE 1R9FA 5FW7A 4YHYB 4JRLA 4NN6B 4P2CG 1OHZA 4F9PA 3QA3A 4TULL 2Y06L 3N1GC 3RFZB 1C16B 4I77H 4MJID 3H6AA 4CN4A 2E6PA 1CYXA 2FBOJ 1UURA 3EO0B 1K6QL 2BWQA 4JREC 2H32A 1JS4A 4AGMA 1I1YB 1CYGA 3FU9A 3HRZC 3QEGH 3JV6B 4KXZH 4Z6AT 5CFHA 4PJ7A 1NGXB 1YC8A 4HPOL 1IAOA 3GXMA 4FTVD 4P23C 3NIDB 4XN9A 1UXSA 4U1NA 1Q1PA 3BDYH 1WITA 2BOBB 1XL4A 1NGYA 4GAJH 1QSVA 4IIQA 2YJQA 3P9WB 5MENB 5I0YA 5AOMA 4G7VH 2C4XA 3E1F1 4M6MH 5DJZA 1RUQL 2NW2B 2OTWA 3KW8A 3B2XA 4NFDA 3T77A 4MZIA 1YC7A 3RL2A 2V2XA 1JYXA 1RK1B 1KLUA 2CAKA 2CIIB 1U6AL 2AXHA 4NOBA 5IVNA 1P2CB 1T3FB 3GIVA 4Q56A 3RY5A 1I7TA 1ZD6A 4U2ZA 2ZOOA 5BJTB 3PJSB 2A6KB 2QHRH 4K2UH 4NQUA 2XTLA 4GBXA 3O2DL 1R5IB 2WP3T 1A1MB 2ZX7A 3B9KA 4HQQL 2M83A 4GXVL 4B9YA 2DMGA 3ESVF 4L05A 1CE6A 3VUAA 3QDME 1HX0A 1G6RB 1X7QA 5CJXC 3EOAA 4TNWF 1X5KA 3L3OA 4X0KA 4OZFA 2NZ1A 3QDGD 5IQOA 4M5TA 5I5IA 4NZUL 3WIAA 4XPAL 1UJTA 4KRPB 4NQED 4PJFE 2RFXA 4J6IA 4PS3A 1TITA 3VX0A 3WEXB 3AU1B 1GOHA 4X7DC 4AMKL 5IJKA 2BP8B 2GTZA 5CGMA 3ZHDA 2OV0A 4LPYA 2CSPA 5DO2C 4QCIA 1RHHA 3WHXA 2EINB 4X5RA 1GL4B 2CKBA 4Q14A 1NCCH 4P5SA 4YFDB 4ODHL 5I0XA 2FD6L 2JCCA 2H1LM 4B9IA 4OTXL 1BXVA 4XCCH 1RPUA 5T5FH 5DJAB 4WUUA 1EO8L 1Z0NA 3S36L 3UZEA 1G9MH 2VZSA 1XR9B 1JMZA 3W2DL 4YX2H 4YSPA 1K2DB 1QNZL 3T1FB 3VACA 3VXTB 3W9DB 3ZJAA 5KYUA 1D5XB 3REVB 2XBTA 1CIDA 4OQ1A 4MCYB 2WLMA 4ZAKB 3O81A 5DRWA 3F58L 4CC4A 2VQ1A 3VGGA 5HY9B 4GUOA 1KUMA 1H8LA 5CU9A 3MVSA 3V79C 1NLDH 4U1MA 3GKWH 4B9ZA 3WNMA 1B0IA 4TQHA 5MHSE 1Z9SA 2ZJSH 4DPBX 2H6OA 4A37A 1FE8H 4P99A 2NSXA 2DN7A 2V6HA 3G04B 2OR7A 4K3GA 2R2BA 2VB5A 1EK3A 2VDQL 2GIMA 4GY4A 1FN4B 5K9JL 4OVVA 1KY7A 1D9KD 4E9XA 2ADIA 4HCRL 1T0OA 4DP5X 3PPEA 4JUSA 4N2GA 1A5FH 1T2QL 3QJXA 3N44B 4G59C 4V2CB 5ICZB 3CMOH 1ZTXL 4GXFA 5D7JC 2EXYC 5ACMA 3KPPB 1H3PH 1PU0A 2OTUB 5AB1A 4Y0GA 5HGBA 3MNWA 5IJVB 3HUJF 4HGMA 3WIIH 1UXWA 3US9A 1YUKB 4NKMB 3AXIA 2BNRD 2OJEA 1JDCA 2N1TE 3TBTB 1CI3M 1XZWA 2IAMC 2WNGA 3VRJB 4Q4IA 3D4YA 1CG9A 2VAAB 4X6DF 3ESPA 5JOPD 3ULVD 3BVTA 1IGIH 4H0IA 1A6VH 3MFGB 5HHQB 2J73A 5MERA 4PP2A 8CGTA 3UJTL 4X4MA 1DQQA 2H41A 4NSKB 2EXWC 3P4OA 3SKMA 2Q2EB 2BO0A 5C09E 4YDKL 2QR0B 3N91A 3IDIA 4JPWL 4F33B 2X70A 4JG5A 4GIAA 3HI1B 2W81C 4XZUA 1R0AH 3VWKC 3ATBA 3CHQA 4N8VB 3V4PL 4XNUH 3HCVB 4N86A 1RK0A 3S6CA 3CSYB 2DMBA 4KI1A 2BOCA 3CE1A 2CPCA 3H9SB 4XNQB 5ERWB 1MLCA 5IKCA 1KBVA 5J7CC 1YJDC 2V17H 1EEUA 2LGNA 2WMPB 3LRLA 5K1NA 1TJXA 4NQDE 1FPTL 4MQ7A 1NFDF 1X5IA 1MIEH 3PQYE 5HHNA 1EXUA 3AUVA 4Z7VB 