3CVHL

How tcr-like antibody recognizes mhc-bound peptide
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
209
structure length
209
Chain Sequence
IQVTQSSSSFSVSLGDRVTITCKASEDIYNRLAWYQQKPGNAPRLLISGATSLETGVPDRFSGSGSRKDYTLIITSLQTEDVATYYCQQYWSTPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title How a T cell receptor-like antibody recognizes major histocompatibility complex-bound peptide
pubmed doi rcsb
molecule tags Immune system
total genus 51
structure length 209
sequence length 209
chains with identical sequence R
ec nomenclature
pdb deposition date 2008-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cvhL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cvhL01
3QHTC 3WHE0 4LNVA 1CDJA 3MV8D 1Z5LB 3ULVE 1A7NH 1GGUA 3B43A 2JIXA 1IGML 4AT6B 4U2ZA 2QQLL 4LSTH 2DM3A 1CL7H 1UQSA 1VDGA 3V4PH 4Y2DA 4O4YL 3OGCA 3FFDA 4R96B 3B8SA 1HZHL 1MH5A 2R2BB 5IVXF 1NBZA 1T2QL 4JZOB 1FL6B 4MJIA 2QSCL 4X4ZA 1VGEH 1WC7A 4WI3A 3VXSA 1ERNA 4EEEA 3MUGA 4A6YB 3NCFB 4MB5A 4CN4A 5KVGL 4ZMAT 2ICWI 3DXAD 2XNAB 3TNMA 4U1MA 2FCBA 1Q9LA 5KTEL 5C0FA 1BVKA 2EDWA 3MLXH 2RFXB 4OZIF 1JHLL 4WNQB 3VFUA 3H3PH 1EH9A 1FGNL 1ZVSB 3I6KB 3BGMA 1A2YA 1FNLA 5C0JB 5IROA 1BEYH 2E3VA 3C6LD 1C12B 1CXKA 1KIUA 3MV8B 2JKXA 4K3EH 2VXSH 3LPWA 5IOPA 3SEPA 1GC1C 5EULV 1JGUH 4XVTH 4DW2H 4L3CB 3L5XL 4OLZL 4O51A 2D0FA 3QSKB 2XFXA 4HKJB 5D7IA 1EAJA 1LILA 5DTFA 3KYNA 1BOGA 1MI5D 5JIPA 1DQDL 2YHGA 3WNOA 5ESVA 2D7TH 1SMOA 2NY1D 3GK8H 3GSNH 1AKJD 3PDOB 1PKQE 1D6EA 3VRJA 1MREH 3VXTA 1DUYA 2ADIA 4YHLH 4EDXA 4YNYA 1FFNB 4HBCH 4HDIB 5DRZA 5KW9H 2ZJSH 1VPOH 4PRPE 4NCC2 1Z9OA 3RZCA 4OD2B 3DXAB 2DI7A 2IWGA 4KKLC 1FC1A 1KV3A 2ZG1A 3OTTA 4GS7B 5L6YH 1G7IA 1ORSA 4ZYKB 1DBAH 1M4KA 3BPLC 5I1JL 4P57B 1U6AH 4NC2B 3DHMA 4PP2B 1C5CH 1N5YH 4QNPF 3C6LB 4O00A 4ODXA 4NRYA 4Z95L 4IIQA 1J05A 4Q58C 2APBA 4NKOB 3UJIH 4AIOA 4FFYL 4S0SD 4G80A 4R0LA 4M8VA 5HDLA 1MI5B 5IB5A 1TNNA 1T83A 2CR6A 2Z91B 5IQ9A 1SY6A 2DQIH 5HGAB 2B0SL 3SBWA 1AKJB 5CP3H 3QUYC 2L4OA 1Q9WB 4LLQB 5KAQF 1G9EA 4K71B 4M8QA 1CTOA 1NGPH 3JTTA 6FABL 1KCSH 3MRIA 3DYMA 2PYFB 4KJQD 2FZ3B 4Y5YA 4JDZB 5L8LB 3DUSB 4AH2B 1LD9A 3C8KB 4P5TA 3HRZA 1BWWA 2I60L 3FMGH 1MOEA 1A7PL 3GSQA 1HXYB 4YEEA 5HHQB 4UZGA 4PJCF 4YDIH 1TCMA 5D70H 2RR3A 3P30L 3T0WA 5IKCB 4HC1H 3P9LB 5DD0L 4JY6A 5JA9A 5GS0H 4B53A 3LHPH 2C4XA 2IMMA 4WFEE 5DD3H 3O3BB 2VLRB 1C16A 3X3FL 3JVGA 1QYGH 3KPTA 4XGZA 2HJFB 1QLFB 2VUYA 4OQTL 4PTTB 3HS0B 5CJXA 5F9DC 1JHTA 1FZKB 4YDVA 1MY5A 5CJ8A 3S7GA 1TCRA 4U05A 1QNZH 5DZOA 5ETUB 5HI4C 4Z5RA 1M7DA 1IQWH 3S3PA 4JM2F 1N6QH 2VL4A 4HIJA 5F7YC 4QTHA 5DMYA 3DMMA 3P77A 1HH6B 1A5FL 3GO1H 4LCUB 1YEHH 1MCJA 3RVWD 2R0WL 3F6LA 3GSRB 2J8OA 2NXZC 4M6NL 3QNZB 4PGJA 1Q0XL 3CFEB 5EBMA 4QGTA 4HS3B 1CFVL 4KMTL 4Z7WE 1G1CA 3MV8E 1X5AA 2XZQH 1NFDF 4X4YA 5FF6A 4FP8L 1JNJA 1W2KT 4NJAH 3V0VA 2C3XA 4LSQL 3SDCA 4ODSL 3SKNA 1RK1B 1O7VA 1F6FB 4LBEA 1WFOA 4NNPH 5JNYB 3QEHB 2O61B 3U7YH 2YEZB 3ZDYE 2NY5C 1SYSB 2FSEA 4PY8I 2MNUA 3OB8A 1B4JL 4HX1B 1OGAD 4LCCC 3WV0A 3VGGA 3OKOB 3BIBX 3WIIL 2VO5A 4A2LA 3U4BH 3WDIA 4EN3A 4G7YH 3NMEA 1I7ZA 4ACPA 1NCDH 2BSTB 4F9LC 5SX4I 1GGBL 3HMWL 3QDME 2D7NA 3G6JE 4JPKL 5HI5D 4LARL 1J0ZA 3L5JA 5GJSH 1KCRH 1PSKL 4X80H 4JKPH 4G6KH 3VD5A 4M6ML 2A9MH 3D18A 5ESAB 4MNHB 3IFNH 1ZLUH 1LO0L 5JW3L 1HILA 2AV7A 3FQRA 2UWEA 4LSPL 4ELMB 4K7FB 3K0WA 3GSXA 4NN6C 2ADFH 1A47A 3WJLA 2DKMA 2IPKA 1FLRL 1JZ3A 4IRSA 3MOBL 3QEUB 3QULB 5GGRA 5I6XB 4H0HB 1MVUB 2XY2A 3GI9L 2AKRB 2VDPH 1CQYA 2X9XA 2QHRH 4HH9B 4TTDC 5GGRY 1RJLA 1T7ZA 4LHUA 4RQQB 2FD6H 2YD7A 2ADJA 1QLEH 4HWBL 1OGAB 4YHIB 1T5XB 4LLUB 5J6GA 4POYA 3DWTA 4LMQE 4PJHA 3PJSA 5C0GB 3OZ9L 2W0LA 3V4UL 4FXGA 3TBSA 1G9NC 5ILTL 1LO4L 3GMOB 1MCBA 1AY1L 1KCUH 4I5BA 4IRJC 3ZTNH 1EDQA 2V9TA 1K8DB 2VLLB 5IESH 3HI5H 4XNYL 4RMQA 1JJUA 4Q6IC 2M2DA 4C55A 4OF0A 2V7NB 5CILL 2FDBP 4PB0L 1AXSB 1BBJB 4XBGA 1O7SA 1JGEA 3RWFB 5C1MB 2D03H 4HJGB 1GAFL 4C58B 4U1KA 3VMPA 3RWEB 2VLJD 2VLRE 2ZG2A 1YNKL 3QXAA 5JW4R 3QQ9D 3LY6A 4XRCA 1HQ4A 2G75A 1ZANH 1F97A 1LO5A 2DQTH 1U8OA 2V5YA 4N8VA 3FB8B 3C5JA 4I18C 1A9BB 1K6QL 5HHPA 2E6PA 1HNGA 4K3DL 1F8TL 2AEQL 2A74A 1IZJA 1WZ1L 4J4PA 4JFQA 4QRPD 2GK0A 3TPKA 4R4NC 2BMKB 3DX8A 3L3DA 3OAYK 5DVOA 2D9QB 3FQWB 3LAFA 3LD8C 5CHNA 4KI5F 1YN7A 5C0RL 2GK2A 2BSRA 3KXFD 1SEBB 3ZDZF 5T1LA 3DPBA 5HHOB 3RNKA 1T89A 1F4XL 4YGVB 5TJWK 4JGMA 5F3BA 4LP5A 1WVZA 1IGTA 2BXYA 4L5FH 5HY9B 4Z0BH 3EOAA 2OM5A 3CFDB 4MQTB 4U1HB 4F57L 3V52H 3EDKA 4LVHC 2VLJB 1UXWA 3ARDD 3QHZL 4ODUB 1MCFA 1JWMA 4UQ3B 5LBSL 3TCLB 3UYRL 2NY6C 1A9EB 3VXMD 5DD1H 1TENA 2JJTA 4KK6C 4ETYA 3TVMA 1J8HD 4X4XB 2D7OA 5JW5B 1EUUA 3GSOB 4BH8A 4HULB 1YPZA 3CD4A 3ZKXB 4KROD 2HH0L 5F1IB 1OTUD 4JDTL 1CE1L 5CIPB 3H3KA 5I74B 4R9HA 5L8JB 3ARGD 3MV01 4ZS7L 2OP4H 3A6BL 1S7UB 3M1BB 5EFIA 4UDUB 1N0XH 2J6EL 3X12A 1MAJA 3CXHK 5MEQB 2PF6A 4F7CA 2VDOL 2BOCA 2YD9A 4ZO6A 3MLSL 2JB5L 4OLUH 1LE9A 3FB5A 3OG6B 5EUOE 3VGAC 1H8OA 1MFCH 4LEXH 1VFMA 3KXFB 1S9VB 3CLEH 3LPFA 1DP0A 4Y4FC 2AJZA 2VR9A 2XKNA 3BVNB 5D7LE 3QUXC 3MZTA 5DRXA 2UZIL 3EYQC 3HZKA 5HYEA 5IHZB 5EU3A 4ZS6D 2YWYA 3ARDB 1E6JL 3VXMB 1OGAE 3FQTB 