2IH9A

A high-dose crystal structure of a recombinant melanocarbus albomyces laccase
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
559
structure length
559
Chain Sequence
EPTCNTPSNRACWSDGFDINTDYEVSTPDTGVTQSYVFNLTEVDNWMGPDGVVKEKVMLINGNIMGPNIVANWGDTVEVTVINNLVTNGTSIHWHGIHQKDTNLHDGANGVTECPIPPKGGQRTYRWRARQYGTSWYHSHFSAQYGNGVVGTIQINGPASLPYDIDLGVFPITDYYYRAADDLVHFTQNNAPPFSDNVLINGTAVNPNTGEGQYANVTLTPGKRHRLRILNTSTENHFQVSLVNHTMTVIAADMVPVNAMTVDSLFLAVGQRYDVVIDASRAPDNYWFNVTFGGQAACGGSLNPHPAAIFHYAGAPGGLPTDEGTPPVDHQCLDTLDVRPVVPRSVPVNSFVKRPDNTLPVALDLTGTPLFVWKVNGSDINVDWGKPIIDYILTGNTSYPVSDNIVQVDAVDQWTYWLIENDPEGPFSLPHPMHLHGHDFLVLGRSPDVPAASQQRFVFDPAVDLARLNGDNPPRRDTTMLPAGGWLLLAFRTDNPGAWLFHCHIAWHVSGGLSVDFLERPADLRQRISQEDEDDFNRVCDEWRAYWPTNPYPKIDSGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Laccase-1
publication title A crystallographic and spectroscopic study on the effect of X-ray radiation on the crystal structure of Melanocarpus albomyces laccase.
pubmed doi rcsb
source organism Melanocarpus albomyces
molecule tags Oxidoreductase
total genus 179
structure length 559
sequence length 559
chains with identical sequence B
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2006-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ih9A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ih9A02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ih9A03
1L9PA 5I5IA 3S3DB 2UXGA 3FSAA 1IUZA 4A2DA 4DPCX 2YARA 2ZOOA 3TBBA 4GYBA 1E65A 2R7EA 1CC3A 4N4YB 2PPFA 3X2QB 2IAAC 1NPNA 3WNJA 2VMJA 3PCYA 1ET7A 2GI0A 4UANA 2GSMB 2BW4A 1NWOA 8PAZA 3CVBA 1BXVA 1PZCA 4YSPA 3QJRB 1WS7A 1WA1X 1XMEB 4EF3A 2B08A 4E9VA 5B7EA 1KDIA 2BP8A 2AANA 3OD3A 1A65A 4HCIA 1AZNA 2H5UA 1OE2A 1N70A 1XB8A 3AG2B 6PAZA 4G70B 2J57A 2UXFA 3WI9A 3NP3A 2IDFA 2EILB 1V55B 4Q89A 4AZUA 5E9NA 4TXVB 1BQKA 4PAZA 3NJJA 2HXAA 1M56B 1ZIAA 1NIFA 4P5SA 4DPAX 1JXGA 4GP5B 1ASOA 2XVBA 2NRDA 4WKXA 3T6ZA 3UACA 2OCCB 2YAPA 3ABKB 2J56A 2CJ3A 4HIPA 4BDVB 3QJSB 5TK4A 4A66A 4NERA 7PAZA 3NJHA 2OV0A 7PCYA 2IWEA 1PMYA 1TKWA 1BQ5A 1XB3A 1FA4A 2CCWA 2DWTA 4YVUA 2QPDB 2PP9A 2XXGA 1WA2X 4A2GA 2N0MA 3JT2A 1A4AA 2YAMA 2WSDA 3TA4D 4Q8BA 3NSCA 4HCGA 2JKWA 2AFNA 3NJIA 1B3IA 5D4JA 1J9SA 1J9RA 2YQBA 3V9CA 1PZBA 4JHVA 4BDVA 4K9JA 2BHFA 3FSVA 2MRYA 3FU9A 2XWZA 3QJVB 1EZLA 4YSOA 3GXUB 4W9ZA 3ZX1A 1AQ8A 2FJSA 1EHKB 1JZHA 3CVDA 4N8UA 1NTDA 4KO6A 1NIAA 4CSZA 1OCZB 1WAEA 4AI7A 1X9UA 5B1BB 2VSKB 3H4FA 3AG4B 3GDCA 5I6PA 3G5WA 5B7FA 4YL4A 3ZDWA 1OOWA 1IC0A 1J5DA 3AG3B 5AFAA 2BWDA 1L9SA 4JHUA 4YSDA 2DYRB 5I6LA 4W1TA 3S3BB 1AS7A 1OCOB 2HX9A 3TASA 1RCYA 2DV6A 2FQGA 1CUOA 1SF3A 1KBWA 3NSDA 3AW5A 2CAKA 2XX0A 5B1JA 2W8CA 1PNDA 2XLLA 1V54B 3FQ2A 4HZ1A 3EH3B 1GR7A 1UATA 5EHFA 4HAKA 1PLAA 3BQVA 5D4HA 1FFTB 2FT7A 3NJKA 3S8FB 2ZWNA 3FYEB 1VLXA 2XV3A 2WO2B 1AR1B 2FNWA 3CDZB 3FS9A 2PP8A 2IH8A 1ILUA 1AANA 2XXFA 2YAQA 1BXAA 1ZPUA 2CUAA 2UXVA 4E9WA 1JOIA 3ABLB 3ERXA 1PY0A 4L0PB 4YSUA 4BXVA 2YXVA 1JZFA 3WG7B 3PAUA 3ASNB 1WA0X 4NB7A 2HRGA 2AVFA 3FPXA 1NIEA 3PXLA 1JERA 1A3ZA 4HHGA 3ZBMA 3NJNA 1OF0A 1ZDQA 3ABMB 3AG1B 4A2HA 2XU9A 2XV0A 3T6XA 3UAEA 1GS6X 3CDZA 1PNCA 2B3IA 3X1EA 2Y1AA 1NPJA 5AKRA 1SF5A 1ZV2A 1AOZA 1A8ZA 1CYWA 3DKHA 2XUWA 1CURA 3QPKA 2FTAA 1TU2A 4DP7X 4YVNA 1TEFA 1FWXA 1GS7A 4BWUA 1AZRA 4KO7A 4F2EA 1ZDSA 1MZZA 4E9XA 3IN2A 2AZAA 3WKQA 3OMAB 3CVCA 3N2JA 1KCWA 1A4CA 2YAEA 2AZUA 4JKNA 3QJUB 1QNIA 3NP4A 3V9EA 1J9TA 2BWIA 5B3SB 1F56A 4DP0X 4YSEA 1SNRA 3EH4B 3X1GA 4BWWA 4AKPA 1M57B 1NICA 2RACA 5B1AB 2HLEB 3X1FA 2UX7A 5I6KA 3RYMA 5B1JC 1M9WA 1MG2C 2GC7C 2PPDA 1BYPA 3KW8A 1JXDA 2PCYA 4GY4A 1BQRA 2IH9A 3UGEA 1V10A 2ZONA 3N55A 4WTQA 2MTAA 2EIMB 1AACA 2CALA 2GBAA 3FU7B 4P5RA 2QDVA 2VM4A 1QLEB 1GSKA 2BP0B 3L45A 4QLWA 3SBQA 1DZ0A 2A3TA 3KW7A 4DP6X 3QJQB 2E86A 1PLCA 5AZUA 2FT6A 1OCCB 1JVOA 1GY1A 3UADA 1SHXA 4UF7C 5I28A 2PPAA 4YSTA 1ADWA 3IN0A 4MFHA 4DP4X 5TK2A 2CBPA 5FC9A 1CYXA 1JZJA 4YSRA 3SBRA 3T9WA 2FQFA 4F7KA 1AS8A 2EIJB 1NINA 4ENZA 3EHBB 1W8EA 5I5JA 9PCYA 1RKRA 3FU7A 2GB2A 3JTBA 3NJFA 2VW7A 2BP0A 5PAZA 1OE1A 1AZBA 1E5YA 3PLYA 1SHWA 1ET8A 3PAZA 3CG8A 3DIVA 2YAFA 3X1BA 2VSMB 3OMNB 1KV7A 3FU8A 1BEXA 4G72B 2PCFA 2YXWA 2HZHA 1X9RA 2QPEB 2IDQA 2VM3A 5D4IA 3UAAA 1PLBA 5I6MA 4G7SB 1L9TA 3FT0A 4HHWA 4F2FA 1J5CA 4YSSA 3NJGA 1AZUA 1KCBA 1W6LA 3OMIB 1PZAA 4GP8B 2FWLB 1N68A 1SFDA 2XV2A 5PCYA 3UABA 1ASQA 2BO0A 3S3CB 4E9TA 5LDUA 2P80D 3FSZA 5IY5B 3BVDB 5ANHA 2QDWA 4UAHA 1KDJA 3IBOA 2P80A 5I6OA 3PAVA 1PF3A 2QT6A 3MX0B 1W6WA 3IEAA 4BWTA 1ET5A 2DWSA 3ABGA 2BZCA 3PPSA 1E67A 3TBCA 1NIBA 2TSAA 4HCFA 1GW0A 1OV8A 2UX6A 3WNIA 1URIA 1JVLA 4A2EA 4E9SA 2DYSB 2J55A 4KOCA 5F7BA 2H3XC 3SBPA 4YSAA 4FA7B 4AKQA 1NDTA 2JXMA 3NYKA 2OJ1A 4KNUA 1GYCA 1ID2A 1MDAA 1TEGA 2EINB 4QKTA 1NIDA 3AY2A 3HB3B 4GXFA 3HEIB 1JZIA 2GC4C 4PCYA 1J9QA 1SJMA 1AAJA 2HX8A 2VN3A 1NWPA 4E9RA 3ZIYA 2I85A 4GP4B 2Q9OA 1GS8A 2I7OA 3NSYA 1E30A 4A67A 1AZCA 3AZUA 3FQYA 3IE9A 4KOBA 4DP2X 1ILSA 1ASPA 2Y69B 3C75A 4HALA 1NZRA 1BXUA 1A4BA 1L9QA 2IDSA 4E9YA 1YLBB 2VW6A 1E5ZA 3OM3B 1AS6A 1HFUA 4BK5C 3DTUB 2FQEA 6PCYA 3TU6A 4A2FA 1XB6A 4YSQA 2J5WA 2W88A 1BAWA 4M3HA 5B1KA 1AG6A 2YAHA 3WKPA 1L9RA 3FQ1A 4KNSA 3D12B 4AKOA 1IKOP 