4MZIA

Crystal structure of a human mutant p53
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
193
structure length
193
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKFGTCTYSPALNKMFVQLAKTVPVQLYVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERSSDSDGLAPPQHLIRVEGNLRAEYLDDPNTFRHSVVVPYEPPEVGSDYTTIYFKFMCNSSCMGGMNRRPILVIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reversal of the DNA-Binding-Induced Loop L1 Conformational Switch in an Engineered Human p53 Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antitumor protein
molecule keywords Cellular tumor antigen p53
total genus 37
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4mziA00
1KZYA 3D08A 4AGLA 3US0A 5A7BA 3D0AA 3VD2A 2AC0A 3WTUA 2FEJA 3VD0A 3US1A 2WGXA 4IBZA 4GUOA 1T4WA 4QO1B 3QYMA 3Q06A 2BINA 2BIPA 1TSRA 1HU8A 3IGKA 4IBSA 4G83A 2AHIA 4AGOA 3WU1A 2IOMA 2J6WA 5AOLA 3KMDA 1GZHA 2J1XA 3EXJA 2OCJA 4LOFA 2J20A 3D07A 5AOJA 2YBGA 2BIMA 4IBTA 4L0ZA 2XWCA 1EAOA 5G4MA 3WTXA 4IBUA 2J21A 3EXLA 5G4OA 3WTYA 1CMOA 1TUPA 4HJEA 4IBVA 4IBYA 4MZIA 2J1WA 3Q01A 3WTTA 2ATAA 2IOOA 3KZ8A 4MZRA 2RMNA 3WTSA 4KVPA 2ADYA 5LGYA 4AGMA 1IO4C 2IOIA 5AOIA 5ABAA 2P52A 4AGPA 1HJBC 1EANA 1YCSA 1UOLA 2X0WA 5ECGA 3WTVA 3QYNA 4LOEA 4G82A 2XWRA 4IBWA 2J1YA 1E50A 1CO1A 2J1ZA 1GZHC 2MEJB 2X0UA 3VD1A 3WTWA 3TS8A 3Q05A 5AOKA 2H1LM 1LJMA 2BIQA 4XR8C 4L0YA 4L18A 1H9DA 1HJCA 2VUKA 2BIOA 2PCXA 4A63A 3D09A 3D06A 5KBDA 4IBQA 1EAQA 2X0VA 4IJTA 5AB9A 4AGQA 4GUQA 5LAPA 5BUAA 4LO9A 3ZMEA 5G4NA 2GEQA 3D05A 5AOMA 4AGNA 3IGLA
chains in the Genus database with same CATH superfamily
3TASA 3MRRB 2WB1A 2YSSA 1KIUA 3OXRA 4P3CH 4Q9RL 3DUUA 1SJHB 5DQ9B 4XNUH 3NIGE 4CMHB 5CIPA 1S7SB 3E7JA 1ZLWK 1YJDC 4PGEB 1YNLL 4G8EA 5F7YC 2AJZA 2W0FA 1T2XA 1S3KH 4TOYH 1IGJB 1M57B 4ZO8A 1GGYA 1T5WB 4Y8AA 1A47A 2NLJA 3TJEL 5DVMA 5E2JA 2OYMA 2Q7YB 3RKDC 2MNWA 3NCEB 2CO2A 2HKAA 3IFPB 3IFLH 3BPOC 3C6LA 1I8AA 2DRUA 3LXBA 4BSVA 3FPXA 4LKCB 3QZWB 3MLUL 5MENE 2K6YA 3ZQXA 2EIZA 5BV7H 2GSIB 1PYWB 2YBGA 3L6FB 2YRZA 4HXAL 5K9KA 1MHEB 1F4YH 1OCRB 3DECA 3GRWH 2CLZB 3P3TA 5DD3H 5B7EA 3EG9A 1F1AA 4FA8A 4ZFGH 3U0PA 1CZ8L 3L3KA 2UXFA 2E7CA 5FF6A 4XVSL 2GFBA 5HGAA 1DR9A 2PPCA 1JGEA 1P0SE 3OKYA 4XNZC 4UTAH 3QXTA 4OJFL 3HE7C 5LDUA 4KKLC 3N1GC 3IJYB 2WQRA 3UG4A 4Y4FA 1I3UA 5HYJB 1DQKA 5EOCJ 4A7GA 5ESAA 2JELL 1F3DH 1J0YA 4L8SA 3F6JA 1NGQL 3FCTA 3RILA 3BZ5A 1NFKA 1F0LA 1JMXA 4PJ7A 4EI5C 1IBBA 5IWLA 4JRYD 1UADC 2IOIA 3EGDB 5BV7C 3FFCB 4LOUD 1IAIH 3DROB 1QX1A 4P2OA 4XNZB 5EB9A 3UTQB 1WBZA 5JNYB 2Y5TB 1TJHL 1VLXA 5E2WL 2J8UA 1GZPA 4YSAA 2GJJA 3S3SA 3RDTA 3CX5J 4GW4A 4PY7A 2C4FT 4YPGA 3TPUA 4Z77B 1PDKA 2IWGA 4WFEE 4ODVH 1F3JB 9PCYA 2DMBA 3EOBB 1PPIA 3VFPA 4PG2A 4G8GB 3FU0A 4MMZA 5KEZA 2VISB 1GTNA 5F6IC 2E8YA 3L5WB 2H9GB 4R96A 4V2CB 3OHMB 5AD0A 2O93L 1MXGA 4A7TA 5I0XA 1YQ2A 2FGWH 1IM3A 1UWEL 5C0CB 2J2ZA 4NQEB 1ZJAA 5KVGL 4DKDC 5D2NC 2H5UA 2BCKB 1EVTC 4XCFH 1MHCB 1KJVB 4IRSA 4OZHE 2P5WD 3HB3C 4GRLA 3ZOAA 1SXBA 1XSIA 4XVOA 5GGTH 4YHPA 4K3JL 3KGSA 1UD8A 3HFML 3O3EA 4NBXB 4NZFA 1Z6JT 2B4CL 3RJDA 1KJ2B 2GUYA 3AG3B 3MLWL 1FDLH 1WBYA 2BWDA 4GMSH 4A2DA 1MFNA 3S8WA 4AITA 3FFOA 3MNWA 1NCAH 2ALAA 1EXHA 4IBZA 3P02A 2Y23A 4ODTH 4JUTA 4NO3B 4ATTA 1SN5A 5T3ZE 5ICYA 3ISYA 4G80B 3NG5A 4CVWA 1DVZA 5E5MB 4YXLL 3O6FD 4G6JH 4OT1L 4AVJA 4EXKA 4FQ1H 1PSKL 3FRPA 3I9IA 3VQMA 4EI6A 3GHEH 1ASPA 1NSNH 2A4CA 5CZKA 2A6JA 1K8DA 3QPQC 4PRBB 4XN8A 1WITA 3U6XS 1SEQL 2HH0L 1RH8A 1PQZA 1XQ4A 3FH8A 2BVOA 3MV01 1S5IH 2QVFB 3OGCB 1IQDB 3T04D 4F3FB 4ELDA 3I50H 5F9JB 1MJ7H 4QT5A 5CJQH 4N0CC 3DETD 5E23A 4IBYA 1ZOXA 5C9JA 1NCBL 3Q01A 3V7AG 3VXOB 4JQVA 4WWKD 1Q38A 2IOOA 2RB8A 4RFEB 2A73A 4NYLB 3C6SA 1V7MH 3KBFA 3QO1B 1DTUA 3GZPA 4AIOA 4UT6A 4OI8A 4KFZC 2HG5B 3OB0H 1FFRA 3F04A 4AUJA 1TMQA 4WCYL 4TUKH 4U6VH 3NCBB 4K8RH 5DDHA 2C3VA 1RZ7H 2P52A 2KHAA 3GUTB 1EDYA 3GDCA 4K5OA 5IJKC 3QA3B 3QR1A 4FXKC 1ZD6A 1XFPA 1TLKA 4MAYB 4AE1A 4HPOL 1O6TA 5JA8B 2D7NA 3HPLB 4CW1B 1YAZA 3H3PH 1BW8A 3II1A 5DFVD 4J8QA 3FAWA 4QTHB 4UM9D 5CLZA 2OMYA 1AGEA 4QXTB 3MRPA 4ZMZA 4D94A 1WHOA 4PREB 4U1HB 3WS3A 4ZZKA 4RH4A 5FB8B 3GMMB 2CK2A 4JCWA 2X4NA 4IJ3C 1IGFL 6FABL 4M93C 4YHKH 5EOQH 1QLEB 3IJSB 3W37A 3MJ8A 1MSPA 1T6BX 4KGLA 1FZJB 2VUKA 3CFBB 4H4NA 2UZXB 4OLUL 4DF9A 5JHDA 5BCAA 5L2KE 1WDAA 2WZPD 1I8MB 4BZ2L 4I1RA 3OQ3B 4HU2A 4KV5E 1QA9A 3NSYA 1MIEH 4H20L 3KXFB 1OPGL 4F8NA 1NGZA 3VI3E 3P4MA 5E6YA 1KBKA 2GJZA 5AVYB 2BS9A 4KJQD 1JP5A 5EU7E 2FBRA 5I6LA 4DEWA 2IJ0C 4Q74A 1IUZA 5DO2D 3I3DA 5I1AA 2O5NA 4BDVB 3ZMRA 4S0HA 2OYPA 1HQRB 2BP0B 2ZYRA 4R6UA 4F37K 1J0JA 2E9GA 2A99A 2Y7MA 1FL5B 1D5MB 4GUOA 1CDGA 1I1RA 4EF3A 4XXDB 2NNFA 3QHZH 4Y9EA 3V0HA 4Z7UB 3VXMD 3V0WL 3NJNA 4MNHB 4WFED 2WVTA 5BS0B 1D5ZA 4Y4KB 5IROD 1WFIA 4DN3H 5EA0H 5HYFA 1ANUA 4XMLH 5FM8A 4MA7L 3W11C 5CBAB 4GBXC 1FN4A 2PKDA 4MNGA 4YHMH 1E5YA 1F6AB 2ZWKA 4OF5A 1EAOA 4CILA 3OKLB 4KNUA 4BZ2A 1PLGH 5E99L 4BWUA 1FE8H 1OHZA 2Q2EB 2ED7A 4JPVL 3B1UA 2BY0A 3V52H 4U1IB 1HESA 2IO5A 4PJFB 1UT2A 3O0LA 5AW7B 5E51A 1Z9MA 4I3GA 2IAMB 4IGBB 2HYMA 5IR1A 2IANE 3DLQR 3T8XA 3U82B 4UI2A 3SQOH 3RWJB 5CJXC 1ZT4A 