3CVHL

How tcr-like antibody recognizes mhc-bound peptide
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
209
structure length
209
Chain Sequence
b'IQVTQSSSSFSVSLGDRVTITCKASEDIYNRLAWYQQKPGNAPRLLISGATSLETGVPDRFSGSGSRKDYTLIITSLQTEDVATYYCQQYWSTPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
molecule tags Immune system
publication title How a T cell receptor-like antibody recognizes major histocompatibility complex-bound peptide
pubmed doi rcsb
total genus 51
structure length 209
sequence length 209
chains with identical sequence R
ec nomenclature
pdb deposition date 2008-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cvhL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cvhL01
4XNYH 4LLQA 4QCIA 4D8PA 4RQQA 5T3ZH 1YEJH 1WWWX 1JRHL 3QDHA 1ZSDA 2XWTA 1E28B 1UB5A 4R8WH 5ACZB 2V2TB 2QSCH 2V5RA 4I3SH 1GC1H 4OCLC 1R3LA 2YD5A 4M7LT 1A6TB 4GKSA 2BNRA 4KK5D 4J6RL 4NYLB 5LCVH 4TSBL 2GTWA 4DZ8B 1F3JA 4FTVB 4Y19D 4BFGA 4L29B 1GSMA 2P7TB 2A77L 2IMNA 4YZFF 2BC4B 3VH8B 4IMLA 4NSKA 2PN5A 2GTWB 1J5OH 1RU9H 3DV4B 4OZGB 1XAUA 3MXWL 3SE4A 5JW5A 4XC1L 4GBXA 1KJ2L 2BC4A 1T1XA 4NGHH 2GAZA 4EIZC 5MEPA 1LD9A 1IKFL 4HUUA 4FNLL 4J3SA 5DUBB 1S7XA 2R9HC 4LEXH 3U79A 2DQEL 3O45A 4H8WH 5JOPE 4LVOB 1R0AH 5GJTH 4ZTPH 4UNVA 3SJVB 3ARRA 4Q2ZA 2E9BA 1IZKA 5E00A 2J8UE 2ZCHL 2VC2L 1K9TA 4IRZH 1BLNA 3W9EA 3SJVA 1AO7D 1GJIA 5IMKA 1Z9MA 3WJLA 3RDTC 4RZCB 3S3SA 1KNOA 1N59B 5E5UB 1YMHB 3EYSH 1JPTH 5LQBH 1JPTL 5LQBL 1DSFH 3IDJA 4R4FL 2Z4QB 1CGSH 4ZPVB 1CGYA 1CT8A 5DUPH 3HR6A 3OJDB 4U7MA 3H7BA 3VH8A 4HUMB 3D85A 4XAWH 3ZKMD 4PJ5A 1J0IA 5HGGS 5CD5D 4CVZA 3OX8B 2P47B 1H3WM 5EZOH 5SWSA 3L3GB 4MQSB 3VGHA 5L7XH 1XGQB 4PR5B 1DL7L 2QHRH 1T0MB 4XNMB 3JVGC 4ONFH 3V2AR 3F8UB 1JV5A 3T8XB 5BS0D 1GVIA 5EA0H 3TA3D 2FEDD 2JCCE 4HQQH 2F5BL 2ED7A 1BIIA 4UB0H 5E94B 2NZIA 2BSTA 2W65A 2VUOA 3HC0A 1RMFL 4AMKH 5FV1L 4WFHD 4G8EA 4ZFOL 2CH8A 2H1PH 4GRLA 1HNGA 1UADC 1KEGH 1YEIL 4NJ9L 4DEPC 2FIKB 3GBNH 5GRZA 4G6KH 3H7LA 3O2DH 3Q5YA 3U6RA 4LLMA 4LVEA 2FJHB 4HWZB 4L9LB 5J6GA 3BD5A 1Q1JL 5T5FH 1A7PH 3IU4H 5K33A 5IQ9B 5DURD 3V7MA 1OGAA 5DMIH 1NFIA 4FXKA 2XQYK 4WNQA 5ENWA 1J1OH 3C60D 1TETL 2P8LB 3O11A 5LGJA 5T5NF 4YZFE 5LXGH 4C58B 4YIQB 3EYFA 4LRIA 2OMBA 1OGAE 2VYRE 2DN7A 5C92A 4XNQB 3GMPB 1B0WA 2BXZA 4P4KC 3BP5B 4J1UA 1BQHG 1F8TL 2XRAL 1LO5B 3HUJB 5ADOL 4K7PH 2R29L 1ROWA 4J1UB 1AHWC 4XH2B 4KH2A 2Y06H 1BF8A 3BZEB 4ODXA 3CLFH 3DURB 3ALWA 4NHUB 1Q0YH 5BVJB 4WTZA 4XP6H 2DM2A 4PV9A 3GFUA 4TQEH 4LKXA 1QP1A 3GMQB 4UNUA 4OLWL 2AXGA 2CRIA 3QRGL 3MRJA 1Z5LA 4E0RA 5C71A 2YWZA 3VXMA 3ULVF 4ZFOB 3EOAB 2VE6B 4WW2F 2P8MB 5FB8B 3LPWA 1MVUA 2V2WB 2IFGA 4WCYL 2ZSVB 3ARQA 3JV4A 4M00A 4EOWL 5I18H 5F9OH 3ARDB 3OAYK 4NUJB 5ERWA 5IGXL 5ILTL 4HEPG 4J12A 1IM9B 4NO0A 3PWPD 4P4RB 3BP5A 1HXYB 1XGQA 1L7IL 3HI5L 3MLXH 4NFDA 3TM6A 4DK3A 4QRPB 3T0EC 4Z76B 5ICXB 3VRJA 2ADFH 1OCWH 1XGYL 4RMQA 3O6LL 3KPNA 3QEHB 3RHWF 4JFOA 5EIQA 1XF5A 1RK0B 3QUZB 3I75A 4P2QA 3SKMB 3W5MA 3LEVL 4ONHA 3L3IB 4OF7A 3IS0X 3WS6A 1FO0L 3PWPB 3QR2A 4JM2B 3MGAA 3U2SA 3MBEB 3O2DA 1U8HA 2NW2B 2QSVA 3KGRA 3MUJA 3ARPA 4U7KA 1HIML 3SKJH 4JG0L 