4MZIA

Crystal structure of a human mutant p53
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
193
structure length
193
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKFGTCTYSPALNKMFVQLAKTVPVQLYVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERSSDSDGLAPPQHLIRVEGNLRAEYLDDPNTFRHSVVVPYEPPEVGSDYTTIYFKFMCNSSCMGGMNRRPILVIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antitumor protein
molecule keywords Cellular tumor antigen p53
publication title Reversal of the DNA-Binding-Induced Loop L1 Conformational Switch in an Engineered Human p53 Protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4mziA00
3IGLA 1CO1A 3D08A 2XWCA 3VD0A 3WTXA 3Q05A 5AOMA 4L0ZA 5BUAA 2J6WA 1T4WA 4IBTA 2RMNA 2VUKA 4IBQA 4AGPA 3IGKA 2J1WA 4L18A 2X0UA 4IBZA 5KBDA 3WTWA 1HU8A 1H9DA 1E50A 5AOLA 4A63A 4AGLA 4IBVA 3WTVA 3WTSA 2GEQA 4MZRA 3WTUA 3TS8A 5A7BA 3US1A 2AC0A 4G83A 2H1LM 2ATAA 2AHIA 1KZYA 3US0A 2IOIA 2J21A 4G82A 3QYMA 5ECGA 5ABAA 2BIMA 5AB9A 3D06A 4IBYA 3EXLA 5LGYA 4GUOA 4HJEA 1HJBC 2J20A 4LOFA 3QYNA 3D07A 2X0WA 2MEJB 4IBSA 2BIQA 2J1ZA 5AOIA 2ADYA 4LO9A 3KMDA 1TSRA 1EANA 4L0YA 1IO4C 1GZHA 2PCXA 3D0AA 3D09A 4MZIA 2X0VA 1EAQA 1LJMA 5AOKA 4AGNA 4LOEA 4AGQA 4GUQA 2BIOA 1YCSA 3KZ8A 3WTTA 4IBUA 1GZHC 2J1YA 3ZMEA 4XR8C 1UOLA 3VD2A 2IOOA 5AOJA 5G4MA 2XWRA 3Q06A 5LAPA 1TUPA 3EXJA 2IOMA 2YBGA 3VD1A 2WGXA 3WTYA 4AGMA 4QO1B 1HJCA 1EAOA 2FEJA 3D05A 4IJTA 5G4NA 4IBWA 2J1XA 2BIPA 3Q01A 4KVPA 2P52A 5G4OA 1CMOA 3WU1A 4AGOA 2BINA 2OCJA
chains in the Genus database with same CATH superfamily
3VI4A 5DQDH 5ISZA 4PTTA 4AUUA 2ESVE 2IH3A 3JZ7A 3L54A 5KUKA 3EBIA 2D8KA 2D2OA 2DJSA 2G3MA 4B9IA 1JD7A 3EOTH 4JDEA 1BVKB 1KC5L 2VZ3A 3L3JB 4TS6A 1A6TA 3BUBA 4QUOA 1TQTA 3I85A 1IKFH 2N59A 3D85B 3KYMB 2CJUL 4YWGL 3S4SG 1DUYA 5IEKA 4LASL 4WNJA 5J06A 5FW6A 4DERA 1QACA 3PGDB 4TVPE 5IB4A 1WFIA 3LKNA 4PJ7F 1SY6A 3U6RB 4N2BA 1SXSA 2X4NB 5D1ZI 1VESA 2R0ZH 2O1AA 4JFXB 5DMGD 3V0GA 3V0HA 5C0AB 1EHLH 4OFYA 3SPIA 2W65A 5DD3L 3BIKA 3IDNA 3DGGA 5J89A 3EJZD 3K6OA 3OMIB 4U1GB 4OZGA 3QZBA 3JWOH 1YNKL 3QDME 1CLZL 4HHWA 4UAHA 3OGCA 4GAYA 2C4FU 1URLA 3MA9L 4XPAL 1G1CA 3ABKB 3C5ZA 4GAGH 3HS9A 3GMPB 1NH6A 1FPTH 2H8PA 3PQYB 4AL8C 1G7MA 3MLYH 2WP3T 3L81A 4M4RB 5GGRY 5HDQL 1SDYA 2YN3A 4FLRA 3TBWA 4MHHG 4YL9A 2W9LA 3UAAA 4PAZA 1N68A 2YC1B 4TNGA 1ET5A 3LQAH 4MAZA 4H40A 3HMXL 1G7PA 1Y1DA 2CM6A 3K2MC 5DJCB 4JFEB 3PGFL 4LQFL 4LOUD 4TQEL 3X17A 2ALWA 1IBHA 1K4CB 1B2WH 4WF7A 3X1EA 2AK1L 2QDVA 2YLHA 1YCSA 1QNZL 3E8UH 3KGUA 3MV9D 1NMBH 5CSGA 4ZW3A 5JQ6H 3DSNA 4NDMB 1BFOB 5H2BB 2RR3A 1LO2L 4L3EB 1SHMA 5TPWL 4OQTH 5JHDE 3WE6B 3TV3L 1BGXH 4NOBA 3PABB 5LAPA 2YGVA 5SWSB 4JGJA 3UBXI 1K3ZA 1HOEA 2CGRH 3K72B 5BZZA 3MRLB 3HE6C 5IVZA 2WUBH 1JNNL 5C0BA 2YBRB 3VFNA 2HJFB 3N55A 5FKPB 1ML0A 3VGGA 5HHVH 2VC2L 1UD6A 4Q4IA 3BEVB 4ZMZA 4NO0A 2NY5L 2WN2A 1T0OA 5E6ZA 3OR7A 4GY4A 1A6AA 2DWSA 2F9BT 3G5VA 4WFGE 4AY0A 5G5DB 3ULUH 2BC4A 5HHQA 1CLOL 1KJ3L 1DZBA 1T0MA 1OY3B 2ZXQA 3M17A 2MPAH 5HHME 3ARGD 2P43B 4YOKA 3W39B 2OMUA 4Q9QL 3MRNB 2FWOA 2A5UA 2KDGA 5IT2L 2R2EA 5GSVA 2GJJA 2EIZB 4CJ0A 4G9FD 4S1RH 1IGML 4LPCA 4CILA 5EU3B 4LSQH 3P77B 3O2WL 3QDJD 4XMZA 4IBVA 4P0DA 2QVIA 3GZOA 4U49A 1YLBB 1AGDA 3N1GC 4NENB 4XNAA 2FQGA 5I1GH 2JMRA 4H1LH 1PTZA 2AZAA 1P7KB 5GGVL 4XE5B 2X40A 4J4PD 4RQQB 1AXSB 4J3OD 1PX3A 3RTLA 1MW2A 3HG2A 1S8DB 3GQFA 1OSPH 1PGRB 2X4SB 4CC4A 1DQLL 4XP5L 5CXPA 3FCBA 4HUUA 2XV0A 4YBQC 5IFHL 2RJMA 1BREA 3B3IB 4ZI8A 3GNML 2BWQA 4I7ZC 3QIUB 5EU5A 2VW6A 4LL1A 3AZUA 3MYJA 1A6UH 4P2OA 4HJUA 1WH0A 3VFPA 3MV8E 2KC0A 1XGRA 4DESA 1I7UB 3IXAB 2JJWA 4XVJL 3HLKA 1BG1A 3OBAA 4Y5VA 1OTTC 1JGLH 2IPKA 2DD8L 3SKMB 1V3LA 2YA2A 2VE6B 3KEHA 3G08A 4JKWA 4JL1A 1QLRB 3JTSB 1BFTA 1EXGA 3S4SA 5D7IA 3RPIB 3HI5H 3WG7B 1MCWM 1YDPB 2E7LA 1FZMA 5BRZA 4R4BB 4Y5YC 4DKFL 3MC0A 5EOTB 3BVXA 4CU6A 2DH2A 3DX2A 1T6VN 2XVBA 5C09D 4ODTH 5D9SB 1MFDH 1ZLWK 5ITBH 1H6EA 1W72L 1TUPA 4HKXB 4KPHH 3T3ME 3P1VA 3QZOA 5B1KA 3CK0H 1MRFH 3QWQB 4RFEB 3CZGA 5DEGB 1OSEA 4H8HA 4OD1L 4X5PA 2WQXA 3RNKA 2VN5A 1Q1PA 4YDIH 5GJSH 1I1CA 4GKZA 2DIAA 5ACMA 3RIKA 1DJGA 5G4NA 4M8QA 1ZTXH 3RGVA 4EBQL 2EZ0D 1R5VB 4OLYH 4P9MH 3PL6D 2P8PA 1CMOA 1AH1A 1FFPA 3DUUB 4LDLB 1IE4A 1RFDH 3QG7L 4JM2B 1KPUA 5DD0H 2Y1ZA 4EN3A 5K59F 2DDQH 3PREA 4W1TA 5LXGL 1PJ9A 1X5FA 1WIUA 1UB5B 5FYJE 1MPAL 5BVJB 1D5BA 1ZEAH 1AR1B 1R3KB 5JO5B 1AD9A 3DX8B 4PBVC 1WUZA 1JNJA 1F3JB 2E7DA 4CUCA 3NZ8A 4QHMA 3TVMC 1GYWA 1JUFA 4LLUB 3B2PA 3LS5H 4F7EA 4X4YB 5IIEB 1IEAA 1W8NA 2UZXA 2XWEA 1LE5A 1DZ0A 1FBIH 4FKHA 1ADWA 4MAYD 1T22B 4QHKJ 4NO2B 4EI6B 4GAAA 3LVEA 1HU8A 4Q8BA 1DL7L 2JCCE 1QR4A 3X11A 1XSKA 2UXTA 2EYSB 1EEUA 2WO2B 5GGUA 3SDCD 5IUCA 3CVDA 1V54B 3GBML 5IWLA 4APXB 5KN5B 1CVSC 2A74C 5MENE 3I84A 1NMAH 5I1KL 3Q2CA 1I9JH 5EA0L 5JXEA 1S9WB 2WSPA 2M83A 1AACA 4GMTH 3PGCA 4NSKB 5AW9B 4YUEL 1CD0A 1MLBB 2OMVA 1DTUA 3B6SB 5IM7A 3JV6B 2P1YA 3IBOA 3ECBB 4IRJA 4J3OH 4MDRA 1QSFA 3L95A 1ORSB 3PJNA 5J12C 4POZC 5EIIG 4JHAH 5CLWA 4HJTA 4N0UE 2BRQA 4X5WB 3VXTB 4G2AA 4JGNA 1AGFB 3QFGA 5E8EB 1E67A 3NCYS 2XXCB 2F19L 3MODL 3MYZA 3NIGF 5DA4A 2JSFA 5DRWB 