3RDJA 2I32A 3IRPX 3B9KC 2PPAA 1U3ZA 2BC4B 5DLMH 4OD1L 5FOBA 1L4IA 4XBGB 4AYGA 4RMRA 3UJIL 3VFTA 5TQ2H 1PZ5A 3WYRA 4F7PA 3EYQD 4POUB 3MN8A 3NTCL 2G2PA 5KVEL 2WCGA 2BSEA 1K5WA 2AXGA 4HEPG 1QFOA 4NWTL 4Q9BA 4ORZC 4N68A 1RIVH 5I1GL 3N5AA 4GP5B 3LIZA 3S37H 2EZ0D 2X1WL 3LN5A 1DE4B 2NX5D 4YVNA 2BNRB 2WP3T 1FRGH 1FZJA 2AJVL 2LHAA 3BWUF 3BP4B 3ZZSA 2CG9X 3KPMA 4LSRH 3JWDL 4F91B 1A3LH 2NNXA 3L08A 3NEEA 5K93A 3SN6N 1UZGA 1ZT1B 3FSWA 2F1AA 3H7BA 1CFSB 2DLEA 3VFUA 4IRZA 4QGYA 5FW8A 3RL2B 4JN2A 2NY0C 3IFLL 3DDFA 4BCZA 3D25B 2BVTA 4ZUWB 2VR3A 3GEFA 5DVLA 4TQIA 1XF3B 2WQ8A 2OYLA 2ZYSA 1U30A 3L3OA 3V55A 4V33A 5D7JC 3QRFM 2QQLH 1CK0H 2CHNA 1ODUA 4GKLA 3SYPA 2QVKA 2DM3A 3DUUB 3SDYL 3BUQA 5T5FL 4C83A 1O6SB 1EDHA 4NFBA 2VDMH 3ZT7A 4I0PC 3D5OF 2Q20A 4DP1X 1XGQB 4DPBX 2G4GA 2X4PB 4PG2C 4O2EB 3CFEA 5C0AD 4L3CB 2J4WL 5GGVH 3WY3A 4YEEA 3KMDA 2J6WA 4YX2L 5J1AA 1DEEB 3GSXB 9CGTA 2EYTB 2J1XA 1C08B 1YECH 4UV7H 2NTFA 1K5NA 1FYTD 2JXMB 3L9EA 1S7VA 2F8OA 4Y19B 3H9HB 1FFOA 3C09B 2D3JA 3DGDA 3V4PL 3FF8A 2VMJA 3MRBB 1UD4A 4U3XA 1MLCB 1AR1D 5BUPA 1MQKL 2X05A 5T3XE 4PGZA 4O58H 3O6FC 3LNIA 2BP5M 2AJ3A 2EAEA 3NCJH 4AL8L 2ENQA 1S2EA 1U6AH 3K6NA 5C0RL 1LK3H 4O51B 3OF6D 5DVKA 4ZTPH 3ZZLA 1N5AA 3LNHA 3NPSC 2P5EE 3NCCB 4W4OA 4RMWA 5EU4B 3FS9A 3NRFA 4NI3A 4XP1L 1NAMB 3SDXA 4U6HA 3EYOA 1OF2B 1GGIL 2VLKE 2EDWA 1OHQA 2I07A 1U8LA 4GBXB 1DQQA 4WKXA 3GYRA 3AXHA 5ACLA 4XP5L 5KYYA 2VDPL 1AQ8A 1WG3A 3S3BB 1YSOA 4AM0A 4P2QD 1NMCC 1BIIA 4Z0XA 1AQMA 4MDIB 3T6WA 3GIZL 5CCJA 3BGMA 3EUUA 4HWUA 4XN4A 1F2QA 2V5YA 1E43A 4L29A 3S35H 4QRPB 2XDHA 1NTDA 5TE6L 4XNYL 1U8OA 3VSUA 3GXFA 3N04A 3BQUD 5ITFA 2Z31C 3KNBB 4MXVF 3NIFB 4XVJL 1C5DB 1DYZA 3VFVA 4YDNA 4D9LL 2KDYA 4HIJB 1EHAA 4XVUC 3PAUA 4JFDB 1TEFA 2W0LA 4R7NB 1J9QA 2W60B 2V17L 2JK5B 4D0BB 4N28A 4CC4A 1F1DA 1NCCL 4BM7A 1T3FB 1KXTB 3PV6A 3WE6A 2IGTA 1F4XL 2EC9U 5AAMA 1L3WA 5JNYA 1XGTB 2QSQA 3QEUB 5IHZB 5FLUA 1TU2A 3T3PE 4N2HA 2J8UF 1AZUA 4Y7OC 5HGGS 4P2OB 2V8LA 4XCYB 5C0GA 2EO9A 2Z7YA 5LLIC 3DX8A 4P4KC 4XBGA 1KCRH 1VEPA 1YYML 3FT2A 3QUZB 5EZLB 3WKQA 3PABB 3ULUE 2OXGB 2QQKH 1QSED 5C08B 5I1IH 2NR6D 4QO1B 2Z4TA 4XHQA 4OJCA 4ZO6A 2NNRA 1ZLSL 2DQTL 4X8XA 3N9GH 4W81A 1FNGA 5JW4M 5D1XC 3KJ6H 5IBTL 2DWDA 1J0HA 3QPKA 1DVYA 2PXYA 4LHUG 5E4OA 5DVOA 4XVSH 1MHHB 1L0PA 2FZ3A 5CKAA 2WQSA 5BO1H 4YOKA 4KX7A 3ASOB 1Y18A 4PRDA 3KPOA 2VW4A 5JO5A 1C8QA 3MA9H 5C6WH 1F02I 1YYMH 5GGRA 4KPHL 4TSAH 3GINA 2X2JA 1J7VR 4IBUA 1KXQA 1HI6A 4WO0A 5A16A 5DO8A 5T5FH 3QORB 1T20B 1A7OH 4G3YH 7PCYA 1W8EA 1P84K 1LMIA 1NGYA 2DLIA 2DQFA 4GS7B 4PFEA 5ADOH 1Q4NX 1T1YB 2BSRA 2NUPB 1A0QL 2OL3B 3WIHA 3QDMD 3W0WE 4FNUA 3PFUA 1MPAL 1OP4A 2Z8WC 4MCZB 2IAAC 4L8DB 4QHNA 3GPEA 5SWSA 4R83A 2P5WA 3W5MA 4MQTB 3MLRH 1MREL 3PJSB 2EACA 1J8RA 3VNYA 4URKA 3X13A 2F74B 5B4MC 1WT5C 3GMNA 4PJDB 4JQIL 3ARFB 4JHBA 5A2BA 2VLMD 4ZFOA 4N9GA 1HILA 3IXTA 1ZPLA 1HZHH 1XB6A 4NJ9L 4G7RB 3MLVL 4CU8A 1P1VA 3OPUA 2R29H 4Z7VE 2CLRA 1T0MB 2ZUWA 4G7QB 3G5ZB 3LEVH 4QTIH 1NIAA 4KJPC 1NPNA 5FM4A 4JZNA 2AKRA 1Q9LB 1MAJA 5ADOL 1WPCA 1TTCA 4YAQA 5FUCE 4LASL 1COBA 3L3OC 1JK9B 3VFSB 4AYEC 1JZ8A 2CJUH 1M2OA 2X38A 1C5DA 1S8DB 3LRHA 1IAII 1MEXH 3HZKB 5CXPA 3VWJB 2DICA 4OGYH 2XWBB 3C5ZA 1IBDA 3UBXA 1F86A 2CR0A 4YR6B 5C0RH 5CFAA 4L3EA 4FXGB 3WEMA 3FDWA 3I2CL 1RZ8A 1UJ3C 2PYFB 4G6KH 4OM1L 1G9EA 4PVLA 3E6HB 2ZAHA 3GD1C 4RGND 4B50A 3UG3A 3SJVE 4FFYA 1HX0A 4KTDL 4MMZC 4PCKA 1QQDA 5AZEL 5I75C 4FQIH 3QZBA 3BEVB 1K6QL 1P4IH 1VENA 2B5IB 2WQVA 2A74A 2JCCF 4S10A 4R5VA 5JW3H 1I3GL 2CO3A 4YHLH 5AYTA 2XT1B 4L48A 1YEDA 3EYSL 4JFFA 2HN7A 2VABA 3FHEA 3OC5A 5D1QE 2JB5L 5DJDA 4JO1L 2BSED 4IMKC 4LF3B 5ALBL 1QYGH 2X6AA 4IRJA 2VDLB 3ESMA 3FL7A 4OZ4B 4L8CA 4HXAH 2N4IA 2A2QT 5T1DL 1KPRA 2BW4A 1DVFA 3AADB 3BUIA 4LLVB 1LHZA 4NO5B 4IMLA 4JX0A 1OGAA 4OLVL 4K9JA 4PJAA 1KGXA 3QUYA 1TYEB 4XO3A 3IGAA 3M17A 2XN9E 3UFIA 4ZMXA 5EBWB 3RI5K 2AK1H 4M62L 5C08A 3HE6D 4QO1A 4U7MA 1PKQB 4FX5A 1MJJA 2LGNA 5I73B 4TQEL 1HOEA 1PL3A 3LPOA 3OGCA 4HV8A 4JO3H 3QH3B 4PTTB 1QWUA 3P9WB 2R4SH 5E99H 3ECBB 2NY6C 4NN7C 1GMEA 1MY5A 1S9VB 1CT8B 3FB6A 5HVGB 1FVCA 2W60A 4U3HA 4D0BA 4EIUA 3E9UA 3RX5A 4OBRA 1H0DB 3ULUH 4QRRB 3L5JA 5FYJH 2H6OA 1VA9A 3M7FB 1C1EH 4R5XA 4RZCA 4Q14A 4LGRB 4WENB 4PY8J 4DO6A 1UXMA 1A1MA 4XCEA 4LPTA 1PZUB 4OCYH 1UXWB 2OM5A 3MVSA 1R5IA 4JFFD 3S0PA 5FGRA 1IIIA 3LHPH 3WIFB 2KKQA 2EVHA 5E00A 2OR8A 4D3CH 3ZRCC 1ZLDA 2Z8RA 2ADGA 3CPLB 3QUXB 2L7UA 1BAFL 4GO8A 4PJBE 1ZHLB 4D9RE 2CJSA 5DF0A 1OQOA 1Q94A 3V4LA 5IQLA 3G6AA 3F7VA 1OCOB 4LOUC 5L7XL 3DHPA 4YAQB 3WY2A 4YFLI 3V7MA 4ZW6A 4APQD 5GGRB 1P7QD 4XPGH 4U1GC 1MFEL 4LCWD 5IFAH 4O4YL 5FDWB 3T3PB 2XRAL 4NQTA 1NEZB 2F54E 2IVFC 4F5CA 3B7SA 5AOMA 4YO0B 4F8OA 3MFFA 4NCC2 2ZKHL 1E5UI 4X5XA 4KXBA 1YECL 5CN3A 1EEYB 3QS2A 5LN4A 3BDYH 1CE6A 1JXKA 2VLRD 1ID2A 3QJRB 3FTYA 4PJXF 4LLWA 3ZUCA 2QJDA 3RFRA 5HYJD 4N1EA 4EXPX 4IS6B 1AANA 2QPSA 2R1WA 3EJCA 5BZWA 3BCDA 4EDWH 3DO7A 3NOIA 1P4LB 5GJTL 3REVA 1SMAA 2WGXA 3SDYH 4HOWA 4PGJA 2ZD0A 1QR1B 4N90D 1XTLA 2GUOB 2G2NA 4HWBA 1S4IA 1JSYA 3QP3A 4FFZL 1P7KB 4KI5C 2FEEI 1YEJH 3UYOD 2HFGL 1SUJA 2UY6A 2BS71 4PJFA 4MSWA 5HBBA 