2A77H 5C0IB 2ESVE 3D0LA 4JPVH 4FFVC 3VFTA 5HYJD 1IARB 3LEYL 4D8PB 4HWEH 1Z6JT 4JZOB 5IR1B 3SEPA 4MLIA 1X7QA 4M7ZB 5D2LF 4Y5VA 2HT4C 1ZVSA 3AY4C 4LRNH 5T1KB 5IESH 1H5BB 3ME0A 5SWZE 1HHGB 1EEZA 4NRZB 1U8LA 4H20L 2HFGL 2FL5B 5DI8B 4X6FA 4I0PC 1NGPL 4RFOH 2XN9E 4HKXA 3VWKC 4OFVA 4OFPA 3UZEA 3H42H 4LSRL 5EU4A 4PJFE 4UTBH 4JVWA 4JZJC 4HS6B 1XF4A 1K8IA 2H26B 3SE8H 3VXOA 5ISZD 2NW3B 5JDSB 4L4VB 2AW2A 1SEQL 3C6LD 3JWDC 1MHCA 5JW3H 3RX8A 2K7PA 2JF1A 2V5TA 1HILB 1A1NA 4HGMA 4NN5C 4Y4KA 4R0LB 1UEYA 4Y4HA 1S7XB 2OS7A 5CUSH 43C9A 4EBQH 3KPSE 1NGQL 2HG5A 2UYLA 3L1OL 1BFOB 2EIEA 4YK4C 1VSCA 4NN6B 1HILA 4PPTA 1QSVA 1XIWC 2G5BA 2UWEF 5HGBB 3ZDYE 2VN4A 3FO9A 4OCWH 4LCYA 1QEWA 5JPNA 5D7LA 1D5BA 4FQXA 1LO0L 3GI9L 1A6AB 5DD1L 3RGVA 2Y7QA 4KZDH 4L8CA 3VRJB 1FIGH 5F6HJ 5EU4B 1A5FL 4HPYH 3ZKXC 1IMHC 4GRLD 1BP3B 2ATPA 3I85A 5I1GL 2BRQA 4LP4A 3VXOB 3IKCA 3VWKA 2Z8WC 1NCUA 2Q86A 1GCFA 3L3IA 4OLZH 4Y5YA 3SDAB 1YPZE 4N0CD 4JM2A 4YPGA 4XNXH 1IILE 1SJVA 3P30H 4OGXH 2F9BT 1H8OA 2JELL 1JF6A 2ZUYA 1MREH 2QSQA 4MJID 1B0RA 1DLFL 1I8IB 4K9EL 3BKCL 3S6CA 1H8SA 3LD8C 1F11A 1Z9LA 2EYRA 3W0WD 3GSVB 1WC7A 1LE9B 3EYVA 2WINA 1P4IH 1MCPL 5DJYA 3GSRA 4PYGA 4O5LH 3GSUA 3UYOD 1K4CB 4OQTH 4LSSH 4JN1H 1X9QA 5EBWB 5JLZA 1B4JL 3MJ8B 4FXLA 5DRXA 3EO9L 3ARBB 5CBAA 2AVGA 3OKYA 2WBJA 3WO4B 5C08D 3FB5B 3N9GH 1DDHA 3VFMA 2OTPA 1BD2A 4HAFA 3TA3B 3FRUB 5DXWA 5C0ND 1I9RL 4P2QE 2NY7H 1BQLL 2IAMB 4IEFB 4WEUD 5I15H 2GK0B 4KI1A 2VITA 3T0EE 3L95B 1RD6A 1TVDA 4KJYB 2X4NB 2AJ3A 2DJSA 1IGYA 1AD9A 4JG1H 2E7LC 4OLYL 4KJYA 3V8CA 4ELMA 3R1GL 1WJ3A 2BY3A 2APWA 2FBOJ 1J05A 1NPUA 2KL6A 5FO7B 2HFFB 3EOBA 3GSVA 5F9OL 1LWRA 5EU7C 1U8IB 3MLUL 2HJLA 3BZEA 1VPOL 4P46D 3NZ8A 3LSOA 3K74B 1YEFL 5D7KD 1BFVL 1MJUH 3ZDZF 5A43C 4MD4A 1AFVL 5AZEL 1U95B 3OGCB 2BVPA 3GMQA 5CJ8A 1D9KC 1XF1A 5I73B 4QRPD 2M1KA 1YY8B 3JSSA 4X9HA 4G8IA 2YS4A 1ZLSH 1ZLSL 4ORGB 2BP3A 2MCG1 4Z7WA 3MRNB 2GITA 3CDYA 5L8KB 5DMJB 1DCLA 1AQDB 2AABL 3MV8D 1ZMYA 1IAMA 4Z78A 3C87A 5LJYH 3C5JB 2V7NB 1I3UA 3R8QA 2BVUA 2BDNH 4XHJC 4F9LA 5FCSH 3BAEH 1BVKB 3OKOA 4NIKB 2FHFA 2HMID 4MX7A 4R0LC 2DF3A 4M9PA 1T21B 3WFBL 3B2UD 3R06B 5I6XC 1AE6L 3RUGE 5E4EB 4JFXA 1YNTB 5E9DB 3L5XL 2EKSB 1C7TA 5IVZA 2MQ0A 2YPKB 3CFIC 3QO1A 1ACYH 2AV7B 2E5EA 2VLJA 4B50A 5JNYA 2XV6B 1ZHBB 3CXDL 5I9QC 1PG7L 4MS8C 4HKJB 4AG4H 3IDNB 3KWWA 5H37H 5B38A 3T0VA 3GSOA 1I1YA 1U91A 4NQEA 2ARJQ 3RUGB 4I2XA 3DVNB 4AQ1B 3MCLL 4KZEH 4ZFFA 1R3IH 2VO5A 2Y4SA 4YNYB 3O3BB 3SGDI 3H9HB 3VXNB 5D7IF 4WEMB 4KTDH 3BH8A 2R0KL 5FKAB 3ARBD 4ONGL 1RPQA 3QEQA 4WY7H 3BZ4B 3MBED 3N0PB 3OBAA 1EEQA 1WZ1L 3IS1X 3CVHB 1EFXB 5CFHA 5EU6D 2O93L 3F62A 4O2EA 4RA3A 4FQLH 3WE6A 3JTTA 2NZ9C 2JIXD 4PRPA 4GQ9L 2XZAH 2BVOA 4P23C 3HCVB 1OAUL 4O2EB 1PEZA 2NW3A 3S4SB 3PNWB 3OHXB 3ULSB 3DRQB 5HJ3A 2ZKHL 2LV4A 4OD1H 2OL3B 1MHCB 15C8L 3PNWA 5HHPA 4O4YH 4K3JH 3UTSB 5C0AD 2ESVD 1F4YH 4R0LA 4R96B 1CFQB 5GRUH 2I25N 1SVZA 1WVZA 4FTVD 5FEBA 5DZOA 5JOFB 1VA9A 1KIQA 3L7EB 1MPAH 2AK4E 3RBSA 3O2WH 5DRZA 2WK2A 3VXNA 3O4LE 3QXDB 4BK4A 4AEHL 3HE6A 1CU4L 3E8UL 1KBGH 2KPNA 2AK1L 3C8HA 4ZOEA 1SYVB 5F9WC 2XQYG 2ICWB 4GG6F 1UM6L 1KLGB 3VD4A 5JW5B 