4DEPB 4JQIA 4MJ5B 1LK3H 2AXHA 2NQDA 4WI9A 3UJJH 2W38A 2XTJE 3ZRSA 1II4E 1QZNA 4P4RB 4X9GA 2V2XA 3K4AA 1SY6L 2PXYC 3ZQXA 4WGWB 5TF0A 4P4KB 1N9PA 4NJ9H 1AQDA 5HI4D 2VNCA 5IVXA 4M43H 3RWIB 3FFDB 4HWBA 1N59A 4JFFA 1INEH 2EINB 3MJ7B 4AYDC 4NQCA 4CNIA 4AMKH 4LAJH 2QVMA 1KN4H 2ERJB 3ZDYB 1UOLA 3B8YA 5ITFA 1LK2A 3AM8A 2B5IC 3WFDL 5KWYC 3GXPA 3S97C 1L9NA 2WV3A 4XMKL 1MJ7H 5AYUH 2OR7A 2F54A 4OKVB 1TJGH 2YQBA 3SOBH 1YEDA 5DC2A 3UTZA 3FXIC 3KCWA 5TQ0H 2WGXA 4O4YL 2XV6B 5H35A 3TNNA 3BAJA 4RWHA 1E8YA 3C60B 2G3ZA 2J1KA 3U36A 2IANA 4FNUA 4BQ6A 1EFXD 3QORB 3MROB 3SY0B 3CFEA 1HNGA 3OAWA 2CCVA 4LEXL 4NQVB 1JYXA 3QI9B 1E4HA 2P8LB 3S35H 2X4OB 2NLJA 4KZCA 2WWOA 4WWKC 5LG1A 4F15C 2ZX5A 4ZTOL 3RKDC 3A4DA 4IOSA 4NWUH 4MNGB 3C2SA 3H4HA 3S36H 4HOXA 3HS0B 1JWUA 1WISA 4W70A 4X50A 3VMNA 4NIYE 4K15A 4BFOA 2G5UA 2JFCA 1WGVA 4JM4L 1N6QL 1EV2E 1R47A 2EE6A 3KLHD 1VFAA 1OPGL 4KRPC 4P9HL 3I2CL 3ALXA 1KGCE 4L2LA 5AWNH 4ERSH 2JB5L 2R4RH 4JM2F 4L29B 2AK4A 5A2JH 1U8MB 3C8DA 5M94B 1TEGA 3L3DA 2CRYA 2D7QA 3SQOL 1UUSA 2Z1KA 4MXVF 5F93C 5DJ6B 3HHSA 5FA4A 4DK5A 3KCPB 3L48A 1CTOA 5AW8B 3QIWC 4ODBD 3LH8A 3OKLA 1AP2A 3V52L 1A1OA 5LN4A 1G7JA 3CQFA 2H1LM 1H3GA 2DEWX 3AXHA 2QFRA 4MJHA 2L7QA 2Q86A 3P9LB 4R26L 4I3RH 3RVWD 4P23C 4KU1A 3CVBA 2APVA 4QRQB 2YEZB 4EDXB 4QLWA 3NG5A 5ALCH 1V7NH 3VI4E 5C92A 8FABB 5ISZE 2IBZX 5I82A 1SYVA 1DQJA 3V8OA 1HJBC 4KK6D 5IB1B 1AJ7H 3IJHA 4TNEA 3WFHA 1MWOA 1KB5B 5KANG 5F3FA 2BFGA 3ZDZF 3GRWH 3LQMA 4PB9H 3UJIL 5I1JH 2EIJB 4XNQB 1XAUA 2P24B 3NAAL 3IF1A 4NT6B 4TSCH 4FHKA 1UT1A 3IPFA 2ZXWB 5E8PA 4Q6IA 1UURA 3IDJB 4GSDL 3QVAA 3BVVA 4WW1A 4KZEH 5AVTB 5HDBF 2HCZX 3V4VH 4BK5A 4PTUB 3T4AB 3JQOB 1QFHA 1EAPA 2ZTBA 3VSUA 1BJ8A 2C8NA 5F9OL 3VQMA 4DO5A 4KX7A 2DWYA 4BV1A 4EZKA 4KI5F 2XOTA 1FAKT 2CO3A 2J71A 1SJVA 4P3WA 4MBOA 4YFEA 4L4TB 3SPCA 3KBEA 1WEJL 3NTCL 3LEYL 1I3RB 3MXVH 5T1JA 2VDPH 4HDIB 4LKXA 3IKCA 5EIIA 4FXGA 2H45A 1NC4B 5CEYB 1I7RB 1N0XL 3ERXA 5KBMA 1CXLA 3ZHNA 3HTLX 4N8VG 4NYLA 2VITA 3N50A 1KN2L 5BS0A 4FQ1L 3K8LA 3WHE0 5I76B 2X3CA 2JNZA 1FJ1A 3R8QA 4I4WA 2FJFA 3QUYA 4P57A 5I0ZA 4HMCA 4LDOB 4HIQA 1Y6MR 5FYJU 1P7BA 3WEMA 3ARBA 4PW9A 4XP9H 3DX1A 1T4WA 2XPGB 2RMNA 3WIAA 5AZUA 1M3JA 1ZA6B 4KO5A 3SBQA 3HCVA 1IGYA 2WXLA 3SGDI 4AT6B 5C0BE 5CSZB 3L5IA 1E4XL 3FRUA 2W92A 4FFZH 4QRRB 3VH8G 4OBRA 4F7TA 4G8EA 1T21B 3DDGA 1P9MC 3AT9A 5I66A 5DI8B 1NFDB 4N2IA 1NGPL 1W2KT 3KYKH 4X9IA 5F7NC 1WBXB 4C8XA 2WBJD 2H3XC 4JFYA 4G8AC 5L4IA 2N7BA 4L8CA 4U31A 1Y0LB 3QZWB 2HX7A 3FOMA 3V4UL 1WJ3A 5I2IA 4GH7B 3KXFE 5HDOA 4EOWH 1BZOA 1PZAA 4PS3A 5DURD 1XXDC 3L3HA 4OZHB 5A2KH 2QVFB 5CD3A 2GITB 3PHOB 3PWUA 3SCMC 1E40A 3ARWA 4KOCA 4KH9A 1DBAL 5BMFL 1C5DB 1P6FA 3H2PA 2Z93B 3MRBB 2L8AA 3V0IA 3U1QA 3KL5A 4PJHE 2PR4H 2XG5B 5KSBB 5LLIC 1RK0B 1U58A 3G5ZA 3P4NB 3KD4A 2EADA 3FW6A 2CBQA 1QO3A 3LSOB 4K7PL 4M00A 4QHUA 4AKQA 4WW2A 1T0NA 3UJTH 3QXVA 2P47B 3F2LA 1KELL 5E1AB 3TX4A 4CJ1A 5LVEA 5DLMH 2J88H 1YAIA 3QULB 2WBKA 3U83A 5DHYB 3WJLC 3GXIA 4PJCA 3O6FB 4C56A 4WI8A 3OGOE 5JW3L 1NKRA 1LMKA 3U2JA 3HE7C 2OI9B 4RGND 5I26A 1UA6L 1J9SA 4Y4HC 1YEFH 3SPGA 5GRZA 1FE8L 3ULVF 1RZQA 3BESR 3WIHA 4CGUB 1E8WA 1YO4A 2XWZA 4I0CC 2WQUA 1IM9A 2B3RA 4KTEL 4JKLA 5EOCJ 3S34L 1Z9MA 1GW0A 3HRZA 4OZFG 4R5TA 4JZJC 3FQWA 4POYA 1SDDA 4QJ4B 4U1SA 3RDTA 4HKBB 4QCIA 4JQIL 4Y16C 5E5MB 5SWZB 2W0FB 4IRSA 1KCKA 2Y72A 1RJLB 2HTLD 2BSED 2Q76B 3F7RA 2AJZA 4XB7A 3F7QA 5HYJE 4FYRA 1HN1A 2Z64C 4IS6A 5D7IE 4Q2ZB 1RXLA 2G2RA 1PZSA 2YD2A 4NHCL 4IKJA 3LN4A 5BRZE 3EJYD 4DIXA 1VEMA 3HG1A 2IPUG 2DQEL 4LSUL 4QMEA 2WK2A 3QUZB 4R84A 4RX4A 1ULVA 4PLOB 1EO8L 1F86A 1AO7D 2I07B 5F7HA 1JPGA 4PMEA 4UUJB 1W0YT 4TNFA 5CJXA 3W9EB 3EYVB 3UAJC 5B7FA 4ZW8A 2P49B 3BWZA 2ZAHA 3L3KB 1EX0A 3HKFA 4DP1X 4MNQD 1PW3A 5IVOA 3AS0A 3I6GB 4ETQB 2QVKA 2EACA 4WEEA 2DQFA 4X98A 4BFJA 5DMIL 1EHNA 4YNYA 2JELL 1L4IA 4C47A 4U3SA 5I1AA 1S7QA 5EZOL 4UQIM 5F0LB 2FB4L 1U3HA 4BRJA 3KPQB 4KKBC 1EIBA 1CZ8L 3FT3B 1AS8A 4OH2A 2OZ4L 1OARH 3AC0A 1AY1H 4ANVA 1N4XL 2EC8A 2NTFA 2ZNXA 4WHYG 3GSNA 2VLRA 3IU3A 3OV6A 4S2SB 5IHBA 2FE0A 1NFDF 4FQCL 4P2QD 1SBBA 2DQIL 1L9MA 4QKXB 5L88H 4E41A 3A0OA 2FHBA 2C7FA 5KUMA 5IV2A 4M62L 4U1GC 1DVUA 5IB5B 35C8L 3WXVL 1WF5A 1QFWL 2QT6A 3D3VA 3IT8D 4IMLA 1BZ7A 2VXSH 2HJLB 3TP4A 1BAFH 2EUXA 1ICTA 1P4IL 4D9QE 4FA7B 3LZFH 1DBJH 4FERA 5H94A 4EF3A 1BF2A 2ZOKB 5DVPA 3MNVA 2IDSA 5DZPA 2ZOWA 2H3NA 1RU9L 2X2IA 3PWLA 1CDCA 1D5IH 2A99A 2NY3B 3LKRA 4Y19B 4D0BA 1FCCA 1OCOB 4IOFD 2FK9A 3BKCH 3GMNB 3WSQL 1YECL 3CXFA 1I1AD 2QEJA 2ZYHA 3OMZA 2NOYA 2RB8A 4GBXD 2HLFD 2PW1A 4A2HA 4I0PD 4IJ3C 2ENYA 4PFEA 2AJYH 4NWTH 4Y1AE 4YXKH 4CMMA 1Z9SA 4U0QB 4P5TB 1QSFE 1PL3A 1H6FA 1JHTB 1G9MC 4OCXL 4CU8A 3OKDA 1FNGA 4RBPH 3CBJB 1E9PA 1FLRH 3DO4A 5C0AD 3VTTA 2V2TB 3ZO9A 3KHQA 4G80B 4L9LC 5IQ7H 2YRPA 3PY9A 1G0YR 2XJLA 4B50A 4QXTB 3EFFA 1COBA 1G7HA 1U9KA 1CD1B 2BP5M 4NNYB 4ORZC 4KX8A 1LO4L 2J4WL 4G1MB 2JKLA 3PQYD 1N26A 4HXAH 5IVXE 3U4KA 2VM3A 2LE9A 1N2RB 4KC3B 1S7TB 4NQCE 5GHWH 5MERB 5CKAA 2NNFA 4OSUL 4TSBH 2AXJA 4Z7OE 5E03A 3U0WH 3MRPB 3FB5B 3MUJA 2GHWB 3LB6C 2IDQA 3NPSB 1HL4A 4XN5A 5DD1H 2F5BH 1JXDA 1I8UA 3MJ6A 