4AMKL 3UJIH 5KVDE 2NY6B 3CFEB 1QP1A 3D3VB 1A4BA 5IVNA 5DS2A 2MH4A 5HJ3A 5I76A 3BHBA 1W72H 3HNSL 4K23L 4QCIA 1NGXB 1AD0A 1R4XA 5C0FA 3TBTA 1AZRA 4Z7WB 2V9RA 3I6KB 1ORSB 1KIQA 2KERA 7FABH 5D96C 3QNZA 5AUMB 1UWYA 4Y89A 4JPKL 2ARJA 5GZOC 2P80D 3BP6A 1CI3M 5HYQA 3QORC 3D25A 1SHSA 3BJ91 5ISZD 1EQWA 4ZPVA 5E9DB 2H26A 4PUBL 4CSPA 3F7LA 5I2IA 3JSSA 3WUWB 4OZGE 4CC4C 1BXVA 2R2EA 4LPUA 1FZKB 4IHBA 1HXYA 4RIRA 5DJCB 4EJ1C 1AGFB 5KVEH 2ERJC 4LLYA 5IP4A 5E56A 4HJ1A 1EFXA 4FFVD 4N1HB 4BFEA 1UOLA 3BMVA 3RWJA 2VLJA 4UCFA 3KPMB 1CC3A 2BSBA 2R2CA 2KYIA 3WFBH 4GW5B 5C86A 3U36B 4UNVA 3H3KA 3FXIC 4AZ8B 4XPAL 1DJZA 2CDFB 4I18B 5I8KH 2YXVA 4GKZA 4ANVA 1WTLA 4JM4L 3B56A 4HH9B 3TX4A 4W9IC 3FYIB 3JTSB 2LU4A 1IILE 1UFUA 1UOVA 4OV5B 5MENB 1IZKA 3ZE2E 3QIWA 4OFIA 1RUQH 2V7NB 2Y1AA 3MGTA 4M62H 4XVUD 4GRLD 4WWOA 3F7VB 3CX2A 3AT8A 3WNMA 1Z32X 3BD3A 3VSTA 4DOHB 2KPWA 1USQA 2CHXA 4BQ9A 1WGVA 5T3ZL 3EJYD 1U8QA 2FVNA 4JMXA 4PBXA 4P23A 1E90A 1PEWA 1Q1PA 3CSBA 1FL6A 3V0VA 3ENEA 2P80A 3CMOH 3GSXA 2Z3FA 4HXBL 3NP3A 3IWUA 2A1WL 5FA3B 1ZWIB 1AR1C 3UPCA 4Q6IC 1OEZW 2RFXA 5F7DB 3E2HC 2VT0A 3MLSL 3GC3A 3ZE0B 5FYJL 4AK2A 4Z5RB 4WLCA 1QNIA 3P0GB 2N7SA 4MCYA 3QUMB 4M1DH 1RLWA 4NNXB 3IGAB 3M17B 4YHKL 4FG2A 4V2BA 2SODB 5DMKB 3RUGA 4JAMA 4TPRH 4JGNA 4KZDH 4ONGL 2WSDA 3MJ7A 2CKNA 4LK4A 2AHIA 2PYEB 4TNEA 5FA4B 5IVZB 1K4DA 3CZEA 3GS7A 1VAHA 3OM3B 4WJ5B 3KJ4B 3SBWA 4NIYE 1XXFC 4X9IA 1DVXA 3BKMH 4KZEL 3X1FA 1CXKA 2AQ3A 3GZKA 3MYJB 3RB7A 2WLHA 5JLZB 1N7MH 3AU1B 1ZV2A 2BP8B 2VXVH 4WUUE 3PWLB 1E2VA 4ZYKB 4Y2DA 1M7IB 2DLGA 1S7QB 3KXFE 1AZZC 1PFOA 3OXSB 3EYVA 2VAJA 3HNVL 5AL8A 4X8JB 3UAEA 4AXWA 4D0DB 3QRBA 3CZKA 4H8HA 1DFBL 1HHJA 2ZG3A 1FGVH 4W1TA 1CFVL 4QRAA 3P0VH 4Y16A 3PGCB 5KANG 2AK4A 4BQ6A 3ZVVA 2FX7L 2YKKA 2ZF9A 5C71A 1OB1A 5DK0A 4X7CC 1Q94B 3ZKNC 3IJ9A 3MGOB 2O5ZL 4HAGA 5KAQF 4HS3A 2PP9A 4KK5D 3BAWA 5K9JH 3L1FA 4X6CA 3AY4A 2X4NB 1JK8B 4NLHA 4PJAE 4X5PA 2K8MA 3IS1X 4G82A 2RD0A 3PWNB 2QR0A 4ZX5A 3VWKB 1MWOA 1L9RA 4NQQA 3RIFF 1V27A 2FLRT 3SE3C 5FUCC 4QTHA 4GJTB 1XCTB 1IJ9A 2H8PA 3MUJA 4CKVX 2R1XA 4D3CL 4L18A 4OJAA 4YDIH 3UTPE 4HISA 1IMHC 3ATAA 3QCTL 5FGCE 3FO9B 5GSRB 3UTPD 5BO1L 1Q9LA 4Y4KD 1BMWA 2WUCH 3HZMB 1DCEA 5DDHB 4LSDA 4Z7QF 2DQDL 4XXCA 3QNXA 1LD9A 3B8YA 4H7VA 4R7LA 4OM1H 4NQSB 3VRIA 5IBLC 5BXFA 5C0BB 2XZAL 3HUJE 1PX8A 3HAEG 4NC1C 4NAQA 3KXFA 2YO3A 3QDMA 2QGBA 5J12B 3S98A 2R8SL 3BT2L 1G7HB 4FZEH 4HJUA 2A6IB 2E7DA 1WAAE 2GIMA 4QYAA 5F0JB 1WD9A 1RD6A 1V7NH 4O02H 1KCVL 4IOFD 4PG9A 5H94B 3BEVA 1H3XA 1ZPUA 2H6PB 1G4RA 1TZHA 1HNFA 2FQDA 2ARJQ 1KTDB 3IJSA 3BGAA 3HC0B 3MLUH 2HJLA 1TSRA 1MFVA 2YXMA 2EH7L 1BGXL 3GMMA 1HL9A 1L3NA 3C60D 2HFEA 1Q90A 1CF8H 1KC5H 2IBZY 4UWQB 4Z78B 2ESVE 2W5PA 1BVLB 1HIMH 3D39E 2J6EA 1PZ5B 4RZKA 4UZGA 3O2VL 3QQ4B 4YH6A 1T5XA 3GS0A 4CVXA 4PWIA 2HPOA 4Y5YA 3N1PC 3RIAK 3TF7C 1AZNA 2G2RB 5DD1H 5L2KB 5GGRY 4ZS6D 3I02B 2WWKO 2VN7A 4J27A 4RGOH 2JLLA 2NRDA 1T80A 3QEGL 4GY4A 1NH6A 3LIZH 4XCCH 4Q7DA 4Z7VA 4JREB 3B9AA 4MQXD 3EOAA 2JKNA 2PN5A 4XXCC 2VMEA 3QH3A 4PTTA 2CGRL 5H37H 2FT8A 4IU2A 4EDXB 2DYPD 3HN5A 1A14H 5GPRA 2IWFA 1AIFA 1MRFH 3HMXA 1P7BA 5BRZA 4JLRA 3I2CH 4JANA 1PD0A 2BERA 3VFSA 4XAKE 1MOEA 3QBTB 4C59B 5JQ6H 4X6FA 3L1OL 5JW5A 3RAJH 4PJAF 4UOQA 4N87A 5B22A 4XVTH 3VFGH 2IV8A 2IMNA 3MGTB 2X70B 5EBMA 3SCMA 1T66D 3KPQB 3W81A 4NO5A 2J8OA 3DTDA 1D5BA 4H8PA 4FADA 5CEZH 1NGZB 2XQYA 1GAFL 3B6SA 4J12A 1IBFA 1GOGA 1R1CA 4FJ6A 4AL8H 5DUPH 4GKSA 3GSRA 2AXJA 1UACH 4D9LH 2DBLH 2EADA 1ET8A 2ZWYA 2OS7A 1WSST 3HTLX 3OJDB 4E9RA 1UZ8A 3OSVA 3HLAA 4Y19E 1L0YA 4JFDE 3LD8C 4PRID 1SJEB 1TCRB 5JLZA 2E27L 4LLMA 5HI3C 1MCFA 5I19L 1ADQL 4FXKA 4G11A 2QLYA 3G6AB 5CS7A 3EGDA 1Y7VA 1MJUH 1Q9OB 1L9PA 3WLWC 4GKNA 1KJVA 2ENJA 4QOKE 3O2DH 4FXGA 4QRBA 1HHIB 5KSAC 1NINA 2X4QA 1U8IA 2A6KA 3FO0L 5TPWL 5TH2A 1QSEB 2BNRD 5KSUB 1ZHNB 2CQVA 3QQXA 1AOZA 1HEZB 3DPBB 3QUML 1QLRA 4ZAKA 3WIIH 5EIIA 2AC0A 1IM9D 1NCUA 1U42A 3IDIB 4C4BA 5LNDA 4HCGA 4LLQA 4J3OF 4TOYL 1F8TH 4CU7A 3C8KB 1NA8A 1NOFA 1TZGL 4ELKB 2H45A 1DQTA 3UTZB 2CBMA 3UTSE 4CSSA 1LTXA 2JTYA 2WB7A 3C6LB 1E6JL 1CLYL 4PH8A 3JVFC 2VZ1A 4NZUH 4QPEA 3IVKA 5I6XC 4KUCD 1X9RA 2OXHB 1BYNA 1JNNL 1P5UB 3G9VA 5DHDA 1OO2A 3PGDA 5MHSE 4FFWC 4NQEA 5E08L 1U95B 1BG9A 5KTEL 1RZFH 1EJOL 2ZZUT 3QJHB 1HK6A 1MW2A 2AABL 1HSBB 3Q8CA 1FFOB 3RE0A 1KV3A 4Q6IA 2BS8A 4E0RB 2XZQH 4GH7B 3O6KH 1V5JA 4GG8A 3FCTB 4JQXA 4PJGF 1E2WA 2D9CA 3QZNA 2W8CA 2ICWB 2UUDH 5J11C 1YY9D 3FCSB 5GRUH 2V7HB 43C9A 3JWDC 4KUZH 5DFTA 2Y1VA 4JL1A 3HE6B 4HK3J 1E9QB 5C07B 1ETA1 3AWFA 3UTQA 5T1KD 3HZYB 2BNRA 2Y5TA 4JKMA 3DOSB 2BIHA 2JE8A 4ES9A 3FQRB 1MCJA 4UQAA 4JDZB 3CSYB 5EIQA 4MMXB 5TQ0L 4XWGH 3AXLB 4NT6A 2EE6A 3DUSB 2Y6SC 2JKRM 4FXTA 5K5YA 3ZDYB 3UCRA 2IMMA 4AQAA 3S34L 3QEGH 3L2MA 1PZCA 4OSUL 1QVOA 1T1ZA 3ULSA 2MEJB 3ZTCC 4WEUD 4JKKA 5IESH 4GP8B 4KQ4L 1QSFE 5AAWA 2E6JA 1QMUA 4NC2B 4WVRA 1A6UL 4X7SL 4IRSD 4WFHE 2DJUA 3IDYC 4HFWB 5D1QD 4G72B 2X40A 2HRPL 4X7EC 2YA2A 4RGNB 1OW0C 2DN7A 3VYNA 3MV7A 5A40E 2GIXA 5IHHA 3MO1A 3RIFK 4WUUA 3JT0A 4BFRA 1DQQB 5DK3A 1FZOB 4OD3L 3CSFA 3GSRB 1BHGA 3LPGA 3QR0A 1TG8A 3EYOB 1ORQB 3QCUL 3TN0D 