5HHVL 1E4XH 4YAQB 2BOCA 3B9EA 4FQXC 3VA6A 2HVKB 1QQDB 1D3CA 1RMFH 1S9VA 2VDOL 2IH1A 3QO1B 3AREB 4O9HL 1GOGA 3DWTA 5EUKB 1OD9A 4LIQE 4NC2B 5MP6H 1KPUB 2CK0H 4NJAH 5GGQL 3BPOC 2OL3A 4KI5F 3QFJA 4U0RB 2M2DA 2J6EA 5FUZH 4FZEL 1HSBA 4NQEB 3VJ6A 4LLQB 1FNSH 1EXUA 4MXVE 1N7ML 4GRWE 5DUPL 5LGHL 3ZYZA 4A2MA 4WU5A 4OF0A 1FNFA 4CVWA 3M8OL 5BZDA 4RAVA 1KB5L 1SQ2N 4K3HA 4RFEA 1INQA 1NUDA 1TCRB 1UVQB 3L6FB 2EDXA 2LAAA 2IGFH 4Z7QF 1TCRA 1BIHA 1MCWW 1NGXA 12E8H 4HKZA 2I9LA 4M5YL 4FXGA 1AQKH 5FOBA 3ARBA 2CK2A 3FHQA 1UB6A 4YEEA 2FBJH 1DBBL 5J56B 4JVUA 5AZ2L 1BX2B 3KAAA 5KZCB 4MVBC 4C55A 3HUJA 3U4AA 1TTUA 4F7EA 3ARUA 2YMXH 1O7VA 1OVZA 4H1LG 3EJJX 3BMVA 3ARXA 4HFWA 1IGYB 1IAIH 4M3JA 5DD5H 4ZYKB 4I2XE 3VW3H 1EXUB 1T7ZA 1FN4B 1TJIL 1DTUA 1A22B 1A1MA 4PV9B 3MXVL 2J5LB 3MLXL 4GXUM 3EZJB 1BBJB 3CSYA 4YGAB 2FHCA 3KYOA 2QADB 3UTSD 4OBRA 3K1DA 3E6FA 4OAWA 2YC1B 2AKRA 2HFTA 1ZANL 4OBSA 1JYVA 4OM0L 4QHUA 2DMKA 2YD8A 4E42A 5T3XE 4FFWD 3U7WH 3BPOB 3GMLA 5DFVD 2DQTL 5DFTA 1NDMB 5TF0A 4HMDA 4HKZB 2WAHA 3EOTH 4WHTB 3VXQA 1IGML 1MREL 3DVFA 1JL8A 3D2UA 2IAMC 3O8XA 2EXWC 3SY0B 1MIEL 1JNLH 1H5BC 3DRTA 2FZ3B 2VLRB 1FLTX 2GW5A 2YOCA 4J4PA 3RY6A 4PIRF 2YK1L 1E0OB 5KG9B 1R3KB 2FX8H 4YFDB 3VGEA 3LDBB 4HJGB 1JNNH 1Q9WA 5HHXL 4ODUA 4YC2C 3NCJH 5IESL 1S7QA 5KW9H 1MRCL 4J3TA 3VJ6B 4KMLB 1D7FA 5D1QC 4HWBA 4LAJH 4F57L 3F6LA 4YEFA 2OZ4H 2AABH 3HLAB 5IBLC 4BH7A 4X8XA 5HY9A 2MCPH 1EHAA 3ROOA 3NACH 2DD8H 5EO0A 3PDOB 3IFLL 3BESR 3QPQD 4EZMA 5INDA 3BXNA 1G9EA 3E2HC 4JRXE 4KKLC 3U30B 1C16B 1HEZB 4JZJA 3QDGA 1OGTB 3TPUA 4Y4KB 1F13A 1FNGA 3HMXL 3QG7L 4JVPA 43C9B 5IV2B 1T1WB 3KPSB 3OF6D 5D2NA 5HGDB 5A2JH 4PLNC 3NH7L 1RIVL 5M95B 4N9OB 4XCFH 4Z7NF 1A4JB 1I1FA 3L7FA 1VFBA 4Y5XA 3UPRA 1G9NH 4CU6A 3TBTB 2MQCA 1CFTA 2ZNXA 1ACYL 4RISL 2E6JA 4HCRA 4Z76A 2DMCA 1M7DB 1R3HA 2JJTA 4MA7L 4JDTH 4OCWL 1A6AA 3DYPA 3EHBD 4K94H 4WUKH 1XF4B 3WXVH 3W82A 5CZXD 1NGQH 3BUTA 2DQIH 4N0RA 1N6QH 4L4VA 4DN3L 4Y8DC 4O5LL 5DD3H 1QVOB 1W72A 1A6WH 2R2HB 4HF5L 5AAMA 1T20B 3AAZB 3N06B 4Q9BA 2PXYC 4PRPB 1J12A 4BFBD 5IP4A 1T20A 1U3HC 4ZFZB 3PABB 5E2VH 4G7VH 2P24B 5ITFA 1D6VH 5CKAA 4DN4H 3MACH 2ATKA 3VFOA 4LSRH 1MHEA 3DX8B 4HIEB 4TUJA 3A6BH 1DL7H 1I7RB 4ZOAA 4I3RL 1OAXL 3DRTB 4BKLB 3TYGL 3IXAA 3P0YH 1I1FB 3L7FB 2DOCA 4LIQL 4OCMC 4ZS6D 5GSRA 4WTZG 5D5MA 1T04B 1KB5H 3QUMA 4PLJD 2NY6B 1UT9A 2CXGA 3K81A 1LO4H 4N0UE 1ZAGA 3LKPB 1F2XK 2G60H 2FLRT 4BELD 4QRPA 5ETUB 3GMOA 3Q6FA 1FGVH 3FQWA 4GMSH 3NIGE 4NQVB 4ZDHA 5HVWA 3HFML 5DHVH 4F7PA 5DJCB 4JRXB 3TO4D 1OB1B 1E4XL 1IKFH 2PO6D 4CAGA 4YBQC 5T5FL 3W39B 1VGKB 5I75C 3PIQA 4LSSL 1AH1A 2WQ8A 2DM3A 3WNOA 1QUNA 1IL1A 4HSQA 2M26A 2PCPA 4MAYD 4Y4HB 4EXKA 2OP4H 3MBEA 3EFDL 5DTFB 5DD1H 1Q9KA 4RQQB 3JTSB 3TJEL 4J3XA 4B7LA 4QOKB 5HTSA 1I85A 4YHNA 5HI5D 1J05B 5E2UH 1U8OA 2AV1B 4KROC 4HIIB 3QO0A 1J11A 1CG9B 3ALXA 1BD2D 2B39A 1OQOA 4P4KA 4XAKE 5MEND 3BEVA 5C0NC 3TIDA 3QNYA 4PJEA 1I9EA 3NA4A 5B21A 4Z7OE 1YA5A 4UU9A 1N2RB 2NY1C 2A9NH 3BFOA 1U58B 4JFED 3BIKA 2ERJC 3BH9A 1FGVL 1MI5A 1KT2A 2QR0A 3BHBA 1FC1A 2XRAH 3ZL4H 1ZGLA 1HQ4B 4JO2L 1A2YB 3AS3A 3W9DA 5JHDA 2WANA 3KXFA 1NC4D 4NN7C 4HK3N 5ICZB 