2IH9A

A high-dose crystal structure of a recombinant melanocarbus albomyces laccase
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
559
structure length
559
Chain Sequence
b'EPTCNTPSNRACWSDGFDINTDYEVSTPDTGVTQSYVFNLTEVDNWMGPDGVVKEKVMLINGNIMGPNIVANWGDTVEVTVINNLVTNGTSIHWHGIHQKDTNLHDGANGVTECPIPPKGGQRTYRWRARQYGTSWYHSHFSAQYGNGVVGTIQINGPASLPYDIDLGVFPITDYYYRAADDLVHFTQNNAPPFSDNVLINGTAVNPNTGEGQYANVTLTPGKRHRLRILNTSTENHFQVSLVNHTMTVIAADMVPVNAMTVDSLFLAVGQRYDVVIDASRAPDNYWFNVTFGGQAACGGSLNPHPAAIFHYAGAPGGLPTDEGTPPVDHQCLDTLDVRPVVPRSVPVNSFVKRPDNTLPVALDLTGTPLFVWKVNGSDINVDWGKPIIDYILTGNTSYPVSDNIVQVDAVDQWTYWLIENDPEGPFSLPHPMHLHGHDFLVLGRSPDVPAASQQRFVFDPAVDLARLNGDNPPRRDTTMLPAGGWLLLAFRTDNPGAWLFHCHIAWHVSGGLSVDFLERPADLRQRISQEDEDDFNRVCDEWRAYWPTNPYPKIDSGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Laccase-1
molecule tags Oxidoreductase
source organism Melanocarpus albomyces
publication title A crystallographic and spectroscopic study on the effect of X-ray radiation on the crystal structure of Melanocarpus albomyces laccase.
pubmed doi rcsb
total genus 179
structure length 559
sequence length 559
chains with identical sequence B
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2006-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ih9A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ih9A02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ih9A03
1M56B 4KOBA 2TSBA 4ENZA 3C75A 3CG8A 1ZIAA 5B1JC 3UAAA 1NIFA 1R1CA 3MBWB 3NJLA 3GYRA 7PCYA 2I7SA 3FPXA 4YVUA 4PAZA 4G72B 5I5IA 3PLYA 1RKRA 1L9SA 4DPCX 1W8EA 2UXTA 3UABA 4DP2X 1RCYA 1URIA 3PXLA 1KYAA 2GBAA 4HZ1A 2BWIA 2R7EB 3NJHA 1L9OA 2XXFA 9PCYA 1WS7A 2PPEA 1ZDQA 2VW6A 1BXVA 1SF3A 4BWTA 5I6PA 1BXUA 3H56A 1J5CA 4JHUA 4FAAB 2E86A 3NT0A 4BDVB 1DYZA 2J57A 1ET7A 2EINB 2FT6A 1CYWA 1QNIA 1JVOA 1KBWA 3X1FA 4A2HA 4E9QA 3AW5A 1JXFA 4JHVA 5IY5B 4P5SA 1WA2X 2I85A 1TKWA 3CZUB 1QHQA 2GIMA 1V55B 2AFNA 4Q89A 3X2QB 3ZX1A 1GY1A 4E9SA 3S8FB 3S3DB 2JKWA 1GY2A 4YL4A 2IDUA 1HAUA 2BO0A 2AZUA 2IDSA 3GDCA 3GXUB 3IE9A 3JT2A 3NP4A 4E9XA 2DV6A 2IH9A 1BYOA 5B7MA 2AZAA 5TK2A 2Y1AA 4BK5C 3U25A 3FYIB 1QLEB 4ZK8A 1J9SA 1MZZA 4GP8B 2WO3B 1AZBA 2YAFA 4UF7C 2JFCA 2BW4A 4HIPA 4KO9A 1GS6X 2CAKA 2PPAA 2PLTA 1NDTA 1PY0A 5B1KA 4AX3A 5I6OA 2XX1A 2P80A 2X87A 1ZPUA 2PPFA 3FYEB 2DYRB 1FA4A 3OM3B 1L9TA 2PCFA 4F2FA 1N70A 1NIAA 2H3XC 4E9RA 1GYCA 3CVDA 3DTUB 4F7KA 2FQDA 4PCYA 1KGYE 3QJTB 1N68A 2WSDA 5D4IA 3AZUA 1W6WA 4YSUA 5I6KA 3UADA 3N55A 3NJNA 4E9VA 2BP8A 1ETJA 5F7BA 2PP7A 4JKNA 1J5DA 2QPDB 3NSCA 4HALA 3V9CA 3HB3B 2FQGA 4BWUA 1GS8A 1A4CA 2OJ1A 2XV0A 4BWWA 4NERA 3IN2A 3OD3A 1IUZA 2DY2A 2DWSA 4E9YA 2YXWA 1PAZA 2WO2B 4GP5B 1OE3A 1SDDB 4A2FA 2YAEA 3SQRA 1KBVA 3WIAA 4QKTA 1AS7A 1MZYA 4HHWA 1JXGA 1OCZB 5E9NA 1E5YA 5B3SB 2B08A 1ADWA 1PLAA 1NWOA 1NICA 2HRHA 2XXGA 3QJVB 1NPNA 4KNTA 5B1JA 4YSAA 1CC3A 3FSAA 3NSFA 5B7FA 2QDWA 4AKOA 1AZNA 1J9TA 2QPEB 3N2JA 3FPYA 4A2GA 2N0MA 3CVCA 1JZHA 2GB2A 1SNRA 3FQ1A 2HLEB 1KDIA 2EIJB 1RZPA 3NSDA 2YAQA 3AG3B 2MRYA 3FU9A 1AG0A 5I6LA 1GSKA 4CSZA 4K9JA 1PLBA 1SDDA 2BP0B 3FSZA 2UX7A 4DP8X 1SHWA 1NINA 3PCYA 4GXFA 2CBPA 4UANA 3TBBA 3CDZA 2DWTA 2MTAA 3FQ2A 1AZCA 2ZONA 6PAZA 2UXFA 2BP8B 1ILSA 5AZUA 1JZIA 3T6WA 1W6LA 1KDJA 1OE2A 1WA1X 4KO5A 4YSCA 3SBRA 2FT7A 3PAVA 4YSRA 3V9EA 4A2DA 1HFUA 2PP9A 2VM3A 2XLLA 2ZOOA 3OMNB 4G70B 4DP5X 3IBOA 2XVBA 4AKQA 3NJGA 1AOZA 3IN0A 3QQXA 1A8ZA 2HZHA 3ABLB 1NTDA 2PCYA 3DKHA 2BZ7A 2W8CA 2XYBA 3OMIB 1AAJA 1SFDA 2VSKB 1X9UA 1WA0X 2FQEA 2EIKB 3BVDB 3S3CB 3T9WA 4DPBX 2FQFA 2GI0A 2J55A 3AG4B 5LDUA 1MDAA 1XMEB 1L9QA 3OQRA 3ZIYA 1JERA 1JZFA 3FT0A 3KW7A 1J9RA 1SFHA 5B7EA 4X4KA 4QLWA 1AANA 1AS6A 1IKOP 3ABKB 2UX6A 3S8GB 2PPCA 3ABMB 3L45A 1WAEA 2YARA 1EHKB 4UAHA 1AG6A 2GHZA 1E5ZA 2H5UA 3NJKA 1KCWA 1V54B 2PP8A 3WNJA 5ANHA 1NPJA 5AKRA 3S3BB 1PMYA 3QJRB 4P5RA 4G7RB 3EHBB 2HX8A 3MX0B 4A67A 6PCYA 3WI9A 1E30A 4YSDA 3H4FA 4G71B 2CJ3A 1PNCA 1IBYA 1XB8A 1ASPA 1NIBA 3NJIA 4E9WA 3G5WA 2IWEA 2TSAA 1ASOA 5I6MA 3NSYA 2XWZA 2VW7A 1PNDA 3FS9A 1ASQA 1ET8A 1PZCA 4AZUA 4YSPA 3EH4B 4A68A 4YSOA 2CUAA 3JTBA 3TA4D 2VM4A 4RH4A 2ZXWB 1TU2A 3QJQB 3SBQA 1A4BA 4YSQA 1FWXA 2Y69B 4F2EA 1OV8A 3PAUA 4GYBA 2BHFA 1I53A 4NB7A 3UGEA 2IDQA 1GS7A 4HCGA 1EZLA 2YAOA 1GW0A 1B3IA 4KNSA 3TASA 2OCCB 2XX0A 4G7QB 1JXDA 1L9PA 2B3IA 1AIZA 1NIEA 1PF3A 2GC7C 2Q5BA 5D4JA 1VLXA 1BQ5A 5FC9A 4N4YB 5TK4A 2W88A 1A3ZA 4DP1X 4AI7A 3WG7B 1X9RA 4A2EA 2IDTA 4YSSA 5PAZA 3FU8A 4DPAX 5I5MA 3AG1B 2GC4C 3BQVA 2IAAC 1AQ8A 2YAMA 3WKPA 1TEGA 2BW5A 1L9RA 4A66A 3EH3B 2UXGA 1SHXA 1UATA 2VMJA 5D4HA 3UACA 3ZDWA 2IWKA 3ASNB 5I26A 2AANA 1OCRB 3EH5B 4YSEA 2JXMA 1PCSA 2YAPA 3QJSB 1BAWA 4HHGA 2BP0A 4M4RB 1WS8A 3HEIB 4GP4B 3T6VA 1ET5A 3H4HA 2Q9OA 4DP0X 2XU9A 2ZWNA 3ERXA 4MFHA 3UAEA 3FSVA 3TBCA 1RZQA 3SBPA 3FSWA 1IC0A 2FWLB 4DP7X 1ZIBA 3NJJA 3T6XA 2J56A 2HX7A 3AG2B 1ZDSA 3AY2A 2YAHA 4G7SB 2FJSA 4FA7B 1OE1A 1M9WA 4W9ZA 1JVLA 1PLCA 3ASOB 8PAZA 1CYXA 5EHFA 2VN3A 1KV7A 3WNIA 1T5KA 4DP4X 4CSPA 2A3TA 5I5JA 1NZRA 3WKQA 1GR7A 3PPSA 1MG2C 1NWPA 4KNUA 4TXVB 2H47C 4EF3A 1BQRA 1NIDA 2IH8A 1JZJA 4BXVA 1E67A 4DP6X 3PAZA 1F56A 2FTAA 3FQYA 3TU6A 3X1EA 1J9QA 5I28A 2AVFA 3NJMA 4HCIA 3KW8A 3NYKA 