1QPPA 4Y1AD 1L9SA 5T1LD 4Z3FA 5BV7B 1S5HB 2XN9D 3FTXA 3RZCA 1A6VH 4FQLL 5HTSA 1NL0H 4KKPA 4HCFA 5D1QB 5EUKA 5L88H 1RK0A 3IPEA 1MAMH 2XACC 1RY7B 1FA4A 4AH2A 1EV2E 3R0MA 5EU7C 3ERXA 2FWSA 1HEZA 4ZAKB 2UXTA 1K85A 2OQJB 3HR5B 5HHNB 1TZIA 5EU6E 2VQ1A 3C5JB 3GGWA 4R97B 3QIWB 4Y5YC 1IE5A 1V3MA 2UWEA 2B4CH 2K7PA 1IBHA 1PZDA 3JTSA 3TTSA 1B2WH 2DEXX 2HFGH 3W2DH 3FQWB 4F7EA 5F72S 1JWSB 4PRPE 4AQEB 1T0NB 4JPSA 5C7XH 1KPUB 4H26A 4J5VA 5JHLL 1F2XK 3MCLL 2WVVA 3DSNB 1E4JA 1E0OB 1CYGA 3KE0A 1RUAL 4KUCF 2WTPA 1W0VA 2XQYK 3ESOA 3T6XA 5CEZD 1HCFX 5DYOB 3U0TA 2UVFA 1RP9A 2VDNH 4U2ZA 3UO1H 1BVOA 1MCOH 4JFZH 4PJHB 1N4XH 2KL6A 2VXSH 3SCMB 1EJFA 4JJ5B 4XODA 4YVUA 1M7IA 1P6AB 4HKZB 2DJSA 5IV2A 4MMYB 1DQMH 4ZS7H 1QEXA 1DL7H 2Z31A 2XWBA 3C5ZB 3TEXA 4QWWD 3P0VL 1NC2B 1YMMB 5FYJU 1GPOL 4LPCA 2VXUH 4R26H 3HLAB 3T08A 3FCUB 4H0GA 2VDMB 2JI2A 2YAOA 4L1HA 2FX9L 2PCFB 1A3QA 1BFOB 1ACYH 3CFQA 2VR4A 3K1DA 2WSPA 5K1JA 2FL5A 3S35X 4D0CA 3WE6B 1G6RL 2HLFC 4MDRA 4U1MA 2ZWSA 3V4VL 4LVNB 1JXJA 3ROLA 1NQBA 4AYFB 3NACL 5HHXL 3KPNB 5DJ0A 1AO7A 5F3FA 4OCXL 1QPXA 4K0OA 3TC9A 3U7YL 5TTRA 4F20A 2PCXA 4Y0GA 5TGBB 4WKZB 2VLKA 2XPGA 4H88H 5HHOD 3DXAD 1ZTXH 1IAKA 3PIQB 3RWIA 2QDWA 3QUGA 2Y4SA 3LKQB 3D8MA 3S36H 1DJIA 5EF3A 35C8H 4NN5C 3OBAA 3QPQD 1KGJA 4JN2B 2AQ2A 4NC1E 1I9JL 1TZAA 1AP2A 1WZ1H 1Q8MA 3VGAB 1G6RH 2HMIC 3QIBB 5LAXA 3VXUE 1TR7A 1G0DA 5BO0D 1M7DB 2DL9A 3G08B 4BDVA 4OCXH 4LLDA 4FI8A 3QFDA 2Y06L 3L1EA 3MLSH 3QS3A 1W6WA 4A7QA 2VDOH 2FEJA 4JG1H 4PJDE 43CAA 2CR6A 3WUWG 4DP2X 3MDJA 4NN5B 4NXSA 4TUJA 3IJEA 1CJYA 5IT2H 2BVEA 1G9NL 2OCCB 2NY3C 3HCVA 5E8DL 2APTA 2V2XA 2ZCZA 2W95A 4JPIA 4BFJA 3FONB 4PS3A 1F6LL 3VTMA 3F6IA 3CVBA 4K2UH 1DVSA 2VR8A 2P9RA 2EDEA 3OKDB 5I1EH 4QRFA 1R5IB 4XI5D 2DTML 1NAML 4WK4B 1FLRH 4JVWA 3E0GA 2B0SH 1I9JH 3DWTA 2OI9C 2OR9L 2ZOTA 3JVGC 5I16B 4HUXB 5DK0B 1AGBB 1BJMA 3ARZA 2BZCA 4E68A 1NJ9B 4S1QL 3SDAA 4DQOH 1WZKA 3EOTL 1QATA 4X6DE 1G7HA 4JK0D 4ZUVA 2ED8A 3QJVB 5BXFB 4N0YH 4JKPH 4BH8A 1KB3A 4BSWB 2QKIB 3K0WA 3LRKA 4KTYA 1KTCA 2GTWB 5D1XE 3X14A 5L8KB 1CXHA 4WTZG 5I17A 3UJJH 2VKXA 3AS2A 3ZDYE 3MNMA 5J7CC 1ZXKA 4ETQB 5GSRA 3WDIA 1KJ2A 5J6GB 5JIDA 4XO4A 3LPPA 4UILL 2VDLH 1V10A 1FGNL 3AS1A 5ICXA 1ZRUA 4I7ZC 1U8MB 2CDEA 1K8IA 1H9VA 1P4IL 4KMLB 3NJVA 5AOZA 3K6SA 2V3DA 1IGCL 3QWNA 4MAUL 2QR0B 1O9ZA 4PBWD 1TSHA 2J2ZB 2B3IA 3IU4H 1JPSH 3FBQA 1UASA 3RX9A 1RSYA 1OPOA 3EW3B 4G5ZL 4K9EC 2Y7SA 1OWWA 2DMCA 3DVNA 3GXUB 3ILPB 3L5HA 3H7LA 4PS7A 2VISA 5FPIA 2C7FA 3NDZE 4FQ1L 1LP9E 4JFFB 1F4XH 3N42B 4CMHC 1OSZA 1T2QH 2JQMA 5CEZE 3H56A 5TE7H 3CFCL 4GFXA 1CR9L 4HUUA 3IDJB 1EGJL 5B39A 1CE6B 4BZ1A 2AK1L 1ED3B 4ODUA 2DQEL 1CD1B 3PL6A 5J13B 2IAMC 1KXTA 3PV6B 4IGBC 5KAQG 3O9WD 4JDEB 4P2QB 1EHXA 4G43B 1CVSC 3BH9B 3U48A 1MCQA 3EJTA 5EPMB 3FB5A 1BPVA 3L3KB 1TETL 3QG7L 5C0AA 1U58A 5C0CE 1U33A 4CMMA 3D39A 5K59E 4O51A 3CCHA 1BZ9B 1BQLH 4CGTA 1BV8A 1MVUB 4ZNCD 3BAYA 3BKCL 3HVNA 2YD9A 3ARVA 3VXRD 2ZXBA 4JGMA 3RWEA 1TYRA 5IMOB 2IQAB 1NCHA 2IH3B 5K33A 3WO4C 5ITFB 5C2BH 1ZS8A 1ZVNA 1HXYB 1FSKC 2OP4L 4RIRB 1AHMA 4H8WL 1KULA 3P1VA 1R5VB 2VRQA 1E3XA 2R2HA 3F6LA 1DBKL 1J18A 4NQDA 3QB7C 4PJ6A 2BOLA 4YQXL 2KZ1B 2KH2B 4YE0A 1ZGLA 4ZMPA 4BH7A 3S9DB 1JTPA 5F7KC 4J3OD 1ORSA 4AZ8A 4KHTL 3QRLA 3UEQA 5GS2D 4DKFL 1B90A 2Q76A 3HUJA 2QGCA 3D50A 1L9MA 3TCTA 1UA6L 5HJ3B 5KVGE 2DM4A 3KH3A 2CE6A 5HYSA 4JHAH 1FHGA 4PY8I 5D1XB 3ARQA 1NC4D 4XC3L 2GT9A 4O2FA 2I07B 3ZQWA 2K6ZA 2XNAB 1AACA 3GMOA 4KMTH 2EUVA 1KEGH 1PCSA 2YKLL 3MRGB 2Z92B 3KS0J 4LNVA 3HZVA 4XBEL 4N1CA 3RL1A 2GUOA 1PZBA 5I5MA 3LIUA 1UZ6E 2E9WA 1SYVB 2V9QA 4XNAA 5CBEA 2FJSA 1F00I 2VXSL 3QAQA 2Z91A 5DJCA 2NZ9C 2WHVA 3AITA 5JR1L 4U6YA 1Q1JL 4LCYB 1SYSA 5FO7B 1N26A 1JZFA 1OY3B 2UWEE 2Z8SA 1YN6A 2D7TH 3O11A 3II3A 4HJ0C 3TO2A 1FZMA 3MC0A 3MLRL 5IROC 3FONA 2QQNL 2WWOA 2X9YA 5CP3A 4BQCA 1KGYE 4GIAA 1ERNA 4KO5A 3QNZB 2ZWNA 5AUMA 2EDBA 2CO7A 4L4TE 5EIIB 1AZCA 5BJTB 4W4NA 1XGPB 3AGVA 1KY7A 3QQ9C 4R4BB 1YEJL 2WW8A 5CGTA 5DVNA 4Z3EA 3WHE0 1C8PA 4NQVA 3GMPB 3C2SA 1XH3A 1KTKE 4LLDB 4F2EA 2EEFA 2VXTL 1MI5E 3EHBC 3QEUA 3O4OC 5E70A 2UY6B 4I0KA 4F57L 4PGBB 5DUJA 3LS5H 2ESVD 4NPJA 4LEXL 1XR8A 3QC6X 3V9EA 2OMZA 1FFNA 4Z7VF 5JIQA 3VDCA 3VGFA 2HZHA 5BVPL 2AEQL 3W9DA 1BJ1J 3QYCA 4UU9B 1D5IH 3ARGD 5L88L 4Q0XH 3P9MB 3DJRA 4GXVH 2FO1A 2PW2A 4ONHA 3V2AR 4Y2LA 1MVUA 2MWCA 4JFOB 5DJ6A 3SGJA 2QQKL 4KK8C 5C09D 3VAEA 2C1PA 1URIA 2JB6B 2AJXL 1UYWL 1BQUA 5D7LA 2IH1A 4I88A 2ESVB 2HUHA 3NTCH 3IKCA 3DX7A 1RZKL 3CK0L 2ICWA 5EDXA 3GZOA 3NH7L 3T65A 3R06B 5GGSA 1GYAA 4AMXA 4RWYL 5BS0A 2DLFL 2WVUA 1KB5H 4HUNB 4NQDB 2YAPA 3AWGA 2HB0A 4XE0A 1X5JA 1WHPA 1OD7A 5AKTA 1E67A 3II2A 1DJWA 1DJGA 4L9LC 4LVHC 1S7SA 2YGVA 1UM5H 4ZDHA 3L2LA 1HOCB 4KKRA 1QQDB 4UM9A 5GS1B 4JFHD 4UQ3A 3AWEA 3OWRA 4PJ8C 4PJCA 2HVKA 4KY1L 1OOWA 4MA1B 1KNOA 4UQCA 4ONFH 5AWNL 2IDQA 1A7RL 1T4KA 3BXNA 4G43A 3BH9A 5TQ0H 5E6IA 5ID1A 4QKTA 4OUUB 3QIUC 3HJEA 2TSAA 2HVBA 3F7QA 3U0TB 5DMGD 3D0VB 3QIUA 2LV4A 4Y2OB 5HPMA 4QRUB 4Z95H 3DI3B 2J7LA 3UO8B 3VJ6B 3ETTA 3SGKC 4YS4A 2Z6FA 4G8FA 1MHEA 2IPUG 1UXSA 3QXWA 1ZXQA 4LAQL 4L3EE 2BC4A 2ZUYA 4FAAB 3E1F1 4HT1L 3KPSD 