3QEGL 1AI1L 5TPWL 5DMKA 1A2YA 3W9DB 3TVMD 2HKHL 2E6QA 2A1WL 2PW1B 2ZSWA 3FFCD 4LEOB 4U1LA 5F7NC 5FGBC 3VGAB 5DMGD 1LK2B 4JO1L 5BRZB 3DI3B 3EOBB 4HWBH 4EUPG 3JTSA 4FQPA 1S7RA 1A14H 4M93C 5IT2H 3NFPA 1JHKL 1UM5L 3G9AB 5CS7A 4MXQC 1QLEH 1A7NH 3VG0L 4LLAA 1CXFA 2MFNA 1G7MB 4M1CC 4KTDL 1J1XH 1J1XL 4I8DA 3ZTJH 4LCUB 3WLWC 5E4IA 5EPMB 5J3HC 2C3HA 2R0ZL 5CBAB 4E42B 4UDTB 1DLHB 3MV11 2F5AL 1A4KA 2AEPH 5D1QA 3FB5A 1J1OL 5GGRY 3FHAA 4ZMAT 4NQVA 3SDAC 3H7BB 4K7FA 5HHOB 3Q6GH 1U3YA 3WIFB 1HYRC 1YMME 3OKDB 4MA3A 1HCVA 1TIUA 1KG0A 2Q3AA 2UY6A 3CXDH 1Y0LB 3GMMA 3MODL 4QXTB 1X5HA 4CVZB 1CE6B 4RWYH 3BMWA 5GIRA 1HDMA 4OGAD 2VLKD 3EGSB 3VXUA 1QYGH 4YDJB 1NGYB 5E9DE 5EOQH 5HPMB 1EUUA 4K71C 3SPVA 1K3IA 3OPZL 3WO3B 3QI9C 1BM3H 4XPTL 4XNZB 2JJVA 5EU3B 3WKNA 5DD0H 3WXWH 1HYSC 3MLPA 3EJZD 4C4KT 2OR9H 3O6ML 4KFZC 1RJZA 2JLLA 3PJSB 4P5TA 1A14L 2ZG1A 2ZPKH 1HINH 4PRBB 4JDZB 5GZOD 4Q6YA 5DVKA 4GAJL 3UEZA 2HJFA 2BDNL 3KPMB 3UO1L 3UYRL 3NACL 1DN2A 2FWOB 2O5ZH 2OYPA 4U2YA 1YUHA 1EMTL 3EZ8A 4TPRH 2QV2A 3CLEH 5EOTB 2CUMA 4LVNB 5D7IB 4Z7OF 1OW0C 1BREA 3UAJC 3BKYL 5C8JB 3B83A 1ITCA 3VD7A 4GAYA 5DQJB 5B39A 1WLHA 4G42A 4N5ED 4GG6A 5CJXC 4K3GA 3NH7H 1FH5H 5C0EB 2V7HA 2DYPA 1ZT4A 4GAYB 5FGCB 3DETC 5ISZA 2IEPA 3VXME 4X4XA 1S7SB 1G7LB 4AJ0A 4KK9C 3RWJB 5BW7C 1W8OA 1M7XA 5C0GA 3C9NB 4NNXA 4NM4H 4Y4FC 1PG7H 1R3HB 2VB5A 1LO3H 2FX9L 2C3GA 3MRMA 4OZHA 1CI5A 3U9UB 3QG7H 4XPGH 1VFAA 4Q6IC 2VLLA 3AS1A 4HS8L 2BRRL 4R9HA 3BIAX 5IJVB 3MROA 3WCYA 3WNMA 5HJ3B 4XX1E 1KCUL 3BIBX 4R97C 4PLKD 1P7KA 4OZGE 5IJVA 1LILA 2DQDL 1CD9B 5SX5K 3ZSSA 3C6LC 1JPFB 4ZUSB 1JN6A 3IDXH 2JCCA 5AWNL 3KNBB 1PVHA 1OF2A 4P23D 1E28A 4UINH 5JW4Q 1FL5A 4S1SH 2IPTL 2EDYA 1U2HA 3KXFE 4KK6D 2ARJA 3HA0A 1HXYA 5DVNA 4FS0A 4XPFH 3DYMA 3PUCA 4LQFH 1IGCH 4HMEA 1FL3B 2OJEA 4KKCC 2WP3T 3ARBC 5FUZL 1BAFH 4NM4L 2HLAB 1Q9OA 1BBDL 5EZOL 1G0DA 3MACL 2WUBL 4OZGF 4U1NB 4N1HB 2DI8A 1TLKA 4BQ6A 4I4WB 3FOLB 2ENYA 4ZSOA 3QUZA 4Z7VF 1MQKH 2I07A 1YNTA 1X5AA 4R26L 4RAUB 5DMYA 1A0QL 3QG6B 1JWSA 1FVEA 1M1SA 3H8NA 3U7WL 4IS6B 4KV5F 3U9PH 1E4KC 1F90H 1MFBH 1LNUA 3VFWB 2BMKB 1UWEH 3GK8H 3NCBB 2R4RH 3VGBA 4LK4A 1HHIB 1UXSA 3HE7A 2VC2H 4IRZL 2IC2A 5IVXE 1S7TB 1A1MB 4K07A 3KYOB 4K23L 3QJHB 4N9GA 2GT9B 1F2QA 1F97A 4PTTA 4CVXA 2ZOLA 4XI5C 2AKRB 5JW4M 5A3ID 3N9GL 4X9IA 1C7SA 1KV3A 2WNGA 3QIUB 4S2SA 4WWKA 3QEQB 4P48A 5JMOC 4M4PA 4PJEB 4NQDE 1MF2L 2ZOLB 1I1AB 2DYPD 5F7HA 4X5WB 3O8XC 3C08H 1MAKA 3FT3B 5SWQB 3QYCA 5FV2A 2CSPA 3R8BB 3VG9B 3CSGA 3MV01 1RUQH 4QRUA 3RVUC 3TO2A 3BHBB 3GSQB 3UJJL 3FKUS 5JXAH 3C8KA 4YJZL 5FYKH 2QHRL 3ZE1E 3TYGH 3PQYB 4U1JA 3ARWA 3U4EB 1MSPA 4ZFGH 5GGUB 1FGNL 1NLBH 3AVEA 4TNVF 4XNMA 3WSQL 3TA3C 4EI5D 3LHPL 3P77A 5C9JA 1NKRA 1TDQA 5HBBA 3EOTL 1XIWB 1KCRH 1G6RH 4M3KB 3TT1H 4UZGA 1ZLWK 3V4PL 1N5AB 2ITDB 4X4YB 1S7TA 3EYQD 1WSST 3NA9H 3HC0B 4RFNC 3GBNL 5F21B 3HR5B 5KJRH 3ESVF 3UTQA 5FA3B 3WHE1 3SQBA 6CGTA 5GGTH 3PXJA 1A64A 4WI6A 1XH3A 4X6EA 1VGEL 2BVYA 2HRPL 3ZO0A 2F19L 4J4PD 3B5HA 5LG1A 4ZS7H 2HT3D 1Y18B 3MRRB 3GMNA 2OJEB 4Q9CA 3VXQB 2WM0A 1TZGH 1VEOA 3N85H 4TOYL 4Z18A 4FFWC 4HWBL 2ICWA 3MFFB 1J86A 2EE9A 4JKPH 2GKIA 1J8KA 