2IH9A

A high-dose crystal structure of a recombinant melanocarbus albomyces laccase
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
559
structure length
559
Chain Sequence
EPTCNTPSNRACWSDGFDINTDYEVSTPDTGVTQSYVFNLTEVDNWMGPDGVVKEKVMLINGNIMGPNIVANWGDTVEVTVINNLVTNGTSIHWHGIHQKDTNLHDGANGVTECPIPPKGGQRTYRWRARQYGTSWYHSHFSAQYGNGVVGTIQINGPASLPYDIDLGVFPITDYYYRAADDLVHFTQNNAPPFSDNVLINGTAVNPNTGEGQYANVTLTPGKRHRLRILNTSTENHFQVSLVNHTMTVIAADMVPVNAMTVDSLFLAVGQRYDVVIDASRAPDNYWFNVTFGGQAACGGSLNPHPAAIFHYAGAPGGLPTDEGTPPVDHQCLDTLDVRPVVPRSVPVNSFVKRPDNTLPVALDLTGTPLFVWKVNGSDINVDWGKPIIDYILTGNTSYPVSDNIVQVDAVDQWTYWLIENDPEGPFSLPHPMHLHGHDFLVLGRSPDVPAASQQRFVFDPAVDLARLNGDNPPRRDTTMLPAGGWLLLAFRTDNPGAWLFHCHIAWHVSGGLSVDFLERPADLRQRISQEDEDDFNRVCDEWRAYWPTNPYPKIDSGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A crystallographic and spectroscopic study on the effect of X-ray radiation on the crystal structure of Melanocarpus albomyces laccase.
pubmed doi rcsb
source organism Melanocarpus albomyces
molecule tags Oxidoreductase
molecule keywords Laccase-1
total genus 179
structure length 559
sequence length 559
chains with identical sequence B
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2006-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ih9A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ih9A02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ih9A03
4KNUA 3AG1B 2AVFA 4YSCA 2UX7A 3T6VA 3EF4A 3S3BB 1OE3A 1XB8A 3NJMA 3ABGA 2UXTA 4WKXA 1MDAA 1BYPA 7PCYA 3ABKB 2VMJA 3QJVB 1AOZA 3AG4B 1PY0A 3UABA 1CYWA 4GY4A 5I6PA 4X4KA 3WIAA 2HZHA 1AS8A 3KW8A 2JFCA 1HAUA 1V54B 1IKOP 2CJ3A 1ADWA 2PCYA 1N68A 4UANA 4YSAA 1YLBB 2Q5BA 2XXGA 3X1EA 1JXDA 1GYCA 4M3HA 1PNDA 4KOBA 2PPFA 2GSMB 1KYAA 1FA4A 2I7SA 1WA1X 4DP6X 3FSVA 4A2GA 4HIPA 3PAUA 3UACA 4GP5B 1X9RA 2IWKA 3H4HA 5I5JA 4P5RA 2Q9OA 1W6LA 3MBWB 4QKTA 2B08A 1TKWA 2FWLB 2BW5A 4MFHA 4DP1X 4F7KA 1M9WA 3QJUB 1DYZA 2YAOA 1RZPA 1ID2A 5TK4A 4YSDA 1X9UA 1AIZA 1SHXA 4DP0X 1PCSA 2VM4A 3WNIA 4NB7A 3NJJA 4JHUA 2PPDA 1J9RA 3NSCA 1AACA 3S8FB 1JZIA 1A4AA 4DP2X 2YAHA 4DP8X 2AANA 3FU8A 3OMIB 2CUAA 1J9TA 2XWZA 2FNWA 1SDDA 3CVCA 1AAJA 3PLYA 1ZDQA 4KO9A 4N4YB 3ZDWA 4F2FA 1SHWA 1SJMA 1UATA 2ZXWB 2YARA 1OCRB 3EH4B 4NAJA 4W9ZA 1AG0A 2J5WA 3NJIA 4L0PB 3GXUB 1KGYE 3FS9A 3X1NA 2PP8A 3IEAA 4DPAX 1WA2X 3FPYA 1L9TA 1GW0A 1NINA 4YVUA 1KCBA 4G7RB 3WNJA 3PAVA 4BXVA 1JZJA 4G70B 4NERA 5F7AA 2AZUA 2DWTA 4E9YA 4CSZA 1SDDB 2IDUA 1OCOB 1AANA 3T6WA 2TSAA 3ZIYA 2BP0B 1QHQA 3TASA 4HHGA 1BXUA 2CALA 3PAZA 2OCCB 3CDZB 3ZBMA 1HFUA 2Y1AA 4YSUA 2CBPA 1PF3A 2PP9A 2EINB 2J56A 5I6NA 2XLLA 3WI9A 1NTDA 4KNTA 3GYRA 4DPBX 1JZFA 1ZIAA 1KV7A 1GS8A 2FQFA 5B1JC 3NJHA 3SBPA 2PCFA 2UX6A 2GI0A 5I6OA 5B1AB 2IAAC 3NSDA 2XVBA 1KBVA 4BWUA 4P5SA 3CVDA 3T6XA 1ET7A 4A2HA 4UAHA 4GXFA 3MX0B 1ASOA 3C75A 1AZNA 4DP5X 1OE1A 1PZCA 2J57A 3NJKA 8PAZA 1TU2A 2ZWNA 1AZUA 2DV6A 3SBRA 3SQRA 3IE9A 1BQ5A 3NSFA 1IBZA 2Y69B 2UXGA 4JKNA 1JXFA 1OV8A 2J55A 4E9XA 1XB6A 3OMAB 3WKQA 3TU6A 1L9QA 5ANHA 4EF3A 1SFDA 3CZUB 1MZYA 2CAKA 3V9EA 3BVDB 3GDCA 2E86A 1PAZA 1PZAA 3NJFA 5I28A 3ZX1A 2UXFA 3QJRB 2BO0A 3AG2B 1B3IA 4TXVB 1TEGA 3ABLB 2W8CA 4G71B 4F2EA 4HZ1A 2PPCA 3HB3B 4E9SA 1ET5A 2IWEA 5B1BB 3H4FA 1ILUA 5D4HA 1GSKA 1NWOA 5A7EA 1SF3A 2FT6A 2XX1A 5F7BA 1MG3C 3FU7A 4JHVA 5AKRA 1ETJA 1AZRA 1JZEA 2XV3A 5PCYA 4DP4X 4DP7X 2BWDA 2OJ1A 2H3XC 3EH5B 4PCYA 3TA4D 3CVBA 3FSAA 6PCYA 5EHFA 1A8ZA 2XXFA 4BDVA 2FJSA 2XX0A 3V9CA 1E5ZA 5I5IA 4HHWA 2FQEA 1I53A 1J9QA 3AY2A 4PAZA 2YAFA 3WG7B 2FT7A 3NSYA 1ZDSA 4BWWA 2P80D 1AS7A 2DYSB 2FQGA 3UGEA 4AKOA 3L45A 4YSSA 2P80A 2B3IA 2AFNA 2HX9A 1AZBA 3CG8A 1JOIA 1N70A 2BP8B 5B1KA 2YAEA 1PLBA 2IDTA 2RACA 2AZAA 3KW7A 3SBQA 2XV0A 1KBWA 1ILSA 3QJTB 4K9JA 3QJSB 4UF7C 3JT2A 2PPAA 4YSTA 1E30A 1GS6X 2A3TA 1OF0A 3FQYA 2FQDA 1EZLA 1XMEB 2IH8A 3OMNB 1SNRA 1BQKA 2PLTA 3T9WA 4BK5C 1A65A 2YAQA 3ERXA 3OM3B 1CYXA 1R1CA 3RYMA 2EILB 1QLEB 3IN2A 1KDIA 2HRGA 4A68A 3OQRA 1AR1B 1EHKB 4E9RA 1VLXA 2GBAA 1NICA 4ENZA 1AQ8A 1NDTA 4GYBA 2EIKB 4YSQA 1BYOA 1TEFA 4AX3A 2VN3A 4ZK8A 3EHBB 3PXLA 1T5KA 1NPNA 5D4IA 3FYIB 1A4CA 4N8UA 4AZUA 4KOCA 3FSZA 4RH4A 2BZ7A 2LLNA 4A2DA 1PMYA 2HLEB 2NRDA 2IH9A 1BXVA 2EIMB 2XU9A 1PLAA 3NJLA 4BWTA 3UAEA 3QJQB 1IUZA 1OCCB 1L9OA 1J5CA 2XYBA 1J5DA 4Q89A 4KNSA 9PCYA 4KO6A 1OCZB 1JZHA 4QLWA 4AKQA 2XV2A 1SF5A 1SFHA 1E65A 1NIEA 1CC3A 3OD3A 4BDVB 1RCYA 2VW7A 5B1JA 1QNIA 3FT0A 3PCYA 2BZCA 1OE2A 1IBYA 2IDFA 2JKWA 2VW4A 2GC4C 4W1TA 2GHZA 5I5MA 4HALA 2YXWA 2WO2B 2I7OA 2YAPA 3CDZA 1W6WA 2IWFA 3NP3A 5I6KA 1L9RA 1ASPA 2WO3B 2HX7A 4A2FA 1F56A 2VSKB 2PPEA 2HX8A 3BQVA 4FA7B 1V55B 2DY2A 1KCWA 3AZUA 4YVNA 1L9PA 1V10A 3QQXA 2GB2A 3TBCA 3S3CB 6PAZA 3NYKA 1CUOA 1AZCA 3T6ZA 4GP4B 4A2EA 2QPEB 5B7MA 5LDUA 1NPJA 3NT0A 3U25A 3X2QB 1NWPA 5B3SB 1NIBA 2TSBA 3FQ1A 3S3DB 1URIA 1L9SA 2JXMA 7PAZA 5B7FA 4FAAB 3DTUB 1FFTB 4E9VA 1GY2A 3H56A 3FQ2A 2VW6A 5I6LA 1RKRA 2DYRB 3HEIB 4G7SB 2MTAA 2YAMA 2PP7A 4GP8B 5IY5B 2GC7C 3QPKA 1JERA 4HCIA 2QT6A 3ASOB 4Q8BA 2BP8A 5E9NA 3D12B 4DPCX 1WS7A 3X1GA 1GY1A 3AG3B 2BW4A 3DKHA 1WAEA 4YSEA 5I6MA 3G5WA 2EIJB 1PLCA 2BWIA 4YSPA 3WKPA 2R7EA 1WA0X 2BP0A 2IDQA 2X87A 2YQBA 1CURA 2QDWA 1M57B 1PNCA 