2IDFA 3ABGA 1TEFA 1BEXA 1A4AA 3QPKA 2YXVA 2NRDA 4WTQA 4Q8BA 2CALA 3FU7A 3X1NA 1SF5A 4DP9X 1AACA 1E65A 1MG3C 2BZCA 1BYPA 1AZUA 4AKPA 2GSMB 1CURA 1ID2A 4N8UA 1BQKA 1OF0A 5PCYA 1HAWA 4L0PB 2YQBA 1JZEA 3FU7B 1FFTB 1ZV2A 1CUOA 3ZBMA 4GY4A 3NJFA 1PZAA 3EF4A 2PPDA 4E9TA 2HXAA 4M3HA 3CVBA 3DIVA 2XV2A 1V10A 1ILUA 5AFAA 1A65A 4W1TA 1YLBB 4YVNA 3NP3A 4YSTA 2VSMB 3QJUB 2FNWA 4HCFA 2IWFA 1AZRA 4KO7A 3X1GA 3RYMA 2X88A 1DZ0A 3CDZB 1JOIA 3IEAA 4WKXA 5B1BB 1XB6A 3T71A 2LLNA 1OCOB 3T6ZA 1BXAA 5A7EA 4KOCA 1IBZA 4KO6A 2J5WA 2VW4A 1SJMA 2CCWA 1OCCB 4NAJA 2DYSB 2HRGA 2RACA 1XB3A 1PZBA 2XUWA 4BDVA 5I6NA 3OMAB 5F7AA 1AS8A 1KCBA 2HX9A 1OOWA 4HAKA 2EILB 1M57B 1AR1B 2I7OA 3X1BA 4BXSV 2FT8A 3D12B 2UXVA 2XV3A 1JZGA 2BWDA 5B1AB 2QT6A 2EIMB 7PAZA 2QDVA 2P80D 2R7EA 2OV0A
chains in the Genus database with same CATH superfamily
2TSBA 3BAKA 1CFTA 2C7FA 2H9GA 5DUJA 4WF7A 3CG8A 3FCTB 5AW8B 3ZE1B 3RL2A 2CR0A 1L9NA 1LHZA 1KXVA 3NJLA 3T0BA 4GW1B 1N3NA 2YZ1A 4PJEE 1CD1A 1UTDA 4GQ9L 3C08L 3THML 3VSTA 3NESA 4WWOA 3SE9H 2ZG3A 2VNCA 3IMVA 2Y7QA 4X2UA 3T77B 3BH8B 5E5MA 5EEUA 4GJTB 1KJVA 3G9VA 1UVQB 3DNKA 4DGWC 2EYTA 4HIEA 4E41D 5LWYH 2NXZC 1JF6A 4FI8A 4PRHB 4ZPVB 1WS7A 3Q8CA 3APNA 3GWJA 4G6JL 3V0JA 32C2A 1B6UA 1S7SB 2EIZB 1YPZA 1UD8A 5DK2B 5EA0H 5EORH 3S2CA 4H1LG 3HC0A 4Y9EA 2W91A 3TVMC 3FO9A 3CN2A 2H32H 5HTSA 5KSBB 5EF1A 1P5VB 4MSWA 1DQQA 1AY1H 3NT0A 3T0WA 1I7ZB 4PN6A 2IGFL 4IBLT 1UWXK 4XCEB 2JELL 4EN3C 1JXFA 4KZCA 4MJIB 1AXSA 1OVZA 5E94B 5ESVB 5C0FB 1TKWA 3GMLB 5C09B 1OHQA 2HTKD 1JF1A 2WTOA 3OZLA 1QR4A 2OR9L 3ARDD 3S8FB 3NZUA 5GIRA 3IM1A 4UQ3A 5EFIB 3BUDA 3IMUA 2QPSA 1TSRA 5F2FA 5T3ZL 4OCMC 2AZUA 2ERJB 3T3ME 1K72A 1GC1L 5I18L 1HHKB 2C5DC 3D2TA 1QR1A 3IAQA 3FYIB 4U7MA 2WIIB 3HPJA 1GMIA 1XF3A 3ZZSA 1IFHL 3KMDA 2JJWA 3FO9B 3F7QA 2J12B 4UT7L 2YAFA 4AJYV 4W81A 3CPLB 1MFEH 2NW2A 3QEHA 2JKRM 2BNRE 5EFIA 4G59C 3BP7A 4GAGL 4QRSA 3BD4A 4TQPA 3N43F 1CFVH 3VQLA 2O5NA 5DK0B 3HRZB 3LHPH 1WZLA 4EUPA 4XCEA 2YPLB 4OIIL 2XNAA 4L29A 1ZVHA 4X6FA 2J8HA 2D3VA 3UJJH 7CGTA 4M6NH 4X80L 2H0JA 2CKBA 2WKLA 4Z7VB 2VC2L 3EDJA 1VENA 4B9JA 4LQ1A 3D0AA 4PGCA 4JKNA 2E6PA 2EE2A 1XEUA 3NSCA 1ZTMA 1V05A 4U4IA 4QJ5B 5CLTA 3ETBJ 2BFVL 1U8PB 2R1WA 1CIDA 1RL1A 4OCXL 1FAKT 3V4PH 2FH8A 3AS3A 1JYWA 1KCVL 5FK9B 4G8AC 3LVTA 3T0VA 1MFAH 2QKSA 3AU1B 2CDGB 1YQVL 2A83A 2OMVB 3CX5J 4Q6YA 4QY8B 5BUPA 3MZGB 1QFOA 3AAZB 1PG7X 1KMGA 2I07A 3HW7A 3HLAA 2NW3B 2Z7UA 3OHXB 4LSVH 2OZ4A 2QQQA 4R3SA 3TZVC 1NPNA 4ELDA 3QCVL 4PYGA 2CLRB 2X1WL 1G1KA 2NR6C 1KOAA 2BHYA 2FBRA 2QDWA 4I0CC 1ZXQA 3MV9B 4I77L 1YMHB 3RUGA 5IFHH 5M7QA 3QFJB 4Y5VC 1BG1A 4YC2C 4I1PA 1JGEB 1FFRA 3GLZA 1I8MB 1VCBC 1T7ZA 1KDIA 2HLAA 2ENQA 1NGWA 4YXKL 2BSED 3WEMA 2C34A 3PV7A 2VLKA 1JPTH 5DZLA 2EDDA 3OB8A 5T3XE 1WK0A 5A3ID 1G7PB 5INCB 3VWJD 1IGFL 5DGRA 1TVBB 4DP8X 2BIQA 3MV8B 3G04B 1G6VK 5ICZA 2V5YA 4EMZA 1BOYA 2X2IA 3QPXH 4JRYA 3CDZA 3TT1H 5E6RB 4ZD3H 5BV7L 2UZXB 3INUL 3EFFB 3VFUB 2BP8B 5FV1L 2K9UA 3BW9A 2WKGA 4FNUA 3AY4C 3CFKA 4AQZA 4IRJC 2HG5A 3O6FD 4RISL 4CBPA 2XBDA 3DROB 2WTRA 4WFGD 3SE3A 4YZFF 2EH7L 2WNKA 4L05A 1OD9A 1DQTA 1PX4A 4D94A 3BUYB 3VXNA 1GZPA 1LO2L 3NFNA 4LEXH 1EJ6A 4Y2DC 1JP5A 1Z66A 4I13B 1G9ML 4L18A 3OVUB 5AYQA 4OGYL 1YN6A 1G5GA 1LP9F 2ZYSA 3HE7C 3QNXA 1FCGA 4YBQD 1FHNA 3SY6A 3V95A 2OTPA 3VSQA 3B8YA 3BDYL 2DKSA 2ZT9C 1B9KA 2X6UA 3ATBA 5C07A 2DLGA 2GI0A 1HE7A 2WSPA 3HMXA 2V9RA 2ZUQB 4HIJA 3VD5A 2WUBH 3GSNL 1LTXA 3QEQE 5HVWA 5KSAA 4XP1L 1A1MA 4KHXH 4LLUB 3KW7A 4LU5L 1G6RB 4G6FD 5HI3D 3SGDH 4FABH 4MRBA 1KPVB 2EDKA 4JFOA 5T5FA 3CBRA 4B0MM 3TWYA 4ZOEA 2QSCH 1YEWA 4M48L 2NPLX 4QRPE 3MJ7B 4DKEL 2XZQH 4ZYKA 1LEIB 2XXMB 2E7LA 5EOTB 1NCAH 5CBAB 1KENH 1S7XB 3MMEB 4UAHA 4WNQA 1WISA 4Y4FB 1IV8A 4DHLA 4IDLA 3NOIA 5DD3H 1J88A 3LD8C 3OXRA 2PP8A 1T21B 3HG5A 1NPJA 2VZTA 4N3TA 4FQCL 5LBGA 4AGOA 4K71C 4G6ML 3VGGA 4QRPA 2CHXA 3TEWA 2AK4E 4G71B 4JHWL 4NZUH 4PJXE 3DI3B 1XB8A 3UTSD 2CO2A 4NHCL 4HIXL 4HIQA 2TSAA 3EHBC 1DJHA 3BW9B 4O00A 3U0WH 3WXVH 2YXMA 1D3CA 3HRZA 4ZX5A 5SWSB 2VZVA 2VO8A 3FS9A 3MUJA 4X6DE 1FYTD 5C08D 2AKRB 1CZ8H 3KL3A 1CDHA 1PDKB 2CLVA 2VIRA 4Q7DA 4NCC2 1B4JH 2BJMH 4XCFH 2DH2A 1E5BA 5FWQA 5DJDA 4W9EC 1IAIH 2QLYA 3EZJB 4IGBB 5D2NB 4NZUL 3H9SE 4I88A 3MRCA 1T0MA 4GBXD 5FHBH 4YHNB 3OLGA 5IFAH 2YKLL 1XSJA 3QNZA 4QXTB 5ENWB 1UT2A 4JKLA 3QH3B 1X7QB 4A7QA 5HDBB 4OLEA 3DGGA 4FNRA 1JGEA 4DQOH 3B3BA 4XP5H 1OCWH 2ADFH 2AAAA 1JNNL 2Z92A 3H0TB 3GJFK 4HKBB 3VDAA 5EO1A 3N42B 3U4EA 4AG4H 5AZ2H 2NNAA 3WFCL 4X7DC 1NANI 1QFWH 3LTVA 1EFXB 1Z5LB 5DUMH 4PJCB 4FA8A 4P5KA 2CDGA 1OEZW 3WHE1 2GJRA 3QWOA 4AQAB 4GXUM 2BY3A 2WWOA 3QDGB 3MLTB 1EXUB 4NC2B 5DEGA 2YD1A 1BVLA 5EIIG 5KSBA 3BQVA 3F04A 3ATDA 1RZIA 3Q2WA 4F8LA 2XQBH 2WN3A 4BV1A 2GSIA 1D5MA 2ADFL 3BO8A 2R1WB 5AB2A 5HDQH 1MLBB 1ZOXA 1Z32X 2I60L 5TDPB 4GG6A 4PGBA 4NEHB 2A73A 4YDJA 3MTXA 2COQA 1KJVB 4YSEA 2X0UA 2WXIA 5C3TA 2Y7OA 3L3DB 4JPWL 5KW9H 3FB7B 3HEIB 4JY4A 1MCSA 4I0PC 3W81A 4L5FH 3R8QA 2LLGA 3BAWA 3V8CA 4M4PA 2ZSWB 3M07A 4Z7WA 4HUVB 3OC8A 4X6FB 2AJZB 2ENJA 1GAFH 3IJSA 3O2WL 4ZMXA 3FRUA 5DJCB 3FSVA 4X5WB 3TBCA 1UXLA 3QDME 3QEQB 4K2UL 3MLWL 2WLLA 3QULA 1TETL 1CFNA 3LKPB 3V5DB 1AO7D 1ZIBA 4PW3A 5D4QA 3U0PB 1NC2B 2NR6A 4HD9A 5E4AA 