3TO2B 3HZYA 3UZQA 3QFDB 2DQTH 2W59A 3X12B 1ZHLB 2Z31A 1MCKA 4PJ8C 3BT2L 4M7ZC 4QHLB 1CF8L 1XF2A 4GW1B 4WDIB 4P2YA 1BEYH 2GUOA 4YHLH 4Z7UB 4M8QA 3NPZB 4PGCA 4XC1H 5J1AA 2A6KB 2QADC 1PQZA 1S7WA 1UKSA 1YECH 3C6LB 2D03L 4JHZA 5JW3L 2ZCKH 4U6HA 4LF3A 4IOFC 4P2QD 1ETZA 4JY4A 1KELL 1KLFA 4P5MB 4MQ7B 4P0DA 2FSEA 4WI8A 1C5DA 3QHFH 1QVOA 2R2HA 2OJZH 1MELA 3VXPB 3GI8H 1A3RL 4NC1E 3AB0B 4XP1L 4OZFB 4L1DA 5IFHL 2AP2A 5DD3L 5LBSL 5EWIH 3TPUB 4F33B 5L88L 1AO7B 2DD8L 4PGDB 1TJHH 4NN5B 3FRUA 2YD2A 5I0DA 4L3EB 3QIWA 1VFBB 4Y5XB 4LHUB 1RUKL 3WFCL 5D1XA 4Y5VB 3RZCC 1QHPA 4LLYB 4E5XA 1MFNA 3LAFA 1GH7A 1WIPA 4G42B 4KMTH 4KMTL 1DN0A 1IKNC 5CKGA 3RVVD 2D7TL 1B2WH 1JGEA 4WI5A 3RQ3A 5KSBE 4JFDA 4XVUD 1NLDH 4D3CH 1MFDL 4PGCB 4WJ5B 4QKXB 1B88A 1RIVH 2NY1B 3SE9L 4KHTL 2ZZUT 1GZPB 2XTJE 3QQ9D 1R5WB 5C0BA 4D94A 1E6OH 4KK8D 4XRCB 4HS6A 4LDLB 3TNMA 5E24E 2ESVA 3Q6GL 2FSEB 5JDSA 3KVQA 1X44A 4LLVB 4ONHB 3DHMA 4PJEE 3U7YH 4IRSB 1MCWM 3KXFD 2EO9A 2BOBB 3PWPA 1XR8A 5C0JA 2HWZH 2K1MA 2NW2A 2WBKA 1KTRL 3RAJH 2B7DT 5E03A 3F5WA 1MCFA 2ED8A 3TESA 4PJBB 2Z8VC 4HIEA 1U41A 3MNWB 4WFEE 5TQ0L 3S8WA 2QHLA 1T03L 1MNUH 3PQYE 2YBRB 1JN6B 3BUYB 3X13A 3OZ9H 2GSGA 5EBLA 5BQ7B 1QFWI 1JTOA 1T22B 2IH3A 1U8MA 1CFTB 1IGFH 3F7QA 2BY2A 4HF5H 3P9WB 4GW5B 3GGWA 2G2RB 4YHIA 5IW3A 1T22A 1B2WL 3JWOL 4X7SH 1BVKA 3AM8C 5KVEH 4MAYA 3SDDC 3CLEL 5TFSL 5ICXA 4EIGB 1XEDA 2P45B 1F02I 1ZHKB 3GKZA 3NIGF 2X1QA 1Z9SA 5C7XH 4K7PL 1CGVA 4WTWA 3L3OB 4JFZH 4KVNH 3U36B 1XF5B 5DA4A 1W0VA 4P5TD 1CVSC 1T0NA 2NY5C 1H3PH 4LBEA 3ZL4L 3OR7B 1EHXA 1XZ0A 2EYSA 3V4VL 1YEFH 1VDGA 4XBPB 5EORL 4ZAKB 1KCRL 3OKMA 5DZNA 5DUMH 3LS5H 3TV3L 4L3CB 3LH2H 3SDXB 4ZAKA 3IDYB 1G7QA 5JIKA 5JZ7D 1LDSA 4NDMB 4Z8FL 1GGIL 4FZ8L 3H9HA 4HPOL 1M4KA 4F9LC 1DR9A 5JO5B 4EI6B 4APQB 4PJ8B 2GT9A 4PTTB 5D96B 3VDAA 2LABA 2D7PA 4PV8B 4UB0L 5IJKC 1BQLH 2W9LA 1N5YH 4UT7L 2H3NB 1EBAA 2AXHA 4E41B 4RMTA 2HKFL 3I9GL 3VI4F 5FKPB 4JRYD 1KEGL 4LRIC 5AWNH 4P9HH 3I6GB 5KJRL 1MQ8A 1YMMB 3IU3A 3RJDA 4Q74A 5ID0B 4UDUA 1U3HD 2H45A 5IB3B 1FNEA 3LEXA 4TNWK 3VFGH 4F7CA 5BRZA 4X0KB 1AD9B 2VAAB 2DQUH 4LOUD 1UZ8A 5KSAA 3S3PA 4WFHE 3PV7A 1JIBA 2X7LB 3F12B 1AD0A 4Z7WE 1M7IB 4H8WC 3RU8H 4DZBA 1UH2A 3GSRB 1ZVYA 4GW4B 5ACMA 1RURH 2LFGA 4OLXH 2R8SH 3GSUB 1S9XA 1KXVC 5JOEA 2XTJB 1MQKL 2DQHH 2KBGA 5KS9A 1G84A 4M6NH 1CFSB 3LEYH 5DRXB 3VXRA 5J12B 2KH2B 5H94A 3NOIA 2W0FB 3RNKB 3ARDD 5T1LB 2C1PB 5KS9B 4F15C 4Z77B 1DVFB 3IDJB 3VFRB 2DQCH 4GRMA 2Y7QB 2X4PB 2CUHA 4DGIH 1N5YL 5BJTB 2EDLA 3KPRD 1BZQK 1KLUA 1A9BB 3QDJE 4LKCB 5TDOA 5F7FA 4D9QE 5EUKA 1WZ1H 4MD5B 1IBGH 4OFIA 2LVEA 5DD6A 4O51A 2VXSH 3ZDZE 4DQOL 1OPGH 4FQ1L 3GO1H 4QLRA 1PW3A 2R2BA 3CJJA 4HHAB 1EDQA 3HC4L 5E9DD 3S34L 4L8SB 3LQZA 5GGVY 5M7QA 4XVJH 3O41B 5DURB 3RRQA 4L3ED 4HUXA 3GUTA 1NSNH 1UXWA 4M5ZL 5LCVL 2K3TA 4IRJC 3RPIB 1F8TH 1TZIA 3OKLA 4G5ZH 1G7JB 4ZUWB 2VQTA 5DEFA 2EYTA 2FO4A 3F65A 1S5IL 2OXHA 4I9WD 1J88A 1PSKH 4NOFA 2ARWA 2SEBB 3LKRB 4J8RB 1NBYA 3TH4T 5FOBB 3TBYA 4M7LH 4ZFFB 3O0RH 4WNQB 3JBG7 5ENWB 3O3BA 1BZ7A 4M02A 4UI2A 3SE4C 3TBYB 3CNKA 2OBGA 3U0PB 1OT1A 3NCYS 3RWDA 5FYKU 3REVB 3BZ4A 1G7HB 1DN0B 3MLVH 2G75B 1AGBA 