4MZIA

Crystal structure of a human mutant p53
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
193
structure length
193
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKFGTCTYSPALNKMFVQLAKTVPVQLYVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERSSDSDGLAPPQHLIRVEGNLRAEYLDDPNTFRHSVVVPYEPPEVGSDYTTIYFKFMCNSSCMGGMNRRPILVIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular tumor antigen p53
publication title Reversal of the DNA-Binding-Induced Loop L1 Conformational Switch in an Engineered Human p53 Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antitumor protein
total genus 37
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4mziA00
3US1A 2IOOA 2J1XA 5ECGA 2FEJA 3IGLA 2X0VA 5AOKA 2IOIA 5LAPA 3US0A 5AOMA 4IBWA 1EANA 2BINA 4IBSA 2BIOA 2AC0A 1HJBC 4HJEA 5KBDA 3WTYA 2XWCA 2PCXA 4LOEA 4L0ZA 2J1WA 1TUPA 4QO1B 3D08A 4KVPA 4GUQA 1LJMA 2J6WA 5LGYA 4L0YA 5G4OA 2OCJA 3IGKA 2AHIA 4IBTA 2BIPA 4IBYA 1H9DA 2IOMA 4IBZA 3WTSA 2BIMA 3WTWA 1EAQA 4AGPA 3D05A 1GZHA 4L18A 1E50A 3KMDA 4MZRA 2BIQA 2RMNA 5AOLA 2P52A 2MEJB 3D0AA 5ABAA 1CO1A 4XR8C 3WU1A 3WTTA 4IBQA 3Q01A 5G4NA 4G82A 1HU8A 2XWRA 1GZHC 3QYNA 3Q06A 1TSRA 3D06A 2X0WA 4G83A 1T4WA 5G4MA 3EXJA 2YBGA 5BUAA 3Q05A 5A7BA 4AGOA 2ATAA 2GEQA 5AOIA 3TS8A 3WTVA 2WGXA 4LOFA 3ZMEA 2J1ZA 2X0UA 3D09A 4A63A 2H1LM 4LO9A 1HJCA 2J1YA 3VD0A 2VUKA 3WTUA 4AGLA 3KZ8A 3QYMA 3VD1A 4GUOA 1CMOA 4IJTA 4IBVA 1IO4C 4AGMA 1YCSA 4MZIA 3WTXA 2J21A 1EAOA 5AOJA 3VD2A 1UOLA 3D07A 4AGNA 5AB9A 3EXLA 4IBUA 2ADYA 1KZYA 4AGQA 2J20A
chains in the Genus database with same CATH superfamily
4X8CA 3MRJB 4HPOH 4W9GC 4ZZFA 3GLDA 4JBSA 1KGCE 5AVVB 43C9B 4L8SB 3SDAA 3LCYA 4BV1A 3U79A 4H20H 4KKAD 3SY6A 2V4LA 3CHOA 1X5ZA 4I18C 5B38G 3QI9B 5DYOB 3MCLL 1D5XA 2IC2A 3MR9B 3N1PC 1MJ8H 4PV1C 1TJGL 4X98B 2E0PA 4H8PA 3IDXH 1RZJC 1PU0A 2BHUA 3L81A 3NJFA 4KVPA 1BQKA 2F61A 1NGZA 2F58H 3BWZA 4JJ5A 4MRCA 1QEWA 1CLYH 1AKPA 4OAWB 1RZJH 5A43C 3SGKA 3L5XL 1IAOA 5B22A 3V5KB 4LDOB 2WPGA 3DA0A 5HHME 4NS0A 5DFAA 5GJSH 4TUJB 5DO2D 1R34A 2OMVA 3WXWH 1OARL 2W0LA 3W5MA 1A0QL 4G7YH 4H0LC 1KLUA 2BIMA 1CGTA 4U1GB 1I85A 4G43A 4X9BA 5FX3A 4JFOA 4NOBA 5C0ND 4GBXB 5KVEL 2WJ7A 1N7MH 4K5MA 2CO4A 3MLZL 5C07E 2X4NA 4ZMAT 3MCKB 3VXSD 4X4YA 3PU7A 3K6OA 3T77A 1XF5A 2HT3D 1CFVL 4R7DA 4L4TA 5E5UB 2IANB 3QHTC 5FO7B 3UYRH 1RUML 3CLEH 4ENED 3Q06A 2OQJB 4Y5VA 1A5FH 1RZFL 4P4KB 3KGUA 1CDIA 2F0CA 1E65A 3F00A 5CIPB 2GBUA 1PEZA 3WIHH 2DQTL 5JHLA 5C3TA 3OG4B 5JDSA 3O3DA 2PF6A 1GGYA 2NMSA 4L1BA 4NUPA 2Q76A 4MHHI 5EO1B 3SDCD 5M7QA 3VW3H 1QYGL 2EDLA 3HB3D 4FHJA 3EBGA 1MWOA 4OM1L 3SJVA 5MEQA 5K69A 3ZE0F 2UZXB 5K1JA 2CGZA 4JFVA 4HBCL 2X6CA 3BWUC 3OR6B 2GJPA 1N0XL 4QRPE 4Y16B 1KBKA 1KB5H 2WXIA 4JN2A 3CFQA 5F89A 5EF3A 3S5LG 4R96A 4GKZB 5IG7B 3KCPA 1I53A 1S6NA 2R83A 3HBGA 3LZLA 3QXAB 3TIDA 2BZ7A 1FVDA 3BUIA 3ZHDA 4P8QA 3DPDA 4FLOA 4IU2A 1A1OB 2HSIA 1I1AC 4XWOC 1RL1A 1SMAA 1U8KB 4KPHL 4M9OA 2WSDA 2PP7A 4R8WH 1KSRA 1FH5H 2ILLA 3IXAA 3FNKA 3FU0A 3RLSA 1G43A 3P4OB 1XMEB 4POYA 4HOXA 5B38A 2IDTA 2XV3A 3BPOB 3NEXA 4AK2A 4KGLA 4QXTB 3OZ9L 4L29B 4UDTB 3PJLA 2W07B 2CIKA 1U3JA 1YEHL 2CDGB 3AQXA 2AQTA 5BZDA 4MVBD 3KPNA 3NJHA 2IQAB 3IPBA 2V2XB 3EFDH 1WEJL 3LNGA 1JYWA 4MWFA 2ICWA 4DEPB 3M1CA 4LQFL 2I07B 1FWXA 4NWUL 4F8PA 1ICTA 1D5ZB 2WAQA 4QRRE 3VXNB 4PTTA 3P11H 2QZQA 5DUML 3TV3L 1UACL 4LSRH 4ZT1A 1XDTT 5HJGA 5B8CA 1EK3A 2P8LA 3SDAB 1UXSA 3GHBH 4GMSL 5E23A 5G2NA 2WJ5A 5C0AD 5C7XL 4CVWA 1INEL 4HHWA 4J12A 2CJUH 2Y5TA 3KM2A 4Z3FA 1I1RA 3GMMB 5HHOD 2WYIA 3ECUA 3RVVC 1D5XB 1ZIAA 4JPVH 5TDNA 1F2QA 1FO0A 4G9FA 5D2NC 3QXWA 1GZHA 3GSRA 5AB1A 3QIBA 5I1AA 1NQBA 4AE0A 1UD3A 1I7RA 5FFOA 1FORL 2XG5B 2J88L 3VD4A 4N8PA 2ZCZA 5F0JB 1ZSDA 3NRQA 3QXTA 4W9HC 3AS0A 4PJDE 3MRGA 1WK0A 1IAOB 1WUZA 4G70B 4APQA 1N5YL 1CD9B 3PAZA 4M43H 1A7OH 5FA4A 3NIFE 2WQUA 3SE6A 5B4MD 2SODB 2OMVB 3L6FA 1H6TA 1KLUB 4I9WD 2B0SH 3E6FA 4N6RA 5DJZB 1L9RA 1KJ2H 4JFOB 5TF0A 4JM0A 1G7QA 5C0CA 2QGEA 3C5ZC 4P04A 5C0DA 4X4YB 1GGBL 3CSGA 2RALA 3WUWA 1BFSA 5C0GB 1AE6H 1XF5B 3DJRA 3T77B 2A6JA 1MHCA 4R7DB 1PY0A 4N90D 5D1ZD 3G04A 5CCKL 2BP3A 4TLKA 1QFUL 2DD8H 4R83A 4YQXH 4AYFA 4Y5VB 2XFGB 3JUZA 4Z95L 2AJVH 2E27L 2I24N 1E5UI 4XNMA 4CGTA 2Z7WA 3D51A 2B3IA 2HKFL 4PGDA 3VFMA 5JDSB 3O3DB 3DXAD 3FB8B 5ADPL 2EO9A 2Q76B 2O93L 1HYSD 4JY6A 2HFFA 4JKKA 3NRPA 3EKCA 3TIEA 3BZEB 2P1YA 3N0AA 4OZGF 3SJVB 4M48L 5MEQB 2X6VA 1DQTA 2E7MA 2X53A 4NRYA 4AOFA 2VW4A 4N2GA 1XV8A 3KD4A 1QRNE 1EPFA 5F89B 3U6RB 4JN2B 4P23A 3LQAL 2ITCA 4ZK8A 5C86A 3RPBA 4GRWF 2GJJA 2WBJD 2Y24A 3K3QA 3TIDB 2X1QA 4WTWA 1CZ8L 4YBQC 1FVDB 5LCVA 4GUCA 1FYHB 4Q6IA 2IALA 1G7MA 4IU2B 3P0GB 5CEXA 4AEIL 2K7QA 4YE4H 2YD7A 2VRAA 1J0IA 4JFEA 3B5TA 4OBRA 5AQ0A 5INDA 2HRGA 3EZJB 2LGNA 2YK1H 4S1DD 2FJFA 5D93B 3M8OH 1U2CA 2VWEC 5B38B 4N0YH 1IEAA 4WI8A 1NAMA 1AR1C 1X5GA 4L0YA 3HZYB 2ZWYA 5F88B 4S1QH 1K3IA 3NAAH 4FZ8L 5KVGL 4PJ9A 5BZDB 1KPRA 1B4LA 2EAEA 3FZUC 4MWFB 3TO4A 1AKJD 2HG0A 2ICWB 2R51A 3GLAA 2DQGH 5EHFA 1DO6A 4WDIB 3DURB 3N40F 2Z3FA 4HOWA 3T1FA 3MLTA 1H3XA 3KH3A 4MYWB 3OWRA 2BVPB 2VTFA 5B8CB 3SB3A 1NH6A 2GKIA 2P8LB 