4A66A 4YSRA 2H47C 4HCFA 2CCWA 1A3ZA 3AW5A 1MG2C 1BEXA 1A4BA 2BHFA 2QDVA 2DWSA 4WTQA 3ABMB 4KO7A 3UADA 1MZZA 3N55A 3X1FA 1ASQA 1NIAA 3IN0A 5PAZA 4YL4A 5B7EA 5AZUA 3T71A 1RZQA 2WSDA 4G7QB 2YXVA 2VSMB 1PZBA 1NIFA 2XUWA 2MRYA 3JTBA 4BXSV 1BAWA 1J9SA 2R7EB 2FT8A 2QPDB 1JVLA 1BXAA 1E67A 1M56B 2W88A 5D4JA 3FU9A 2VM3A 4E9TA 2ZONA 3FU7B 5FC9A 1IC0A 4HCGA 3PPSA 4E9WA 1AS6A 1ZIBA 4A67A 2IDSA 1KDJA 3FPXA 2HRHA 2FTAA 2OV0A 1ZV2A 3FSWA 2N0MA 4E9QA 2X88A 1HAWA 5AFAA 1JZGA 5I26A 1W8EA 1NIDA 3X1BA 1AG6A 3DIVA 3NJGA 3IBOA 1WS8A 3TBBA 1JXGA 3ASNB 3NJNA 4M4RB 4HAKA 2H5UA 1OOWA 4CSPA 2I85A 1BQRA 2HXAA 1GS7A 3FYEB 1ZPUA 2ZOOA 3EH3B 1JVOA 3N2JA 1E5YA 2GIMA 4DP9X 1ET8A 1GR7A 5TK2A 3S8GB 4AKPA 4G72B 4KO5A 4AI7A 3UAAA 1DZ0A 1NZRA 3NP4A 2UXVA 1XB3A 4YSOA 1FWXA
chains in the Genus database with same CATH superfamily
4YO0A 2WB1A 2OMNA 3NRFA 4X9HA 4UTBA 4Y16B 3WV0A 5JIIA 4C47A 1AE6H 4Z7OE 3UEZA 4WJKB 4ZW5A 3DOIA 2XBTA 3V8CA 1SLVA 5DD3L 1NCDH 1V27A 1TFHA 1KLGA 4GSUA 4LGPB 3O4LA 3E8VA 4U1IB 3MOBL 1BLNB 4RFEA 5D1QD 4DOHE 5AG8A 4I89A 4N2DA 2AV1A 4JHAH 4L8SA 4YUEH 2CLVA 4FFVD 2R2EA 3D0VB 3MJ7B 1CE1L 1GGCH 4PBDA 4XMKL 1SUHA 6CGTA 5IT2L 1TU2B 4Z0XA 4J6RH 2PO6B 2FYYA 3G04A 3IMVA 3MBED 5IB5A 3L3OB 3GDBA 1DQIA 2HYMA 4FG6C 4Y1AD 4IRZH 3V5HB 3TZVD 4XVSL 4YXHH 1S7UA 5HYIA 2OSXA 4G8GA 4DVBB 3QUMH 1P7KA 5E4IA 2BS71 4DAGH 4KROC 1LHZA 2IANB 5DVPA 4PRPB 5ITFA 1JF1B 1KGCD 1N64L 2DQEH 2VLKE 4XCEA 4LEOA 1J1OH 5E8EA 4ZUVB 3BYYA 1B2WL 3DHMA 4M5YH 2APSA 3FCTA 4N1CA 1RI8A 3BYTA 4GW4B 5F7NC 5HHQA 5DSCB 2EDRA 5IROD 3FB7A 4X6BB 2YMXL 4WCYL 4JFUA 4E41D 3L4VA 5C0AB 3VSVA 4JFDE 4ZMAT 3JXAA 1W0VA 4NO0D 4B9KC 5IM7B 2AXJA 3GD1C 1YEEH 1G1OA 1Y6MR 2H4EA 1AD9B 3P4LA 4X50A 1YEEL 1FG2A 3VXNB 5F7YC 1WGOA 2WLLB 4WENB 2FSDA 1TLMA 4TQIA 3IDYC 4J3OG 5GZNA 4WEBL 1ZVSA 1YNKH 3MOBH 2WKOF 4JFEE 3FAWA 2CMRH 5I9QC 3U2SA 2BSTB 2OTWA 5DGQA 4LIQE 1XSJA 3WLBA 4LSRH 2ZXWB 3T8MA 4W9ZA 1KXQA 2XY1A 1KTDA 4M48H 1KGYE 1WYJA 1BZDA 4GRLD 2AKRA 5K69A 3S96A 1NLBH 4FQXC 5GS0H 4FC3E 1B0WA 1EXHA 4ZDHA 5FHBL 4YXHL 3HG1A 3QWQB 2VSDA 3ROOA 3QUML 1EA9C 2PETA 5HYSB 5T3XH 3SD2A 3OAZK 3C6LD 5GS0C 4G8IB 1S9YB 4JFED 4U05A 5D1ZC 4YHLH 1LO4L 3S3SA 1S7QA 3HNVH 3LS5L 4KU1A 1P4BL 4UT6L 4RA0C 1AIFB 4UM9B 1KENL 4YQXH 1HHHB 2CKNA 3HE7D 5KVEL 3PAZA 2OCCB 4J3TA 5A2IH 5I17A 3G04B 5IB5B 4GMSH 2BFVH 4RZCB 2EINB 3DVNA 3E38A 3ESVF 1YPZE 3O0RH 3RPIA 2MCMA 4AGPA 5D1QE 1JNLH 3WI9A 4NN5B 2IPKA 4NQEE 1U6AL 1Q0XH 1BM7A 1F4WH 3VRJB 3HG1D 4Y5YA 5CEXB 5J56B 4G7YL 4GAAA 4X6DE 5E6YA 3VWJA 4MSWA 4R0LB 5B1AB 5ICXA 3RJDA 3WDJA 2CKBH 4YNYB 3ATAA 1XF5A 2CKBL 1I9JL 4XCCL 3V95A 1AZNA 4EI5A 3TS8A 2ZYRA 3MBWA 3ARWA 3APCA 4PRNA 5C07B 2R15A 4K3JL 2ZCLL 2UVEA 4UNIA 1X5JA 4KRNA 2A0LC 3WDHA 3SQRA 3BP6A 2EDKA 1JGUH 1FLTX 2X6BA 3FF8A 1VFAA 1I8AA 1FVDA 4F58L 5JHLL 2BY2A 5IKCA 4MDRA 2OMYB 3TO2B 4HPHA 4ZPVA 1NOAA 3CFEB 1ETA1 5IF0B 3CGTA 2R29H 3GHEL 4PJIF 1UB5A 4W9JC 3QG7L 2VLKA 1EO8L 3F7KA 5JOPD 1TCMA 1RURH 1F1GA 4LAJH 4JFHD 3CPLB 2XYCA 4FTVE 5FOJA 4LSSL 2YPLB 1CLYL 4IQHA 1MQ8A 4H8WL 2OSWA 2YPVA 5FYLE 1C7TA 3HB3B 1OHQA 1N6QL 1XL6A 2A83A 4XVSH 4TSBL 4I9WD 2UZIH 4PJ5A 5EZIH 1NCOA 3MCLH 3ZDYF 4JM4L 2JCWA 5ICYA 2E4FA 1BQHA 4C56A 4PJEB 2OL3H 2L04A 2OP4H 5K59F 2QQLH 1HYSD 4L0YA 1I9IL 1WE5A 4QY8B 3UYOD 4J3BA 2OJ1A 3VYPA 1AXIB 1RZ7H 5EV7A 4J27A 2HVJA 2Y7SA 2YUXA 5D71L 2YPVL 4PWIA 4HXBL 2DTML 3O9WC 1LEKA 4BFBD 5C0CD 1JI2A 2FQEA 1DVZA 3RTQA 4JANB 5HDBE 4NNXB 1Z5YD 5J4MA 5E24E 4XNUL 3DTXA 2FQGA 3RPKA 3UGEA 3MRDB 1X5LA 3MVSA 2P80A 1NM4A 3QQ4B 3Q05A 2IAMB 4ZX3A 3VRJA 1BREA 4LT7A 4KJPC 3WE1A 5JO5B 3RWIB 5E08H 3DROA 2JJUA 1P1ZB 4MCZA 3MXWH 3UTTD 4WJG3 1UJ3B 2NR6D 4JM2B 3STLB 3UZQB 3D4GA 4K5LA 1QSEE 1UUNA 2V7NB 2F58H 4A1RA 3GO1H 4HEMA 1RFDL 3O8XA 3ZO0A 4LEEA 4NQCA 2AGJL 4K8RC 2FX9H 5F3HB 2WIMA 2LVEA 1YJDH 4P04A 4J23A 4PJ7A 4EN3B 3T0AA 4QRUA 3AB0C 3ERXA 1CF8H 4HEME 4KX9A 4BKSC 2H32B 3N1QC 1PEWA 4ALAC 1Y07A 3NGBC 3BRDA 4HCRH 2QADD 1MWAA 3K2IA 2C4FT 3A23A 3IN2A 3UTSB 1AH1A 4QRRE 2B4CL 3PP4L 2NY4C 2BP3A 3HLAB 4NHUA 1JFQL 3V0JA 2QR0B 2B5IC 4FULA 3BGMB 4I0PD 1PY4A 2Y0SA 4WCYH 5A2FA 1GL4B 4KOCA 5BRPA 4R97B 2XTJD 1KIPB 3QI9D 5C0AE 4HHAA 1PMYA 1VFMA 1NSNH 4IKLA 4EDWH 4XNUH 3QCUH 5D70H 5I2IA 4DN3L 1ESOA 4AUJA 1A5FL 4LKCB 1CL7H 5E4EB 4ABVA 5I0WA 1S78C 4TV3A 4BWTA 4DGIH 2Q10A 3C8HA 4OKDA 4PJEA 4CC1A 4FQXA 4AIOA 3U36B 4TQ8A 3RGHA 3CC5A 4Y1AA 2OTPA 3HVDA 4ZAKA 3BQUB 3ILDA 1ZV5A 2PYED 4N8CH 4XMLH 4CVZB 4Z7QE 5I1KL 2IOOA 2F58L 1NIEA 1PL3A 4Q0XH 1RFDH 3GSXB 2LW3A 4K3JH 5DFWH 2IOMA 3M17A 5I18L 4EIBA 4XMWA 4IOSA 1T66C 4G43A 3KG5A 4Y2DA 2GC4C 1F4YL 4M8VA 3BEWA 2FUTA 5E2UH 1TT6A 3FFOA 5DRZB 4RNRA 2I7OA 4NKIH 2UY6A 3OC8A 2X4PA 3P1VA 3NP3A 4XPBH 1JGDB 1TVBB 3QUYB 3BSZL 3V5DA 4P2OD 4P5MB 1SQ2N 4XNDA 4NENB 2DY2A 4W6YB 5DLLA 4J3OF 3G6JA 1KCWA 2FB4H 2QLVB 1F6AB 4OQTL 4HBQA 5GGSY 3QEUB 4DKDC 2D4DA 3QP3A 1K9TA 1WZKA 3Q2WA 4KVCH 3NT0A 3JV4B 3D18A 5KVEH 2OMWA 4MZIA 5MI0C 4I0PA 2WWNA 2TSBA 3HG0A 4P4KA 2Z8RA 5FV1L 4O4YL 5AD0B 4W9EC 2CNZA 2CDEB 3NTCL 1D6EB 4PTUA 2LU7A 4KK6D 1LE9B 4GW5B 2OK0L 1J1XL 3V52H 4O2FA 4K73A 4E0RA 1MAML 5K9QI 1A3LL 1OPOA 5FA3B 3QYMA 5FAAA 3MRIB 1GTFA 3HN8A 4JPKH 5C0BE 1FFNB 1D6VH 3B3BA 4I3SL 5D7KD 