2GBAA 3AREA 1JV2B 1DSYA 5J89A 3CD4A 1PIFA 1QHPA 3E9TA 2ICEB 3DDGA 3RIAF 1KWGA 1I8MA 3C8KB 3JWOC 3RLSA 2P52A 1EDQA 3Q8FA 1JRHH 4QYAA 4RRPA 3SGJA 5J3HD 3GUTB 4JQIL 3QUYC 2Z31B 4JG0L 4JQVC 4G9FB 3I2CH 2AJVL 2BMKA 1IBDA 4P5TD 3T3PB 3L4CA 3MRJB 2X89A 1JGUH 4FD0A 4R84A 5F7DA 5IB3B 4L3CB 3GTNA 4MXQC 1I8UA 4DKFL 2X10A 1R75A 4DZ8B 3U6XS 4HULB 4XMWA 3OXSA 3NCWA 1PZAA 5C3LD 5E24E 4NAQA 4PY8J 4OZIA 1CWVA 4H26B 4XXCA 4OJYA 2IQ9H 4JW3A 5DQ9B 4BA8A 4KJPD 3RY4A 4E0RB 4NM4H 3SE3A 4J1UA 1OGAA 2HLAA 2EE9A 2VXQA 3Q5TA 4JHVA 5AVQB 3SPHA 3VG0L 4F3FA 5AAWA 2IC2A 2QZQA 4QXGH 2PO6A 1P4LA 1E6JH 4EMZA 3N43B 3RDTA 3ZE2F 1T1YB 1ZA3A 4B7IA 3CSPA 3FB6A 3GMLB 4PRPA 4W4NA 4U1JB 2NY1D 1YJDL 4KX8A 5AALA 1TJIH 1IKFH 5LGHL 5C0DA 4PJIF 2OYLA 4O58L 1QFWI 1ED3B 1F4XL 3O0LA 2IANB 1UT2A 2HRPL 3ZKMC 3MACL 2X1WL 3BEVA 4ZODA 4IOSA 2FJFA 5TPWL 1B0RA 2XVBA 4U2YA 4GG6E 4JREB 1GJIA 2HJFB 3FW6A 3JWOL 4J3WA 4IJ3C 3U0WL 1A4JA 3ARSA 4OLXL 4KZEL 3HRZB 1CMOA 4LARL 4AMXA 4BFKA 1XF2B 3AAZA 3CLWA 4LOUD 3N40P 4HT1L 4DQOH 3L5HA 2Y7QB 3SOBH 5F7KC 5GGUB 3BKYH 2GABA 3MREB 3GI9L 2Y0SA 1F6LL 3NSFA 4OCSH 4XVJH 1JSYA 5IY5B 2X6VA 3FUHA 3LQAH 1QO3B 4ORZC 1TF4A 4DAGL 4ZUTA 5C0NC 4PJHE 1BG9A 4FNSA 6TAAA 1M9SA 4HKBB 4ZUWA 4WU5A 4GMSL 4M8VA 5C0CA 4WI6A 1TJGL 2YD3A 2PLTA 3UO8B 2UY7B 3FBQA 4FFZA 1CZ8H 4H25B 1CDIA 3HE6C 5I6MA 3EO1A 3O9WB 5C3TA 1LP9E 4RRPM 3EH4B 2W59A 2BSSA 5T3XL 3KPMA 2ZCKH 1NFAA 2WBKA 5FGBC 2WY3B 3QDMB 4BDVA 3THMH 4FFVD 3D18A 3HE7A 4UBDD 1BIIA 4OLUH 1WUZA 4N85A 3UAJA 1WWBX 3VAEA 3CDFA 1WCBA 4P2QB 2ZWNA 4K3EL 5FDWB 4PJFB 2VDQB 2N7BA 4MMZC 5ILTL 3BP7B 1LO0L 5DVLA 4NCDA 5AUMA 1ACXA 1AR1C 2HVJA 3NFSH 3O4LB 4EN3A 1GYCA 5HI4C 5B1AB 3C6SB 4APQC 2EDQA 3D4CA 3QIWD 3GNMH 1LE5B 4D9RD 3PNWB 1GYWA 4CW1B 1N59B 3NH7L 1MVYA 3WNIA 5C7ZA 3NCJH 5C2BL 1L9TA 3WJMB 2C9VA 3MV11 2DQTL 4MCZB 2XQYK 4EZJA 4DVRL 4LSTH 1ID2A 4WZ9A 4KKBC 5CSZA 5KVFL 3KWTA 1A7QL 1LXMA 1NGQL 4QTIH 2JKRM 4PI0A 4TQIA 2A38A 4F7TA 1LEIA 3U1PA 4L4VE 3PFQA 1KCBA 3FUMA 3D0VA 3DJRA 1GIGH 4P9HC 5HDRA 5J1AA 2WB1A 1BREA 2P7TA 5ID1A 5LQBL 2ZKXA 2P8PA 1E27B 3V4PB 3CVIH 4ZZFA 4H88L 5KSUB 4CDGC 2OMUB 3SKNB 5AG8A 4MSWA 1YEGH 1QRND 3GMRB 1ZANL 3GBDA 4LLVB 3RRQA 1C5DA 2WXJA 3QJOA 5INDB 1TNMA 4M1GH 4MA3B 2R4RH 4WTXA 5D7JB 1YAZA 3VMPA 3WIFB 5HD8C 4NHUB 5EUKB 3L81A 3DTXA 4PREB 1JI1A 3AADB 1KEML 4XB3A 1ZJBA 2X1XR 3FCUB 4KO5A 4WTWA 1BVKB 3MV9D 2MWCA 3MRNB 5I1KH 2ENJA 1ZSDB 5CLXA 4BFGA 5IBTH 2FL5A 2IALA 1YEHH 2IV9A 4QHKJ 2XV6B 