3QJTB 4FAAB 3CZUB 2BZ7A 3NT0A 2IWFA 3T6VA 4DP5X 5A7EA 2GIMA 4ZK8A 2BW5A 2PP7A 1SDDB 4X4KA 3OQRA 2TSBA 2X88A 1JZGA 1OE3A 1PAZA 3MBWB 1ZIBA 1ETJA 2WO3B 3FYIB 3H56A 2PPCA 2XX1A 1BYOA 1GY2A 1KYAA 2PLTA 4KO9A 2UXTA 2XYBA 1RZQA 4DP8X 3GYRA 5F7AA 1SFHA 1RZPA 4G7QB 3QQXA 1KGYE 2LLNA 1KBVA 1HAUA 2I7SA 1QHQA 3NJLA 5I26A 3T6WA 3ASOB 1PCSA 4KO5A 1R1CA 4DP9X 2Q5BA 3FPYA 4M4RB 3WIAA 3SQRA 5I6NA 4KNTA 3EH5B 1JZEA 4AX3A 2FQDA 2PPEA 2GHZA 2VW4A 3EF4A 3NJMA 4CSPA 1SDDA 4YSCA 2H47C 2R7EB 2IWKA 1MG3C 1MZYA 2JFCA 4RH4A 1WS8A 4G71B 4BXSV 2HRHA 1OCRB 4NAJA 2DY2A 4G7RB 3U25A 2IDUA 1JXFA 1AIZA 1I53A 4DPBX 3T71A 1IBZA 2HX7A 4DP1X 5B7MA 5I5MA 2EIKB 4E9QA 1DYZA 2ZXWB 3NSFA 1IBYA 1L9OA 1HAWA 2IDTA 2X87A 2YAOA 3H4HA 1AG0A 2BP8B 2FT8A 3X1NA 3S8GB 1T5KA 4A68A 3FSWA
chains in the Genus database with same CATH superfamily
5I5IA 4RMQA 1I8MB 4I1PA 5GZOA 1HI6B 1Z1WA 5JHBA 2YGVA 5TE7H 2ZOOA 4FFYL 3IPFA 5F7YC 1ITCA 1TZ8A 3GMPA 5JQ6H 1DVTA 4DZ8B 2CIKB 2XNAA 2Y6SD 1YJDH 2OTWA 5IGXL 4OV5A 2BPBA 2HT2C 3VYOA 2WV3A 4EI5B 5BZWA 2K6YA 4XMPL 3RILA 4BFNA 4ABQA 5AENA 3BX7C 1PZCA 4RFNB 1WBYA 5EBWA 1IO4C 5GRYA 4K8RL 3E2HC 3IJ7A 3VXNA 1IEAB 4RWYL 4ZFFB 5EU4A 5JPMC 5C6WH 1Q9WB 1GJWA 1CDJA 3TBYB 3WUWB 3ZSTA 3TH2T 3TPKA 2P45B 5DJ6A 4ZX5A 5CGYC 4RSYA 3ZE0E 5HI5C 3I9PA 1RZKC 4YXKL 1HVXA 3DX9B 3TJEL 2WXHA 3CZLA 3V0IA 4ZO9A 2Z4QA 2DMKA 3NACH 5TQ2H 1F2QA 4XCCL 4G6MH 3DROB 2KBGA 1D5MA 3QDMB 4ZXBD 2E59A 2PYFB 3BSGA 3O9WD 2ZXCA 3QZMA 1AR1D 4OCLC 3LRMA 3WY4A 1JZ3A 4HLZG 4YHKL 3VFPB 2RH0A 3K6SB 3LRSB 4WKXA 1YPZA 1AGFA 3U6RA 4EJ1C 3N06B 2ICCA 2DQCL 2VDMH 3LXAA 2CJ3A 2J1KA 4ETQB 5SWZE 1M71A 3CFQA 1HCFX 2PNDA 2W59A 1EAOA 1FL5B 5EEUA 5AB9A 5DJYB 5EO1A 4ABUA 5FOJA 4YHZH 1AY1L 1TKWA 5DWPA 5E99L 4DZBA 3U2SA 4X4ME 3ZTNH 2W95A 4U1MA 5C07E 3VFTA 2BM3A 3N1PC 3L2MA 3DWTA 4G3YH 1HHKB 3PABA 3QUZA 4KROB 5ESQB 3WBDA 3B83A 2VJXA 3Q3GB 4J3OG 4EIZC 1WWBX 1HHJB 2VXVL 2NSQA 3GS7A 4HLZH 2N1KA 2LGNA 5FK9A 4IS6B 2OP4H 5T1DL 4L4TE 4QRRE 5TH2A 1AHWC 1RU9L 1ZEAL 3K0WA 3KPSD 3IAGC 1NOFA 1MFCH 1AKJB 3I9GH 3CFKB 4OB5H 5HHPA 3INOA 1OZTG 2H3NB 5AVZB 3QARA 2DYPA 1YUHA 3MRJB 5T1LD 5HYQA 1LLAA 1S3KL 3UMTA 1B4JL 5H94A 1ETZA 2WBJC 4JFFD 1O7DC 5DURB 4TOYH 1CFBA 1MCIA 4ZMVA 5HD8C 2SEBA 4FLOA 1A7QH 5IVXF 2Y07L 3OKEA 3UPAA 4UQ3A 4EKXA 4Y5YC 2EEXA 5C0ND 2DQEH 4J3SA 1XDTT 4XMLL 1DVFA 5E9DE 1T6BX 5CEZL 5EFIB 1NUNB 1KEGH 4PCSA 3RTLA 1BOGA 1TTFA 4ZPVB 3IDJB 2O6CA 5C7ZA 4JFTA 1AP2B 2JKIS 1OOWA 4G6JH 2EDYA 1NDGA 3QZPA 4TLSA 2VZ1A 1CICD 3L5HA 4NM8H 2V2TB 3FL7A 4UQDA 3O6MH 3UJTH 2I9TA 3IFNH 3IJHB 1R17A 1AS7A 3HC4L 1RCYA 1FNLA 4ELKB 4ERSL 1Y6NR 3QZNA 4ZW8A 3ILDA 3VNYA 4ACPA 2E5EA 1RPQA 2EDEA 5I75C 2HUEA 4OJEH 3KPOB 4P46C 3K74B 2KLSA 4PSRA 1V54B 1YNTF 2UY6B 3FB8B 4PWFA 2Z31B 4LPVA 2Y7QA 4PJGA 1PLAA 4QRQB 5FF6B 3VRJB 1AJ7H 1VERA 4D0DA 4PJXE 2YPVH 3H9HA 1VLXA 4WWKB 3BFOA 1UWEL 1B2WL 3V4VL 4XN5A 3V4VB 4DKFL 4QYOA 5KAQF 1X7QA 1SY6L 2JCCE 5BZZA 1JDCA 3RI5F 3VFNA 4PY7A 1RURL 2LW3A 1NAKH 4HIIA 1UA6L 3NK4A 1PY0A 3SO5A 2V9RA 2ESVA 4M03A 2YXVA 5I0ZA 4ZUSA 4M6MH 1ITBB 5HSFA 5KWYC 5EG6C 3HE7D 4OGXL 4QHUA 3R0NA 3E9UA 1N64L 1G7QA 4L0YA 3QPXH 4M62H 1C8QA 2FB4L 2Z34A 1IT9L 4PI0A 3SDAA 2Q76A 4XP9H 3WEAA 3WSQH 4WO4D 1N26A 4FI8A 1OAKL 1GKOA 2ICEB 3CHRA 5IK3A 4YR6A 3IJSB 4C58B 1ZV2A 5JNYB 2FEEL 2PUQT 3PIQA 3J8F7 1H3TA 4BGDA 3H3PH 1E50A 3QPKA 4DP7X 1G7LA 3SQOH 4CKQA 1FWXA 2CKNA 1QYGL 4X98B 5DVLA 1AZRA 2F53A 3DXAE 3TBVB 3VH8G 3PDGA 3FQUB 4LHUD 1NEUA 3T09A 2NZ1A 5AAWA 4R4NC 4JFYB 4J3WA 4Y8DC 5E1HB 4MSWB 4BFBD 2QQNH 4ODTL 3G5ZB 4NO2B 4W4NA 5JHLL 5HHXL 3DX3A 5JHDA 4JHWH 3KEHA 4IRSB 4PRPE 2ITCB 4MZIA 1Q90A 3C9NA 4CMHB 5EZIL 1NICA 2W60B 1IL1B 1R3IL 4L9DA 1R47A 5C0AD 3GI8L 5E5MA 1SRDA 4Y19D 5HDLA 1NLBL 5E24E 3ABZA 2G0LA 1EH9A 1PZSA 1BQRA 1DLHB 3W39B 3ZHDA 3V4UH 5EEXA 4M1GH 1U93A 4UT9H 3N55A 4XNQA 1J88A 5EUKB 1A3LL 4XWOD 2YD9A 1EO5A 3CSTA 5LLIC 3FOMB 4JGUA 5FA3B 1CTOA 2QDVA 5D55A 4DVRL 2WTRA 2BHZA 1IC5H 4AYMC 3VVVA 3ZDZF 3GMNB 3SBQA 4NNYB 5CGBA 5K5YA 4ELMF 3TWYA 4QXGH 3MLYH 4MYPA 1BQSA 2WZ5A 3OWEA 1Z5YD 4YSTA 5D9SB 4MMYB 5C0GB 2R0WH 2DTMH 2WQRA 2P8MB 1OAXH 2F5AL 4Z7NF 3TNMB 1X5ZA 3D2UB 3JWOL 4M6AA 4HJEA 5FYKD 5IFHH 2LU3A 3VFUB 5I71C 4L8CB 3L9RB 1XIWB 5T1KB 1J8HB 3T9WA 1VA9A 4JFSA 3UTSD 5MEND 1LEIA 1HYRC 2IV9A 2EIJB 2HT3C 5AW5B 1ZV9A 3CIQA 1W8EA 4HJGA 5BXFA 1UCBL 4Z7VF 1X7SA 2Z93B 3NJFA 2B1OA 2DKMA 3VGBA 1DVYA 5AWNH 4G8FA 4O2CA 3ES6B 1H8LA 4PJ5E 1NSNL 4KK9D 5INDA 1HEJC 4G6FB 3PNWA 2ZT9C 2WVVA 3KGUA 3L3GA 3U0WL 1A6UH 4RMVA 1O5DT 4LSPL 1I1AA 1DR9A 2HZHA 4XBPA 3VWJC 2Y06L 3O3UN 5D4IA 5AVVB 5E9AA 4L2YA 3UPRA 3M07A 4HWUA 4FHKA 4Z7WF 3NCJH 2WQXA 2WWNA 1TZGL 1I3RA 4JJOA 4TNWF 1NGQH 3WOVA 1NCBH 5SWSD 1V7NH 1U4FA 4XZUA 5CZKA 2YS4A 4K5LA 2VOTA 1XXFC 2A4CA 2XRAH 4LKXB 3EO9H 4JFDA 5EZOL 2X1PA 5IY5B 4LSDA 4LOUC 2JKJA 4AQ1A 1MAMH 2DIEA 2EE9A 2G3XA 2JLPA 3FQNB 5FO7A 4IW4C 1KIQB 1C12B 3EBHA 4YHLL 5ISZD 5L7XL 1NGPL 2IAMA 4OM0H 3UTZB 1EAPB 4WSGA 3NCEB 4ZW7A 4LNRA 4LEOB 2FWOB 3TO2A 4BWTA 2E9BA 3ABGA 3N1MC 1A2YB 2BZCA 2HTLD 2W5PA 5FCUH 3IU3B 2JV6A 2YKLL 4ZO8A 3B5HA 2P5ED 5H37A 1OV8A 2UX6A 4YQXL 3EYFB 4H20L 4D9RE 4OLXL 4HWEH 4Q74A 4BH7B 1E28A 1S9XA 3N42F 3WN6A 1NGXB 3OJ2C 3MKGA 5ELIA 5B8CA 