3IE4A 2NY5L 1T04A 1C8PA 4FKKA 2R0WL 5EPMB 2UUDK 2J1YA 3ELAT 1QLRA 2CQVA 2IDQA 3FL7A 4NFDA 4U6TA 4Q9CA 1J18A 3BZEB 4YBQD 1VPOH 1RPUA 3UDWC 1KPUA 1I1YB 3HCVB 3LKQB 1INDH 4GRWH 3BFOA 2FUQA 3LRSA 4HCFA 2C3GA 4JZJA 3HAEH 5DJ6B 4JJHA 4FFZL 5LCVH 2BHFA 2H6OA 3KM1A 3R4RA 3ABMB 5D6CB 4TLSA 1U8JB 1CN4A 4KO7A 1S7WA 1PG7W 3UADA 5D1XA 4K2UL 1W2KT 5C6TL 4QHLA 1FO0B 3H3KA 3MRQA 4PI0A 5HGHA 1C1EL 4GIOA 4ATTA 2Y06H 4LRIA 3FTGA 3OHMB 4G7QB 2YXVA 4Q58C 3S6CA 4M5TA 4YDNA 2K6YA 1JGLH 1X44A 1P84J 5DVNA 3QEQD 3WBDA 1R75A 4OSUL 2EKSB 2G5UA 3CQQA 4H8UA 5L9DL 4N0UB 1UURA 2BXYA 3N9GL 1BA9A 2R39A 5I73C 2GKIA 3P54A 5E6UB 2APFA 1AHWB 4S0HA 1V05A 1CGXA 4Y19B 2WMPB 1E28A 4L2YA 1A64A 2DQIH 5E94B 3KYNA 3KWXA 4MD0B 2FO4A 4YGVA 3U4EB 4X98B 5GSVA 3VFVB 1FPTH 5T8IA 3VXPA 4GUCA 2ZX9A 1A7NH 4KKCD 1Q9OA 1RMFL 2P5EE 1SMOA 2PR9A 2VISA 4P23C 1F4XL 4B9ZA 1DTUA 4LQFL 1JZGA 3HMWL 1NAML 1AVAA 3X1BA 2GYSA 1O75A 3WSQH 1CIUA 1IAOA 3VFUB 1D6VL 2ZCKH 4KKBD 4JVWA 5IMLB 3PQYE 5AW5B 2ISDA 3SDDA 1CFVH 2BNRB 2J8HA 1HHGA 4Z7NB 2YKKA 2J8UF 3Q5TA 4D7BA 1REIA 4TVSa 5BQDA 4U1SA 2D3LA 5CIPB 5K1VA 1NBQA 3TA3D 1FYTD 2CIIB 5JOFA 1KOAA 3VXRD 4CW1B 1NZRA 1S7RB 1UB6B 3OKLB 4Z0BL 3UBXB 3HNTH 5K1NA 5D2NB 4HJ1A 1MIEH 1L6XA 4XPTH 1T5WA 1BQLL 2GSIB 2J2ZB 4XXCC 4FS0A 2UXTA 3F7YA 2BWQA 1BQLH 1F6LL 7PCYA 4F7PA 2V7HA 5BO0D 4PG2C 2COQA 2MH4A 2G4EA 4NO3B 2NXZD 1QZNA 3STZB 4H40A 1KPUB 3HCVA 3LKQA 5GRZA 1R5IB 3SZ6A 4UV4H 2VOTA 5FLVA 1GC1C 4WUUA 1TJIL 2YPKB 2CDGA 1P4LA 2PCYA 4PP2B 2GCYA 1XGTB 1H9DA 1IX2A 4AY0A 1N18A 3KLAA 4QR7A 5SX4I 3TWYA 4J6IA 5KBLA 4MAYD 3HNSH 3DXAE 1AMXA 3WLWC 1MDTA 3MR9A 1MCWM 3GXTA 1HKFA 4KXAA 3UTSE 4KBPA 2Y07L 1G7IB 1W16A 2V6HA 2AQTA 1KBKA 4K3EH 1R5VB 5C0RL 3T4AB 3QDMB 2AJUH 1RJLA 5C0RH 3NQIA 3OKOA 3LXBA 4Y19A 2L3BA 5KVGH 4KJWC 3A6CL 2Q9OA 2C3VA 1WEJL 4JY5H 1TKWA 3K1DA 2XJLA 1YY9C 4GQ9H 5IVOA 1E4XH 2MKLC 3BD4A 1XXFC 2IGFL 4BQ8A 1P6WA 1W15A 2YAOA 1P7HL 1NCWL 3QAZB 4NO2B 4PS4H 4NPYB 4Z77B 1UT9A 3PL6C 1MCIA 4I1NB 4OJFH 3WMPA 2VKWA 3S96B 3OPUA 4X6FB 4OF5A 4Y5XB 4RX4A 2JKSA 2K0RA 3KGUA 1SVCP 5C0DB 2JKRM 4KQ3H 1JPGA 4XOBA 2XN9B 1OP4A 1DQJB 4LP4A 5IBUG 3TZVB 2CBQA 1DJXA 5DUBA 2ZJSL 3LZQA 1XSIA 4BUHA 4M9OA 2A77L 4U1SB 3O2DH 3EO9L 5I1HL 1AAJA 2XTSA 3V0WH 3K71B 2WQRA 4HG4K 3V6ZA 2AABH 1JZ6A 3GXUB 1WJ3A 4OFKA 2DMGA 1T1YB 1T22A 3FQUB 1G6RB 1ZD6A 3HHMA 3BPLC 1GW0A 5BUPA 3QUMA 3V2AR 3L4YA 3OAYK 2YRZA 2WNKA 2CO7A 4F91B 1CWVA 5FYJE 4FQJL 5EU6D 4ZQKA 1JZJA 1UHVA 4BSVB 3ULVF 3PPEA 5GZOC 4FNRA 5G55A 4OZGF 1HJCA 2RR3A 3VG0L 3SOBH 5C2BH 2VLJB 2C1PB 4MA7H 5KVDE 2G3XA 5CJXC 2XG4B 2VDRB 3ZIYA 3BW9B 4B9PA 4G1MB 4XXWA 5JPMC 2CK2A 3TASA 2Y1ZA 3EBAA 3INUH 3QFJD 4EI6B 4I0PC 4OW6A 2A74B 4QLRA 1ORQB 4P4KC 3P11L 2Y1AA 3E6HB 5LGHL 1BDYA 2NSXA 5LGKA 3NIGF 4AQOA 1DUYA 5I1IH 2YXMA 1UFUA 2IV9A 3KNBA 4GLRI 4XH2B 5TQ2H 4LLQB 5BJTA 1GS8A 1EEYB 1U8KB 5B1JC 1VFAB 3TO4A 5IIEB 1AKPA 4GW1B 5DQ9A 4AZ8B 2DMKA 4B53A 3IJEB 3RI5K 4HFUL 1YECH 3EW3B 5FOBA 3SDYL 3TBTA 3RVWD 3A22A 1M9SA 3M6DA 1B4LA 3X13A 2E4TA 4KH9A 3QE5A 4OD2B 2P3YA 3LPWA 3DXAA 2KQMA 4OI7A 3DHPA 5KSVA 4HV8A 3UG3A 5EF3A 3AMLA 3QUKB 4ZUUB 5LQBH 1DBJH 1Z9MA 3CHPA 5JZ7C 2ATKA 2F5BH 1AZUA 2MQGA 4RZKA 2DI9A 1H3PL 4AIEA 3IE9A 4PPTA 4Z77A 4ZAKC 3T09A 2JCCB 5CCJA 4PJFB 3MRFB 4JRXD 3NZUA 1VHPA 5EOQH 2YUZA 1XB6A 1E9PA 4HKZB 3RWGB 4KJPD 1R6VA 1G9ML 4L4VE 2ZUXA 4YMPA 3B4NA 2UWEF 3I6KA 5C0DA 1KZYA 3CZUB 4PWGA 3ZR6A 1DHKA 4LSTH 3H9SE 4NCDA 1JDCA 2R29A 3FQWA 5I1CL 5L88H 3L08A 2R1YA 3VFMB 4L18A 4X4XB 2DQEL 5DMJB 4UMGA 4CGTA 1QMUA 5HHQB 2W8CA 1O6SA 3C09B 4PRHB 1GC1H 3E1F1 1KT2B 4ZO9A 1ODAA 4JY4A 3WIFA 2A9CA 3MV8A 4MX7B 4JK0D 3ZDXF 5KYWA 5B4MC 4WZ9A 3D3VB 3QCTH 4LLMA 1T03L 1G6RA 1PJ9A 1HEZA 2X70A 4L1TA 5HI5D 3DSNB 4HCRA 5EBWA 4B9CA 4HKBA 4R0LC 2YLHA 3GI8H 4O58H 1TJHH 3N5AA 3D4YA 5FKPB 3GSWB 1QLFB 3B2MA 4WWPA 4JPSA 2VUOA 3RL1A 5CAYB 5M7QA 5C0BB 2EDMA 4FEMA 2R1WB 5EMYA 2PTTB 4HXAH 3U6XS 4AH2B 2YD7A 4G1EA 1E4KA 3WJJC 1WEJH 1M53A 4G1MA 2XN1A 1D2PA 3ARQA 1I9IH 3CC1A 3T4YB 1QBMH 1RZ8B 4PVMA 3BN9D 1FO0L 2XX0A 4K71B 4ZD3L 1AR1C 1YZZA 1JK9B 1F4AA 2LV4A 3B5HA 1Y6KR 2ZX7A 4HJTA 5EEWA 4N0YH 3NSJA 5FFOA 1FGNH 3UTPE 1YAIA 4TL4A 4AKOA 4FYTA 3FSOA 3GT6A 1IQDA 2EH7H 4XH2A 3FQ4A 1I1FA 3P3RA 2BP8B 3V7MA 2YAEA 3L9RB 4KKAC 3MV11 4OGAC 3BH9A 3IYLW 3OHXA 1BVZA 3TVMD 5K5YA 2AZAA 4IRSD 1F0LA 2NW3A 3FTZA 2MWCA 4UF7C 4PMFA 5F1SA 3S2CA 5KYUA 5A6IA 1TJGL 3F6IA 5BW7C 4M4PA 2FQDA 4RBPK 1WVZA 4LCWA 4BGLA 1SNRA 5KW9H 3QEQB 4UIKH 5ADOL 1UOKA 3QRBA 4C56E 2GJ6D 3AXLB 1PD0A 2C7UA 1AQDB 2X4TA 3CAFA 1KLFB 5CLXA 4KTEL 1OZTG 3L4ZA 4IGBD 3GSNB 3MCLL 1E9OA 3OB0K 3OTTA 5L2JA 1SJXA 3D50A 3IB4A 3O3AA 2E6PA 5I8EB 1DLHA 1FZJB 2A6IB 1UOWA 4BZ2A 2IBBA 2OMVB 2G5BB 5KSUA 3QUZB 1JPSH 4QXWA 5LUMA 5FYKL 2D7TH 5J0BA 1EMTH 1FGNL 3LRKA 1TETH 3QJHB 4Y4FA 5B38G 3OLIA 1DFBH 1MF2H 4L3CB 4H1LH 5C86A 4UOW1 1R0AL 1NCJA 5KJ4A 1HI6A 4WFGE 3D8MA 4JQVC 5TQ0H 1R3HA 1MF2L 3B83A 2CCLA 4OFVA 2WXMA 4Q89A 3U0WL 3LZNA 4EO5A 2X6VA 1I8LA 3PXJA 4NC0B 3OX8A 5AVXB 4P5MA 1OANA 5DO2D 2ENPA 5IQ7L 1KTLB 2O61A 1J88A 1JPTH 4QF1A 3BMWA 5SWSB 3UFIA 4PJ5E 1N5YH 2X0WA 2ATPA 1NGYB 4PREA 2HSIA 3SJVE 1PZ5A 1JK8B 3NCWA 4BDVB 1QNIA 3FTWA 1GGCL 2D0HA 3AWFA 1QPPA 1IBYA 3HAEA 1JK9A 5CD3B 