4EXPX 4JR9H 1NAML 3RIAF 2VZ1A 5D6DC 3JWDL 4APQC 1J8HB 4FTVE 3QPXH 4KROB 1YYML 5DRNA 3WS6C 5FV2A 3UMTA 5HDQH 4X8JB 4I4WB 1O0VA 4WY7L 2YRPA 5GZOD 3ARGB 1EXUA 5HVHB 3QEQE 4NBZB 3S88L 3N1PC 2F74B 2MPAH 3IDJA 4M7LT 4OCXH 3SDYL 4BSJA 2B5IB 5FA4B 4N0YL 3B83A 1WTLA 1TFHA 3ULVF 1FIGL 3LN4B 4KJPD 4Z18A 4G8GA 3QIUC 1RZIA 4WFGD 1FZMB 1IEBB 4NP4H 1NFKA 2YK1H 2HT2D 4QHUB 1IAMA 3VXRE 4PJGA 1AHWC 1MJ8L 3LKSA 5DMIH 3VJ6B 4FQJL 2J8UF 4YWGL 3OR6B 1YMHA 2YPKA 2E8YA 2XZZA 4JCMA 1ZHBA 3NZHL 1S9XB 2FB4L 1NMAL 5DQJA 3BDYL 1UEMA 4NKIL 4X83A 3DSNA 4P2CG 1R3LA 3AMLA 4TNVK 5D6CB 5HHOE 4GBXD 3O8XD 3JWOC 1A7OL 3I85A 4YR6A 3TBTB 3M17B 5IT2L 1P6AB 5D1XD 2VDRL 3S37H 5CINH 3NCCB 1RZKH 3KLSA 3S8WA 4UILH 5D7KD 3OPZL 2VLJE 3JBG7 4LIQL 5FYJD 1A6VL 4ZO7A 5FM5M 3BKML 1YEDA 3KGRA 3BZDA 2EYSB 4FQXD 4PB9H 2JJUA 2ZCHL 3DSFH 4HLZH 8FABA 1VHPA 1T66D 5IBTH 1U8KA 5F89B 5TPWL 3FQXB 4JZOA 2QADB 1VADB 4Q0XH 3EUUA 2V5SA 1VFAA 2OZ4A 1ONQB 3ZL4H 4PJ7E 5F6HI 1P9MA 2UUDH 3QI9A 4XP1H 4NUGH 3S96A 1RZ8A 4UT7H 3QDGD 5DK0A 1KFAH 3U9UA 3DURB 2FJFA 3NACH 1CFNB 1U3HA 5T3XH 1S7QB 2LU3A 3LB6C 3TWCL 4MZ3A 3D5OF 3HZVA 4ZFFA 1N5AB 1BFOA 5ESQB 1F90H 3QCUH 2ARJB 3PL6D 1KJMA 3OF6D 4HKZB 1LO2H 9CGTA 2UVFA 3KXFE 1JZ7A 4K3JL 4GBXB 2GCYA 3O8XB 5K9JH 1MHHA 1SY6L 3VWKC 4HG4J 5EU4A 5JHDA 4CMHC 5DLML 5TF1H 3QAZB 4L3CA 5D1XB 4KDTC 5CD5D 1OM3H 4OLVL 3UDWA 1BF8A 2Z35B 4QXTB 5DWUH 3VH8A 3UTPD 1ZA3A 4LOUC 5JTWA 1GJIA 4NN7C 4DOHB 4FQXB 3BP7A 4IDJH 1ZEAL 1LO3H 1S9YB 2KQNA 4JVUA 3O0RH 1D7FA 4OJFL 1QA9A 3LH2L 3QPQD 1YEJH 5D2LB 1RJYA 5DUBA 4F7MB 2J88H 2P5WE 5E6IB 3QDGB 4YDLC 2QR0B 2H2SD 4WEBH 2B2XL 4OF3A 4H1LH 4UAOB 1S7SB 2IADA 3O3UN 4KKAC 3NVQA 4LRNL 2IFFH 4LSUL 4JFDD 1EZVY 1QRND 4ZYKA 1DSFH 4O58H 5E2UL 1RAMA 3MLRH 1BVLB 4WW2A 4H5SA 3PL6B 5C8JB 5GGQL 3KPLB 2I9TB 1I85C 5F8QC 4QRTB 5D1QC 1PQZB 1RIVL 2A73A 2FBOJ 3G5ZA 5AYQA 4G3YL 4I8DA 2X42A 1BX2A 2ZZUT 3RY6C 1IAOB 4NKOA 2AEPH 2G2RB 4K55A 4LSVH 3TJEH 3AMKA 1MI5A 1Z9LA 4M7ZC 3ULUH 3BKJL 3QG7H 4UQ2B 1A4JB 2GTWA 5KSBB 4OB5L 4QXWA 1X5KA 3UTQA 4JEGB 5M95B 2F8OA 2VZ3A 3HI1A 3DIFA 4X6CE 4LSSH 1CZ8L 2DQJL 5SV4A 2IQAA 3ARFC 5CEXA 4NOBA 1FYTB 3SGKC 2FZ3A 3GSVA 3IS0X 3P0VL 4G6AC 5I2IA 2B4CL 2E9IA 1P53A 3TO4D 4NWTL 1T5WB 4P4RA 1FSKC 3D0VB 2NZ9C 1LEKA 1I9JH 2F54E 4H20L 5LWYL 3A6OA 1D6VL 3RVTD 2VMFA 5F71A 5E24E 4OTXH 1OW0C 1C8PA 4NQCD 2XACC 1VSCA 4JFDB 1HHIB 2P8PB 4Z7WF 1QRNB 1CT8B 2VISA 4PJ8D 2X9YA 3LS4L 2CDFB 2AK1H 1YNLH 1I3GL 1NGYA 5E4IA 1MIML 3BIAX 4HH8A 1M6OB 3VXUA 1X5YA 1ZLWK 2OQJB 3RGVA 3ZDYF 3IDGA 1ZT1B 1HWHB 4ZFOA 4CVWA 4X7TB 2HYMA 1FZKA 5BVJA 3MRGB 4OCSL 1IC5H 4M6OH 1WWAX 3P0GB 3EDDA 1NL0L 4XPTL 4R97C 4DCQA 5E2VL 1K4CB 2ZPKL 4OD1L 2HKFH 4DKFL 3D0LA 4LCUA 3U1SH 1A7RH 4UIKH 3G6JF 2CKBL 5GGUA 3OWEA 1EVTC 2X4RB 4QOKD 2YA2A 3ZT5A 3QNZA 3CFEA 4DKDC 2DRUA 1UWGH 4OLYL 5GPRA 3VFGH 3H9ZA 2W65A 3PWNA 1NGWB 3CFBB 4P2QA 1NFIB 3W9EB 2MKWA 4E5XB 2EE2A 3QCTH 4JZNA 1CGWA 3BP6A 4PJ8B 4XCYB 4X6FB 2YC1B 5C70A 4AIZA 5D7KE 1G0DA 3I3EA 3O3DB 3ZZ1A 3W11C 1SYSA 1KC5L 3PDDA 3GRWL 4NKQB 2BVUA 3BX7C 1GRWA 1JK8A 1OAUL 4KVNH 1QFHA 5MERA 2X89A 5GZND 1G7LB 5GGSB 4NZUL 5IVOA 5B38A 2EXWC 1KJ2A 2CLVB 3O3AA 3ZHKA 2XQBH 4ZUSB 3AM8C 4UTAH 4HJJH 1OGTA 1HINL 1MQ8A 1J7VR 1TZGL 1I8LA 4ZNEE 2O26U 2DDQH 1I7RA 4RX4D 5SX4H 2ENYA 2VSCA 4R4FL 2AW2A 5HD8C 5EH1A 5KSAD 5EORH 1WFUA 4RGOL 3UYPA 2QHLA 1JVKA 4DZBA 4ZUWA 1MWAA 2ATKB 1VFBB 4QOKB 1KPVB 1TVDA 4HSQA 4U0RC 3ALXA 1RJZB 1FCGA 3MJ7A 4R6UA 2OJEB 3F12B 4PJIE 1RU9H 4OI7A 2OI9B 3ZYOA 3O2DH 1I4FB 1WT5C 4OFKA 4R8WL 3QEUA 3QULA 5JXED 4GXUM 1MVUA 4AEHL 4PRNA 5D7JA 5E8EA 2AKRA 1NDMA 3QJFA 4ONHA 1BP3B 3KPMA 4HH9A 2DQGH 3SKMA 4DAGL 4MHHG 2QSQA 4KMQA 5I30H 3LN5B 4JY5H 4CAGA 2OR9H 3BKYH 2FX9L 1FYTE 3TT3L 1G6RB 1S7WA 1A02N 1YYLH 4DGIL 4DKEL 3GMOA 3MNWA 4KK9C 4RA3A 3WDJA 3RA7H 4Y2DC 5GRZA 3BAEH 1YA5A 1I9IH 1BM3H 1AQKL 5CP7B 5KSAB 5DUMH 4CDGC 4JFDE 2NMSA 1FVCB 3BGAA 1AXSA 4OM0H 4OFYD 4LVNB 2VIRB 5CBAA 4IOFC 5I75C 3IDNA 2P1YA 3RWEA 4OF5A 2YUZA 2B8OT 3HZYB 4HT1L 3FO9B 3MROA 3SDAA 4UUJB 4GXUN 4HUNB 3WLWC 5INCA 1HHJA 3GNML 3BW9B 4P59L 4RMRA 2DQCH 4KRNA 5TFSL 3TP4A 1B0WA 2XTLA 2V2XB 3N9GH 1FJ1B 3WN5A 5IROC 3AU1A 1R3IL 1JNLL 2R9HD 2GFBB 1G9ML 1DDHB 3IJYA 3FN3A 1YY8B 5DUPH 4GQ9H 2YR3A 5E08H 4MJ2A 2MCPL 4MX7A 1CF8L 4OGZA 1FZOB 5DD5H 4XVSH 4D9LL 2WBJA 1SEBA 3K74B 2AABL 2YD4A 3W5NA 1P7KB 5T3ZD 5KVEL 1KENH 5EUOF 2X5PA 3CDYA 3CNKA 4JG1H 1WAAF 2LV4A 1ORQA 3I3DA 4MNQA 2BSSA 2Z4QA 3CFDA 4TSBH 3V95A 4HCRH 4B7IA 2FNBA 2O5YH 3S97C 3W81A 3RZCC 1JZ2A 3TCLA 5I66B 2FR4A 3D3VD 1A9EA 1ITBB 1U93B 4U1IB 3FQNA 1FO0H 5IFHL 3KR3H 5KJRH 2HTKC 1J18A 4OGYL 5JW5A 5AEAA 1SM3H 5ADOH 3L3KA 3BH9A 3KG5A 5C0IB 4TNWF 4M5ZL 1FBIL 3E6HA 3BEVB 1BD2B 2Q8AL 5CMAA 2R4SL 4QXUH 4Q9CA 3MMEB 5IJVB 5L88H 4IIQC 5IB3B 3M1BA 4UDUA 1UKSA 4QRPA 3FQUA 1PZ5A 2Y1VA 4P23D 4BFGA 3PHSA 4R0LC 1PBYA 3O4LD 1T83C 2AQ3A 5H35B 4RFOL 3NBNA 2DN7A 3UBXG 3HN3A 3SBWC 3D25B 1E28B 2OL3A 5JOPD 4U1JB 5I8OH 2I26N 1I1AB 3MNZB 5IHZA 1UGNA 1OAXH 1RZFL 1E4WL 2WUCL 1MFBH 1AI1L 4O4YH 4Y5YC 2EEDA 4M1CC 3D3VB 4LASH 1JGDB 4P5TC 2GTZA 3ZHLA 1KGCE 3FQTA 1N6VA 5E95B 2LFGA 3WFCL 4V1DD 