2JXMA 3GSUA 3NYKA 4X7CC 2WCPA 4NUJA 3SYAA 5IEHA 4X7SL 4PP1D 3SDYH 1HL9A 2BSDA 2I5YL 1MCKA 4NN6C 1UH3A 2APSA 3I3DA 3AY2A 1E8XA 1UOWA 4GXFA 4XNXH 3MGAA 3RA7L 3CFUA 5GJTL 4M7KL 1SJMA 1BD2A 1BZ8A 1OTUC 2DLFL 1ZGLB 1TTBA 3ILQD 2OMXA 3NSYA 3FQYA 5I1GH 3E8UL 3G5VA 3H1ZA 4YPJA 3K6OA 2CR3A 4BHUI 4BSWA 1JRHI 3EBGA 3ARGB 2XZCH 5AB2A 3MV8B 4NBXB 2FQEA 3AT9A 1CGVA 1FJ1A 1OHZA 3MFFB 2ARJQ 2OS7A 2F1BA 1KMGA 3X12B 1GPOH 1NGWA 3NZHL 3EFOB 5DRXB 3VWKA 3FTSA 1DQLL 2IWFA 1I3UA 1UZ6F 4K3DH 4PB9H 4ONFH 2L04A 4DETA 1KGCD 3P3TA 2ZSWA 3A22A 3D7PA 3TN0A 1N7MH 1KPVA 1XCQB 4HGWB 2W65A 4QO1A 2L7JA 5IBTL 4QTFA 3TYFA 3FYIB 4LCIL 2R23A 2K78A 3BO8A 3D34A 2WXIA 4PRDA 3C12A 1MI5E 1MJ7L 3G9AB 4Z3TA 2NMSA 1SFHA 4GSUA 1TNNA 3AB0C 1NGYA 3MRHB 1OAZL 2IADA 4KJPC 2XFXB 1YAZA 4N2CA 4HJJH 1KJ2B 2WINB 2NNAB 3S34L 2IH1A 4APQC 4GG6E 3NVQA 2IC2A 1S5HA 1MFDH 2GCYB 2NZ9D 2IF7A 5C0BA 3ULVH 4ODSH 4MA7H 4I9WE 2W9EH 4ZS7H 2VC2L 5FO9A 3PQYE 4ZSOA 5CFAA 3ECBA 3B2VL 4ZMWA 2VC2B 1DDHA 2EDNA 3FRPA 3GXTA 2GW5A 2V5SA 4M7LL 5E6UB 1QO3A 4HJIA 1IGMH 1HT6A 1TQCC 1UB5A 4OLVH 1OCRB 5EZJA 4OGZA 3MJ9H 1NA8A 2CWRA 1AIZA 2ENYA 1IQDA 5AL0A 5GSRA 1BFTA 2AKRB 4G8GD 1IM9D 4RZCB 2WQ8A 3OAUH 5KVGE 2F08A 2YAOA 2J44A 1MXDA 2A9ML 3NK3A 3EBIA 4HPOH 4F33B 1OD9A 4W93A 2VZSA 1QSEA 5DHVH 3TBBA 1E65A 3EG9A 3VFRA 1QI3A 4L8SC 4DFHA 1WQVT 3AY4A 4UM8A 1H8NA 1SXCA 3RFZB 3HBPA 4F57H 1WT5C 1U4EA 1A1MB 1JFQL 3CVBA 4EOWL 3TEWA 4K3JH 1UZ8A 4OF6A 3ECUA 2JF1A 4KX9A 3B9VA 2ZF9A 3HCVA 4FNTA 1J7VR 3L4VA 3UGUA 5IROD 2J1ZA 1RLBA 2WSKA 5CINL 2BP8A 2Y5QA 2YUXA 5KSBF 1IC7L 2ICWA 4ODBD 3WTVA 3FB7B 4ZFOA 2DIBA 4PJDE 4DEWA 4IGBD 5DO2D 2OQJB 1INDH 3WO3B 1S4IA 4JPSA 4ELDA 4XOEA 5D8JL 1OVZA 1T4WA 1V05A 3IDGA 2ZUQB 5IF0A 4PAZA 4FFZA 3AU0A 4N0UB 1XD0A 4Z3EA 1O75A 2Z0BA 3NZ8A 2CRZA 1TNMA 4W9EC 3CC5A 2YPKB 1NCUA 3EO0B 2J56A 1KCLA 4HIPA 2BNQB 4MCZA 5HY9B 5C0CA 3SE9L 5DRZB 1KIUA 4P46D 5A3ID 2OSXA 5F7DB 1RZJL 3MRDB 3II2A 1ZD6A 4JB9L 1J0HA 1IBHA 3UTQB 3WHXB 1AD9B 1ACYH 2ED7A 5EUOF 4LF3A 1XTLA 4FQHA 4EN3C 2WOBA 2YRPA 1OB1A 2N0MA 2XTJD 3GIVA 5JPNC 2DS4A 5GISL 3BVWA 2MQ0A 3MNVA 2K9UA 1KZYA 3FO0H 3O3DB 2GK0B 5HGDB 3V0GA 3UXFA 4N85A 2D3VA 1L0YA 2R1XA 7FABL 1X9QA 3X11B 1KCVH 4IRJA 4X6DA 2UZYB 3PXHA 4PJCB 3O2VL 2R1WA 1XL6A 3QNXB 3T6QC 2HJFB 1CDIA 5DUPH 2GYSA 1VFAA 4OJFH 3D4YA 3KVPA 1MF2L 3FRUB 4GPVA 5DJAB 2UZIH 5DMGC 3WIFB 2AI0H 4M8RA 1U36A 4PRHD 5B39B 4LVNB 2Z7ZA 1A9BA 1NC2B 2NUPA 3V6ZA 1QVOB 4XPTH 4DTGL 4LKCA 2VDKH 4XP6L 4U31A 4UNVA 1LWRA 5EO0B 3ZZQA 5CIPA 4M6NH 5CEYA 5GS0D 1IIIA 1RMFH 5IQMA 5D1QA 2UV3A 4JM0A 2P28B 2YBGA 4N8CL 2BLFA 4S0HA 1MRDL 1TJIL 1MFAL 1W0WA 3AQDA 1EEYB 1RL1A 3O6FD 4WI0B 1C1EH 3T3MB 4HDIB 5BQ7B 3BZFB 2CKBL 15C8L 5A6MA 3QIBA 1Q4NX 2CKBB 3SKNA 3GDCA 5I6PA 1M6OB 4ODVL 1I1FB 3VW3L 3BFWA 3QJFB 5JQHC 4UM9B 4PLJD 2QADB 4PJGE 3OZKA 5C08B 4PMEA 4JHAH 1YMHA 4ALAH 1N8ZA 2KS0A 1BJ1H 2W9DL 5KBMA 4JG0L 1G7PA 1N0XH 1T22A 5C2UB 1PLGH 5HHQB 2P1YA 2FHBA 3HHSB 1SMAA 4I3RL 4JVPA 3VA6A 3BGMB 4Q6KA 1L7TH 2XX0A 2ED6A 3MGTA 2QJDA 1DP0A 3Q5OA 4GSQA 1MY7A 4U0QB 1BIHA 3CFDA 4LLMA 4KVNL 4AMXA 2CNYA 4HKZA 1RVFL 4XP5L 4KKNA 4L3AA 4BA8A 5I6XB 2D0GA 3EGDA 3VTTA 1G94A 4P23B 1AE6H 4OCXH 4BZ2H 3FT9A 3J2PA 2BP5M 4NZRH 3IPBA 3E38A 1BZ7A 4GIPD 1Y18B 2IGTA 3QIWA 1JXJA 1ILUA 3G6AB 4NUGH 5J6SA 3OKYA 3TNNB 1TU2B 4P5TA 5K9KA 2I25N 1CD1B 4EO5A 2UXVA 3BVXA 1JOIA 3OKMB 1D9KD 3KYMB 4JN2B 2ZXEB 4GKZB 1LE5B 3PP4L 2G3ZA 4GRLA 4JZOA 3L3DB 5LCVA 3ASNB 5IR1A 1R3KA 2FGWL 2F53E 4TSAH 3ZKND 3B6SB 2WVUA 3APFA 5I16B 1W2KT 1A3ZA 2F8VA 1F41A 3GBLA 4KXAA 4NDMB 2R69L 3OTTA 2BIPA 1OF0A 2RQEA 4QNPF 3RRQA 2V33A 1ZDQA 5DJ2A 5DT1L 2BDNH 2XV0A 3CPUA 2P8PB 5IHUH 2RFXA 4RRPG 3CFBA 1NPJA 3VWJD 5JHDE 4TSCH 2YFNA 4PLKD 3DKHA 4NKOB 2XPGB 1D5IL 1YEHH 5T1JA 4XPBL 1U92A 1F1GA 1FFNB 4L4VB 3KLAA 5I73B 3GSVA 1XF2A 3ZK0A 2D4FA 4J8RA 2GTWA 5DJDB 4U6YA 2FYYB 1ZANH 5JDJA 1IAIL 3LD8C 5LBSL 4HAGA 1DFXA 1IGJB 3E2HB 4AVJA 5C09A 3H7LA 3BP6B 5JW3H 1UD2A 4MTMA 1WHOA 4LOUD 2GTZB 2ZG2A 3CVHB 3GTTA 1OP3H 3I84A 4HBCL 4OZGF 1T66C 2E9JA 1CBVH 4DP0X 2VDOB 2WXFA 4OKDA 1KXHA 5F72S 5ANMB 1VFBB 5EU5B 4XC1L 2WXOA 3V4PH 5F1KC 1NOLA 2PPDA 3GMMB 4A7TA 2FEEI 1UM6L 3HR5A 1BYPA 2PCYA 4IRZL 2BIMA 4O00A 3VX1A 3VD7A 5DHYB 1A7NH 2WLNA 4WTQA 2FIKA 2DICA 3S3PA 4Z5RB 5SWQB 3QFGA 2ZYIA 2GBTA 2GJJA 2EIMB 3OKNA 3I6SA 1UOVA 2X1XR 3FQRA 1M9SA 5E7FA 2DWDA 5EULV 1MOEA 5D2LF 4GKNA 3RPBA 3AXIA 3VG9C 4Y4KA 4YDZA 3RWCB 1JPFA 3Q2VA 5CLWA 3ZL2A 5JIDA 4LSQL 2FATL 4HK0A 4DEPC 2PPAA 1DJSA 2HLFC 3M86A 2AQRA 3BH8B 2ZSVA 1BQUA 3KZ8A 3UJIH 4KZEH 3I6KB 2AEOA 1JZJA 2WYHA 1S9VA 3BDXA 3C60A 3ESNA 1UKTA 4Q9CA 2X4TA 4QGTA 5CLYA 3B7YA 4TQHA 3KPMA 4PG9A 3MOAH 5F7MC 5BW7A 2X5PA 4PJ9A 4MJ5A 3FUHA 4I0PB 2FSDA 3QPQC 5FFOA 1OP3K 2EKSB 3ZMNA 2BP0A 3M17A 5PAZA 3F7RA 3C6LD 4D8PA 5E8EA 4JFDE 1T89A 3MRRB 3KL5A 4BZ1A 1IKFH 2VSMB 3CHPA 4U1KB 5FFLA 4KKQA 4DCQA 4J3BA 5DD3L 4W9GC 2VKWA 2RCSH 4LVOB 1KTDB 5D70L 3Q8EA 1TVBB 4PS7A 2DQMA 4PJEA 4QXUH 5ETUB 3GUFA 4FEIA 1THCA 5I0WA 2WBJB 1MNUL 2CIIB 4WFHE 1OSZA 3SDDC 2D2CC 3FFCE 4GBXB 5I30L 2HKAA 2E56A 4B95C 3I75A 1UB6B 1IBGH 1PZ2A 4UDTA 2NY4C 4JY5L 1CFNB 3L08A 1XH3A 4LPUA 5KOMC 4NFDA 4JDZB 4WHCA 5AOZA 5GGTH 4PJHA 4K9EC 4QAWA 2VXQL 3VE0B 3CE1A 