4ONGH 3CHOA 4LLWB 2DQCH 5I5MA 1J5OH 1WGVA 3ZL2A 5EDSA 2BCKA 2DQCL 2PO6C 2B59B 4Y4FD 5JHLA 3VFPB 1N6QH 1CMOA 4C83A 1IARB 5IMOA 1CD9B 3LHPL 3TH4T 1EXUB 2FJGB 4KK8C 2B0SH 1RIHL 4PV9B 2WO3B 4PWKA 4MZ3A 5I1CH 4F3FA 2VH5L 2V2WA 2EXTA 4YDIL 3WOVA 3IS1X 2FIKA 3DK2A 1UCTA 1VB9A 1G0DA 6PAZA 4OCXL 5E6SB 4D3CH 2NY6C 2EDYA 1CZ8L 3IU4L 1AZCA 3SODB 5LDUA 2YEQA 4S1DD 1KTRL 1NPJA 2WXPA 5ICZA 5JXEA 1CQYA 4TNWK 2P5ED 2XDHA 1S9WA 4IDJL 3G5YA 5HPMA 2XCMC 4JDVB 1OAXH 1A0QL 1MHCA 3CSPA 2ICEC 1TETL 2V37A 4B3VA 4YDVA 5E8DL 2DYRB 1R34A 3KPQA 2KUTA 4QRPA 4U1NB 5AYTA 3RNQB 3C5JA 5BMFL 2Z7YA 1ZGLP 5H37H 5D7SL 3TYFB 4HC1L 3GMRB 3NCXA 4D0CB 1YUKB 4UT9H 2AQ2A 5DU7A 3DKHA 4JHZA 3E1ZA 1OGAB 3EKCA 2AXFB 3CH1B 3WHXA 5I6MA 3OKMB 2GJ6E 3GUTB 4JM2A 1RD6A 4JFXA 2VUYA 2X87A 4CDGC 1CFQB 2V7NA 3GHBL 2QDWA 2IPUK 4A39A 3ARDB 5I23A 4XMLL 3PWJB 1E7UA 5JMOC 1HH6B 2M83A 4AUYA 1E6JL 4I2XB 3KZ8A 3BD3A 5HSFA 4P2RD 3QFJA 1RZGB 1EEZA 2PWFA 4DW2H 2HG0A 2WQVA 4F58H 4Z7WB 1RZQA 5JHLH 4DWHA 3PJSA 3BH8B 1UFGA 1WTGT 3QB7C 4OU3A 3L95A 5EZJA 3TC9A 1FUNA 1F13A 1NFDE 3ZOAA 5ITBL 4JCMA 4AM0A 4J8RA 3P2DA 2D03H 4XPBL 1JZ4A 4UTAH 1M56B 1ZLWH 2GTZA 3RAJH 5IHHA 5CD5C 1IO4C 3V9FA 1OSPL 2VXQA 5L8LB 4K3DH 1W91A 3MODH 3MLRH 4N3UA 3VD3A 4BH8A 2F5AH 1F5WA 3PPSA 2QMKA 4R7DB 1YCSA 1MCEA 3D6GA 3IFNL 3HG4A 4Z9KB 4BSWA 1AOHA 2P8LB 5DD6A 1Y18A 4APQA 4GQRA 3MV01 1M7DA 4JG9A 1KIPA 4HHAB 1PYWB 3D39A 4FKEA 4TLTA 3Q43A 4OZFG 5AW0B 1HAWA 4E9QA 3ZTDC 5KVFL 1U6AH 2QHLA 2ZT9C 4OGQC 3H2QA 3DIVA 4JO1H 3TBBA 3ZHFA 2QBWA 1AGFB 4XC3H 5FW6A 5IOPB 1OM3H 3AY4A 3MJ8A 2H5UA 5KS9B 2J8UA 4Z7IA 5DK2A 3CC5B 4HKXB 2D4FA 1MAMH 2NOYA 2BNUB 4TQEH 4HWZA 2XZCL 4JFEA 3EHBC 1WC7B 5FFLA 3BPOB 4LB8A 3T65A 2EICA 3L3KA 4Q0XL 4JFOA 4TUKL 1KMGA 3OKKA 4KXCA 4XRCA 1T0NB 1L0YA 3BAYA 3UYPB 1QPXA 4LMQI 1OT2A 1OARH 4L8SC 4YHZH 1U41A 3IS0X 2YWYA 4BH7B 1CB4A 4L48A 2IXQA 3AG1B 1NAKL 3VSQA 4WWNA 4KX7A 5D4QA 1IM9B 1QSEA 3H6AA 4NN6C 2FO1A 2HG5A 2IGLA 2YJQA 3RUGA 5CWSB 4QRAA 3K6FA 1VSCA 2FD6H 2GITA 2IMMA 3AQDA 4XP9L 5IZ7A 4ZSOB 3PNWA 3VWJD 2DLHA 4JS7A 4GY4A 4NXSA 4RX4D 2HJLB 3WEBA 3T4AA 4ECNA 5ADOH 2XRAL 3KW8A 2XHNA 3B9VA 2D8KA 3HPLB 5FYLH 3JWNE 1IGJA 3GXNA 2BOBB 1HIMH 1JCVA 4Q6YA 4FG4A 5E0FA 1E8YA 1HZHL 3QSKB 4NUGL 1HIML 3D51A 2EYRB 3EYQD 3GB7A 2XXGA 4ZX4A 2CBTA 1FNEB 1I1AB 5F7DB 4PJ8B 1MFAL 4GXVL 3QORC 3C08L 2DJMA 3CFNA 1LDPH 5FA3A 4JZNB 2IPTL 2V2XA 4NRZB 4LOUD 4BEIA 1MHHA 3O3BB 4ZMXA 1AD0B 4PWJA 3QQNA 3L48A 4PJ9B 1S7VA 3CHXA 4ZO7A 1VADA 3DPDA 2FJHA 3QFJE 1N4XH 1WBZB 2X6AA 3W0WE 2F68X 3HHSA 1NCTA 4H26B 5HYQB 4NJ9H 3TZVA 2ZYIA 1EGJH 2AJUL 2LE9A 3FFCA 2DWXA 1Q9WB 1SJVA 2HN7A 3B9KC 1XEUA 4KVNH 4QKTA 3HZVB 3S5LA 1HINH 1T6VN 4OZHE 4FADA 3GLAA 5D7SH 1KCLA 4MNQA 5L8JB 1Z6JT 5IVZB 5GS0D 4X9YA 1ID2A 1IGYA 4P4RA 1FCCA 1G1KA 2CHXA 3EGDA 2V9UA 1LDSA 4M43L 1HNFA 3NFSL 1NCWH 3WHE0 4I87A 2ZZUT 3NSCA 5A16B 3D7PA 1IC1A 4GRLC 5IUCA 5E9AA 4ZW8A 5HGGS 3RX8A 1PIFA 1XCQA 3C2SA 4EPSA 2UYLB 3MV7D 4JFOB 4G83A 3F7RA 1NPUA 1QTYT 2HRPH 2FX9L 4JL2A 1KELH 5FHBH 2YGVA 3JVGC 4X98A 2BVQB 4JPIB 5IFAH 2GSGB 3B2UD 1A1MA 3CDGA 1YEFH 4NBXB 1ZAGA 4Z7QF 1F3DH 2Y5TA 1A7NL 1SLUA 4UBDC 3ARBC 3MFGB 3IEAA 3MGTA 1F2XK 3L3DA 3HPJA 1NUGA 3HI1B 1L9TA 1M71B 4XNYL 1ZTXH 2EVFA 1SJHA 4FTVD 4ODWA 3PL6D 5SWZB 3V4PA 4LLQA 4M3JA 4JJ5B 4KKRA 5BJTB 3WU1A 2WCSA 4NERA 4MA1C 2FHBA 4U1MB 2G5RA 2DWTA 3CLEL 3TO4B 2ATAA 2WUCL 2VDNB 1UKSA 1AANA 3OV6A 3U4BH 5LN8A 1DN0B 1QHQA 3LKNB 4H8WC 2X2IA 4ATWA 2IQ9L 4W4OA 4Y88A 1HOEA 3ZBMA 4JO5A 4APQC 4L23A 1UH4A 3ZYJA 4Z7UE 4FLRA 2H8PA 2MEJB 2Z7ZA 5I6NA 1I1AA 5F7DA 4NQTA 3AS0A 1IC4L 3PDGA 4QXTB 5DUML 2HKFL 1ZLVK 2DWDA 5BNXD 4ELKA 5CD5D 5FGCE 3GHBH 4F7PB 3FB6B 4LSVL 4R83A 1QYGL 3QR0A 1ZA6A 2B15A 4J3VA 2KT6A 3V4UH 2F9BT 5MEOA 4AYDC 4HUKB 4YHZL 3IF1B 1JPFB 3ZT5A 3T77B 1IAIH 1A21A 2ILLA 5T3ZL 5SX4H 2ZXQA 4DP5X 1HXKA 5FB8A 2Z91A 1S9XA 3K7UA 4MD4B 1E8ZA 1M7XA 5FDWA 5IG7B 1QHOA 5JIPA 1KIUB 1QWNA 4QTHA 5HYEA 2FX7H 1P5UA 2Y69B 4W6XB 4GUPA 1DDTA 4PV1C 2AV7B 3CHRA 1LO5A 4MLSA 5DHVB 5IB2B 1CFTB 2WGXA 5A16A 3V0VB 2WXFA 1U3JA 1ERNA 1QNZL 1QBLL 1MHPL 4ZMQA 2X0UA 4MB3A 1PZAA 2RALA 4FFZA 3NJFA 2RAMA 2NX5D 3MNZB 1FYTB 2Y6SC 4TXVB 3HI5L 4N2LA 4AGMA 2PTTA 2DQFA 4JM4H 3PUUA 4C4BA 1FPTL 2Q0ZX 5JHAA 4ZW7A 5JQ6H 1CLOH 3QNYA 5EBGA 2WIIA 4MZ2A 5IBTL 4KZDH 2UUDH 5B1BB 3LNHA 3V10A 3INUL 4F93B 4U0QB 3DJ9A 2Z93A 1A3LH 2XFXA 1YEJH 3EGSB 1WFOA 3KYAA 3MGTB 3QVAA 4D9RE 5IB3B 3B3IB 4OM0H 3EOBA 2X40A 3RBSA 5A7EA 3U1QA 4ZNEE 5JORA 4H0IA 1J87A 2BXZA 1JUFB 4Y16A 1UEYA 2ALWA 3HS9A 5I1LA 3I75A 1JZEA 4N87A 1JPGB 3B2DC 3H9SA 1HCVA 1EZVY 3VFSB 2A6JA 3S34L 9CGTA 2QQQA 3HBQA 4JKMA 4XOAA 2HP4A 4PWFA 1WFNA 1EDHA 1HINL 4POZC 1A8ZA 3U0WH 1L5GB 5KYUB 4P05A 4N0FA 2RTTA 5E5RB 1E5ZA 2R56H 3CXDL 2XBZA 4JLRB 1DLFH 2TAAA 1XR8B 4PYHA 2OTUA 3L54A 4DVRL 4JY6B 5DHEA 4D9RD 4X5LA 3CFCH 1LM8V 4HPOL 4IM8A 4XPTL 1BX2A 1JCKA 1T1YA 1CU4L 1U8QA 1KCVL 3VMOA 5BVPL 1AQDA 2X4TB 4PD4J 2ZUTA 4YLQT 1U0QA 2OCJA 2Y2WA 2DQDH 3H55A 4LVHC 5DJXA 2EH7L 4XVOA 3RTLA 4GKNA 4QOKA 1K3IA 2KI6A 1ILSA 3IDIA 5C7XL 3JT2A 5AKVA 1U3HD 4BQBA 2VDLH 4G6KL 4OT1L 3RP1A 1N26A 2FHCA 4MJ5B 1EZLA 4QKXB 5FA4B 3DVGB 3VFRA 1G7PA 4J4PC 3PGFL 3I6GB 4BUQA 2A74A 3DURA 1DEEB 1YEIL 3IGKA 2OMTA 