3LEYL 1J8HA 5ICZB 5D8JL 4KTEH 3MBEA 3MXVH 4KQ3H 3CX5K 5BZWB 5KTEH 3G08A 4CL7A 3JVGC 1WV7T 5D7SL 1FIEA 2BVPB 2H32H 4X6BA 1W72B 5JDJA 5SWSB 1EEZB 4EOWL 5CJXC 4E41A 4BM7A 1W0VB 4Y16A 4PJAB 3RWIB 3OKNA 4P23B 1GGCL 3S5LB 5I19L 4OZIA 5J12C 3O4LB 2JCCE 5HSFA 4JFPA 2ADGB 4YHYC 4HXAL 3DV6B 3KJ4B 2OZ4L 1OLLA 1FZMA 1IEBA 3TN0D 2HJLA 3OKLB 5CZXD 3DMMC 4MGXA 4YHPB 2H8PA 2EYTB 1N3NB 2N7BA 2VL5B 4XC1L 5I73C 1RIUH 1I7UB 4KY1H 4QHUA 4N5EC 2FEDC 3ME0A 4L8BA 3MYZA 2Q6WB 1KN2H 1N8ZB 3VJ6A 2P49B 4M43L 2Q76B 4G7VH 4KGJA 4XCCL 2DIBA 3GB7B 3SPVB 3MRFA 4RSVA 3IXAB 4PJ7F 3GBML 5E8PB 3MJ6A 4V1DB 4JHBA 1FG2B 3TH2T 1A4KB 3CVIH 3SDCC 1UB5B 3HMXA 4JREC 3STZB 4OCRH 4I0KA 4QRQB 5T1DH 1ZHNA 1KLGB 2N1KA 4G8IB 2AEIT 3UBXB 3WDHA 4NCC1 3TBTA 5SWQB 5LXGL 2R29L 1ROWA 4OZGB 1BFVL 3WNNA 3WFBL 4EN3C 3P4MA 4C4KO 1W8NA 4KKBD 1A6PA 4YHZL 4IRZL 3DVGB 5DVMA 4HZLA 1NUFA 4Z95H 3OKYA 3TN0B 3GJFA 3L5WA 4X9HA 5LGHH 1NBVL 3WYRA 5EA0H 5BS0D 1Y6KR 2LTQC 5T33H 1QLRA 5MEOA 3F7VA 1ONQA 4WHYH 1I8KA 4XPFL 5F1SA 4EVNA 1OD7A 1CGUA 1Q1JL 2BHUA 4Z7QE 4WI4A 1F13A 4ZD3H 3LQAL 1U8IB 1TQBC 5FYKL 2VAAB 1BD2E 3WJLC 4F2MA 4HV8B 1LE5B 4FA8A 4IRSC 5D5MB 2H3NA 4ZNCD 1HEZB 1EZVX 2DBLH 1D9KD 3QUML 2YZ1A 3LCYA 3OX8A 5EOTB 5I8CA 1FNSL 2CXGA 2ARJA 5FK9A 1PVHA 4ZDHB 5T3ZE 3O8XA 1XR9B 4M3JA 1MY7A 1AD9A 1IAKB 3ALPA 2Z92A 4PJCA 4K2UH 1ZVHA 4QXTA 3X3FH 1S8DB 2VDKL 3U0PA 5C0AE 4PRHD 1RUML 2UYLB 2EIBA 3THMH 2QV2A 3D3VE 3MRLA 4J8RB 3FONA 3TYFA 1S9YA 4WJ5B 4UBDC 2YPLD 3PWPE 5I1CL 1FH5L 3NFSL 5BS0B 1R5WB 3G6AA 3QDJD 4LVEA 1R3HB 1FORL 5DQ9A 1MCEA 3ORJA 4F7MA 4X6CF 5BV7L 1GCFA 3N85H 1A5FH 2X4OB 4JM2A 5IHUH 2V5RA 2UZXB 5FO7B 4BUGA 2FX7H 5DFWH 5SWSE 2XKUA 2VKWA 5JXAL 1CFBA 2B1AL 4M6NH 1D9KB 5DJ2A 1Q0XH 4KTDL 4KMTH 1S78D 4L29A 3AXLB 4ZFOL 1BVLA 5EB9A 1OCWL 5BVPL 3OF6A 4FP8H 1UWXK 2WLYA 1J0YA 5CWSA 5LAXA 2BHYA 1Z9MA 3QEGL 3B4NA 3MRCB 2FGWL 1IBGL 1NFDA 4NQEB 3BP5A 4ODSH 5JOPE 5FECA 4TTGA 5TQ2L 5IG7B 4J4PC 3K1KC 1U8HA 2IEPA 2DD8L 1CVSC 4PRHB 1YDPB 4XWOC 4ISVA 1R3JA 5KSBA 3V5DB 1H9VA 2MOVA 1B0RB 4GG8B 1KXTB 1U92B 2YPLB 4XP9L 1T89C 1XF5A 3PWJA 5C9JA 1FP5A 4XXDA 2QQNL 3QXTA 4NPYB 2HLFD 3QDJB 5B3JE 4UINL 2NPLX 2IPTH 2PW1A 4P48A 3SDDD 1UM5L 3ARSA 1PSKH 3QA3A 3SJVD 1T5WA 4KUZL 2YXMA 4P4KD 2WQ8A 1JP5A 2AJYH 2G9HA 2BVQB 3L95B 4ODVL 1LO0H 2JJTC 3O3EB 4Y4KA 4LSPH 1XH3A 2GSIB 5A16B 3TVMC 1QRNA 2X4SA 1P1ZA 5CD3A 2CK2A 2CDFA 3QFDB 1U91A 2GQHA 4KKCD 4PR5B 4HUMB 4FNLL 5IW1A 4UT6L 4I2XA 4JO2H 3GI9H 3PUCA 4ZXBD 2ZSWB 4JKLA 1BJ1J 2R0KL 5DD6B 3MRGA 5ITFB 5CEYA 3HKFA 2AJXH 1T1ZB 2J4WH 1RZ7L 3DGGB 4HWBH 4PGDA 5TDPA 1G9MC 3N1FC 1BQHG 1CG9A 3SDXF 1QACA 5GRJL 1PG7L 3OZ9H 3V4UH 1P4BH 4NZRL 2HMID 4B0MM 5ILTH 3C09C 1QSVA 3N1GC 1AY1H 2X4RA 3VFOB 3PP3K 3TO4A 3SDDB 3SJVB 2E7LA 4Z7OF 1KPRB 2XRAL 4R2GD 3RGHA 3WIFB 4P4KB 4IOSD 3GM0A 4PGCB 1EHAA 5EUKB 4BZ1L 5BXFB 1MCIA 3CFBA 1CD9B 1AGBA 4NJ9L 4NQCA 2WNGA 1UVQA 1TVHB 5I15L 5EIVA 2NLJB 5AZEL 2WZPD 1DQML 2H2PC 2NX5B 3C5SB 1UH3A 1CFSB 2A1WH 3LKNB 3PV7A 1CD0A 4ENEC 4DZ8B 4XNZC 2P5EE 3LKOB 4XMLL 4M61B 5IVZB 5DGQA 4Q9RH 4KJWD 3UAJC 4ZXBB 4DN4H 4XPBH 12E8L 1J0HA 2V17L 1QSZA 1BQUA 1FPTL 1KACB 4P5MA 4PTUB 1ZSDB 1K6QH 4U4BA 2ICEB 3MA7A 2IAMB 4RMWA 1RK0B 3BHBA 3KPSD 3T0ED 4H26A 4YHMH 1A21A 3L7FA 1LVEA 4U1GB 4GQPH 2FYYA 2DLEA 5I0DA 5CKGA 4HFUL 3CVHB 3MOQA 1U2HA 2XXCB 4QOKA 1KPVA 5K93A 3MFFB 1RJZA 2KBGA 4G8EB 3MGOA 4R2GB 4ZSOA 4UIMB 4L4VD 3T0AA 1EO8L 3IFPB 1OHQA 4JN2A 4NQEE 4NO5B 4ZPTB 1JGLL 2X70A 4MCYB 4FQQA 2WK2A 1KTDA 1I3RA 5IMLB 3QHZH 2APTA 3BT2L 1S9WA 4I0CC 5IM7B 3GIVA 4HUWA 4PRHE 1JZ6A 4FMKA 4JFXA 4LPYA 3BE1H 2GITB 1JIBA 1EMTH 4LCYA 2K7PA 1K4DB 1DEDA 4PPTA 5GRXG 4JQVA 2MQ3A 3WXWL 1TTUA 4G5ZH 4PJ5A 1R0AL 4JDTH 2OBGA 4DGYL 1CE1H 4JFEA 2IMNA 3O6LL 1XGQB 3KPSB 3OXRB 5DEGB 5J11C 3A6BH 5CJOH 5AWNH 2AK4A 2AXFB 5DJCB 1HK6A 1W0YT 4W4OA 5KSAA 3ULUD 3MBXH 3WUWA 1NGZB 4HK0B 2R2EA 4QRSA 4LLMA 3GSNA 4FXLA 2HT4C 4BFEA 3HUJF 4NBXB 4WRLA 4YIQB 3LKPA 1P9MC 4NOFA 1CXEA 3QI9C 1KJ3L 5J1AA 3MJ8A 1QSEB 3NCJL 3HZYA 4L4VB 1QQDA 4L9LB 4UUJA 1U3HC 1JPGB 5KSUB 1LEIB 2XN9D 1LP9F 3SN6N 5I1IH 1FNGB 4D9RD 4LQFL 2IG2L 4Y0GA 1J1OL 3GMMA 3BZEA 3LQMA 2IBZY 4KKLD 1LMKA 3L6FA 1RD6A 1JV5A 3UX9B 3ZE1E 5JPNB 3TIEB 3V6OE 1OSPH 3JWDH 2GFBA 4ONGH 2HLAB 3QJHB 4Z7UB 3PGDB 5B21A 1SYVA 1W0WA 1S7VB 4HS6B 3ES6A 4WY7H 2OL3L 3UDWC 3KPRE 2Q20A 5BJTA 2VDMH 3FCTA 3HNSL 3MLVH 4PRBB 3GM8A 3VXNB 1KXVC 1Z6JT 4XXCA 1GXEA 4JPWL 3SDYH 4LU5H 1P7KA 2FECL 1TJHH 5F70A 3MR9B 3OXSB 2NX5E 1BQLH 4OF6A 5CP3A 3QUYD 4WUKL 3MGAA 4TUOB 2YD2A 2ZUUA 1HHGB 4WTZA 1IC4L 4QHKI 4OF8A 3QO0B 4K8RL 2AXGB 3VA2C 2AGJL 2D7MA 2FWOA 3ZKQD 1U93A 2XN9B 2JB6A 5K9QG 1AP2B 1NC2D 2DKUA 3TA3A 1C5BH 1NMCC 2D4DA 4PS4L 4FQJH 5HPMB 4R4BA 3LQAC 1FVEA 5DK3A 1ZLSH 1CLYH 2V2WB 4HAGA 4WW2C 3MCLL 5F7MC 3S36L 1EIBA 4AM0A 4DFIA 3JUZA 2J8UA 4HC1A 3GMLA 3BPLB 4U7KA 3NZHH 3RIFF 2ITCB 2IF7A 1MNUH 2FB4H 1NMAH 5IB3A 4AEIL 1FZJA 4GKZB 4NKIH 2YKLL 1E4KA 2PETA 32C2B 4GW1B 4XPAL 3QXWA 5H35A 1A7OH 2NY1C 4YUEL 1NH6A 3GMQA 5IEHA 2FO4B 3S36X 2XQYG 3D25A 2JCCF 4TVPL 4K71C 4PV8B 4S1RH 5HI4D 3KYKH 2Z9TA 5FFLA 2MWCA 3O11B 4LIQH 1ITCA 3QUYB 1R24A 4I48A 1U8JA 