3MUY1 5HHMB 3AROA 1HSAB 5GGSB 4KI1A 1GYUA 1JRHH 1KYDA 2CK0H 4C4UA 2VR6A 1ORSA 5DYFA 1Z5LA 3LTVA 3UZEA 1BD2E 4Z7UB 3FB5B 3BN3B 3GO1H 4AUJA 2H3XC 4TM9A 4N8VA 5ABDE 5D71L 3DMMB 3TYGL 3UDWA 4MA1C 1LL1A 1LXMA 2IBZX 3F2LA 2I24N 4UZGA 5AOJA 5ABAA 3RWGB 3ZDXB 4AEHH 4KZDL 2RIKA 3MX0A 4HKXA 4P06A 3SCMB 4DN4H 3MBED 1KTBA 3CSFA 4ZUTB 4I8DA 2WUBL 3N41F 1SJEB 5BRPA 1J9QA 1KELL 3V8OA 3CFTA 4HS3B 1O6TA 2F54A 3QWNA 4S0TD 4TNEA 3DX1A 4GW4A 5KYXA 3AZUA 1QTSA 4WY7L 4X5WB 3WS3B 2OSLB 1JP5A 1NZRA 2PWHA 4TUJA 3B5TA 3BN9C 5E6IA 5C07B 5MP6L 4GXVL 2A1WH 1G5GA 4PIBA 1Z66A 3SKJH 1AO7A 4DUVA 1H9DA 4NO3A 3JV6B 5EOQH 2OYKA 1XH0A 3D12B 2K3HA 1I8LA 3B3IB 4YAQB 1N3NB 2YC1A 5I15L 3T1FB 4I18B 2OMWA 1MWOA 4XE5B 1D7DA 4UYPA 2XZAH 3EOAB 5C0BE 4G7VL 5IMKB 4AQ1C 3WMQA 4KXDA 4LCWE 3CFEB 4JFUA 3ZE2F 4N0CD 1CTNA 2HKHH 2IAMC 2IPTH 3TH3T 1OL0A 3HJEA 2FBRA 2QFPA 4WFFE 1M3IA 1AI1L 3IKCB 3U46A 4IU3A 3IDUA 4U1NB 1FBIL 3QQXA 5HVHC 4YWGH 5KTEL 5KVEH 1VADB 3G6DH 2J6EL 4JGJA 2UYLB 2KL6A 3BW9B 4FQQA 1EDHA 1QATA 3CLEL 4S11A 1ZVSA 3ZGHA 3ULSB 4K23H 1PGRB 4C56D 4JRXB 3UZQB 2JSFA 3DBSA 3VI4B 1ZGLP 2GHZA 3V0FA 2PO6D 1NBCA 4UQBA 5TQ0L 2JI2A 1IKNC 1LQSR 1A6VL 3C08L 3OR7B 1JVKA 1QSEE 3WUWG 4GQQA 1G6RL 5HHXH 4FXKC 4HX1A 2ATPA 4U2ZA 1G6RB 3D0VA 1ERNA 2JELH 2C1PA 3EADA 2CHNA 4B50A 4DGVH 5B7MA 3B7RL 3GQFA 4X9GA 4R3SB 5C0EB 1RHFA 2A2QT 1K2DB 1FNSL 5DQ9B 1AKPA 1HAWA 4MCYB 5GZOD 4IOSA 4IKNA 3S5LB 2AQ1A 3JBG7 4FFYH 4MZRA 5JIKA 3ATBA 2BFVL 2UXGA 4G5ZH 5T33H 1HXYB 2JWYA 3NCYP 1YN6A 5IGXH 2WBWB 2CDEB 1CC3A 5IKCA 4LCCA 4IBVA 4G8AC 5MEQA 2DWEA 4Y2LA 4UNIA 4XMPH 5D4QA 5C0JA 3PL6B 2GI0A 4K8RH 4RWYH 4UANA 4YL9A 1KCRL 2DOCA 3R0MA 5FGCB 2F19L 3VD9A 2JCCB 3EDEA 2R15A 3VX0A 4I0KA 1CPUA 2YXFA 5HJBA 1ND0B 2FEDC 5AVUB 1PX4A 4YXKH 3TJEH 5IB4A 3TN0C 4JPIB 5DJ0A 3C09B 3JWDC 1N5AB 2L7UA 1JWMB 4W9CC 5GRUL 5C0CE 4CILA 1JNJA 3CFJA 3LPOA 1U42A 3AG2B 4NX0A 4XXWA 3QQ3B 1ORQA 5E4EB 2IH3A 1Z0NA 4KJQC 1ZLDA 1VF5C 3HG2A 4YHKH 3UP6A 2WAHA 1MVFA 3MRLB 1RSYA 1JGEB 2G75B 1U8HA 4PJIF 5EDSA 1CJYA 2DQCH 1UJTA 1JXGA 5EU6A 1WF5A 3LH2L 1YC8A 4MAUL 3WJLA 3UACA 2Z35A 2FJFA 2ZPKL 3ABKB 4AK2A 4CNIA 4I4WA 4BDVB 4F9PA 4A66A 2DDQL 5KVFL 1AY1H 5E99H 1Q94B 2YPLB 3BVNB 3WGVB 5H8DA 5KSAB 2O6EA 4HF5H 3QUZD 4XMTA 2IWEA 5IM7A 1R3LB 3HZMB 1FNFA 4YDVA 4ZTOL 2WLMA 4FN0A 2PYEE 4Q4IA 4XNZC 4Z3HA 3RDTA 2H41A 4WEBL 1QBAA 3RTQA 3GLAA 4AVKA 1ZEAH 1RU9H 2E9IA 4KDVA 4N20A 5GS1B 2EVHA 3PDOA 5F7EL 1T7XA 1A6WL 2BIQA 3VAEA 1BSIA 2OCJA 1T5WB 4OUUB 5GRXG 1RH8A 2DYPD 4LLWB 5D1QE 1G7MA 5EC2B 1GGYA 2AK4E 3KPNB 4YIQA 4UV4L 1PKQA 3AY4C 4U6XB 1OHQA 4W9ZA 5AZEL 5EN2A 1WJ3A 4GS7B 5CSGA 4JL2A 2ZX9A 3ZL1A 1ZA3A 1QFWL 2A6JB 1T03L 1HN1A 2Y07H 4EN2A 3EAKA 1DVFD 4XMLH 2VR7A 3A67H 1N2RB 4XC3H 1LD9B 5CEZH 3SSGA 3AQYA 4NPYB 5JR1L 3D18A 4HZAA 4QHMB 2Z92B 1TVDA 4N8PA 5DJZA 3JTSB 3ZZSA 2QGEA 3HZVA 2V6HA 3MRGB 5I2IA 4S1QL 3S37L 1T2XA 5IQNA 1TO5A 4MZ3A 1QZ1A 3O11A 1IFHL 1DCLA 3TT1L 2J8UB 1KBWA 2XG5A 2FJGA 1VEMA 3I3EA 2H8PA 3AREA 4HUXA 2GUOB 2V37A 4F7CA 3V5HB 1T04A 4BRJA 3EHBD 4HZ1A 3R7RA 1UWEH 1B2WH 2QGCA 3R19A 1ZLUH 3V4VH 4APQB 4CMMB 1LEKB 1J86A 2FH6A 4DKFH 2VMCA 1SY6H 1BECA 3P3SA 3HR6A 2Q2LA 3DOSA 3PJLA 1N6UA 2NYYD 5JOFB 4L3EA 4F8TA 1RURH 3MROB 4CVXB 4B9YA 1KGXA 3TTSA 1U8LA 3VSTA 4NRXA 4RBPH 1UA6H 2ESVD 3D09A 3KCWA 5DRNA 1MHEB 3QXWA 5DVPA 4X4YA 1UWFA 5HDBE 1TQCB 2N0KA 4P5MB 2I9LB 1WCBB 4TV3A 1E8WA 5SX4I 4MVBC 4OGXH 4L0PB 4IK7A 3N04A 4XN7A 3BP5B 2ATAA 1GTNA 3PAUA 3QIUC 3SDAD 4YHML 5AVQB 2ZZUT 2H1XA 5M94B 2BVUA 3PXLA 4X6CB 3U9WA 4BFOA 4YC2B 4FLQA 3V0EA 4EDWL 3DIFA 4ODXA 4F15B 2L7EA 4PHZA 2WBXA 2WIIA 1CL7H 3ROLB 5BS0D 5IG7A 4AYDC 3A4EA 4KKRA 3RUGE 4Y9BA 5D1QC 2C3GA 3QQ4B 1QYGH 2YPVA 4HKBA 4OZIA 3CX5J 4GLRI 3FONA 4LLUA 5HJ3A 2FTAA 4R0LB 4A55A 3SQBA 3L5XL 3EXLA 1GGCL 2OK0L 4PJAA 3BIBX 1KPRB 2ZF8A 2BVPA 4ODTH 1QX1A 1NAML 4P2OC 2VN7A 1AGBA 1PJ9A 5JHLH 1NAMB 4OQTL 1K8DB 3CVCA 3OKOA 1C08A 1CGSL 4L3CB 2WCSA 1P9MC 4LSUH 5HJDA 3HVNA 5LWYL 3P73B 2YAEA 4GUPA 3E3QE 1AYRA 1KXQE 1GOGA 5B3SB 1R3IH 1BQHB 3MRPA 3MV7A 3SE8H 1O0VA 3GI8H 5ID1A 1NLBH 1NOAA 4ZUWB 3EOYG 3X1GA 4FE9A 4RBPK 5AW1B 4AKPA 3B9KA 4X9YA 3HPLB 1V3JA 3X1FA 3U30B 3ARFA 5T3ZH 3TA3C 1OEZW 5K93A 5DTFB 4FQXC 1YG9A 3B1TA 3ML9A 5BMFH 4L0ZA 2PCXA 2IXQA 4KKPA 4Y4HA 3BVTA 4I77H 5G4NA 1K5NB 1L7IH 3QCUL 4JFEA 3HE6D 2J6WA 1ZV5A 2V3FA 3LQZB 3OKKA 3IRPX 4JW3A 3QCVL 2VABA 1ZLVH 3QYMA 3QIWC 4KQ4L 2HMIC 3VFMB 4AENB 4IMKC 4ZAKC 2F5AH 2IGFL 2QKIB 4AV4A 1OZUA 4YNYB 5EC1A 4PTTB 2XN9D 1ECZA 1T0MB 3RWJA 2JKTM 2Y1VA 1E3XA 1S9YA 4DP4X 4GRLC 2A6IB 1RJCA 2CMRH 4IOFC 4UB0L 1O7SA 2ZJSL 5FC9A 5JPNB 4G9DB 4ZDHA 1SJHA 3KJ4B 1HWGB 2XACC 3L4WA 3LQAH 4XP1L 5I5JA 3LRGA 3WY3A 4AT6A 5EEZA 1FNGA 1R4XA 4LEEA 2ZKWA 4UT9A 3UX9B 3U0WH 4GRWB 3PWPA 1CD8A 4JCMA 3QE5A 4KV5E 1KB5L 5G4MA 1I1AD 2X4OA 4LSPH 1CB4A 1OGAA 4NJAH 2CHDA 2Y06H 4RQQA 3VH8A 4TTDC 4X5PA 2C3VA 1ACZA 3FUDA 1KV7A 3BZEB 3D85A 4PJHE 5CN1A 1FZKB 4L37A 4LSRL 1TQBB 5TD4A 1TZGH 1AOHA 5GGVH 3HRPA 2JJUA 5AZ2H 1SEBA 4G7SB 4NS0A 4FZEL 4GAAA 4AYBA 1JK8B 1KIRB 1W6LA 5EZOH 5D7SL 1MUJA 4UQCA 1E4KA 2FWLB 5ABZA 4YHLH 5A2CA 1NGPH 5L7XH 1LP9B 1Z32X 3LMJL 1ZLVK 4NO0A 2DH2A 2I60L 5D7IB 4PW9A 3BD4A 3GNMH 2DPKA 1QTYT 4S1DC 4WFHD 4X8CA 3WFCH 