4B9PA 1QSZA 4RAHA 4B5EA 4GW4A 4WTQA 1UKSA 3WJMA 3O9WD 4P5SA 4OH2A 1NIEA 1XCWA 3EIFA 2Y5TB 5KVFE 1U3ZA 4KO9A 1XCXA 4AM0B 4XWGH 3KPTA 3OXRA 1OK0A 4U7SA 3TVMA 4MS6A 5D8JL 1Q72L 3B9KA 5TDNB 1OAKH 3RDTA 5DYFA 5CFAA 1FO0B 1LVEA 4G9FB 3ZUCA 2OXHA 5T1LA 4YHMH 2YKKA 3MN8A 2CCVA 3FFCA 2OW6A 3GSRB 3LEXA 4DKFH 5BUAA 3QJSB 5I1AB 1I7RB 4ZW3A 1KPVA 3LZNA 3IU4L 3ZDWA 5BRZE 1ITCA 4UQDA 4YHYC 2EUXA 4O4YL 1ZSDB 1NMBL 5DMYA 4UQAA 3MRGB 3FTWA 3W11D 4OIIL 3CQQA 4HJ0C 1ACYH 5DZ9A 1IGCL 4N2HA 2FNBA 1IKFL 5CEYA 4DP1X 3E6FB 5FO2A 4FFYA 1JF1A 1A6WH 2R2BA 1A6VH 4N6RB 6PAZA 1IM9A 5F9OH 1V7MH 4XBEH 4M6AA 1UCBL 4OB5H 3U2IA 4YNYA 2VZUA 1G7QB 5C0CB 2P24A 3F6JA 2BPBA 2VMCA 4WEMB 3K8LA 2PP9A 3WUWB 4KV5F 4LEXL 4HC1A 3QCVL 3STZA 1T3FA 2A6JB 2Y36H 5KJ4A 3ZZ1A 3G04B 3KPMB 1DSFH 2DJSA 4CSTA 3MO1A 1L0XA 4PN6A 4Q9RH 3FT3A 3QWRA 3ZE1E 2QHRH 2JJSC 1MAKA 1S9WA 5AOMA 1IC5L 4XNMB 1EUTA 5IM7A 3K2KA 2BINA 3MLVH 4PGDB 3VFMB 3NCXA 4KRNA 1BBDL 3B2DC 3OAYK 2HT4C 4JY6B 5GISH 2HFFB 3BPNC 3QZNA 4MZ3A 4Z3JA 1PKOA 3TIEB 4DCQA 3PQYA 4HVBA 4HCGA 1LO2L 3K2UL 3ORJA 4HJGA 1T04B 4N0CC 3FMGL 1RLBA 3FU7B 4NRYB 4N8VG 1RERA 1IQWL 1L9SA 2DMBA 4CILA 4KNTA 2NY2C 2AVGA 2X3AA 4MQXC 1XF2B 2ITCB 3ARSA 1Y7VA 1ZEAL 3QISA 2VC2L 4LCCA 2WXLA 3AG3B 1ZA3A 3BQUA 3EOYG 1A9VA 3KYAA 1CCZA 5CEXB 1SY6L 1F4HA 1MNNA 4RCAA 2FSEB 3Q44A 4I89A 5GHWL 5INDB 1GS7A 4NZRH 2WKOF 5D1XC 1CYWA 4Z3EA 2FJFB 1IEAB 1NAMB 2VR6A 3C12A 3PWLB 1HQ4A 2WCGA 4IGBC 4ZRGA 3TXAA 1CF8L 4F33A 2CO6B 5FUCE 2EXWC 3O3BA 3ZTJG 5HGBA 4PJ9B 3V0GA 1KPRB 2N1KA 1YN7A 4TRPL 1WCQA 3TBYA 2NT0A 4MJ5A 2K3TA 3AC0A 5F7FA 1D9KC 3DETC 5L6YH 5E8DL 4BGDA 3T1FB 1KTRL 4JDVA 3A6BL 3D9AH 2B59A 1Y18B 2QADC 3NJIA 3U0PA 3LNDA 5JHDA 3EGSA 3T0WA 4Q6YA 4FJ6A 5IB2A 3L3KB 3EJUA 3BOVA 1YO4A 1CDBA 1YLBB 4IOFC 5FC9A 1Y1DA 3QXUA 3OXRB 3TVMB 5IUSA 3B9KB 1I75A 4ODHH 3GXPA 5GGQL 2OKMA 1DVSA 4I2XE 4J3UA 5T1LB 3Q6FA 4U1LA 4BFJA 1QFOA 3FFCB 3LEXB 1WIOA 5DFVD 4ZMXA 1XGUA 4PSRA 4MMXA 5B1CA 1CXLA 3ABLB 4BZ1L 3BRDA 3CG8A 4ZO9A 5HDBB 2R1YB 1HKLL 4JN1L 4AL8C 2YO3A 3HE7C 1YDPA 1MCPL 3ABKB 2XHNA 1MUJA 1TLMA 4QLRA 4OD3H 4YUEL 3T0EC 1IFGA 3KPSA 4QTFA 5LG6A 3ZMRA 1F6AA 1SJMA 1G1YA 2NZ9C 2XNAA 5CLZA 4AL8H 4EIBA 1GY1A 3UC0H 1MPAH 2CWRA 2O72A 3FF7A 5FWQA 1JF1B 2R2BB 1IM9B 4HKZA 4OGZA 3WY2A 3BT2H 4YNYB 2YXMA 2MQGA 2P24B 3CIQA 5KBLA 3EJZC 4UTBH 2UZIL 4KKRA 4NN7B 5GGRB 1QNZH 1OTTC 5GZOD 4B41A 4JQVC 2VR3A 4UTBA 1T3FB 1USZA 5TPWL 1I8LA 4LNVA 3SE4C 2KI6A 3ROOA 4BFGA 2EE0A 2AJXL 5AZEH 1TCMA 2YN3A 3MO1B 1UQSA 4OT1L 3BD4A 5ELIA 1WV7T 4UOJA 2EEXA 5HHNA 1S9WB 4XBMA 3RQ3A 3B1TA 3UMTA 4ZS6C 1IFHL 4P2RD 4IRSD 2MNWA 4XMWA 1RXLA 2QSCH 3U7YH 4FFTA 3ZTJH 2FD6L 4XB8A 1HXKA 3S3CB 5EF1A 1BAWA 2ZSWA 2BVUA 2WLKA 4A2DA 1GS6X 1HZHL 4JZNB 4MAZA 1AHMA 3ARXA 1B2YA 5IKCA 2CK2A 3LN4A 4MDJA 4LCCB 1ZA3B 3N85H 3F84A 4Y88A 4NJ9H 4V1DE 1NWOA 2ZX5A 2V2WB 5HYSG 3ECVA 2M1KA 3B7SA 4ONHA 3T8MA 2ZNXA 4UV7L 3VXRA 1IAII 3BI9X 4QAMB 2QKIC 1S4IA 4JRXD 2FLMA 1O7VA 2EH7H 3NFSH 3L4TA 2VDML 4Z7WA 3CXFA 4FABH 1HL5A 1W72H 5ACZA 2CBPA 1UD6A 4L3ED 1HQ4B 2Y72A 5I66A 4KBPA 1ETJA 3L4UA 3ZKND 4L05A 5FGBC 4PLKD 4Y4HC 3O3BB 5H4YA 2D31A 4A55A 4UTAA 2RCSL 4ZW5A 5J13C 5IBUG 3TBYB 1T6BX 4GI6A 4MJ5B 5DXWA 3H7BA 3TYGL 1RK7A 2BC4A 2EIBA 4YBHA 4NFCA 5IBLD 2F15A 1GMIA 2BVQB 2I7OA 2NTFB 5GZND 1XGTA 3NDYE 4JDVB 2DL2A 3LEYL 4IJTA 3ZUNC 5ISZE 2B59B 4X5WA 3D39E 5IJDC 3F58H 5AAMC 2VSCA 3V4VL 5JHDB 3EGSB 4K8RH 2LAGB 5IB2B 1UA6H 4IBUA 3NA9L 2VM4A 4M8UA 4FE9A 3K0WA 4DTGL 1HN1A 1H5BC 2VIRB 4W81A 2EILB 1AFVH 4KUCF 5E2UL 2VYRE 12E8H 2EKSA 3R8QA 3C60D 1SVZA 3Q6GH 3TJEL 1WZLA 4DKEH 3G6AA 4OIFA 5EZOH 4U1LB 1OF0A 3CFCL 3RBSA 3TT3L 1XGUB 3RUGB 1MKFA 4MMXB 3RWHB 2XICA 5C09D 5FYKL 3ILEA 4H13C 4PRHE 3O2DA 4I3GA 1ZPLA 2X41A 3L9BA 4WI7A 4L9LA 3KLQA 3RJDA 2UUDK 1QVOB 1YDPB 3WIFA 5HYQA 2WYTA 1MUJB 1JNHA 5T3ZD 3KPSB 5E99H 1F6AB 2CO1A 2XNAB 3F3HA 1HE8A 3WIIH 5ICYB 3UGUA 3U6XS 3GRWL 4HKZB 3WO3B 4UYQA 4YSEA 4IU3A 4U6HB 3T71A 4R5XA 2A9CA 1NGPL 2GTZA 3TCTA 1OSYA 3US9A 4DAGL 2WIIA 3AAZA 4NIKB 1GYVA 3NOIA 1IILE 4X6CF 1SBSH 2PWFA 5I9QC 5E8PA 3ROOB 3QDJA 4EUPG 1OB1B 1UQSB 1UKTA 3UBHA 2V7HA 2XU9A 3UC2A 5HHNB 1PZAA 1U8IA 1PKQB 4JFYA 1UCTA 3IJEA 3ZRSA 2EICA 2BS71 4OGXH 2K78A 4ZODA 2EIEA 3APFA 2VLLA 1WAAE 4Y9EA 4DERA 2W59A 5DEJA 4JM2A 4WI3A 1CLCA 5IEKA 2G5BA 1MI5D 3RZCC 5I16A 4BQBA 2ENPA 4HF5L 1KGIA 1Q0EA 1T1WB 5KYWA 4RH4A 4P46C 5EOCJ 5HYIA 5IKCB 3LN4B 4AQ1C 2LTQB 4YX2L 3ETTA 4MDJB 1GCYA 4NKIL 3ZL1A 3V6ZA 4RMUA 1MCDA 1WFMA 3RGVD 1FGVL 4I0PC 4HWEH 3QFJD 4F8OA 3I9GH 1XIWA 2XOTA 2I9LA 4ONHB 3STLA 4DP6X 3CXHK 3VXRB 2VXTH 5JHAA 3QJXA 3LZRA 4GRLC 4Z7WB 3UOAB 4AMWA 1A7PH 3R1GH 4YGVA 2CRMA 5I66B 4XB7A 5FPIA 4KXZI 1PG7X 1W72B 3IGAA 1WVZA 3CHSA 3HLAB 1DN0B 4N9OB 4NXSA 4H8HA 2FX9L 4RMWA 3WHXA 3HBPA 2CR3A 1MNUH 4R26H 1TSHA 3H7BB 4RGMC 1EWHA 1MCRA 2BC4B 1FLRL 2J71A 4FQPA 2VH5L 4Q8BA 4JANB 4NQCD 1TETH 5E4IA 1XGTB 3KYOA 2YAPA 4HXBL 4X5WB 3BAIA 3A6OA 5ADOL 3UTSD 3NP3A 1SOQA 3QCUL 4F8QA 2FR4A 3WD5L 4WIQA 1D6VH 1GW0A 2IANE 1MELA 3A4AA 1ET7A 4XNDA 2LAAA 5F3BA 1G6VK 4QRSA 2EKSB 2UUDH 3AVEA 3PFQA 3QCTL 3KXFA 5FKPB 2XN2A 1T80A 4PGEA 3GMNA 1EX0A 