3JSSA 1OPGL 1VACB 2H41A 2ATPB 3BKMH 2DQUL 3KWWB 4MB4A 2DQDL 3FFCE 2F5AH 5IMMA 3CDGB 2CK0L 2DLGA 5HHME 1M7IB 4R26H 2AV1B 2NXZD 1X5XA 1CYGA 3QQ3A 1NC2B 2NY0C 5E9DD 4UV4H 3T0DA 5ICZA 2BNQD 4OM1H 1MF2L 3MRNB 2JELH 3ARBD 3KPSE 4OZHF 4BQ9A 5CLTA 4PJFB 4QTIL 1G0YR 3DO3A 3H0TA 4JAMA 35C8L 3L3JB 1H5BA 1LK2B 5FKAA 3RGVC 1PLGL 5HGBB 1U8PB 4PV9B 1MJ7H 3TLRA 1PGRB 1XCTA 4PJAA 3RWIA 3S5LA 2WW8A 5JR1H 4MA3A 4NHCL 5DJYA 3HZMB 4OLWH 4Z0XA 3DV6A 1QSEE 2E7CA 3DHJA 5DLMH 1CLOH 2GJJA 4WO4A 3UTSA 4U7SA 2W0FA 1N3NA 2HN7B 3MUJA 2APFA 5F7UA 1JYNA 4XAWL 1ZEAH 2Q76A 4LK4A 1RIHL 2A0LC 1XF3B 5EZLB 2VN4A 3QH3B 2NXZB 4M1GL 5K59F 3F5WA 3IDIB 1ZOXA 3IXAA 4Z7UE 5GGTH 2VABB 3VGEA 5E8PA 4TUJA 5E9DB 1FRGL 1EO7A 1HHKB 1HCFX 2R8SL 4LPXA 5IQ7H 3BPNC 2H6PB 5I71C 1BIIB 3V0AC 4XNUL 4RBPH 1JFQH 2NY7L 1ED3A 1M71B 1UXSB 1KLGA 4OUOA 3FL7A 3IB4A 4LSUH 2Z93A 3FB7B 1QSFA 5E2UH 5SX5K 4E9LA 3CUPA 4OZGA 5E94A 5AZ2L 4MD0A 4X5XB 3I6LD 3MCKB 5I1DA 1RIVH 2CMRL 5C08D 2D31B 1I8LC 2Z8WC 1UB6B 4PD4K 2QJDA 1GPOH 3W5MA 4OCWL 5EWIH 4NRZB 4K23L 4ZQKA 3VXOA 2CRIA 3RWJB 4QY8B 1DQLH 4MNGB 4IRJD 4KUCF 4RA0C 4NQXB 2ERJC 1SEQL 4M1DL 4OB5H 1IGFL 1U8IA 1ZE3C 1QFWI 5ADPL 4DQOL 4XVUC 1LE5A 5HJ3A 5D5MA 1MAKA 5M7QA 1IM3A 4PLKC 3SE8L 2B4CH 2IH3A 1P4LB 4YAQB 3UJJH 1LDPL 4NWTH 5D7JC 4XH2B 1XZ0B 5LWYH 1D6VH 3NGBB 4KHXL 2OLDA 5C09A 5F3HB 3T3ME 3GSWB 5ALBH 3Q3GA 1R3KA 3HG1D 5HVGB 3GJFK 1H3TA 4Z7WA 1MIMH 4XB7A 2WAHA 5C08B 1S5IH 1S8DA 1CD1A 1KIQB 2M8XA 4TULL 4XNMB 3UEZA 3DO7B 4M7LL 4EI6A 5HI5C 3L7EB 1DBBL 4J8RA 4GW4A 1HNFA 4HKXB 4PY7B 4ZOBA 2VXQH 5DJ0B 5DEZA 4R4ND 4YXHH 5GXBB 5F96H 1G7PA 1ND0A 4EBQL 5BS0A 2CPCA 4IRJB 2F53D 5I76A 4RGNC 1NL0H 4ONOA 4X5LA 1I8MB 3TEUA 2P46B 4FXKB 5CEZH 4Q6IB 4PJFE 2EDHA 5E2VH 2ZPKH 4OD1H 4L3EE 2X4OA 3RPIA 3SDAC 5FO7A 4F7TB 1T6VN 2CKBH 5JMRA 3U36B 2J7LA 3CDCA 3UP1A 1UH4A 2ARWA 2KH2B 4OLYH 3G6JA 2DM7A 2NY6D 3AXLA 4KK6D 4HZAA 4MD4A 3BSZL 3WN5C 1SJEB 2EDLA 1J8KA 1G6VK 3MRCA 5E1HB 1A7QL 1ZHLA 3HG1B 1RFDH 2VERN 3JV6A 2OTUB 4IM8A 4RMTA 1OWWA 3WEXB 4NYLA 3FB6B 3IETA 3GRWH 5IMOA 4Y5XA 4JDVB 1MRCH 4PLJC 2DMKA 3L3GA 2WBJC 1JI2A 4P3DB 3RUGE 4GG8A 1U92A 2YPLA 1E4XL 1B88A 5E9DE 5GSRA 1AD0A 2ICES 3K2UH 5DEFA 4M7KH 3LD8B 4NPYA 3QDJA 2F53B 1XEDA 3AY4A 5INDB 1AQDB 1IAIM 3MRPB 5ICXA 1PY4A 1MHPL 4Y4FD 4D0BB 1ES0B 3QUXD 4U6XA 5F7FA 3EO9H 3EYQD 4OZFH 4JRXD 1LGVA 3CJJA 3CXHJ 3PP4H 1YEIH 2IANA 4GH7B 3L95A 4LVHB 3O3EA 4X98B 5FO8B 2GSIA 2YA0A 3BWUC 1EGJH 2NY6B 3UO1L 5KANI 5GIRA 5J13C 2XWJA 1S3KH 3CSYB 1FCCA 4APQD 3VDBA 3DVIA 1A7NL 43CAB 4AEHH 5FCSH 4MNGE 1F4WH 4LSTL 4JY4B 5DD6A 1CL7L 3HAEH 5CGTA 2H32B 4DAGH 2C1OB 5ICYB 4GG6F 3QRGH 5FB8A 3FT4A 1CICA 3U82B 1KEGH 2FX9H 1BZQK 1VGEL 5KG9B 4D94A 3TT3H 4RGMC 3VGAB 4DGIH 4DKEH 4MXQC 3OKEA 5C0BD 2FIKB 3B3IB 4UDTA 4Y4FB 3T65B 3IVKB 4LCWA 2P24B 3QUXB 4TPRH 3REVA 1IL1B 3BH8B 5FM4A 2R0ZH 4JRXB 2GUOA 4NQDA 4P4KA 3OKDB 4XPHH 4JFFA 5LGJA 1VA9A 3MNVA 5DJDB 3NIDE 3LRSA 1ZWIA 2NLJA 2W60B 3H3PL 1FAKT 3C5SA 4HWNA 1KB5L 4KROC 4WU7B 5C08E 3C60D 3MBEC 4F33A 4K8RC 3ARTA 3FO0H 4APQB 1BJ1H 1JCKA 4JHWL 1JHKH 1JGUL 2Y5TA 4XVTL 4OFIA 4DW2L 5J3HC 5KSVB 3GNMH 4P59H 5TFSH 5DHYB 4QCIB 3NPZB 4HMDA 4PJBF 3U79A 1XF4B 4Y16C 4M6AA 5JW4M 4CGTA 3E8UH 1RK0A 3GSNL 1KYOK 3QXDB 4XTRC 3Q5OA 3G5XA 25C8L 3TCXA 5EZJB 1MREL 4QHLB 1CFQB 1X5HA 3HE7A 3QCVL 3WFHA 2FATH 1PG7W 2HFTA 4EIGB 5C0BB 3PWUB 1JF1A 4ZS6C 2FECI 2X7LB 1CGSL 4U3HA 4XCNB 1HQRB 1F11A 2ZOKB 2AABH 3RI5F 3S3JA 5C0CD 3F58L 3WXVH 3DX6B 3ZKND 1AHWB 2AJ3B 1DBAL 1T20B 3ET9F 3T2NH 5EUOA 2IBZX 1T1XB 1GZQB 1LK3L 5IMLA 4HIEB 3C60B 1WAAA 4XNXL 1C5CL 1N5YL 1NCAH 4JRWA 2ICWA 3FOMB 3NA4A 1DN2A 5DK2B 5D7LA 5IFHH 2HVKA 2EC8A 1WZMA 3LB6D 4AZ8A 4OGYH 5JW4N 3C5ZA 4U1NA 2F53E 1VERA 2ZUQC 1YEEH 3D39D 1G7HA 3LEXA 5DR5H 3HR5A 4LFHG 1UCTA 2DQIL 3D2UD 4M5ZH 1FBIH 4MAYD 3T0EA 3HNVH 1MJUL 2C1PA 3ULVL 3CMGA 2CO6B 5DJCA 1NGPL 5HYSA 3C2AH 1KCSL 2BC4A 3NA9H 4LOUD 4KRLB 3S9DB 3GUTB 4RMVA 1NGZA 4XMPH 2R0LH 3QEQA 3KPNB 4KRPC 5J06A 5ID0A 4YIQA 5C0CB 1SBSL 3KS0J 1JN6B 4ZUTB 5GS2H 4YHOH 1I1RA 4KK5C 5EN2B 5K9KB 1TZIB 4L9LA 5E8OB 5D70L 4YDIL 3Q6GH 5DDHB 3VFNB 4I3RH 5T5NF 2NXYD 4HC1L 1E4WH 1KJVB 3L3HB 4BA8A 1AI1H 4RDQF 4F3FB 5GS0L 4S1SL 3L3OB 1MHEA 3P4LA 5CFHA 5E2JA 3BRFA 2DWEA 1F4YL 1L0QA 1QHOA 4H1LA 4NKMB 3K7UA 5IB1B 1QYGL 4PGZA 3TIEA 3REWB 1T3FB 2FX8H 2UY6A 4JN1H 2NW3A 3O8XC 5KBNC 2BP3A 4LPWA 1IEAB 3U2SB 3GHBH 5D8JH 2BOBA 2A6KA 3QAZC 5JPMB 1QNZL 1V7NH 4BKLA 2CDEB 4QT5A 2DLIA 3D39B 1IQWL 3KPPB 4FQ2L 3D2UB 2BCKA 4YFLI 4LLDB 5D7SH 4CMHB 1N59B 4JFHD 2XOTA 5E00B 3TO2A 3VXNA 1OB1A 3PNWB 5F9AC 5EO0B 2C3WA 4BZYA 3IDMB 2RCSH 3GO1L 3ILPB 5T1MA 4EOWH 1YEHL 2GT9A 5T5FH 3PIQA 3MR9A 4NN7B 2CLRB 3K81A 4PJEF 5F1NA 4HXAH 1GZPB 4XI5D 2C7UB 5D72H 5ANME 5F7HA 5DZLA 3IAPA 1NCCL 2XZQL 1NLDH 4HJ0C 2EH8H 2WINB 4NJAL 4JM2C 3Q6FA 3ARFD 3V5HA 3U6RB 2NTSP 1E4JA 1IGYA 2NXYB 5IJKA 5D9SB 4YDLB 1WSST 2NZ9D 1DE4A 3U7YL 2R23B 2HG5B 4N1CA 4X6DE 5JUEL 4XCCH 3IF1A 4JLRB 5IV2B 1Z0MA 4L9DA 3GBMH 3RIAK 1J0JA 1KPUA 5EIQA 3ULSA 4GOSA 3RPKA 4W68A 3U4BL 2DLTA 4G7YL 5ERWB 1IC7L 4YO0A 4QRRD 3UROR 4NNYA 1KCRL 4NC1C 2XWTA 3G5YA 2DLHA 2R39A 