1G9NC 3P11H 1RHHA 3FB7B 5G4NA 3D34A 4QTHB 5BRQA 2WJ7A 3QDGA 2HB0A 3TBSB 1LWRA 3NBNA 4HVBA 4RGMC 5J1AA 3V6OC 2NXYB 1RVFL 2P8PB 4QHKJ 3ARRA 1N4XL 5LBSA 3RGBA 1VLXA 1BWWA 5HVGB 1T03H 1HI6B 1ED3B 4ZTOL 2NXYD 2A4EA 2I9LA 4JO4H 4L4TE 4ETQB 2XXMB 3VFNA 4TQPA 1DVXA 1WV7T 1DUZA 1NPNA 3IM1A 2BVYA 5F6HI 4FNTA 4EUPA 3WS3A 4Y4KB 5B8CB 4G7YH 1LGVA 3PWPB 2R0KL 3QQ9D 4PLJC 1D5IL 4A2DA 5JNYA 5GSRA 4HPOH 3S35X 2BDNL 5CZVH 4UTAA 4JGNA 4F2MB 2J5LB 4P5TB 2AAVA 5DI8B 4WQOA 3QJQB 4NT6B 5DXWA 2WZAA 4NQDB 1HDMA 5EOQL 4HG4J 2XA8L 2N7AA 3GMPB 3QIBD 3WEOA 1XHHA 4NZTH 1FH5H 3HFML 3CZGA 1FE8H 3LNEA 1MCWW 4OT1H 1XEDA 3A4EA 1XF3B 1E65A 1KJVB 1EQWA 3B9EA 3DGDA 3JSSA 1KYFA 4X4XA 4GFXA 2EYTB 3CXHK 2DH2A 4XB7A 4WY7L 1V5JA 3N42B 2KH2B 3RWHA 1ZHNA 4HJSA 1MJ7H 2IMNA 3T0EA 1IE5A 5T3ZD 1VGEL 3NCJH 2DYPB 1OPGH 3Q6GH 2WBJB 3KVDD 4L9LB 5FLUA 1BX2B 5I1AA 4MJIE 2HTLD 3B2VL 5HHMB 3EYFA 3RX9A 3KPQB 4NUPA 3EHBD 2KL6A 5DK0B 2DQMA 2RD0A 5H35B 2XQYG 3GSWA 3T0WA 5FF6A 2GB2A 2YIHA 4GEJA 3T1FA 3GMRA 5CILH 3GSRB 4NP9A 5DHXB 1G43A 4FYRA 3HRZC 5F1IB 2OULB 1PZSA 1NDMB 2DQHH 4JFXB 4MXQC 4QCIA 4C4KO 1DJHA 3H8NA 5LG1A 2P5EA 2XVGA 3HW7A 3GJEA 1EZUA 5AKSA 2HTKD 4E9VA 1P4IL 3UPAA 4EI5B 2FH8A 4OM0L 3PWJA 3UYRH 1NCCH 4Y19D 1IGMH 1X3DA 5HHNA 3RNKA 4OCWL 4PJEF 4X2UA 1I1AC 1MCPL 5HI4C 4GSQA 3UIYA 1KC5L 4JFFA 2ZOLA 5TDNA 4W81A 2EVJA 2W65B 1BZ9B 7FABH 1WQVT 5IKCB 1W80A 4N22A 4UNVA 3UZVB 3EYQC 3GRGA 3I84A 4I3RH 4P46D 5KANG 1DLFL 3JYBA 3G6AB 2XPZA 3S37L 2Z4TA 4JRLA 1RZKC 4PJBB 2CXKA 5HHXH 2QDVA 2DWSA 3D0VA 4UQIM 3WD5H 3SDCD 1NC2A 3N55A 1UT2A 1U8OA 3X14A 1BZ7B 2RMNA 2WSDA 3VXQB 3BRFA 1NBYA 1BEYL 3ARGA 5DEFB 1YNTF 5C0CA 3FO2B 4L3EB 5J6GB 3POHA 4XI5D 2XUWA 3H3PH 1HDMB 4CVUA 1U93B 2R7EB 2FT8A 3GSNA 3BUBA 4AE1A 3FU9A 2NY3C 2VZ3A 4P46B 4H0GA 3KLDA 5IVXB 2X4UA 4HJJL 4MNGA 1GC1L 2UZXA 2MPAH 4TNEA 5GGVY 2WO4A 2DPKA 1S7XA 3WSQL 1Z9LA 3L5XL 5LAPA 5AOMA 4LBEA 1I4FB 3K5SA 5EULV 3TO4C 3IMTA 5C08A 4IKIA 2ZKWA 4FQCH 1QFOA 3MLTA 2OJZL 3L5IA 5GGTH 3GGWA 5CU9A 1S5IL 1EZVX 4Z76A 5DK0A 3KJ4B 3TL5A 4N9OB 1QEXA 4HK0A 2B5IB 3OZLA 2IALB 3F85A 4G7VL 5CCGE 3LVTA 4HUVA 1X6NA 3MZTA 3NAAL 3VXUE 1NGYA 3C9NA 1HHKA 3BN3B 4O02H 2GIMA 4RDQG 4ZFOA 4FFWD 1WCBA 5FWQA 2RCSL 1SY6H 3B43A 4Z3EA 3L3HA 1U8HA 5MENE 3HPLA 2B1HH 1BOGA 3NGBB 3UCQA 4CVXB 1RZIA 4U3HA 4JN2A 1TO4A 1DL7L 1S3KL 1OE3A 2CGZA 5C0EB 4FL4C 3ABGA 1YY8B 4LEXL 3ZKXC 2IGTA 5C0NC 1NKGA 3K91A 4OI8A 5CEYA 1CD1A 2O4EA 2CUHA 5GHWH 4CU8A 4OD3H 4LSTL 4JFHE 4K7PL 3MRGA 3T0BA 3UBFA 4HJJH 4YH6A 5EG6C 5CLWA 4B9IA 2A6KA 3F6JA 2K6WA 1HH9B 4XO3A 3VU2A 2FJHB 4FNPA 1KB5L 2W0KA 1XGPB 4I9WE 2UY7A 3B7UX 5IK3B 2IF7A 3APDA 1BFTA 1XQ4A 5AWNL 4AEFA 3AITA 3KPNA 5I8CB 2FR4A 2QVTA 3BP5A 1CXEA 2WUCH 1BMGA 2PWGA 4YAQB 4KFZC 5C0IB 3G08B 2A5UA 3PWLB 2ADFL 3ZDXB 2R4SH 4FX5A 1MW0A 2HVKA 1B2YA 3Q8AA 3UTSD 3HIZA 5C8JB 3SJVD 3F7VB 2OZNA 4ORGB 1MY7A 3KH4A 4U6XA 2J6WA 3ILPA 2UZYA 4K5MA 1J8HE 4WO4C 5FYKE 3II3A 4P2QB 3IGLA 1XF5B 2A1WH 5JIHA 4CVZA 1D5IH 3RWCB 4OD1L 2Q7YA 4X6EA 4ZD3H 4HWBH 4DTGL 5I76A 1WIOA 4X6CE 4E5XA 4LVNC 3P2BA 3FW6A 4HD5A 3UAJC 3VWKC 5EU3A 5DZ9A 4YPGB 2QPSA 1M9WA 1DYZA 4XN4A 5D6DA 1RZPA 1OW0A 3I50H 3MLZH 4DP0X 1H19A 3BZFA 4QXGL 5GS1C 2DM7A 2AC0A 3HI6H 2VR5A 4AQ8C 1B3JA 2NW2B 3IDGB 3SZKC 3VFTA 3QYNA 4PRIB 4FQXD 1DJZA 1A4AA 4DP2X 1MKFA 4MB4A 3B56A 3FU8A 2HFEB 4FFWC 4YHPA 2B9AA 3LQMA 1NGQL 2WLYA 5FEBA 4Y2OA 3OG6B 1UGKA 4QMEA 3RGVA 1WCBB 2D2CC 1WBXA 5CBEA 5H37G 2RQEA 1A6UL 4G9FE 3BIAX 5DD6B 1BFSA 4MXVE 1Z5LB 2YRLA 1PG7L 4R5VA 3VJ6B 1TYRA 2DKSA 2OCFD 3HE6A 1MEXL 2DH3A 2UZIL 4X99B 5EZIL 4BKLA 1NINA 4YVUA 3ZKNC 1DQQB 3QIBA 3T2NH 4WKZA 3UXFA 2N0KA 3LIUA 3WNJA 5KS9A 2DQGH 4XODA 3ARZA 2AQ1A 3LDBC 1I8KB 4AQEB 1EJOH 4V2BA 3FQXA 1OAYH 1URLA 4AK2A 1OD9A 3KPOB 4QRPE 4K7FA 2EEXA 2BHUA 3UYPA 3IF1A 4KKQA 1MVUB 1O9WA 2VGLM 4LVOC 2Y25A 4MJIB 1RUQL 4UM8B 2ZWYA 4BZ1A 2PXYD 4Y1AE 3BEVA 1MH5A 2FWSA 4X9BA 4ZFOL 4TPRH 2VAAB 5DVLA 4IGBC 3DGCR 3H7BB 3GBNH 1U2YA 3OR7A 4FXTA 5HY9A 1Y0LA 2K6ZA 1KGCE 2E8YA 3L6FA 1CCZA 1NGQH 2P5WD 4U2YA 1KBVA 4XHJC 4PGZA 4DH2A 1ET7A 3MX0B 3O2DA 3KPSB 4KHTL 4LQ1A 5G5DA 1TDQA 1PZCA 2CGRH 3NK4A 2CRIA 2DQFB 5E94A 5JUEL 2MJWA 4FI7A 1SQMA 2B4CC 3ZTCC 4FJ6A 4OVUA 1ROCA 4FL4B 1IBDA 1UZGA 3QQDB 1A7OH 2ZAIA 3ZQXA 2NDFA 4J3UA 5IMMA 3GS7A 3EJZC 4JZNA 3WKQA 5A2LH 2BVOA 1HWHB 4WWKA 4EF3A 3IAQA 1IAOB 4NO0A 3I74A 1NC4A 4OTXL 1SYVA 1WLHA 1RLWA 4XC1L 1JYVA 1G7LB 2X28A 3ZX1A 4HOWA 1W8NA 5GGTA 4NZRH 3PREA 4L8DA 4LVOB 5IFJA 1RIVH 3BWUF 4LKXA 1MCNA 4JPQA 5GRWA 5FM5O 4IOIB 1EHLH 4OUUA 1TZIB 4WAFA 4L37A 5HYSA 3VD9A 3NIFE 4G80A 2WNWA 4CW1A 2VDRH 5SX5K 5JR1H 1J0YA 2OL3A 3LDBB 4G82A 3FU7A 4JHVA 3AT8A 1ETZA 2JB6B 4UU9B 1HOCA 4QTFA 2ICWA 2ZXBA 2XQBH 2XZCH 1JJUA 3BT0A 3O6ML 5DFTA 3OZKA 2HKHH 5DUMH 3VSUA 4F9PA 4DP7X 5JIQA 5LDSA 2AAAA 3FC8A 1EK3A 3IU3B 3CVBA 3FH8A 1G4MA 2AXGA 3NRPA 1CJYA 3KPOA 5I5IA 4I9XA 1BBJA 4JFYA 4HHWA 4ONFH 1J9QA 3LOWA 1A7RH 3MNVA 5DZJA 1ZMYA 2D0GA 4M8UA 4OCMC 4QXGH 5DWPA 5GRVK 2BH0A 2BY0A 3U0PB 2W60B 3K6NA 4L4JA 2YD2A 4GLRH 1IEBB 4ZMYA 4LIQL 3L16A 4Y4KD 3B34A 3BKMH 3O45B 4LIQH 2B9BA 1QSFB 3KWWB 2Y7OA 4X9IA 5EO0A 4FOMA 4GOSA 2FEDC 1OSPH 1EVTC 1H15B 4Z7NE 3NH7H 5IR1B 1TTUA 1KXTB 3D0LA 4ZJ9A 4TNFA 1OK0A 3FQYA 