4XCFH 2FH8A 5E8DH 1OT1A 5DVMA 2YEQA 2IAMB 4WEEA 1INDH 1HVXA 4GAGL 1C12B 4HPYL 4ZD3H 4L8DB 4OGAC 3CDZB 4ONHA 2XU9A 3FRUA 2AK4E 4E42B 4YDIL 1KTRL 2EDRA 3IXAB 3OB8A 4M48L 1NKGA 2IOIA 1JPTL 4G8IB 1L7IH 4PLJC 4TV3A 3QDHA 3RWDB 4HMCA 4RNRA 1DVZA 1KGXA 3ISWA 3MRIB 4O2FB 1UFGA 2VL5A 3FTWA 4NOFA 5DTFA 3QJRB 4TSBH 3N0PB 3BRFA 1IU1A 3VWKB 1E2VA 2P47B 4R90H 5IIEA 2I24N 1ORSB 5AKSA 5E2VH 2QQNL 2D7TL 3L1OL 4NM8H 1RULL 4QRRA 3DJSA 3KHOA 2LE9A 5E9DB 5E9AA 1NCDL 1QYGH 2DLFH 4NQDB 1NCHA 5I8OH 6FABH 1AQMA 4YBQD 2YUWA 3O4OC 4PJ7E 5GS2H 3VFPB 4KMTH 2QLYA 2C3XA 5BUAA 3NCYP 5LDSA 1AZNA 1CU4H 5D1XC 4Y4KA 2J5LC 1AI1H 5KVMC 3QUYB 3UBXG 2CDGA 2DWSA 4PR5B 3RJQB 1I1CA 5E5RB 1TQBC 5TE6H 1MJUH 1XB6A 2DQHH 1EAJA 2ADJB 3N0AA 3OR7A 4OUOA 4KROD 4XP1H 4MNHB 1Y6MR 4OAWA 3MDJA 2CHDA 1TO4A 2CUMA 1KULA 4N2KA 3GRWA 1F1AA 1IAMA 2R2EB 4ODWA 5ADOH 1WAEA 4BQ9A 4W6YB 3D3VA 1UA6H 2NY3C 2HFEA 5DHXB 3ZE1F 3KYOB 4UNVA 4JG9A 3TN0D 1BG1A 4Q74A 4ZX5A 1IFGA 1Q9KA 4OLZH 3TX4A 5GISL 2UYLA 3V6FA 1LWHA 3X14B 3EFDH 2QSCH 1DQJB 4O2CB 1ORQA 5CEZD 3OZ9H 3IDMA 3BP5B 3F65A 5C0AD 4DZBB 2E4FA 5AZEL 2VWEC 3GBLA 5D7IF 1I1AC 2VWEE 4GG6B 4OF0A 5AW4B 2ZXAA 5D7HA 3TH4T 3C09C 1UZ6E 4IJ3B 3C5ZA 3EDDA 4LT7A 4HSQA 5GHWH 2XA8H 1CFSB 5KYXA 4DUXA 1TCRA 1B6UA 2X4RB 3VFWB 5EBWB 4I1NB 1ASOA 4HD5A 2C9UA 5IV2A 3M17B 3RHWF 4D0CB 1SF5A 4O51A 2P44B 2FX7H 4GQ9H 3H42H 1H6UA 1NC2A 1MFCH 3TBCA 5A2BA 3TEXA 1KCRL 3B6SA 4HOXA 4F2EA 2DJMA 4OZHB 2A9NH 3QORC 4M5YH 5FYJD 2OLDA 1S46A 3G08B 1LP9B 3HE6B 1F4WL 3LH2L 3PWPD 4OJFL 2W80C 3A4EA 3GJFB 4N1HB 2VN6A 2A77L 1XBDA 1CR9L 3P4MA 4MYPA 5AKRA 4E9SA 4D9QE 3D9AH 5CN1A 4B53A 3LH8A 3D50A 3UBXA 1SJXA 1BPLB 4PWJA 3QUKA 5IW3A 4YQXH 4V2BA 3WD5H 5DD1H 4AJ0A 2CCLA 1ZKAA 2VDPH 4MMZB 4XMUA 4FQXA 2BVYA 3Q6FA 1I9JL 5DJYA 2W38A 3MRPB 2HX7A 2WZ0A 1RU9H 3DXAD 4WHTB 4XMVA 2CGRH 3MRRB 4XMPL 5DRNA 5T1LB 1WRFA 5AAPA 4APQB 4OLYH 4ACTA 1BA9A 3QS3A 5CD3B 5IB5B 4KBPA 5BO1H 4LSVL 3RVXC 5D9SB 3X17A 1CD1A 2F54E 4LHJB 2G3MA 4FG2A 5EIVA 4ZMWA 1NDMA 2OSLB 3SBWC 1YEDA 5C0IA 1RJZA 2XJLA 5D4JA 4UYQA 3DX2A 4MHHG 4MS6A 4ZO9A 4CADB 2GT9B 2EDNA 5GJSL 5IHLB 3D0AA 4UTBA 1WA0X 3DUUB 5B3SB 1MQ8A 2XN9E 1YO4A 1GVIA 2WYTA 4X7TA 4YBLC 5ISZA 5F1IB 4O4YL 4RMWA 4X9BA 4FZEH 5HYSB 4L4VB 5I8EA 5KSBE 2VT0A 2MCMA 1GGBL 4NYLA 1Q1JH 3H3PH 4FGMA 2FQEA 3FK3A 3UGXA 2C7UA 5IVZA 2GJZB 1DANT 4FQJH 4W9EC 1P5VA 5JXED 1LEKB 3AITA 4LSPL 5TE7H 3SPIA 1NDGA 1JP5A 1NANI 4LNRB 3RX5A 2JJTA 2F1EA 2HT3D 1F6AA 4OV6F 5DS1A 5C08E 