4X80L 3T77A 2R29H 4G6KL 5LXGH 4X7FC 4RWHA 3IFNL 1INQB 4K7PH 4N8PA 4YHZH 4IRZH 3QPQC 2XZAH 2ADFL 2ATPA 4NRXA 2H2SC 4P2RA 3VFTA 1M7IA 3ARFB 1NBVH 2PCPA 5EO9B 2VTFA 1ADQH 4Y4KC 1FSKB 4XPFH 1TITA 2A6JB 3MRNA 5FGSA 5FYKH 1OAZL 4QF1B 1C08B 4FRWA 2C3HA 3CC5B 2H9GB 1TQCB 5HDOA 3QUMH 1UH2A 1X4YA 3HLAB 3CPLB 3MX0A 1FNSH 1WJ3A 1F6LL 4CVUA 5GRUL 3GFUA 1MVFA 2I9LB 4QRRB 1T4KA 1I9RL 5C0CE 3ZTNL 2Z8RA 3BUTA 4C83B 3HI5L 1U58A 3CFCL 3L9RB 4WTWA 2EXWD 4RFEB 4R90L 2XPGA 1CCZA 3IJSB 2DI9A 2D03L 2HN7A 4R97B 3NABH 1IEHA 4GRMA 1KF9B 3OGOE 2NY4C 2Y5EA 3TO4C 4CVZA 4PRAB 2E7LC 2ITDA 5TGBA 2E9JA 1LHZA 3RVTC 3FAWA 3TNNB 3IAGC 2DQTL 1KLUA 1FORH 2JJVA 1N2RA 2BNQA 3MV7A 3IFOA 4XBEL 1NCNA 3AFLA 3O2DA 5BV7H 3ARBA 5L2KD 5C9KA 1WCQA 1KNOA 4HGWB 1RZGB 2AJVH 3RWHB 3KHOA 4WI5A 1ZHKA 4X6CA 1K5NA 2B1AH 1HE7A 1IE5A 2L7UA 2MTPA 5EIIB 4UOJA 1K8IA 1OCWH 5DI8A 5BVPH 2R69H 5FUOH 2F54A 4Z7VB 5E2TL 3RVVC 4A2MA 4LKXB 2W59A 3FT2A 3QEGH 4C56A 5HYJB 1UB6A 4N0CC 2JIXD 4PREA 4NRZA 2EIDA 4L5FL 4LLAA 3QUKB 5IFJB 4KK9D 2DD8H 4NQVA 3V52L 5LCVL 2AEWA 1ZLUK 1CLZL 3FHAA 1U41A 1E4XI 2ESVD 2HTLD 3SE4A 4HIIB 3P0YL 2DL9A 4XP9H 2A83A 1I7TA 1JPTL 4U0RB 1MJJA 5JORA 1DLHB 5EU6D 4IOFD 1QFWH 2VZVA 3D69B 4RIRA 2NCMA 2P42B 5L2KB 5I16A 4JFHE 3WLWD 5ECJE 4TOYL 2OP4L 4AG4H 4HUKB 4ODVH 4CU6A 3FHQA 3UPRB 4QHMA 4EQ2A 4GAGL 1N0XL 1F42A 4JCLA 3Q1SH 4HFWB 2DQFA 1WZKA 1DTUA 3FTGB 2RBLA 4HIHA 4JQVC 5GZNC 4QRUA 1NAMB 1HYSC 1YEKH 4OLUL 2BK8A 3CDFA 5IB2B 3CLEL 1SMAA 4FS0A 2JIXB 5TE6H 3BQUA 4Z8FH 3CLFL 5DJ0A 1PZUB 2R0KH 4E42B 1WK0A 4W4OC 5KSAC 5ELIA 1UQSB 4Y2DB 3DROA 1AGDA 3RUGF 3OGCB 4LVNC 3DUHA 4FXKA 3KYOA 5DJ6A 1H3XA 4M7JH 1NBZB 3F8UB 4MJIB 5FYLE 5GRJH 4JR9L 1WC7B 3VXSB 3MUGB 5AUMA 5EU6B 5C6WH 1OP3K 4HCRA 3QPXL 5I75B 2FHFA 3U36A 3SDXA 1LQSR 3IDYB 5HDQL 4QRRE 3TNMB 1FO0A 1RULH 4EZMA 5H37G 3UTZA 1Q9LB 4DWHA 4CJ0A 4BZ1H 4LLWA 3MREA 4FMFA 2MPAL 2Y36L 4NJ9H 2OCFD 4KI1A 3OKMA 3S34H 3VFUB 3WSQL 3KNBA 1DQMH 3P4NA 4K9EL 4FN0A 3BGMB 1A2YB 5DS8A 1TDQA 5I9QC 2GEEA 2AJSL 4XMLH 5IOPB 2CIIA 5JQHC 4L8SA 4I0PA 4G6FD 4G9FD 4NP4L 4O51B 4KGLA 2XFXB 4XXCC 1JWSA 1FC2D 1TIUA 5DTFB 4FFVC 2JJSA 3RNQA 3KYNB 1BOGB 1UYWH 2YK1L 1FPTH 1GHFH 1NEZA 1CD8A 1RUQH 3GMNA 2G60H 4GRWH 5INDA 5DHVH 4PJBB 1JNNL 1GVIA 2COQA 1VEOA 2IALA 3Q5TA 4D0BA 3VRJB 1Q72H 3CH1B 3VXTB 1DUYB 2ADIB 4Y1AD 4P3WA 4EDXB 4YNYB 5C7XL 5DRZB 3X13A 1T04A 4HFUH 1RPQA 4X98A 3ZDXE 5FO8A 2EXYD 1QO3A 3TA3C 4M1CD 3TBWA 1EO8H 3QIBA 5HYJE 1ORSB 1UWEL 1BVZA 3U46B 5GS0C 1HN1A 3NIFF 5CINL 2DB8A 3BT2H 4P46D 1AR2A 1RZKL 3IJHA 4HKBA 1EBPA 4ODXB 4NRYB 5JW4Q 1E4KC 3KPQA 2JF1A 4IIQB 4U49A 1J05B 4L4TD 1U3JA 4G6FB 4PB9L 1FQ9C 4G9FB 1KIRA 2BY1A 4CVXA 3MV9A 3HR6A 3ZE2E 4G80B 4R0LB 1AGCA 5FAAA 1NDGA 5IB5B 1R0AH 4WEMB 3O6LH 5IQ9B 1I1YA 3CX5J 5IHBA 4HEME 4EIZC 2YN3A 1KCLA 2CRYA 4XP1L 3S37X 3B3IA 3DMMD 1KTLA 4UT7L 5C0DA 3RJDA 4M8QB 5T3XL 5MP6L 4JJHA 3JTTB 3QNYA 3MRIB 1YC7A 2E7HA 4D9QD 3LMJH 2FEDD 3HHRB 4Y5YB 3VGDA 2W60A 2CKNA 2YN5A 1F90L 3QCUL 2YBRA 3HRZB 4BELD 1LO2L 1F6AA 3GSQB 4HUXA 2VE6A 1ACZA 1RUPL 4L1HA 1INDL 5K9JL 3HUJA 4OLEA 3SDCD 1H5BC 4MVBD 4JY6B 1A6WH 5DRWA 5TF1L 4LQFH 3SKOA 1EPFA 3RU8H 3P9MA 3TPUB 4P46B 5B39B 2PYED 1LP9A 4ETQA 2QQKH 4HEPG 1C16B 3FO1A 4XGZB 2Q3AA 4L4TB 3EOTL 4IDJL 4YEFA 3IU3A 4MJIE 1JHTB 1LO3L 3KJ4C 3DETD 1DVFD 3VXSE 3O0RL 4WCYL 2QQQA 4XX1G 1TCRB 1B0GA 4EN3D 1CFQA 5J12B 4WO4C 4Z5RB 1M7DB 1U36A 4ZUVA 1D5XA 1PDKA 1YEJL 2OL3H 4LHUG 4HIJB 4QTHB 3DMMB 2X7LA 3P77B 3BO8A 3H9SD 4HGKC 3TH3T 3DX6A 2BNUA 5DJXA 5IBLC 4N8CH 5I73B 4NHUA 1H3VA 3VI4F 1HKFA 5EBMB 1DSFL 4O58L 5CSBA 2K7QA 3MLRL 4KPHH 4GKOA 3C60A 1Y6NR 3V0VB 4IRSD 3CSPA 1LEGA 4OFDA 5DK2A 3U4AA 4P99A 4NDMA 5HGDA 1EAPA 3SDCB 4JREB 2HRLA 5D7IE 4LBEB 2Z8SA 5J1SC 4PS4H 1J10A 4LSVL 3TJEL 3V7AG 1T1YA 5J56B 1JMZA 3ARXA 3MRHA 3QG7L 3GJEA 4H8WL 1DVFB 4N8VG 2ZUXA 5TE7H 4W6XB 4EN3B 5CZXC 1Q8MA 1I7ZB 4LSSL 4U6VL 3ESUF 1PW3A 3MRQA 2BNRA 3MRBB 4XPAH 3ESVF 3KPNA 4Y19D 2MQ0A 4YUEH 4UBDD 3H9SB 1EEYA 4MA7H 1I9JL 2UUDK 5E99L 3UXFA 4DUXA 4ZUTA 3D18B 2YRZA 1QBLL 4M4RA 3HAEG 4PBXA 4OTXL 1TZIA 2LTQB 5E8OA 1HILB 2AV7B 3FQRB 1G84A 2UWEB 5DDHA 3I84A 3GSXB 1OPGH 4U1LA 1RHHA 1RMFH 2DQUH 3VG9B 2DQDH 4PBVC 1YNLL 4PRID 4IRSB 1Q38A 2CK0H 3OAZH 5GGRB 2CKBB 1KLFA 5DURD 5IB1A 2K9UA 4BSWA 2CUIA 3EHBC 4X6DF 1T22A 4JPVL 3U2SA 3ROLA 3CCHB 4W81A 3SGJA 1RJLB 4JQIH 5JPMA 4LHUB 1IC5L 3D39A 4M6OL 4QTIH 2ADJB 4TNWK 4MAYA 35C8H 5J6GB 4LLDA 1OWRM 1CIDA 2YD5A 1A64A 4NZTL 4OZHA 4P5KA 1PLGH 3PJSB 3PNWA 4J4PD 2HKFL 3ARPA 4FXGB 5GISL 3U1SL 3WFZA 3TBSB 1CDBA 1CR9H 3KS0H 5AG8A 3GMPA 1MSPA 2CLRA 3WE6A 2WWMC 1UWGL 5T1LD 4UNTA 1MELA 4XP4H 5EO1A 2J3SA 3MRDA 2JTDA 2WINA 4XBGB 4NZJA 1F3JA 4NCDA 1FN4A 1BZ7A 4KU1A 4OZFB 1U8QA 1B6DA 3QXAB 1TXKA 3BP4A 1MHCB 1RIHH 1AR1D 1HQ4B 4XRCB 2G75B 4ZFZB 2EKJA 2XICA 5DURB 4M1GH 4K3HA 5IV2A 3SOBH 3O4OC 4S1QH 1LO5B 3TVMD 1U8OB 4M93C 4N8VB 4TSCH 2H1PL 3D9AH 3W0WE 3M45A 3I3BA 1CDUA 4ZUUA 2R8SH 3KLHD 3A67L 2HFEA 3CU1A 3EYVA 5HHPB 2XQBL 4XNQA 5GRWA 4MS8C 4HUUB 1VGKA 5DXWA 5C0NC 4Y5XC 2A74B 2C5DC 4AJ0A 4NT6B 4JFQB 4D9QE 2GK0B 1L7IL 2AXJA 3HAEB 5EORL 3DX8B 3L3DB 3VRIA 5IWLA 1T1WA 