4JFQA 3PAVA 1FZKA 1SBBA 1NCJA 3G6AB 3KBPA 5IT2H 4EUPH 5KJ7E 3S3DB 1Q8MA 1TJXA 4AYID 1EJ6A 1R75A 3D8MA 3QDAA 1QFPA 1JXDA 3SHSA 4L9LB 1E4XI 3SE9L 3KPRA 5HYQB 1JNHB 2IH3B 5IK3A 3WAKA 2OMBA 5HI3C 3JV6A 4LP8A 1M71B 1NCBH 1KC5L 1T03H 1DQMH 1M53A 3V5HA 4P3DA 3I2CH 2FYYA 4E9LA 1A7NL 3DV6B 1UXWA 1WICA 4OJEH 4UB0L 4IU3B 1OT1A 4QJ4B 1EFQA 2ZUUA 3S6CA 2GTZB 1GXEA 1H6FA 1MIMH 3D2UA 4ZFQA 3AAZB 1I31A 1DQDH 2WLNA 4IIZA 1SJEB 1S5IL 2HT2C 3ME0B 4Z9KB 5E8PB 2H8PA 3KPPB 3QDJB 4Y9CA 3W3BA 5J1SC 4PLOB 4RMSA 3G7TA 3RFZC 1M7XA 2Q3AA 3HRPA 4APXB 1GGCH 2V7HB 3GDBA 3H7LA 5IR1A 1RZGB 3AQDA 1U8IB 3VWKC 4JFYB 3IJEB 4ZUVA 5I9QB 4Q9QH 3CC1A 3NJKA 1KCUH 4PWHA 1XGQA 4MXVE 4B7LA 3O6MH 1C5DA 1FFQA 4GT7A 3TBTA 1RY7B 3NTCH 4MHHG 4JFUA 3NJMA 3I74A 4JM2B 4MXQC 1AQKH 3QQNA 5IEKB 5J8OA 1T22B 2G5BB 4FG2A 2EDQA 4ONGH 3TN0C 4DP5X 3WI9A 4CJ1A 4MA1C 4OCXL 1DUZA 4GKLA 1DYZA 5KYWB 4YBLB 3RHWK 4WGWB 1UOLA 2EYTB 2XACC 2Z31D 2CALA 4UIMB 2PYEA 2OCFD 5TD4A 3MODL 1AC6A 3JWDL 2Q8BH 3ZE2F 1KIRA 3HBZA 3OM3B 4KDTA 1OE1A 4RISH 1J05A 3VQLA 1I7ZA 3QUZD 1ZHBA 2FH6A 3LKNB 3V6ZB 4RGNC 3SDDC 3Q5OA 3QDGA 4P46B 1PD0A 1MFNA 1XIWB 1KXHA 2QGDA 4QPEA 4NZFA 1B90A 2WVUA 3STLB 2ZXEB 3BVWA 1IQDA 3OGCA 5D5MF 2DB8A 3MMEA 3MZTA 4PJEF 1CUOA 5IESH 4DUXA 1G6RA 4N25A 2AK4A 3DGCR 1AZRA 3JWNG 4GIAA 5ENWA 1AD0A 2ORBL 3ECBA 2VN4A 4YDVA 4HCRA 3RTLA 2EE2A 1BXAA 3IGAB 5HHMD 2CPCA 2FX8H 3WNIA 4YOKA 3TT1H 3ISRA 4GRLB 4UT7H 4DNLA 4KI5F 2AGJH 2YUXA 5DUJA 4KRMB 1AH1A 3BIAX 2QT6A 4OCRL 2UZPA 4LNRB 5I73C 2A9NH 2X1PA 4PJXF 3CN1A 4XCCH 2GTWA 2NNRA 2ZYRA 3KYOB 1G0DA 1PG7H 2FR4B 3NSXA 1ZLSH 4AQEB 4QJ3B 3GGWA 1LTXA 3ASWA 5DQDL 3DDGA 2VXUH 1WCBA 1R3LA 1UD8A 5GSVA 4YDJA 5B1AB 3MBEA 1M1XB 3K5SA 3K2IA 4X9FA 1KMGA 5F3BB 2PABA 4BYHA 4QRSB 5GGVY 4IEFA 3GRGA 4O2CA 4M5YH 2RMNA 1FZMA 4LLWA 3S5ZA 4KZEL 3BPLB 4ODVL 3PV6A 4PGEB 5I17A 2FJHA 3GMNB 1CTMA 4JFQB 1U3HA 1FZKB 2BO0A 4G42A 3L4XA 3WTTA 1MAJA 2ED6A 1HNYA 1HU8A 3SJVE 4M7LT 1EJOL 1UD5A 4U1KA 3WLWC 3ULSA 1HCYA 4G83A 5IB3A 2F7RA 2ERJC 3II1A 5MEPA 3MKKA 4TL4A 2HJLB 3G6DL 1BGXH 4ZFFA 3QEQA 1FGNH 5L4FA 5IK3B 2YAQA 3JV6B 3V0AC 5D1ZI 1JI1A 3ARQA 4OKVA 1AIFA 4E41A 4R90L 1XXFC 2VABA 4P3DB 3V5HB 1IKOP 2FYYB 4FYSA 3QNXB 1OP4A 4X7TA 1QHQA 3KBEA 4G8IA 1NOAA 2G4GA 4Q7DA 4OJCA 3WNJA 2UXGA 1YEJH 1OPGL 4WW2C 4WHDA 3D2UB 1NC4A 4X4MA 3SCMC 4BZ2L 3AFLA 4UZUA 4ZSOA 1WO2A 2H8PB 1P7QD 3QUMA 5MERA 2H0JA 4LQ1A 4DVRL 1E5ZA 3UCQA 1DR9A 3JWNC 3QDMA 2GHZA 3UTTA 2A6KA 1WA1X 2A6IA 2QZ5A 1YUHA 4WHCA 5IR1B 3LNIA 1GGIL 4ZUVB 4Z23A 5AFAA 5JQHC 5HDQL 4P49A 1A3ZA 4ZAKA 4A7TA 3B9EA 3JWNH 1XGQB 3LD8C 1C5DB 3DROB 3SKJH 2Y7LA 3TBTB 2ZWSA 3NACH 1MCQA 2YD2A 5EA0L 3B2UD 2EADA 3O6LL 1R3KA 1DUZB 4KO7A 5IROA 2IFGA 3WNLA 3WTYA 2PYEB 5CP3A 1XGYL 3DUHA 3LZFL 1QBLL 1KIRB 2GY7B 4G9FE 1J05B 1I7ZB 1ZHBB 2VW6A 1KBBA 5DS1A 4FDWA 2J8UF 2CA3A 3QDGB 4KK5D 3QUXC 4QRBA 3LV3B 3QP3A 5F93C 1IQDB 3FRPG 3OGCB 2W60B 4WFEE 4MAUH 3MMEB 1IC1A 1SN5A 1SPDA 3EOBB 1G6RB 2AK4B 1J9SA 3ETBJ 2ADGA 5ENWB 3DO7A 3WE6A 1T5XA 1W6WA 3ECBB 4YDVB 2DI8A 1PD6A 2WNKA 1O75A 1V3MA 2YAMA 4UM8A 1NJ9B 4XMLL 1Z3RA 4FQ1H 4DGVH 3KMDA 1SLUA 3JYBA 4LRIA 4UIKH 1E6OH 5IOPA 3CBRA 2JKLA 1MHPL 4KJPD 1UADC 5C0CE 2NNAA 1X6LA 1G9MC 1Z9PA 3UJTH 2C7FA 3U1SH 3MXVH 4S0TD 3BEVA 1H6EA 2X10A 2HRPH 4LHUA 4TTDD 2TAAA 3LKPB 3ULUL 3GGWB 3SBWC 3BAWA 5EUKB 1WCBB 5GSVB 4WV1C 1VADA 2YD1A 2GHWB 4YDJB 4HPOL 3JUYA 5GGVL 3VMOA 3DBXA 1QBAA 4QAWA 1CICD 1MN4A 3F7PC 4H0GA 4IEFB 4O2CB 2APTA 1LL1A 2PMZA 1FZMB 2Y6SC 4LLWB 3A6CH 2N56A 5I19H 5I17B 2FJHB 1CXIA 3OF6D 4TNVF 1U3HB 2A1WH 1PFCA 4J3VA 5JYLA 3G9AB 4PWIA 1NFKA 4G42B 4W4OC 1K5WA 1HE7A 1RUQH 1IT9L 3F62A 4RLDA 4JLRA 1Y6NR 2CHXA 4U1KB 3ULSB 4WUUA 4F58H 1PD1A 4O9HH 5IB3B 4I77L 5MEPB 2XZCH 3VSQA 25C8L 4Z7VB 5TF1L 1M3IA 4ZFFB 4DSYA 2H3KA 3QEQB 4ADGA 2FNWA 2A38A 2NW3A 3HZKA 1FAKT 3ATBA 4OKVB 4X80H 3SGJA 3WNKA 4E41B 4LDCA 4OCYH 4AQZA 2WWMC 2VABB 1N68A 4N2LA 2ZKHL 3TL5A 1RK0B 4X7TB 4G8IB 2BNQA 1KGWA 3GXMA 5AOKA 2R1XA 1AGCA 3GF8A 4ADIA 4OM0L 3GJFA 2XSKA 4FQ2H 1NC4B 1ZVYA 2LU7A 1KJVA 5EFIB 5F1KC 4QRFA 4AX3A 5FS5A 4Z76A 4L4JA 2EUZA 3TFKC 5MERB 2DAVA 4JVWA 4JZJC 4NX0A 4PRIA 4JVPA 3PY9A 5BQDA 3QDMB 4L0ZA 3UTTB 2A6KB 1NCOA 2E8YA 3AXHA 5EOCL 3SCMB 1YUHB 4CDHA 1B4RA 3BLKA 1AS7A 3MA7A 4TUUA 3LTVA 4ZAKB 4HCFA 3TEUA 4X8XA 1B4TA 1JZGA 1T5WA 2NY3D 2V0AA 2AEPH 3X14B 1QZNA 3D33A 3F7VA 4RX4D 4JRLA 2YUWA 5JIQA 2PXYA 1U8PA 4HIQA 4OJDH 3UAEA 1R3KB 4G7VH 4OI8A 2AS5M 1IBGL 3UXFA 4K9EC 1UJ3A 3WNPA 1DUYA 4B9KC 3C2AL 5HYEA 4GH7B 3NQKA 4K9EH 1WS8A 1EEUA 2ARJQ 4X6CA 4XCFL 2GW5A 3RPIB 3UROR 3FFCE 4RDQG 4Y8DC 5ESQA 4CGUB 1TPXC 2CLVA 3P2TA 4XGZA 1YMHB 1WQVT 4AW7A 4PEEA 5FYJE 4XVOA 3PGCB 2AW2A 5HDBE 4BZYA 1JHTA 4B9IA 5BRZD 3BAEL 4PWGA 2FIKA 2VN6A 2YQ3A 2EZ0D 1T5XB 2KQNA 4MJIB 1NLBL 4UM8B 2N1TE 2DYPD 2YBGA 5D1QA 3BDYL 2NCMA 3FQRA 4EN3A 2GEQA 1W0VA 2BSSA 3WTVA 4JE0A 4U33A 5IOPB 5JPNA 2JIXD 5E24E 2NNAB 4L3CA 4EDWH 2WYZA 1T0PB 1TLKA 4LPVA 4XXWC 3BEVB 1VAHA 4LHUB 3CGTA 3CX5J 3PAYA 2AJSH 5F7LB 3QRFM 1GS8A 1SXSA 3MUY1 5D7SL 3W38A 4LRNH 3GSWA 4LSRL 1FBIL 1IO4C 1UA3A 2IH9A 5HHQA 5CMAB 3DBXB 3OLDA 1OWRM 3JV5A 2BS9A 1AQMA 4G72B 