4GBXB 4HK3J 4S2SB 5FO9B 4YDKL 1QBLH 3KPSA 3X3FH 2MCAA 3TNMB 4UILL 4DUWA 3M8OL 1EUTA 2MQ3A 4XX1E 5DEJA 4DF9A 3RY4A 1R24A 3MV8E 3GQFA 3KLHD 3OM3B 1QUNB 4NI6A 1KENH 3TA3B 5IP4A 2HUEA 4E5XG 4NQXB 3C5ZA 4DCQB 3ENEA 2FBOJ 1U8PB 2HRGA 5A7BA 3MV7E 2YA0A 1DBKL 2YK1L 3TOPA 2X4SB 4EI5C 5EORH 4KRPD 5EWIH 4ENZA 2QZQA 4O02A 5D9SB 3QIUA 5AZ2H 1B9ZA 5E5MA 4AUUA 5KG9A 2QQKH 4LCYA 2FECL 4OF6A 1KBGH 2O26U 3B6SB 2F0CA 4KC3B 3VXMA 4PJXA 3LIZA 4HU2A 4PJIE 4UWQB 1N2RB 1M7IB 2Z91B 4UT7H 3G5ZA 2C8NA 3O2WH 4FNUA 2WJ5A 3C6SB 2X4QA 3BAJA 1ODUA 5FO7B 3BPLB 3HZKB 1ACXA 4K3HA 3M46A 1OCCB 4JHWL 3T2QA 3WFEL 4M4RA 1MREL 3VXSB 5I6XC 3DO7A 1PKQA 2ZYHA 3DDFA 4IKNA 4L9LC 9PCYA 5JQIB 3WFEH 1KCUL 3GMOB 1T21A 2PXYC 5EUKA 4R84A 1FNHA 2C9RA 3KPTA 1SOXA 1FL6A 3K2MC 3VAEA 1VZIA 1TLKA 4OFIA 2OJEB 4HJ0D 1XAUA 4X8GA 2NR6A 1XV8A 2DQIL 3RLSA 2VW4A 2IFFL 5GSVB 1GCFA 2R83A 3RVVC 2VO5A 3ULVL 1WITA 4DN4H 1JG9A 5GJSH 3W37A 3WIHA 3OSVA 2JV6A 1M1XB 3UTPD 3IWUA 3HMWH 3BUIA 3TCXA 3EBIA 3WJMA 5IFHH 4J39A 1TSHA 2W07B 4MRBA 5I1DA 1Q8MA 1QSFA 2YD1A 2XOTA 3LQAC 3AZUA 5DTFB 4ZO6A 5I74B 5I1LB 3QQXA 1RL1A 2PF6A 2VMDA 3O9WA 4CMMA 5LNDA 2CSPA 2PW2A 5ALCH 2PWHA 3MCYA 4M00A 1XH2A 4YLCA 1ZT7A 3C09C 5D5MB 3QORA 5E7BA 4GAFB 1S7SB 2ED9A 4N0FB 5DFAA 3MJ9H 5DDHA 2QFRA 3AUVA 5JOPE 5KSVB 5IHUH 1TTAA 1F1DA 4ORZC 4HUUB 3VVWA 4PJCE 1IJNA 1OGSA 5I16B 2NXYC 2YAMA 1ROWA 3VYOA 5IMKB 2ZKXA 1BZOA 1U8OB 4GO6B 4DCQA 1A6AB 3D2UA 3UROR 1I9JH 4XN9A 2R9HC 5F96H 1BD2B 2D3NA 3U2JA 3APNA 1GY1A 2ZCHL 3P4OB 4Y2DC 4JFTA 3QUXA 1PLCA 2WOBA 2OMXB 2WAHA 3P0YH 1P84K 4OV5B 1JSYA 3B6SA 2X1OA 2V9QA 4HH8A 2X4UB 1ZEAL 5IFAL 3AS3A 2CDGB 4XNQB 1IIKA 1YNTA 4PRHA 4PJ7F 1A7OL 1XAKA 1F90H 3C6SA 1QRNB 4MA3B 3AQXA 4LLVA 4FMVA 3RI5F 1KWGA 5ENWA 2J72A 2P42B 3MMEA 5KBPA 4PR5B 1NIFA 3BQUD 5H2BB 4L3AA 1RJYA 1T5XA 5K39A 1E67A 3WNPA 1YYMH 4NWUH 4YOKA 5HVFB 4U31A 2DL2A 4H44C 1UACH 4F9PC 1FLRH 2NSMA 4M02A 4OJEH 1EHLL 2XQYA 4P3WA 1IB5A 4FTVB 5ID0A 4KK6C 3RY6C 1AHKA 3O6LH 4EN2A 2H3NA 4HF5L 5EOTA 1FSKC 5AFAA 5LKNA 3BWUC 2HKFH 3LXAA 3KCPB 4RISL 4YZWA 1TUPA 1KIRB 2Q3ZA 2R51A 3EO1A 5EU6B 2M1KA 3KVQA 1VGKB 4NQEB 4OIFA 3UERA 4L8CB 1A02N 5GGSB 2QL1A 1WWAX 5DYFA 2XV6B 2NPLX 2Z64C 1GCYA 4JPWL 1XF3A 2NW3B 3N44B 1EDYA 2CRYA 2DKMA 2G2NA 3PL6A 4XMVA 3VXRE 2MNUA 4H8QA 1E5YA 4MWFB 1QFPA 5EZPA 4N8CL 2VL4A 4RWHA 3D9AL 3RZCA 3ELQA 3T4AC 4MNHB 3P0VH 1YN7A 5EBLA 3BKJH 2BVUA 1NLDL 1DQKA 1AKJB 4YSOA 1UXSB 1KCVH 1CE6A 1RQ5A 4OM1L 4N2BA 3EF7A 1DVFC 1MRDH 5FXCH 3TCLA 5KAQG 2BS9A 2H2PD 3NJMA 2GEQA 1QSFE 1MRDL 3T3MF 1U4FA 2O6EA 2ZP0T 3AG4B 1L4IA 5J12B 1CDGA 3FUMA 5E00B 4HS6A 3TN0D 4PJHF 5F7KC 5JIKA 2QKSA 1UOLA 4X4KA 4P2OA 4LEOB 1LDPL 3EG9B 4IRSA 4AE0A 1V54B 4YHOL 2A9DA 2CLZA 2FJFA 1TCRA 3FCTB 4GO8A 3I85A 1MJUH 2AEOA 1WP6A 3DSFH 4ZS7L 5LHDA 3FHEA 5AKTA 1J7VR 3HG1E 4M62H 2NY3D 1C08A 4YPGA 5T5FA 4M7KH 4KOBA 4RGMB 4M8QA 3E8UL 2NY3B 3A4DA 4PJ5D 3HZ3A 4XZ4A 3V4VB 5EN2B 4XAKD 2VR3A 1CICB 2X53A 4JFZH 4B5ZA 3RVTC 2EC9U 5C0GB 3UZVA 2PR4H 4P23A 5D70L 4G6MH 4A7GF 1ZHLB 3TN0A 2F8IA 1KTLA 4WTZA 1KUMA 1CTMA 3K5RA 2WYTA 4HGWA 4HW6A 2VT0A 2PYFA 3FU5A 4OUOA 2V5SA 1W6LA 1DANT 1PLGL 3MBWB 4LLYA 3VXTB 3BGAA 3FFDB 2PCPA 5DMGC 1NGPH 4ZZFA 4F37F 2VWEE 3SKUD 4HPYL 4U6VH 4QO1B 4WU7A 3SPGA 1YQVH 3HC0B 4NEHB 5AW9B 3UL4A 1L0PA 3KCPA 5C07E 2Z6FA 3GRBA 2XPYA 2Z4QB 2DLIA 3WNIA 4C55A 4G3YL 3ILEA 3MV9E 3PQYD 4LVHB 3MLZL 3MUY1 3ROOB 3CCHA 4HIJB 1R9FA 5KUKA 4P46A 1EPFA 1IGTB 4P2QD 3OMIB 2RQ8A 3BAEH 4X6DB 1DE4B 4OCXH 3P73A 5AW6B 3PLYA 4B0MM 3BVWA 5IESL 1F3DJ 1SHWA 1XGQA 2GIXA 4S1QL 4RMSA 3F12B 1UATA 3WY4A 2FO8A 2YARA 3NN8B 2MOGA 5EBLB 5E6ZA 3LPFA 2EDWA 1HX0A 4IS6B 4XNMA 4ZFGL 1OP5H 5KS9F 5GISH 5TH2A 3NESA 3DHJA 1M6OA 3DVNB 3OAWA 2AK1H 2E0PA 4HSCX 5T5NG 1N3NB 5HVHB 2ADFH 2VLRA 4P2QE 5GRVL 2FSEA 3HR5A 3OQ3B 3Q2VA 3GKWL 4CSZA 4ZX6A 5HY9B 4RWYL 1C5DA 3Q9QA 1NM9A 4MSWB 4R0LA 5TDPA 1N8ZB 3GBLA 4YXLH 1PPIA 3ALWA 5HHOB 1TIUA 1QBML 2FYVA 4JG5A 5IEHB 3N40P 4UNUA 4K7PY 4UM9D 3LD8C 2CBPA 4IK7A 3CFJA 3NIDB 4ICXA 4B50A 2Q8AL 1ORSA 4LPYA 3CSYA 4YK4C 3L1OH 3DOHA 3WFHB 1DL7H 1S3KH 4M8QB 3QQDA 2ENJA 5DQJB 3QGVA 1M1SA 3Q48A 3FDWA 3SYQA 1MIEL 1IZJA 5GJTL 1UENA 4OJCA 1SHMA 3CFEA 3A5VA 3O4LB 5L4FA 2EAEA 3P0VL 4ZAKD 3AGWA 1N67A 4DGVL 1H8NA 1E43A 2XZQL 3MLRL 4IRJB 2XICA 2OSLA 1JNHB 2FNBA 3BSGA 2BHZA 3GIZL 2CGRL 3SBRA 4AWJC 5BRZE 1MHPH 4NN6B 3NSFA 4H5SB 4GSXA 1DJIA 3LS4L 1L7IH 1IC5L 2W9DH 2Z34A 3IFOB 1HEHC 4FLSA 4KTDL 1KTJA 3RRQA 5KVFH 2WZPD 1IKFH 7CGTA 5E95B 1NGXA 3MRNA 5SWSD 4X7DC 1SPDA 5T33L 1VFOA 4BD4A 5EU5A 5I8EA 1SXSA 4IHBA 1DQML 1HSBB 1U91A 3R0NA 5MI0B 1TQBB 1CS6A 2O5ZH 4LCCB 4F2EA 4FFYL 2SEBA 4PJ6A 5K9OB 1BOYA 4X6BA 4M3KB 1EAPB 4MD5A 3H4FA 2GBTA 4RGND 3RILA 1NCNA 3ETBF 5KZCD 4HLJA 1KCRL 2P4AB 4HMDA 3U0PA 1NGZA 3T0ED 1TZOA 1DR9A 4QHKI 2WLLA 5FV2A 5TD4A 2R56L 2AJYL 3CXDH 4G7VH 2G0KA 2ERJB 4P49A 1M6UA 2EDJA 2VDKB 2O61B 2C9SA 5DD0L 2G2RA 2OX5A 1GYWA 4LPWA 5K1JA 4ETYA 2QGCA 3STLA 1WCQA 1OT1A 2GJ6B 4JQVA 5HHXL 3VH8G 2YPLD 4LARH 2G3NA 1Q9LA 1INEH 4LLWA 4OFQA 1BQUA 4JGUA 4MZRA 3U6XA 1OQOA 1YAZA 4BRVA 1AS7A 5F0LB 3VJ6A 2VDLL 3RVUD 4GRWB 1A1NA 3B2XA 4LF3B 2E74C 4FXGA 4M5SA 1ORSB 3I9PA 5FYKD 2HT2C 2G4GA 3W0WD 4NQXA 2RACA 1OB1A 5KBMA 1MCOH 