3VXPA 4XC3L 1ZLVK 2UY6B 2SEBA 1RZ7H 2F54E 1WWAX 4OD2B 1GGTA 3BYTA 3ATAA 5ID0A 1IGTA 2OXHB 2JK5B 3EGSB 7CGTA 2YAFA 2GJ6B 4FG6C 2UY7A 2B14A 4KTDH 3BCDA 5KW9H 2IANE 2CO7A 5D1XB 4F92B 1DN2A 2A1WH 3MO1A 4L3ED 1SMDA 2YSSA 2GJZA 2XJKA 4Z3HA 4ORGA 3AGWA 1WSST 2P5EA 3KPMB 2AHIA 2AW2A 4UQ9A 3CZEA 3EH2A 4URTB 5SWSD 3VX1A 3CMOH 4E0RA 5CINL 2WQ8A 4HFWA 4OZFA 3ZDXE 2O6PA 3VXQB 4L8BA 4XCFH 1UXLA 1FFTB 2ADIB 2PWFA 1TIUA 3ARXA 3K7UA 5BNXD 1RZJL 4MA8H 4XNYL 4JHWL 2J73A 1DVFC 2HRLA 1ZLDA 2IWKA 1UXSB 2MQ3A 4LHQB 3QXTA 5DQ9B 5FW7A 4YSOA 3N1MC 3BDYL 4MYWB 5D96B 5DC9B 5DUMH 5LUMA 1JGVH 3MAWA 1BIIA 1WP6A 5GRJL 3IFLH 4ODUA 5T5FH 4XNDA 5BXFA 4UB0L 3TT1H 4Z3JA 1DBKL 4LSTH 4PPTA 4WI0B 3QIUC 3LV3B 2VMFA 2A9MH 4DN3H 2VN7A 2HT3C 1F4XL 3GPSA 4FQXC 2ZOTA 3UO1L 1YEKH 2FJGA 1REIA 2Y7QA 2AQ1A 1I7ZB 3RA7L 3B9VA 2IAMB 2J5WA 1HC1A 1T89C 5D2NB 3IAGC 4GUPB 3KPOA 4XMLL 1OM3H 2BSDA 5EF3A 4UIMB 3RPBA 1A6WH 2XYBA 5F1IB 4BFEA 2X4TA 1IT9H 1VACA 4V1DE 5INCA 1O9ZA 2F15A 2WJ5A 4MDJA 1UT9A 4H2AA 4YVNA 1DANU 1P7HL 4Y4FD 4NAJA 3ALPA 4Z8FH 1BZQK 4PRHB 3MRHB 1AZBA 1M6UA 4PU2A 3V0VA 4WO0A 4UTAH 4YHLH 1K5NA 1FRGH 5C0NC 4GUCA 3NYKA 4JRYB 4JBSA 4ZFQA 2XDHA 3BQUB 4IKLA 1JXGA 3X13B 1Z9OA 4D7BA 4ICWA 5FFOA 4MB1A 1I9RH 1JVOA 2A6IA 3OAUL 3TO4C 2E59A 3CFNA 5FHBL 5K5YA 2NCEA 4ICXA 3S88L 4A7TA 1I1RA 2DIJA 5IP4A 3OAZK 5AZEL 4L1HA 1OAYH 2V9TA 3FU5A 3OZLA 4FX5A 3FCSB 3LIZH 5D2LB 2FL5A 1GPOH 2AAVA 2CLVA 2V6HA 4OGXL 2R1WB 1VFBA 3CFCH 4PJIA 5LDUA 3JV4A 1ZVYA 4XX1G 4F2ME 1AR1C 1G87A 3GEFA 1FO0B 3S3PA 2H32A 5M95B 5E8NB 3MLZL 3WIHL 4R3SA 2K0RA 4JJ5B 5HYIA 1JRHI 3LVTA 4HUMB 3A4EA 1XF4B 4N0YL 5DK2A 2D0FA 3K71A 2WMPA 2YK1H 3T9WA 1SZNA 3WTSA 2ZJSH 4YC2C 3BFWA 4M6OH 1KYDA 2BNUA 5T1LA 2CJ3A 1DSWA 1FZOB 3MRDB 4ALAH 1OAZH 3VFSB 2HTKC 4Z0BL 5EC1B 3T8MA 3QEUA 1G9MH 4TLSA 3MCKB 5BS0E 1F11B 3D51A 2WP3O 3H9SA 3MACL 4W9LC 4GW1A 2Y4SA 2VR7A 4QRUA 3V55A 3SDYL 3BP4A 2Q7AA 4P2CG 4R4NC 3MKGA 3SGEH 4EJ1C 2NY6B 1S4IA 2GTWB 3BAEL 3CLEH 2XA3A 5HI5C 5I73B 3SE8H 2ZONA 4PEEA 5A7EA 1EMTL 4JM2D 1M3IA 3OKOA 1QSZA 4I9WD 2XNAB 5CHNB 2TAAA 1CCZA 4YHOL 3WKNA 1QRND 4L48A 3T3PE 1U95B 2F74A 3DJ9A 1F1AA 1PY9A 5FO2A 3QJTB 4NGHL 1J1XH 1F6LL 5D72L 2DM7A 4GQRA 4CADA 1OQOA 4G9DB 3BX7C 4MXWL 5D7HA 5E2TH 2RQEA 3SQRA 1MWAB 4P4KC 3W2DH 4G3YH 4F7PB 4X6FA 2QQLL 4UV7H 4WJ5B 3BH8A 1N0LB 4PJBF 4DKEL 2NDFA 5DK3A 5G4MA 1D6VH 1X6NA 4NCC1 4YO0A 1JK8B 3PJLA 2WQVA 3D1MC 4LZKA 3MBWA 4BQCA 2ERJC 4QTHB 1ZHKA 2ZF8A 4P46B 1YNLH 4JZOB 3RNQA 2ILLA 3WTYA 5HYSA 4BWTA 1C9SA 3F5WB 3LKPB 5IR1B 1EJ6A 5FGRA 4OQ1A 3HC4L 4F37K 2HFFB 2J1XA 4UQ3B 4WK0B 3C60C 2QZ5A 1RIVH 2JB6A 5D4IA 3QORC 4JK0D 2ZYRA 3TIEA 5DD5H 3VFGH 3QI9C 4UDUA 4LMQI 1IAOB 4AXWB 3VRIB 1XL4A 3ZZLA 1EXUA 1MF2L 3Q2NA 4ENED 5IW6A 2AXFB 4PJCE 1CU4L 3NJMA 3NP3A 4C56E 3GUTA 1NEPA 4JFDB 3VACA 2NUPB 3MUZ1 1RZIA 3PWPA 1MHCA 2EH7L 3JV5A 2BW5A 4FULA 5DJDB 3SBRA 4X99A 1NC2B 2AEQH 3S3DB 3IETA 3MU3A 2V7NA 4KI5D 4YSRA 4WFHD 2F0CA 4G7VL 3RWDB 4JO1L 4AM0B 3AWEA 1QBML 2W9DH 1MH5B 1BQ5A 3MR9A 4NHUA 4GNKB 1WCBA 4DP2X 5IROA 3MLRL 3PWVB 4Z7VA 1KIPA 1YEGH 1RLBA 2F53A 2GPZA 1G1OA 4G5AA 2HX9A 2O5XL 1IIKA 4AENB 1DJSA 1INDL 1NOLA 2DM4A 5KAQG 3T0EA 4PVMA 4BGDA 3GSOB 4IIQA 4RAHA 1B0RB 3HG1E 3VFVA 2GBVA 1IU1A 4XBPA 4ODSH 1Z32X 5HP5A 1JWSB 5JYLA 1D9KB 4P59H 5DRZB 3QPXL 1HSAA 1DQIA 1DLFL 1F4WL 3GZKA 2BIHA 4NQXB 5DZVA 4HCIA 3HFMH 1T5XB 4PGBA 5FO8B 3U0TB 3O81A 2VXTL 4DPAX 1BD2D 3P9WB 4GW4B 1MCIA 1NLBH 1VIWA 3B43A 3QCUH 3IDMA 2FECL 3R06B 2NYZA 4FQ2L 3SD2A 4ZFFB 2AJSH 2C1PB 1YSOA 2PYEB 3QJXA 3SQBA 1VADA 4ZSOA 4ONFH 1OZUA 2IALB 3VXNB 5I16A 2DQUL 5CF3A 4DP9X 5ESQA 5D1ZB 1HVXA 3CMGA 1NCJA 2K7QA 3GZQA 3ZHDA 4HIHA 4ANKA 1WZKA 3LXAA 4AEHH 4E41E 5I5RA 1ZHNA 3MJ8B 3FT1A 3T4AC 3Q5TA 32C2A 1DVTA 3OKYA 4FA8A 5FUCE 1XXFC 4WK2B 3CH1A 5C2UB 2CLRA 3RTQD 5DJZB 3ZKXB 3RAJL 3HLAB 4MB5A 4Q6YA 4G6MH 3GS7A 3KM2A 3K8KA 5CWSB 2OSLB 1MSPA 1P4LB 1ZHLA 3KNBA 3NJNA 4NI3A 5I1HL 4UI2A 5IJVA 2VXUL 2DICA 4M03A 1IARB 3DVGA 1QVOB 4MXQD 3B5GA 4URKA 4Q74A 4DKTA 2VQ1A 3ZMNA 1S9VB 1UJ3C 2ZSWA 4GO9A 5CZVH 2G2NA 1OP3K 1R17A 2RACA 2EUZA 1SYSA 4JCMA 5D7JA 3KDMB 4F27A 3VWJB 1E4KA 3ARSA 4P5MA 2QKIB 1XR9A 1E2ZA 3AG2B 2MIZA 3S37X 1SLVA 5AOZA 3EAKA 3RLSA 1DUZB 3ZIMA 4UOW0 5J1AA 1SEBB 3HHMA 3ECWA 5FGCB 1MJUH 5HVHB 3ULVD 2FX9L 3IS1X 2A3TA 4KDTA 3H55A 3KJ4B 1B4LA 5CEZD 3WXWL 4LB8A 1EFQA 4OLZH 1INQB 1J5OH 1A6VL 1KNOB 5FV2A 3UBXB 1Q94B 1AGBA 4WVRA 5I19H 3N1QC 2J6EL 3F58H 3CBKB 1FYTB 4LCIH 1W0VB 1BVOA 5KTEH 4P2AA 4U3XA 4FN0A 2CIKA 2CJTA 3SYQA 2ADFH 2WZ5A 2EDNA 3BGAA 1UCBL 4WWID 3TYGL 1ZGLP 3GDBA 4JN2B 3QB7C 2JJSA 4JFSA 2K8MA 4K3DL 3L1FA 2CBTA 2AI0H 3FSWA 1QW9A 3LH2L 3DTXB 3N41B 3NOIA 5FIEA 1RJZA 3VNYA 5KEZA 4NFCA 5L0QB 1YEHL 2AJXH 5F7MC 1I53A 3DBSA 1U8NB 4XPBH 1ZA3A 1IAIM 2BHUA 3ASNB 3N43B 3Q1SL 4JM0A 4Z5RB 2K70A 1RVFL 4CKQA 1HT6A 3BH9B 4YXLH 3WJJC 3ETBJ 3GI8L 1FDLL 4PJGA 3L7FB 1HHGB 2IPTH 2BVQA 2BP3A 1EA9C 1GY1A 4RMTA 2P5EE 1QBBA 5CUSL 4ZNCD 2YKLL 3FK3A 5A2IH 4N2CA 4FFWC 2ZWSA 5ACZA 1OGAB 2IGLA 2WKOA 1E7VA 3IVKB 2AGJH 3BAYA 3GJFB 1AOHA 4PJXF 2J8UB 4MRCA 1FLTX 3C08L 1A7QH 3FQNB 4OGAC 3SBWC 1CI5A 3GM8A 3DRQA 2C9XA 