4H7VA 1NBYB 5B1JC 2BERA 2CJUL 3O0LA 4CVZA 5EZIL 4ABVA 3LKRA 4LSQL 1CPUA 1BBJA 1BYOA 1LMKA 3BSZA 4L48A 3O11A 4Z7NF 3Q8CA 4XMPL 4WUUB 1JXJA 3VD5A 1TNNA 4JX0A 3GLEA 5J56B 4PY7A 3IFNH 4A6YA 1ACXA 2NY0D 2OMNA 1MG3C 2VKWA 5KSVA 1SNRA 4W9KC 4B3VA 2NW3B 3HZKB 1TT6A 3O4LD 1QMUA 3P77A 4EI5C 4HK3J 1JOIA 3MOBL 3ARBD 2BIIA 2DEXX 2Z1PA 1WA2X 1B6DA 3D6GA 3HOGA 4XAWL 2ICES 4XAKE 1UB5A 2BNQB 2R1XB 4MAYA 5FYKD 3J07A 1AGCB 3HMWL 5F7EH 4YK4C 1BV8A 1DL7L 1F4YL 3GJFB 2VM3A 5IVNA 3SO3C 3QR0A 4E2OA 1KJVB 5EB9A 2ZT9C 1HOEA 3VXQB 1FIEA 4M7ZB 5AVZB 3SYPA 6PCYA 3EOTH 3INUH 2AXHA 5F1SA 1W8NA 2J1KA 2R23A 2CA4A 1BX2B 1BEXA 1FVEA 4NNPL 2WCSA 4OLYH 4TS6A 1NC2B 2H6PA 2DD8L 4NHUA 4DGIH 1E9PA 2RBLA 1T5WB 4H8WL 2XQBL 1FIGL 3GMPB 3H2QA 3I6GA 1HHHA 2VN5A 5JHDE 1YEIH 3F7VB 4J3OD 2QR0A 2PXYB 2IJ0C 3RJOA 2LU3A 1ZGLM 3CBKB 4P2OC 3QUHA 3ESNA 3BKYL 3REWB 1G87A 4WNSA 1OAQH 1SXBA 2YAEA 1EA9C 4NGHL 2MJWA 5TK2A 1YYLH 1UJ3B 2G2PA 4CBPA 5D7KE 3OAUH 2AEQL 2NXZD 4BKSC 2H2PC 1P7HL 2HLAA 1IIIA 3QG7L 5EN2A 3SPHA 3FUKA 3RUGE 3GS0A 4O51A 2Q7NA 4FFZH 3E9TA 3NUKA 1JFQH 1JHTB 4XO5A 2QQKH 3NSYA 3KZ8A 1BXUA 4QCIA 2FIKB 4FFWC 3GWJA 4CJ0A 2O5ZL 4J4PC 5IW3A 3KPSE 1HWHB 4PJ8A 2K1MA 4U1MA 1WBXA 3HG1D 1EAOA 3FQRB 4PYHA 1HWWA 4LAQL 5ANMA 1W0VB 2BSSB 4IJ3B 2D0GA 4G8EA 5JPNB 5KBNC 1YUKB 1Z3GH 1N12A 2AFNA 4AVIA 3REVB 2WTPA 2HPOA 4L3CB 3US1A 2Z7UA 5BZZA 3SN6N 3WKML 3O81A 3FUIA 4P07A 3NPZB 1T6VN 4PVBA 2GPZA 2Q5BA 1MJ7H 2LVEA 4YSCA 3H42L 5J3HC 2ATPB 3MJ9L 2BIOA 1KJMA 5EEZA 1EVUA 1DZBA 2ZSVB 3UGXA 1PKQE 3J7HA 3SSGA 5BPPA 1N67A 4JHZA 3A21A 2HMID 3BRFA 4CVZB 3GTTA 3VVVA 5I1CL 3LKRB 4NZUH 1ULVA 1J10A 4FAAB 1TYEB 4IDLA 1OAKL 1GHFL 2GI7A 3H3BC 2X87A 3O2VH 3O11B 3V9CA 2H1PL 3W82A 3WN6A 3D3VA 3JWOC 5K9OA 3QB7C 5FM5O 3EGXB 4NUJA 1JIBA 4R0LC 5IUCA 4PY7B 5F96H 3JWOH 2VDNL 5EF2A 1KZQA 3L4VA 4WI0B 4A6YB 2Z65C 5IFAL 2GVYA 1EDHA 4ODBD 2F53A 4WNQA 4BFFA 5KSVB 3NIDF 2D2CC 5D7JC 3P77B 5L8KB 3CVHA 4QWWD 1AO7A 4FQXD 4JMNA 4MJ6A 1RPUA 3HCVB 5GS0C 1YG9A 4UT9L 4AE1A 4JO2H 3RX5A 1ACYL 4Z7OF 2X70A 4PB0L 3ABGA 1ZLVK 3VXRE 1UB5B 2GJZA 2E9BA 3BN9C 3JVGA 3NCYS 1WZ1H 4MAYB 4OJFH 3RJQB 3BUQA 5AZUA 1DZ0A 1EZVX 1QW8A 3D30A 2YOAA 4PJHF 4Z7WE 1JHLH 5HHVH 3U30C 1AHKA 1ESOA 4OR1A 5IGXL 1L0YA 2XKNB 2W95A 4WQOA 1ZV5A 1UHVA 2RB8A 1UENA 1WTLA 2P8PB 1HHKB 5I6PA 3TBSA 2JELH 1MFDL 4DFHA 2H6PB 4DGWC 4NHUB 4C58B 2DBLL 4ELMA 1SFHA 3D2TA 2EECA 3I6GB 5I6XC 1HHHB 5AL8A 1AGDA 5ISZD 4OFDA 1O9VA 3MLVL 4XPGH 1W15A 3FCBA 2DLHA 3CIAA 3I02A 4D9LL 2D4DA 1IX2A 2LLNA 1OLZA 4A2GA 4GI8A 3AACA 1D5RA 4JR9L 3TBWA 1FA4A 3DVIA 4TN9A 3MLXL 2W0PA 4NQEB 4M56A 5E4OA 3ZKXC 5D4JA 1KZYA 1Q9KA 4AGQA 3ZYIA 3MRKA 4RRPA 4O51B 4HD9A 1I8AA 3VH8A 1A7QL 1XBDA 4YWGL 4C4BA 4O2EA 2GBVA 1QLEH 1MWAA 3WNNA 3MLUH 3PHSA 3DUUA 5DSCA 4PRHD 3VQ1C 2DQIH 4QCIB 3F05A 3IFLH 3F01A 3W2DL 4PJ8B 5TTRA 2JKSA 1XSKA 4TOYH 1WBXB 3ULUF 5F8RC 5EO0A 4JHWL 3RZWA 4PJAA 4M8QA 1JHKL 4IKNA 5ANMB 2R2HA 5D71H 1NCHA 3G9VA 1QHPA 4H26A 1AZCA 1GC1L 1FHNA 3MCG1 4WK2B 2BFVH 1AZVA 2J1WA 1C08A 2WXRA 5C0BA 1CBJA 4Q89A 2PO6A 3HMXA 4ELKA 4Q56A 2KC0A 1L5GA 4L37B 3WFHA 1D7CA 2YIHA 1S7XB 4PWFA 3QDJE 1C9SA 2A7BA 2AXGA 3MLSH 1W2KT 3QBTB 4U6YA 4IBTA 3P54A 1KJMB 5EZJA 2WOYA 3OLIA 4R2GD 4TPRL 5KS9A 5KW9H 5JYMA 5D70H 5CBEA 1CF1A 1AG0A 1XX9C 1OCWL 3OVUB 3HRZA 5DRNA 4Y1AA 2UV3A 4P23C 1UZ6E 2KQMA 4OF3A 3A0OA 5ALCH 3BX7C 5K9OB 3PCYA 4WWKA 1ZLVH 4NUJB 2LVCA 4FZEH 3CFUA 3L1EA 1C8QA 2V17L 4Q6IC 2MPVA 5DHMC 4K5LA 4EE2A 5K33A 4QT5A 4P48A 5BV7B 2F53B 4WNQB 2NT1A 4OFYA 4NN6B 4PAZA 4HISA 3DOSA 1S7WB 1DLHA 1W0WA 3ARGA 4JHVA 3R06A 1AZBA 3F64A 1AO7B 4MJ6B 5EEWA 4FADA 5JXEA 1BZ9B 1ZRUA 1ADQH 3CBJB 3VB8A 4WF7A 4U6XA 5DWUL 3FU8A 2GJZB 2GK2A 2JKIS 3GKWL 1CJYA 5EPMA 2J7LA 4HSQA 5G55A 1A6UH 2LHAA 4UT6L 1RUKH 4DP8X 4L4VA 3HBQA 4G6AC 1JF5A 3NG5A 3M45A 2BJML 3QR1A 3DO4A 3FUDA 3TBSB 3MLPA 4OQTH 3CN0A 3PUCA 3L3JA 2R9HD 3LQZA 4JHUA 4GKOA 4PREA 1JCKA 1CE1H 3U48A 5EU6A 5A2FA 2YS4A 1J8KA 4ELMB 3TA4D 2YA1A 2ZUTA 3LKSA 1ZLEA 2ZNWA 1AGDB 3RDTC 2Y2WA 2EVJA 3RVWD 2OULB 3V9EA 3ABMB 2EXYD 2VN3A 1TZAA 3B5HA 2ZF9A 4XXCA 7CGTA 2E4TA 4F91B 3OPZH 2IAND 2ZAHA 1KCRL 1BVZA 5HGHB 4HG4J 2G3ZA 1DFBL 4XMKL 5I18L 5L7XH 3LMJL 2R7EB 3LNHA 4UNVA 5KBDA 2MTAA 5BMFH 5J11C 4GEJA 5A2BA 4OD1L 1KV7A 4X4XA 1Q9KB 2ALAA 3S37L 3MRKB 2V3FA 5FW8A 4JQXA 1MCOH 2APBA 4K71C 4M6NH 2QVMA 4O2EB 2MPAL 1JV5B 1WIPA 1MWAB 2OTPA 3V4UH 1N6QL 3DUUB 5FGSA 3A22A 1OZUA 4PJFA 4Y16D 4G6JH 2VQ1B 1QLEB 4KAQH 1QATA 3HI5H 1RV6X 5E6IC 1Z0NA 5HYFA 2PN5A 1JRHH 4HIEA 3HUJA 4YAQA 2UY6A 5EO0B 3M07A 4PJAB 4M8QB 1U8QA 1MCCA 1GYUA 4NUGL 3LS5L 4JFPB 4D0CA 3C6LD 4H26B 4XZUA 1WISA 2GBTA 2G3MA 4YIQA 4AMKH 1O6VA 2AQNA 4X5RA 3RTQD 4PJ7A 4FN0A 5IIEA 5IVXB 4HW6A 5FUZL 5GGSA 5C0BB 3KBFA 1E4XH 3FPYA 2B9AA 3RVXC 4QHUA 2K9UA 1DSWA 3OMAB 1YY8A 4NSKA 3UAJC 1WYJA 3WFHB 1HQRA 1NBZA 4TSAH 3VXSA 3VSTA 2DIBA 2RQEA 3T08A 5C0RH 1RZ7H 1HIMH 3W39A 3AT9A 2DDQL 2AXGB 4KKBD 5I8OH 4LEEA 1MQKL 4DIXA 1BMZA 4U6YB 4ZQTA 4RIRA 3SEPA 1FDLH 2KDYA 2BDNL 2DF3A 2DH3A 3II2A 5EZJB 4DPRA 1MW1A 5KS9B 1G84A 5CBEB 2HJKB 1B3JA 1OSPL 1HAUA 3HRZB 5DRNB 3TPUB 5IMKB 4Y1AB 2KZBA 4GO8A 4WI4A 4AGOA 