4QKXB 2BOCA 3WUZA 4KRPD 2QT6A 5L88H 2YKLH 1Z3GL 2IDCA 4HHAA 5B4MD 4AC2A 3F12B 2AJ3A 3BKYH 4YQXH 1XR8A 3ETBF 1EHNA 2VSDA 2SODB 2EH7L 1C5DA 2QGDA 3E3QC 4OLXH 3WNIA 4YFDB 5C71A 1QW8A 1JHLL 3VVWA 1BG9A 4LU5L 4FEMA 2F54E 5DZNA 3BSZL 5IIEA 2AQNA 4PJDB 4Y4KC 5F7BA 3RVTD 3DYOA 4QAMB 1P4UA 4EBQL 4ECNA 2CM5A 4FA7B 2R29L 4R7XA 1I9IH 5ALCL 2ZWSA 1Y6KR 2WYIA 4HG4K 1GYCA 3F85A 1TEGA 3UYPA 1QG3A 5HGHA 1AGCB 4FLSA 1K4DB 1KXTB 2VWEE 5GJTH 3RA7H 1BD2D 4M7KH 1M7IB 5M95B 2BK8A 1E27A 3ULUD 3HB3B 2QSTA 4WUUD 4ZG1A 3W37A 2GJ6A 1D6VL 4E41A 3CFMA 2GC4C 2DMHA 4HS6A 3IFPA 1AAJA 2ZCKL 4JO3L 2EDDA 3HZYB 3PWUA 5AKTA 3WMPA 2B15A 3D3VA 2VQ4A 3K2IA 3WNPA 4GNKB 1T89C 4AOFA 5AD0A 3DV4A 3A6CL 4PVMA 2B1AL 3CUPA 1LO0L 4MJ6B 3S35L 5FYLD 1JGLH 1TLMA 2W91A 1XGZA 5DC0A 3FT3A 1TFPA 3QEQE 5GSVA 3VWKD 3IGAB 3LN5B 3NZHH 3C8KB 4M3HA 3GUTA 1DQLH 4Z0XB 3RAJH 1E9QA 4XCFL 3TBTB 2EO1A 3FHEA 5BCAA 2P7TB 1QR4A 2XWTB 3L3IA 2WXGA 4NN7C 4N2IA 4J3UA 1EWHA 2GIMA 1H0DB 5ID0A 5IBTH 2GEEA 4JY4A 4KRNA 4YDIL 2NY3B 1IFGA 4RA3A 1FL6B 4KGLA 4LDCA 4N68A 3ZQXA 3T5WA 3VXTA 2H3KA 4QRSA 1MKFA 1JYXA 1KYAA 1KJ2H 4QD2E 1RZQA 1Y1DA 4LGPB 2NY5L 3ZR5A 2R2BA 1ZRUA 3MKKA 3SGKC 3ZYJA 1RPKA 5C0BD 4P3WA 3QUYA 3MRBA 1KBVA 2I7SA 2VC2H 1R46A 3UZEC 1ZSDA 2E7LA 3H85A 2CGYA 3LZRA 5K1JA 5I24A 1RK7A 5DLLA 1NBYB 3AUVA 4X4XA 2BVYA 3CZFA 1DANU 1QP1A 3QEUB 1JPGA 5I0YA 4GAFB 1DFBL 1WVZA 3FAWA 4RRPM 4WQOA 3UDWC 1T1ZB 1ROWA 1MJUL 5E7BA 3HHMA 1MN4A 1YEDB 4JG1L 5IFAL 3FT2A 2Y2YA 5BRZA 2B20A 2UVEA 1OAUL 1M53A 3QWQB 2A9MH 4Q6YA 1BFOB 1U8KA 2B4CL 1IBYA 1SHSA 1PPIA 2CE6A 2UZXB 3H4HA 5EIQA 1SVBA 4JM2F 4FA8A 4H44C 2FT8A 2H1PH 4HKJA 1P53A 4TULL 4ZW5A 1E6OH 4A68A 1RZGB 1EFXA 4XCNB 4DEPB 4KHTH 1R33A 4EAEA 3VXPB 4JDVA 2FH8A 3QI9C 4ENEC 1TSRA 4TKWA 1GIGL 1SHMA 2VWEC 2RTTA 1R9FA 2N7SA 5KYYB 5HHOA 1JTOA 3H54A 1BHGA 2ZXDA 4Q2ZA 4MB3A 8PAZA 3FBQA 3GSXB 4YSPA 2V7HA 3TBSB 1LK2A 5CINH 2FRGP 1QNZL 1XMEB 1JD9A 3G6JA 3QH3A 3MJ9A 1RZIB 1IGYA 3MSPA 3MNZA 1AC6A 1WIOA 1CFSB 2G2RA 4UTBL 4N2BA 2GEQA 4AZ8B 1BBDH 5EWIL 1J05B 1IAMA 1PD1A 4POYA 3RZCA 1XCWA 4HFWB 1T80A 5D8JH 3QGVA 1XSIA 2ZCLL 2UXFA 1BP3B 4LLDA 2YLKA 1EXUA 1J18A 2BSBA 2AV7B 1PQZB 4NO5B 4WHTB 5F1NB 1J8KA 2DTSA 4HW6A 3SDDB 1U8IB 1QWHA 5F70A 3QNZB 5DHVA 1NIFA 4Z7UF 2UZPA 1HHIA 3MA7B 4H1LB 3W81A 5C0CD 4M6OL 1WYJA 1Z9LA 3ARDB 5D7KD 5D1XA 1SYSB 2W38A 4H4NA 3IJYA 3CSYB 2PN5A 3R8QA 4Q9QH 5J11B 1RZJH 5B39G 4PRNA 1AXSA 1Q72L 4QJ5B 3B2PA 3HS0A 4QWWC 3ZDXF 1WFMA 4FXGA 1ETA1 4JFOB 5GIRA 1E2ZA 3CN3A 3KPTA 1SLVA 4JRYA 2C9QA 5GISH 1XH2A 2XWEA 4I5BA 3HUJA 5EPMB 2CRMA 3GM0A 5I1AA 1N59A 4OLYL 2WGXA 3OLEA 1A4AA 3P0GB 4M1CD 5LGKA 3QZLA 5LB1A 3UC2A 2WVTA 3BGFB 3MMEA 3NIDE 3K6IA 4PBVC 5DEFB 7FABH 4IRJD 1I9RL 1WIUA 3ZZ1A 1I3GL 2FO8A 2JIXA 2WM0A 4MAZA 1T1WB 2ZAGA 4JFXB 3T8XA 1MF2H 3ZQWA 2CDFA 2OXHB 4LCCC 1MFBL 3QDJA 3D0LA 3F7QA 4JRFA 1Z0MA 1F58L 2MOQA 3BWZA 5DI8B 4YSOA 2ISDA 3FO1A 4P4RA 4MLSA 4XP6H 1P2CB 3ISWA 2G60L 3SODB 1MRDH 3BVVA 4KO6A 3T0EA 2NUTB 4H8HA 5E6SB 4QOKE 3UTTA 1P7KA 2CKBH 1CMOA 3QXVA 3QIBD 1H3VA 4XXWC 2Q86A 5GGRB 1I7UA 3V5DB 1FYTA 2ZX7A 3VW3H 2WYZA 3CPLA 5FDYA 1CLCA 3CAFA 5IVNA 2YN5A 4I88A 2OMVB 2FSEA 2XETA 1SXBA 4LT7A 1HHGB 3EO1A 5FR3A 4JVUA 1M2VB 3AXLB 1A1NB 1T7ZA 4JG0H 1P4BL 4OT1L 3WJLC 1F4XL 4ICWA 5I17A 2BWDA 3VI4F 4I89A 5J56B 1T3FB 1OSYA 3B43A 4I3RH 3U9PL 2JI3A 5AG8A 4L3EE 2HX9A 1GAFL 1MHCB 1CUOA 5D1ZI 4XPAL 3WGUB 1HHHB 5DD1H 1NUFA 3O4LD 4PGBA 4KVNH 4N2MA 2BERA 4FFTA 3NIFE 3NQKA 3VD5A 1BXXA 4XP5H 4MQXC 5E94A 1K8IB 1XD1A 3FFCB 4IQHA 1D5ZB 4ZYKB 3QYNA 2R4SL 3HNTL 3BZ4B 2FD6H 3RDTC 3S8FB 3ELQA 3RTQC 1UVQA 4GLRH 5AVRB 4HU2A 4YXHL 2R0ZL 5DS2A 4P5TD 2L0DA 3SGJA 1HX0A 1AR1B 1HKFA 1MH5B 1I9JH 2AITA 3GBML 2ZWZA 3JV0A 1O6SB 5DFVD 3Q9QA 4HYTB 4ZW3A 1WFTA 4FXKB 4OZIE 4ODHL 4Y89A 3VRLE 3VYNA 4EVNA 5GGVY 5KYNA 1KGWA 4AH2B 1NGZB 5DUJA 3QWRA 1OGSA 4MDRA 1FFRA 1PZ5A 2R69H 3ZR6A 2LHAA 3LPWA 3SDXA 2QQKL 4XB8A 2VT0A 3DC0A 4Z0BL 2KKQA 2X3AA 4GW1B 4OZHA 4R4FL 1OF2B 1IGTB 1UD8A 4NENB 2O61A 2ARWA 4N6RA 4UU9B 5GRVK 4A2HA 4F7EB 4G42A 2VJ0A 3QUXA 1D5IH 3KWWA 3GI9L 3P9MB 2PWEA 3MV7E 4XPBH 2Q6WA 4Y2NA 1U95B 3HI5L 1V3LA 4B3VA 5AEAA 1HOEA 4OFYA 1IAIH 1RK0A 3LXCA 2V2XB 5LBSH 1FL3B 1FFPB 2GFBA 4BZ2A 2VXTL 5C09D 4DK3A 3HNSL 1XSKA 4FKEA 3CVHH 4E9XA 2CR0A 3ZIMA 5C9KA 4J23A 4NQEE 2VDOH 1FZMA 4M56A 4HBCH 3EFFB 5TE4L 1INQB 3T0VA 1ZSHA 1XFPA 2DZEA 2UWEB 3P30H 4JFEE 3MREB 1A4CA 3IJ8A 1XR9B 1G1KA 2XWXA 3ME0B 4XC1H 1HXMA 5D7JA 1YY8B 4XBGA 2GJZB 1WG3A 3FQXB 1R5WA 5CAYB 3ZKMC 5DD6A 1P1VA 1SNRA 1UM6H 3WLBB 3JYBA 4XN8A 4X9BA 4OZ4B 2X05A 1MW3A 1KN4H 2FWSA 3AREC 4PI2A 4G9FD 5CU9A 3IFOB 5I18L 3AABA 4LHQB 3BHBB 2IH9A 4J3OC 3RIFF 5ACMA 1WTLA 5MHSE 5A2BA 2MCAA 4HLEA 3P1VA 4U7MA 4Q97A 4ODUA 5BNXD 2H2SD 2GITA 1JGUL 4KFMA 4KKLD 3FU7B 4B7LA 3BLBA 3OPZL 2EYTA 3QS3A 4P49A 2ADIA 3HLAB 4LCWB 3DSNA 1FVEA 2X09A 2O93L 2TRYA 4LSQH 3FUJA 2BVEA 1P5UA 2E86A 4PWJA 1CICB 3BAKA 1A7RL 3PWPE 2FT6A 3J7HA 3SGEH 1KULA 1LO3H 3MTRA 3QRLA 1OGAE 4I48B 2PXYC 3C60D 4KX7A 5F44A 4POZD 2AJZB 3K8KA 3QEGL 4LEXL 3Q2CA 1HEZA 2VO5A 5E51A 4YSRA 4NFBA 3LB6D 4PJ9D 4XNZB 4PJ6A 3RVVC 3V4PA 3ETSA 1AZVA 3WCYA 5GPRA 1OQOA 1XZ0A 1TG8A 3CN2A 9PCYA 5MEPB 5HGBA 2NY7L 4PJ8A 2MH4A 3QFJB 3OWRA 3HN8A 