5GIRA 3DBXB 4NKIL 3O6FC 4WO4A 2OI9C 2OJEA 1HL8A 1S78D 2EDWA 1NWOA 3GO1L 5LKNA 2H0EA 3W0WB 3Q3GA 5KS9B 2VAJA 1HEHC 1MCRA 2F58L 2N1KA 4Q56A 1OAXH 1BM3L 3FT2A 4UCFA 2C9PA 4HUWB 3ZMRA 2WYIA 4ECNA 2Q3ZA 1NJ9A 1R46A 1LDPL 2HN7B 4MA1B 4YPJA 1ODUA 2C1OB 3P3UA 4K3JH 4XHQA 4YEFA 1TQBB 3IDGA 1ZT1A 3FU7A 3L17A 3IWVA 4JPQA 4A66A 3CLFL 3NCEB 3JWDC 4WEUD 4N8UA 2FGWH 2W80C 3NJHA 1D5XA 3OWRA 1VFUA 5JIHA 1YY9C 5D70L 1URIA 1P7QA 4DVRL 4ZOCA 1IEHA 1VZHA 3AY2A 1FVDA 1KB5H 1KENL 4FGMA 1QYGH 4KXAA 4ZUWA 4LU5H 3L5HA 4G42B 4U1JA 3RZCD 1JCVA 3JTTA 2IFFH 3IGKA 2UYLA 4I48A 4ZS6D 2X89D 2PYFA 1P6WA 1CD9B 2ENJA 3KPRA 1RHFA 4MQXD 2VDRL 4RMWA 5A16B 3RE0A 4CU7A 1AOZA 3Q13A 4HCFA 4OCWH 3PFQA 4KNUA 4ZW6A 2B3IA 2YMOA 3TN0A 2WY3B 3WV0A 4AYBA 4N2AA 4ABQA 2IADA 3RL1A 3ULVH 2DBJA 2RFXA 4Y1TA 3TS8A 4JANA 1A5FL 3L5JA 3MBXL 2NZ9D 4B9ZA 5CEZH 4ZUUA 5E70A 2X70B 4XNZC 3V6OC 2NY1D 1MDAA 4M9PA 1QABA 6FABH 1DQVA 5B39B 5I5IA 5IQOA 4PRIA 4QDGA 3LMJL 4G1EA 4PG9A 4PJIE 5SWZD 3RL2A 3KPNB 2VJ8A 5J6HB 3CDCA 1MHPL 3GSXB 3TZVC 2DQHL 1AZZC 4NZ8A 1XGPA 1BEYL 1AC6A 1JCKA 3U4AA 2QPSA 4PJFB 4LHUD 3FL7A 5HDRA 2BSBA 4JLRA 3PNRB 5HYQA 2FBJL 2GT9B 3G04B 3T8XB 2DTMH 3ZE2F 3HI6L 3QUZD 4FTVB 3UXFA 5FAAA 3CXDL 2XACC 3FJTA 4P2RD 1PDKA 5ALBH 4AQZA 4G5ZH 1TCRB 3BEWA 4HIEA 3QQ3A 3KDPB 2NY3C 3ZN6A 4IEFA 3LEVH 2WCSA 3MLPA 3EZ8A 4S1DC 3QG6B 5AW5B 3O3DB 4UV4H 4GG8A 3BISA 1A4CA 1A9EA 3R1GL 1WLHA 4OQTA 4XGZA 4UQ2A 1S7RB 3VO0A 3EADA 4L1TA 2DQCL 1H3PH 3LEXA 3BZFB 3T04D 5DJAB 1NDGA 1AIFA 4ZUVA 1HSBB 3WFCL 1A9VA 1CE1L 3QQ4B 5EFIA 1MKFA 3DURB 3ECQA 2HFGL 1JFQH 1JHKL 1O0VA 5DJXA 1KYOJ 2VLJB 2VO8A 4ABVA 3RX8A 4J3OG 4L1BA 1SEQL 4X6DA 5DYOB 1NSNH 2FEEI 2DQ6A 4DETA 1U8LA 2EDXA 1QI4A 3EYUL 2V9QA 3DMMB 4DZBA 1B6DA 3HN5A 3UYRL 4MQ7B 3CUPA 2ZUYA 1YAZA 1LHZA 3SKUD 5DS1A 3ARFA 3QEGH 2BSTB 2DQGL 4NZUH 5FYKD 1J12A 3OMNB 4J12A 2VZVA 1WC7A 5ESVA 3FMGL 3DK0A 2IDUA 3IEAA 3IMRA 3CFJB 4E36A 1LEKB 4WKZA 1G7QB 5L9DL 4MD0B 4KXBA 2A9DA 1IM3B 4XZ4A 1KYFA 1CL7H 3NMEA 4KUZH 2BIIA 4PWFA 4U1MA 5KYYA 4BA0A 4P5TD 4X8GA 5D1XC 1TZIB 1HQRB 1BM7A 4H1LA 1TTRA 5IBTL 1K6QL 2AQQA 2HMID 3JYBA 1JYNA 4TPRL 2J12B 1YPZB 1TZHA 4WUUB 3JSSA 1HILA 4PW3A 1KEMH 3QO1B 4FZ8L 4DNLA 1G6RL 2D2CC 3PWPE 2PO6B 4A2MA 1O6TA 2ENSA 4PUBL 4KO9A 3HPLB 3H0TA 3I6KB 4GEIA 5IMMB 3UG3A 4EI5B 3D87B 4HJ1A 4ZS7L 1H3UA 3SDAB 4ZTPL 2Y07L 2WLKA 3MMEB 2CA4A 1RPKA 4UINH 5HTSA 5MEQA 3TJHC 3VSTA 1GS6X 1H3VA 4Z7VE 4PCTA 3D39B 5EUKA 2UWEB 3JZYA 2QHRH 4NNXA 2F53E 1AZCA 3D34A 4X5XA 4Z1PA 3QUXC 2Z91B 2YAMA 4M7KL 2H6PB 5C07B 3D0LB 4NQUA 2ZUQB 3OLDA 5EBMB 3T0EE 4BEIA 3WL9A 4S0TD 4CBPA 2KERA 3DTUB 1GSKA 2I32A 1PYWB 1PZDA 1A7NL 1U8HA 1EZLA 2X2YA 4DSYA 3GHBL 3FULA 4PN6A 5D1XD 3HMWL 4ONHA 1BBDL 3Q6FA 4Y5XB 1OAUH 1W80A 2OW7A 4JCLA 4TTGA 2V17H 2W95A 4Y2LA 2YBGA 2CKBA 2Y25A 3B9DA 2YSTA 4GMSH 3CC5B 3K6DA 3U1SL 5I8EA 4BSVA 2BWDA 4JFPB 2BFVL 2CK2A 3L13A 2IWEA 4J8RA 4WJG3 3WEXA 4LK4A 3V4LA 5FFGA 5G2NA 1VGEH 1G9NC 5ENWB 5HI3D 4PMFA 3WYRA 1H0DA 2O6EA 3RWFA 1UGNA 4UANA 4LSVL 5DDHB 2R56H 2QQKH 1E8XA 4H0IA 1VKXA 1OWWA 2YPLA 1MI5A 3BQUC 4ZSOE 3I6LD 4DTGL 1R9FA 4PY7B 4N0FB 3N04A 4JFHE 4PB0L 3PP4L 4Q7DA 5ABAA 3V10A 5HHPA 3C5JB 3EG9A 3IGLA 4ZT1A 1KIQA 4HHAB 1UJTA 1HCZA 2I5YL 4GAFB 3STLA 4OT1L 4W6YB 3TBSA 4JG5A 4TYUA 3B9KB 5B1JC 2C7UA 1W6LA 1BQHG 1UXWB 1XGTA 4H44C 1E3XA 5EORH 1I7TB 1FL3B 1QTSA 4ELKA 2YGOA 2EE3A 1F5WA 2VM4A 1H9DA 2IAMD 5FYKH 5KZCB 4BXVA 3VD4A 1NCBH 4FI8A 2NY7L 2XN2A 3CVIH 4BCXA 1FIGH 3NIFF 4JHUA 3ETBF 3X14A 3W5MA 4KZDH 4PRHD 2HKFL 4TLTA 2MQ0A 4M29A 2EXWC 4JRXB 1QMUA 5I8OL 1TO4A 3QPKA 4QRTA 5IOKA 5SX4H 1IBZA 2GK0A 4HYTB 1PD1A 3IJYB 1R33A 4JRYD 4PV8B 4Y2OB 3CFDA 3HE6A 5DK0A 5B3NA 2VISB 4R4FH 2BVEA 1HHKB 5FO9A 5DQDL 3NUKA 4Q6KA 1A4KA 5AUMB 2HJKA 3QEQB 4XOCA 4IK7A 4ACTA 1D3CA 1FV1A 2NY6C 3EOTL 3EFOA 5I73C 1IKFL 4BH7B 1DSFH 1MCPH 1T3FB 4L37A 1ZDSA 2FO4B 2OX5A 4RMQA 3B34A 2A83B 3G6JF 3MJ9H 4M61B 4LP4A 5A1AA 1QSEB 2OSYA 5AOKA 3SDXA 3U6XA 4BUHA 2CMRL 3C6EA 3L3GB 3P9MA 1DE4B 4G6KH 1CYXA 4NUQA 4RAVA 1ETZB 2R0ZL 3BN3B 3F00A 1S7XB 3K8MA 4P2YA 1GZHC 1NMCC 4PREB 4LE8A 1EHLL 3ZO0A 4PJBA 4NO3A 4TV3A 1FVEA 3BFOA 4L4JA 5D5MA 1MCKA 2D31A 3LD8B 4RMRA 2DWDA 3JWOL 2NR6D 1LEIB 4MVBC 1VGKA 1U3ZA 3OF6D 2E6PA 1FIEA 2AJUH 1F8TL 2BS9A 4D0CA 1FPTL 1R24A 3MLYL 3BIBX 3II1A 4N2LA 4OZIF 4PR5B 1IC0A 3P0YH 1IVLA 2PW2A 5I8CA 1KB9J 4P46C 2WKGA 3D05A 5C8JB 1CGYA 3BVWA 2DY2A 4HAKA 2ZCLH 1OGTA 1SOXA 1EEYB 1KLFA 4N68A 3LQAL 1OP5H 2G9HA 3UZQA 4AITA 2GSGB 4GFTB 3GEWB 4LLDA 2NQCA 1JJUA 4DOHB 2BCKB 4XMVA 1B2WL 2ZCKH 1B4TA 1BVLB 4XI5D 1TYRA 1NMBL 1GW6A 2E7BA 2WNXA 1YNTA 2W07B 4O02A 4OQTL 4WSGA 2MOGA 5CBEB 2Q0ZX 1BGXL 1ECYA 1GC1H 2LTQC 2X2UA 1E2WA 3T2NH 1G7IA 2CGRL 3FH5A 4IDJH 3GSWB 2FBRA 3GYRA 9CGTA 5CP7A 5DT1H 2WUBL 1XIWB 3VXUD 3IXTA 5HHVL 1TF4A 1JNHA 2P7TA 4Y5YA 4A2EA 3MGAA 4JHBA 3QUGA 4P3DB 2J21A 3RYMA 2IWGA 2N01B 3DJSA 2MCG1 4ZUSA 2ZP0T 4GG6F 3DPBA 4NRXB 3ECUA 4PP1C 3TEXA 1E3ZA 1MAJA 4JAMB 3BGMB 4AYEC 3ULUL 4XBEH 2XTLA 3GIVA 3NFNA 4K9JA 4ZXBB 5HY9A 3VXOB 1QR1A 3DX6B 5AEAA 3LZQA 3QFDB 3F04A 3C5SA 2CDFB 3ARPA 1I4FA 4LGSB 2MPAL 3B1TA 2E7HA 1IJNA 1CG9A 2FLBT 