5G5DB 4N2EA 5E2WH 3SDCA 2JLLA 2VO5A 3TS8A 2MHAA 4WWKB 3M7OA 4Y9BA 4XCEA 4LBEA 1M3JA 4FGMA 3EF7A 1A4JB 3BQUC 5JMRA 4GNKB 2ZXGA 4LP5A 3SY0A 2DQEH 2PYEE 1VSCA 4QT5B 3UJJL 4F15C 2K70A 1ACZA 2E7HA 4GG6F 3DOSB 1VIWA 1DLHB 1W0WB 3ARGB 1CU4L 3R06B 4TULL 3QDGE 4F5CA 3UZVA 1JFHA 4O5LH 2B14A 3ARWA 3GBMH 4U6XB 2IGLA 3WIIL 2TRYA 1UYWL 3FTGB 4A66A 4QO1A 2W65A 4L8CA 1G7PA 2AK4E 1ASOA 4KNSA 3V6FA 1TENA 3T65A 3PWVA 4L4VB 4AG4H 5CILL 4K7PX 3KJ4C 1M42A 4ABUA 4N9GA 4LT7A 2AABL 3VO0A 1ECZA 3ZSSA 3X1BA 2RH0A 5GRJH 3AUVA 3LQZB 1HS6A 3D1MC 2R29H 4PREB 1KYFA 1XVSA 3FU9A 1ZHKA 2NY6B 1SDDA 3TA3C 5KYUA 2QMJA 3V4PA 2HX7A 5AWNL 4ZZKA 3LKSB 3PYCA 3QZBA 3LOWA 1JZ5A 5I1GL 2FHCA 1JZFA 4NO0D 1E3FA 5C0AA 1ONQA 1LEIB 2WVVB 2D7MA 2DQUH 4HJ1A 3MRDB 4E9XA 4H1LA 4MXWH 5HHOA 4Z8FL 5SWZB 1F3RB 2Z8RA 1IC7L 2AAAA 3FTSA 4MJHA 3BKCH 1QBMH 3H53A 3FULA 5EIIG 1J5DA 2DQ6A 3RGHA 5CLXA 1A4KB 5MI0C 3ARRA 3P4MA 1J9TA 4X4XB 4V33A 2OXGA 2VDPL 3GI8H 3SDXF 1WD9A 4JO1H 4Y7OC 4EIGB 1CDGA 3BSHA 5JO5A 3EHBC 5H37G 4R6UA 3V0JA 4Z7VE 2FT6A 2HVBA 4PJFB 3V6BR 3ZLQC 2BSTA 3RA7L 2NUTA 1RMFH 3QEQE 1J5OH 1A25A 4LLUB 4NC1C 1MOEA 4PJBB 4R97C 2I9TA 1A6AB 4HIEB 3HUJB 4E41E 2UY6B 3VI3B 1DBJH 1A02N 4D0CB 2YMXH 4XZUB 3C08H 1BM3L 3VFUB 4YIQB 4PJ7B 4XN4A 5EU7E 5IIEB 2R0ZH 1EO5A 5GGSB 4XC3H 4O58H 1YNLH 4X4ME 2MKWA 4FCAA 3CVBA 4QHUB 1QWHA 1YY8B 4KH9A 4NSKB 4JMXA 1Q9LA 4N2IA 3LSOA 1JGVH 4CVXA 2MQ3A 4FL4B 1I1AD 3AS2A 3W39B 4YSUA 5D1ZA 4XTRC 5TQ2L 5LVEA 3UTTE 3QDME 2P45B 1F86A 3EDDA 4RIRB 4JDEA 3D25B 4AC4A 1IEBA 4JFWA 1IGFH 3TFBA 2MIZA 1HCVA 2G0KA 4HALA 1YYCA 4FYQA 2QHLA 4J39A 4JEGB 3UTPD 3JWNE 3DXAA 3IDJB 4GSDL 1TU2A 2MHAB 1I1CA 3E6HB 4LBEB 2FB4L 1QAWA 3HAEA 3OL2A 3SY0B 3MRBA 4ZS7H 2XY1A 3EBAA 3K4DA 4F92B 1KOAA 4AQ8A 3U0WH 4NKQB 1A64A 1XT5A 3CN2A 4XNZB 3UPAA 2Z8VC 4JG0H 2F5BH 2WBJA 3ASOB 4IBWA 1F2XK 1N59A 2EH8H 4G9FD 3UZVB 1HL9A 1AD9A 4OF0A 4HZAA 4ZFZA 4S0HA 1AMXA 1DVTA 3EH2A 5KVDH 3J8F7 2E7LA 4HPYH 1TYJA 1I7TB 2CRYA 1HOCA 4PBVC 2YPVA 3RU8L 1KTJA 4QO1B 2FO4A 2W65B 4EZJA 5ECJE 3ML8A 1J8HD 1G7PB 4HUVA 1IJNA 4K07A 3T65B 5LGYA 2WLMA 4MJIE 2D03H 3PWVB 2DM4A 4KH2A 4PBDA 43CAA 1R6VA 3VXMD 4X5PA 4PG2C 4M3JA 4N9GB 4L5FH 2VZVA 1MXDA 4IDJL 5FDYA 4B7IA 1OOAA 1D6EA 1G7LA 1G9NL 2CDFB 3PWPD 2UVEA 5H37H 3FT0A 5IF0B 2KYIA 4ZTPH 1AKJA 2OJZH 3HVNA 1UT9A 4IRJC 4N1HB 2O5XH 2ZJSH 1N3NA 1AYRA 1ZHKB 1TIUA 1DQQA 2X89D 3N40P 3PUUA 2XG4B 4FNTA 4K7PH 1ZE3C 1D5MA 1VZIA 1ONQB 1RFDH 3Q2NA 1A65A 3O9WA 5J57B 3CUPA 1ZE3H 3C5ZD 3F8UB 4GINA 4F7PA 5HHOB 4PHXA 1T89C 3QRBA 3C8HA 2AMUA 2FECL 4XPTH 4YHLL 4B5ZA 1WUNT 4F7KA 5LNGA 3QEHB 2OXGB 2MNJB 3DX4A 3OQ3B 5AW7B 1SEQH 2AV7A 4FYTA 3D5OF 4WUUE 5CCGE 2PCPA 3KNBA 1MF2L 4I4WA 5JO5B 1LK3L 3N91A 4HZLA 5I1IH 5MI0B 2EVIA 2BSTB 4OZIB 5I0VA 2NUTB 1WH0A 3VD0A 1HSBB 3AQZA 1DBKL 4M4PA 1YY9C 3QQDA 5F0MB 1YPZB 3RAJL 3T2QA 3HTLX 5EWIH 2IF7A 1O9WA 4NWTH 2E9GA 4IHBA 4N8CL 2W88A 1DLFL 2BNQE 1TQSA 3TT1L 3GT6A 4X6DA 2OK0H 5EOCH 1N4XH 2LE9A 5HVWA 2AGJL 2FRGP 1Q9LB 1J1XH 4EMZA 2UWEA 3LSOB 2I85A 3B9DA 4CVXB 1V3LA 1YSOA 3N44B 3WV0A 3VD9A 5SX4I 2FHFA 3BP6A 5D1ZB 5FF6A 1OD9A 1ZLSL 1GY2A 1QUNB 1YEEL 4JDEB 1S7SA 3GO1H 2VXUL 4OCSL 1BZQK 2F74A 1AR1D 4KJWC 1QQDA 2WSPA 4LFHG 2MWCA 4I5BA 4WWOA 3DXAB 4OTXL 1LK2A 4XNXH 1MCLA 4M6OL 1TU2B 4Y5XA 3W0WD 3FZUD 4JO8A 4MA7H 1F3JA 3HAEB 3QJHA 2FT8A 5IQ7L 2EDBA 4XXDA 3PHQA 1P5UA 2KH2B 5AAWA 1URLA 4OCWH 1RIUL 1VRSA 3UZEA 5KSAB 2MH4A 4FJZA 4A7VA 4LP4A 3BCDA 5FHAH 4F8LA 3U4BH 4H8UA 4UBDD 4KKQA 1TYRA 1DSYA 2IH8A 1YRKA 1OV8A 2WBJB 1EO7A 1UXLA 3LX9A 1N59B 3LIZH 1BGXL 5C6TH 1N26A 4W9EC 1AD9B 4ZFZB 4XX1G 2XWEA 1BVNT 2P5ED 2A9ML 4FXLA 3KGTA 3MJ7A 1HOCB 1AZUA 1BECA 3D4ZA 3Q8FA 3UTQA 2FO4B 4BRVA 4HUVB 5JOEA 3T0DA 1IGIL 4H88L 1IZJA 4ANUA 1B2WL 3QEUA 5DA4A 3U1PA 1WS7A 4OZ4A 43CAB 1CDCA 1Z5YD 2HX8A 2NYZA 2D0HA 4X83A 3UCRA 1INQB 2BSRA 2ED8A 4ZOAA 1D6EB 1G7LB 1KBVA 1PL3A 5L88L 1AKJB 4BEIA 1ZANL 4NM8L 3GSNA 3NJNA 1N3NB 4A2FA 3EYQC 4GRWH 3SD2A 1PCXA 1DQQB 3KPQB 5CN3A 2NY1C 2AANA 1L6XA 4ES8A 1S9VB 4M5SA 3PL6C 4MA8L 5C92A 1D5MB 5E2VL 3SKJL 1P84J 3NACL 3O9WB 3CUPB 3T2OA 5JPMC 1RURH 2X0UA 2BRRH 2B15A 1K9TA 2R0KH 4F7PB 2J1YA 3SKOA 4ODSH 5KG9A 3QWRD 3C09B 1ORQB 2R4SH 2G4EA 1CXKA 2OJ1A 2K8QA 3PHOB 1KFGA 3TPKA 3ZGIA 2NR6C 2JKJA 2VDOH 1P6WA 2YMTA 1ML0A 4M1GH 1CR9H 2IPTH 2PCPB 3KNBB 4I4WB 2JB5H 5AB9A 1JPTH 2HB0A 2PTUA 3B43A 3ZHLA 2HT4D 4L23A 5I30L 1AGBA 1OP5K 1J1PH 4G71B 4HUUA 3VGDA 1CTNA 3R8BB 3QJFA 4N0CD 4N4YB 3LXUX 2IO5A 3P0YH 3DV4A 3QQDB 4M93C 3WNOA 1UOVA 1MAMH 2VXQA 1M4KA 3BVUA 5I1EL 2Y25A 1Q1JL 3UJIH 4MQXD 3EYVA 2C7UA 3L1FA 4X6DB 4UINH 3NK4A 5J6GA 1K85A 4G5ZL 4JK0D 5CP7B 3SQOL 2UWEB 3KVQA 1LM8V 3NABL 4LARL 1OD7A 1S9XA 2W9DL 1ASQA 1T7YA 3GEFA 4HXAH 4LSTH 4P3CH 5GZOA 2DLFH 1R19A 1FE8H 1G7HA 1O7SA 1BVKA 3BP6B 1T20A 3L1OL 5A3ID 5FF6B 5D1XD 1G9ML 1S7SB 1WFUA 1JPEA 5I71B 2F74B 4LSSL 4ZFOL 4OF8A 5FV1L 4FRWA 1OGAD 2UY7A 1QQDB 2BIPA 4I5BB 4PJDF 4P2RA 2EXWD 2VDQH 4IRSA 1LK2B 4PRNA 4ZUWA 4PRPA 4PP2A 3IGFA 4URKA 1I9RL 2BP5M 3NIFF 2X5PA 4WI6A 4Y5XB 1F3JB 1DANT 2HYMA 1INDL 4XXDB 1P5UB 5AVSB 3II3A 3G5YA 4HT1L 1D9KD 2Z7ZA 3K6FA 1E9QB 5CSZA 2WZPD 1H3TA 