3AITA 3MRNB 1AZBA 1E5YA 4NKQB 1Q0XL 5DD3H 3PFUA 3VMPA 4APXB 4GUCA 1ED3B 2X0WA 3GT6A 35C8L 2WLZA 3VFGL 4QRBA 4R84A 3I85A 4WCYL 4XO5A 2WUCL 2QPEB 1B0WA 5KVMC 5TPWL 4J12A 4JKWA 1OTSC 2I69A 3MNWB 4HHWA 4XO8A 4JFPA 5AB0A 1J5CA 3PV7A 43CAA 4O51A 1YEIL 2HVJA 4JY5H 3U7YH 3Q01A 3D69A 4CJ1A 1XGUB 3WU1A 3MXWL 1SFDA 3L8QA 2BO0A 2VXQH 1NMCB 2Y9RT 5IW6A 2Z7YA 3PE9A 5IMOB 3ARFC 4L1BA 5FYKU 4XH2A 5DDHB 2C3WA 3IBOA 3TEXA 4HV8B 1JCKA 4Z3GA 1RHHB 2XBDA 4Y5VA 3CSPA 4UYQA 1MDTA 1MWAL 2V5MA 3DX8A 5AYUL 5H35B 4PJFA 2ERJC 3TFKD 4NKMB 1QD0A 3N5AA 2D3JA 2GJ6E 1A22B 1VIWA 4E41E 1M05B 2NY2C 3KDPB 3VACA 4MHHI 5D71H 3TYGH 4BCZA 3IGKA 3LZPA 4A37A 2ENJA 3D3VE 5H4ZA 2WMPA 4YSAA 2F18A 1R0AL 4U3CA 3GEWB 4F3FB 2WXQA 4AMKL 5E95B 2I07B 3WDHA 5B3NA 1RLWA 5E8NA 2WUBH 1PU0A 2JI1A 4ONOA 4X6CF 1KELH 3KS0H 2Y1ZA 4OLZL 2DQHL 5GGTA 1DEEB 4WY7H 1SBSL 4PCYA 4MXVE 2VZTA 4P8QA 1MFNA 1JUFB 2I85A 1QBBA 4DEUA 3D4GA 4J4PD 5E6ID 4Y1AB 5DD0L 2X40A 4FG6C 4BELD 5MP6H 4GXVH 5D6CB 5IBLC 1VPOL 2YLHA 4ZNCD 4LBEB 3BPNB 3GKWH 3L9YA 3MQIA 3OX8B 5DZOA 1AO7D 2YA1A 3D05A 4XE0A 3QIUB 5DZLA 1IM3A 3WXWL 4FNQA 4JUTA 3S8WA 1F11A 3L7FB 5CZVL 3MZTA 5D7HA 1CGUA 1YAIA 3GBNL 2FCBA 4DGIL 4JNXA 1JHTB 3ETBJ 3TVMD 1A5FL 1UXSA 4KNSA 1WISA 4XNYL 4OW6A 2QQLH 4G7VH 3TBWB 3CZUB 1E4KC 2BP3A 3GSNH 5GHWH 5MENB 3UTSB 4PRAA 3V0WL 2XG4B 1KENL 3VXUB 2ZKYA 5D5MF 1JZ7A 1JPST 2AK4B 1JZGA 4RISH 2C7UA 2VIRB 4JQIL 2LFEA 3MBWB 2IVFC 1AI1H 4DNLA 1HINL 1TO4A 3D39A 1FBIH 1VCAA 2Q3XA 3S5LG 5KTEH 1BVLB 4QHLA 3MLRH 2J6EH 4P2OB 5F7AA 1ULVA 1RULL 3VI3B 3KPPB 2FNBA 5BRZE 1KGYE 2FLMA 3CLEH 3DGGA 4N0RA 5AAMA 3ZDYE 1H6TA 1S7UA 4X5QA 4HUUA 4M61A 1E2WA 4PPTA 4TNVF 4FYTA 3US0A 4ZNEA 3W11C 3LSOA 3NJVA 2JLLA 5TQ0H 1A6VH 2V5RA 2QVIA 3C08H 2VR8A 4G8IB 2XIBA 4K3HA 5HI3C 3UAJC 4I3SL 1BREA 5G55A 3STLA 1G6RH 3QWOB 3TA3B 3TZVA 2R7EB 4YXLL 4L29B 4V11A 4FQXB 2JFCA 5FM4A 4RH4A 2DBLH 1E7VA 2B2XL 2B59A 2B14A 4G71B 4AYFB 5ISZB 3MLWL 2BSTB 4XVOA 3KGTA 2HX7A 5HHOE 4FLRA 2AJVL 4DP1X 7TAAA 4IOSD 5I5MA 1EO8L 1JGDB 2CLRB 4WNJA 4PJ7A 3RVWC 2IDTA 5EORL 5DMJB 5EU7E 2EDHA 3M1CA 4IU2B 4FNUA 4QT5A 5DZPA 5GRJL 3ZHNA 4V1DA 3B56A 2EDFA 3FF7A 4ZAKB 3KH3A 5JORB 2ITDB 1RUKL 1U2YA 3UG3A 1C16A 3FSAA 4KK8C 4WI6A 3QUKB 3SKOB 4A2DA 1HILB 2H45A 3MXVL 5FYJD 1JNHB 2VMJA 5C7XL 4QRPA 3Q8BA 1KB9J 5DQDH 2KZKA 3GK8L 2VE6A 4JHBA 3NIGB 3GEFA 1X5YA 2DQ6A 4EDXB 4LP4A 5DK2B 1J0YA 5FUCE 4R2GC 4X80L 1YYML 5GRUH 5D1XE 2AP2A 1MJ8H 3T65A 5D7IF 2IGLA 4WI8A 3TO4C 3D50A 1I7RB 4Z8FL 4A7UA 2Y7OA 3JVGC 1HI6A 4M5YL 3WI9A 2IDFA 4NNXB 5CHNB 1UOLA 5LO7A 3ZHFA 5EU6D 4DZ8A 4FFYA 4JKPL 2CIKA 4CC4C 4JRYE 1ES0B 3LH2H 3NN8B 4X5XB 4XPGL 3QUYC 2CM6A 3HUJE 1UWGH 2ZUVA 4MAUH 2HXAA 3QO1A 4WRLA 4EI5A 2MCPL 3RUGB 4OD1H 5HYFA 1M1SA 2NRDA 4TQ8A 2E7LC 3EFDH 4AMWA 1BJMA 4RLDA 1IEAA 2CK2A 3W9DB 4ZFFA 4X99B 2EIZB 3NPSC 1Q9WA 3TC9A 1TZOA 3TBYA 4MQTB 3WUWA 1ONQB 4FQLL 3QJSB 1L4IA 1I3VA 2GSGB 2AAAA 4N0YH 4UUJB 4ZTOH 5ISZE 3V95A 5L4FA 3DX9A 4HFUL 3ULUE 3P2DA 1TT6A 3ZKXB 3T4AC 1HK6A 1OPGL 4KVCH 3ZJAA 3Q43A 4RGNE 4WEBH 3DROA 4TTGA 3PJSB 2W92A 5F1IB 5AOIA 4RAUB 2GAZB 4H26B 2PYFA 3OZ9L 5F7EH 1A6WH 4NKDB 3C8HA 3VFPA 3O3BB 4DJMA 3K6SA 2K4AA 3GXDA 3LRSA 2CLZB 3GZQA 4NP9A 1XF4B 1NH6A 5F88B 1EUTA 1T1YB 5BV7L 4WI4A 3DDGA 1F97A 3T0EE 5JZ7D 5BV7B 1EDYA 3LS5H 3SY0B 3AUWB 4ETQA 3UTTE 1PDKB 2FGZA 3O0RL 1U2CA 4IHOB 1MPAL 1FL5A 5E00B 1ZGLM 3LN4B 3BC9A 3UROR 3Q05A 2KLTA 1FYTE 3HMWL 5DJYA 5AZEH 4BFEA 4ELME 5CZRA 5J8OA 5KZCD 1QFWH 3LHAA 2W0PA 3QXDB 1T03H 5JTWA 2AXGA 1HHKA 5ESQA 1JZHA 4HZLB 3CVDA 2VLRD 2BJML 3Q3GA 1X6NA 1IB5A 3HVDA 2KI6A 5IJBC 2EXWC 4IS6A 5JR1H 2GT9B 4OF0A 1OWWA 3GPEA 3RVXC 4NIKB 1WAEA 1QLFB 1X9UA 1AKJA 2NQCA 1U58B 2H3NA 2M83A 2EUVA 3X14B 3T4YB 4S1QH 3N9GH 1WBZB 3SE3A 3MRJA 5C97A 5FUCC 4FERA 1BPVA 4FNLL 4UBDC 2B9BA 4F9LA 4NRYA 5D1XC 4ETYA 4NOBA 4ZMYA 3BUIA 4Z7WE 2FHFA 4XBMA 4YHPB 5C0RL 4RGOL 2ZCHL 5J12C 1SF3A 4OCMC 4IJTA 2ZG3A 3LS4L 3HS0C 4OCRL 1U3YA 1NBZB 4NQXB 1PFCA 3UYRL 2XQYG 2B1HL 1JI1A 2ZOKB 4AY0A 4CADB 2ZXBA 4IGBB 4ANUA 4L3ED 2OW6A 1ZWIB 2E75C 1XHHA 4ZPVA 3IDJA 3NJKA 4HETA 4MS8D 1GGBL 2K1MA 1OIOA 1U3HC 3CFIC 3HC2A 1AP2A 1MFEL 2XV3A 3H2QA 5AW0B 4Z3IA 2XJLA 1FG2B 3A47A 1JYVA 2V2TA 1T2QL 3N6YA 3ETTA 1DN0B 2VLKB 3IJHA 1DO5A 3UFIA 2BY2A 4JFZH 2WNXA 2PW2B 4DN3L 5I9QB 3LEYL 4KDWA 4E9WA 3K80A 3EJZD 5F0MB 4BXVA 1BQHG 4LASH 4RGNC 4X6EB 1RV6X 3BRGC 3KPOA 2YWZA 2EYRB 2UY6A 3FB8A 4EDWH 2AJSL 3FPXA 4HHGA 4PV8B 4QRQA 3VRJA 5FF6A 1I8IB 2XWJB 3K91A 4NI6A 5AOKA 4WWKA 2XTJB 3MODH 3HG1D 2E7DA 4RAVB 3RIAF 3V4VA 3KD4A 3T0EC 2P8LB 3QI9B 1RIUH 4GRMB 3RBGA 1SY6A 4ZMAT 5GGSY 3L81A 3ARVA 2P42B 4XZ4A 4F80A 4NN5C 1OTSD 4EIGB 2YMOA 4OQTH 4MA8H 1AGDB 2PMZA 5LWYH 1G7HB 1HWHB 2DQJH 3NCBB 3MV7D 3B34A 3OF6A 5EEWA 2C4FT 4K94L 1KPUB 4TN9A 3B9KD 4PRHB 4HD5A 1UYWH 3S48A 2ICEA 3TEUA 2XA8L 3WTUA 1ZHLB 1TUPA 3IJSA 1S6NA 1ZT1B 2C3HA 2R8SL 5GS0L 1G5AA 5HYEA 5JNYA 4Y4HD 3BPLC 5TFSL 3MA9L 2P24B 2VDQL 4TPRL 4OLUH 1QZNA 2E76C 1JXDA 1FN4B 3QCUH 3QR1A 4X98A 5DWUL 4KK6C 3QZOA 3TBVA 1NCWH 3CGTA 1HZKA 2MTAA 3FQUA 1GZHA 3H9SD 2X53A 3OKDB 4B9KC 3QCVH 4I85A 4JFYA 4LMQE 1CF8L 4KQ4H 3IT8D 1ZMYA 4MMZB 4MSWA 2IGFH 3RVUC 1DZ0A 3TV8A 3D33A 3G5ZA 4NO2A 3ALPA 1NCJA 4IRSA 5JHLA 4MDIB 