2GCYB 3QDGB 1U8PB 5CU9A 4TNVF 3GRWA 1MCNA 3VW3H 1J9TA 1NCUA 3D09A 4LSQL 5FK9A 4Y2DD 5AW3B 5EF2A 2NMSA 4HIXH 3GS0A 3A5VA 3GHPA 2FD6H 5I1GL 5PCYA 1J9QA 3GHEH 3TVMA 1H6UA 4G8FB 5JHAA 3V4VA 3V9CA 1CLCA 4HIJA 4HUVA 1GJIA 4X8CA 4PRIE 3WS3B 1UM4H 4LLQA 1E43A 1OK8A 2FQDA 3NK4A 1FO0H 3Q06A 1OSPL 2R23B 1DVXA 4ZFOA 3ARDB 8CGTA 1ZDQA 3BWAA 4QRSB 1YMMB 3WENA 4L4VD 2AXGA 4YHIB 1L6PA 4HK3N 3APNA 3OR6A 3TPKA 2AZUA 3VFRB 5SX5H 3ZKXC 1CFSA 1A6UL 4YIQB 5IMKA 1D9KD 1M2VB 1QA9B 4PJEA 5IK3B 4X6BA 1VFOA 1S5IH 1S7SA 3OL2A 1LL1A 3WAJA 4HG4J 5GS1B 3NH7H 1JGLL 4WGVB 3F7YB 1IEBA 2FJHA 3FB6A 4R0LB 3E9UA 5D1QB 3GMQA 3KWVA 3HI5L 5FF6B 5IREA 1U33A 1EEZA 3QAQA 4YE4H 3VWJC 1KDIA 2QKIC 5I1LA 3UTPD 2BVPB 5J57B 2B08A 4JHVA 1SMAA 5EEZA 4MQSB 2CRZA 1RZKH 4ODTL 5ITBL 2NXZC 3BT2H 2Y9RT 2PXYA 4KPHL 4LCYA 5D1ZD 1VSCA 4QI3A 1VLXA 3C9NB 1MRFL 3CK0L 3KJ4C 4FFZA 3LKOA 2WVSA 2LVEA 4K4KA 4FI6A 1FG9C 1HFUA 5IHZB 4X6DE 5GJSL 1S3KH 4CDHA 1LD9B 5TDOA 1MWAH 4QR7A 4QNPE 3ULUE 4NQSA 1ZTXL 1PLBA 3AAZA 4OLYL 3CIQA 4DK6A 4YHZH 2FEDC 1RFDL 3UCRA 2CBMA 5DD0L 5FB8B 2DDQL 2UXGA 1BZ9A 12E8H 2X9YA 3ZIYA 4XXCC 1I8IA 4PGDA 2X0WA 1ZEAL 4MD5B 2ZUXA 1U41A 3M1CA 3B7SA 2UUDH 4PRAB 4RA0C 2ITFA 3LS5L 4OFQA 1KY7A 2X4UA 4WWKA 1FBIL 4GYBA 3ZE0F 2YXMA 1EJ8A 4R96A 2Z35B 2CIIA 1TVBA 3O41A 4FMKA 5IZ7A 3G5XB 5BZDB 3ELAT 1A1NA 2JI3A 4QAWA 2XPZA 3HC0B 2O6FA 2BH0A 1IZKA 1DVYA 5ADPH 2PCFB 3B4NA 1FN4A 3FUDA 1E5AA 4WNSA 1DEEB 2A6DB 5A2FA 4GRMB 1XSJA 1NMAL 2N4IA 3LKSA 3PWNB 3VGBA 5T3XD 3UTSB 3VGAC 4G43A 1I9JL 1K5WA 2B16A 4OIFA 1BZEA 1IJ9A 1HI6A 4G6AD 3FTWA 4GMTL 4O2FB 2CRMA 2RA1A 4AIEA 5F7DA 3S3CB 4XAWH 2NUTA 1IGIH 3H2QA 2J44A 1UWFA 2OMYA 3HZKB 1OB1B 1UACH 1YN6B 5C2BH 4ZD3H 2NX5D 2WIIB 4JHAL 1BCIA 4NM4H 5FCUH 4O2CA 5IMLB 3WBDA 4P23A 1BQSA 4ZOAA 4G8IA 1LK3L 3CJJA 4S0SD 5A6IA 3UJJL 3CDZA 5HJ3B 3O6MH 1Z2KA 4MA1C 5TQ2L 2VT0A 3DOHA 4KNQA 1ZXQA 5DRXA 3E80A 4AEIH 3FT4B 4NZRH 4NJ9L 4MZ3A 4C83A 3IDXL 1NCCH 4XPTH 3FONA 5E0QA 2FWLB 3QE5A 4AMKL 2H2SC 5FA3A 1QPXA 3WNMA 1QAWA 1KN4L 1GVIA 5AW0B 3F7KA 5HHOB 1BVNT 3KLAA 2XWJA 3DV4A 2BOCA 5AYUL 4JPIA 1MJ7L 2C3VA 1RZ8A 1TJGL 3NEOA 1ZT4A 5C0IB 3SOBL 2BNRB 2PWEA 5TQ0L 4OGZA 2BOLA 3QBTB 3IGAA 2NSQA 3N9GH 3B56A 3T6ZA 2YPLE 1MI5E 3NFPA 4BFIB 3DVIA 1JK9B 1ZTXE 1F2XK 3S35L 3W0WD 1A66A 1J0KA 4NWUL 4QOKB 4TOYH 5F6IC 1NDMB 3AREB 3GBNH 4JZNB 4ANWA 3RWHA 2WBJA 4Y88A 1KUMA 2R2HA 2ADGB 2F2HA 1RZGB 3GB7A 3ATEA 5I6LA 3VD7A 2A9NH 4F7CB 4BK4A 3VUAA 2BIQA 4P06A 2L7JA 4O02L 4WRLA 1Z3RA 4JFOA 1GZPB 5AWNL 4M7LT 1AG6A 4LARH 2XWBB 4ERSL 2WB1A 2CSPA 1T1YA 4I18B 1L6XA 2ZP9A 4R6UA 1MRCH 1F42A 1E5YA 1T7XA 5JLZB 5GGSA 5FUOH 5A3ID 1MY5A 3DX9A 5JHLH 1OM9A 4I2XB 2ENPA 2GQHA 1QTPA 1F4HA 1BA9A 2WWMC 2YQGA 1BBJB 5KOVC 3RFZB 4N90D 3PP3K 2GIMA 4DEUA 3F12B 5CP3H 4I3RL 3OKEA 4Z9KB 5IHLB 1F58H 1L0QA 3VXSE 1ZGLM 5ALCL 1V7NL 3QNZB 3WOVA 5EZLA 4NNPL 5EU6D 1AJ7L 2K8QA 4M1CC 2W0KA 3MREA 1N3NA 5AW4B 3O0LA 5ICYA 2H9GB 2V2WA 2PP9A 5KSUA 5KYWA 5FCSH 5AVVB 1TNNA 1KCBA 1KLGA 2K6WA 2YRZA 2C9UA 5MHSE 2Z4QB 3EJQA 4GRWF 3O8XC 3TBCA 1QQDA 3GRWL 4IGBB 4PB9L 2YZ8A 2VAAA 5B1AB 5I1JL 3PWJB 4MCYA 5CJOH 3J2PA 4PJ5A 1BECA 1LP9A 4XVSH 1AHWB 4RDBA 4TSCL 3SDXE 3D2UA 3QHZH 1G1KA 3GMRB 3ZQ9A 3OTTA 4XMWA 3SJVA 5IJKA 1N64H 1I8LC 2CWRA 3DMMC 1TLKA 4PJBE 5GJTH 3QCTL 3MRJA 4ZAKB 3V4VL 2H5UA 3CC1A 3PPSA 5D5ME 3GMOA 1A3LH 1C8QA 1TQVA 4ZBJA 1LO5B 3MA7B 3ZZ1A 4UILH 5IB3B 5EU4A 1IGCH 4ZFOL 3BMWA 1WPCA 1MHEA 4YSTA 1K2DB 3D25A 1AO7A 1I1YB 5GISH 1CIUA 2VN4A 2IO5A 3LN9A 3V0AC 3FB7B 2LVCA 5E4OA 3UTTA 4OU3A 3KAAA 4HWZA 1TTBA 3NK3A 4M1CD 1PG7H 4IRZA 1FZKA 3EOBB 1I85C 3WJLA 4IDLA 1F6AB 1JGUH 3WHXB 3MV01 2IXQB 3BLPX 3FS9A 2BERA 3PXJA 4MNQA 1JVKA 1FL5A 4P49A 1DN0B 3GJFH 2PPEA 3HE7A 2P3YA 3MXVL 1R4XA 2VDPL 4Y4HA 4F33B 5T3ZE 3NRQA 3PIQA 4O58H 1XGYL 4Z7QE 5F7KC 2F08A 1R3JB 1HXKA 2OZNA 3L6FA 3UPCA 4Z7WF 5DTFA 4JZJA 3KPPB 3VXRB 1GTNA 4TL4A 5DRNA 2VLJD 3II2A 4Y16A 4PLKD 2PO6C 4A38A 4FEMA 4P2QA 4XP9L 3WCYA 4OI9A 3BJLA 4H0HB 2BY3A 1S5HB 2BNQB 4NQDA 5DS8B 4AI7A 5BPPA 3SDAC 5DMKB 5KOMC 2Q7YA 2DIBA 2QLVB 3P69A 4FFZL 1C12B 3ZT6A 2AKRA 4AUYA 4IU2A 3KYKL 3BPCB 1CF8H 2EEBA 2D9CA 2DLGA 2ZUQC 3GKWH 1EGJH 3GPEA 5F3BB 3POCA 4U6XB 4NRYA 5C08B 1IM3D 2M1KA 1IKOP 1BVKA 2MTAA 5I5JA 3DARA 3L3JA 2IEPA 3HPJB 5AL8A 2W0PA 2ZD0A 3D85A 1U8KB 4UZSA 5HGAB 4UOJA 4PJAF 3PGDA 2FX7H 3BC9A 3BN9C 3IE9A 2BWIA 4KJQD 2EDDA 3S9DB 1KGJA 3SKNB 5KSAB 3QC5X 5TH2B 3FCGA 3HN8A 3MXWH 2PR4L 4JFXA 4NQEB 3ESVF 3T08A 5EO1B 5JW5B 2XVLA 5A2BA 5JIMA 5EV7A 2MKWA 4MD4B 5BUPA 4C59B 4HKZB 4HCRH 4BZ2H 4HHGA 1SVCP 3NIDB 2I69A 1FZJB 4RLDA 4WI6A 1FC2D 2B0SH 3UJTL 2VL5B 4EI5D 2EDFA 1ASQA 3ROOB 4PI0A 1TZGH 2XWCA 1WAAF 5DLML 1OTSD 5KVMC 2J88L 3LIZA 5DHVB 3RGVC 4X0NA 3D39D 2A73A 4GPVA 4XN8A 1JZ6A 3PQYA 4QTIH 2R29H 4G8GE 2X2HA 4M4RA 3SPVB 3MBEB 4AV5A 5KANI 3ZKNC 5C07D 4ZPTB 1YEFL 4FXKB 4XODA 1QFWM 1VZGA 2YC1A 4WEBH 4M6AA 4BQ9A 5HGGS 2VDKB 4XP4H 3GTTA 3K4DA 2Y5TB 5DJCA 4JFEA 4KJWC 4PS4H 4PJEE 3W5NA 4W9KC 3KYNB 3RU8L 2ROXA 2QV4A 4I77H 4OF8A 4BINA 1G4RA 2WWKT 1BFOA 5H2BA 1KFGA 3VQLA 3FTYA 1IAMA 3O9WB 3WE6A 2HPOA 2EVFA 2XX1A 15C8H 1AZNA 2ZSVA 3PABA 4BFBD 