3AAZB 5CHNB 3MRKA 2CMRH 3MLUH 3AY4C 1RZJL 3BDBA 5T1LB 1CXLA 3RNKB 1D5ZA 1RU9L 2SEBA 4EUPH 5F3BB 3O2DL 3OKKA 4K23H 1TLKA 1IGTB 2GW5A 1I1CA 4R7NA 3EOAB 1INEL 4Q7DA 1A3RH 4N9GA 3ZSSA 4K94H 1UXWB 5C0AA 1HI6A 4WVRA 1SEQH 5KVFH 4M1DH 5EC2A 1IGFH 2A6JA 3H42L 2RGSA 3KLAA 4M02A 3JWNC 1JNHA 4Q9BA 4QF1A 3PWPA 3B6SA 3TVMB 4JY5L 3CC5A 1H8NA 2H2PD 1YPZB 2OR9L 3U83A 3BKYL 3SE8H 3ZYJA 3F7PC 4MAUL 1JYVA 4ENED 3IDUA 1NBYA 5T1KA 3W82A 2LAGB 1JF5A 1YYLL 1JRHL 4Z78A 3P4OA 4F58L 4KHXH 5EFIB 1I9IL 1BM3L 4GRWF 2V7HA 4WI7A 4YE4L 4X8XA 3MUHL 3X12B 4F7CB 5DUML 2UWEE 1JZ4A 1CICC 2BOCB 2NYYD 4AIXA 1RVFH 4OM0L 1LE9B 4G8GD 3FB5B 2HLFC 3H7LA 2VAJA 4XHJC 3GGWA 1J12A 3PE9A 1UJ3B 3MGTA 2AJZB 4LMQI 1T03L 1NLBL 2XKNB 1DBBH 3T4YB 1TZHA 1S7TB 1C7SA 3C09B 4P4KC 4EBQH 3H8NA 4XX1E 1RUAH 2DQCL 5BZDA 1NC4D 2D7PA 4KKNA 5E5UB 3T3PF 3N9GL 3T1WA 3T8XA 2I5YH 4PJHE 1WGOA 5DRNB 5FGBA 5FYJU 3HA0A 1DFBH 4MQXC 4YLQT 4XNZB 1EXUB 2EDRA 5EG6C 5E08L 2FJHA 5HHVH 3SCMA 1H8SA 3BSZH 4Z7VA 5DD5L 1ZGLB 1KENL 1Y6MR 3E3QC 1RZKC 5IB4B 3HE7C 4JG1L 5B4MC 4PFEA 4PRDB 15C8L 4G8GB 2L7JA 2LE9A 1RZIB 4TSBL 5JOFA 1CN4A 2O5YL 4YBLC 3VD4A 1YEGL 5E0QA 4PJXF 2E9BA 1GOHA 4ZOCA 3ARWA 1E4XH 3AB0C 1FO0L 5EPMA 3KR3L 1ZT4A 2HT4D 3VH8G 3T4AA 4PJGB 3LKSB 2VR5A 1SM3L 3QI9D 1BF2A 5CJ5A 2P8MA 1NC4B 1YMHB 1F3DH 4YZFF 2YPKB 3RWGA 4MCZA 4JFZH 3E1F1 1WIUA 5J9PA 4QXUL 3P11L 1ZHBB 5DQJB 4ODBD 3C5ZC 3UO1H 1OTSC 1F2XK 1XGRB 4NC0B 5ALCL 5IB2A 4YR6B 3T0EC 4MB3A 5JHDD 4WHDA 3VE0A 5HBBA 4FFZL 4GAYB 4N9OB 5D2NB 5I8OL 4E42A 2VDQL 5J11B 5GJTH 4W4NA 1OAXL 4G8FA 1MFBL 1YEDB 5I1KL 1EK3A 2ZUTA 8FABB 2VJXA 2ESVA 1JTOA 2DYPA 3T08A 2NW2A 1U8KB 4ZOEA 4LASL 4E0RA 1YPZE 4BSVA 4L9LC 1KBGL 1VFAB 3EGSA 5EU6A 4Z7NE 4GG6A 1FVDA 4EDWH 4EJ1C 3QI9B 5MI0B 3S96B 1RZ8B 5DK0B 4KTEL 2JLLA 5F6IC 3U9UB 2FJFB 3MXVL 5I8KL 4KQ3L 1U3HB 1UM4H 4OV5A 2NY2C 1WWBX 1AGFA 1XGTB 1G7QA 3LVEA 4GLRI 4WI2A 3HZVB 4ZFFB 1BFOB 4J1UA 5FYKD 1I1FB 3VG0H 1KB5H 1KJMB 2XT1B 3V4VH 2GCYB 4TVSa 4JFYA 1MHHB 5IF0A 1JUFB 4JHWH 3P3YA 1ZK9A 5EU4B 5JHDB 5CSZB 2F58H 1MRDL 1QBBA 5AYUH 4CN1A 1SQ2N 2VQTA 3S35H 1YN6A 3ULUC 3VH8B 1RIUL 1ZA3B 1AE6H 4KY1L 4PJDF 5EBWA 4L4JA 3R06A 2VLKA 4WFFE 3NIGE 1KN2L 3BP7B 5DZNA 4PJBA 4G7VL 4JHZA 25C8H 4Q2ZB 4ZPVA 5F7LB 3CH1A 5DJ8B 3QCVH 4KZEH 5L7XL 3I75A 1QA9B 4LLYA 3O41A 1RJYB 5DUBB 5KS9E 3CVIL 4KHTH 5IJKC 2DLFH 1CGSH 4OCRL 3PXHA 5T1DL 5J1TC 3F58H 1JWUB 2IADB 2NY0D 3PABA 4WDIB 1NMCB 3MRRA 2QLVB 1DBKL 2YA1A 5GRYA 3BOVA 3U46A 4WW2B 4H5SB 4G8GE 1J1XL 1DJSA 1LK3H 4YFLF 4XNXH 1OAYH 2A73B 3G5ZB 3VXUD 1BX2B 1DN0A 1A1MB 3RGVD 1AIFA 4G9FA 2BXZA 3NH7H 3UTTE 2BVOA 2GYSA 5FGRA 5LGHL 1J5OH 3VFPA 4PJGE 5FA3A 3GSUB 5DFVD 5IR1A 5EA0L 3CMOL 2A2QT 5T33L 2H26A 2NY1B 2GTWB 1YECH 3C8DA 2Y25A 4ZD3L 3UTQB 4YDKH 1MJUH 3HI1B 3DIFB 4Y1AA 2Q7YA 5KN5A 3ULVH 5FEBA 3U9PL 2VUOA 4LPCA 3HI6H 5B38G 2IQAB 5CEXB 3GSVB 5I2IB 2DBLL 3KPRA 5EOQH 4P4RB 2A0LD 1LEKB 1SBSH 3B9KA 5GGTA 4AMKH 4P2QD 2NY0B 1MFDL 3HC4H 1S7XA 3FRUA 4UMGA 4WU5A 2VISB 5EU5A 5BV7B 2EC9T 4X7DC 4S1SH 3QBTB 1NGYB 3TPUA 1HH9B 4K2UL 4P46A 5ENWA 5B39A 4HF5H 1F4YH 1G6RL 5D7IF 1MCOH 5L2JA 3VXUB 2I07A 3THML 3AS1A 3RGVB 4L4TA 1S5HB 3IDGB 1BREA 3T2OA 2FJGA 4ZFOB 2X89D 1NMBH 2IBGA 5BVJB 1SJHA 3OB0H 1GGYA 1QPPA 2OXHA 4XCEB 3RWDA 4PGBB 4FQ2H 4M48H 4RFNC 4DCQB 4N90D 2AERT 3LQZA 3N85L 3X17A 3D0LB 5FUZH 5IHUL 4ZO9A 2FX7L 5IW3A 5GGUB 3N50A 3VMNA 1H0DA 4JRYD 5ITBL 2IQ9H 3I50L 5HHXH 4PD4J 1NCCH 4PJEA 2W65B 4XVUD 3PWNB 3ARBC 4P2QB 1DQTA 1PAMA 4FABL 2A77L 4JZNB 4PLKD 3BP6B 3QNXA 4AIZB 2MQCA 3BPNB 5D7JD 5I71B 5LQBH 3HC0A 2PYEA 5JUEH 1HSBB 3A6CH 1JK8B 3I2CH 1BLNA 1T2XA 5GS1A 5MERB 5DJZA 1DVFA 5B38B 4MJ6A 2R15A 1AO7A 1KJ2B 3O3AB 3ZYIA 3W39A 1Y0LA 2VZSA 3MRBA 1OGTB 2IPTL 1IC7H 1IFHL 3RKPA 3DXAE 5EU7C 4H88H 1I7RB 3I02A 5CBEB 2BZDA 4NM8H 4YXLL 3H9SA 3BI9X 3SE4C 2BDNL 2CH8A 2AJYL 6CGTA 1YEFL 4DZBB 4ZUWB 2IBBA 1MWAB 4RGND 5BOPA 1MFEH 1TMCB 2ERJB 2DF3A 3MJ7B 3WCYA 2NQCA 1CDCA 3RX7A 2ICCA 3SDAD 4YJZL 4JG0H 4P49A 2CKBA 3NGBC 5AAMA 4PRNB 4JO2L 5D7JB 5E8EB 3ZTJH 1MI5E 1HHHB 1NDMB 3QJFB 3N1MC 4ONHB 3KPMB 3CCHA 5IBUG 3N0PB 4XWGL 3V9FA 1OAZH 2AJXL 3SKMB 1FL3A 2J4WL 2X4PB 2W9LA 3QP3A 1F3RB 1U8LA 3DLQR 4LRIA 2BY2A 3RIFK 1RQ5A 1JRHI 3LPGA 5KVDH 3BQUC 2DJSA 1U9KA 1P4BL 1L7TH 1S7WB 4WEUD 3K8KA 5GRUH 1Y18A 4ERSH 2DTMH 3MNWB 3GRWA 1SJXA 3WJJA 4GAFB 3DX9A 1IQDA 1FFOA 1I9RH 4PLJD 4LEOA 2WBJD 4Y19A 3CFCH 4JZJA 4S10A 3F7YB 5SWZD 4D0CA 4R90H 2BJML 4DUWA 1A22B 4POUB 1EFXA 4RGNB 5DHVB 3H9HA 4OLXL 3U48A 4MNQD 3DX7A 1JPFA 5CBAB 1KG0B 3EFDL 2ZUWA 3IDNB 3VRLE 4Z9KB 4OZFA 2EO1A 2XXMB 2A1WL 3VXUE 3MROB 3SDAB 1ACYL 1MHCA 4PRIA 4ZFZA 4HG4K 3LKRA 3OQ3B 4OCNC 4YXKH 5INCB 1HHJB 5BW7A 4Q9RL 3G9VA 5EZOH 5JA8B 1EGJA 3QXVA 4DN4L 4HMEA 4XPBL 4XBEH 4ELKA 1LNUA 2CGRL 2EE6A 3ZT7A 3WN5B 5JZ7C 3AU1B 4UT9H 3STBA 3ZSTA 4YHML 4HUUA 2C3VA 4XZUA 4L8SC 5F9WC 4F37F 4I0PC 1KUMA 4Y8AA 3IJYB 3VFMA 2B39A 4NT6A 4HWUA 3HAEA 2MCG1 3UPCA 1A1OB 2JJSC 4MQSB 4D0DB 4QWWC 4MX7B 3AAZA 5E2TH 2WBJB 1WBXA 4WHTA 3CSBA 5FOBA 4LCIL 2Q8BL 1KT2A 4MXQD 4MXWL 4KZDL 1ORQB 4MNQB 2BSSB 2Z4QB 3LS5H 5LCVH 5E7FA 3BMVA 1CLZH 5IIEA 5IBUB 5HGHA 2FR4B 3P0YH 