4H0LC 2ITCA 3D06A 4UB0H 3O2DL 2W60A 1IL1A 1WAAA 1RERA 2YUVA 4KUCF 5E08L 2ED8A 2NXYD 1UA7A 1Q0YL 5TK2A 3WFEL 2Q10A 5TDNA 2R27A 3UBXI 1KBGL 3W39A 1DLHA 1E6JL 3I3BA 2X0UA 3P0VL 4GRWH 5EUKA 1LNUB 1VGKB 2EE3A 2EVIA 1K4CB 3LKQB 3FOMA 5IJVB 5FA3A 1A6PA 2Q3ZA 3REVB 3FFDB 5CMAB 3QUXC 4MD5B 1JGVL 3D85D 3GMNA 3PLYA 4LSRH 5IOKA 4HC1L 4IDJH 2Y24A 2X89A 1IBFA 1ZOXA 2HAZA 5C9JA 1KG0B 2XKNB 3FU8A 3WNOA 4FZEH 1X9RA 5D9SA 3IAPA 4R7LA 3K0YA 1EO7A 4MMYA 5C0GA 2P8MA 3DTXB 3O6KL 1I7TB 5D7SH 3TNMA 1D9KB 3D2UA 1L9TA 3B2UC 4MGXA 5DEJA 3VFUA 4L8CA 1PSKH 3L9RA 5T1KA 1J8HA 4NO0D 1AGEA 3LMJH 2LE9A 4EZKA 2EIEA 5C0FB 5D7JC 3WV0A 1W0VA 4OFPA 2Z93A 2NLJB 4M5ZL 1V5JA 4UV7L 5EZPA 1J0IA 1HESA 3MCKB 1XL4A 2C3XA 3ES6A 5I1JL 4HWNA 2EICA 5C3IA 2A74B 3VU2A 4PCTA 3AAZB 3T08A 1Z3GH 2DQIH 3LIZL 3ZE1B 1AHKA 3AWEA 5FHAL 1J87A 3PRZA 2DEWX 2NQ3A 3MJ6A 3MV11 4WSKA 2C9PA 3VFOB 3ZOAA 3TBCA 1AZZC 3DVIA 4LU5H 1VDGA 4WI9A 4F7TB 1NIBA 1GW0A 1CZ8L 2YD6A 4PJBF 1EVUA 4WW2F 4EBQH 5F7WC 4EIBA 2R29H 4AC4A 3O45B 2VITB 5ALCH 1BOYA 4LKXA 3SBPA 4NWTH 4V2CB 3FQNA 1KIQA 1C12A 2RALA 3NEOA 3DV6B 5CFHA 1B88A 5D93C 1J9CT 1BVNP 1ID5I 3MOQA 4E41D 2CHWA 3UTZA 1EAPA 1D6VH 2XC8A 1XCXA 4LEOA 2FWOA 4Z18A 3QORA 5JA8B 1S7VB 5C0IB 3D3VD 1A2YA 4OSUL 4JLRB 1OP5H 2LAGB 3C6SB 3IU3A 1U8JB 1G7JB 3SDCC 5EUOE 2ITEA 4O5LH 2NTFB 1AZCA 3J27A 3KWVA 1FO0L 2B1AH 3EYFA 2KZWA 1LO0H 1YY9D 1FIGH 5L2KD 1WH0A 4BH7A 2JQMA 3NCFB 4F7PB 4AUUA 3WO4B 1NGXA 3CLWA 1YLBB 2HLAB 1S7TA 2IQ9L 2C1OB 3FTUA 1I7ZB 2N56A 3QR0A 2YOAA 3D39E 2W0FB 3VGAB 1GJIA 2GUYA 3OHMB 5FKAB 2CXKA 1JF1B 3H2WA 4AM0Q 2RAMA 3GZOA 1HNFA 1QLRB 3WFDL 4DFIA 3VXSB 2ENPA 4F27A 1CXEA 3LEVH 1ZGLA 3LKNB 1SDDB 2DWXA 4BQ8A 1IAIM 5CR8A 1OKEA 3BQUC 3QULB 2N01B 2NY5H 3Q8CA 3DO4A 1C9SA 2VB5A 1TXKA 3ARGA 4ZUVB 1CGXA 1XGTB 5I8OL 4GQRA 3MV8A 3TWCH 3VXME 2CRIA 2XZQH 4AIOA 1PW3A 3BKML 5JOEA 2B0SL 4XP4L 3QDHA 4XCYB 1ETB1 3MFFA 3S7GA 3X12A 4HJSA 1OP5K 1QBML 4PJ7E 3FPYA 4M4RB 3WIAA 3EFOA 3GSRB 5DRXA 2VN4A 3DOHA 2CLVB 4JG1H 4V1DE 2RHEA 2Q87A 5DC9B 5IFAH 3BISA 3DURB 3PXJA 2IWKA 3RHWK 3RFRA 2VL5B 1XCQA 1OAUH 4HGWA 3ARTA 4B9FA 4KZCA 3FT4B 1BW8A 3RB7A 3QDAA 2B4CH 5TDOA 5JXAL 2Y6TE 1OGTB 3N43F 3MRHA 3GMQB 4M7ZC 1GGUA 1MIEL 5SV3A 4NRZA 2XFXA 4TULH 3MV9E 1KJ2A 2WINA 1EFXD 1L9OA 2NNAA 3CSBA 3DVNA 3GLDA 1QQDB 4QTIL 4BGLA 1QRNE 1H3UA 1YQVL 2VH5H 2GCYA 3TH4T 1EMTL 4HS8H 3ULVD 3FSWA 4YE4H 4OF8A 1L9PA 3TPUB 2PXYB 3M1BA 4H1LG 3WXVL 2ZAHA 4JO1L 4YH6A 1ZA6A 3L54A 4EI6B 2V3EA 1QNZH 4MS6A 5HGAB 2NDGA 2BW4A 1KFAL 3QZBA 3L4CA 4MDJB 2AKRA 2J21A 3BE1H 4UTBH 1BVZA 3LXBA 3EBAA 4RZCA 5B38B 4IMLB 3T2NL 3MBEB 1OXYA 5EWIH 4WTZG 4TLKA 3RZCD 5E1IA 4TRPH 2DQDL 2ZTBA 4XR8C 2GPZA 3S88H 2ZCLH 5MEOB 3RQ3A 4OCWL 3K1DA 3WKNA 4FULA 2XWDA 4AJ0A 5KANI 4F33A 4P4KD 4G43B 4UWQB 32C2B 3AT0A 4FYRA 3PUUA 2J57A 2X4RB 3ENEA 2HYMA 1RJYB 3DUSB 4XO3A 4H1LH 4CN4A 4LGSB 5A16B 1UJ3C 5AAMC 4M6OH 1DJHA 3RFZA 1M56B 4R7DB 4A6YL 5E70A 3QDME 4FADA 1A1MA 4ONGH 4QR7A 4WKZB 2Z91B 4A6YB 1FNAA 3TGXA 3D08A 4Z7QF 1IBBA 5JXEA 4Z1PA 5D7LA 4PYHA 2IAND 2PWFA 2WXKA 2QMKA 4HJ0D 3DJTA 3W1ZA 2AW2A 2VRAA 3T0DA 1HYSC 3BZDA 4UZSA 3FB7A 1FAKT 1DBJL 4NQEB 3DO3A 3FUFA 5IBUB 4D8OA 4JCLA 2OQJA 1WSST 1PX8A 2YBRB 3U6XA 3MTXA 4WJKB 4YHNB 3L3OC 1I9RH 4FQJL 4LAJH 1U8PB 1INEL 2JIXD 2NY2B 3P4NB 1WZLA 4FFVC 4N0UA 2JKWA 3DPDA 3NJIA 4PRIB 5I1HL 4LDEB 43C9B 4X4ZA 5DC4B 2YPKA 4GO9A 4K55A 4XRCB 3EO0A 3QDJD 3V9CA 1PZBA 1MFBH 3T2QA 2D03L 2NYZA 5LGHL 1KYUA 2BNQA 5HY9A 1F58H 3KPLB 5DRZA 4C56B 2BHFA 5F7DA 1NFDB 2PO6B 3MRDA 3V6FB 2OX5B 4IBYA 4CRPA 3EDJA 3UTQA 2EYSB 3WHXA 1AD9A 1EZLA 3ET9F 4GKSB 2O5ZH 3GXUB 3VXOB 1BF5A 2JQAA 4LSVL 3IETB 3T0ED 1FVCB 2ZUWA 4N8UA 2A9BA 2R2EB 3O3DA 4HEMA 2GK0A 5HGDA 3ZYOA 1WC7B 4LPCA 4W70A 5F1SA 1J0ZA 4MJ4A 4UQAA 3WLWC 4CSZA 4ZOAA 3X11A 3M1OA 5E8DL 2MHAB 2QLVB 2UZYA 3CU7A 3ZTCC 4PJCA 2R2CA 4L48A 3QNXA 1KUMA 2HJFA 3GRWL 4H8UA 1I1YB 4KKCC 3WE6B 1P4BH 4N2NA 3FRUA 3CHQA 4OT1H 1F4XH 1RY7B 1T21B 2BHUA 5HHVL 5DJAA 4BFFA 4EI5C 5EBWB 3WIFA 5B39A 1GW6A 5CEZE 1JNLL 1GAFH 1NC2A 1MXGA 1QVOA 4K8RC 4R7VA 2KQNA 1G9EA 5EO0A 4A63A 1VENA 2X70B 3AS2A 3N91A 2BIIA 2GBUA 2YGPA 1CS6A 5F6HI 4U0RC 3F5WB 4JHZA 3V52L 4W9JC 1J10A 1N10A 4WI0A 1EEYA 2A6KA 3V0HA 2PETA 3VGGA 2Z64C 2R4SH 4HDIA 1TIUA 4GFTB 4P2RD 3BZFA 2FZ3B 3VB9A 5BQ7A 3S36H 2IWGA 2V2WB 4S1RL 4D9LL 1GC1L 4JGNA 2CKBA 1FFTB 1M6OA 4XB7A 2RGSA 5HYSA 1I1FA 1FHGA 3FYEB 1W72L 3DETC 4UM9A 4HVBA 4YLBA 5C08A 1W72B 4TQEL 2D2OA 1XF5B 3TURA 4KVPA 5BOPA 5C8JB 2HKFL 4ODHH 5HHQA 3HHSA 3RL2B 4RA0C 3FU3A 1JPSH 3KXFB 1BMZA 2O26U 3BGMA 5DZJA 4MAYC 4NLAA 5CILL 3MU3A 1OGPA 3HHRB 3IMUA 1V7ML 4Z0BH 3UBFA 1TZIB 1VEOA 4R4FH 2QQQA 3NIGF 1I8KB 4G82A 2Q7NA 4P3DB 4OBRA 2VR4A 5D72L 3JUYA 2UUDK 5HYIA 3ARPA 3GI9H 3K1KC 2CRYA 3ZU8A 3ABMB 4UILL 4J3TA 1OCWL 4XHJD 5ECJE 2EXYC 4P23A 4OFYD 3VD0A 3S5YA 1K72A 3VGHA 3H6JA 5E4OA 4IBUA 1LO2L 1NCNA 1SF5A 1Y18A 1LJMA 2VXTH 2ZICA 2AMGA 1CYWA 1P4IL 3G6AA 3HNSH 4J7RA 3TNNA 1TU2A 2BSED 3WEOA 1CD1A 2F58L 2DLGA 3OKMA 3KYMA 4JN2A 4RETB 4URKA 4GKZA 5TE4H 1LE5A 1KTJA 5CD5C 5FO2A 1EHXA 4OFIA 3HOGA 3U0PB 3KBPA 1SUJA 4KY1L 1TYRA 4KK5D 4A7VA 2NR6C 2P3YA 3B6SA 5GS2D 3SY6A 5I16A 2Y5TB 4GQ9L 4R2GB 3FBKA 2DIAA 5JOPE 4K3GA 3TO4B 2R69A 2ZYSA 