1J8KA 2WINA 2MNUA 4G7YH 3X13A 3NSDA 1UM5H 4G8AC 3D1MC 2E46A 1BYOA 1DSFH 2NY2D 2AEPL 1NWPA 1U8KB 3EYSL 5KJ7E 3TT1H 5J56B 4HEPG 5DYFA 1AD0B 3GKZA 3MLTA 2AJYL 3FT2A 1AXIB 3QPXH 4OLWL 2WTRB 3EYFB 5IEHB 4Z7OF 2PW2B 1Q9WA 1RPQA 2YUVA 4N2HA 4NENA 1R47A 2BNUA 2OULB 2RCSH 3HKFA 2KL6A 3RYMA 4OZIE 1MH5B 1IE5A 5HHVL 4HMDA 1E8ZA 4FMVA 4XWGH 4YHIA 5D7KE 3NT0A 1UZ8B 1OGAE 3VXSE 5CN2A 2G4GA 4KTDH 1M3JA 3QZPA 2HB0A 3BWZA 3FXIC 1VFBA 4HIIB 2QFPA 3QFJA 1IM3A 4HOMA 2X5PA 5HDQH 2W0FB 4ONOA 1JGLL 2MCPL 4H8QA 5E2UL 2NR6C 2Q5BA 3WV0A 1M1XB 4GSRA 4WJ5B 5CD5D 4JVPA 4IBYA 1TU2B 4YSUA 4LOVA 5I24A 2PETA 3ZQXA 3U4AA 5IB4B 3LQMA 4UTAL 4P4KA 5HYFA 3KR3H 3MGTA 1T2XA 2BVPA 1KJ2H 5B21A 3U46B 3KM2A 2GFBB 2EILB 4GRWE 3NFNB 3RZCD 3OC8A 1OAQL 3O4OB 3I6GA 1FIEA 4MLIA 4FQHA 3K2UH 1V8HA 3L5XH 3N1MC 2EYTA 2YZ1A 3VA6A 4LLDB 2XBZA 3UC2A 1SQ2N 2CGZA 5D1XB 3ZKQD 2J5LB 1GGCL 5ETUA 2DIAA 1EHXA 2LAGB 1UYWL 3U1QA 4ONGL 3K5SA 2Z93A 3TFBA 5KSVB 3F6JA 1OK8A 3PAUA 4AH2A 1TQBB 5CLYA 2GSMB 1G9HA 3Q8EA 2A6JB 3AS0A 3LQZA 5ECGA 4EKJA 5I23A 2VR5A 4Y2OB 3OAZH 3U6XA 1D7CA 3B5GA 3F7VA 3O11A 4WSKA 2W0LA 5GRVL 5A6MA 4TVPH 1TQVA 2KT6A 1CI5A 4M8RA 1GJWA 4C8XA 4RGOH 1Z2KA 2NY3B 1K8IB 1UXLA 2ZXCA 5EV7A 1K5WA 3Q9QA 3WDHA 4A04A 5L88H 1ETB1 5D2LB 2KHAA 5C09D 1H3VA 5DURD 5CP3H 3HPLA 1CFTA 3WS6A 1HL4A 4M61A 3SE4A 4KQ0A 1VKXA 3X1NA 3LMJH 1WQVT 3BAEH 1CFBA 4PYHA 4JHWL 5DJ6B 3B3BA 5F72S 3V2AR 2EACA 4ANUA 1I1AB 1MCNA 1HYSC 5SWSA 1JGDB 4PRBA 4BZ1H 1PL3A 2WKOF 5CZVH 5KSAD 3IKKA 2EDTA 4X0NA 5FCUL 4ZFQA 3C09B 5K9KA 3PAVA 1H0DA 3T0EA 1T83A 3B3IA 4WENB 3IJYA 1KDIA 2I25N 3L5JA 3LOWA 2CALA 5D71H 2I07B 2N0KA 1MEXL 4K7PY 3P0VH 4MDJB 5BOJA 4M3KB 4G8EA 4OZGE 4F8PA 3RWHB 3ZSTA 3R8BB 1ODUA 3BHBA 4ZBJA 3UTPE 4GAAA 2PYFB 5FB8B 2YZ8A 4JFUA 1HDMB 3DMMC 5I15H 2DLGA 1XGQB 2MHAA 2E6JA 4LHUB 2R29L 3MJ8A 3II1A 1ZGLM 1KTLB 3QORB 2R7EB 1NMAL 3DVFA 3CVDA 1O7DC 5EFIA 3VH8B 2W65B 2R4SL 1KTKE 3GSOA 1N5YH 1PFCA 2J6EH 3GEFA 4OF5A 3VI3A 3CQPA 2Y6SD 4TNGA 3DI2B 1SXBA 4NS0A 1A6TA 2AXFB 4E9LA 2P5EA 4C4UA 1Z32X 4G80B 4K5MA 1CLOH 2B59A 4ALAC 4CGTA 3BESR 3D0LB 5IT2H 2CBOA 2XWCA 9CGTA 3LIZL 4WI7A 4U1HA 4BWUA 5ACZA 1BM7A 2BS9A 2D73A 2ZKYA 4P46D 4PV8B 3G6JE 2WLLA 4AEFA 1KFGA 2VDLL 2XLLA 4OU3A 4LEXH 2AJSH 1A6PA 4S0HA 2VTFA 1RFDH 4UNIA 1EBAA 2VXVH 3TV3L 3EFFA 4FP8H 4GQRA 3IVKA 4M3HA 2F54B 3GXNA 4X9IA 4F37K 3IDGA 1NTDA 1I75A 4H40A 3BGFC 4NBYB 4AV0A 1NCNA 43C9B 4HJGB 5CP7A 1DE4B 2CUIA 2F1AA 2XTJE 3CFDB 1DQML 2DJSA 5EO9A 3LEXA 