4A2LA 1KXVC 4L9LA 2Q8BH 2X9ZA 3K72A 4BM7A 1PAMA 3MRIB 2YBRA 2VLKD 2HJFA 4LEOB 5FKPA 3ZKSD 4E9RA 1MCWW 1UADC 5BQ7B 4WK4B 4ZNEA 3L2LA 3CPLB 1GYUA 2YFOA 1Z9NA 1JZ3A 3BEVA 4JJHA 1I8AA 5CJBA 2VABB 1A14H 4TQ8A 3B9KD 1UKSA 2WXQA 2IJ0C 3QDMB 2WLNA 3WY3A 2WZ6A 2CG9X 4PGEB 2XXGA 1SXZA 1QFUH 4E9SA 3F6LA 4OJCA 1Z66A 3W39A 1OARL 1AY1L 5E4AA 3RIFF 4YHKH 2D3LA 1CICB 2YD4A 2NY0B 2OLDA 1JPST 1S9YB 2EIZA 5L88L 5AW2B 3LD8C 1KFAH 4PWGA 2FCBA 4U33A 5FO7B 3HNTH 2VXSL 1AS6A 4OCNC 1BAFL 3HR5B 3ZT5A 2X6BA 4LQ1A 3LZFL 4HS6A 3GMMB 3CHRA 1S46A 1N18A 1U91B 1AXSA 4X0KB 5JMRA 3BVTA 4XZUB 1S8DA 1D5IL 2CXKA 1MN4A 4HS3B 2X4SA 3QEQD 1P5VB 1AIZA 1YJDH 3X3GL 5KVGH 3BKCL 3Q05A 2WYHA 3V4PB 2I24N 3WGUB 3B3IA 3WGVB 2J8OA 3VGHA 2NT1A 2AJYL 3FTSA 4NWTL 4NUPA 4YXKL 4YQXH 3QIUA 1WA0X 1KPVB 3O4OB 1OOWA 3FO1B 4PGCA 1NQBA 4FQXA 5TGBB 1OE1A 1KBGH 1WBZB 3IXAA 1AGEB 1P4BH 2IQAB 1FLRL 2PTVA 3RWEB 3UAEA 4LVHC 4GRLB 1PFCA 1H5BC 3UMTA 5I18H 1T89A 3CH8A 4N5ED 4K5LA 4UNIA 4U1LB 3C6LD 3SKMA 3ABGA 5IQ7L 3QNYB 5AVSB 1QLRA 2XN9B 2ZCHH 4B7IA 5HHMB 2AERT 3RPIA 3FQ2A 5JDSB 1XIWC 1ZKAA 4DPBX 2A9CA 4ZO9A 1ITBB 4R4BA 2YMTA 5IW1B 1S3RA 3RJOA 2DQDH 1X6LA 3WN5B 3H3BC 4DGUA 2BDNH 5GHWL 1XB3A 3TFKC 3EIFA 4TSBL 1DDHB 3U0WL 4HKXA 3FQ1A 2OKMA 4JY4A 5AZ2L 1LO3H 5DEFB 3WO3B 2X42A 2D73A 5DD1L 2F5BL 4RFEA 1SMOA 5DEGA 4ZX5A 2OBGA 1AZRA 3PXLA 3QQ9D 3TO4A 4LRNH 3ZPDA 2FJSA 3QYCA 1RZ7L 4TULH 4RFNC 3IJSB 2KH2B 2XZQH 3V5KB 4KNSA 2OQJB 1YUHB 1R5VA 4KTDL 5KW9L 5TDPB 1TG8A 4WTQA 2A1WL 2FHCA 1MFAH 4PVBA 1ZVSB 5FM5O 5I24A 2EYTB 2I60L 2HSIA 1U0QA 3KYOB 3LRSB 3B7TA 3J27A 3NJKA 3P02A 1UB5A 5AAWC 2PKDA 3T09A 3FAXA 5BVJA 4HUKB 1R3KA 5JO5A 3DX8A 6PCYA 3CMOL 1F3JA 4EO5A 2WXRA 2YAQA 4XCFL 4LLUA 4ZW7A 4DGYH 5FS5A 3ZYOA 1JPFB 3S3BB 4FNQA 3FU3A 2VZUA 4BRVA 4X4YA 5C3IA 2NX5E 1YY8B 4MA8L 4OAWB 1BVNP 4BK5C 4NO2A 4EI6A 5FECA 4F8QA 4WFFD 3WELA 1P53A 4ODVH 5DUML 3ARDC 4GQ9H 3B7UX 3AFLA 1JGVL 4G72B 3IMBA 5CM1A 2EYSA 4FJ6A 1PCXA 2W0LA 3IFLL 1QBLH 2QR0B 4F8NA 3TT1L 3AUVA 2VLMD 3EBHA 4ZXBD 4APXA 5KN5A 2VXVH 4LSTL 3FN3A 3G7TA 3GSVB 3QIBB 2A9ML 4DN3L 1JL8A 2Q7NA 2ROYA 2YUXA 1AKJB 1YEKL 3QDGD 4MMXB 3TM6A 4NSKA 2WYTA 2Z7ZA 1MLBA 2K4WA 4BDVB 2R59A 3B6SA 4UAOC 5F0JB 5KSVB 3ECBA 4TN9A 1OM3L 1ORSA 4B95C 1A6WL 2V5RA 3BXNB 3VVWA 4X5WA 4IBQA 5D1QC 4BKTC 3VXTA 1JZ8A 5SWQB 1AGFA 2J1WA 2ZZUT 3Q6GH 5E8EA 1J8KA 1OGPA 2Z7UA 5DRWA 4Z8FL 3C87A 5GXBB 4ZYKB 3HZVB 1LNUA 3SGDH 2Y36H 1HXMA 4G6JH 2YS4A 2P8MA 1QLFB 1FRGL 1T20B 2CHWA 2X9XA 4G11A 2PLTA 4KKAC 5ICZB 1KLUB 3HG0A 4PJ5E 5GRVK 3HAEB 4P4KA 1LP9E 1IZJA 4HBCH 4KTYA 5HJDA 3RWIA 2WOYA 1I9RL 2YXVA 3FFDA 3VI3B 3B2UC 6CGTA 3SJVE 4OCSH 4NKDB 1YMMD 4X9HA 1O5PA 5K9KB 4HX1A 3QFJD 1H6TA 1OAYL 4I3GA 4TSAH 2FJUB 3APCA 3LIZL 2BVUA 1UOKA 5FYLH 1GPOL 1WA1X 3QZWG 2VMJA 1AZUA 2YUZA 2OTUB 5IESH 3RP1A 3C60A 2WD0A 4ZODA 3QORA 3OXSA 3SY0A 3RB7A 5MENB 1UFUA 4NQVA 1JF1B 3QI9A 5DJ2B 3UTTE 2JWYA 5D1QD 5HD8D 2P8LA 1GYCA 2X4OA 2ZXBA 3ESMA 2YK1L 1VZIA 4NEHB 4Y7OC 2ZJSL 4M6OL 2P46B 4MNGA 4ZO6A 3RWJA 3HS0A 4BBWA 2JF1A 1LEGA 2Z1PA 2OL3B 1IBGH 4ALAL 1MFUA 5C0JB 3NQIA 5JW4R 4JY6B 4I89A 5F9WB 3K6NA 1G9ML 5EU6E 4DP0X 2Z92B 4ELMF 4NRZB 2JJVA 4O2EB 3H7LA 4Z7UA 3IPEA 5IW3A 1U8MA 1NAMH 3HKZA 4XMXA 4YDNA 4XTRD 2XTJB 4CAGA 3ZR5A 5F1NA 1BJMA 4Q9RH 4L3AA 5KVEH 4NQDE 4OLXH 4AYID 4R8WH 2XC8A 5F3HA 1B6UA 4NCC2 1RUML 4TKWA 4XN4A 5CLXA 2GTZB 5D7LA 4CDGC 1AFVH 4QRQA 2YEZA 3VXMD 4LFHD 1ZMYA 1X5IA 1NPNA 4Q0XH 1J1XL 3L4XA 1T03H 3IFOA 3T1FB 1GJWA 2WXNA 4RDQF 5E2TL 2K78A 3Q8CA 4LRIC 3W2DL 4G3YL 1KB5A 3CE1A 4UV7L 3VJ6B 1J05B 1LDSA 3ALWA 4ODHH 4W68A 3S96B 1D6VL 1HK6A 4XNQA 2FZ3B 4QGYA 3GMLB 1O6SA 4MX7B 3U9WA 5FDYA 3T3MF 4NT6A 1UVQB 3NJXA 2YJLA 2V5MA 5A2AA 5I74B 2OMNA 3UTSD 4WI5A 3PDDA 2ZWNA 3ZZSA 3VGFA 1V8HA 1R6VA 1TQCB 3I74A 4S10A 4PTUA 3T4AA 4U1HB 3D48R 3MJGX 4YZFE 2HG5B 3E6FA 3FQXA 5DD5L 3VFGL 3X2QB 1M6OA 4HU8A 3HI1B 3L2NA 2E27H 4GXVH 2EDLA 3SDDB 3AREC 2ZG2A 1KIUA 4L4TA 2JJUA 4KK8D 2KLRA 5B4MC 3HC3H 2XZAH 3RVUD 3CQQA 4FQJH 2WINB 2BZDA 1I3RA 5E9NA 2AEQL 4APQB 4CSSA 4QXVA 5IBUB 4GKLA 1UJ3A 1DDTA 1BAWA 4HDIA 4JFEE 2W9DL 2X0VA 2JCCF 1NC4A 5CEYA 1I7RA 3VI4B 1BOYA 2CHNA 4I18C 4RESB 1YEGL 5I30H 1KWGA 1JV2B 3ZTCC 4LCWB 1UC6A 4N8CH 2YOAA 5HHOD 4JDEB 1F90L 3H9ZA 4ZO8A 1A6TB 3AQZA 3OZKA 4M8UA 3RFZC 2X3BA 5AOJA 2BNRD 1W91A 2XPGA 3KJ6H 2QQQA 1ZA6A 1HHJA 4AT6A 2EDHA 1ZE3C 4ODSL 1RPUA 3LKNB 1ZOXA 2K6ZA 3BDBA 2PTTA 4POUB 2N0KA 4P59L 5CSZA 5DHMC 3RVVC 2XLLA 3GRGA 3OVUB 4FXLA 1Q9KB 3TWCH 3HBZA 4QRRA 4KJPC 4ZNEE 1MCOH 3HFML 5EBGA 4Q4EA 3OXRB 4RMBA 4RMSA 4QOKD 1MCFA 4Q9CA 3IM1A 4TNWF 2PTUA 5GZOD 1WBXA 4U6HA 3BIKB 3IDNB 3AGVA 1NLBL 3QCUL 1HHIB 4IGBC 5LGJA 1Y0LA 4DF9A 1TJMA 3MJWA 3TH3T 2BZ7A 2AJSL 2Y1VA 4GAYB 4YGVB 1NCAH 3R7RA 4AVJA 4BH8A 4JRFA 1AHWC 1GKOA 1NFIB 1ZHBB 2Y3AA 4ONFL 2WLMA 1ZAGA 2A77H 2F7IA 4OZHA 2N56A 5D7KD 3IJEB 2GITA 2KDYA 3PHOA 1YYLH 2XBZA 3ZR6A 3ILQD 4ZAKC 4AEHL 4ONGH 3WJJA 3MRBA 3NESA 1G7PB 2B1AH 2HB0A 2R9HC 1M4KA 2XG5A 4PW4A 5JNYA 3PFUA 5KSBA 3OG4B 1SXBA 1RK0A 1JBJA 3P4NA 2GSMB 2HFTA 3BUPA 3THMH 4K8RD 1SFHA 4AMWA 4G6ML 3DSNB 1KZYA 4OY9A 5B7EA 3SBWA 3QSKB 5DVMA 3BWUF 5E1AA 