5KJRH 1E5BA 5CEXB 1G9ML 2P8PA 4W9KC 2A7BA 4P57B 1A64A 1D7CA 5I18H 1SYVB 3QHZL 1A3QA 2ID5A 1HEHC 2BS8A 3RYMA 4EZLA 3VQ1C 4NKOA 4ZTEA 3LJ3A 1FFNA 4L4VA 3U1SL 1JGUH 2DM3A 3OPZH 3ZE2E 5DJDA 2FYYA 1QUPA 1R19A 4XVJL 4PS4L 1NDMB 7CGTA 1IGJA 3TS8A 2PW1B 5LBSA 2VLME 3BP6A 4MKTA 3RGVD 4AL8L 2E6JA 2GTZA 2KZ1B 4CAGA 3VG0L 1GGIL 3CVHA 4DESA 3WENA 2JKSA 3BEWB 1TCRB 2YGNA 3JSSA 3SGDI 1BJ8A 5IVZA 5I8KH 3UADA 4JPKH 3QEGH 1VFBA 5ANMA 3REWB 3QK0A 3POHA 5EU5A 5IVXB 1ADWA 3COOA 1CE1L 4JJHA 3T4AB 3GMMA 2FX7H 3DX6B 1CO1A 2IPUK 2BMKB 1FGNL 4LIQL 4PJ8D 5DHYA 2NY7H 2Z31C 3QDGB 4Z5RA 2H6OA 5SWQA 4HXAH 3EHBB 1Q0XH 1J8HE 5HBBA 4K5NA 1X7QB 2V7NB 4MA3B 2V8LA 35C8H 4BFKA 5LN4A 3WEXB 4WCYH 1E9PB 1SHWA 2WUCH 3RJDA 3X1BA 1CN4A 3RWCA 3OKLB 5TPWH 6FABL 1A9VA 2G30A 1OAYL 3V5KB 4U1HB 5EDXA 3AQXA 1QFWM 3BH8A 2IDQA 3NPZB 4X5RA 3UAAA 1K85A 3UC0L 1MCOL 3R1GL 4AWJC 4HUCA 2OYMA 3STZB 1YNTB 2MWCA 1IAOB 5A2KH 3Q6GH 3I6KA 1VZGA 3MXWH 4YK4C 3KLHC 4MCNA 4OGAD 1ZLSH 4Z3FA 4NXSA 4YGVB 2NY0D 3ZYIA 4I0PA 2A77L 3VXQA 2EKSA 2QGBA 1AHWA 5J7CC 4LCUB 1BBJB 5BS0B 1B4LA 3MPCA 1UH2A 5F7NC 4U1KA 3PAVA 1IC1A 3EZJB 5CN2A 4TVPH 1DUYB 3KAAA 3PJNA 5C92A 3IEAA 1KTDA 1GZHC 1ADQL 1HH9B 1TVBA 2A5UA 4PSPA 3H53A 4P99A 4OJYA 1TSHA 5ETUA 2NXZD 2EACA 2ZUTA 3ZE0F 2WBJA 2CIIA 4JEGB 2EXTA 4A2EA 5J1AB 2C9XA 4GBXA 1R0AH 1GGTA 3WE1A 5EH1A 5J12B 3IMSA 1JTPA 1OT1A 4IRSC 4MNGB 4UDUB 1CFNA 4ZD3L 3U4AA 4D2NA 4B41A 3BIAX 1ECYA 4EKJA 1L5GB 4JDZA 5FPIA 4OLZH 1B3JA 2DQHH 3JV4B 4RNRB 2EINB 3VE0A 3T0BA 4IKJA 1SBSH 2VXQA 3TJHC 4DQOL 4KMTL 4QKTA 3APCA 4UT6H 4G7YL 1U3HB 5JLZB 4QXTB 4NPKA 3U7WL 4P2CG 1NANI 5DD0H 2HX8A 2BVTA 2CH8A 3CC1A 3RE0A 3ZIYA 1D6EB 4HGMA 4WI3A 3B3BA 1N6QH 2R56L 1FRGL 4KOBA 4KTEH 3HE6B 4X6BB 2K3TA 4DP2X 3C5ZC 3FB5A 3QJOA 1DEDA 4BV1A 5BO0D 1ACCA 3UEQA 3WXWH 2RB8A 1F2XK 3DMMA 3NH7H 1S7WB 3VQMA 5CZVH 3WD5L 2BNRD 2NY1D 2VDRB 1HDMB 4WFGD 3GJEB 4DGIH 5JHMA 4XAKE 1A5FH 2XN9B 3RWGA 3PG2A 2X12A 3MV8E 3WNKA 2F1EA 3JWOC 1BZOA 1X5JA 1XIWC 2MNWA 5BXFB 3SCMA 1EHLH 1G9NL 1KENH 4ZUTA 1SJEA 3A24A 4B9CA 4HS3A 4YDKL 5A7EA 2KUTA 1S7SB 4DO4A 2K7PA 3ZDZB 2C7FA 3D39D 4X42A 3WS3A 4V2BA 4X5WA 2TSBA 1JL8A 2FDBP 4JUSA 1YZZA 1Z3RA 1CWVA 1RULH 2LT9A 5DS8B 4PBDA 3IFLL 3GRBA 5C07A 1JJUA 1HOCA 2E9WA 4Z7NB 3CU1A 5KANG 1QI5A 2VQUA 4JL1A 2WTPA 3U4KA 3JV6A 4I87A 5DEGB 3B3IA 4I3SH 3TZVD 4YAQA 1N3NA 4Z7VB 5I6NA 4YXLH 3T1FA 4I18A 4NP4L 1J5HA 4ZZFA 3NABL 1N4XL 2FQDA 2B2XH 4NYLB 3EF4A 3EOAA 4PS8A 4CSPA 3KLLA 5IMKA 4O2FB 5TF1L 3CFEA 3II3A 3MLWH 3Q8AA 3QJXA 5FGSA 3GSNA 2HJKB 4D0BB 2VDNL 1WS8A 1SEQL 3ARUA 2VDNB 3TO2B 3WY1A 1EO8H 1GMEA 2PR4L 3QVAA 5GGQL 5LKNA 3IKCA 5EORH 4JREC 1KCSL 1SDAB 1V8HA 2IBZY 4KRPB 4U1NA 4Y5XC 5GRJH 5D7EA 4Z7WB 1VADA 4YDMA 1HZHL 1RUKH 2UYLA 3BW9A 5GGRY 2J6EA 3F6LA 2ZWKA 4KITB 2AC0A 1EGJL 3S8GB 5I0XA 4PGCB 4PVNA 4YBHA 1TYJA 3ULSA 3NSJA 4JRXA 3UZQA 3VI4A 2ITFA 3S3DB 5E8PB 5HTSA 4DERA 3QG7L 4QRPD 1J0KA 5C7XH 3L9BA 1A0QL 1E2VA 3QG6B 1P6WA 3V10A 2PPFA 3QQNA 4PREB 3OR7A 3GK8H 4JDEB 2J4WL 3NCWA 4NQVB 4UT7H 4FNPA 1LO5B 2GSMB 5HI4D 1G6RA 4Q14A 1R3JB 4XI5D 2E7MA 3FTWA 4X80H 1FVDB 5KW9L 3ULUL 3SD2A 4R3SA 5C0EA 4IKKA 1K2DA 5DQ9A 4WUUB 3P77B 4MCYA 1HIML 5JYMA 4WDIA 4RGMB 3UG5A 3CXDL 3S5LA 3BJLA 4F5CA 1H3XA 4ZUUB 3HI1B 2H5UA 3N42B 2NT1A 5LXGL 1XB8A 3ARGC 1HXYA 3WEMA 1W80A 3BLKA 3NP3A 2CDEA 4GI6A 4EI5D 5FYLL 1IAKB 3QFDB 3GC3A 2YMXL 2P44B 3LKRB 5F9DC 3ZRFC 3K6DA 1KTKE 4FKKA 5E5UB 4DW2L 3GIZL 2APXA 4AJVA 1BIIB 4CSTA 2JCCA 4N0UE 4NJ9L 3QT2A 1EAJA 4MNHB 1ND0A 5DYOB 4UTAL 4OLEA 5BZDB 2ZUUA 2J88L 2ZE0A 7PAZA 1NBVH 3GHBL 5KVDL 4JPIA 1OPGH 1U9KA 2BNQE 1N5AA 1JWMA 3UOAB 5IB2B 4OFQA 5JO5B 3FCUB 4JX0A 3QQ3A 3B9AA 1XB3A 5G2NA 3OZ9H 3L5WB 5DJ8B 1WA2X 2PCPB 3MRLA 1JGEA 1GZPB 4NUPA 1USQA 1FCGA 2G75A 5BV7H 2AFNA 3CJJA 3KYKL 3ALXA 5FO9B 1UOKA 4ZSOB 1DZBA 3V6OC 3O0RH 1FYHB 4HEME 1PEZA 2A99A 3OHXB 2Q0ZX 2J8OA 2EDOA 4CBZA 4BDVA 3HMWH 3KPQB 4K9JA 1NM4A 5D93B 5DHMC 1Q94A 2YPLA 3BVNA 5EZJB 1HL4A 3DXAA 1DO6A 1A7BA 4PJCE 4KROD 3MACL 1M1XB 4HJ1A 1R3LA 3HZMA 4JPQA 5BUPA 1TTAA 3H2PA 2BJMH 1Y1UA 3SDCB 4LOFA 3P4OA 1G9HA 1WK0A 4OTXL 4K3EL 1YMME 2OJEB 4PRPA 1G7IB 2ZP8A 4KKBC 1P1ZB 5K69A 3LQMA 1CFVL 2Z8VC 3EKCA 5GS1A 4LPXA 3PWNB 4YFLI 4N86A 1XGQB 1S8DB 1T5WA 2WKOF 4OUUA 1GZQB 4LLWA 1EDQA 1FE8H 4W81A 5B1BB 2YD5A 5EC2A 4C83B 3H9ZA 3T3ME 3X3GL 3KPNA 3L1OL 1E5UI 3OC5A 1SXSA 3TL5A 3K81A 3G5WA 4Z95L 4U6XA 4UMSA 1A6ZB 5IWLC 5DURD 1DJIA 1T83A 3MJGX 5C0RH 3NFPB 4MJJA 4DCQB 2ZCHH 3IDIB 3PWJB 2OA9A 5F6IB 4JHUA 4RFEB 3NRQA 2A6JA 5C08E 3SPIA 1KLFB 2XBZA 5K1NA 4ZFOL 2DV6A 2FQGA 2ZWYA 3BQUB 4MNQD 3UYRH 2B1HH 3NSDA 4Y2DC 1N2RA 3GHEL 1LD9A 2W8CA 1IGIL 5E0QA 1UADC 4NPYA 3OLGA 3L17A 1L0PA 2ZX6A 1GGBH 3CQPA 4L8DB 1F3JA 5EHFA 1MFEH 4QHMA 2Z92A 4XMXA 1RJZB 1IFRA 3JTSA 4X8GA 3ECQA 1T2QH 5FLVA 2FT7A 1G4MA 4UINH 4PGEB 4XMKL 5DA0B 4HH9B 1DVZA 2VRKA 3MRGA 1IGFL 3UBHA 1MCDA 2YRLA 2WQVA 3LEYH 2MSPA 2CG9X 5CZXC 4CVZB 3V8CA 1MCFA 1J1XL 2C9VA 3E0GA 3EYSH 2QBWA 1ZPUA 4U6VL 5KSBB 2J8UA 2CUAA 3HNVL 5IHLB 1UXWB 1IQWH 3LNFA 3D25B 2AJSH 2GUOA 1RZJC 4D3CL 3U48A 4M7ZB 1WA0X 3V5HA 4WWKD 3SO3B 3IPEA 4YHYB 4JPWL 4XOBA 3R8BB 2J1YA 5BQDA 4APQA 4CMMA 4E5XA 3MNVB 2D7QA 2ORBH 3MRFB 3AG1B 4LSSH 1DQKA 5JOFA 4F37K 1GS6X