1AXTH 3FQNB 2GAZA 1JPTH 4YFEA 3BE1L 3EJZD 5K9OB 4LAQH 3QIBC 1EMTL 4R3SB 4KV5E 4NO3A 2A38A 4G5ZL 5J13B 3MBED 4PJHF 4K8RD 3L3KB 3BH9B 5FCUH 1QTYT 4TOYH 3E6HB 4BH7A 5CMAB 2VITA 5CJOL 5J3HD 5AWNL 5HHNA 4GAGH 2DOCA 4Y4HD 3JZ7A 5EOCJ 4QRPB 1U3YA 4E41D 2YD8A 3FQUB 1PZ5B 4Y16D 3MBXL 2ZOLA 4ELME 1KELH 4MQ7B 3PV6A 3D6GA 4NUJA 4XTRD 1T0NA 1Z3GL 1F02I 4XB8A 2CUMA 3VW3H 1UJ3A 4OIIH 3MCG1 3T4YA 1G7JA 1S7TA 3CLFH 2WP3O 4RGMB 2OL3B 1OLZA 3DNKA 4BUHA 4ZO8A 5I1IL 3FN9A 4P9HH 3WMSA 1XFPA 1PY9A 4TVPD 4UI2A 4O2FA 1QRKA 2GTZB 2X4TA 3ROOA 3T0XA 4B5EA 3R4DA 1U8MA 2HJKA 4Y88A 1OSPL 3B2UC 4ONGL 5IVXB 1U8NA 2X40A 1PKOA 1BGXL 3MUY1 3MBEB 5L9DL 4P2OA 2DWDB 2RQ8A 2B1HH 1I8IA 1P69B 3G08B 2VDML 1XF1A 2X1OA 1T21A 3MLVL 2Y36H 4X6BB 5KAQG 1ZGLA 3WSQH 3CXDH 2Q3ZA 4E41B 4LU5L 2VDNH 4K9EH 4Y16B 3CFJA 1TJHL 3OKNB 2X4NA 1GGIH 4OZIB 2V9QA 5IB4A 4JFPB 1BQLL 2KKQA 2AJSH 4PRDA 1MEXH 1FE8L 2HJLB 2WIIA 4FQCH 2MHAA 2H8PB 4W6WB 4P0DA 4BK5A 5TQ0L 1NGQL 4Z77A 4L8BB 3MRJA 4KRPD 3QG6A 5HVFB 1C5BL 1OT2A 1JNNH 3DVNB 1ZLSL 1CLYL 1NC4A 4KK5D 2RIKA 3O6ML 1Q9OB 2KL6A 3MRFB 3C60C 5C7XH 4DJMA 5C71A 1HSAB 3J8F7 3EYOB 4GKSA 4N1EA 1MNUL 5C92A 2GJ6D 5C07A 4ZODA 4EUPG 4XAKD 2D0GA 5FO9A 1E6OL 1UA6H 1ZHNB 4ZTPL 4BYHA 3I6GA 1UWEH 1XGRA 3MJ9L 4HAFA 2EZ0C 3U0TA 4S1RL 2ZUQB 1RSFA 3KYKL 3P4MB 4NNXA 1Q0YL 5BQ7A 2OK0H 5D2NA 4GAYA 1CTNA 3RL1A 4HZLB 3M07A 2FRGP 3GJFB 2F5AL 3BN9C 1OY3B 3L5WB 4R26L 5IFAH 1XIWD 1BFSA 1II4E 2EDXA 3NIGF 3ZE0E 3ZKNC 1QLRB 5MEOB 4KRPB 3F7VB 4EVNB 1I8KB 5GHWH 5JHLL 4UV4L 4ORGA 4OM1L 3MLPA 2X6MA 3U4EA 4PG9A 4V2BA 2JELL 4HJ0D 4JM2D 4F2MB 5MP6H 5KS9F 4X9IA 4U6YA 2H3NB 1GH7A 1XGTA 4QRPE 3SQOL 1RUKH 3EDFA 4FHBD 2GJ6B 2EDQA 1BIHA 5CS7A 3QFJA 1MJ7L 3SKJH 1QG3A 3OX8B 1PD6A 5I8CB 1I1FA 4GLRH 5JR1L 5FK9B 3SGJC 1J1PH 3QZWA 1RUPH 4OLWL 1INDH 5MEND 3SKUD 3MODH 4MAYC 1JUFA 4HUVA 1AD9B 1ZXQA 5BRZD 5CSZA 5IEKA 1CLOL 5GS3A 2Z92B 4I13B 4PJCB 2EDOA 2BRRH 2C9AA 4MWFB 1K2DA 3U0PB 2UV3A 1CGYA 1WFNA 3EOTH 3MRLB 3FONB 3VXME 4I3SH 3TYFB 3MTRA 4U1SB 1AGEA 4Q2ZA 4WCYH 4G6MH 3BYYA 1J8HE 2VC2H 5DJ8A 3G6AB 5GGTL 3BZ4A 5DQ9B 4LL9A 4EUPB 2NXYC 5IQ7L 1GIGL 4JM2B 3HPLA 4K7PY 1JFQL 3VWJA 1JWUA 4U3XA 4WIQA 1ADQA 4E41E 4WDIA 4Y4KD 1SVCP 5DJ2B 5HVWA 4L29B 4O2EA 3TBYA 4GXVH 1U95A 2EEAA 3KAAA 4PYGA 3EDJA 1XCQA 3U0WH 2BFVH 5CWSB 1BAFL 5LAXB 2QKIA 3WNLA 3KVQA 3QUMA 1A1MA 1GPOL 1NFDB 3BP5B 5CSGA 5EWIL 1C1EL 5FECB 5AG9A 2OTPA 1U8HB 3B9DA 5IWLC 3GSUA 1DQLL 5I1EH 4OCYH 4TVPE 4QXGH 5DO2C 1A7BA 4AENA 4ISVB 1T7WA 1R3JB 1DCLA 4NSKA 4H8WH 3VFVA 3F7QA 4XI5C 1ZGLP 4JQXA 1XF5B 2DL2A 3PWJB 5C9JB 4XXDB 4U6VH 1NGXA 3H6JA 4O2CB 2PW1B 4HWZA 2NY4D 3UJJL 3QA3B 4MHHI 4MDIA 3JV5A 3RI5K 1HKLL 5E99H 1R5IB 1HXMA 2IGFH 1QBLH 2G9HB 2O5ZH 1NPUA 5FXCH 4Y4KB 1XH3B 4LPVA 3ZHDA 3JV4A 2X4SB 1J9CT 5ALBL 1P1ZB 1TQCC 5CD3B 4YC2B 4DK6A 1WEJH 2HRPH 3F62A 5ANMA 1G7MA 1HH9A 1U91B 4BFIA 4WFGE 5CIPH 2G5BA 4PUBL 1S5IL 5E8DL 1V3LA 4J3SA 5IW1B 1IKNA 4I2XB 1V5JA 1S5HA 2XY1A 4YXHL 4KH2A 2EDBA 2VXQL 2XA3A 4JPVH 5F96L 4KTYA 5CEYB 4XCEA 4PGBA 3RVVD 4J12A 1YQ2A 4PGDB 2CLZA 5CEZL 5TDPB 4N0CD 4NZTH 1QFUL 1CG9B 4HQQH 1CQKA 1IGIH 4NZDA 5GISH 2FO1A 3U30C 1KXQE 4HW6A 1ZT7A 2NY4B 1WITA 3TO4B 3MLZH 2XG5A 5ID1B 3ECBB 2A9NH 4OFPA 1JTTA 2KUTA 4YX2H 4J3OC 4KI5D 1WBZA 1AGBB 4NQCB 5E6ZA 1UVQB 3WUWG 4RBPK 4TRPL 4PJCE 2WQRA 4XC3H 1JZ8A 5JQ6H 5FGBC 1RFDL 5FYJE 1YMMD 3X14A 3RWCA 1HSBA 4DOHE 3KPOA 2EDEA 1GC1L 5ISZD 3SCMC 3B9AA 1MRCL 1I3VA 2X05A 2H1PH 3PHOA 2R56H 3L3IA 4PJ5D 3DRQA 5D2LE 4P5MB 4RAUA 1HYSD 3K2UL 3A67H 3EKCA 4JFED 4M7KL 2HFFA 3Q0HA 5E5MA 3MA7B 3BHBB 3G6DH 3QDGE 2PR4L 4H26B 3WFDH 5CBEA 3L7FB 4AK1A 4WW1B 5E8NA 2AK4D 3EO9L 1IGCH 1T0PB 2N7AA 4UU9A 1L7IH 2FYYB 3PP4L 1FNFA 2YZ8A 2FEEL 4U6HB 2GKIA 3IGAA 1YEIL 4UNUA 3GHEL 1UJTA 2DTSA 5IK3B 1CDGA 4JRYA 1EGJL 1RZJH 3MGOB 3D1MC 2WMPA 4ZSOB 1S3KL 3QXUA 2I24N 4JN2B 4TQEL 1NFDE 1INEH 2X70B 1NUGA 4FQQB 3TFKC 2VXUL 1KTDB 1I3RB 2Z0BA 1QFPA 2FLBT 1S9WB 3UTPE 4WTZG 2HA1A 3GIVB 1HHHA 4HUWB 1F4WL 4U3CA 4DVBA 2ZSVA 3H42H 4NC1E 4TSAL 3UBXI 2VQUA 3JV0A 4JFXB 5KSBE 4QHNB 2KZ1B 3DYOA 5ISZB 3JWDC 2X4PA 4LCYB 1KB5B 3QRGL 1KEGL 4MYWB 4PJ5B 2PKDA 4MAUH 5E2WH 5E5RB 1NUNB 2Q86A 4JFEB 1CE6B 1P84K 4NN5C 1JRHH 5DVNA 2YD6A 3GKWH 2K3TA 4F58H 3H7BB 2VYRE 2QSTA 4TPRL 2AK4B 5F7WC 4YE4H 2R0ZL 4FFVD 1H15A 2HTLC 1CGVA 3F7YA 4CNIA 5D71H 3TM6A 3WUWB 1QRNE 4XPHL 2R2EB 4QRSB 1IGJA 4LLMB 3K80A 3GSNB 5DHVA 1KG0A 3LKPB 3ULVD 5J1AB 3MJ8B 1GOGA 3B2VL 1NLBH 3IDYC 4L8DB 1QQDB 1T03H 3FO0L 2RB8A 4I2XE 1JHKL 3O9WD 2EDDA 3TA3D 3GMMB 3BZEB 3L6FB 3OJMB 1A14L 1FL5A 1JV5B 3CFKA 2OS7A 3E8UL 3IT8D 3WKML 4EXKA 5GS0D 3BEWB 1SYVB 4M62H 1W0WB 4NM4H 3ES6B 5I9QB 3MLTA 1Z0NA 2FATL 1A1OA 4D0DA 5BJTB 1OAQH 2E27H 1PX4A 3FCTB 1MFAH 2Y72A 4OGXL 4X9GA 1REIA 4ELMF 4G43A 3Q48A 4NQCE 3WXVL 3WS3B 5I1AA 5SWZA 2VXVH 5FKPA 2H45A 4MSWA 5FGCB 2GSGA 3TIDB 3S5LG 15C8H 1OP5H 2R4RL 2Z31A 4JM4L 3RX5A 2O5XH 3T2NL 1OTTD 2APWA 2GJZA 2AI0H 1YEGH 1NCAL 2FWOB 3FOLB 5DMKB 2JB6B 4QO1A 5K9OA 4CRPA 1TJIH 4PJXA 3TA3B 4IJ3C 4R4BB 4R3SA 1FVEB 4RNRA 3NOIA 1YJDH 4WGWB 1DUZA 4AM0B 1YEEL 3MLYH 5F9OH 1DBMH 5DR5L 1FG9C 2J8UB 4OZ4A 3GMLB 1H3UA 