2PWDA 2AEOA 1KIRA 2P5WB 4QYOA 5B38B 4G1MB 1XHHA 3ME0B 2XN9B 3NK3A 3EYOB 4QHLB 3UX9B 3W11D 5I1GL 4IU2A 2IFFH 2SEBA 2B1HH 2ADGA 4YBLB 3IGUA 4WDIB 2GHWB 5TF1L 5KSBB 5E2TH 1HK6A 2R1XA 4XBMA 2A9ML 2UZXA 3GQFA 4OZ4A 1ONQB 1P1ZB 1DL7L 1TZHB 3FC8A 1ZT1A 2KLSA 3SZ6A 5L7XH 3PWUA 3CFJA 4IJTA 3VFTB 4AYFA 3RKDC 1HINL 4YFLF 1UB6A 4UIMA 1ZHLA 2BP3A 4XPHL 4ZDHB 4PJXF 4KI5F 3ZRFC 1ZLDA 4NWUL 3QRLA 4W9GC 4DP4X 5C08B 4EBQH 2H3NB 4B9JA 4LSRL 4WTZG 4B96A 2XKNB 2XQYG 1SNRA 2X2JA 32C2A 1MFVA 3RVVC 4QXTB 1SHMA 3LH9A 4R8WL 2WXOA 2HRHA 2Z7ZA 1KTDB 5JXAL 2NXYD 4JFYB 5EZPA 4BZ2A 4C56E 5GQBA 2UX6A 4X7SH 2HLEB 1A14L 2VUOA 3R4RA 3M88A 3UP1A 3WN5A 2DQCH 2YXWA 4PJBE 2FWUA 4PJDF 4NKOA 4ZK8A 4NO3A 5KBMA 2ZD0A 4V1DD 3TO4A 4DHLA 1LO3L 1UWYA 5FOBB 1CF8H 1U8LA 4TQ8A 1BXXA 5CBAA 1ZJAA 5CEXA 3VXSB 1NFKA 3RA7H 3GDBA 4QD2E 4DP7X 4QOKE 4W9ZA 1I4FB 1FFPB 3I6KB 4H8PA 4TNVK 5EUOB 3VXUA 3SE6A 4QHNA 5I19L 3IAPA 3FO9B 4CUCA 3TJHD 1TVBB 4GP8B 4JFDA 2PYEE 2R83A 2D2OA 3ARFA 3CVHH 2VAJA 5BRZD 1JBJA 3IETB 3NN8B 3C60A 4HCFA 3U4EB 4J2QA 5EZJA 4J39A 1NAMA 2NZ9D 2X0UA 1TFHA 4E2OA 3AT9A 3G5VB 5EU6B 4OBSA 1OTTC 1Y6KR 5SX4H 3MRCA 2WUCL 1G0XA 1F2QA 3CHPA 4JNXA 3KPOA 1F18A 2DQJH 4ZFGL 3PLYA 4L8SA 4TTGA 4KZDL 4OW6A 3FH5A 3EOTH 4X7CC 2CK0L 3LKPB 1CD8A 1PX3A 1CFNB 2ISDA 3RAJH 2Q6WB 5LCVH 1ZA6A 1Z9NA 5AYQA 5F9JB 2WQSA 2HUHA 5EN2B 4Q9BA 3GBNL 3GSQB 2I9TA 5E6ID 2GW5A 5IJDC 3S88H 1NCOA 1PF3A 2YO3A 2IGFH 5B39G 1CICC 1DBKL 1IQDA 1TO5A 1C5CL 3N42F 3TA3A 4JM4H 3IN0A 4Z3JA 2JB5L 2WQAA 4O9HH 2WBXA 1NICA 1N4XH 1V7NL 2P80A 1KBGL 4JHAH 1IAIH 5F1NB 1VSCA 5HHPB 5F9OH 2V7HB 1SN5A 3ATDA 4WTQA 1F0LA 2B16A 3IEAA 1FNSL 3H9YA 3NIGF 1S9YB 5KVGE 3UTQB 4DP9X 5CIPA 3ROOB 3JYCA 4HK3J 1AHWA 4PG9A 3UG4A 3U2SB 1BQHG 5I71C 1FZKA 4XC3H 4MAUH 4OCXL 4UDUB 3GXPA 1EFXD 4K5LA 3OPZL 1KTCA 5HSFA 3NESA 4FI8A 1H19A 1GYAA 4JG1L 1OALA 1ULVA 4WGWB 3HC0B 1EVUA 1NOFA 1YYLL 4PVLA 3MLZH 2W94A 4X6BA 5HDBF 3KGUA 3T0BA 4F92B 3S8GB 1PVHA 3GMMB 3RUGF 5JHDA 3NBNA 3W9EB 2ADFH 1KBWA 5K1JA 4XNMA 3MPCA 4ODTH 1RLBA 2YKLL 3TWCL 4A7TA 3MCKA 4CILA 3FU7A 4F7CB 1EZVY 5KG9A 1DUZB 4K7PL 2VDLB 5A43C 1D9KB 1I3RB 2PXYA 4F7EB 1UH2A 4FI7A 4OZGB 2ZQKA 4XPBH 3U4KA 1A3LL 1XCTB 4HUKB 2VOTA 2APBA 1JDAA 1BOYA 3JZYA 2X1QA 2HWZH 3BP4B 5I1DB 3WFBH 4JJ5B 3VI4A 4TRPL 3VM5A 1CN4A 1FZJB 1E42A 2D7PA 1S7WA 4Z8FL 1L4IA 2WCSA 4Y1AA 5DJ8B 4XE5B 3RTQA 3TA4D 3DGCR 4GBXD 3B9KD 3FU8A 1WUNT 1F41A 3FAWA 3BMVA 3B83A 1MI5A 1PEWA 1XEUA 5AW0B 2O72A 3DX9A 4LSSH 1LHZA 