4LB8A 5CFHA 2J8OA 4D0CB 4Q9RH 2HH0L 3SOBH 1JRHH 4CN6A 4DFHA 3GI9L 3ZKSD 4ZXBC 1MWOA 5ACZB 4F37F 2R2EA 5DHVH 2Y5QA 3UPCA 1W0VA 4U6XB 5ERWB 3V0GA 2F54E 4MJ5A 4XVUC 1ED3A 1Q9KB 4EF3A 1E5AA 2LVEA 5ACLA 1TTAA 3HE6C 1RU9H 4RAUA 3ML8A 4F15C 3HG0A 1ZHBA 3FRPG 3U2SA 3VXOA 4MJIA 5A6MA 4ANVA 3HTLX 3JVFC 5F7KC 2FEDD 1ZLWK 3DVNA 2CLZA 1XGUB 4AUUA 3WD5H 2CO6B 2ZCZA 5C2BL 3QPKA 4LVHC 3QXDA 4HC1A 2H0PA 1Y7VA 4A7GA 3A6CH 5E8PB 4FI7A 4Y4FC 1MG3C 4N0FA 4L4TD 3I50L 5CSZB 1ZXKA 2K3HA 1WUZA 2DS4A 3BVNB 2AMUA 2MFNA 5F9JB 4W9FC 3WLBA 4XOAA 2XFGB 2R0KL 1AOHA 1AKJA 1UURA 1CDGA 2NSMA 5IB4B 2Q7YB 4RWYL 2AI0H 1GKEA 1SXAA 4WI5A 4NKOB 4B9FA 2HG0A 4KZEH 1EZVX 3LB6D 4KKBC 4NUGH 1FGNH 3WGUB 4PP1C 1D9KB 1U8JA 2HLFD 1INQA 4LVNC 4P2QA 5JPNB 4GPVA 1PFOA 4NRXB 3O2DH 4QT5A 5AFAA 3HNTH 1SMAA 4KKQA 3A6CL 3RL2B 2H32A 1LJMA 1A6ZB 3QIWC 3WTXA 1RK0B 2KZKA 3O2VL 3ARPA 5DQJB 2GK0B 4KKLC 4F92B 4ABUA 1EZUA 4JRFA 1BV8A 4Y5XB 4G1EB 1SEQH 2L4OA 3RWIB 3SD2A 2N4IA 5E9DE 2P8LB 2Y06L 3MRDA 2J5WA 4UTBL 1F8TL 2DYSB 4TPRL 3B7RL 3LKRA 5I6NA 5DJ8B 5CJQH 3KLDA 1JWSB 2HT2D 4YZFE 3AFLA 5CEXB 4J5VA 3ECUA 4RFOH 2AV7B 5IG7A 1JVKA 2EDBA 3D12B 4M9OA 1JJUA 5DJXA 1KN2H 1N59B 4J4PC 5DC2A 4PD4K 5B1AB 4ZTOH 1HINH 3GSUB 1QNZL 1CXLA 1S7RA 3NACH 5JMOC 4WWKD 2X1XR 4RNRB 4XMZA 1M71A 1IM3D 3UAAA 2JTDA 2IH1B 1OAUL 3D34A 1OT4A 5HHQA 4HETA 1WVZA 4DPCX 2VQ1B 3GJEB 3EHBD 1LEGB 3Q48A 2DZEA 3QORC 1JNLL 1P7QB 2VLRB 1UA6H 2VZOA 4PGJA 4ICWA 5EC2B 1UZ8B 3BP4B 4UV4H 1I3UA 1FNAA 2VDPB 3V0WH 1FHGA 1RZJH 3R06A 3CVHB 2JNZA 5JOFA 1KTDB 5KYNA 1KTJA 2AQNA 3KYNB 2CHWA 4X7TA 4XCYA 5FS5A 1FYTB 1PZSA 3NCJL 5FYJH 4HVBA 4NNPH 3L3JB 5KYUB 1R6VA 4KXAA 4P5SA 3VVWA 3FTWA 1YPZE 2QHRL 3CZUB 2GIMA 2UWEB 5ABZA 2B14A 4FZEL 4ZTPH 1ZHKA 3MRQA 1HH9B 4NZTL 3RZWA 3FFCB 5CJOH 3MCKB 2Y7MA 5DS8A 4Y19A 3J8F7 3C5ZD 2AP2A 1LD9A 5SWQA 4BIKA 2LE9A 3W37A 2CO1A 3HNSH 9CGTA 1TFHA 5DS1A 5FFLA 3EOAA 2R4SL 4EN2A 4FG4A 4HH8A 4JDEA 2KLSA 4NQEE 2YRLA 3VNYA 4KO9A 5LNEA 4EKJA 4FLRA 1HEZA 3MRJB 3E6HB 4N6RA 4XO5A 5DR5L 3W9DA 4UQEA 4G9FA 2X87A 2C3WA 3FMGH 3RWGB 3KH4A 1GHFL 1K5WA 3N44B 3I6GA 1H3XA 3APDA 5KVEL 1R17A 1OP3K 2O72A 4OLWH 5HHME 3TESA 2CUIA 2OTUA 3JTTB 4PTUB 2A5UA 4NQEA 3ZOAA 2BRQA 2YSSA 5D2LF 1G1OA 1AGEB 3KPSE 3LPOA 1I85A 3MO1A 3ZE1F 3VMPA 4BFKA 3VI4E 1CGSH 2X4TB 5F88A 3FQUA 4KDTA 5HDWA 3UTQA 1IGML 1ZEAL 2AXFA 3R7RA 4G9FE 1NBZA 1I8IB 3TBYA 1E6JH 4P23D 1Q8MA 2ARJQ 3V0HA 1YEHH 4L37A 3UCRA 1JE6A 5SWSE 4AL8H 1KELL 3H9HB 4LOEA 3QO0B 4MD0A 5AOMA 2OJ1A 2KBGA 4APQB 2X10A 4N6QA 1CLYL 3ZKXB 3S36L 5EUOB 4M7KH 1JGUH 5LXVA 3WUZA 4B0MB 1AGBB 4PS3A 1PX8A 2HVJA 3V0EA 4ZMNA 1DCLA 4EKXA 1COBA 2FNBA 2LV4A 3O0LA 3QUYC 5T1KB 2J43A 4F37K 3OJ2C 1MFDL 1SDAB 3LRHA 4P5MA 1MFNA 1NC2D 3E7JA 4IMLA 3MOAH 5JPMB 5CR1A 4I1RA 2B4CL 4TLKA 4M62L 1OGTB 5IJCC 5B7FA 4U1NA 2R9HD 4P3DB 4YIQB 1T6BX 2ZKYA 4MB3A 4OCSL 3T2QA 4LLVA 3LEXA 3RX5A 5HYEA 1NOAA 5C0BD 1SNRA 4P5TC 1HQRB 2BCMA 2GSGA 5T1KA 2OR7A 5KSVA 3WCYA 1NCUA 2XZCH 3G5XB 4K3HA 4URKA 3WS6C 1NAMB 3PWJB 4OZGA 2CRIA 2LU3A 4K9JA 3I3EA 3FU3A 1GIGL 4MHHG 4BZ1L 3Q2LA 3VQ2C 2PF6A 4W4NA 4ICXA 4I9XA 3EBHA 4OLXH 1RUAH 5J6SA 1RZKC 2D7MA 5I30H 5D7IA 4LSQH 4BFEA 4FP8H 1BJ1J 4JM2C 3TIEB 4M3JA 2E27L 2OZ4L 3KGUA 4FD0A 3IFPA 1U0QA 1QBLH 4N2OA 4PJGF 1GGCL 3H2PA 3KNBA 4QHMA 3T6WA 4AIXA 3FSOA 3KPPA 4XNQA 3SBRA 2FT7A 4PMEA 4YPJA 3FF8A 3O41A 2VDLH 3R8BB 3D4YA 2WXJA 4MLSA 2XG4B 1A14L 1EGJH 1V8HA 1GZHA 2OMTB 3RWCB 4J3OC 2P52A 1G5AA 1I7TA 3KGSA 3NZHH 4IRSA 5EZOH 3EJPA 2IF7A 3ECBA 3OMIB 5JNYA 3B2DC 2X9YA 4K07A 1NDMB 1W2KT 3VYPA 5F6HJ 4PUBL 3BUIA 1CB4A 5JIHA 1JPSH 2VDNH 5GGTH 5GXBB 2X4QA 3MNWB 5DVOA 3IDGA 1LK3L 3W0WD 3OKKB 2J8UF 3BESR 3HZYA 3QYCA 4OR1A 5ISZE 3E6FA 1H8OA 3FDWA 4KRPC 3KS0J 4B5ZA 1P5UA 4OFIA 3T65A 5JLZB 4M8UA 1ACXA 1MUJB 4QLWA 1L6PA 1KGUA 3WFBH 2G0LA 5EPMB 4ONHB 4NI3A 1F3DJ 4U1HB 4PRPD 4Z7VF 4EEEA 2V5SA 2NXYB 5JW4M 3QE5A 1PJWA 4A6YH 4Z77A 5GS0D 4TRPH 1KEGL 3B4NA 1G7JB 1S5IH 1XSKA 3GPEA 4LSPH 1ZVSB 2XN9A 3RDTC 1C5CH 5JXAH 3FAWA 1J0YA 3DO7B 1NJ9B 2PWHA 1HT6A 1QYGH 2WPGA 2R2BB 3QJRB 3SSGA 4APQC 1HHGB 1DSFH 3LNHA 4YSDA 3I75A 5DRWB 4TVPD 3TTSA 1S8DB 1XF5B 3AWFA 4LCVA 1ASPA 4LZKA 4ODTH 4YDLC 3VU2A 1J0IA 4CC1A 4F9LC 2ZX5A 4D7BA 3UZEC 5I0VA 2Y7LA 3VI3E 5HYJB 4OD2A 2VITA 1D6VL 2N0KA 1MHEA 3MLPA 4MMXC 1PZCA 3GDBA 4A68A 3H6JA 2HJKA 3NCWA 5EDSA 2VN5A 2DM4A 2JKSA 5EU4B 3U2IA 1W9XA 2KERA 4AV4A 1T20B 1UYWL 3QJQB 1PZ2A 5EU5A 2OJEA 3FCSB 1HQ4A 3OBAA 4M61B 1WBXB 2FZ3B 3P2TA 1AGDB 1DQKA 5AQ0A 4AIZA 2DQEH 3HFML 4QJ4B 1MWAL 3THMH 5C09D 3OKMA 4F57H 5AUMB 2WXFA 5J6GB 3VRLF 5CD3A 1P5UC 1H3WM 3OPUA 1FO0A 4IDJL 1UKTA 2WGXA 3WKNA 3RWJB 1AGCA 1QFWM 5CGTA 1U8MB 2HKAA 4IRZA 1N8ZA 3H6AA 1NEUA 3DX6B 3F01A 1ZS2A 4JHAH 1HILB 4CJ0A 3UXFA 2K6WA 3GI8H 3BLPX 3LX9A 4GKLA 1MRDL 1Q38A 1JS4A 1KB5A 3DYOA 4Z0XA 1FZJA 4ZMVA 5T3ZD 5E2TL 3MBXH 1QSEB 1A3ZA 3O4LB 1R46A 4WW2F 2DQUL 5D1QE 1KJ2B 3N3EA 1VAHA 3QPXL 1E5CA 5FYJD 1ZT7B 1PIGA 4OVVA 2OXGB 2B59A 3AG1B 4XXDB 3RWIA 1I31A 1UD4A 5I8EB 3T8MA 4GEJA 1CXFA 3GMNA 1S9WA 2I5YL 1IBDA 4FABL 4Z8FL 3GMMA 5IVOA 1UATA 4YJZL 2D3LA 4HBQA 2BP5M 3WSQL 3U7WH 5D5MB 4XMLH 1S9VB 1WBZB 4D7PA 2YGNA 3MVSA 4XMVA 3LN4B 4Z7QF 1IM9D 2X2JA 2YAPA 2M83A 1NSNH 3RY6C 1U21A 1AI1H 3M46A 