1NCNA 1LWHA 4NS0A 4HUCA 5DSCA 4ELMA 4DP0X 4FLOA 1ZEAH 3PYCA 3NCFB 5HI5D 3QI9B 3MJ9H 5I8CB 4QRTB 5AB0A 2JJUA 1A3RH 1LO0L 5EOTA 1HXMA 2YRPA 3CSTA 1MCWW 3GSOA 2E56A 2ZJSH 4EKXA 2H1LM 2QV4A 3HR6A 1KYAA 1E6OH 1D5MA 3SHSA 1S8DA 4F93B 4XR8C 2VE6A 3NN8A 1ZCRA 1MI5B 1QFWM 3O3DB 4JHUA 2NQCA 3JZ7A 1B0GB 3NCJL 3OXRB 2FB4H 3TJPA 3GMLB 3GI9L 1USZA 4OFYD 3QUYB 1U3HD 1YYLH 2C1OB 3G5VA 4N5EC 5CJOL 4AEIH 4QR7A 2VDNB 3QJFB 4OM0L 4X5WB 2P47B 4WU7B 3ZO9A 3IE4A 3CLFL 2F5BH 3VI4E 4D8PA 4WO4B 5EO1A 4GUPA 4HV8B 4YGVB 1LO4H 1LO3H 1T89C 2IPTH 3REVB 4L4TD 4G6KL 5I8EB 3H54A 4XMWA 3DK2A 5DZOA 5T3ZH 5H37A 3LN5B 5GZNC 2KDGA 1YC8A 5I24A 4PJAB 3C75A 2QHRL 3WKMH 1EAJA 1RZPA 4M8UA 2FLMA 3V52L 3S48A 1AIZA 4DO4A 1DDTA 1KJ3H 3F84A 3EXJA 3GJEB 5LN8A 4FS0A 4LP4A 1RFDH 1ZTMA 3RWIB 4DPAX 2B4CC 2QBWA 3VWJD 1DQJA 3O8XD 2MTPA 2PR4L 2L7QA 3OV6A 2I9LA 1AY1L 3HI5H 3MBEB 3THMH 4WTWA 3V5HB 3FMGL 5IVXE 3E1ZA 5K1VA 3CFDA 1ZVHA 3E8UH 4NKOB 4EI5D 5LAXB 5CLXA 4YDIL 1AYRA 2FEDC 4R7NA 1T4KB 1A5FH 4CVUA 1QSFD 1GJWA 1KDIA 5DMIL 4PIRF 4DEUA 5D7EA 2BCKA 1IIKA 2B3RA 5F3HB 1M2VB 1NLDL 1G0XA 1X5YA 5GS1A 1KB5B 4PG9B 5H94A 3TA3A 2G0KA 3TNNB 1UWXK 4YDZA 4HC1H 1WEJH 5T1MA 3EFOB 3QUMH 1NC2A 4GQRA 5DGQA 5DR5H 4MAYD 3DVIA 4XN5A 1JNJA 1E5AA 2EDYA 4RBPK 5KBPA 4G9FB 5D70H 5E8EA 5IB5B 5E4IA 3DI2B 3OJVC 4KRPC 1QSFB 5IW6B 3NRQA 3P0YL 5KVFH 2DD8H 5EV7A 4FZEL 4B9CA 1SVCP 1P7QA 1TQVA 3LB6C 3DX7B 3L5XH 1R3LB 5IB1B 2DQ6A 4PCYA 4MAUH 2W9DL 3PQYD 3R4DA 1CGUA 5LXVA 3HPJA 3CZSA 4E42A 3Q05A 5KZCB 2YWZA 2HVJA 4WU5A 4X7FC 3UTZA 1O6SA 3IDGB 5KWYC 4R3SA 2D7QA 2Y36H 5AKRA 4IM8A 3NN8B 1LLAA 5IBTH 1X5HA 4IBQA 3T4AB 2GHZA 4NPKA 4UU9A 5JTWA 3TEWA 1U8LB 3U1QA 4ODSL 5BUAA 5AVRB 2OW7A 2Y6SD 4GI6A 1RI8A 3Q1EA 1JF6A 4DEPC 2UVEA 3FTVA 3M1BB 4JPIB 2NY5H 4KROC 2VDRH 4P5KB 3NEXA 4WI5A 2ZNWA 2B08A 2DS4A 2D31A 2AJ3B 3BGMB 3CIQA 1ZA6B 2AI0H 3KLHC 4QRRD 3X3GH 1D5RA 1NCDH 1GYUA 5KVDL 2R2BA 4UYPA 1OGSA 3ATBA 4Z7AA 3FT1A 2OMBA 3VJ6A 1B0RA 1D2PA 43CAB 3ZDWA 2IAND 3D4YA 3VDBA 3BSZA 2F53A 1JN6A 3QDGA 3RVVC 3BSGA 1SVBA 2EKSA 5D7KE 1I1YB 1FNEB 4UDUA 2J71A 4GKSB 2DWDB 1JWUA 2YKLH 4PWFA 2YA1A 3GSQB 3OG6B 4YUEH 2GTZA 4GYBA 2HVKB 3ILQD 4PJIE 5AW5B 3I74A 4QF1B 1PGRB 4F8QA 4IHOB 3TXAA 2AZUA 3QUZC 4XPHL 1GRWA 2OMXB 2J12B 1P53A 2FQGA 3FT3B 2KI6A 3FW6A 4GAYA 1IGCH 3ARYA 4YDMA 5MERA 3RBSA 2VKWA 1EUUA 4KO9A 4O5LL 1R0AL 1EZSA 1OGTB 3VG0H 5HXMA 4RA0C 5I2IB 4ZODA 4O9HH 2WINA 5JA9A 1EERB 4K4KA 1BZOA 1SDDB 4WU7A 4AC4A 2E7LC 3WTSA 3K8MA 1LGVA 1AZBA 3SGDI 3DX6A 3TBCA 1SMOA 5BZZA 5SX5H 4IIZA 3AXLA 2P49B 4NT6B 4OGYL 5ABAA 1DBAL 3SQOL 5ILTL 2L0DA 4FD0A 4KKNA 4I48B 1TPXB 2A9CA 1IC4H 1OP5K 2Y22A 1MHPL 3QUKB 1CTOA 1JZEA 1CS6A 5GGTA 2IFGA 1T6WA 1X5KA 4EN3B 5EU5B 2HT2C 4PJEE 2APXA 3KCPB 4GRMB 2BSDA 4O9HL 5CJQL 3JV5A 4MQ7A 1JTOA 4QOKA 3HUJF 4C56D 1RHHB 2A6KB 2YPLE 1S3KL 1YN6B 4K8RD 3ALWA 2ICEC 5DUBB 5E8PA 3TS8A 3BIAX 2Q2LA 1NGYB 1E3ZA 1EGJH 1L9TA 1PD6A 3KPPA 2WMPB 4MJ4A 3X17A 2E0PA 1MFBL 3S96A 4I5BA 5JHDD 3NFPB 2FUTA 4DHLA 3LZFL 3OGOE 5HGAB 2PWFA 1NWOA 1G87A 2QV2A 4IDJH 4OJEH 3UGEA 2WV3A 3T3ME 2CO7B 4NZUL 2MOVA 4WTZA 1UA3A 3T4AA 1ILSA 3FCBA 3K81A 3FUHA 3HHMA 5GGQH 5MEPB 5E5UB 4C56B 1E6OL 1JVLA 4UBDD 1ZLEA 5C07A 2XWTB 4Q2ZB 5IGXH 3OAUL 4CC1A 3ZDXF 4ABUA 1CQKA 1DBAH 3LKPA 1NIFA 2YD6A 3MRHB 3WNLA 1C5CH 1CLCA 4NQDE 4KHXH 3WMQA 1QTYT 4AGNA 2V37A 1SF3A 4GAFB 4E9XA 3MZTA 2MQ0A 3BWSA 4OTXL 2JKLA 3N6YA 4LCVA 2IEPA 3BT0A 2DKSA 4X9BA 2LAGB 4YFLF 4YDLB 3C5SA 5IQ7L 4JHVA 1G7LA 2JI1A 3CHQA 1J5CA 2QVIA 4W6WB 4CKQA 4DNLA 2L7EA 1GVIA 4PJIB 3ECVA 1MLBA 4HC1A 2GY5A 5F1IB 1AKJA 2HWZL 3PJNA 1MCSA 1HU8A 3FUNA 2G60H 1MIEL 2IPTL 4M5SA 3Q8BA 1V7ML 1ACYL 2VZ3A 2X87A 3DYOA 3DX1A 4HUWA 4PV1C 2MCG1 4HALA 4HD9A 3U1SH 5F89A 5B39G 3INOA 5BZDB 3GSQA 3IKCB 4KK9C 3STZA 3FTSA 3CIAA 1AO7E 2WLJA 5CD3B 4FG0A 4JR9H 3QZMA 1JN6B 3CZFB 2GCYB 4HIHB 4I87A 3TCXA 1TO4A 3V4PA 3PP4H 1E42A 2GJPA 4ODVL 2MPAH 1JOIA 1PY4A 2P28B 1MFEH 3DYPA 3RLSA 5DFWH 4DOHE 5JPMB 3ME0A 1F11A 4L1BA 3RUGE 5GIRB 5E2WH 2D0FA 1XR8B 5DJYB 3WD5L 4NKDB 3B9EA 1RULL 2F54A 5FHAH 2DI7A 3N85H 4F7PB 2EIJB 2F08A 3MRNA 3PWJB 5T5FA 1G9NH 2UZIH 4MBRA 5IFAL 1S9WB 1OCWL 1XIWA 3S5LB 5ID0A 2CNYA 4DCQB 2YD5A 5D4QA 3JYCA 4BCXA 4LIQH 4JPVH 4NLAA 5AW9B 5LBSH 2VRAA 2QEJA 3ZX1A 2FT7A 1N5YL 2Z31B 4ECNA 2V4LA 3MI6A 3IYLW 4ES8A 3MV9E 3OLIA 3V4VB 4ZZFA 4J3SA 5MEOB 2WXKA 3ZL2A 4P49A 5D8JL 5GISH 3ELAT 3EYUL 4MRBA 3QISA 3MOAH 5FDWA 2AITA 2BHZA 4M56A 5HGDB 4TNFA 4PJ5E 2OI9B 1ADQA 3IJEB 1S7RA 3D12B 4FERA 4RQQA 4BQ8A 3HZMA 5CZXC 2HT3D 4BBWA 4XWGL 3T4YB 3MRBA 1IGTB 4R4FL 1B88A 1UURA 4S1QH 5DD5H 3TGXA 1G1CA 2DBLL 2K9UA 4AVHA 1WJ3A 1A7QL 3L7FA 1F4WH 1IFHH 3E9TA 5BW7A 1OAUH 1I1FB 2DWSA 1TO5A 3FUMA 3NJLA 3TZVA 5A6MA 4LGPB 3MHZA 4HMEA 3D0LA 4PB9H 3NIGF 3N44B 4I3RL 1XGQA 4DZBA 1QACA 1NCBH 4L4JA 4BSJA 3PFQA 3LEVL 5DWUH 5DQDH 3UX9B 3HI5L 4DH2A 1EHLH 3QFDB 3WNIA 3LQZA 3NSJA 5EZJA 3X14B 2X6MA 4PJEF 4ZS7L 3D4ZA 3RWGB 5E2VL 1YMHA 4U1MB 1ZVSB 4MTMA 5FUZL 2CM5A 3C6SB 4U2YA 3H42L 1HYSC 4G6MH 3UABA 2YSTA 4ABQA 4J2XA 5CP7A 1UUSA 1TVHB 1KEMH 2UZXA 5JHDE 4AZUA 1BQKA 3JWNG 1WTGT 3CFKA 3BGFB 3PCYA 2AV1B 1KIRA 1CGWA 