2ZKHL 1UD3A 2Z3FA 3S2AA 1AGEA 4S1SL 4BSVA 3KPQB 2VMEA 1SFHA 3HS0C 4XRCB 2NY4C 1AQDA 4XN8A 3RWJB 1PLGH 4LU5L 3X11B 3IRPX 5FHAL 4FFYH 5LAPA 1G7JA 1EWHA 2MOVA 2EICA 4JFQA 4CU7A 1TZIA 2Z4TA 4HXAH 1OM9A 4G9DB 3G6JB 1JTOA 1TOXA 3GSWA 3MAWA 3MGOA 2BIMA 1CGTA 3DV6B 1SJMA 3TO2A 4GKLA 1ZS8A 2I5YH 3FULA 2QEJA 5D72H 5B1BB 4PB9H 1WBYB 1JFQL 1QFOA 1NC4B 1S6NA 1U4EA 3PWVB 3T8MA 2XFGB 4WUUD 5A7EA 4KTEH 2YPLD 4KK8C 2L7EA 1M3IA 3BGFB 3RWCA 4Y5VA 3U1SH 4YDZA 3MYJB 2CO1A 2EYRA 3SEPA 1BQHA 4F58L 2RH0A 1UVQA 4DTGH 4P2OA 3QFJE 5C0EB 3IS1X 3SY0A 4KJWD 2ZAIA 3IJ8A 5T5FA 4H1LB 5DVOA 2B9BA 5G4NA 1A7RH 1IE4A 1NKRA 2J57A 2XWTA 2CK2A 2DKUA 3QIBD 4X80H 4KROC 3S8FB 4ZZKA 4H8HA 2DMKA 1E8YA 2GAZA 3F5WA 3RGVA 5KS9F 4WV1A 1SJVA 3K6IA 4M4RB 5F7NC 3VFNA 1OAYH 3R18A 1AC0A 1UD8A 3SGEH 2DEXX 3FTUA 3DBXA 1MLBA 2WBJA 5JOEA 1LYQA 5DWPA 5L0QC 3F84A 5IREA 1UOLA 3JTTB 3JWNC 4N2AA 3QJVB 3NCCB 3ZDZF 5DFTA 4LF3A 3SYOA 4L8CB 4D94A 1S7TA 1H5BA 3EOBA 3I75B 4C56B 4FRWA 1KLFA 2N59A 4MXWH 1M7IB 2F61A 3IAGC 2Y07H 4PJBB 2H47C 3KEDA 3CHSA 1QBML 2DYPB 2E9BA 2FEEL 4GXUM 5FYLH 4DT2A 2E56A 5EU5B 2DWXA 4GW4B 4O2EB 1RERA 5TF0A 3RNQA 2I9LB 5JOFB 1L0PA 5I9QC 5DLLA 2LFEA 4GH7B 1BM3H 1SVBA 1SY6L 1ZK9A 4WI2A 3HG3A 3ILDA 3MKKA 3V8CA 2DBJA 1PAZA 4YR6A 1MOEA 2B1AH 2PF6A 1WH0A 2Z8RA 3QQDB 1YYMH 4DN3H 4Z76A 1N7MH 5LWYL 4UT6H 3B37A 1AZZC 1R3HB 1PNDA 2PYEB 5E08L 4EI5C 4D8PB 1J9QA 4F2ME 1DVTA 4ZMTA 3HUJE 4PRHA 4HMEA 4NQCB 1MUJB 1KCUH 1ZY9A 4PWIA 5F71A 4X9HA 4PJCA 1VZGA 4UM9B 4PP1C 5SWSE 3MBXL 1ADQL 2GUOA 4X6DE 3S8WA 4U3CA 2OP4L 3TONA 2IH9A 3MU3A 4MQSB 1R5WA 3ARED 1EJOL 2YK1H 2J8UA 5CEZL 2FT6A 3C5SA 3V4VA 2UZIL 4TL5A 4AVKA 3ARUA 1E65A 3Q1SL 5CINH 3ULUH 5JW5B 1SYSB 1DFBL 3ZHFA 4OFYA 3BEWA 5E1AA 4XP4L 2HFFA 2C1PB 2HXAA 1KYDA 4L3FA 4G6KH 2EH7H 1TETH 1XF4A 3RQ3A 5B1CA 1T89C 2PPCA 3MBED 3P9LB 4ATWA 5BOPA 2VDRH 2H9GB 4QRUB 3RY6C 4JRYA 4I0PA 3U4BH 5JIKA 1HC1A 4UOZA 4XZ4A 1LO2H 2DEWX 3GDCA 1MJJB 5DA0B 4QF1A 1S7RB 4W93A 5DSCB 2ITCA 4M02A 5EN3A 1NGPH 1Z3GL 4PD4J 2PO6D 2OL3A 3VI3E 1HHGA 2WIIB 3MUJA 3QI9A 1DO6A 3VGDA 1GKOA 1RXLA 1KJMA 2AK1L 3POHA 4KQ3H 4PJGB 4PRPD 2O5XH 5I71B 2FIKB 5FYJL 1W8NA 1DVSA 3IF1B 3SDCA 3QGVA 4LK4A 4CKVX 2CO7B 3NDYE 3NJLA 1O7SA 1CLYL 1UG9A 4B0MB 4GAYB 4HBCL 3LN4A 4F57L 1KJ3H 5TTRA 1KT2B 4IOSD 1G0YR 2RQ8A 1OCOB 4XVUD 1FLTX 2WUBL 2NDFA 1RUPL 4G72B 1VENA 1XB3A 4U1KB 1MW0A 5FW8A 3VGBA 1JPST 4GRLA 1NCBL 2Z4QA 2E7LC 1J5OL 3DNKA 4L2LA 3DYOA 1MWAA 4N25A 4PRAA 2VE6A 1AZUA 2ZZUT 