4S1DD 4PRDB 5D72L 5KSBE 2BRRL 1LYQA 4K23H 2BIPA 3L4YA 1ET5A 4CJ1A 4PB9L 3VXRA 2Q9OA 1M1XB 2XETA 5I0ZA 5I1CH 4G80B 1HQRA 4RGNE 3SZKC 1T20A 3UBXA 1FZMB 2BHUA 3M17B 4ODUB 4XNZB 5ISZB 5C08A 4GIAA 3DA0A 3CD4A 1A9VA 4L9LB 4P2AA 5KJ7E 1K8IA 4EXPX 5GS1C 1FSKB 4PJ5E 4DEPC 5E8PA 5HHPB 3BOVA 1TOXA 2PCPA 3ABZA 3LH8A 1XF5A 5D2LE 2VDOH 2OX5B 2A6IB 1LEKB 3QUZC 4CC4C 3EDKA 4R7NA 3WNIA 3VXOB 1T5KA 1DSWA 1T66D 2XN9B 3MV8E 4TXVB 1CICD 4MZ3A 4BHUI 1QUPA 3FRPA 5FHBL 2B1HL 5AVSB 4MD0B 3EO0A 4XVTL 4XPGL 4EN3A 2FLMA 4NJ9L 1FG9C 3L4VA 3UOAB 3HHMA 3AQYA 1TQUA 5FKAA 3U30B 1WT5A 1FFOB 3MRNB 4KI5E 4OW6A 1CQYA 2VDNB 3BGFB 2AAVA 4RA0C 5AAMA 4JFFE 4U0RB 4WTQA 3ALXA 1U36A 4K71B 2CALA 3ZL1A 3BAEL 1T89C 4U6YA 1MEXH 1F18A 1QFWL 2ED8A 3QYMA 1B4RA 2X2YA 3QULB 4XN2A 3L7FB 4KRLB 1LK2B 2D7NA 1CURA 1YEKH 2BVUA 1D2OA 3QGVA 4HZAA 1EZSA 4L0PB 3S2AA 1TJHH 5MEQA 3ARXA 1BG9A 5HDQL 1PX3A 1NDGB 2XY1A 5J12C 3T8XB 2VDPL 3NJFA 3DXAB 2OR8A 5B8CB 2X6BA 3O41B 5SWQB 1DDTA 1Q0YL 1ND0B 3CDCA 5H35A 1UA7A 4JPKH 2FSDA 4QHMB 1Y18A 4NQDD 3QJUB 4DN3H 3QRLA 1RUQH 4U49A 3JWNE 1KT2A 3BO8B 2JKNA 4MWFA 5TH2A 3NUKA 1XB6A 3EG9B 3LZFL 2CGRH 4HWBH 4AMKL 5DD5L 1NAMH 4WHDA 2AEIT 4I1NB 1L0XA 2MWCA 2GFBA 1ZA6A 1V3MA 5I66B 5C0IB 3MBEC 2DI7A 1ZLDA 2W5PA 5CZXD 3WLWD 1OCCB 4S0HA 4RISH 5TDNB 5CBEA 3IJEA 3VFVA 1IT9H 4HX1A 5AVRB 1G0XA 5DUBB 4OQTL 1MH5A 1LNUA 2VQUA 3MXVL 2QPFA 3GHBL 2GSGB 3CVHA 1DEDA 4JPKL 5MP6H 5BO1H 2YGQA 5C0IA 5EO9A 4N0UE 3SOBL 3CFEB 4R4FL 1ZWIB 5AVUB 1J18A 2EIMB 3BP4A 1AFVH 3FZUD 1TR7A 5CEYA 3DTDA 3J07A 2VDOB 3CVHL 1MCWW 2QGEA 1BYNA 4MGXA 1YDPB 2VLJA 3IDNA 2VXSL 5CMAA 1ND0A 4P2RD 1UJTA 4WNSA 1F3JA 3KXFD 3D18A 3DUUA 3O6FB 1B0GB 3BX7C 1DQJB 4F8PA 2W07A 1RUMH 2Q8BH 1JI1A 2GPZA 4NQEB 1NANH 2Y23A 4AYMC 4U1SA 5DYFA 1KYAA 3MYZA 2WLHA 3CXHK 3I6GB 3UG4A 1HYRC 2WKOF 3ZHNA 1HJBC 3D3VB 1FPTL 4O2EB 3ARGA 1SLXA 1JRHL 5IROD 3CH8A 2UVFA 2E8ZA 1SF3A 2W60A 5I6PA 4ENEC 5HYSG 2NT0A 1ZA3A 4Q6IC 4S1SL 2Z93A 2GCYA 4JM2A 4ILDA 5DJ2B 2VLKE 1QMUA 4OBRA 5DJ8A 4WGKA 4ZFOB 1ZHNA 1I1AA 1OTUD 2DICA 2QVKA 3P4MB 5JIPA 4H7VA 5EEZA 4G6FB 3JTSB 1Q72L 1RU9L 3H2WA 3QUZD 4ZO6A 1BFOA 1OTTC 1TJIL 4HHAB 4JVWA 5C07D 5FYLH 4LSUL 2PUQT 5F9DC 2CZNA 5E6ZA 4GIPD 1AXTH 2YA0A 3GHEL 3SO5A 2J2ZA 4G42A 5KYXA 4P0DA 2Z8SA 1TQCC 1UWGL 4K3DH 5BRZB 4D3CH 5ADPL 3FRPB 4U1KA 3PABA 4OIFA 2PKDA 4Y2NA 5J4MA 4MMYB 4QD2E 5EO9B 3TPUA 5B7MA 3NH7H 4XP6L 4JDEB 4PS4L 2P24B 1KYFA 1MZZA 3VFVB 3NCFB 5CP3A 1PKQA 1X5YA 3AROA 4ZUUA 1TYRA 4YBLB 5KS9B 4WUUA 5L88H 5EDXA 5FM4A 3V4UH 3DJZA 3P4LA 2HN7A 1SOXA 2CUMA 4JHBA 5J89A 1KGIA 1M6OA 4KJYA 2W81C 3JVGC 2PPAA 5FWRA 4Y2LA 3Q6GL 1JUFA 3QORD 1ZE3C 2JVUA 4OZIE 1CE1H 4N90D 5TF0A 5C08B 1BLNB 1F4WL 1CXKA 4D9RD 2JJSC 5I1KL 3WYRA 1P7QA 4MMXB 5J8OA 1I3GL 1KYOK 4MBRA 5LN8A 3GSWB 5IBLD 2PYEB 1SYSA 4YEEA 5CAYB 1M1SA 5FDWB 3N9GL 3S4SB 4TL4A 3L5XH 5I24A 3M1BB 1BD2B 1MPAH 1PG7W 1UFUA 4RFEB 1ETJA 3QIWD 1KG0A 1QAWA 2Y25A 1KUMA 4MCMA 4PREB 3HI6H 4RGNB 3TOPA 4V1DE 2OMUA 3MBED 4MMZB 3QCUL 2JI3A 3GQFA 3M86A 4EI5A 1W72A 4DO4A 1XTLA 2NYYC 3RTQD 4RSVA 3SE3C 1I9EA 2FX9H 4GP5B 1JN6A 4N2HA 1CLVA 1KBVA 1FZKA 3A23A 1IM3A 2G5UA 2JF1A 3BVWA 2E7HA 1JV5A 3UYPB 3PY9A 1AS7A 1QNZH 2FECI 4QWWC 3TIDB 1FZJB 4F7MB 3MRNA 4NQXA 4AV0A 3WV0A 4JRXB 1BF8A 1UXWB 5B1JA 1T89A 1TETH 2AXGB 2BSSA 4MDIA 5BV7C 5HHVH 1BVNT 3JWOH 4K8RL 3FOMB 2QPEB 3N2JA 4FFYA 4EIGB 2P8MB 1ZY9A 1MQ8A 3FQ1A 1OARH 3TO2B 2BINA 1XCQB 2MCG1 3WNOA 1Z9SA 2EIJB 4X4XA 3SIKA 3DSNB 1KB5L 5IUCA 1DVYA 1JTTA 3DRTB 3Q2VA 3EXLA 1A5FL 3ZDYF 3RURA 1HQ4B 4O9HH 3LRKA 1YEEH 4E41E 3Q05A 3F12B 4WU5A 3KVDD 3QAZC 4KJWC 4OJYA 4UUJA 2NCMA 1E3FA 4UANA 3TBBA 1D5MB 1E4XH 1CK0L 3FQ2A 5E6IB 4Z7UB 5KYYB 2VITB 1W0WB 3IETB 4K3GA 2VDQB 4GRWF 5CEZE 1GGIL 3HC3L 1DUYB 5C97A 4F5CE 5D93B 1PIFA 4GI6A 4R7LA 3A4DA 3VW3H 4YSCA 1U8KA 1HSAB 4KI5F 3WD5L 4NAMA 4HKXA 5F3HB 1MCDA 3CN0A 5DVNA 5JIKA 4OFYA 2EDOA 5GGSY 1WCBB 4RZCB 2ICWA 1NJ9A 4K9EC 4M4RA 1ZHBB 4N68A 5AOLA 3SDCA 2NR6D 3B34A 3HAEA 4WO4D 4F5CA 1NTDA 3K2KA 3ZZ1A 3QDGD 4JZOB 2OMYA 3WELA 3BZ4B 2AJ3B 1ZAGA 4HEPA 3QEHB 4P4RA 2G2RA 4L3EB 4M29A 5E8DH 3MA9H 4N0FB 4Q97A 3BVDB 1FNSH 5AW3B 1CDBA 2FX7L 1A7NH 4PRPB 2XDHA 2IMMA 1L9QA 4S2SB 1RHHB 3I6KA 3RI5F 1XF3B 3VW3L 3LJ3A 2DRUA 1NFDA 2P46B 1OGAE 1JZFA 3FO2A 1DFXA 5D6DA 2VXQH 5DR5H 3CC5B 4JN2B 4U6TA 1W80A 3IMSA 1UZGA 4IJTA 1HKLL 3C08H 3L5IA 2B7DT 2C3GA 3DX7A 2YMXH 3ML9A 3FTZA 3VX1A 5KVEH 2RCSH 1I9JL 2X4QB 3MNWA 4K5LA 2H2PD 4F9PA 4DNLA 4MS8D 2BS71 4LGSB 3UBXI 2FECL 3GSQB 2HKHL 1NDMA 4KITB 3O4OB 5KSUA 1J8SA 3DBXB 4JBSA 2D0GA 1IVTA 1ED3B 2Y7SA 4XN9A 3RJQB 3NJKA 1ZT4A 5ANHA 1IAIM 4QRFA 5E1GA 1SYVA 3FO0L 4IBTA 4M62H 5AW4B 1PLGH 3EHBB 5T5NG 4DCQA 2ZSWA 5JQIB 3F65A 5K9OA 3QJFB 1CGTA 3IGFA 5CGMA 4WY7L 4XXCA 4JVUA 1KFAH 4Y1SA 4WEBH 3O8XD 4A6YB 4GMTH 4PRNA 5ILTH 4Y7MA 3VYNA 3VH8B 1NC2A 4JDTH 5EZIH 2VAAB 2IG2L 4H1LA 4XNXL 3RPIA 4Z3FA 3P9MA 3F5WB 4PVMA 4EVNA 1NC4B 5L7XL 4RZKA 5M95B 3PNRB 4PJFA 3SKJH 2A6DB 3FOLA 5K5YA 4YO0A 4GIOA 1KLFB 4MMZC 4LSRH 5EBMB 4WU7B 2R2CA 3FN9A 5HGDA 4OCYH 3VFPB 4MA7L 1C1EH 1N3NB 2DW5A 1HNFA 3OZ9H 1S8DA 1HNGA 1HXKA 3B6SB 5F7DB 2AJYH 2WVVB 2Z35B 3UBXG 5AOZA 1G1CA 1HHGA 4AZ8B 1L0YA 1U8CB 4NQDB 3UGEA 5C7XH 2ICWJ 4UTAA 4NQUA 3Q8EA 3QR0A 