1UM4L 1N3NB 4OI7A 5E1AB 4CUCA 3GDBA 1GGCL 1Z2KA 4RRPA 1BJMA 4U05A 4H0IA 5J7CC 3WFCH 3ARFA 4EI5A 3ILQC 4DOHE 2WW8A 4JY6A 1CXKA 2P1YA 2AXFB 1JVKA 2I07B 3VFVB 2FX9H 3AXLB 1T66C 5I1CH 2D9QB 1YYML 1NCDL 5GRUL 3RWCA 5D7IA 4GQPH 5IHUH 3FB8B 4N5EC 1DLHA 1EZVY 1IAKB 3QDJD 4YE4H 3GSOB 1B9ZA 1N26A 1OP3K 2VDPH 1JNJA 4V2CB 3LS4L 2WIIB 1L9NA 32C2A 3QHZH 1UWEL 2VR9A 1DVFD 2VXUL 5K59F 5HGHB 5A2IH 5DJAB 1CE6A 3QISA 3IAGC 1A0QH 2VLKE 3BH8B 3LV3A 4UIKL 5IB5A 4YFEA 3RVXC 4KAQH 1I7ZA 1G7HA 4HIXL 4HQQL 4JM4L 1YZZA 1RIHH 3BGMA 3L3KA 3QNXA 5GRJL 4GSDH 5MENE 2V7NA 5DO2C 2C1OA 4AH2B 1MEXH 1RUML 1CFVL 4NSKB 4CADA 3LRGA 3CCHB 1PJ9A 5D6CB 2AJXH 5ISZE 5DS8A 3C8KB 2BNUA 1T7XA 2A9MH 4QYOB 4P99A 2KQNA 3UTTD 2EEDA 4QRQB 5CP7B 1HQRA 3X3GH 4CW1B 2V17H 1RZ8B 5F7LB 5J4MA 2PYEB 3G6AB 5C2BL 4ZFGL 3D69B 5LGHH 3BDYH 1MCJA 1VADB 2PTTB 4TUOB 3VGGA 4JN2A 1G6RL 3MRPB 4QF1A 4QWWD 4AQOA 3V95A 4M1DH 5E6IC 4TVPL 4AEIH 1XH3B 1NLBL 1WQVT 2HT2C 4X6EB 2N4IA 3WSQH 1EHLL 5JORA 4YR6A 2A73B 4PP2B 2WBJD 2GI7A 1FZKA 3ECBA 4XMKL 4YWGL 1AXSA 3QH3B 5FGCE 4PB0H 5IIEA 2VDRH 2VDML 2IPUG 4JAMA 1LP9B 2CJUL 4YR6B 4FQQB 1REIA 4LCCB 3GB7B 1B4JH 5EO1B 4NBZB 3D3VA 2Y25A 4PRNB 4BQBA 1PG7W 2QEJA 3FCTA 2XTJD 1QFWM 3WHXA 4KMQA 4Y4KC 3MLYL 5EU6A 5E2UL 1WT5A 1JPGB 2YMXL 4FRWA 5D1ZB 5DT1H 1OL0A 1UZ8B 4XTRD 2H8PB 3GSNA 3DUSB 1JHKH 2ZUUA 3DGGA 4JANB 5GISL 5DEZA 3DMMD 4YXHH 1U3HA 5AZEH 3VXSE 1KSRA 2DLFH 4LVHB 1UJTA 3THMH 1PZUB 5F7UA 2Z92A 5HDQH 4GKNA 12E8L 3BISA 5GGSA 3RI5K 2RHEA 3DPBA 3GMOB 1AXIB 2ZUTA 5AG9A 1IGTB 3QSKB 4Z95L 4NBYB 5C86A 4DTGL 2YUVA 1NCWH 2VXQL 1BVZA 3MLTA 4WHCA 2FJFA 2Y5EA 4NNPH 5EORH 3CSPA 1M6OA 3CMGA 3K2UH 2FATH 1KLGA 4FMKA 4PJXF 1H15A 3OPZH 3ULVL 3UTTE 3D18B 3QRGH 1I8KB 43CAA 2YSSB 2WMPA 2BNUB 2R23B 2Y5TB 4MNGE 5C9JB 2DQIL 1UQSA 3HNTH 3DSFL 4JKPL 2HFEB 4LU5H 2PO6C 4QRQA 4LCIL 2ICWI 2F54D 3EW3B 2DKSA 2GJZA 1OLZA 4S1RL 4Z7UF 4MAUL 4UTAL 3NFSL 3W11D 5ESQA 3WN5A 4X5XA 2YPLE 2GFBB 4RMUA 4U1KB 4U6XB 3DNKA 2VZTA 5CSGA 3UBXA 2IALA 4ZD3L 2NY5L 5L2KB 1H3XA 4XPGL 1I1RA 5L6YL 4OV5A 4W81A 1XGYH 4RIRA 5BMFL 3C60A 3MODH 3CK0L 3ZHKA 1GGYA 1YEHH 3AUVA 2P5EA 4AEHH 4ORZC 3RWFB 2VDNL 1EVUA 3AREC 3DV4A 3SCMA 2X10A 2CRMA 2M8XA 1ZS8B 2FH8A 5I8EA 2XFXA 3TLRA 4Y88A 5GS0L 4YDIL 4ZO7A 5GS1C 1FSKB 3TO4B 1ZHNA 2VIRB 1JPSL 1NDGB 5CEYB 4M7JH 1P7QD 2CUIA 2GJ6E 1HH6B 4N0UA 3GJEA 3PG2A 2CDFB 4U6YA 4XAWL 2VMFA 4YHIB 3PWLB 3VXSD 1ZHNB 3O45B 3MRLA 2VDQH 4AT6B 1CK0L 2XACC 4ETQA 4X6BB 1A1OA 4DK6A 1CIDA 3B8SA 2O5ZL 1AGDB 3GKWH 3OB0H 4TN9A 1XR8B 1N6QL 2Z91A 1A21A 3BX7C 4UT9L 3GMRA 4OGZA 4G9FD 2XKNB 5D5ME 5TE4L 5T3ZD 5EPMA 4ALAH 1MY5A 5C0BE 1EVTC 2P5EE 4IRSC 4M1GL 1XFPA 3FTGB 1KJMA 1IGIH 3GSXB 1NEUA 3HAEG 4XXCA 5FOJA 3WIFA 5E7BA 3VFUB 2VLMD 3U0TA 5IR1A 1EA9C 3ZE2E 1JK8B 5HSFA 1CXIA 4Z9KB 3JUZA 4DFHA 2B1AL 3A67H 2R1WB 3QIBA 5EU6E 3V52H 1GZPA 4GO6B 1S9YB 2CPCA 4R3SB 5CJBA 4WI9A 2W60B 1DBAH 5I30L 3L5JA 2W0PA 3TVMB 1AGFB 4PV8A 2VISA 3LZFH 3SKMA 3LZFL 4JDZA 3PWUB 4N8VG 2H32A 3IRZA 4KPHL 4NQUA 5F97E 3S35H 5K9QI 4QTHB 1C5BH 4U1KA 4LFHD 2O5XH 3QDGE 4XHQA 3KPMA 2GAZB 2PTVA 2ILLA 1UKQA 4MYWB 3HI1B 3FO0L 5L2KA 2B4CH 2DQGL 3SBWC 