2FQFA 4FQQA 4B27A 3MLSH 2CG9X 3ZE2E 2WJ7A 3EYUH 4B95C 3WTUA 2FAUA 4WI3A 2C1OA 5IEKB 5DVPA 5FUZL 2BHFA 4PJIE 1O6VA 5C0CD 4MDIA 4QO1B 4J6RH 4XPGL 2WSPA 1IC4H 5E95B 4A67A 1E8XA 3EJQA 5EO1B 3MV7A 4HDIB 4L23A 4ZMYA 3K8MA 3E80A 3FH7A 3WFDH 3BQUA 4LL1A 4ENED 3QZOA 1T7XA 4QKXB 1QP1A 2AJXL 5JIQA 5MEPA 1M2OA 4PWGA 5C6PB 4XCEA 3FUIA 1FFRA 4HFWA 4TOYH 1J8SA 2NY4B 1U8NA 2P28B 3R06A 4OT1H 4Y2DC 3WNOA 2F15A 2GEQA 3I6LD 5D70H 3BLPX 2DS4A 1T1XB 3QH3B 2DQ6A 3IN2A 4HJJL 3MA9L 5IFAL 1JZ3A 3A4DA 2GIYA 3QPQD 1N10A 1KCSL 2GJRA 3MMEB 5TGBB 4ILDA 3DHMA 1JAEA 3QXDB 3QXVA 5LVEA 5J6GA 1Q0YL 5IGXH 5GRUL 5MP6H 2DQEL 1PZ3A 4W4OC 4YMPA 5FPIA 3T1WA 1MG3C 4HWNA 1PKQA 4IBTA 4UZSA 3TPUA 1I9RH 1JWUA 3FUJA 2VABB 1AFVH 3POCA 3QSKB 1X6LA 4EJ1C 4DESA 4DPCX 3DX6B 4X6CE 1MNUH 1NZRA 5I1LA 4D3CL 4UOJA 4R7DA 1HHIB 4A55A 4PIRF 1FYTB 1NCUA 1WZLA 3UPCA 3QO1A 5DQJA 4QJ5B 3QNYB 3UERA 4RSYA 2R0ZL 4XBEL 4JFDE 3GGWB 4KROB 1O9ZA 1A7NH 2VLRE 1U8MB 5FECB 3LEYH 3KYKH 1OW0A 4Y16C 2QSQA 3DUSB 1R3LA 1X5ZA 1ESOA 1CURA 1UD2A 5I2IB 2BFVH 1X5YA 1UA3A 3NG5A 3NJHA 3TNMB 2OMNA 4M62H 1TDQA 3MRKB 5ABAA 3TLRA 5DJ0A 1QABA 1MFDL 2CDEA 4OCWH 1U92B 2F7IA 4UF7C 3ZL4H 5L0QB 1B4LA 5K93A 3T2NL 5A6LA 5A2AA 4R26H 5JNYB 4BFIA 5IBLD 3CX2A 2CHNA 4GP5B 3QNZA 2YPKB 3HI5L 2Z1KA 4FG0A 4PGBA 2F7RA 3ML8A 5C0AB 3GHEH 3L5WB 1FZOB 2P26A 4Q0XH 4LVEA 2BY2A 5GGRB 3NPSC 5IWLA 5KSAC 3MRBA 3MODH 4UUJA 3STLA 3VTAA 2HG0A 5ITFA 1JN6B 3LS5L 2XTJD 1IEBA 3BVUA 4H8UA 1J11A 1QWNA 4JUTA 5I9QB 4JX0A 1DJZA 3DOSB 1E67A 3OKNB 3GB7A 1FYHB 3WFCH 1PX8A 2H1PH 1D5IL 3V5HA 1ECZA 2FHFA 4I3SL 4CDHA 3OHMB 4NZRL 4AEIH 1I8IB 3TBWB 3QWOB 1OAKL 3HUJB 4HCIA 3QNXB 4EI5B 3BWAA 3D30A 3SQBB 1WICA 2DWEA 3QS2A 2OMYA 4R7VA 4QRRD 1ZIBA 2KC0A 1CF1A 5E1HB 4GKNA 5I1AB 1JDDA 4KK9D 2W9EH 6PAZA 1JHLL 1EEQA 1R3KB 4YE0A 4IBUA 4EDXB 3AQXA 1VCBC 1N8ZA 1ZWIA 3HB3C 4X6DB 1T66C 1JF1A 4QWWC 2NY5C 2ITFA 1SEQL 4JLRB 2ZOLB 3EJYC 4AENA 2FO8A 4QT5A 2XNAB 1NBQA 5IM7B 2TRHA 4NO5B 3L3IB 4QTHB 4WWOA 2K3HA 1ZT7B 2CE6A 4Y4KD 3MROB 3S5ZA 1LO5A 4HK0A 1BFSA 2HH0H 4UDTA 3TEUA 4MJ5B 1HCZA 1J5DA 3EAKA 3VWJC 2OYPA 3AS1A 3DSFH 3BH9A 4TF4A 1CDBA 4FAAB 1DJWA 5GGVL 4G6AC 3ARGC 2WC7A 3DXAB 3OJMB 4PJEA 4PUBL 2G5BA 5H4YA 1FI8C 1N64L 4FHBD 1NFDB 4KHTL 3SDAD 1FH5H 5AW7B 5IG7A 3D3VD 3Q2LA 3TV8A 4F5CA 4RA3A 5J9PA 4I5BB 4MVBD 4KNUA 4M3JA 5DEGB 3S4SA 4LLWB 1MI5E 3MNMA 4HUWA 3OF6A 4WWID 2NCMA 5ANMA 5JDSB 3DK0A 1E43A 3EW3B 1CGSH 5TQ0L 4BIKA 1OCWH 4YFEA 1QFWH 2FEEI 3W11C 3ARRA 3D25B 