4R7LA 3DXAA 3GWJA 1KBVA 3TURA 3RIAK 4JW3A 3FF8A 5DHYA 3O6FA 2X41A 4Y7MA 5J4MA 1F97A 2O5YH 5CZVL 4XRCB 5IVZB 1J5DA 1K8DA 2A4CA 1XX9C 5E5UB 5E9DA 4BFFA 1EHAA 1TETL 3UC0L 3INUH 3BP5B 5K1VA 1HYSD 4HKBA 4NO0B 2NCMA 3P2TA 1ED3A 1MJUL 2PP7A 1N5AA 2EXYD 2W0FA 5DO2D 1WWBX 4ILDA 3G5VB 4OLZL 5HHQB 1RJLA 2Q76A 1J5OL 2H1XA 3BSHA 4PRPE 4XAKE 3VYPA 2WO3B 4I3SH 1WTLA 1T0MB 2IBZY 2Z4TA 3KXFB 5I19L 3W11D 3D4YA 3M17B 2ZE0A 4Q2ZA 2CHXA 3F58L 2CGYA 3IU4H 3L4ZA 3T2PA 4FFVC 4LCIL 2V5SA 2OMUB 5KTEL 4MLIA 1DO5A 4DW2H 1NANI 2ADFL 2AQNA 2I07A 2EC9U 1IMHC 1E28B 4UUJA 4YDZA 1I9EA 4NPJA 4PJHB 3DDFA 4TNVK 3EYVA 3W9EA 5DHEA 5FM5M 2AI0L 5AAMA 1JTPA 3L3KA 4AQ1B 1AGDB 4HD5A 3L1GA 3WMQA 1N6UA 4ETQA 3ZKQD 5JDJA 2AJXL 1UG9A 1THAA 1UM5H 2CCLA 3MV9B 3Q5YA 4XPBL 3LNIA 4LT7A 1YEWA 1FNFA 5CJQH 3V6OA 3KPQA 2X1QA 3DWTA 3VXRD 4YXLL 5T33H 5KSAC 1UENA 4FHBD 2NYYC 2OTPA 3MZGB 4YVUA 3T0WA 3ZRCC 1ZV5A 4XO5A 3CZUB 4S2SA 5CLTA 2ZYSA 2WZAA 1KBWA 3O6KL 5LNGA 4KMTH 4NN5C 3FB8B 2BNQD 5D55A 5EU5B 3EH5B 4Y4KD 2AGJL 4O51B 4OZGF 2XQBH 4V11A 5CNHA 5IB5A 4P2OB 3A3YB 1P5UB 1XGRB 2HJLA 3S2AA 1KMGA 1S7WB 5F7BA 5TFSH 5CCJA 2AP2A 2X09A 4PRBA 1BZDA 3AJ7A 3NRPA 2XKNA 4OVUA 4OUUB 2ZXAA 5CD5C 2DJUA 1JRHH 4FXKC 5BOPA 1KXQE 5HYJB 5CIPB 4Y19A 2KZWA 5D7IB 3MRGB 5D93B 1PZBA 1WFMA 1X5YA 2DW5A 5C08D 3GMNA 3U4EB 2YD0A 3JVGC 4FJZA 4LSPH 3U30B 3F05A 3GI9H 2KZKA 4K3JL 4FC3E 1CYGA 1J8HD 1EUTA 4G9FB 4K8RH 4U6TA 2CO6A 3B2VH 2FGWL 3EH4B 3EHBB 4P5TA 2G5RA 4TUKH 4G70B 5LBSA 1JHTA 4QWWD 1DJZA 1VPOH 3ES6A 2R1YB 3FSAA 3V7AG 1KYUA 3O9WC 3NCBB 4N25A 3IMUA 4HFUH 4OM0H 5CFHA 4EI0A 1KB5L 1Q0YH 3TNMB 3SOTA 4LF3B 1QYGL 2VLLB 2QVTA 4N6QA 4LU5L 3SEPA 1XWVA 1OK0A 1RULH 2ZWZA 4JR9H 4PLJD 2IFFL 5IG7B 5C0CD 1C1EH 4XNXH 5H37H 4LP8A 3N44F 4A7QA 1GH7A 4OCWL 4X7CC 4QXTA 1KPUB 4EN3B 4HISA 1DJWA 2WLLA 3RVXD 2BSSB 1CD1A 3MJ9A 4WFED 2BXYA 1N2RA 1U8OB 2QQNH 1RUPH 3E2HB 3MBED 5CEZL 5C0EA 2X87A 2ADJB 1ZIBA 3OG6B 4J3XA 4GS7C 4XCEA 4F80A 3SO3B 1JZGA 3ZDYE 3CZFB 3TF7C 4Q89A 4KKRA 3L4WA 7PAZA 1Q0XH 3PHSA 6FABL 2NW3B 5D4HA 5GGQH 2ED7A 1R5IB 2KKQA 3W56A 1IV8A 4NKMB 3WHE1 2OXHA 2R27A 3CZJA 2GJ6A 2JTDA 5GGUB 3MV7A 2ESVD 1NGWB 3EDDA 2DLFH 3MOBH 4UMGA 3QXWA 1FWXA 3KEDA 1UQSB 3B9AA 2NY0C 4UWQB 5D1XA 3ZE0E 3BRGC 1IAKB 1K85A 1JV5A 2WBXA 2GUYA 2WTRA 3O9WD 1T7ZA 3KWWA 4PH8A 4HZAA 5C0DB 4P07A 3V8CA 2WLYA 1KIRB 1OIOA 2YXFA 1EAJA 1CDUA 4PJ8B 2QPEB 3UFIA 2DTML 4Y1AB 4IRJB 5KVDH 1T66D 3VXQA 4TVPD 5FGBC 5ALBL 4G5ZL 4V2CB 4EIBA 5E6SB 1OLLA 3BZDA 4HMDA 3LEVL 3QXDA 4OCMC 1UXSA 2X6CA 2BSRB 4HPOH 4Z7UE 5DQ9A 4UV4L 4ESKA 5IUSA 4U2YA 3M7OA 4YHMH 3RDJA 1M7XA 1A6ZA 3OZ9H 3MLTB 3D30A 2WZPD 4ZPVA 3QUXA 2V2XB 3CPUA 4WI0A 1BOGB 3LRGA 3LV3A 3VG9B 3U9PH 5IVXB 1JWMA 1YRKA 2K4AA 4PIRF 3QNXB 4UT9H 5E6ID 4CNIB 4NQCB 5I71C 2X6UA 5DR5H 2IH1A 4HIPA 1G0XA 3K46A 3VG0H 1P6AB 2DKSA 4Z7OB 3QFJE 1CICD 5D7LE 5D2NA 5I75B 4N0CD 1JFQL 3D5OF 4GUPA 2E4TA 4C4BA 3FO9B 4FQPA 4JJOA 4MAYB 5F1IA 5IQ9B 4S1QH 2GBTA 3CSBA 3BHBA 2VDLB 4Q14A 3WDIA 3MUGB 1D7FA 1NSNL 1CK0H 1HTYA 2F54B 3D18B 4FAAB 1Q9LA 5D7IF 2VRQA 3L5WB 1Q0EA 5CN3A 1XCQB 4PRHA 3MRHA 1M9SA 3KHOA 3SDCB 4NPYB 5H35B 4KY1H 4KX9A 3WN5C 3ZT7A 2VZTA 3U6XS 4JRYA 3BLKA 1CS6A 5JHDD 2GAZB 2NLJB 3AMKA 1XBDA 4HJ0D 3BQUA 1CGWA 3LPFA 2HKHH 1MIMH 3X13A 4FHJA 3SE4C 3TF4A 2C9SA 1F00I 2VO5A 2M2DA 4J3WA 3S0PA 3WY2A 3ZDXB 5I15H 4UNUA 1Y18B 4W9EC 4HOZA 4JFQB 2NY4D 3LPOA 1CL7L 2H2PC 1E9OB 3E7JA 4JO2H 4KUZL 5LNEA 2PMZA 1BQHB 4W9DC 4X80H 3FCSA 5B1JA 5D2LA 2FT7A 2Y7OA 5DHVH 3RUGA 5K33A 4HLZH 2ED9A 2R1WA 3APDA 1SJHB 3ZKMD 1UH2A 3EFDH 4GRLD 3MCLH 2AMGA 1JG9A 1FO0A 4WFGD 1AGCB 1KEML 3OJDB 1WZ1H 5I6XC 4L4TE 3RX9A 3DX3A 3J7HA 4KFZC 4H0GA 5FKAA 3WNJA 1XF4A 4OLVH 5JA9A 5HHMD 1TVHB 1AP2B 2VDKH 1G7JB 1CE6B 2GYSA 3CVHB 5CKGA 3S6CA 2Z9TA 3FTVA 3BAXA 4NIKB 1EAOA 5EC2B 1FI8C 3EYQD 2O5ZH 3MRDA 4YDJB 5IGXH 3PPEA 4LSRH 1QUPA 4UINL 1SLUA 1VDGA 4LDEB 1T1XA 3OKNB 3VFSA 4JE0A 4V1DB 4Z7AA 3WU1A 3A4AA 2GY7B 2QHRL 3HVDA 4UBDD 3MCKA 1F11A 4MA7H 3WFHB 1J5CA 2WXFA 4YEEA 5JIPA 1EUUA 5C0GA 1JERA 4MMXC 1EFXB 1QZ1A 2Y23A 4TVPH 1QWUA 2GTWA 1I9IH 4YN3A 1SHXA 5I1DA 4KKLC 1ADQH 3A47A 1OAUL 5IQLA 1AE6L 2XQYG 3BFQG 3QZLA 5D7JC 1GGUA 1E2VA 2C5DC 2V17L 5E8PB 4QRRE 4Q6IB 7FABH 4GRWE 3ZYJA 5CHNA 4KMLB 5B3JF 5TE7H 1CDJA 4GMSL 4FFYA 4R2GB 4WW1B 2DWEB 1PCSA 3W81A 5CZXC 4AYFB 3K0WA 3HNSH 3UTQB 3DVNB 4GSQA 4MA3A 4K07A 4Z6AT 1VGEL 4KDTC 1J48A 4G9DA 2LU7A 1EAPB 3MV8D 3WIFB 5IFJA 2R56L 1JXKA 1H19A 1SBSH 1MWAA 4F7PA 3UBXG 4IBYA 4WJ5A 4F2MB 1PNDA 5IVXF 3BPNB 1KTBA 4TXVB 1BMZA 3TO2B 1HCVA 3I9IA 1OF0A 3SZ6A 4DP6X 4YJZL 3EO0B 3DV6A 4A04A 1KCRH 1CQYA 4Z7OF 1ZLSH 2A6KB 1Z1WA 4QTHA 1T2JA 2EDKA 3IMVA 5FM8A 2W60B 2GFBB 4P46A 1MCEA 3CHXA 3IJ7A 3QIBD 4JZOA 1H8LA 2X28A 3IKCB 3F5WA 5EORL 5KSBE 1A7OL 4XWOC 5IR1A 2DBLH 5BO1H 1XH0A 4KGJA 4QGTA 2B59B 2HFFA 3GXTA 5D71H 5E8OA 2LU5A 3I6SA 4UQ3A 2QADB 3U4BL 3ISYA 1NCBL 4RETB 4I4WB 1IAOA 3QUYB 2JKXA 3DXAE 4OUOA 3VRIA 3CVIL 2AXFA 2X4PB 4W81A 1MVYA 1FIGL 3TJPA 3ARBB 3V4PH 4JFDA 3DX0A 5FUZH 1HH6A 4KZDL 2NUPA 3Q0HA 2QBWA 4ELMA 5IMOB 4XHJD 3HCVB 5CGBA 3ZDXF 1U42A 3QT2A 2XWRA 2Q5BA 3UCQA 1KPRB 2KHAA 4M93B 