2P8LB 3P11H 3VXQB 4PJ9A 3HNVL 3QQ4A 1FZJB 4PRPD 2EDKA 3C2AL 4QOKE 3NA9L 3DVFA 4MQ7A 4XMPL 2R0LL 4N68A 3ZO0A 3GI8H 2D2OA 5ALCH 3GMQB 5IEHB 3K2MC 4KDVA 1C5DA 4YHOL 4WO4D 2ORBH 3UTSD 4BK4A 2KZWA 5F7DA 4FFZH 1A6AA 3Q6GL 1JYXA 1A3QA 2P7TA 2VDQH 4U7MA 4I3RL 4I48B 1R24B 1U8JB 5I1KH 3LIZL 1EERB 1DBJL 3G5VA 4I77L 5DGRA 3B9EA 2EXYC 5IMMB 3WD5H 3ARED 3WIHH 4XP6H 5IBLD 4NGHH 4JVWA 3B9KC 4YBQD 3QQ3B 2ID5A 2VWEC 2FX8L 4JN1L 1KBGH 5IVXA 4PJ5E 4JFEE 3GHBL 5HPOA 1CDHA 1V7NL 4MLSA 1F58H 1KIPA 2DWDA 5I8KH 5EOCH 4P46C 3H0TB 4JAMB 1H5BB 5ACZA 3BZFA 1A6TA 1B6UA 4AL8L 3BRDA 5FKAB 3QIWA 1QSFD 1D5BB 2RCSL 4LDOB 4Y4HA 3VFWB 4CU7A 1EA9C 4HGMA 1XCTB 5T5FL 1B90A 3NCMA 3HC3H 4MA3B 3V6FA 3NTCH 5DJYB 4Z0XB 5D72L 5FDWA 1S7RA 3OAUL 5EDXA 1FFQA 1WZLA 3NPSC 1M05A 4WO4B 1MRDH 1NLDL 3UTSB 2W0FB 2EH8L 1V05A 4OI9A 3VGHA 4G42A 2EDNA 4WFED 4KDWA 3QWOA 3HPJA 3V79C 4CN6A 4CADA 1MCPH 2VQ1A 3DVNA 3ZE0F 3AREB 3NZ8A 4PJDA 4LQ1A 1Z9SA 2RHEA 1P6FA 1Q9OA 3F5WB 2HKHH 5L7XH 4TUJB 3VCLA 1HSAA 3QT2A 3OG4B 3EYOA 4MVBC 2B4CC 4XPGH 4X6EA 1L4IA 2Y6SC 3TC9A 1ED3B 3UJTL 5L8KB 2EKSA 3GMRA 2AP2A 4HS8H 3EHBD 2Z93B 5C09D 1QSFB 4Q6YA 2FL5A 1DBKH 3GEWB 5FGCE 5GS1C 2VH5L 1DVFC 1ODAA 3CUPB 3DETC 1UFUA 5E94B 1XF2B 3O6FA 1J1XH 3B9VA 5BOZG 4MD0B 2DQHL 4UOW1 1JPSH 1DQJA 4K7PL 3BWAA 4U6TA 5I1DB 3F6IA 5JOEA 4FG6C 4FQHB 3IFLL 1CI5A 2XZAL 4C57C 4DGVH 5J8OA 4ZQKB 3VXOB 1FGVH 4L8CB 2RAMA 4DVRL 3MO1B 4MMXC 3CMOH 1MLBB 2WWMD 2Y7QA 1ADQL 5F9JA 3MA9L 1NSNH 3TZVD 1MCWW 5DYOB 2J8UE 3BUYA 3VG9C 4K7PX 1HDMB 1BZ9A 5HJ3B 2A6DA 2D7QA 3U9PH 2VZOA 1X7QA 2CJUL 4OV6F 4XBPA 1IM3B 2GJ6A 2IH3B 3QDMD 3DJ9A 3EFFA 4YGAB 2CSPA 5HDBE 1MFDH 3QUZA 5I17B 1CFTA 5C09B 1K3ZA 5HYIA 1RJCA 4LRIC 3U7WL 2PO6A 2DM2A 3Q3GB 1R3KB 4Z7WB 1G6RH 4MS8D 3NABL 4MWFA 1CD1B 3WJJC 5C0ND 5EBGA 4EI6B 4GW4B 1TJGL 4IMLB 1UZ8A 3IRZA 4U1SA 4JZJC 1G7PB 1ND0B 1XIWA 3QYCA 1FFRA 3C2SA 7FABL 5I76B 4ALAH 2ARJQ 1EV2E 3TZVB 4EUPA 3OJVC 4PIRF 3LV3A 4OBSA 1UM6H 3RPIB 1ZS8B 2AJVL 3PGFL 2IAND 3ARYA 1ULVA 4N0UA 1BJ8A 4PJAE 2WUBH 5BW7C 3QDMB 5D93C 1QR1A 4X7SH 3G6JB 5ITBH 3O4LE 3I50H 3O6KL 2R69L 5FUOL 4IMKA 3O4OB 4MD4B 1N6UA 4M93B 4K3GA 5MENA 2VR4A 3SE9H 4FABH 2A77H 2PTTB 3UTSE 5BRZA 2CDGA 1ZHLB 1HOCA 1DANU 4JO1L 2AVGA 3JV6B 2VLRD 5D4QA 4ZFGL 4NYLB 5FHBH 3IETB 4YHKL 5IMOB 4Y5XB 3BIKB 2CIKB 3L3GB 3NFPB 2NTFA 1CICD 2JK5A 3EYSH 4V1DE 2ZKHL 1AD0B 5GSRB 5DEFB 1ZLVH 2HT3D 4XHJD 1QFWL 1IFHH 4O2CA 5ICXB 5CCKH 2DKSA 4LCWD 3KLDA 4U6XB 4YXLH 2FEEI 3EO1B 4GFTB 4FQIL 4NQDD 2BDNH 3STLB 1AR1C 3Q2CA 4AG4L 1R5IA 1YEFH 2IANB 1QSFE 2NNAA 4JFFD 2R2HA 3NCBB 4DTGH 4OZGE 4HLZG 3Q1SL 5GIRB 3ARVA 2ED8A 2XWJB 4P2YA 3DV4A 3KLHC 1YEKL 5J89A 4KRMB 1FDLL 4MJ4A 3JWOL 3B8YA 1IM9A 5CZKA 1L6ZA 5JLZA 4KFZC 1T0MA 1VKXA 5TE6L 4Z8FL 4MQXD 5DVLA 5A2IH 5GSVB 4XWGH 1DLFL 4H25A 5J57B 4NQSA 5D2LF 1X5JA 5FB8B 3FT4B 1A3LH 1CICB 1UJ3C 4M7JL 5D5ME 5T3ZH 3W0WA 5H2BA 4XMKL 3HE7D 5B4MD 4UOW0 1IRAY 4PY8J 5IMKA 4NKDA 5IHLB 3OKEB 4YPGB 2PTVA 4UDTB 3OSKA 4LCWB 3REVB 4HPOL 5ID1A 2OTWA 1KTKE 3ECBA 1V3JA 3DRTB 1JE6A 2GUOB 1XMWA 4NQDB 4F15C 1RULL 1UACH 3NN8A 5C09E 5HYSG 2WSKA 2BJMH 4XVJH 4JFFB 5LGJB 3MNVB 5EC1B 4WWID 4PJIF 3LRSB 1ZWIB 4OLXH 3S34L 5BMFH 3EFDH 4BFBD 1Q9KA 1PG7X 3EJYD 1MUJA 3DTXA 5T3XD 1E0OB 4F33B 3PQYA 4P2OC 1ACYH 2R1XA 5D7LD 2BVTA 4JFOA 3Q5YA 2O93L 1G1YA 2Z8VC 3NFNA 2D0HA 2Y5TB 3RVUC 1TTFA 3VXPA 1W72H 3IXTA 4S2SA 3C5ZD 5BS0E 3W9DA 5KSBF 3K4AA 5CGYC 1UYWL 1OTSD 4MA1B 1GHFL 1NEUA 2CGRH 4H1LG 3FO2A 2NYYC 1RUQL 2G60L 1O5DT 4XCFH 3V5KA 1F4HA 3EO0B 3G5XB 2YSSA 4FTVD 1Q72L 4X9BA 3TGXA 4WW1A 5K9QI 3HE7B 3WFHB 2LQRA 3LRHA 1CDIA 4U6HA 3OR7B 1LWRA 4YBLB 1JF1B 3QEQD 4X0KB 5IK3A 3PHQA 1F11B 1EO5A 3AB0B 1QBAA 4LCIH 2D4FA 2Q8BH 4FZEH 5H94A 1MCNA 5D1ZA 4MXWH 4KZDH 5EUOB 3DBXA 2N56A 2NY2D 1YMMA 2ICWB 4N0FB 5I18H 1SJVA 5D7LB 2HVKB 4QHNA 1IT9H 2B7DT 4CBPA 5ISZA 3VD7A 2YPLE 3WNKA 1X5ZA 4LKCA 3C5ZB 3VXRD 1KB5A 4IEFB 4LF3B 3QDJE 2DQEH 4HK3N 4U1NB 1L0XA 3VGFA 2PTUA 1DZBA 1G7HB 3LEXB 1CE6A 1ZVYA 3HR5B 5D2NC 2EYRA 3T0EB 3H7BA 1X6LA 3C08H 4RWYL 4FTVB 2C1PB 2IANE 1RY7B 3UC0H 5HYSB 5CUSH 4X4MA 4Y5VA 2BC4B 3LMJL 1QP1A 2X41A 5CAYB 3QEQB 1XGUA 4DFHA 2VRAA 1Z3GH 5HHOD 3G04A 5ID0B 1HCVA 3PXJA 3FZUC 5MI0C 4L8DA 2IFGA 4WWKD 4PP1D 4HMCA 3ILQD 1I9EA 5FYLL 1L9NA 1A6WL 5F6IB 1CU4L 1MHEB 1TPXC 3RU8L 2DWEB 4H1LB 2NY2B 1IAII 3FKUS 2QQKL 1P5VA 1OP3H 4GUPB 3BD3A 2J8HA 2YMXH 3C9NA 3AS2A 5TDOA 3RBSA 5B8CB 1R5VA 2NW3B 5HYQA 3VXRB 3BEWA 3JXAA 2BOBB 4WI6A 2A6KB 1BGXH 5L9DH 4W70A 4WTXA 5L0QB 5LJYH 4BKLB 4QT5B 4ZAKA 4RRPA 4LCWE 2BCKB 5IW6A 3SJVE 4NQDE 3TO2B 5DJAA 4MJ5A 1OB1B 2PW2A 1MLCA 1OP9A 4K07A 5T1MB 1WISA 2GT9B 4JFFE 3TF7C 3WS3A 5I1GH 3PIQB 4WHCA 4N8CL 3OJDA 1N7MH 3E2HC 3TIDA 3UZEA 5F1NB 5E1AA 4WUUA 2WANA 1FE8H 3CK0H 2A6IA 2W92A 3WLBA 4KPHL 2J12B 1A6UL 1QUNA 4P2RD 4WWKB 3Q6FB 2VN7A 3LSOA 3VWJC 3FOLA 3TBVA 3V5HB 3RDTA 5DMKA 5TQ0H 3N1QC 3O9WA 1IGYB 1NGQH 3PF2A 3EYFB 3EYUL 5TDNA 2D3VA 1DE4B 3S3SA 1WF5A 5HI3C 1WUNT 3VGBA 3O6MH 4CDHA 3IF1B 4LSRH 1P4IL 1KPUB 3E3QE 4MMZC 5C3TA 3ULSB 2P8LA 4Y8DC 1P5UA 3VXQA 5TE7L 5GQBA 4PJ7B 2GY7B 4JHAL 4ZTOH 2P5WD 4RCAA 1IJ9A 3EOBA 1E6OH 2GHWB 4YO0B<