2CMRL 5MI0C 2HT2D 1MCIA 5C1MB 3ZE2F 3B3IB 4G80B 3AC0A 1C16A 2A83A 3B6SB 3HNSH 1K6QL 4PBXA 3NN8B 3QDGB 3PHOB 4JFEA 1NAMH 1U8PB 2BY1A 1NGZA 1BJ8A 2VXSL 5IFJA 1RFDL 3CSBA 5HGAB 2Y07L 1BOGB 2XWJA 1A4JA 2AJUL 4PRPE 3RU8L 2UWEE 3VE0B 5IB2A 1N7MH 4NFBA 5AG8A 2YD4A 1K4DA 5HDBE 1TETH 3OG4B 4LP5A 4OM0H 3STZA 2Y06L 1BZ9A 3WNPA 4UDUB 5DMGC 1FZJB 1M71B 2W1NA 4PRID 1ORSB 3GEWB 5H35A 5ADOH 1XCQB 1WV7T 5FYKL 4HLJA 3G6DH 1JZ6A 3DX6B 1ORSA 1X5JA 2PW1A 5DD5L 2ZSWB 4U1LB 3VW3L 2YPVL 5SWSE 1XR9B 4O51B 2HKFH 3I9GH 3UJTL 4WO4B 2IJ0C 2Y72A 3VG0H 4QO1A 4KJWC 3DUHA 4S0SD 4TTDD 5F93C 1RHHB 4QXGL 5C08A 1MVUB 3I3DA 1OSZA 1CYGA 4IRJA 4I77L 4NDMA 4QRRE 2R0WL 2EE6A 3ARZA 1RHHA 5I1EL 3VWKD 1QD0A 2EDRA 5GSRB 1YY9D 2YD1A 1CLZL 4XCFL 3D87B 4XVSL 3WD5H 3MV9A 1AKJD 4YDKL 3K8MA 5CJ5A 1RIUH 1MRDL 4S1RH 4QOKE 4OZHF 4JLRB 2CIIA 1FZJA 5E7FA 5EOQL 5GSVA 5IB3A 5IROC 4WW1B 3T0DA 2DJUA 3FN9A 4QXUH 5CBEA 1WCQA 1S78D 1ND0A 4IOSD 4PGEB 1X5FA 2B5IB 2FB4H 3RVTD 5I1CL 2VAAA 4JEGB 3WFHB 4F9PA 5BS0A 1CZ8L 3ZTJG 4YPJA 1CL7L 1KULA 1CCZA 4FQXD 1HHHA 2LE9A 4DEPB 3OKEA 2HYMA 4WHDA 5I19H 3BN9D 4M62L 3ES6B 5FM5O 4PLOB 3TN0A 4BK5A 5AEAA 4OCSH 1PKQB 3T4YA 1IC4H 3V6BR 1NC4B 3GRWL 4AEEA 4HC1L 1JNNL 2EC9T 5EUOA 3UZVB 3QO0B 2ENSA 4DKFL 1HHKB 3NCEB 4EI6A 5A2KH 4PRIE 4JHBA 4OZIA 5D7JB 1BQSA 1KPVA 2NXYD 2YD3A 4XCNA 1TJHL 2AJXL 5F9DC 4M8VA 4P59H 1LEKB 1WFUA 2WIIA 1S5IH 2FH6A 5MEPB 4F37K 3GBML 2G75A 1R5IB 3QHZL 2YPLD 4MHHI 4DKEL 4OD2B 3OZ9L 3KYNB 5CAYB 5CEYA 3ARGD 3WFBH 2N7AA 5HYIA 5FFLA 1AJ7H 4H26B 2APFA 3MUGB 4YE4L 3PGCA 3BPNB 4BUHA 4RFNB 4URTB 3UCRA 3ARFB 1PKQA 3MV8B 3MUHL 1E27A 3QZWG 5C0AA 3G5ZA 1CLYH 3MROB 1V7MH 4WI2A 1ZT7B 3GNMH 3U7YL 4OT1H 3WUZA 2APVA 3VXTA 5C07E 5L0QC 2RFXA 4F7TA 5C0AB 2VLJB 3MMEB 1P84J 2B0SL 4BA8A 2ZP0T 2PTUA 2P5WE 4M7KH 2ZG2A 5CIPA 2VKWA 3CFEA 4N1CA 4B7IA 2RFXB 4F7TB 4P23A 5TQ2H 3K7UA 4FQLL 1UM4H 1QR4A 3D85B 2V5YA 1BZ7B 1B0GB 4F3FB 1S7VA 5DK3A 3RL1B 1IC7L 3RY6C 4U4BA 4MA3B 4OZHE 1ZSDB 1JGLL 1DQMH 2BCKA 1A7OH 2B4CL 2DQGH 5ICYA 4HH9B 1R3LB 4U1HA 3KLDA 5D7JC 1SYSA 1R3KA 4NO0B 1T21A 2HTLD 5EZIL 3WKMH 2EIDA 5AYQA 1MAML 3PV6A 4Q9QH 2WWMD 5J13B 1EHNA 1IT9L 1YJDL 4R2GC 1J1PH 1AJ7L 2WUCL 1MY7A 4IIQC 1NBZB 3LQZB 3T1FA 3CVHA 3BO8B 4TSCH 1PDKA 1XF3A 4FTVA 1I9IL 5MEQA 4L3EE 4GS7C 4JZNB 5DSCA 2AV7A 4MQ7A 4ODXB 3OKNA 5DR5L 4TVSa 2DM7A 4JQVC 2VLRD 4O02L 4G3YL 1ACZA 1YNLL 3VXPA 1TZIB 1ADQH 1YEKH 4HS3A 4LCWA 3NCCB 3IJHB 5DJ2A 4MMZC 4NPYA 4OI8A 1IJ9A 3RNQB 1P4BL 4NZTH 1N0XH 1P6AB 3IU4L 2Y1VA 3PHSA 1IAIM 5LGJB 5DLML 3FQUA 3WUWB 4MSWA 4DCQB 4GAGH 5D2NB 5HGDA 3LD8B 4JPKL 5C09A 2ZSVA 3U1SH 5TJWK 1PY4A 4AZ8A 1S5HA 2DWDA 5J6HA 3QI9B 4H1LB 5B22A 1UENA 4UT9H 5E8NA 1JYNA 1U8QA 1CVRA 5CGMA 5IK3A 2XWBB 3VRLF 1K4DB 2C7UB 4OF3A 3SKOB 1IGTA 1S9WB 3VCLA 5F7DA 3TJHC 4POUB 1FPTL 5IK3B 3DETD 1D6EB 5C3LD 2GTZA 3L5WA 4U33A 1G9ML 5BV7H 1CICC 4LPVA 4M6AA 2ZCKL 3PGFH 4FN0A 5CSZB 4P57A 1JGVH 5D8JH 2IGFL 3G5XB 4X7FC 3T1WA 1OTUC 1JYXA 1FNSL 2VL5A 4CW1A 5CSZA 2H8PA 3GSNB 4M62H 2VXQH 2VDNH 1NCWL 1AY1L 5I75B 2YZ8A 1F11B 1QBMH 2EYRB 3HRPA 3T2PA 3C6SA 2J2ZA 1QLRB 4JRWA 3HE6B 2CD0A 4XPAL 4IRJB 2EXYD 4H88L 4JFYA 3KLHD 