1OAUL 2DTSA 2Z65C 4GI9A 1YO4A 5F7HA 4Z8FL 1OAZH 3NIDF 1W16A 1SHWA 3MBWA 2ZX7A 4MNQE 2A74C 5E8OA 4G5AA 5FKPA 2GJZB 3SE4C 2Z93B 3GKWH 2VZUA 3W2DL 2RMNA 4HT1H 4NKDA 5BQ7A 4I18C 2Q7NA 3SCMD 5DC0A 2NQ3A 2ADFL 2GAZA 4TUJB 4F37F 3T0XA 4HIIB 4LCIL 2Y9RT 4IRSC 1D7BA 1WH0A 4JY5H 4LEBA 4P3WA 1QYGL 4Q89A 5DURD 5TGBA 3DX9A 3OD3A 2F53D 2P8LB 3QDGD 1B0GA 1FQ9C 4LSRL 3MTXA 4C4KT 1JGVH 3M6DA 1OGPA 1EWHA 3P4NB 1K4CA 1EK3A 1DQVA 2G9HA 3WHXB 5DHEA 3OR7A 5BZDA 4GO9A 3UGUA 2WBKA 5DUPL 2JVUA 4B9PA 2ETWA 4KWUA 4W9HC 2JQAA 3WFHB 3R8QA 5E7BA 1CFMA 1OAKH 1HHKB 4GMTL 2AXWA 5FV1L 4M4RA 5LDSA 2B20A 1Q9WB 5HD8D 5BV7L 4MVBC 3QA3A 4QXUH 2V5TA 4Z3TA 5I5RA 5I9QC 5JHAA 4HIHA 1MCEA 3QARA 4XI5C 3V4PB 2AJUL 3QI9D 3ULVC 4YC2C 4YHNA 3T3PF 3PPSA 3FOMA 2J88L 2ZF8A 2WLIB 3B1TA 1IC7H 1N8OE 2Z7UA 4WWID 3LQAH 4BXVA 5FGCB 1ZGLM 1X4XA 3VXOA 2VSMB 4WV1C 3ASNB 4EZLA 3UPRA 4H5SA 4JHWL 2CDFA 4I18A 4PJXA 3DV6A 1IL1A 1T1XA 3H2QA 3QZOA 1PF3A 4MCYB 2FX7H 4BKTC 5I16A 1ETZA 2OQJA 2UZPA 3EFDL 3HR5A 5HHNA 1BZDA 3LKSB 3O2DL 2EICA 3S3DB 4DCQA 3KWUA 3PDOA 3CUPA 1GZQB 4RMVA 4OZGA 2DV6A 2V7NA 3R8BB 5I15L 1WK0A 1FZKA 1RU9L 5IVXA 1IC7L 1NGPH 2DZEA 3D69B 3JQOB 5HGBA 3KR3L 1K4DB 4OKDA 2QQNH 2X2IA 2P44B 3VGGA 1WA0X 3WEXB 4PD4J 1XD1A 5HDBB 4PJ5D 1KDJA 4HLJA 4FJYA 3CLEH 2JH2A 4H25A 4MJ2A 4K5PA 2GJ6D 4XP5H 3SY0B 1SMDA 4WI8A 1LDSA 4UV4H 1H3WM 1IGYA 1U4FA 2APVA 4LFHG 3S5ZA 3ZGIA 4ZW5A 4K3EL 4NQCD 2YLKA 1BZEA 3MZGB 5DT1H 1I7TA 3NCYS 4UF7C 5IJCC 5F7DA 4WQOA 2FWOA 3RA7H 3VXMB 1QI4A 5E08H 1MWAB 43C9B 1S46A 1XVSA 2R4RL 3PHOB 4GXVL 5IB3B 2KZWA 5KYWB 2DQHL 2WN3A 4KVCH 3GEWB 3QJUB 3F12A 3KVPA 4DP9X 2ZONA 2X4RB 3JTTA 3V6BR 3EH5B 3HS0A 4JL2A 1CDUA 4DPRA 1SDDA 1QTSA 3GGWB 1UYWH 2APWA 2D03L 3LQMA 4WUUB 4ALAH 4XGZA 3AVEA 2R59A 3A4AA 5BMFL 4MJID 4PP1C 4QY8B 1F90H 2AJZB 3SDXF 1JGEB 1OB1B 2WBJD 5T1MB 4JFDD 2B59A 3B2UC 1DANU 2BFVL 3A47A 5FOJA 3RVVD 1IRAY 4X50A 5D1QA 3MPCA 3DBSA 5L0QC 1BSIA 2GTZB 1RIHH 4TSBH 3LB6D 1HINL 1NIDA 3OR7B 5IG7B 4FQQB 2C7UB 4NB7A 5FYLE 4OZ4A 3FULA 4HKBB 4KMQA 3F5WA 1NCTA 1L7TH 2WINB 3EG9B 3ARPA 1WBZB 3DOIA 3U0PB 1H9DA 4HEME 1F58L 4A7SA 2W0FB 4LBEB 3TN0C 4XN1A 3S96B 4EQ2A 3TBSB 4RMUA 1I1AB 1ZLSH 3LKNB 4M8QA 4QGTA 5CJ5A 1ZSDA 5KSBA 3DMMC 4L2YA 3MBXL 1RUPL 2F19H 4MB1A 5CU9A 1F90L 4L8SB 4XP6H 3RL1B 1XHHA 3H55A 4ZMNA 2ADGB 3QFJB 1S78D 4G8GD 3FSZA 4JM2B 5ENWB 3D4CA 3MCG1 2CBOA 3C87A 3W3BA 5H37G 3BVUA 2I69A 1BM7A 4GAYB 4JY5L 4EN3A 1HEJC 1DSWA 3MRMB 3L1OH 2VZOA 2DM2A 1OAXL 4LZKA 4UQ2A 1B0RB 4PW9A 3T2NH 3FAXA 1RUML 3DGGB 3TFBA 2WO4A 1T4WA 2BNUA 4L1DA 2E6QA 1CFNA 3I3BA 1O75A 1VERA 3KAAA 3RVXC 3V0DA 1UCBH 2XZZA 4X4XA 4LSPH 1FNEA 4UDUB 1W0WA 2EP6A 5E8PB 1D5BB 3P30H 3H2WA 2E6PA 4OD1H 2FX8L 3HG0A 2AERT 4JKWA 4Z7NF 4FRWA 5D2LE 3ECBA 1N0XH 1G7MA 3FU7B 3PDOB 1J0KA 3UTSB 4FTVB 1H6UA 4GAGH 4M5ZL 5FYLL 5K9OA 3MSPA 2NOYA 1ES0A 3AY4C 3CMOL 3G04A 3IETA 4G1EA 4M4RB 4QRQB 1F6FB 1P4LA 1BX2B 4NO0D 1UHVA 4PWGA 1I8LC 2LW3A 4WHYH 2XIIA 3GJFH 3MRFB 3B9KB 5CR8A 4N2DA 5ANME 2LLNA 1EJ6A 4Z7VB 3WJLC 2E74C 2GI0A 4O2EA 1BXAA 3MXWL 2H32H 3BN9C 3D34A 1OOAA 2EEAA 2C4XA 2WLIA 3ZU8A 1JXFA 3D85D 4H13C 4KVPA 4H0LC 4N5ED 4YO0A 5J11B 2OMWB 5GGUB 3VI4B 1IX2A 4EZKA 4DK6A 2CHZA 3HAEH 4X0NA 1LP9F 1UUNA 3FKUS 3GI8H 4RETB 1EPFA 3WLBA 2Y6TE 2B1AL 5FM5M 4PJ8A 5DEGA 1KACB 2WQAA 4J4PA 5I1CH 1VACA 4OB5L 4JREC 3P3RA 1N70A 1UOWA 2HMID 2X2UA 1UGNA 5I1GH 5C07E 2NY4D 1IFHL 4YEFA 3AT0A 3POCA 3BVNA 3Q44A 4GG6F 1CFQB 2N1TE 4PV9A 5E9DA 3LDBB 2TRHA 2X42A 2F0CA 2QGDA 2G5UA 1OTTD 1CR9H 2ED6A 1W6LA 4XN9A 1FVEB 1KTDA 5B3SB 2GITB 2VDKL 1YEHH 4X9HA 1J9TA 2NY1C 5EUOA 3SOBH 4I0PD 4Z76A 2VTFA 3ZDYF 2ZXDA 4Y1TA 5IOPB 2YGQA 3PWPB 2V2WA 1N3NB 1LVEA 2LFGA 5SV3A 1E8WA 5SWQA 3THML 4RAUB 1FAIH 3ZJAA 1IAMA 3EFFA 4PJDF 3C5ZD 2OMVA 4RMQA 2CGZA 4OBSA 2I26N 4PB0H 5DC9B 5AEAA 2VZSA 3IF1A 1KZYA 5KBNC 3IJHA 3WG7B 5K9JL 1KTLB 3S36L 5JHDB 5HHQA 4ZUVB 3DUHA 1P1ZB 3L4TA 5FCSH 1XGRA 4ZPTA 4QY8A 4HBCL 2BHUA 5EIVA 1PEZA 1QSEE 3IU3A 2YAEA 2F7QA 3K46A 3ZHLA 4F9LC 1MRDL 3QQ3B 5EC1A 1HXMB 4YGAB 4CBZA 3QIWC 1EO5A 4LRIC 4Y5VC 4NQED 4F8TA 5LGKA 2Q8BH 3T0WA 3VXMA 1IGTA 3V6OE 2A83B 5D9SB 3VACA 1M6OB 1WV7T 1GS6X 1QSFA 2IALB 1NWPA 4PI0A 4LVOC 3CH1A 1FV1B 4ZFOB 2AEWA 4ERSL 5E6SB 2WNWA 4PRHE 3BGFC 5D55A 2PWHA 1JRHI 2QTVA 3FB8A 4K2UL 4PS4H 5C0EB 3ISRA 3ALPA 3Q6FA 3WV0A 4JMNA 5DLLA 1KBBA 3F8UB 4H40A 5F3HA 4QHKJ 5D5MF 3A4FA 1GCYA 4QRTA 5IFHH 1WWWX 1OAQH 3PGFH 3DTXA 4HMCA 4XZUB 2ROYA 4PJXE 3CFIC 4U1JA 3BIKA 4M1GL 3OZLA 3CVHB 1KELH 2G4EA 3ZRSA 3GFUA 3S5YA 2XFXA 5CGMA 2Z35B 1BYPA 2ZX9A 4ZXBD 4YHOH 1A6VL 2MNUA 4FQIL 3O9WA 3DXAE 1UB5A 2P46B 2QADD 3G9AB 4HYTB 3H0TA 4AEFA 2EH8H 7FABL 3G3LA 1Y07A 1KYOJ 4N25A 3U2JA 2BRQA 4DW2L 2OL3A 3OXSA 4B9ZA 3FK3A 1PLBA 2VUOA 4G1MA 4X4XB 2ZXWB 5D1XA 4GSRA 4NHUB 3DURB 3RY4A 2OULB 4J8RA 5KBLA 3CXDH 3FU5A 2YUXA 1XF4B 2DF3A 3PGCA 3TH4T 3EYFA 1TQBC 1BX2A 1DLHB 3MV7B 1B2WL 4XPFL 1CYWA 3FN0H 4WDIA 4QRQA 1M2VA 4BH7B 1PZ2A 2R0WL 2YQ3A 1YPZE 4FQHA 2B1HH 4P2OD 4P5MA 5KG9A 4XH2B 2CXGA 4Z7IA 4P05A 2V8MA 3ELQA 4LLVA 1N18A 2EIBA 3LQAL 4RGNE 3TO4A 3MXWH 4ZYKA 4WNQB 4AQ8A 3I6SA 4U0RB 4ZMLA 5IMMB 3BWUC 4KJQC 1T2QL 