3PV6B 3OKEB 5F8QC 3A6BH 2EE2A 1IQWL 1WBXB 1KB5A 1S9XB 2NY5L 3KWWA 5HHOA 4HEME 1IJ9A 4NUGL 4HSAC 1FL3A 2ICWI 4ZMXA 5BZDA 2HRLA 4PW3A 2PCPB 1INQA 3CZKA 1WJ3A 1N2RB 1T20A 2CDFA 4I77L 4UQIM 2F74B 1Y0LA 2W07A 3KNBB 5DC2A 1CC3A 3C5ZD 3W38A 1HHKB 1M4KA 2IADB 2P8LB 3CFKA 3NCEB 4N0UA 5KUKA 4L9DA 3DKHA 3QEGL 4KNTA 1DUYB 3OKDA 2VDML 3PRZA 4IK6A 3ZE2B 1WHOA 3N50A 4XGZA 3VXPB 2NX5E 4KKAD 5AD0A 3FU6A 3GMPA 3QUGA 1CFQA 2J3SA 5FM8A 4A7GA 3BDYL 4H8WH 4PJIB 4GAJL 2NXZD 3L3HA 1NC2D 2ODHA 1B4RA 3P40A 4JQXA 2QV4A 2VXSH 4G7VL 4JFEE 4ZFOL 1S2EA 3T8XB 4M6ML 4GI6A 1UOWA 2WYZA 1N5AA 3L1FA 1G9MC 3K1DA 4WJG3 4M7KH 2UVEA 4BRJA 3VG9C 3GBMH 1G7QA 4I18A 2JXMA 1KB3A 3LNDA 5EO0B 2I85A 4DOHB 5E8EA 3DVNA 3OV6A 4BKSC 2G4EA 4KTYA 4J27A 4K2UL 4K23H 3IKCA 2WYHA 5DC4B 2LU3A 4NP9A 4F80A 2JLLA 5EZLA 4Y2DB 3CC5B 3OL2A 3RWEB 2WB7A 4XVTH 3E7JA 3QQ9C 3HZ3A 4FQXD 3GTTA 1KPUB 1DLHB 1WAAF 2CJUL 2B7DT 1DBJL 4NKQB 1J9TA 1MZZA 1CBVH 1U8HA 2EO7A 4Y5XC 3T2OA 1IMHC 3D08A 1DDHA 2XPZA 2EDEA 2Y06H 4LEOB 1GCYA 5G4MA 1AXSB 4X83A 4NNXA 2V2WA 5KN5A 1I7RA 4UYPA 4X7FC 3VXMA 3FNKA 2N4IA 4JHZA 1ACYH 5K69A 4PG2C 5IUSA 3WTWA 3W5MA 3K91A 1K85A 2D4DA 2IMMA 4OUUB 1G9ML 3FCBA 4Y7OC 4X6CB 3OJDB 3O3UN 2BOLA 5EMYA 5BQ7B 5ISZD 1YY9D 4WNSA 4IGBC 4BCYA 3O6LH 4YNYA 5JPMC 3B7SA 4NXSA 3WO4C 2QTVA 5E6IC 3MYZA 5LGJB 2X6BA 1YMHB 2VLRB 4AK2A 4URKA 1RUQH 3GKWL 1OSPH 4TPRH 3L08A 1SPDA 3SE9L 2VH5L 1M9WA 3CUPA 4Y16B 3JVFC 1KYUA 3QG6A 2ZJSL 3ULUF 1E5UI 1QZNA 1XDTT 4PBVC 2Y5QA 5DUPH 1E2ZA 1YPZA 2LQRA 5C0BB 1VADA 4LLMB 1XF5A 3HC2A 4KK6C 1E5YA 2J8UE 4A68A 5I0DA 1HH9B 4HQQH 1E90A 3PIQB 3KLHD 3N9GH 5DURB 3KPSA 1K3ZA 5DFVC 2HJLA 4O5LH 5E23A 3CFEA 4F7PA 3CMOL 2AGJL 2AI0H 1WT5C 3LV3A 4E41A 1M6OB 1H3PL 4E5XB 5BW7C 3S9DB 4P3DA 1DBBL 4OQTA 4AGQA 3B9DA 5FEBA 3SO5A 3VI4F 1DEEB 3H2QA 4XVOA 2HVKA 3WIIL 2O6DA 3NPSB 5ENWB 5B7EA 4JRYE 5IVXF 3QEUA 3S0PA 3TIDB 5KSAB 1BPVA 4PV1C 4NX0A 3HAEG 4ODVL 5D1ZA 4AT6A 5AOIA 4AQEB 4AL8H 4RAVA 1N19A 3NEXA 4WRLA 3BN3B 1BF8A 2AV7A 5IBUG 2DPKA 4PJ6A 2FD6H 4UOQA 2IQAB 5CKGA 5JW4R 4RBPK 5KJ4A 4OTXH 1A6VL 4YDLC 2ZG3A 3QFJD 4PFEA 4ZXBD 3S36H 2BS71 1IM3D 3QISA 3F6IA 3NCMA 3QAZB 5ESVB 1O9VA 3AG1B 3PF2A 4Y5YA 1XCXA 2ATKB 4HGWA 5LG1A 2AABL 1HOCB 4L4TA 4LASH 2PTTB 4OV5A 1U93A 1OD7A 2X4SB 4LBEB 1EMTH 4H8VA 1R0AL 3WS3A 1BXAA 3F58H 4P4KD 3D69A 4JN2B 4XNUL 5E70A 4Z7OE 4YSOA 2C4FT 2G30A 3SGDH 3HB3B 2NTFA 3ARXA 3QIUC 5MEQB 1S7VA 3VD0A 3MFFB 2VR3A 1M53A 4G8GA 5CMAB 4Z95L 5L4MA 4CAGA 2YJLA 1MIEL