1L6PA 3P3UA 4LAJH 4F58L 2F9BT 2QADD 1CI3M 4O9HL 4BIKA 3GHEL 1NBVH 3VFTA 3CZGA 4ORGA 4NQEE 4PG9A 5LBSL 3QQ3B 2XN0A 4JCWA 3WEBA 2OZ4H 3OB8A 4ZUUA 1IFRA 4IOFD 1NUGA 3ATAA 5EOQH 2OZ4A 4FA8A 3MJ7B 5IV2B 3HE6C 5E8EB 4XC1H 4XNUH 3HPLA 3UTQB 4GMTH 3ZDXB 4AEHL 2EC8A 4FQQA 2NNCA 3QEUB 4AJWA 4U49A 4L3EA 3EJRA 3L3HA 4NKOA 4OZ4B 1M9WA 1PX8A 1SXZA 4Z0BL 1AGFA 1CVSC 1SRDA 1B0GA 2BXZA 5ANME 1E9OA 1XD1A 1XF1A 2R56L 5D7LB 3K1KC 3ZDZF 1BQUA 2XYBA 1YEWA 3EG9A 3K7UA 4P9HL 1A1NA 5DLMH 3MBEC 3GSNB 3V52L 4PSPA 4TLTA 1R46A 4Z6AT 3WXVH 2XWJB 5GZNA 1ZT4A 4XT1C 3U7WH 2NZ9D 3P0VL 4OY9A 4OZFG 3WJLA 3LRKA 3WKNA 3UPRA 2XTJB 3IFOA 2X2HA 1ZIBA 2CK0H 1BAGA 2AEPL 4AM0Q 2AI0H 4M5ZL 5F6HJ 3L4YA 3EO9H 1KN4L 1GH7A 3EJZD 3SKOB 3LPOA 3FF8A 1OP5H 5KG9B 2EO7A 4LASH 1OTTD 5J12C 3C60A 5E03A 1XBRA 2O6PA 1UWXK 1JV2B 4YMPA 3EAKA 1A3QA 1EEYA 2I27N 4S1SL 4G9DB 1J1OL 1KDIA 3D3VE 3BHBA 4FKEA 2BNUA 3HR5B 4JDZA 2WLJA 4S11A 2OL3A 4ETQA 4X8JA 2D7NA 3HC3L 5CD3B 5C09A 2DQHL 2DJ4A 1U2HA 1H8OA 3UADA 3MCLH 2ZXDA 1MFEL 3ZJAA 1AGBB 2F53E 1TJGH 1CLZL 2X4QA 4EZMA 3MDJA 4HUUB 2JWYA 2Z9TA 3EUDA 3GNML 3GIZL 1NBCA 3DV4B 3OC8A 1AO7E 4DZ8A 1IBDA 1FSKC 2HTKD 2IAAC 1TVBB 4HWZA 3AB0C 4XMXA 3R7QA 1V8HA 3MRIA 3OJDB 4NOFA 3U9PL 5DD3L 1KCLA 1N5AA 3L5XH 3VXRD 5J6GB 1NFDA 2HLFC 3KLLA 4LVEA 2Y2YA 3FUHA 1UWYA 4AYEC 3MRRA 1L7TL 4NO2A 3CZSA 1OCOB 4GQZA 2EACA 1OARH 2FEDC 2Y5QA 1G7HB 1A0QH 1G0XA 1BVKB 1ID5I 4QYOA 1T20B 2B4CC 4OF5A 3MLYL 2V9UA 3GXUB 4EOWL 3FN3A 2B4CH 3MLZH 3L2NA 2NDGA 4PRDA 3OKMA 4ELME 4Y89A 4P2RB 1CC3A 3QZWG 4TVPL 1CFVH 2ZF8A 4PRNB 4WEBL 3NSJA 4PRPB 1AHWA 1NUFA 5K59E 5L4MA 2J25A 3EXJA 1RUMH 4NM4L 2BP0A 5JQIB 4BSWB 1RZFH 1MI5A 4JPKL 3ILQD 4HH8A 1KULA 4K8RD 4JL2A 2D0FA 5CSZB 2PCYA 2DQTH 2DI7A 2CUMA 1PIGA 1PGRB 3ES6A 4OZFH 3VFTB 2HZHA 2AQRA 4ORGB 3BAXA 1QYGH 4PG9B 3IM1A 3AREC 3RGVA 4OM1H 5I0YA 1Z7JA 3QFJA 4PJIA 4HBCH 2RGSA 4I9XA 4TSBL 5HXMA 1S78D 1N0XH 1XTMA 2Y6TE 4ODTL 2VJ8A 2IDQA 4OLXL 3B2VL 3HPLB 3ZE1F 4WW1B 1ETZB 2OSYA 3DDFA 2B08A 2QDWA 1NEPA 3CSYB 3CZKA 4L3EB 4NKOB 5F7EL 2CM6A 1AGFB 3CX5K 4PJAE 1B0GB 5KBMA 3EJPA 1E9OB 2HUEA 2M26A 2XZQL 1MSPA 2WXKA 1SHMA 3T3PB 3EG9B 1A1NB 5IVXE 5C0BE 3B7TA 3L8QA 1UWXH 1T7WA 4HWBA 4NQCA 1ZT4B 5E6ZA 3ZL2A 1QKZL 1ZDQA 3OZ9H 3UPRB 1CQYA 3IFOB 2Q87A 3UTSA 4HIPA 1YEHH 4RFNC 1H3WM 1J0YA 2V9RA 1ZTXL 3ZXAC 1WEJH 2HPTA 3D18A 2EE9A 1V5JA 4LQFH 2JTYA 3BGMA 5KS9E 3VWJC 3WL9A 5IHUL 4NWUH 4G80A 3C60B 3N9GL 3NZUA 1VEOA 2XX0A 4Y1AE 5DUMH 3TV3H 3D0LB 5T33L 1UACH 4FTVA 1EEYB 1FV1A 5MP6L 2CJTA 5T3XE 1KGXA 3BHBB 5TE4L 5C7XH 2BNUB 2JE8A 3KBHE 1INEH 1WC7A 4JDZB 4ETQB 2IOMA 2H45A 2OL3B 2Y06L 3DHUA 4YFEA 4LPUA 5C09B 5DHVH 3WTWA 4QEGA 4FXGB 4LLYA 4KX8A 3WLBA 1K8DA 4AV5A 1E50A 5AAPA 2OYMA 2X4QB 4MZRA 3V6OC 3T8XB 2CXGA 1JTPA 4OGYL 4GXUM 1PZSA 3HNTH 4DZ8B 3NEOA 4M1CC 4KVCL 2WQXA 1FORH 4AZ8A 2J88H 4P46D 3MRIB 2VDRB 5G4NA 3U1QA 4WFHD 4A7GF 2IAMC 2EYRA 4GG8A 2IDSA 4E36A 1N5AB 4JFZL 1NFDB 1OK8A 1N5YH 4B50A 3CX2A 1E6JL 2OV0A 4I0PD 5AVRB 4NO2B 2BVTA 4L4VE 1T1XA 2ENSA 3AB0B 1FPTL 3JXAA 1I4FA 5E1GA 1GOFA 2HJFA 4QMEA 4YC2C 1MJ7L 4GRLD 5FOBA 2J1ZA 2ZTBA 4HJIA 4YSTA 1CXEA 3CWGA 4KUZL 3NVQA 3WS6A 4PRDB 3OKMB 1QFWL 3OV6A 1GGBH 2V2TA 3PXHA 3Q9PA 4HIIA 4QF1A 1EQWA 3UO1L 1AHWB 4ZYKA 1BDYA 3KVDD 3QW9A 5DVPA 4FQJL 5CCKH 5EZLA 4RMRA 2IEPA 2BP0B 1QFUH 1LO3L 4O02A 1BFTA 2CBOA 2ZG3A 4KO5A 3RRQA 2WBKA 2BY0A 3BH9A 4Z95H 5CAYB 2E27H 3D07A 4I1RA 2F54D 4LSDA 5LB1A 2Z31A 5SWZE 4KJQD 3K46A 1KT2B 5I74C 1F1AA 2AVFA 2BMKB 3ES6B 5CZXC 5ADPH 1MDTA 3QUZA 4M48H 2IWFA 4CSZA 2Q9OA 4PJIB 2XI9A 5LAXA 1QO3A 2DWXA 5K9QG 4EN3C 2WQRA 3LQAH 1UOKA 3FOMA 5KANI 3N3EA 4PJFE 4WO4C 3AREB 1MDAA 4XPHL 4BKTC 1CZ8H 2JTDA 4PJBE 3GXIA 3R0NA 3FOLA 3T0VA 3HUJE 4KI1A 3VI3E 3EF4A 5E1AA 4XHJC 2GJRA 3GBNL 4AEIH 3CSPA 3THMH 3T4AC 3AWGA 4BHUI 5E56A 3GMRA 1G0YR 5G4OA 4BINA 5DS8A 4F27A 4PJ7E 2YXFA 1Z9SA 2ZKMX 3ARDB 1J0JA 3DMMC 2G60L 4J1UA 5HI3D 4NQCB 3S88L 5EU3A 2ZYIA 2WP3T 1TEFA 3EO1A 3ET9F 1P4BL 4X6FA 3MRFA 4FZ8H 1KIQB 5KVGH 4I3RL 3WTSA 1J87A 3GK8L 4H2CA 3D12B 2OSWA 1CD8A 5E9AA 4K0OA 3D18B 4KK8D 3BGMB 3NCEB 2P7TA 4DQAA 2NCEA 4G80B 3SPIA 5D6CB 3GSVA 1I7UA 2Y4SA 1UH2A 3VFNA 2HT2D 1UOWA 2X9ZA 4FTVB 1U42A 3PWJA 3F12A 4YSRA 1FNLA 2V8LA 1AXTL 1P9MA 5CBAA 1WC7B 2EKJA 1P2CA 1RULL 4YSOA 3WO4B 4LLYB 1S3KL 4JKMA 2IXQA 4NT6A 4KHXL 3WLBB 1K8DB 1Q72H 3CHXA 3VDCA 2PYED 4ACTA 4MJ2A 2IWEA 3RIAF 4AXWA 1WDAA 3TN0D 1TQCC 1CFTA 2DMHA 3QZWB 2YMOA 2JKXA 4W93A 2HG5A 3QDGD 1IKNC 2H1LM 4XPAL 4ALAL 3NZ8B 3IU4H 3CMOL 3FCTA 2B1HL 4KVNL 3CVIH 4O4YH 2BOCA 4LIQE 2ARJB 1NMBH 3CU1A 3Q3GB 4GG8B 4R7NA 5AVTB 3TF4A 5D71L 4OIIH 1Q1PA 2QQLL 4BDVA 4L8DA 4RGND 4ZXBC 3SDDD 2MMXA 1GJUA 1T1XB 2Y7QA 2PW1A 1IGCH 4QGYA 3S5YA 1IKFH 5AOJA 1P7QA 1LE9A 1I4FB 1YEFL 2F7PA 2HJFB 1CDYA 2JNZA 4HYTB 1UCBH 5FOBB 3V5DA 2CKBA 1VFAA 3WEMA 5HYJD 4B3EA 5FOJA 3K72A 3BH8B 1YN6A 2V2TB 3WFCL 4HIIB 4LEXH 3QCVH 4P05A 3TBCA 4QF1B 1CDJA 1YZZA 3UBXI 4ZYKB 2J57A 3FB5A 3UZQA 3VFVA 5J9PB 3MV7D 5EZLB 4O02B 5F6HI 3ARYA 3UX9B 4ZW7A 1HJBC 5EORL 3BVXA 5CEZL 1UH3A 4LOEA 1A7RL 2Z31B 5HHOE 2Y2TA 5DVKA 3EDEA 2RHEA 2HVKA 4WEUD 1BBDH 1PAZA 3FQWA 1T2QL 2OX5A 