4ZOAA 2Q6WB 1ZVSA 3RWHB 1OLZA 5F97E 4P04A 4DOHE 2CDFA 2XX0A 5LQBH 2ATKA 4IU3A 1S7UA 2B3IA 4ODXA 4K8RD 3ATEA 2WYTA 3EGSB 1JDDA 2GC7C 5KJRL 3GBEA 43C9A 4JGNA 2AQRA 2JQMA 2EDNA 4JFED 1U93A 4HP5A 1T0MB 2Y22A 1EXUA 4XRCA 4J3WA 5DEGB 2CHZA 3ATFA 2A9AA 4YSSA 1QKZL 4PJAE 3NA9H 2X9XA 2WLJA 2XKNA 3QZMA 3A6OA 1WBYA 4XNUL 3TO4C 4LQFL 2GC4C 4EI6B 2PYFB 3QXAB 4AEHH 3WY1A 1CCZA 2LABA 2QHRH 2X4SA 3QJXA 1TQBB 2ZOLA 1QVOA 5E9DA 4P49A 3S34L 4LPXA 3ECBB 3S37L 1W8OA 3TVMB 2H3KA 4A39A 4DGIL 4UNTA 2AANA 5JNYB 4ZUVB 1UT1A 1BAWA 1D7DA 3K1DA 1DUZB 1EGJL 3V6OE 4LCYB 2H1PL 4P23B 4NO5A 4BFNA 3H4HA 3B3IB 3QORB 5HYQB 5DURB 3KM2A 3KAAA 2WZ0A 5TTRA 5T5FL 4KQ4L 4YDIH 43CAB 2DMCA 2ZWNA 4KTEH 4RMVA 3KPPB 4BCYA 3T0ED 3D0LA 4M5YL 1YMHA 2MCPH 1GVIA 4Y1AB 1T1XB 2COVD 2ZNWA 3TIEA 1XCWA 4UOZA 1I3RB 1KCLA 4HKZA 1JTOA 1X5GA 1J8RA 1MFUA 3U4AA 5I23A 4QY8A 4TSBL 4XVJH 4OFQA 4G6JH 4Q14A 3FH7A 3JV0A 3QHFL 3ULVL 1EBAA 1NAMA 4HIJB 4KTEL 5KSAB 1CYXA 4OFVA 2O26U 2PWEA 2VZ1A 2PWGA 2ENPA 3QRBA 4G8EA 3LSOA 4ZMOA 1C9SA 2J5LB 2XWRA 1GOHA 3KPLA 5DUPH 4JMXA 3ALPA 3SN6N 3GRWH 3FFCA 1U95B 1MN4A 2V8LA 5E5UB 3ULUE 2IH8A 5F72S 4BXVA 3QIBA 2EEBA 3SDAA 4DSYA 3X11A 5DQDL 5MI0B 1F56A 4AVKA 3BLBA 2BVYA 2CKBB 4J3VA 3HZ3A 5EU3A 4EDXA 4L4VA 4QF1A 2ZUXA 4MNQE 1J11A 4X99A 4YNYA 4TNGA 1MI5D 5TQ0H 5C9JB 5HGHB 4JQVA 1WPCA 2AF2A 1LO3H 3L1FA 5LAXB 4X6CF 3MUUA 3MR9A 1CO1A 3EYQD 4O58L 4LFHG 3DURB 3H9SA 4DP9X 3NZ8A 4HKZB 1FZOB 3NRPA 5E6UB 3HRZC 4FG6D 1QSFA 4YHLH 1XT5A 5EBLB 1KJ2H 1B2WH 1T6WA 2GSMB 3MXWH 3MCLH 3T0DA 1MFEL 1A6WH 3ILEA 3H9SD 3KM1A 1KPRB 2MKWA 4RMTA 5AYUH 1FFTB 3S5LB 3PWPB 1NBZB 3W38A 3B3IA 3QORA 4OUOA 4IKIA 3FQUB 1T03L 3RVXC 2XV2A 1AHWA 3MO1B 3UPRA 2Z91A 1QASA 4O58H 4YUEH 2OTUB 1IB5A 3NG5A 4PTUA 3NBNA 4PLKD 5T3ZH 1WIUA 3QFJA 4OIIH 2VSMB 4YSTA 5HDOA 2YD0A 4WO4C 1D9KC 2X3AA 5DFVC 5ABAA 3QDJA 4Z23A 4Z78B 2YLHA 1S3RA 3PP3H 1DBKH 2Z8WC 4O2FA 1RZGA 2P26A 4F33B 3GSUA 1G7IB 1CFQB 2HWZH 3Q2NA 4KVCH 4N8CH 1A3QA 4OLYL 4NAJA 2X6VA 2AJVL 5AVTB 2VL4A 4AM0A 2BFGA 5I73B 1EHLL 1DQQB 3QDJE 3C12A 4QXUH 2NXYD 4HMCA 4ZO8A 5J57B 4CC0A 5F89A 2AQQA 3BDXA 1LE9A 2FCBA 4P4KD 4JDZA 1L7TH 4RMSA 2FT8A 1QWNA 2YUVA 3LRMA 2QFRA 5DD1H 4NP4L 4B96A 3D25B 4XVSH 3K0WA 2CDFB 4X0KA 1Z5YD 5CP3H 3F2LA 5LBSH 1ZHKB 1BWMA 2QQNL 2WQ8A 4X6EA 3U30C 2R7EA 2HWZL 2G9KA 4IHBA 5HI4D 2OV0A 3RVVC 1RK0A 1E8YA 3G6JE 4G6AC 4G43A 2AEPH 1C16B 3D39A 4H25A 4WSJA 3WL9A 3FB8B 5DD6A 5HYSA 2VC2H 4B53A 4X6BB 4CVUA 5KYUA 2BJML 1C8PA 1A47A 3T0EC 3A3YB 2A9NL 4Y4HD 4HWBA 4PJ8D 1IGTB 2YPLA 3QUYD 4E41B 1MHPL 3C5SB 3A6BL 2J7LA 4BH8B 1VPOH 3HHSB 1FVDA 3N1FC 1WC7B 4PJBA 4P2OA 3MOQA 3L9BA 2BH0A 1JK8B 3CHSA 3WN5A 4WEMB 5DMKA 4FEMA 5DTFB 3RPIB 2JIXB 1BXUA 3CPLA 5GS0H 2ZUVA 1MJ8H 1F4YH 3G5ZA 4KDTC 4PJ9B 4OZGE 1R3JB 4XI5C 1NMAH 2B2XH 4XAKD 4YXHH 3WFZA 2A99A 2W9DL 3GUTA 5HY9B 1NC4D 3OAYK 5DO2D 2XTJE 2IPTL 1L4IA 2X1PA 1A4KA 3VGBA 3BEVA 4EUPB 4G5ZL 1IC7L 4X98B 3MFFA 4JPIB 1D6VH 1AJ7H 4L3ED 3ZX1A 3EH1A 1ZVYA 2O6DA 4RAUB 1J1OH 4YXKH 3S3DB 4QRSB 4BZ1A 2JKWA 2VDML 3DJRA 1TKWB 3GMLA 3WOVA 3IE9A 1TJGL 3O9WB 2F5AL 3BAEH 5E2UH 3D3VE 3GKZA 1FNEA 3HZKB 3WHXA 4NGHL 2EDLA 1QLEB 4Y9GA 1NFDB 3QB7C 5E00B 3LKRB 4NFDA 4R26H 2MNJB 2ZAIA 4W9IC 1JNJA 3O2WH 4V2BA 4XGZB 3B5TA 1RK1B 4RIRB 5I1JL 3GMPB 2AV1B 4LBAA 2D7OA 4UCFA 3VFSA 2J6WA 4KHXL 1ZLVH 1E4JA 4XMPL 4HH9B 3HBGA 3GI8L 1ZPUA 3RFZC 3QEQA 3BH8A 5E5MB 2DYRB 3HHSA 1A66A 1BD2D 4UWQB 2DQIL 2ICWB 1EAOA 3RGBA 1JGVH 4OZIB 1NIAA 2H32B 5JYLA 3Q8AA 1UENA 3EJRA 4E9RA 5E2TH 4WV1B 1B88A 5JHDD 4JFWA 5C6TL 3EBGA 2NT1A 3EJYD 4ELKA 3VFTA 1N68A 2VJ8A 1BVKA 5JORB 1DVZA 2CBOA 2DTML 5I6KA 4NZRL 4GQPH 3L3DA 5DGQA 2XTSA 3F83A 5KYYA 2WXHA 3CZGA 4ZQTA 4Z8FH 4NN5B 4UQCA 4HALA 3US0A 1YYCA 3HRPA 3GKWH 2FQGA 3PL6C 3CLEL 5DYOB 5I0WA 5EEXA 4NHCH 5GGVY 4JO4H 1S7QB 2DYPA 2DQIH 4E9YA 5AL0A 4FQPA 3RWFA 4TS6A 5BQ7B 5HXMA 3T77A 3CFDB 1SDDB 3O6LL 1V7NH 2GJ6E 1G9NL 3MOBH 4H26A 2D0FA 4XP9H 5DRXA 4JRWA 1OAQL 4JRXE 5DRZA 4BBWA 5IBUB 3ZDYE 4AQEB 2CLZB 2OZNA 2P5WA 5AVZB 1K4DB 4CBZA 3AQDA 3O9WA 3ZPDA 4TTGA 3FCTA 4TTDC 2LFGA 1IAOA 2JCWA 3X13B 2ED7A 4TLSA 1WWAX 1ZV5A 3FSAA 5EU7C 3Q5YA 4D9LH 4YPGA 3K72B 3WE1A 4NNYA 3ZO0A 5FO9A 3DX4A 2WINB 5HSFA 1Y0LB 3VXSD 4KZDL 3HE7B 4WGVB 3S88H 2WLMA 4JN1L 5AKSA 4J2XA 1V7NL 1HOEA 2XIDA 3QARA 4RWYH 1ADQL 1SGKA 2YAQA 2VXVH 1YAIA 1Z5HA 2SEBB 5ENWA 5KVGL 1F1DA 2NMSA 2XPGB 3DIDA 3K2MC 5EOQH 3VFMB 3KYOA 1P4IH 2ZF9A 1SJHA 1KPRA 3U6XS 1YMMD 5GSVA 1NFIA 5L4JA 5KS9F 2A77L 2XG5B 1YN7B 4PS4H 3QZBA 3QI9C 4MD5B 4PRIE 1KNOB 4JZNA 4XO4A 1L0QA 3F7KA 1AZCA 3V4UL 5IFAL 2ZUQC 4YHML 3BSZH 3C09C 4H44C 3MRGB 1Z3GH 3L54A 5FF6A 5IMMA 3MJ9A 4A2LA 4LSUH 3ULUC 3ARDB 1DJGA 3WO4C 3VSVA 4FFZA 2E4TA 5CJQL 3RTLA 4KKBD 4XXCC 1QRKA 2VM3A 3HI5H 4FXKC 4KU1A 1TF4A 1GXEA 2A4CA 1T1ZA 4NM4L 2CPUA 4C56B 4OV5B 2E76C 1F58L 1BAFL 3D33A 4GRLB 2FJGB 1MJUH 2A73B 4J8QA 4QRTB 1JPEA 2XYBA 3FQ4A 5HHQB 4PBXA 5IF0B 1XXDC 3UL4A 5E4IA 2HKFH 1SM3L 4QGYA 1OAYL 2HT4D 3FUDA 3N40P 5AWNL 1OIOA 1VGEL 3KJ6L 4JDVA 5D7LA 5F7EL 3PIQA 5AEAA 3HS0C 2VDPH 3V4VH 4J3OG 3SDXE 1U41A 1SFHA 2OPCA 4TM9A 5B7EA 5TE7H 2IFGA 4LCCB 4IU2A 5IJVB 4P4KC 3A4AA 3C5ZA 1KY7A 3LKNB 4WFED 1KJMB 1LP9A 1MREH 5DJ6B 2B8OT 5FGCE 1EHKB 5FB8B 2WZPA 