4K7PL 1KBWA 2EYSB 4GAAA 2VN4A 2P8LA 1EFQA 5A7BA 1U91A 4KXZI 4GQ9L 5CWSA 4XT1C 5DJZB 5DEGB 3MA7A 4N2BA 4N8CL 4S1RL 1FH2A 4U3SB 2W9LA 3LZOA 2AK4E 3L4ZA 5D2LB 3BW9B 3V5KB 2MKLC 4OQTA 4XMTA 1NLDH 1X9QA 2GHWB 3AQZA 4R2GB 3R06A 5GGSB 2BOCA 2CHWA 5IKCB 5JPNC 1AG6A 3WU1A 1YAIA 4JRYB 3P11H 1QRNB 3PWLA 4TYUA 1TJMA 4DETA 4YLCA 1ZA3A 1SYSB 4KXAA 4KGJA 1FG9C 2M8XA 1SDAB 4XNXH 1DDHA 2J6EL 3MODH 4KRMB 4ZDHB 1QLFB 5IQ9A 1KF9B 3BO8B 2VMDA 2EIMB 3UH8A 4QWWC 1MW1A 1KLUB 4TMPA 3ZR5A 4PJXB 2HLEB 2EXWC 2VXQL 4QLRA 4NZRL 3I9PA 1E9OB 3IK2A 2HX9A 2B2XH 1TZGH 4NO3A 5HGHA 4NQVB 4U31A 5FFOA 4ZFQA 3NSDA 4HIQA 4QOKD 4C56A 2IDTA 2UYLA 4WCYH 3ZKND 3UYPB 5FM5O 4LCYA 3BYYA 3CDFA 5HHMB 3WNKA 4C83B 1JV2A 3IFNH 1QBLL 3P4OB 1NCWH 4PR5A 2Y07L 1IVLA 4L4VA 3ULAB 3WAKA 2JIXA 1I9EA 3UAJC 1B4TA 4F9PA 1UT1A 4BFNA 4MSWB 5I8CA 2NTFB 4HUVB 1C08A 2RJMA 1TVDA 4X4ME 3TA4D 2R29A 3V6FA 1QFWI 1OGTA 3D18A 4WWKA 2DWEB 2VDKB 1CDIA 1YYLL 4YNYA 1J5DA 4AEIL 3PHOA 4Q6KA 2AVFA 5CZVH 2ESVA 2IH1B 2HKHH 2YR3A 3U6XA 4AJ0A 1I7TB 3HI6L 1DO5A 3VFRA 4HOZA 3DNKA 1AGCB 1BD2E 2O6FA 1TFHA 1E8ZA 4JFPB 1AMYA 1DLFL 1O7DE 2X4SA 5IVOA 5PCYA 1ZKAA 4X6DA 1RKRA 3T0EE 1D9KA 3W39B 2MCPH 1RUPH 2F19L 4Q4IA 1U9KA 3F65A 1KSRA 1Z3GH 4NZTL 3ARED 4GMSL 4Y1SA 4EUPA 1CYXA 4B7LA 4ZX6A 1NIEA 3EJZC 2W9EH 4UQ3B 1H15B 3VXSA 4L4TA 4OLWL 2VLJB 1AR1B 2WZPA 2FWLB 4C57C 3F7RA 2YLHA 2YIHA 1KBGH 4L3ED 5CUSL 3UMTA 4KC3B 3LKSA 3OR6B 3C60C 5CEXA 2XWDA 5IMMA 3T2PA 5DRNB 1N0LB 2B15A 3RWDB 2VDOB 3VA6A 4ZPVB 1LO4L 1J9CT 1LO3L 2P24B 3B5GA 3HNVH 2Z31D 1FRGL 1WC7B 3K6SB 1AY1H 3LKRA 3TBWB 2G30A 1CL7H 2WYHA 3X2QB 2LU7A 3I50L 4MNQB 4FQ2L 1IGMH 3TPKA 1AJ7H 1JZ7A 2E4FA 2Y3AA 1J11A 1XF4A 4XMPH 2B59B 4A7UA 3LXCA 5AW2B 4TRPL 3KLDA 4NKIL 4WO4A 5BMFH 4XPFH 4N4YB 2HT2D 1YNTF 3KWWA 2ILLA 4OH2A 2RTTA 2NXZC 5CILL 1WUZA 1Y6MR 4M6MH 3SD5A 4W6YB 3RI5F 4UINH 4JFEA 1GIGL 2QKIA 1CBVH 1CLYH 4QRPA 4I77L 1S3RA 2A73B 4NYLA 3L95A 1JZ2A 1WRFA 2LOEA 3HC4L 4H1LH 1AXSB 1QFWH 3APNA 5GGSY 4BA0A 4UQBA 2QMKA 3KS0H 3MFGB 1ZE3H 1KN4L 1DBJL 3EFOA 3OAZH 4XMPL 2WBJC 4TSCH 3X12B 3ARBD 1KCSH 3CN1A 4IEFB 5J6GA 4P9HC 8CGTA 3ZL4L 4HIEB 2WYIA 2ORBH 5CBAA 6PAZA 4QHNB 4N86A 2H32A 5D4HA 5HGHB 3MRHA 4P59H 4PGDA 3M46A 4ZUUB 3DMMB 2CIIA 5GZNA 2X0UA 4DPCX 3ROOA 2ADJA 4EMZA 3V5HA 2R2HB 5B4MD 4FI6A 4R0LA 5MEOA 1BOYA 3B7UX 2G3NA 3KM1A 2ZIDA 4NWUH 1QI5A 1KCVH 4BFIB 4PRHA 3V5DB 1DDHB 5T5NF 5BRPA 5ADPL 3EJPA 1UD5A 1RVFH 4KI5E 4ELME 4UTCA 2AANA 2Y2YA 1IAOB 3GXPA 1XIWB 4P2RD 1LO2L 4WFGE 3X1GA 1JTTA 1ECYA 1CFBA 3MRNB 2VM9A 3UC0H 2WXRA 2P8MB 4R7VA 1J1PH 1G7QB 4U49A 3MBEA 5DHXB 3L9YA 4YK4B 3RVWD 4MS6A 3U1PA 4AY0A 2C9PA 1X6LA 5E1AA 5I6KA 3FU6A 3GZQA 4P5RA 2O6EA 3GBLA 1BF5A 3LPFA 2IADA 3ILQC 4HGWB 2ALWA 3HB3B 5AVXB 1RPKA 3G5ZA 1B4JL 3J07A 2OTUA 3W57A 5EBLA 1I3GH 5HGDA 4YHLL 2VLRA 3VH8G 3GHPA 4MYPA 4HWEL 2R51A 1H6FA 2WZAA 2DYSB 5AZUA 5TFSH 5EC2A 4GNKB 5JYMA 1BXUA 1KJ3L 4KDWA 3QDJA 3ML8A 4PJ5B 3ZSTA 5AB1A 4J4PC 3TEZA 5LCVA 2HN7B 2VABB 4NKMA 3L7FB 2BCMA 2HG0A 3MKGA 3X13B 3MNZB 4KZEH 2DL2A 3GMNB 4PJDA 4FC3E 5SX5K 5J5EA 4XNMB 4QHMA 2BY1A 3G04B 3R19A 3CU7A 2BHYA 4HLZH 5EEYA 3CDCA 1JL8A 1CICA 2E7BA 3IRZA 3PU7A 2ZXGA 5DD6B 5DZVA 1OP5H 3UYRH 4WSKA 3BH8B 2A5UA 5FO2A 5BPPA 1I3RA 3FFDB 3FO1A 5JW4Q 3CN2A 1TF4A 4WV1B 3QPXL 2FYYB 1CFQA 1AQDA 1C12A 1EDQA 1TNMA 2X4OA 3IFOB 1NFIA 2VIRA 3HE6C 3QQDA 4GQPH 3TU6A 2W65B 2XZQL 3NFNA 3JVGA 3QULA 3VG9B 2CR3A 3MREB 1F41A 5C0IB 5KVMC 4G7VH 1YMMD 4M1GH 5CCKH 4AGPA 5EUOB 3LKOB 4JQXC 1A1OA 1DSFL 2WXFA 4AIZB 1OANA 2J43A 3BVDB 3BT2H 2D31B 3DJZA 5FYKU 3K2UL 1FNFA 1KGCE 1CU4L 3CVIH 3JWOC 3QWOA 2RBLA 3KDPB 4WAFA 1GKEA 1JYVA 2WYZA 1RZ8B 2NY7L 3BVNB 3B83A 3OMZA 2CLVB 4B3EA 3P77B 1QBMH 5HDLA 1TQUA 2D8KA 4X4ZA 4XHJC 5TF0A 3FQTA 5C0EA 1JHLL 3TF4A 1BWWA 3ARDB 3WIIL 5T5NG 4KKBD 3BWAB 4ZPTB 1DN0A 1B6UA 5L2KD 2SEBB 1UM4L 2WVVB 1M7UA 1GC1H 3JWNH 1BJ8A 3VFPB 2W9DH 4U7SA 1YQVL 3KCWA 3PHQB 1K5NB 3FRUA 5KSVB 3MV8A 2W94A 2EC8A 1K2DB 1WZ1L 5LBSA 4DZ8A 3SPGA 3VFWB 4EI0A 1U8JB 2G3ZA 2H3KA 2WOYA 5GS0H 3WEAA 2FL5B 4D0CB 3JTBA 4LSTH 5E24E 2KLTA 5EA0L 2J8UB 4OY9A 4K7PH 4ZRGA 4IEFA 3S2CA 5AENA 2PW2B 4ONHB 5ISZB 3P54A 4HAKA 2VB5A 3D87B 1YMMA 4UNIA 3TONA 1P9MA 3GIVA 5C0DB 4PYGA 3B37A 1H19A 1I9IL 1WIPA 1LNUB 2XA8H 5LNEA 4E9WA 1OP9A 3WXWH 4IHOA 2CJ3A 4TVPD 3OKEB 4XO5A 3MLZH 1R33A 1EA9C 3GSNB 4AGOA 1MNNA 4PW3A 3PXLA 5ERWB 4UT9H 4X6CE 3D30A 3U25A 2VC2L 1WICA 5E5MA 4OFDA 1Z0NA 1OTUC 2XETA 2H1XA 5DJ2A 4M7LL 5IW1B 2D3VA 4Z0XB 2CD0A 3KCPA 2Q0ZX 3BP4A 5F7BA 8FABB 1BZ7A 1FFPA 5DFVC 2NY1D 4MA8L 4QRUA 1EZLA 5IHZA 1UKSA 1JZIA 1KCBA 4HKBA 2IGFH 3F5WB 1CDJA 1HDMA 5AAMC 3OAYK 4AJYV 1L0XA 1N9PA 2WMPA 1GL4B 4AYDC 1QSEA 4XMKH 3DDGA 2VR9A 2CO6A 1E2ZA 4F7MA 1BG1A 4L9LB 3EDFA 5DZJA 5F1IA 5D2LF 5IVXB 1OTUD 3ESUF 5B38G 3SPVB 1A4CA 1RZIA 2XA8L 2Z0BA 3HN3A 4JZJB 1HHGB 4GW1B 5D71H 3TFKC 3C12A 1UEYA 3CFJA 3U4BH 4LCWB 4F27A 1TTAA 2FH6A 3SYCA 3TV3L 2EE3A 1J5HA 5DJ8B 3EAKA 1ML0A 4L37A 1FO0B 4WUUD 1G7PB 3P69A 2Q6WA 3HC3H 4NHCH 2RH0A 2V2TA 5HDBE 3T6VA 1BXXA 5K39A 3VGEA 4G9FE 1SBBA 1R75A 2R7EA 5HDOA 1M1XB 2BHFA 3H6JA 3VFNA 3P4LA 1LJMA 3KPTA 4NPYA 2NYYD 5I1HL 3GO1L 1PW3A 