1PCSA 4GQ9H 5LCVL 2Q20A 3K2UH 3FMGH 4YE0A 1HNGA 1JWMA 1ZHNA 5I15L 3DIFA 4DEWA 2QTEA 1IQWH 1YEDA 3HS8A 1CIUA 3QS3A 4UOW0 2W9EL 3FOMB 4HAGA 1C5BH 3D85D 4OZIE 4HS8L 3EDJA 1ZEAH 1NAML 3A4DA 2VC2H 4PJDA 1WAAF 3IF1B 3FOLB 2Q7YB 1YPZE 5E1AB 1LO0L 1SY6H 3N1MC 5B3NA 4M8VA 4I9WE 4ZUTB 3NP4A 3CFMA 5GHWH 2Z8WC 3KLHD 3NESA 3GMRB 1SY6A 4L3FA 2YSSA 3NEEA 5DS8B 4LLMA 5JIHA 1Z9SB 4J1UB 1J8RA 5F9JB 4CUCA 5I6LA 3ROLA 5EU3B 2DKMA 3Q01A 2OAAA 1CF8H 1U8LA 1KXVA 1CE1L 3MRFB 1FI8C 3GSOA 1ZLDA 2OR7A 1JVKA 2WXQA 4N90E 4EDXA 4X5QA 4TRPH 2DQMA 1BZ8A 2X2YA 4LHQB 3S48A 3HC2A 2XXFA 1JN6B 1KFAL 2IMMA 3I6LD 3SCMD 1CICA 1IUZA 5E8DH 1DVFC 4KZDL 1I7UB 4IOSD 2A6DA 3VFNB 3TF7C 3MBXL 4BFKA 5EU5A 1FHGA 3QE5A 3F12B 1MVFA 2R39A 2HKAA 3DXAE 3OF6A 4KI5C 2Y7MA 2X05A 2CCWA 5EBGA 1VB9A 5CBAB 1JNJA 4AGLA 2GIYA 4JQIL 5BMFL 1HSAA 4GAGL 1MXGA 3EYFA 4HZ1A 5FYJL 1TQBC 4NT6B 1B88A 3NH7L 1DANU 4CMMA 2M2DA 1YCSA 5GGQH 1ZHLA 3S2AA 5I0XA 1XSIA 3G6JA 3V4UL 2B5IC 3RILA 3Q9QA 5DRWA 3ZMNA 4AXWB 1E4KA 3UBFA 3OSVA 4BXVA 2R4RL 3EJYC 1X9LA 4J27A 4KAQL 4QXUL 2NY4C 1JXGA 5D96C 1E5CA 1CG9B 4FFYL 1L3WA 4BZ1H 2BOCB 4JFDB 4R7NB 1S9YA 3I50H 5HP5A 2IH1A 1U9KA 2CLZA 1HKLH 3L5WA 5SX5K 4BM7A 1IB5A 3ATDA 4JN1H 4BDVB 1MCPH 2IFFH 1H15A 3HG3A 4L8DB 4YUEH 1GW6A 3X11A 1QSFD 2Y7QB 3BKJH 2PW1B 3QUXD 1XZ0B 4HC1L 2YOCA 4MJID 1P7QB 1LE9B 2Z7YA 3VM5A 1RKRA 3MV01 2WM0A 4GP8B 5DT1L 5C0RL 4P3WA 4PWEA 1U30A 4JCLA 1A22B 1VFAB 5CJOL 4NP4L 3K72B 2UZIH 1YN6B 5CJBA 5E0QA 2YA2A 4HG4K 2ZX9A 1FNEA 3V4LA 4TNVK 5ACLA 4LL4A 5TPWH 2AHIA 4OGAC 2VJ0A 2ZX8A 1MVUA 1R5IA 3FB5B 5E95B 3CNKA 3VFVB 2AJXH 3V55A 5J1AB 5L8JB 4RX4A 4OT1H 4KZ0A 2G75A 2J5WA 5CKGA 2CGRL 5E2WL 4BH8B 3VQ2C 4NQTA 3AGVA 4HBQA 5KUKA 5IWLC 4PW4A 1IFHH 2HVKB 2Y1AA 5E2TL 3FQWB 2OX5B 4HGWA 2NYYC 3NGBC 2Y9RT 1TJHL 2GSGB 3QORC 2FD6H 4WFFE 1FNFA 3SO5A 1JWMB 1ZHNB 2ZOLA 4C54A 3DIFB 3CHRA 2DYSB 1YEDB 5IQLA 3IVKB 3WU1A 1HZHH 2FBJL 5IQNA 1PAMA 4DESA 1B4JL 3ZO0A 5BRZA 1S8DA 1KXQA 3KCWA 2BM3A 3VRIA 4AQOA 4MXVF 5BOZG 1S9KC 1F6LL 2DYPA 2PO6C 3FT2B 1I3GL 1TCRA 4KTDL 1NMCB 3VQMA 3TURA 3S98A 4UV7H 5HHPB 4X6DE 4QGTA 4W4NA 1JUFB 1MY5A 2JIXA 4WZ9A 2Z6FA 4CW1A 2WXOA 2VDMH 5T1DH 1EERB 1KTBA 2LFEA 3B34A 4K73A 3ROLB 3RNKA 2UWEE 4L2YA 4OF6A 2NZIA 3DX9A 2FBRA 1JGIA 3QYMA 4U0RB 2E86A 1CMOA 4OI7A 3FFDA 4N2MA 2PR4L 2N59A 3UACA 1KPUA 5KEZA 5GS1A 2X6BA 3TYGH 3E1F1 1JZ8A 1QX1A 3MTXA 3NZHL 1CICB 4YH6A 1KEML 1PZ2A 5I23A 3BGAA 2A6DB 3LEYH 2WUCL 5EU5B 3TFKD 1NC2D 5E9DD 5AUMA 1ANUA 4KKZA 4RWYL 2FATL 2YD6A 3V4VH 2E74C 5SX4H 1GA2A 2X4TA 3NA9H 4HQQL 1DVFB 1HSAB 3JTBA 3SYCA 3IDYC 4DTGH 1NLDL 3EYFB 2D7QA 3MRLA 2ZUYA 5E2UH 3ALWA 1DQJA 4JVUA 1IBYA 5JXEC 1Z9LA 4CMMB 1IL1B 3IDGA 5TE6L 1ZHLB 4HU2A 3VFOB 3DECA 3G6JB 4HJEA 3TJEH 2XBDA 2WYHA 5DRWB 3IMVA 2B8OT 3CFCH 1PY9A 2XVBA 3O4LA 1CGXA 4OLVL 5CGYC 2Z35A 3TT3H 5JMOC 1R3HA 4MMYB 3ARBA 4Y2LA 3SGDI 4ZPVA 1SJXA 1WP6A 3N1FC 2R2EA 5KJRL 2Z64C 1U0QA 3ML9A 2IH1B 1UM5L 2LLGA 3ISYA 2WKLA 3MNZA 4ZMTA 3ZDXE 1E42A 4YFLF 1H15B 1NTDA 2ZPKL 2ADIA 3X11B 1VACA 4XC3L 4F7TA 2F18A 3KJ6L 2XA8L 4AJYV 1GPOL 5DHEA 4XNAA 5D7LE 1XEUA 3I75B 1OO2A 1JYXA 1I3UA 1PZCA 5CUSL 2QLYA 3ECQA 3CXHJ 3GRWA 4HHGA 1N0LB 1NGPH 1E90A 4KKAC 2BIQA 4DAGH 2HN7A 4CC4A 2A4ZA 3ZTDC 3ZHFA 3FQNA 4WUKH 3FPXA 4W9JC 5DURB 1FNEB 4K2UL 2LOEA 2MEJB 3LAFA 3VJ6B 2NY3B 2XTJE 2IADB 4MS8C 2W0KA 4IKKA 1MVUB 1R5IB 2CO3A 4MNQD 5LHDA 4ZW6A 1RP9A 3CFBA 4ZTOL 2G75B 2XWBA 3VDBA 5DZJA 1O7DE 4QLWA 1F4WL 3OHXA 3HS9A 2P42B 3RKDC 4FJYA 2O6CA 4GAJL 4HGWB 1MCBA 4NYLA 4ZS7L 2UVFA 1D5BA 4MNGA 4R84A 1E67A 2BCMA 4ONOA 4YO0A 2PLTA 3F5WB 2EEDA 2ZOLB 4HF5H 1J5CA 1EVTC 4JRFA 1QFWM 1VERA 1J9CT 4PGCA 5KVDL 3PXJA 4YX2H 2FHBA 3QHFL 3VRIB 2E8ZA 5E2JA 4NKIH 4XPBL 5JW3L 1IGYB 3UAAA 1FGVH 1PLBA 2DYPB 1SYVA 4TV3A 3RFRA 3ETSA 3G5ZA 4PR5B 5AYUH 4M7JL 5JIIA 1TCRB 3EUUA 3HG1A 4UTAL 3VG9C 3RY5A 1OTUD 1Z9MA 3M7FB 3OPUA 4G5AA 5FA3A 4KXCA 1TO5A 1PEWA 2JIXB 4WY7H 4CW1B 1OALA 1U93A 5SWSB 5ICZB 5FXCH 3NSFA 4MAYD 3L3DA 3V0VA 2GC4C 3E3QC 5EIVA 3RNKB 4ZTPL 4EI5D 2FQGA 3DX9B 2WN2A 1SJVA 1K8IB 4GFTB 4PJ5D 4D7PA 1JWSA 5D9SA 1FNSL 1O5PA 2AQPA 1NCCH 3FFDB 3HI6L 1A9EA 2FX9H 7TAAA 1H19A 4XX1E 5GS1B 1SLXA 3GZKA 1HHIA 1MFCH 5MHSE 1F02I 1FLRH 2EIZA 3HB3C 4Y19D 4OFPA 4ZMQA 2VH5H 1YYML 1TVHB 4Y4FC 1MRDL 4OV5B 2KPWA 5AUMB 4GO9A 1JVOA 4P2RE 1AP2A 5EBMA 4N86A 5ADOH 2APFA 3APCA 3QCUH 4BUHA 4PRPE 1VPOL 2A74A 3LZPA 3QZOA 3V4VB 1A66A 4YZFE 2CHZA 4QI3A 3VA2C 3MRLB 3VX1A 1DQJB 4YHOL 4Z77A 3O2DL 3QCTH 1IJ9A 2H5UA 3IDGB 3PWUB 4YGAB 4TSCL 2C9UA 4N8UA 5F1NA 4KV5E 3AXIA 3WCYA 3PJNA 3O4LB 5ES4B 1R3HB 3BH4A 2YGOA 3IK2A 3LKOB 3FTYA 3ARBB 3QEGL 3CSBA 4FQXA 4NQED 5CWSA 4KFZC 4ZPVB 1TTFA 2JB6B 1HINL 4AI7A 3QHZL 4FYRA 3RY4A 4ADJA 1NFAA 4MVBC 2DQCL 2GUYA 3QWQB 1MLCA 3LRSA 5CINL 2H2PD 3DRQA 4FC3E 2OM5A 3BGFB 4FTDA 1VACB 4L3EE 4QRQA 1D2PA 4LLVB 5TE7L 4F7TB 4WJKB 2EDOA 4DGYL 1VZGA 1ZXKA 4YSQA 1HK6A 1A7NH 4XN7A 1AACA 4F8TA 4UB0H 3ZZQA 3T3PE 4QHMA 4YFDB 4FFWD 2H0PA 1EV2E 4J4PD 1QHOA 2HN7B 4B9CA 1ZGLA 3PLYA 5T5FA 3S3SA 1CS6A 3GMLB 2L7QA 3I9IA 4JFFD 1S5IH 1BFVL 5ISZA 4EQ3A 1I9JL 2UXVA 2OP4L 2XWBB 3BZ5A 3EYOA 3ZTNL 2XQYK 3Q5YA 5L0QB 