4E42A 2KPWA 2EEXA 1G0YR 1JCKA 4QTIH 5GJSL 2RGSA 2A9CA 4M1DH 4RGOL 4BFJA 1E90A 3P73B 4ZNEE 4PD4J 5AZEL 4E68A 3TCLB 4LMQI 3NFNB 2F53D 5I2IB 3KLAB 1SLUA 5TDOB 3P0VH 4FADA 4WTXA 3FULA 2HVBA 1R3IL 1JWUA 3IJYA 4K8RH 2DQ6A 2G75B 4NNPL 5SWSD 3RX8A 1U3YA 5IKCB 5F6IB 4Z18A 1F5WA 2UUDK 1HCYA 2YS4A 4QRUB 3S96A 4N0YL 2XOTA 3KHOA 3V0IA 1BQHG 5GRUH 4LESA 1SDYA 3M45A 2Q76B 3EH4B 5D6CB 5HHOD 1EHXA 3ROOB 4AQ1C 1OKEA 3GNML 4X4YB 2D31B 4KRPD 1TVBA 3OLEA 4H8WL 5K9JL 2ODIA 3INOA 4LHUD 3VFMA 1N7MH 1SXNA 2CIKA 2FVNA 1IJNA 3U4KA 3HNSL 4FF9A 4F2EA 5IEKB 2EUVA 3G6JF 5CMAB 1MVYA 4N1CA 3QFGA 1U58A 5DVKA 3OAYH 2IH3B 1FG2A 4Z7NB 3NRQA 5C71A 3EBIA 1RIHH 2DDQH 3BDBA 3KXFA 1EZLA 4HCGA 3WN5C 3KWWA 3QIBB 4HSQA 3B37A 4NUGL 2QQLL 3T2NH 4HKJA 4L1TA 4O2CB 1FV1A 4FHJA 1AIZA 1IIIA 1RJZA 5IB3A 2OYPA 1NUNB 3FQNA 1YEEL 1KPUB 1Q1PA 1LNUB 3QZOA 4OZGF 2CWRA 1NGQH 4FNLH 4HAFA 4AI7A 3TBTA 2WXPA 4A2EA 3NIDE 2KI6A 3EH2A 4QYOB 1TTCA 3VFPA 4NBXB 1Q0XL 3IGAA 4TVPL 3HB3C 4P9ML 4W6XB 3MV01 3REVA 5F3BB 3EG9A 4R90L 3CDGA 4DQAA 1IBHA 3ARYA 2DLEA 5HD8C 3WS3A 4JL1A 1NCTA 2Y36L 2ILLA 2IAMB 2PYED 3K5RA 3A67H 5ICUA 3ME0A 4X5XB 3IMWA 4F8OA 1TQBC 4PGEA 4H88H 4U1GB 2EXTA 5BZWB 4M6OH 4PS7A 5CHNA 4LK4A 5GRWA 4A7GF 3T6VA 1KJ3L 3BKJH 2RA1A 1YNKH 2ZG2A 2BERA 2IXQA 1SQ2N 3QQNA 4QHLA 1EO5A 3GXPA 2FE0A 2C9UA 4V1DB 2FJHA 4OCLC 3U46A 4RWHA 1SJXA 3P2BA 5D1ZC 1K5NB 4J4PD 5KG9A 4TPRH 4Y4HA 4YWGH 2FWLB 3Q3GB 4LLYB 4ZS6C 3HCVB 4ERSL 2XG5A 1MCPL 4HJ0D 5DZNA 1GCFA 3D6GA 4IIQA 3T6XA 5DMIL 1G7PA 5INCA 3CC5A 1DANT 2GTZA 1PLCA 3ASOB 3V0WL 1NCNA 4XBEL 1NGYB 3OWRA 2CA3A 4CSPA 3ARFD 4F2ME 3BH9B 2NCEA 5I5JA 4OM1H 1NZRA 1ONQA 5JW5A 1ZSHA 1VKXA 1T7WA 1S7UB 1UT9A 2CIIA 3KPSB 4KKCD 4PP2A 2NY1D 3V79C 1SOKA 3QO1A 4FP8L 4WHCA 3RFRA 4I4WA 3WTSA 2P44B 3HC4L 3UAJA 4DP6X 4WW2C 3RBGA 5CZRA 1XV8A 3ZR5A 3SY0A 1J9QA 1NBVL 2MH4A 3PGDA 4FE9A 3ZDZF 4CU8A 5GJTH 5K69A 4P05A 3MRBB 2IDFA 4JM4L 1UA6L 2OX5A 4JDTL 4P8QA 5I1IH 5EZIL 2XZAH 4MAYA 2G4GA 4NFBA 4JJOA 1MCOH 2E9GA 3SJVB 3IPFA 2WQRA 4AQ1A 4BRJA 3F7PC 4DGYL 3T08A 1ZV9A 3X1NA 4YHOH 4WFGE 1ETZB 2EDQA 1SXCA 3IXTA 3O6MH 5E6ID 5TD4A 4HJGB 4U6VH 2BHZA 3BFQG 5EU6B 1HWWA 3WE6A 3WMQA 2AW2A 1V3JA 5D1XB 2MCAA 4MA7H 1IAKB 4XNUH 1CFMA 3EGDB 4KROB 2JCCE 4NDMA 3VH8A 5BOJA 1D5XB 1JK8A 3TNNA 1YMMB 3IWUA 4ZMAT 3CTTA 4WEEA 2NSXA 5LHDA 3C5XA 1KLGA 1C08B 1U8IA 3VXMA 4LDOB 2WJ7A 3DX9A 4L2LA 5CINL 1CWVA 2P8MA 4OZIA 3VRJB 3TJEL 5EU6E 4EOWH 4ELMA 1AD9A 1EIBA 2C26A 4NRYB 3K4ZA 2ARJA 1YPZF 3CHPA 1IKFH 2J88L 4GS7C 4TULL 3RI5K 4ZFZB 3ZVVA 4EI0A 1HHHA 5HYFA 3NA9L 1C5BL 3L4XA 3HIZA 2GK2A 2B59B 1CBVL 35C8L 2VLLB 2HRGA 5F89B 1XAKA 3QUHA 4BDVA 3O4LA 1H6TA 1KIQB 4MQXC 2F7OA 2QTVA 2V0AA 3B7UX 3HPJB 2AQ3A 3VJ6A 3G6DH 4BCXA 4HAKA 2YJLA 3I02B 3QS3A 5DFVD 3G6AA 5BS0E 3N04A 4YLBA 4BXSV 1ZT1A 4JFDB 2L0DA 5FYLE 5EO0A 5CLWA 3FJTA 1WFNA 2HCZX 3HUJF 1HSBB 2V2WA 4L4TB 2P80D 4PB0H 1JSYA 1V27A 3FB5A 2FEJA 5F71A 3M1OA 5C09A 5T5NF 3ZU8A 1CBVH 2F15A 5I75C 1UOKA 2YFNA 5B1JC 3OKMB 1A6UL 1HCFX 2PETA 4RGND 4Z1PA 3GT6A 3MBEB 4LRNL 4CADB 1UKSA 1H3TA 3G6DL 3FCSA 3K7UA 2D4DA 1W8EA 5DJYB 3MREB 4DP2X 3IXAA 4OZ4A 5BJTB 4I2XA 5A2IH 1R5WA 3ZE2B 3TC9A 3EYUH 3OAUL 5FIEA 2BOBA 2FLRT 3VO0A 4U7SA 3RPBA 1DEEB 2VGLM 1ZDQA 3FFCE 3H56A 3BIKB 4X8JA 2GJJA 4UB0H 2R56H 2Y7QB 4LDEB 4H13C 1YEFH 4OF6A 5KS9A 1PLGL 1RZ8B 1IGTA 1SEBA 4JJ5A 2J57A 2Q2EB 4A63A 2YPVA 3BE1L 3GGWB 5CSGA 4L4VE 4A2HA 2Q7NA 1KPUA 3ZKMD 4WSKA 4G8FB 5D55A 1T1YB 2XTJB 2J3SA 4LOFA 5DF0A 3TJHC 3S97C 5TJWK 3B83A 3D9AL 2JTYA 4X4ME 4EIBA 5I75B 1E9OB 1JPGA 3JWNH 5I1DA 4OJAA 1LO3L 2C9PA 2JJTA 1S5HA 4P9HL 5A6IA 3JT2A 4I48B 3VX0A 1NSNL 5F1KC 4MX7B 4K5MA 1DBKL 4POYA 3C60D 1JV5B 5ITFA 8FABA 4EN3D 4J28A 1L3WA 4FFYH 3DK0A 4Q9CA 4ORZC 3OG6B 3R1GH 4AM0B 4BGLA 3KPOB 1U8QA 5G4NA 4HUXB 1FVEB 2QFPA 4OLYH 2OAAA 4HIPA 3O8XB 4H2AA 3D9AH 1S7VB 1NDTA 3VGAC 5JXEC 2BVTA 4XC1L 2XX1A 4GRWB 2AGJH 3OKEB 5DWUL 5J5EA 3CDFA 4Q2ZA 3RL1A 4KJQC 4HJ0C 1YSOA 2D9CA 4PJIB 1HZKA 1A14H 2H3XC 3FT2B 2UY6B 2ZJSL 3HPLA 3SD5A 3PUCA 5FDWA 4DT2A 4M5SA 4PJDF 3KEHA 3X12B 4PCYA 1SYSB 3ZKND 5D4IA 5JXAL 3T4AB 2Q10A 5DVMA 3UADA 4TSCH 4PYHA 5J56B 3OGCA 5ICXB 2Y1YA 5JQHC 1WHPA 3TVMA 1EMTH 3U4BL 3TBWB 2ZXEB 3F7YB 3S34H 3CFJB 2IAND 1UCTA 2J6EA 3I9PA 1N0XL 4Y16C 4ZS6D 4BZ2L 5AVWB 2DY2A 2Z31B 1FZOA 2DWSA 1DR9A 2LU7A 4QXUL 4HS6A 3L3OA 2WO2B 3EJYC 4RAVB 4ZS7L 3QXAA 3PJSB 2ODHA 1HWHB 3PNWB 4LCCA 3UIYA 1I1FA 3IJEB 3G5XA 1PZ5A 4PSRA 1MZYA 1BDYA 4EI5C 1BX2B 3MBWA 4BZYA 4O02L 4UNVA 2YPLD 3QUYA 4UINH 3SEPA 2QKIB 2W38A 4M43L 3ZDYB 1PLAA 2AEPL 4BJLA 1PFCA 2X89A 4HULB 1NOFA 1FFNB 1CL7H 2BLFA 2C7UB 1VEOA 4HDIB 4ZAKA 4RETB 4EZMA 3TYGL 1X4XA 2W0PA 4Q74A 1R9FA 4ZS7H 5I16B 2ADJA 1XIWC 4LARH 1YYLL 1TO4A 1VPOL 2LQRA 1QRND 4DVBB 1U8CA 4NQDA 2UY7A 4HBCH 4OTXL 1H9DA 3HAEH 1RH8A 5B38A 5I6LA 4HEPG 3QR2A 1DO6A 5HYIA 1EDQA 2BP0B 1NLDL 1CLZH 1ZA3B 5IMMB 3T0EB 1LO2H 4LEXL 3R0NA 2X28A 1LK2A 1SMOA 3EZ8A 1ZANH 1UYWH 3L9EA 1DZBA 5KSAC 2DQUH 3ARGB 4CVXB 2W65B 1XIWD 3TO4A 4C57C 4BQ8A 3E1F1 2VLKD 3B1TA 2DMBA 5JHLH 3LV3A 5D96C 5GSVB 1I8KB 4IHOA 1RAMA 5GSRB 4FTVE 2LOEA 2UYLB 2ZCHL 2RQ8A 3M8OL 5I71C 4HWUA 1HFUA 4KUCD 4NLHA 3NSXA 3VH8G 3TP4A 3U36A 5C07E 4KXZH 4UT6L 3QG7L 2CK0H 1L7IH 3WENA 4QPEA 