4UYQA 1NC2A 5F9WC 1HOCB 2FATH 4D9LH 5E9DE 4G8EB 3RWDA 1E4WH 2G5BA 2E86A 4R4FL 5FYJD 1AI1H 3U0PA 2B9BA 1VFMA 4XXDA 1MH5A 4PWKA 3E1F1 5CILH 3TBBA 1CC3A 4IK6A 4RGMB 4L8CB 3ZE1F 4ZMXA 4LLYB 2ALAA 2BP0A 5I2IB 4AENA 2H0FA 1SJEA 4GW5B 3VWKD 1DSFL 1T5KA 1MCPL 4HG4K 1ZIAA 5CJ5A 4V2BA 5F7WC 3L3HB 4YWGH 3GSOA 5AALA 2HT4C 3MJ9L 1B0RA 2MRYA 3PWUB 1ET8A 4YS4A 3RGBA 1JWSA 4G6KL 3TA3B 4NLAA 3NN8A 5DRZA 5MEND 2QSTA 5HJGA 4Z76A 1CLVA 5FO8A 1T5XA 3U0TA 1A8ZA 4KKCD 1U58B 3FQTB 2IWFA 4QHUB 2DZEA 3N0PB 2EDJA 4WW2B 3C09B 5TF1H 4HPYH 3R06A 1XH2A 1A1MB 3V6OE 4ZFFA 1E9QB 2AJUL 2C1PA 2PYEA 3QWRD 4N2DA 4YPGB 4WAFA 2HRHA 5I74C 3VXNA 1IBFA 1OKEA 1IUZA 5HGHA 3QJOA 1NOFA 3KW7A 2ZCLL 3IDYB 4KJYA 3TN0C 4QYOB 2XTJD 5E4IA 5LGYA 2PWGA 4HJEA 2GABA 1IM9B 1J18A 1TJIH 1TQCC 2J20A 3QWOB 5F1OB 3MJ8A 4XVUD 4DO4A 1NBZB 5AVUB 3QYNA 1PD6A 1DFXA 3HRZB 1IVTA 4P48A 2H6UA 3PGFH 1P2CA 2A4EA 1ZS8A 1SDDB 3RDTB 1M7UA 1TZAA 2NXYB 5BCAA 4ONOA 3KG5A 1UA7A 4GJTB 1HEZB 3MLSH 3ME0B 3SDDC 5CN1A 3R8BB 3UPAA 1XFPA 1QFPA 3JWOC 2OSLA 1P4LA 3OD3A 4XCYB 5CWSA 1GXEA 4AJ0A 1GC1L 2IH8A 4IS6B 4Y19E 1Z3GH 5DURB 1KCWA 3W38A 3K4ZA 1QVOA 1J5IA 3T2NL 3LN4B 4LCVA 2Z8VC 1CQKA 4IDJL 1S9VA 3HG1B 3I75B 5DT1L 2BS8A 2XQYA 5JHLA 3X12B 4U6YB 4NO5B 3VWJA 2AEPH 2QKIA 1QI3A 1TZ8A 4GKOA 5CP3A 1JZ5A 4XP1H 1DUZA 43CAB 1SEBA 2BVOA 3HB3D 1WT5C 5L2JA 4HS8H 4XBEL 1EK3A 1MXDA 3OJVC 4PJ7B 3O3BB 2EJ1A 2XIDA 1PSKH 4U3SB 3EGXA 4KQ4H 1G9NL 1PPIA 1KNOA 2ARWA 3UBXA 2K3HA 1KJVB 1Q94A 2H47C 5GZND 3HAEH 2C3GA 3V0JA 2CR0A 1GGYA 1BX2B 1FYTA 3NPZB 2Y06H 5FYJH 1MFNA 3VW3L 2Q6WB 2NTFB 3ORJA 4YLQT 3GSNB 5EEXA 2P5WD 5C7ZA 3T3PF 2B4CH 3ZTNH 4E41B 5IKCB 4JN2A 4HIXL 4XXCA 3RIFK 3GLZA 3QEHB 4ZMYA 1MW3A 2JJTC 1H3TA 2YHGA 2FD6L 3FUKA 4C58B 1UWEH 4APQD 3RVTC 3GHEL 1MJJA 1L0YA 5IB2B 3KVPA 5F7AA 3TYFB 5HHNB 1UM4L 5LBVA 1JP5A 3MNVB 4MMYB 3AT8A 2OTWB 2Y7NA 1WBYB 1FO0L 2GJ6E 5ISZD 2O72A 3MV7E 4RWYL 1ORQB 2AABH 3H56A 3OX8B 2DTSA 3H3PH 3K91A 3LKRB 4YH6A 3BH9A 4IQHA 1BLIA 4G59C 1QW8A 3D50A 5AVRB 1HHGA 3HRPA 4IM8A 1L0PA 4WZ9A 1WAEA 4N9OB 1QKZH 2OL3H 3VCLA 2PW1B 4K73A 5EN3A 4BIKA 1OGAA 1Z9SB 3LX9A 3IVKA 5CBAB 4IBLT 3GJFA 4WW2F 3WMPA 2J8UA 1U4EA 4LVOB 4TQHA 3OKDB 3LIUA 5HGDB 1NCWH 3NH7L 3WKQA 3DO7A 1PLAA 2ITEA 4PJCF 3D07A 1GRWA 2FHFA 4Z3IA 4OFYD 4YBLC 2DD8H 4QEGA 4DK3A 5KS9A 3QHFH 2P44B 1NCHA 4YE4L 5F96H 4E5XA 3EFFB 1JPTH 4XMPH 5DMGC 1HQ4A 1G7HB 2F1AA 3LPPA 2VSDA 3C5ZD 3F64A 3EJUA 4DKFH 4WWPA 1RZKL 1URZA 2ORBL 2BHFA 3BT2L 4N2HA 3U7WH 2X4QB 5F7EH 2CUMA 3EJZC 3S8GB 4OI8A 4NUJA 4Z18A 2VRAA 4H20H 4HWEH 2E3VA 5HDWA 1TQSA 1XF3B 4M6NH 4G7QB 5E1GA 2FWSA 4E68A 3VFOB 3VXPB 1S3KL 2SEBB 2KPNA 4N0RA 4EKJA 1MWAL 1EJOH 5INDA 3ZGHA 1EGJA 3U79A 3SO5A 1E90A 3JWNC 4G42A 4EMZA 2XY1A 3RWCB 2UY7B 4EBQH 4KV5E 4GI8A 4YHZL 1J1PL 3WNKA 1CGXA 4NPKA 12E8L 4IIZA 1K8IB 2WB7A 1KTRL 4FKKA 4XVOA 4MS8D 1I1AB 2P5EB 4LOUC 5BQDA 4ZDHB 4AQ1C 4GBXB 4I0PB 3BVUA 3MUUA 4HFWB 4YXHL 1KT2A 1YQVH 2LLLA 4TTDD 1J1OH 5C0BD 1IILE 2X70A 3FZUD 1RUAH 2GK2A 4Z78B 1A7PH 1YA5A 4FQLH 1L9RA 4HCRA 4BZ2A 5CEXA 5TD4A 5D2LE 5B39A 3V2AR 3RUGE 5ADPL 1ACYH 2RHEA 4NO0D 1BIIB 4EIUA 4HKJB 3MGTA 3UIZA 1HS6A 3KPNA 4ODUB 5J6HA 3GSXA 1M05A 1JI1A 5BUGA 1UWXK 3ARYA 2R29A 4YHYB 3KXFD 5J13B 2B77A 4PJFA 9PCYA 1XF2B 1MQKH 1P5UC 2DS4A 1IGFH 3MNWB 4XAWL 4YUEH 2E74C 2GT9A 1IGIL 1BXXA 1Q1JH 2Q2EB 3BDXA 3G04A 4TRPH 4FTVA 3BSZH 3WKMH 4YAQA 2FIKA 4LCUB 5C2BL 4ZD3L 3B8SA 2O93L 4PYGA 2VR5A 3C5XA 4NM4L 3BUDA 5FCUL 3S5YA 3FOLA 1NKGA 4TLUA 3L5XL 3U9UB 4LBEB 4MDJB 3II3A 2YQ3A 3ARGC 4BCYA 3QG6A 2EKSB 2VDQB 3O6ML 4MKMA 4CVXB 3U30C 3V0VB 4AZ8B 4I85A 3RJQB 4E9YA 1N7MH 1WA2X 3FNKA 1K5NB 5K9QG 4AEIL 1S7RA 4NZRL 1SY6H 2KYIA 1NCCL 4XPTL 2IC2A 3O8XA 3BZFA 5DJAA 1HSBA 1GS7A 3VTMA 2WBWB 3KMDA 5T1KB 3DURA 1JZJA 4J4PC 1EZUA 4J3OC 5I6PA 1I8LA 1T5WB 2CDEB 4TVSa 4D8PB 3PV6A 4P2OD 4AGNA 2A9AA 3DMMA 2CLVB 3N9GL 2CDGB 4MQ7A 2KUTA 3V5HB 1PBYA 1VF5C 4J23A 5AW6B 5C97A 2AMUA 5A43C 4F58H 3FN9A 3VD9A 2BSTA 1E0OB 1CDIA 2APWA 4R3SB 3IGUA 1TEFA 4ZX6A 2AXWA 5HYJD 1BDYA 1FGVH 1XGZA 3MUHL 3SO3C 3K71B 2PP8A 2WMPB 4TOYL 2AV7A 3DSFH 2WXHA 4YX2L 1FC1A 1QPPA 4LEBA 5BRZD 3TJEH 2BW4A 4MJIE 5T1LB 2X1OA 4AGMA 3CFJA 3CFBA 1LEKA 1I85A 2CUIA 2ITCA 2K6YA 2A9NL 2Y7SA 3L1EA 1G7QA 4FLHA 3GM0A 2EUVA 3VM5A 1BP3B 2OR9H 4MD0A 1IM3A 3TEUA 4UOW1 2HG0A 3E1ZA 4P9HH 3EHBD 4LARL 4I5BA 4Y4FB 1TZIA 1NGXB 1B2YA 1HQRA 1KBBA 3DROB 3Q01A 1GYAA 3CLWA 1MW0A 2ICEB 3LHPH 4I1PA 2QGBA 4JMNA 3SE6A 2UZIH 1MRCL 1SQ2N 1HAUA 1YPZA 2JKIS 3MRKB 4WUUA 3A6OA 4XX5A 4JFDE 5FUOL 4JFWA 4N2FA 5JHLL 4DO6A 4XN9A 5KYUA 4ELME 5EF1A 4UU9B 3KBHE 1Z9LA 2GJRA 4YFLI 2DI7A 2YD9A 2JKWA 1BQRA 3NIGB 4YBHA 2PO6A 3VFUB 1CFNA 3ZXAC 4EN3D 3HPLA 3N91A 4M7LH 1F58L 3I6KA 5IMMA 4R26H 4WV1B 4DP5X 3WUWB 4EI5A 3SDAA 2EVGA 3OKMB 4NJAH 2F74B 2HUHA 1L9PA 2V3FA 3QJHA 1KTLB 2APTA 2EZ0C 3NJVA 4PRDB 4AOFA 3DI3B 1WICA 3BZ4B 1XEDA 3PL6C 1X9RA 1XT5A 2EDEA 1EXHA 4OLUL 3FH8A 5AVYB 3KLDA 2Z91A 1P69B 3HZ3A 5KJRH 1G0DA 2H6PA 3P3RA 3DLQR 3VG9C 3D0LA 4WU5B 3GKZA 5K69A 1WQVT 4D9QD 2HYMA 1A7RH 1U8JB 3BH8B 3JWNH 4FRWA 4HPHA 2CM5A 4AC2A 4LEEA 1T6BX 5CJOL 1PYWA 5AB9A 3BAWA 1NL0H 4NCDA <