3JTSA 3BDXA 2WWKT 1RZIA 3OHXB 5E51A 3I3DA 5T1MA 4XCYA 1YEGL 5K39A 3CE1A 4D9RD 5HI5C 1T21B 1ZV9A 2IPKB 1R5WA 2TSBA 4FD0A 4GRMA 4WWNA 4AGMA 3L48A 4NYLB 4G6ML 1UWFA 4TNEA 1D5BB 2AXFA 3U4BL 4MNGB 4AJVA 5TJWK 2NOYA 4ODWB 4MYPA 4ZFGH 3HN8A 4YO0B 4JS7A 2XQYG 4ZMLA 4EI6A 4FG6C 4OCXH 5A2KH 3JWDC 1IAKA 4PP1C 3TTSA 5C09E 2ZE0A 5B4MC 4LBAA 3FTVA 4PGCB 2ITEA 3MODH 2F7QA 4HFWA 2X4RA 1OPOA 3JWDH 3TH3T 1PLGL 4PRHA 8PAZA 4V2BA 5D2LA 4W9IC 2L4OA 2F53D 3GJEA 3SQBA 2ZAIA 3HIZA 3R0MA 3G5ZB 5FYLL 4JGNA 3SIKA 2J73A 3HG1B 1T0OA 3MNWA 1WFJA 5FA3B 3IMTA 4PD4J 4LKXA 1N9PA 2D9CA 2ZP9A 3MUGA 3NK3A 3CFJA 1NFDE 4FXKC 2DQFB 3L3DB 3V0VB 3GKZA 5EULV 5TDOA 3O45A 2ORBH 4ORZC 1Z6JT 1ZOXA 4F7CA 5HI4D 5GS0D 1JWSB 3UIYA 4X0KA 5D9SB 4KRPC 2KZWA 2MNUA 4IBLT 2EXSA 1A9EB 4NKDA 3S8WA 3BN9D 1CGWA 5CJ5A 4NLAA 5KYYB 1HHIB 1RZPA 2EIZB 4GO6B 4OCRH 5ABDE 2J72A 5HDBF 2FK9A 4I7ZC 1MG2C 5KVEE 4XP1L 5EBMB 1AP2B 4YDLC 2CHWA 4NNYB 2WO2B 3CTTA 4X7SL 5DQDH 1SXCA 4HJJH 1M7DA 4X9IA 5FR3A 2DQDL 4HMEA 4RBPK 2CR0A 4Z77B 3IJ8A 1CO1A 5B3JE 5DZVA 4KZEH 2J4WH 4ODVH 6FABL 3ILPA 2E7LC 4M1GL 3EJQA 3JSSA 2MQCA 1JZHA 5JZ7D 1OHQA 1WTGT 5F1NB 5IBTL 3SBRA 4E42A 1LO5A 1EAPA 4S1DC 1AQDA 4ZOCA 1R9FA 1EJOH 5CWSB 4PJIE 1URZA 4FQXB 1M05A 4X98A 5JNYA 2OBGA 4CMHC 4KQ0A 1EEZB 4NP9A 1MAML 2OSXA 1P7KA 1RUPL 3G6DH 5HVHC 4LMQI 5I1HL 3IAGC 1OF2B 1MLCB 1XHHA 3LRSB 4OAWA 3DRQB 5F9WB 2DIAA 3AROA 5FM8A 4QRQB 1BP3B 5IMMA 3WMPA 5DVOA 4X8GA 4GKSA 4R90H 1LP9A 3P2BA 1KXTA 2R15A 3KYKL 5F0LB 3MV8D 3EH4B 5A2AA 3LNEA 3DPBA 4TUJA 4U3CA 4GSXA 1DBMH 1P84K 3ARFC 4QHMB 2QV2A 2Q3XA 3P3TA 3EXLA 4AGNA 3MCYA 4NQCE 4BZ2H 3BFOA 4U1HB 1JDAA 5E6YA 4NQUA 5LNEA 4DVRH 2GSIB 4U4IA 2JJTA 2FEJA 2L7JA 2IIJA 2XKUA 2VDQL 3EYOB 4GI9A 4KMLB 2JF1A 3E80A 1GGIH 2IANA 5T1MB 5FO7A 3L4CA 5HDQH 3PV7A 3QJTB 1R5WB 4FTVE 5JW4M 2AQQA 5CIPA 2AXFB 3MA9L 2J2ZA 5EA0H 2E9IA 5IEHA 3ALPA 3W11C 1FYTD 3EDKA 5GGUB 3S36L 1MJUL 4H4NA 3O6LH 3RX7A 1IAKB 2D7OA 2YRLA 5F7BA 3UH8A 3SOBL 3QZMA 3MRHA 3LN9A 4UQCA 2UZXA 3LZFH 2X4RB 5HTSA 1QBLH 1TQWA 5KANG 1G6RL 2HRLA 3AM8C 4ZX5A 4Y16A 3N42B 4RGOL 5D2LB 3ZDYB 4C83B 3GJEB 4KK6C 4HCRL 3SQBB 2QVIA 4GKZA 4DWHA 4LVOB 5I2IA 5B7EA 3OJVC 2GT9B 3LB6D 3I6KA 3LZQA 1TEYA 1HWGB 3MNWB 3PP4L 5GJTL 4LOVA 3MUGB 3C6LA 4Y9FA 2BOLA 2ICEC 1B0RB 1F3DJ 3CFJB 5I5MA 1U8KA 4ZQKB 3RTQA 5I0WA 3OJ2C 3RL2A 2CNZA 5TDOB 3O45B 4XMLH 4MJJA 2WWNA 4F7CB 3P4OA 3LNFA 4G11A 5FW7A 1BD2B 3MV11 2C1PA 1X5HA 5BZWA 5BOJA 4NKDB 4OIBA 4QXTA 2DRUA 4JG5A 1WBYA 2W07A 3WELA 4RNRA 3H54A 4R2GB 3ULUC 3R18A 1N8OE 4GSRA 3UZEC 1A4CA 2I07A 2FECI 4KX9A 4JL1A 2RFXA 1QABA 3OLEA 5FFLA 1D5ZA 2NY6D 2WLLA 4LASL 3FDWA 5GS2H 1A4BA 5F71A 3ULUH 1HFUA 3VXNA 1DJSA 1M7DB 2OI9C 3MREB 4HMDA 1HILA 3F7KA 1KJ3L 3BFQG 3ZMEA 4AV4A 1UH4A 4IS6A 5GGVH 1NIBA 1MCSA 2WXNA 3B2MA 3O3AA 1BF5A 3ZIMA 4A04A 2AXWA 3ILPB 3GMMA 3QNFA 4EEEA 1SVCP 5L2KA 5SWZD 2EDNA 1EFXD 4E42B 1LO5B 2OLDA 3ZRCC 1EAPB 2BHZA 1AQDB 3RVTC 3WGVB 1TJIH 1IT9H 3BYYA 5JNYB 2QPSA 1M05B 2B1AL 1BPLB 1PW3A 5DEFA 4ZMNA 4I18A 5L9DL 1NPJA 4I77H 25C8H 3BW9A 2KBGA 5B21A 1UEYA 1P7KB 4FCHA 5TF1H 4CU8A 5A16A 2XG5A 1SEBA 1N70A 3TZVC 2FO8A 3NSDA 4Y4KC 3Q43A 5IMMB 5AW6B 1EBPA 3T5WA 3LVEA 3G5WA 4GKSB 4XP4L 3QUML 2BH0A 5EEYA 1LP9B 1KXTB 2ZKHH 3DPBB 4C55A 2RD0A 3VYNA 5F6IB 4U31A 1W80A 2HP4A 1MZYA 4OM0H 2CBMA 5DJZA 5C70A 5E6ID 1G1CA 3L2MA 2FUQA 3MUZ1 1G7IA 3NIDB 2B4CL 4Q0XL 3UBXG 5CSGA 5C0GA 1BM7A 3IDIB 4OLWL 3KGRA 5FK9A 2BHFA 4NO0A 5KVGE 3M46A 3CPUA 2BVOA 2Z34A 5DZOA 2ADFH 5LXVA 4BHUA 4WKXA 5LLIC 5DFVC 2X40A 5H4ZA 3SE8L 4Z7WF 2IPUK 4BQ6A 4ZUSB 2J2ZB 4KWUA 5IEHB 1LWHA 3BMVA 2DLGA 3FB8A 3WIHA 4PJGB 4Y5YC 3BZEA 2ED9A 4XNYL 1IBGH 2Q8AL 4J8RA 1JI2A 2E76C 3MRHB 2QEJA 2HTLC 1CDUA 2P52A 2IPUG 3C2AH 4Y7MA 1GIGH 3DLQR 1L3NA 4M1DL 3TH4T 1XB6A 4IIQC 4K3JL 4LPCA 4P9ML 3U6RA 4K7FA 1JPFA 4XCFH 4Z3IA 2F7IA 1KB5A 5JR1L 2EUWA 4JREC 2FTAA 3WFEL 5I2IB 4U2ZA 1V05A 1GZPA 2DLIA 3HJEA 3I6KB 5D6DC 1I3RA 4CL7A 4WSJA 3RWCA 3C6LB 4GLRH 4JFDE 3H55A 3KL0A 2BP8A 5F7KC 4FOMA 4F3FA 2QTVA 3RTQB 3RL2B 2VJXA 3BAEH 3BVNB 1BZ7A 3EYSL 3X1FA 2E4FA 1NLBH 3H0TA 4GS7C 1LWRA 3BDYH 1JPSL 1AS8A 4FQIL 2C1PB 4AIZA 1I1AA 5BZWB 3HZYA 1CFSA 4KZCA 3TX4A 1WBYB 5E7BA 5F88A 4H5SA 3DC0A 1TXKA 4HEPG 1LDPL 5E8OA 3PG2A 3E2HB 3KDMA 4RNRB 4U1IA 4XO9A 3D4CA 4PVMA 4WDIA 1J5IA 1LO4L 2RFXB 1R5VB 3QR2A 3QK0A 3DURA 4N87A 2WLLB 1NFIA 1D7DA 1Y07A 1TTAA 2ITDA 3WNMA 4MBRA 4PW9A 3OKKA 3P73A 5D7SH 4JJOA 1HILB 1UATA 2BVPA 2GB2A 1G4RA 1FBIH 2J20A 3QVAA 4IS6B 5FEBA 4JZOB 3O3AB 3SPVA 4LEOB 3VG0L 3BUYB 5ALBL 1XH1A 2YQBA 5EZIH 3IJSB 3PDOA 4LSQH 5L2KB 1VHPA 4AM0A 2VLKD 2ZOTA 4C57C 4QXVA 1UA7A 1BQLL 3AMKA 3PE9A 1D7FA 4XMPH 4FG4A 3UBXA 5DEFB 3MROB 2JI3A 4I18B 5HDWA 1GOHA 3HNTL 2XXGA 4P2YA 2H3NA 2TRHA 3BW9B 4PLKC 5A16B 2F5AL 3UEZA 1SEBB 2UX7A 3WN5C 2YAFA 3MJ6A 1J8HA 3IMWA 5LQBL 1C7SA 5D2NA 2X6MA 4FI8A 2VAJA 3MOBH 1UZ6F 1I1YA 1ZKAA 2A9DA 5GZNC 1FL3A 4JM2F 3VXMA 2NX5B 3WJLC 4GSUA 3IMUA 3EHBD 4XAWH 2X1OA 4Y4KB 2CO7A 2GJ6D 3HMWH 3PWPA 3S3BB 1DL7H 1F4YH 2X9YA 2GG1A 1E2VA 2Z0BA 2X89A 1G7IB 3SYAA 1KJ2A 4RSVA 2V5RA 1RJYA 3K6DA 5FK9B 3S5LA 5IZ7A 5J7CC 4NO0B 5DJ0A 2BVOB 3N0PB 3NPSC