4MCYA 4K7PH 4HOZA 1U3NA 3GLAA 1T4WA 3CDYA 4NSKA 3PU7A 4H0LC 4YR6B 3K72A 4G8IB 3CFEA 4ZD3L 5BV7H 3PGFH 2JCCF 3HA0A 1NM4A 2EIKB 2ZX8A 4NJAH 3K6IA 5A40E 1XSOA 1P6WA 1BOGB 2OL3B 3O2DA 4WJKB 4DKFL 4EI6A 1MH5B 6FABH 1A2YB 4J4PA 3GKWL 3WJMB 4CKVX 5FO7B 3F84A 4N2NA 3II2A 1UJ3C 4HJTA 1T03H 3MJ9L 2VZ3A 5DRXB 3FO2B 4X4KA 4FNTA 1TU2B 2ZOUA 5F7YC 5IESL 3U0WL 2R15A 2X4RB 5AB9A 1A9BB 4JM2F 4TUJA 1KTCA 4LPTA 4K23L 5AVYB 3BUBA 1YUHA 4HIIB 4UT9H 4WUUD 4ADGA 5IJBC 5SWZA 2WQVA 4N8CL 4CRPA 1ZD6A 4QI3A 4X5PA 4FJ6A 4JFDD 3F00A 4Z7QE 2WVSA 2K4WA 3SHSA 2C1OB 4NX0A 2BC4A 4P5RA 3VXRB 3DXAA 1BVKB 1FYTA 2WZAA 3SYOA 3PWUA 2QGCA 4KZDH 2DPKA 3NJIA 3GMQA 3P2DA 3G5WA 3BWSA 4Q0XH 4XCNA 5H37G 4P57A 5E56A 3BZFB 3HR5A 3DHPA 4V1DD 4HUUB 3MRFA 1DDHA 2GJZB 3OSKA 3T3PF 1CLCA 2ZUUA 1O0VA 4DZBA 4P2CG 4OF0A 4QRQA 4DO6A 1PTZA 2OP4H 4AVIA 4NQCA 3WNNA 2Z8VC 3GMNB 1R5VB 3TURA 4OU3A 2OJZL 5L2KE 4XPTL 2CMRH 1KJ2A 4PWFA 3L3GB 4OZFA 4GQRA 2IH1A 3UZVA 1I53A 2ROYA 1OXYA 2IBZX 2R0WH 3MJWA 5CCGE 3FAXA 3LNIA 4QXWA 2HTKC 3RGVA 2BVPA 3VU1A 4BA0A 1VEMA 3FOMA 3VA6A 4DEPB 4MBOA 3OXSA 4D9QD 2M2DA 1AGCB 2AABL 4TNEA 1NEZG 4IIZA 5INDB 1MJ8L 1MCWM 2OJZH 2GIXA 2FD6L 5KBDA 2W0LA 3O11B 1PGRB 2I9LB 1JFQH 1BQ5A 4N4YB 5FO8A 1WBXA 3CH1A 1T66C 5DD5H 4R97C 2AQ2A 5PAZA 1MQKL 4K94C 2P8LA 3MRDB 4S2SA 1JK9A 2HJKB 1NUFA 4PLJC 5JO5A 1I7UB 3PWPE 3QRGL 1FL3B 4W9GC 1N12A 3U83A 2PTUA 2JJTC 5G4OA 4DTGH 4ZX4A 2K9FB 3KD4A 2XXCB 2X0WA 1FZMA 1OCRB 4ALAH 3N44F 4EXKA 2J1KA 2JXMA 2X70B 4M4RB 1U3JA 4UIMB 4P2OD 1QATA 4J3UA 3KYAA 3LIUA 3GEWB 1MJUL 2NY2C 4LEEA 1M3IA 3DHMA 2XN1A 5JW4R 4DK6A 3SDYL 1KEMH 4B6ZA 4KHTL 3FUHA 5J9PB 3QDGE 2DQGL 4YBQC 3VXPA 4H20L 1MDTA 1VA9A 4KXDA 1UOLA 5BRPA 4QOKB 3V4VA 2Z4QA 3C6LB 5D96B 3FB6A 2WO4A 4WK2B 3SKMB 2HA1A 3NJJA 1MAMH 4J3OF 4N5UA 4QRRE 5EG6C 1YEIH 2OXGA 3S35X 2HX7A 3QXDB 2OSYA 2CM5A 3FTYA 4NT6B 2OSLB 2XBZA 4M9PA 2ATPB 2PTVA 1E2WA 1GAFL 5B3NA 4N8VB 4OFKA 2D2OA 1R24A 2YEQA 4HJUA 4X7SH 5CU9A 4H20H 5INDA 3FUKA 2DQHL 3ZTNH 1NWPA 4Q9BA 4K2UH 4F7EB 2GTWA 2XQYG 1EJFA 3COOA 3P0VL 3PHAA 2J2ZB 4JO4L 4PHZA 1EANA 1S7WB 3TCXA 4QUOA 1IM9B 4NQXB 3EF7A 2AVFA 2APWA 3KPMB 3H3KA 3U36B 3MOBL 4OZFB 1QABA 3JTSA 3GI9H 5D1XD 3CLFL 2VDQL 3CX5K 3DIFB 1PPIA 1VGKA 3DVIA 2O4EA 2H3NA 4NHUB 3CZNA 3KNBB 2GKIA 3C6SB 3F6IA 5EU4A 4MAYC 1U91B 3O3AA 4JO1L 1HHIA 1UWEH 4EI5B 4NKQB 1JV2A 4W9HC 4P2QE 2OMUB 4MMZA 4N25A 2CHNA 2P5WD 1R4XA 1TLKA 3L48A 3D3VA 4QCIB 3E3QE 1OF0A 1X6LA 1RVFH 4UDUA 2OYLA 1FNSL 3PV6B 4M8QA 1IE5A 3GMQB 4LL1A 1FC2D 4NQTA 3M1BA 5A2BA 1RIHL 3PWJA 4K4KA 2ESVE 4NUJB 2Y36H 4OZGB 1DBAH 3O6FA 3PDGA 3EYFB 3AB0C 4C56D 4Q4EA 3KPNB 1ILUA 3HMXH 4L4VB 2AEOA 3IFLH 4BH7B 5CCKH 4LLVB 4F7PA 4EBQH 4RFNB 4HCRH 5EN2B 1HIML 3S7GA 5KUMA 4E0RA 3FT3A 5TDPA 1DLHB 1BLNA 2ITEA 3QXUA 1EXGA 2X88A 4HWNA 5EUKB 4PRPE 4W6WB 4JFEE 1LVEA 2EIDA 3T6ZA 3G7TA 1NCBH 4N0UA 3RDTD 2Z3FA 4ONHA 1EHAA 1I4FB 3OHMB 2NZIA 4B3EA 2A6KB 1TQSA 4BQ9A 1WAPA 3WGVB 4EZLA 3T65B 2R29A 5JLZA 2XUWA 2UZIH 5F96L 4YEFA 4OCRH 5F1SA 4KUZH 4ODWB 3UIZA 4WEBL 4MCZB 4EBQL 1ZA6B 5DCCA 1DQML 5KBKA 2BNQB 2DKMA 1FF5A 4N2IA 4XHQA 5CJBA 3O9WC 2CXKA 1I7TB 1RURL 4IRSB 4BCZA 1N6VA 5FCUL 4HS8L 4P2RB 3N9GH 1NCJA 1U8OA 3U48A 2QV2A 3NAAL 1J5OL 2R9HC 4ANUA 2XG4A 4GLRI 3AXIA 3BZEB 1XSIA 3GYRA 5F1IA 43CAA 4Y2DA 1VADA 5I0DA 5DJDB 1I82A 4YVUA 4ZFOA 3DXAD 1I9RL 4G9DB 2AJYL 3FT2A 3ZJAA 5BCAA 3QG6A 2OK0L 4PG9A 3PQYA 4PW9A 5HHOB 2WWKT 3RGVD 1T5XB 4D8PB 3ARBA 4P46A 4KKRA 2YQGA 2Y5TA 4F80A 4AMWA 4AGNA 3CZJA 4JZJA 4Y9CA 1N6UA 2MMXA 2Z64C 3IMRA 1AH1A 2X12A 2XN9D 3CHOA 3PQYB 2DWDA 3LNFA 5FA4A 4KV5E 3X14A 1WBYB 5HPMB 1HI6B 3O45B 1RK7A 2E86A 4B50A 2VLMD 2YLKA 3BSZA 4P48A 3PREA 1QNIA 2V7HA 3BZEA 3JWOL 4DO5A 4HQQH 2XV6B 5DS8B 1QP1A 4OZHB 5IEHB 4AEHL 3AACA 5D1QD 5LLIC 1JBJA 4NC1C 2BWQA 2A6JA 3FU6A 5D7LD 4KTDH 5GJTL 2KDGA 5EUKA 4EN3B 4Z3JA 1CIUA 1UOWA 4HF5L 5K39A 2KKQA 3ZYIA 2X7LB 1MKFA 2VXTL 3P0YH 4RGNC 1EQWA 4DIXA 2EO7A 1DLFL 2EDTA 3BT2H 4E9XA 5H4ZA 1KB3A 3NCJH 5FYJL 1UHVA 4KXCA 1N0LB 5E8DL 3HBQA 3UP6A 4Z7VE 4YAQB 4B27A 4HS6B 4IRZL 4FQIH 2JFCA 4RAVA 5T3XL 4ZZFA 2A74B 5C6WH 4X8JB 2IAMD 5IM7A 4R97B 4TQIA 5GS0C 2PWDA 1PAMA 2ED9A 2UZYB 3C5ZC 2EJ1A 4TN9A 4Z3TA 3FHQA 3IDJB 1AQKL 1R5WB 3VTTA 2E47A 2ENYA 4F2FA 3EJCA 3TBVA 4NHUA 2B1AH 1UXMA 3DTUB 4R7DA 1MCHA 4JAMA 1P7KB 3FN0H 4U0QB 5B8CA 1JHKH 3BMWA 4LHUB 1SUJA 8CGTA 4L9DA 1G7QA 4N2MA 3UO1L 4BSVA 3AZUA 5FM5O 2ROXA 2DWDB 1GCYA 2DJ4A 1I1YA 2LAGB 1DQVA 3VI4F 2ICEB 1TFPA 2HB0A 1GS8A 3LIZL 4BUQA 1J1XL 3WXWH 1U2YA 3CAFA 3SYQA 4OCSH 3ZUNC 4PJ7A 1QFWI 4OLWL 5TPWL 4ODSL 4FYTA 2YXWA 1CD8A 4N5EC 1NLBL 4LASL 2PXYD 4XXDA 3QDJD 3D50A 4NNXA 3RZCA 4LOVA 1CDCA 4HK0A 1QX1A 5LDSA 2D73A 4HHWA 5DU7A 5BMFH 3L95A 3BISA 3GTTA 2XWJB 2EYSB 3UDWC 1NCGA 3P3UA 1E9OA 1JPGB 2XXGA 2NY1C 4KNTA 4DKDC 1DE4B 4YWGL 4MA1B 5HGAA 3BKCH 2NUTA 3FFDA 4MA8L 3RVWC 3S36H 1QLEL 1T83A 3ARZA 1GZQA 4A2GA 2GG1A 3SE9L 4GRMA 5IV2B 5D6DC 1I9IH 4ISVA 4WCYL 1TYEB 2A6IA 3AG3B 3ARGD 1OWRM 5T1LA 4NKOA 1RSFA 5F3HA 4YZWA 3IAGC 3NCYS 1PLBA 3SPIA 3HNVL 2XVKA 5HHPA 1JHTB 5T1KD 4ZI8A 2UWEF 3IDMA 2CBPA 3CZEA 1I1AD 3FTXA 4NQDE 3QZWB 4HZLB 4LOUC 1JPSL 2VDNL 1U8LA 4ZXBA 5A1AA 2LHAA 1XCTB 3DPBB 3V5KA 1LDPH 4Y5YC 3AB0B 1CU4H 3GJEA 2WB7A 