4X7CC 3G6JB 4LSQH 3C08H 3X17A 3W9EA 2HCZX 2DI8A 2X2UA 3VWKD 2WW8A 5I30L 4TVPE 2CR6A 1AD0A 5BS0D 2X4SA 1JHKL 5HDQL 5I1GL 3PP4H 2QVIA 1XMEB 4UM9A 4K7FB 5KSBA 4DAGL 3M7FB 2WWMD 4IDJH 1SOQA 5IB4B 2YBGA 3AQZA 3T3PF 1AZVA 4YL9A 5I1EL 2P8MA 3IDXL 4F5CA 3V55A 5M94B 3M8OH 4RZCA 1WAAA 3X11A 5I1EH 4FGMA 1JMZA 1WPCA 3BISA 4UDTA 5LGYA 1OD7A 4DN3H 3NPSC 2PR4L 2JLPA 3TYGH 2X1PA 2BSRA 1MFDL 2ICEB 3CFBB 4Y5VA 3LX9A 1TEFA 2VXSH 1X5FA 3FOLA 1I1YA 3TBYA 1KNOA 2Q76A 3FYIB 3P9LA 4N8UA 4LCCA 1UXLA 2JNZA 2WVUA 2OZ4A 3U79A 5L0QC 2EDTA 1I3VA 2P1YA 2NRDA 5I18H 4M7ZC 4JM2C 4G43B 2NTFA 1I7TA 2NY6D 2VR4A 2AP2A 2Z31B 5EC1B 1RZGA 3K2KA 3DXAD 2DQJL 2VB5A 4EZMA 1HE8A 4MJ2A 1JVKA 4O00A 4P8QA 1MI5D 1MQKL 1L9OA 4RNRB 3EFFB 4NC1C 2GIYA 1F42A 5CU5A 3GJFB 4YDMA 2VERN 3D2TA 3K0WA 5DHYA 3ZMEA 3L3DB 1HL9A 2J7LA 3NK3A 2F7RA 3HB3C 1CDJA 4CMHB 4J2XA 2J20A 3BKYH 3FRPB 5I1GH 3ZN6A 3HS0C 4NZFA 1YNLH 2IDCA 3ARYA 1FC2D 3O9WB 2ZPKL 3IWVA 4U1MA 5CN1A 4CMMB 4D0BA 1AP2B 1LYQA 5B39B 3AXIA 4PGBA 2IANE 3CLEH 3FT0A 4OI9A 3U9PH 1U3HA 1UM4H 2OMWB 1ZT7B 4ZW6A 4NGHL 3RWJB 4APQB 3KLLA 3TXAA 2DI7A 1IAKB 3MV7A 2B77A 1ZV9A 2IFFH 4PJ5B 3VFGL 2IWFA 2ZWKA 3O11A 4LF3A 3LQAH 3ZHLA 3E3QC 4OZGE 5C92A 5HYJE 3VI3A 2BRRL 2VSKB 3ZE1E 4Y5YC 4HF5H 4HWEH 5LBSH 5B4MD 1L9PA 2AEIT 1B0GA 3F58L 4YFDB 3BVUA 1BD2A 2WNGA 1XD0A 2WPGA 4HMCA 3UAJA 2L4OA 4ANKA 1XMWA 1T04B 4NBYB 4U1HB 1B0RB 2XNAB 3LB6C 2MQCA 3U25A 1KLUB 3FH5A 5CCKH 2AS5M 3KS0H 1A7BA 5AOJA 1PS3A 3OKKB 2WM0A 3RVVD 3RKDD 4JRXB 4WHTB 5HHOE 1CIDA 3DTUB 4JZJB 5GS1A 1INDL 3T77A 3W5MA 1BVNP 1KCRH 4QTIL 4YHMH 3HEIB 4UOW0 2ICCA 2ZWZA 1FO0A 4WF7A 3MRQB 1PBYA 2XY2A 4L1LA 4LRNL 1GSMA 4G11A 1C1EH 2Y2YA 1SXBA 3PNRB 3WELA 2Q6WB 2Z65C 3ZZ1A 4GUPB 4EKXA 1TEYA 3T0XA 1NFAA 4MXVF 1WAEA 3CFCL 4XXDA 4PY8J 3QEHA 2EIJB 1UJ3A 2BWIA 4PN6A 3S5ZA 1YC7A 3K4DA 2P47B 1PNCA 1U8NB 2V5TA 4QRTB 5E99L 2H47C 5INCB 1A3ZA 3P0YL 1SVBA 5AB2A 4WTQA 4NQED 2JE8A 2XPGA 3UP6A 4JHBA 5JW4Q 2KDGA 1ASQA 3GB7B 1F2QA 3MLVL 1YPZA 1NIAA 5PAZA 1EHNA 1ZJBA 5ACZB 2CUIA 1VF5C 5KW9L 5C97A 2BSED 1A3RH 1GGIH 2DJSA 4ZMWA 1X9LA 2VN7A 2YZ8A 2VSMB 4WFGD 2X42A 2MRYA 1I3RB 2AJ3A 5HDQH 1UVQB 3MACL 4OZGA 3TIEB 1PFOA 1BXAA 3QO0B 4TSBH 1HHIA 4JX0A 1EJOL 2QKIA 1HN1A 3FUJA 5FIEA 1CDIA 3D33A 3L4WA 4GKLA 2VSCA 5C3LD 5JXAL 4L8CA 3I75B 3UG5A 4NI3A 2AW2A 5F0PB 1XGZA 3BN9C 4D94A 4Z7VF 1MFEL 4PJXB 3F01A 4JDEB 5CIPA 3B2PA 4YHML 3ZHKA 1YMMB 2O6CA 5IJVB 3UTZB 2N0MA 3O41A 5I2IB 2JCCE 2EDOA 1VFBB 4RRPM 5KTEH 1LE5B 3BPCB 3HZKA 4HXBH 5CSGA 5B39G 3J8F7 3ASNB 1GGBL 4RSYA 4K23L 3BI9X 1KN2L 3ZRCC 4HAKA 4ELME 5HI5C 4WI5A 1SY6L 4XX1G 4EIUA 3QH3B 3HS8A 2HMID 1JXJA 5TDOA 2XN9A 5DR5H 2FWOA 2Y5EA 1XVSA 2V7HB 5C1MB 3EH3B 3N42F 1B0RA 3SHSA 4PGCA 4NO3A 1L0XA 4WUKL 4DUVA 3RVXC 1ET8A 3V79C 3QXTA 2CGYA 1CD8A 1NMCB 2CLVB 4XE0A 3RVXD 5FCUH 3U46A 3ESOA 3QIBC 3ULVH 1ETB1 2DBLL 1DQLH 4MQXD 3NP4A 4YR6A 5KYYB 3QJFB 3AREA 1MOEA 2KQNA 5J11C 1NFDB 1JV2A 5TPWL 4BFFA 3FB5B 4Y9GA 2H7WA 1BPVA 1XGTA 3JV6B 3QZWB 2VMCA 5DD1L 2K4AA 4JREC 3ARFC 3US1A 3VO0A 5IFHL 3V4PB 1MLBB 2NX5E 1DFXA 4AQ8A 5C0FA 1Q38A 1IM3B 1XH1A 4KPHH 4QGTA 3FB8A 1E2WA 5EO1A 2I9LB 4ETQA 4QRTA 3BVTA 4FQIL 2GJJA 3U1PA 4Z3IA 1AS8A 3QXUA 4ANUA 3LKRB 1E3FA 3MC0A 1JYWA 4YDJA 1N68A 4KMTH 5D7LA 4JW3A 1C5CH 4FQ1H 3QRFM 5IV2A 2VDRL 4IOFC 5GSRB 4XXCA 2YGQA 2CCVA 1ONQB 4K23H 5D2LA 5DQDH 5D7LE 4HS3B 1FFNA 3ISRA 3CFKB 5JW3L 4XMPL 1IZKA 2K78A 5DMIH 2HPOA 5J6HA 2ITEA 4KXZI 4RRPG 5FYJU 4JM2F 1IC7H 4YX2H 2JKTM 3X13B 3BWAB 3FQRA 5MP6L 5H4ZA 1VCAA 5F0MB 5CEZL 1P5VA 4PYGA 4ADGA 1HE7A 1SMAA 1ZT1B 4U3XA 2JSFA 1RZFL 2CG9X 5EO9B 2F6AA 3F7PC 2A77H 4FYSA 3UTZA 5L0QB 4P2AA 1TTFA 5IG7A 3LEYH 4G6FD 5LWYH 5HGDA 2GEEA 1L7TH 5BZXA 4DZBA 5H2BA 1AGDB 1L7TL 3QHZH 3JWNG 1YQVL 1AGBA 1J9RA 3SE4A 1A9VA 3QHFL 3LY6A 4QWWD 1OAKL 2BNRD 3O2VL 3UBXG 2VITB 2CUAA 3MUGA 4DO4A 2MHAA 4NZUH 3IMRA 5F3FA 1AR2A 2FNWA 3U9WA 4KO9A 3OVUB 2V2TB 1SJMA 5D96B 4JY4B 3RKDC 2VH5H 5CEZD 3GTVA 3UCRA 4I5BA 5KYWB 1X5XA 4N9GA 4Z3TA 1E5UI 1F97A 4AXWB 4PJ7E 4DPAX 4FF9A 1AXTL 4GSRA 4OLZL 1FL3A 5L7XH 4DESA 4I77L 1KCBA 4G7RB 4C54A 2EP6A 3KPMA 3REWA 4M7KL 1MW2A 4IGBA 1EFXA 1BM3H 3S2AA 2D73A 2OP4L 4X4MA 1HCYA 1N59A 4G1EB 1J8HA 4D0DB 1NUFA 3UDWA 2BP0B 4TUUA 3TM6A 3IMWA 3T4YA 4QTIH 3WN5C 3Q06A 4HHGA 4PVNA 2P26A 5IHUL 2XTLA 5BXFB 1ZE3H 3K8KA 5KSAC 1BECA 1E4XI 4HV8B 4WV1A 2VDKH 2NY1C 3IT8D 3US9A 3GFUA 3JZYA 3V6FB 1QW9A 3JYCA 3O6FA 3QDME 3B9DA 5I82A 1M2VA 1KEML 1NL0H 2BVPB 2QEJA 2FQFA 3WNMA 2B1AH 3SBPA 3EO0B 1V3MA 2GUYA 2UX6A 4GJTB 2G30A 1KJ2A 1EEQA 3T3ME 4PBVC 2XFGB 1G9MH 4HFWB 1L3WA 5F9WB 5E08L 3ZQWA 4P2OB 5FCUL 1FYHB 4OSUH 3WXWL 4WSKA 2J57A 2UZXB 1FCGA 4EE2A 1TU2A 3TBVA 2ESVB 1DEEA 1D5BA 1TITA 1IL1B 1LK3H 4H0HB 5TF0A 2DV6A 3TV8A 3VM7A 3HOGA 5FW8A 4L1SA 1BG9A 2NUTA 3SKJH 4P0DA 4Q9RH 4QHUB 5I1JL 1T83C 1SMDA 1XGUB 3V5HA 4ZUTB 2WSPA 4H8HA 4HD9A 4N8VA 3K6IA 1MHEA 5E5UB 3LS4H 3A24A 4PTTB 1F4XH 2W59A 4FYQA 3DMMD 4GAJH 5AOZA 2F53B 3DJSA 4DGWC 1DBML 3UGXA 2NY7H 4HGWB 5FGSA 4QRRB 4UOZA 2G5BA 2WINA 4MAUH 4X5PA 3QJXA 4JL1A 2IQAB 1GPOL 3QUGA 3HKFA 4E9SA 3S4SG 1XGYH 3GSNL 4S11A 1IKNA 5BS0B 4KZEL 4OLUL 4RMTA 1I7RB 1SF3A 2B1AL 2WSKA 5F7BA 3OXSB 1O9VA 3IRPX 4HWUA 4KXZH 4OGAD 5AKRA 3ZRFC 2OZ4L 3D39D 