2AJYH 3IGFA 4WO4D 4Q6IB 4E0RA 1T7ZA 3EF7A 4LASH 5GGQL 4X6FB 5DXWA 1X7QB 2IDFA 5HHXH 4FL4B 4HJSA 2PTVA 1DN2A 2YQ2A 4O02A 2FLBT 2DQIL 5ES4B 2FJHA 1G84A 2OXHA 1VDGA 5ADPH 2YMXH 4S0SD 3SYOA 1N68A 5D5MA 5AW3B 3SIKA 3HMXL 2Q87A 3VDAA 4D8OA 3S88H 4M7KH 2QKIC 2X1OA 5I66A 3HNTL 4MMXA 3Q6GL 1SY6H 4WW2B 1EIBA 2AMUA 5I74C 1QSZA 3POHA 4OLXL 4Z7WA 5IB4A 1R3IH 4KTGA 5BRZE 3QVAA 4U1LB 2VERN 1XO8A 3P40A 1OE2A 4PJEB 3F83A 1F18A 3NCXA 4LSVL 4P99A 4FQQA 1OP3K 4K94C 4PJ7E 4ONFL 5AWNH 1ED3A 2D7PA 4G42A 4M1DL 3BPOB 3FCSA 4ODXA 2B7DT 2K0RA 2DPKA 2YD0A 3F64A 3H9SD 3BPCA 2LQRA 3DIVA 2X6UA 1A7OL 1KN4H 2OXGA 1Q9KA 3V4UH 4KXDA 3RU8H 1N6QH 1BFSA 1GGUA 2ZXAA 4G8IB 4X0KB 3M1OA 4J3TA 1LEGB 1LWJA 1OAQL 3ES6A 1UM4H 1TCRA 2WIIB 1SF5A 4IOSA 4TQ8A 4PHXA 4Q97A 4DGWC 4P57B 1S5HA 4M6ML 1T3FA 3K2KA 4JDVB 5EU3A 3SE4A 2WJ7A 2UX7A 4DFHA 1TIUA 3CLFH 3WY1A 1E27B 3WMPA 3DRTB 1EEZB 3DXAB 5IFJA 3BESR 4ZMVA 1BQSA 3JYBA 3ZE1F 2OAAA 2YMOA 1UOKA 1AHWA 4WJG3 12E8L 3HHSA 3CNKA 4A39A 1GAFH 5D7IE 2RQ8A 3AREB 4G7YH 4GW1A 2JKIS 3INUH 4ETYA 3MGAA 1D5ZB 5C08D 4OLYL 3HZ3A 5C08E 4MS8D 3E8VA 4OJYA 4FLSA 3NIDE 4U1KB 4L9LA 4N8VA 1U8HB 3BZ4B 5ERWA 3SDDB 2DQUL 2QSVA 1RL1A 2FTAA 3RU8L 1IAIL 5ESAB 5I71B 2CH8A 3M7OA 1LE9B 1W0YT 2C9RA 3ECUA 2NSXA 4O4YH 3VO0A 2Y0SA 1YEIL 1BF2A 5D93C 3U4AA 5JOPE 4L0YA 3LMJL 3M88A 3CGTA 4NSKB 3DOSA 3D06A 3FUIA 4LSPL 3QUXD 4KNTA 2B9AA 4IJTA 2ZNXA 2PLTA 4N2CA 4UNUA 4QXGH 5CP7B 3SGKA 5IMLA 3AB0C 2VN6A 2R23B 4TSBL 5D4JA 2ZUUA 2DH2A 4FFTA 4NN6B 1UWGH 4PJ9B 4B0MM 3WKYA 4B27A 1RZJL 3ULVE 4JO4H 5IFHL 4U33A 1INQA 1T22A 3LZRA 1CDHA 1YEGH 5EN2A 3OKOB 1HCZA 1BPLB 5IW6A 1OTTC 3CMGA 4PWJA 5KJRL 4NC0B 1BMGA 3Q7JA 5I9QB 3DSNA 3BI9X 1R5WA 4NFDA 1RMFH 1SYVA 2DAVA 3R4RA 4HEPA 4A04A 2ZOKB 4LSTL 3GRWA 5KJ7E 3QCVL 4MXQC 1TITA 5DD0H 1KYFA 2KUTA 2VGLM 3IDGA 1DBJH 3CBKB 5D7IA 2MJWA 1JXGA 4HJIA 4K9EL 4MB3A 3NJIA 4JM0A 4QRSA 3K80A 2WK2A 1OT1A 2O5YH 4OCWL 4OU3A 4RRPM 3LD8B 1LL1A 3IT8D 3BRDA 2OTUB 5AW8B 3ABZA 2H6PA 5D7KD 5I15H 5I8OL 5IROA 2CZNA 2GY7B 1WQVT 4JQIH 4C58B 2R69A 4FFZA 1A2YA 3GTTA 5G4MA 1BM3H 2EDRA 5DJ6B 1YNLH 3MUGA 3WEBA 3ZYZA 3GSWA 1NFDE 4F1ZA 2TSBA 1R3HA 1THCA 2C8NA 4NN7B 1NGWA 1LK2B 4YBQD 3P3UA 3VRIB 4QEGA 5D1XD 3MRKA 2X12A 4UIMA 5FK9B 2QVMA 2VDNL 3UO1L 5LCVH 4DVBB 1I3RB 2YD1A 1BVNT 3A6BH 3FFDA 3WENA 4HD5A 4YDLC 2YEZB 2ITEA 1QO3B 3O0RL 3ES6B 1TVBB 4M5ZH 5FYLH 4F58L 2XPGB 1WFOA 2XTJE 4JFFE 5B1AB 5FKAA 5GZOA 3T3MF 3V5DA 5JUEH 5MI0C 4LDOB 3BFOA 3KPPB 4Y4FD 1WWCA 3KLAA 4NQXB 4TNWK 1RCYA 4V1DD 1OQXA 1QWHA 3EFFB 4RAHA 2JF1A 3T8VA 2VRKA 2IDSA 5IJBC 1U8HA 3BZ4A 1HKLH 3FQ4A 1IFGA 1PCXA 5AG8A 1FFQA 1TJIH 4N0FB 3VQLA 3T8MA 4KK9D 3WKPA 3BH8A 4TF4A 1KCKA 4KV5F 3EGSB 5DFAA 3ARBB 2ENYA 3AREC 3GLDA 2VCOA 4HKXA 2IPUK 3BPLC 2XJLA 1TQWA 2ZSVA 4YFDB 5KBDA 2XBTA 4CUCA 2HFTA 2F7IA 2EVJA 1LK3L 2LVEA 5GQBA 5JR1H 4X6EA 3O3AB 3N40F 4BGDA 1JNLL 3HE7D 3QJXA 1SXAA 2VLJD 5IF0A 2Q10A 2VLJE 4JR9L 4OM0H 4EVNB 3KBPA 2R0KL 2YD8A 4HSCX 1S7WA 4TL5A 5CEYA 3BPNB 5J6HB 4NZRH 1WE5A 3LRMA 4QHLB 4C56E 1ZK9A 4EOWH 2V3FA 3PXJA 4JM2F 4D7BA 3BUYA 2GKIA 4HFUL 5T1KB 2N7AA 5J89A 1SJVA 5FWQA 1X4ZA 4BXSV 3C5SB 1IM3D 2WKOA 2VXQA 4JFVA 3UBXG 2DOCA 1DUYA 2C3VB 4G8FB 5IHLB 3CE1A 4JRLA 4RBPH 5DRWB 4OV5A 3C08H 1QEWA 4X5LA 2YC1A 4NQCA 3N44F 5A2CA 2DDQL 3FH5A 5DK2A 4BH8B 1LEIA 4I13B 1G6RB 1NDTA 3BIBX 2IPKB 3V4VA 4F15C 1D6VH 5ICYB 4YSUA 4OFPA 4OZIF 2MTAA 1JPGB 2XBZA 1TQTA 4RFOL 1U8QB 4DGVL 5I0WA 1I7UB 2ICWJ 3MV11 2N7BA 1XX9C 1FYTA 4GRWE 2DTMH 4H1LG 5IEKA 1WUNT 5I1AB 1BD2A 2YGPA 2VL5A 4Y9CA 5B1CA 2AGJL 1PQZB 2IQ9L 4OF6A 5D7HA 1Q72H 1S9WA 2F68X 2FBOJ 1IC5H 4LQFL 1RZJC 1G1OA 1YPZB 4K3DH 3WJLA 1UFGA 1QOKA 1HHIA 4H8VA 2WWMC 5DHVB 4DKEH 3L17A 3D85A 1P2CA 5AYUH 2F54B 2VJ8A 5EPMA 1AD9A 3BZEA 3DTUB 2IXQB 4YDJA 5KS9F 1G43A 1W80A 2QELA 4FKHA 3CTTA 3RUGB 1OARL 1XR9B 2OZ4H 1ETJA 2X4SB 3NIDB 1R9FA 1SXCA 2DQEH 2LFEA 2Z4QA 4WSJA 1SJEA 3F2LA 1GGCL 1ZIAA 2PP8A 3SE8L 3HW7A 4JUSA 5JORA 2CKBB 2HFFB 1A25A 5L6YL 1YEFL 4PB9L 4WK2B 5CD3A 3WTVA 1BLNA 1ZT7B 3WGUB 3ZYOA 1AGDB 5F0MB 3D18B 2DWEA 3ZSSA 3H42H 1Z5HA 2K70A 2HSIA 3L1GA 3TO4B 3KDMA 1IE4A 5I18H 3LVEA 3OKNB 1EXUB 2NUTB 4FMKA 3G7TA 3SKMB 5IT2L 2Y24A 1RJZA 5CEXB 1CWVA 4Q8BA 3WIAA 4UUJB 2BZDA 1WCBA 1SVZA 3I6KA 1LDPL 3O3UN 4XCCL 3FFCD 4B5ZA 2EEXA 4FG4A 5C92A 1M71A 4NPYB 4OF7A 2ZSVB 4KRPB 3A5VA 2V5RA 3U6RB 2EUXA 1PY9A 2NYKA 2CRZA 5A2JH 1M42A 3ZKXB 2H26B 3IAPA 4AC2A 2I9TB 2VZVA 1L6ZA 4RX4A 4Y16C 3FBKA 4PTUA 3FT9A 4NRZA 3N85L 4FULA 4YIQA 3NJXA 2NXZD 1EH9A 3MU3A 3L4WA 1NAKH 1GGIH 4AGLA 4XC3H 1A3LL 2WIMA 1FG2B 2XN9A 3RZCD 3QXVA 2NDGA 4TPRL 3SDDD 3ULVF 2E27H 4WWNA 4TTDD 1MRCH 4G8EB 3ZHNA 4C4KO 4MHHG 3KYOA 1E65A 3GJEA 2MPAL 3QEQA 4YJZL 3PLYA 1L9QA 3LS4L 3HRZC 5SWZE 2VLLA 3VMPA 2B1HL 5F9OL 5FO9A 2X4TA 4K7PY 1JNLH 4S1SH 4WY7H 3O6LL 3N55A 1E4XI 3TBBA 2J5LC 3RKPA 1GYCA 2XV0A 3HVDA 3U2SB 3O41B 2F58L 3VXPA 3VWJA 4L8CB 1H5BA 5BS0D 4FA6A 3Q2LA 1RXLA 1N6VA 4X6DB 3MOBL 3SCMC 3ZTJH 1QEWB 3S3CB 3MLTB 3HC3L 1NCCH 4NHCL 1OD9A 2A9NL 4Y9BA 3S7GA 4B9KC 5J1TC 5E1QA 1PIGA 2WXNA 5D7SH 5GHWL 4Z18A 1FN4B 3G5XA 2AQRA 3I9GH 1XWVA 2F61A 3IMTA 1T0PB 4L37B 5KS9E 4L23A