3ATAA 5GS1B 1RY7B 4KO5A 1T2QH 4YSRA 3RG1C 5C6PB 2GVYA 3H1ZA 4HK3N 3DRTA 2V2TB 4BKTC 5GRJL 2I9LA 5F6HI 2VWEE 4ISVB 1OQXA 4PRDA 3KEDA 3O6ML 3SQOL 2OMXB 1GZQB 1Z9NA 3OXSB 3CFCL 2F7IA 5L8JB 3VXQA 1EUUA 1NFAA 4GFTB 3IDXH 3FQXA 4XHJD 3GMMB 5D7SH 3N1QC 1CTNA 3BH9A 1P6AB 5BRZE 4M5YH 4TUKL 4O02B 1PQZB 5I1LB 5HVHC 4LSSH 4AJ0A 3RWEB 2FB4H 2YD2A 4HGWA 5EEYA 1XD0A 1I8LC 2H0FA 4KQ3H 1AO7A 1JZ8A 3WTTA 2WHVA 1P53A 2MOGA 4N9GA 5FUCC 3S8GB 2B5IB 3POHA 2C9XA 3OKKA 3GZPA 3T3PE 3BWUC 4GO9A 2XTJC 1X5JA 2MTPA 2FYYA 4WRLA 1N5AB 1ECZA 2OYKA 1A1OA 5ESVA 4QHNA 3AQXA 4Z5RB 1UM4L 3EO1B 1F4YL 5FM5M 1QRNA 1XGRA 1CL7L 3DETD 2ID5A 3D07A 3JV4A 2EE0A 3MLYH 4KQ3L 4GQQA 1O6SA 4JAMB 2Q7YA 4E9WA 1XFPA 4M1CD 3GB7A 3FTUA 3KCWA 2TRYA 1YYLH 1A7PL 1ASOA 4MJID 1TJXA 2VW7A 1T3FB 4X0NA 1UCBH 1MVUA 4LKXB 5D1XA 2ORBH 2UZYA 1TITA 5HHXH 4TUJB 3IE4A 4N0CC 1J8HB 2WYHA 1C5CL 2GJ6D 3BPLC 4WVRA 4UV7H 4RH4A 5L4IA 4JRXD 2BSTB 3S98A 3GF8A 1E40A 1AC6A 4LSVL 4AM0Q 5FECB 4PJCA 2PNDA 4LE8A 2V9TA 3K6SB 3VA2C 4MZRA 4FXTA 4XZUA 4J3TA 15C8H 2BVOA 3DOSA 4DUVA 3QEUA 2CHDA 1I8LA 1R3KA 3DK2A 5J13C 2IDQA 3TM6A 1CFTB 1XGZA 2O61B 1OW0C 2J21A 4WEUD 5C0GA 3QI9D 2K7PA 4OKVB 5D1QA 4I4WB 2YWYA 5JHMA 3U9UB 3SJVD 4DZ8A 4HIIA 4TUOA 1JXDA 1W8NA 3GPSA 3MLZH 5DZOA 1RZ7L 3BWAA 1J8HE 2DLIA 1W16A 2APTA 4JGUA 4JRYE 1FIEA 1JGVL 1BFOB 2MOVA 2Q0ZX 4NO2A 1MI5A 5CZXC 1QBAA 5ICYB 1R0AL 5FO7A 2EC9T 4YHZH 3QNYA 5JZ7C 2VTFA 4EPSA 3APMA 3X14B 2HVJB 3ASWA 3QWRD 1E28B 4DKTA 4YK4C 2ZWZA 2MPAH 4WFFD 2MHAB 2C9SA 5JXED 3FTGA 1XAUA 4POZC 2BSRA 2WLLB 1XMWA 4JHAL 2X6AA 1IO4C 2WLIB 1BF5A 1EEYB 3EKCA 4NSKB 4YR6A 5L4FA 2R69H 1FNGB 2NYYD 3RTQC 1FVCB 3LZPA 1SUHA 2JCCB 4FQ1L 1GC1H 3HG1D 1L7IL 1KENL 2CR6A 1NGPL 3KS0H 4XP9L 5CFAA 4NAQA 5IVXF 3QQ4A 4PJ5A 3BKMH 1LMKA 4FC3E 5GSRA 3K2UL 4LBEA 3UAEA 5F9OL 3PHQA 4M5TA 4N3UA 3ZQ9A 2WUBL 3GSNH 3SBPA 4XPGH 1VERA 3M7OA 5DVPA 1REIA 5CILL 5HI4C 1G4MA 6TAAA 4LLQA 4MCZA 2ZJSH 4U1MA 1YG9A 2EDWA 2FJSA 4GBXA 4I2XE 2XN2A 2A4EA 1JVLA 3AS0A 2NY7L 2Q86A 3BKML 2FGZA 2V8MA 3PHOA 4DP4X 1ES0A 2CO7A 3I6SA 2C4FT 2EDYA 3WKQA 4N0UB 4UAOC 3D8MA 3NN8A 5EZJA 2DJMA 1QEXA 1AIFA 3HB3D 1DN0A 4DN4L 1X44A 1FFNA 2Y1VA 1KGCD 1O9WA 3W2DL 4X6DA 3TLRA 3JWDL 4LLMA 3CN4A 4L8SC 4P3CH 4PJHB 4I18A 2IMNA 3STBA 2ZOKB 3TA3B 5ITBH 5IVNA 1SJEB 2Z4TA 4FULA 4GW4B 4D0BB 5F0MB 1CS6A 1QACA 5IW6A 3A4FA 2CDEA 3L3HB 1HCZA 5AL8A 2Y0SA 4WJ5B 5DURD 3SGDI 2TRHA 2OP4L 1J5HA 2FD6H 3PWVA 1EO7A 3FU7A 4MNHB 2IADB 2XIIA 4X4YA 3OKNB 4J2QA 4NKIL 1CTMA 1KCUL 2Q76A 4ZSOE 2AKRA 5EOCH 1MNUH 4JFYB 3UZEA 3ZL4L 4LSDA 4KY1H 1T83C 4OB5L 3DJ9A 1F90L 3JYBA 2FIKB 5JOEA 4Z7UF 5I15H 3ZE0E 3OGCB 4ZBJA 1NL0L 2DD8H 2NY2B 1EBPA 4ZXBD 1KN4H 1LEGA 1BVZA 3T09A 3MU3A 2BNUA 1BQLL 1MVFA 2PPDA 2Y2WA 1NBCA 3ARSA 4OD1H 5DHYA 1XH3A 3X12A 4ALAL 2UYLA 1ZJBA 1OGAD 3K71A 5CN2A 1ZGLA 4I3SL 4NS0A 2NXZB 4G3YH 3TEUA 4LNRA 3BVVA 5C6TH 3CXDL 4OT1H 2NNRA 2EUWA 4F20A 3QK0A 2C3HA 4JFFB 1J05B 5AAPA 3W9EA 2XWTB 2RMNA 4KOCA 1YEDA 1IBZA 2LVCA 1NL0H 1A22B 2WQXA 1QO3B 4ESKA 1FRGL 3BGAA 1OSZA 1DBBH 4R7NB 3RFZB 1NKGA 3P77A 1EJOL 2OYMA 3F85A 3FU5A 4N5ED 2BK8A 3UTSB 3MGTB 3LH2L 3TJHD 3R7QA 5JYMA 5IBTL 4PTTB 1DL7H 3DX0A 4PLNC 5IHHA 1P2CB 2G9HA 5GRYA 2EAEA 3FXIC 1U8PA 2G3XA 4G8GD 2BWDA 4OT1L 3SDXF 3P4NA 2VKXA 2BOBB 1D5IH 2ZCLH 2ALWA 2IFFH 1ZPLA 3NCBB 4FJYA 5LKNA 4Y16D 1LO4L 3L16A 3STZB 1MHHA 4K7PY 2DTMH 3MHZA 1G6RL 5GISH 4IKKA 3Q6FB 3IF1A 1BX2A 3KVQA 3MBWB 4G8GA 3CSBA 1G7LA 2YN3A 3LRGA 4BSJA 4WV1A 2D8KA 4TNWF 1L9SA 3O3BB 3H3BC 2VR8A 1FH5L 3E80A 3L9RA 1RCYA 5CO1A 1URIA 4YFEA 1JL8A 4DKEH 3VGEA 1A9EA 2R23A 4Q6KA 1DEEA 4Q9RL 4FEIA 4MD5A 4QTFA 2ITFA 2BDNH 5EO0B 3TBSB 3IU3A 4RIRA 5GZNA 1S9WB 5K9KB 1S7TA 4HLJA 2CBMA 4U3HA 3GK8L 2AEQL 2PABA 1BZ7B 4JLRA 4AXWA 3DGDA 4JHUA 1HN1A 2B20A 4BDVB 3HZKA 3WHXB 3CUPA 5E08H 1CYWA 1SOQA 1BXXA 5CU5A 1WWBX 4UOJA 2YRZA 5EF3A 1KF9B 2WNGA 1CBJA 3VDCA 1VB9A 2GUOB 3Q1SH 4YDVB 2FEEI 3F7LA 1T1WA 2ESVB 1DBMH 4ABVA 2B5IC 1T7VA 3T5WA 3ZRCC 1JF1B 2V2WB 4J3OD 1MFBH 4L4TA 4O4YH 3HMXL 3LMJH 4JPIA 4NRZB 4OLZL 4XOCA 3STLB 3RIAK 3A67L 1N59A 1UADC 5F0PB 1BYOA 4U2ZA 5AB1A 4ODBD 1MRCL 1I7ZA 1I1RA 2Y1AA 4BK5C 5CEXA 3GUTB 1FJ1B 3VXRD 4ZK8A 1PBYA 4J6RL 1KIQA 5EV7A 5C2UB 5ITFB 2OJEB 4L4TE 3VE0B 3WY2A 5JUEL 2BW4A 1YMMA 2DEYX 4GXUN 5HJDA 4Y9BA 1DQLL 3EGDA 1KIUA 5B1KA 1YJDC 5IQ9B 4OLVH 2V7NB 4DK3A 3NIGE 4YH6A 3LS4H 4HJGA 5EU6A 1W91A 2J71A 4P2OB 5E99L 4AYGA 4OD2B 1LE5A 1PKQE 2VMDA 3E8VA 1N4XH 4XX5A 3U1QA 3HKFA 4KVNH 4NKDB 2WCSA 3CVDA 3HBZA 5DMIH 1RURH 4PWJA 1KLGB 3HOGA 3ES6A 1SEBB 3UMNA 3IDYC 1JZ2A 3M88A 4R5VA 3C8HA 1NCDL 3I84A 1M6UA 2R69A 4WKZB 3U0TA 5B8CC 2BOLA 3R4RA 2Z65C 3HN8A 1Z9LA 4LVNB 5JPNC 1HC1A 3QQ3A 3QJOA 3ZDXF 2YMOA 2CIIB 3KPSA 1A7BA 2VDKH 2NW2B 3E8UH 2F53A 1LXMA 4U7KA 3IXTB 2X4UB 4U1HA 1YEJH 5E1QA 4AJWA 3BP6A 5AG9A 4AC4A 4A2FA 3UTPD 1C7SA 4B9PA 1BGXL 5F9WB 1MUJA 1BMGA 1SXBA 3S48A 3DWTA 3BH4A 4PS8A 4AENB 4LCWA 2CO6A 5HGBA 5CUSL 1A1NA 5J1TC 3RU8L 1JXGA 1S2EA 2IPKA 3GSNB 4H8WH 5FCUH 1E5YA 3UTOA 5B3SB 3LXBA 3VUAA 1CFQA 3MQIA 1NWOA 2ICES 5IQLA 3EDEA 3KPRE 2NY4C 4HJJL 4KKZA 4Y4HB 2YR3A 2RR3A 4AW4A 2ZKHH 1AZNA 4R6UA 4N2DA 1AXSB 3IGUA 3IMTA 4G6KH 2DDQL 4HJ1A 2HLEB 2Z91B 4YHPB 1MCKA 4PJHF 1CPUA 2MPVA 4R7VA 4HXAH