1QOKA 4FN0A 4PCYA 4H20H 2ARJQ 1LMKA 2QGEA 4OLVL 3FSAA 4KK8D 3UZQA 4BDVA 1OWWA 2E7DA 4XWGH 2Y7LA 3AY2A 5AW3B 4GAYB 3FRUB 5F1OB 2XWDA 2CK0L 2YFOA 3NFNA 4X4ME 4Z0XB 3G3LA 4BK5A 1O9ZA 3R7QA 4Y5XC 2GBVA 3SBWA 3PV6B 1J0KA 2H32A 3SOBL 3NFPB 3NRQA 1ZANL 3G5VB 5T3XL 5GIRA 1KY6A 2R0LH 3H85A 1YHPA 2B16A 3PDOB 2DJUA 2V2WB 3CV5A 2ARJB 1YUHB 4GB9A 1THCA 1T2JA 3T0EC 3SBQA 1FNGB 1KJ2B 1N0LB 5I24A 3GRWA 2PPAA 4P57A 4W4OC 4YSTA 3F7VA 3UIZA 1A6ZB 1HSAA 1JAEA 3QUXD 4HLEA 3MRCA 2OKMA 4E2OA 1H3WM 2N1TE 4KMTL 5AYUL 3GRWH 1D9KB 1JHTB 4YHOH 5T33H 3J07A 3N0AA 3EFOB 3LMJL 5IVXE 4M7LL 5IEHA 1GOHA 3OSKA 4YN3A 3DPBA 1GYUA 1COBA 1D5BB 4AG4L 2HJFA 3AFLA 3C87A 3GSQB 1Z9NA 5JHDE 3W1ZA 5ELIA 3ZT7A 4J1UA 5DQDL 3CZFA 4AG4H 2VDPB 3W38A 5DEGB 5KANI 3APMA 3ALPA 3K74B 4E36A 1P0SE 3QJHA 1BAFL 1KXQE 1CGSL 1EAJA 1OSZA 3OQRA 2MPVA 1ZSHA 4Y4HD 1XWVA 3ZE1F 4U49A 1AD9A 3GJFA 1U8MA 4X8XA 1ADQA 2AXFA 3CH1A 4LLDB 4O2EB 4ZMVA 7FABL 1BYOA 4K8RD 1AZZC 4X9FA 3OL2A 1TQUA 4PRIA 5D1XD 4BZ1L 4XMTA 5J8OA 4I3SH 5D7IE 4PJAB 1DBBH 1UWYA 3HKZA 3O4OB 1PLGH 2VABA 4PJBA 1P7QB 3OZ9H 43CAB 1AO7E 5FHAL 5C07A 2OSLB 2ARWA 3FT3A 1MRCH 2CK0H 2CHDA 3ILQD 4XVTH 5DUJA 3ZYZA 3QDGE 4G6AC 4JVUA 2OS7A 1N12A 3BP6B 4RGNE 3Q1SL 1KTDB 4C4KT 1IAKA 5I19L 2A99A 2CLRA 4LPTA 2JI1A 1C12A 1J5DA 3HC3H 3S98A 3IVKB 4JGMA 3HE6B 3AAZB 4ELMB 2FEEL 3IETB 1OCZB 2LGNA 3WTVA 5E8NB 4PBXA 3S35L 2H0EA 3KBFA 1UZ6E 3P4NB 4PHXA 3FQWB 4UQ2B 5BW7A 3VI4F 1YO4A 1LK3L 4N85A 1XIWA 3W81A 1KT2A 5KOMC 4P4KB 3QHTC 3VI3F 4HALA 4C4UA 4OZFH 3IJYA 1WG3A 1AXTH 2DIJA 1XCTA 4LHUA 2KBGA 4NGHH 5C09A 1ES0A 1CLOL 3ZE0F 2YD9A 4FG2A 5KJ7E 2A73A 3DUUA 3Q2LA 4M5YL 1AGFA 3FQTA 4RGNC 2HX8A 4KJQC 1YUHA 1DBMH 4YHNB 5KBKA 3GJFH 1E5BA 2WVTA 1DVQA 1KV3A 4TPRL 3QDJE 3GPEA 3GMNB 4WSGA 1KPVA 4WI4A 1AQKL 2YS4A 4XPHL 3M1BA 5I0ZA 3QA3A 1CDYA 1MCSA 1YEDB 5DT1H 3PU7A 4UQCA 3NACL 5DJDB 2LT9A 3HMXL 3IJ8A 1OKEA 3BVNB 1GY2A 3DPBB 5CINL 1RU9H 4YK4B 3MSPA 1K85A 5JW4R 4WI0A 1GKOA 3RHWK 1A66A 3DTXB 4I1RA 3LZFH 2HWZL 3BRGC 1U95B 4JKLA 2JCCF 4K5NA 4WEUD 3KR3H 1MCBA 3CQPA 5KVMC 3L2MA 4LAQH 5DJ2A 4HETA 4Q8BA 5E1GA 5EZLB 3RFZB 4WGWB 3RWIA 3BH8A 4N2EA 5K9JL 1FVDB 4WLCA 4TF4A 5CSBA 3CLWA 3FONA 4K3GA 4HIIA 3DLQR 4APXA 4PJAA 3MRLA 3ECBA 3VRLE 3SGDH 3VH8A 2BOBA 3V4PH 4AL8H 12E8H 4NP4H 3UTQA 2ADJB 5FK9A 1S5HB 1E90A 4HX1A 3IN0A 3VI4A 1K8IB 4NWUL 5B7EA 3PGFH 4IIQB 5F93C 1YEWA 2A83B 3IXAB 2A4CA 4Q56A 4UT6H 1ZLSL 1M05A 1MRFL 3FT2B 1H9VA 3CDFA 3LQAL 1DVTA 4BHUI 1NEZB 4UI2A 3FU7B 4HUWB 1IC0A 3JUYA 4GKSB 4MAYA 3T6QC 2H45A 3A3YB 3SPVA 2EVGA 3LNFA 3CPUA 1GYVA 1R19A 4CN1A 1OAZH 3N1PC 4KAQL 5BZWA 4HWBL 4F33B 4PGDA 4WU5B 2H6UA 1MCLA 4Y4FB 3ETSA 5EIIG 3ESUF 1XCTB 4LHUB 5C09B 4ONFL 4XE5B 2VXVH 2Q8AH 1WFTA 2FRGP 1LO3L 3RFRA 4F24A 4UIMA 2CMRL 3NIDF 3CH8A 4WK0B 4XNZC 3TESA 3CX5J 3VGHA 2GSIA 4X7SL 4AIZA 4JRYB 3BQUA 4UT9A 2ICWI 5C71A 1E5CA 2V9RA 4QF1B 2I24N 3RTQD 4RAVB 1JZ5A 2WTPA 4FG0A 3SB3A 3MBEB 3QHZL 1GOFA 2YGOA 1FE8L 4HLZH 2I07B 2KZKA 1QSED 4M6OH 3NIGE 1A1OB 4N90D 3PS6A 3MRJB 1LQBC 2AJVL 4NPKA 5JHDB 2X4PB 4YDLB 5GXBB 3DX6B 2I27N 2Q8BH 3H6JA 1XBDA 5IV2B 1TVBA 3WIIL 3HZMB 3O3UN 1SJHB 3F62A 1E9QA 3ABKB 1BZ8A 1SGKA 3EDFA 3DO3A 1BFVH 3UABA 4PJEE 4UMSA 3A21A 1MJ8L 1LK2A 1XGRB 4R5TA 3VQ2C 4GMSL 3ARBB 1D9KC 2GAZA 2Y5QA 1DN0A 2E7LC 1XT5A 1S9WB 2JFCA 3I2CH 1HAUA 1VA9A 3KWUA 1KULA 4RSVA 2FLMA 2N4IA 5D2LF 3UGUA 5IWLC 1CGSH 5A2KH 4NIKB 1JD7A 4ZMPA 1S9VB 2Z35B 3IGAB 3T2LA 3T0EE 4YIQB 2KZWA 3TBWB 4MMZC 2Q6WA 3CBRA 1ZTXE 1HWWA 1C8QA 3WE6A 4CJ1A 4PLKD 1AGDA 1I9RH 3FSVA 4Q6IA 1T3FA 4A2GA 3V8OA 3MRHA 2XG5A 4ES8A 3HFFA 3DGGB 4OV6F 1NL0L 2J21A 2QGDA 4GP5B 1U2CA 4OLWL 5D8JH 3VRIB 4P5RA 2F1AA 2UYLA 3MLXH 4Y16D 4QRFA 3I3BA 3MU3A 5IJBC 1QSVA 4OGYL 2DICA 2GSGA 3VVVA 2M2DA 4LEBA 3CSGA 3SKOA 4PV8B 4JR9H 4TUOA 5D2LE 2F5BL 3VX0A 4EOWL 1T22B 2R9HD 2WXHA 4ODXB 3HI1A 4UB0L 1AACA 4DQOH 4LSUH 1D5ZA 3QO1B 5ESAA 5GS2H 3KPRE 3IDNB 4KUCD 3ZKSD 1KBPA 1O5DT 4V11A 2MCG1 3U82B 4OCYH 3FU3A 4S1RH 2XWZA 1P2CB 1SM3L 4R4FH 3QCVH 1SYSA 4ZTEA 3BIKB 2FO4B 4YGVB 4J2QA 2ENYA 2H6PB 2E9BA 3MHZA 3TA3C 4OUUB 1DVSA 4L0PB 2XQ0A 1WT5C 4QNPF 2OW6A 1SHSA 3WL9A 5ISZB 2ESVE 1VFBA 1LE5A 2O72A 4Q2ZA 1BFOB 5D71H 2QELA 2NY2B 2PW1A 2WQSA 1UWXH 3AWEA 4LESA 3ZYOA 3C2AH 5CKAA 5L2KE 1T20A 4HU8A 2Q2LA 4BXVA 4MNGE 4A7GA 4ELKB 3N41B 5TJWK 4E9YA 3VWKA 3OAYH 4N2HA 3EIFA 4NWTL 3IJEA 2R2HA 2OQJA 1FORH 3W0WA 3HMXH 1RSYA 1ML0A 4P23D 4NUJA 4NC2B 5T3ZE 1IGIH 2CR0A 3DXAB 4HJ0C 3K8MA 5TGBB 1EZSA 4F7TB 5EF1A 1SY6A 2YLKA 4RDBA 4XNQA 1S9XB 1MFBH 1ZEAH 4G8EA 3CJJA 2ATKB 4KNTA 4QRSA 2HFTA 1JV2B 1QX1A 2ENSA 5ALBH 5FDWB 3PWVA 4MQTB 4IEFA 3S37H 1FZKB 5LNEA 3GO1L 2VXTH 4PJFA 2P43B 1FNSL 5IGXL 3STBA 2Y23A 3N44F 35C8L 3IDIB 2DWEA 3I02B 5I6OA 3LPGA 4ELMF 2IAAC 1OWRM 1O0VA 1T5XB 3MRHB 3OKEA 4OLYH 3NIDE 4OCYL 4M6OL 4RMBA 4AEHH 3D2UD 3AROA 2OFQA 3ET9F 3RDTA 3CVDA 2FEEI 2VDNH 5EN3A 3VW3H 4M93B 2D03L 2P5PA 4NQVB 3L1EA 1WIUA 1NMBL 3IXTB 3SYPA 3KYNB 3LEXB 1FFPB 4W9GC 4NM4L 3BSZA 1EO8H 4R97C 1A3RL 2ITDB 2H3NB 2RH0A 3BZ5A 3ISYA 3VFVA 2P7TB 3N0PB 2VLKD 1A6WL 1X5GA 2F54A 4PV8A 3KD4A 3VGEA 5FGBA 1OV8A 4JNXA 1M7UA 3C2AL 3OAUH 4NQUA 2Z93B 4BA8A 4PS3A 3K6SA 5DO8A 2E8ZA 4L4TD 1UH2A 2GTWB 4RETB 4PCSA 2GHWB 4P4KD 5J6HB