4P3CL 5HGHA 1JNHB 2FB4L 5K9OA 4B41A 3FONB 5JPNB 4YLQT 4F7MA 4PRHB 3QDMA 3PDDA 4B5EA 5F3HA 5TH2A 2EXYC 3VD9A 2J4WH 5T1DL 3KLHC 1HK6A 4XP5H 1INDH 5C0CD 1N0LA 5L2JB 4P3DB 4Y7MA 2F54A 3IAPA 3MFGB 2WSKA 2FGWH 4ZOBA 4PJXA 3W0WE 4HK0B 3M1BB 3L95A 3GHEH 2Q3ZA 3VWKB 3U4EA 5IWLC 2F74B 3BE1H 5DA0B 5IMLB 3MOBL 4XMPL 1FYTE 3VFWA 1X5KA 3CC5A 5FO7A 4Q2ZB 1LHZA 4C83B 4I2XB 3IDYC 1NMCB 4X6BA 4FQJL 4QEGA 4PJ7B 4XBGA 4KKAD 4P2OD 4HIIA 5ANMA 4YXKL 2Z35A 4L8SC 5FO9A 3MREA 1HI6B 4QHMB 3CFKB 4QTIH 3FJTA 1OM3L 4HAGA 3IDIB 5C09D 4PJFB 4JM2F 4EDXA 3CFJB 5DK2B 1HI6A 2LVCA 4U1MB 4AIZB 3OB0K 2PW2B 4XCYA 3D25B 1KJMB 3VXSA 1ZS8A 2EDNA 1INDL 3MLRL 4EJ1C 5I8OH 4DQOH 1U3ZA 3KLAA 2LU7A 4AENA 5DWUH 4K7PX 3MRBB 3ZTNH 1V7NL 1JI2A 1A7QL 5HYSG 1CIUA 4WWKC 3B5GA 5FUCE 3KLSA 3UTSA 3IETB 3HS0A 4MDJA 3D85D 2HP4A 5F96L 3O6FB 1V5JA 2B20A 4NO5A 4NT6A 1BMGA 3L7EA 1KIQB 2COQA 2X89A 4JRYE 3NFNB 5ACLA 1T2QH 3QWQB 4XBGB 3IJSB 4ZODA 2DBLH 4G43B 4GBXD 2HN7A 5FXCH 1ONQB 1RU9L 3LVEA 3RTQD 5E08H 4U2ZA 1JPSH 2HT4D 3FFCB 1YYMH 5I1JL 3RAJL 4PJFA 5IFAH 1J1PL 2NY3C 5HI4C 3CX5J 2HLFD 4MJ6A 3HE6D 3I50H 2VLRA 2N56A 5F71A 5DGRA 3O6FD 1M6OB 5MEOA 4KQ4H 3RA7L 3UYPA 4DVBA 5I17A 1NEZG 2HH0H 3QUMH 2CGRL 3EO1B 1IGCL 4WV1B 3D18A 5GS0C 4WY7L 3UPRB 2VDOH 3IDXL 3MRLB 4NKQB 3LIZH 4NYLA 1A7RH 3WFEH 4QHNB 5B3NA 5DC9B 4Y1AE 4ELMB 3O41A 5F1SA 3HNSL 5SV3A 1PQZB 3GUTB 3WEXA 2YZ1A 4KDTC 2W92A 2Q6WB 4Z7WF 1IEAB 5F44A 3H9SA 3JV0A 2JELH 3DMMC 3ZMRA 5TDNA 1S8DA 3ARGC 5ALCH 2DWEB 4L1HA 1UWGL 5DEFB 2F8XC 1NBQA 1OQXA 3TN0D 5EZJA 3MV9E 4WO4C 5EIVA 2X4OA 4NRYB 5JW4N 2VE6A 4XBPA 1F4YL 3MCKA 1A9EA 1XGRB 3FQTA 5EOTA 1Q8MA 4N90D 3HE7D 5CINH 4NM8L 3WJJA 1II4E 4HUWB 3P9MB 2OK0L 1NKOA 1RJLB 4O2CB 4LPCA 5IQ7L 3MRHB 1WZKA 3SKUD 3T0EB 1KB5B 3AM8A 4N8VB 1U8JA 3EYUL 3ETBF 3P9MA 3G5YB 1IKNA 4ELKA 1SVCP 1KCSL 3VFSA 5F7YC 4BH8B 3BD3A 3OAUL 1L4IA 3QEUA 4KJPC 4GG8B 1DBBH 3KJ4B 2C26A 1XGUB 2F53D 4MQTB 4XC3L 4D9RD 3ARSA 3BRFA 4OAWB 4DAGH 2KZWA 4FQ2H 3KPPA 5TDNB 2FX7H 5TGBB 2OP4L 3OKKA 4MD0A 1L0QA 3I6LD 2Q86B 1QKZL 5C0BD 2FO1A 3DECA 2FATL 2FD6L 3LMJL 4V1DD 4PUBH 4WHTA 5CZVH 4JR9L 4OLXL 1P4LB 1Z0MA 3QULB 2EH8H 1W0YT 3SDXA 3DSFH 4WU5B 1RSFA 5I17B 4YHPA 5TPWH 4MB5A 1GPOH 2AEIT 5BQ7A 3QZWB 4YBHA 4I0PB 1EV2E 4KUCF 3IF1B 4PJ8A 4ZSOE 3D2UD 8CGTA 3SDDD 2NR6D 3INUL 3MYJA 3BQUA 3Q3GB 2JK5B 1W0WB 4W4NA 1OB1A 3MA7A 4GG8A 2MOVA 3ZHLA 4OUUB 4DUXA 4DTGH 4CU7A 5FKPA 1AGFA 3SKJL 5TF1H 1N64L 1YEJL 3FQXB 3GJFB 1DDHB 3BPLB 2OXGA 5JXEC 4TTDC 1RZJL 2X42A 1V7NH 2HVJB 4KRPC 3TZVB 1SBBA 4TNVK 1MFAH 1MF2H 4WFFE 1E4WL 2D9CA 4JKLA 4LU5L 3DRQA 2VN7A 3QAZB 4P2CG 1HQRB 3BPNC 4N0YH 4NC1C 5E00B 2UUDH 5DUBA 5C09E 5T1DH 2R4SH 3NCFB 2P4AB 4W6YB 1X6NA 3AROA 3AU1B 3AMKA 4LSDA 5C3TA 2A6DA 4NWUH 4LAQH 4IIQA 3OXRB 3KHQA 1KIRB 1MJ7H 4EUPA 4YX2H 1NUFA 4WVRA 2R2EA 5KSUB 4M6OH 2DQCL 1N8ZA 4Y4FB 5KVFH 1OAKL 4Z0XA 3ORJA 2W9EH 2W9EL 1JGVL 1A6PA 1KIRA 4EUPB 1GGBH 1XIWD 5EIIA 2F8VA 1P5VA 5C0CE 1MRFL 5CHNA 4R4BA 4GLRI 5EUOF 1VKXA 4OGYH 1XCTB 1YN7B 2J3SA 4GBXB 4FQJH 4M43L 2OX5A 4Y16A 4OD2A 4PY7A 5LGKA 1DBKH 4RMRA 2DMBA 3C5JA 4X98A 2F53B 4PJAB 1J8HD 1I1AD 3QUYD 1FG2B 2VABB 4HZLA 4F57H 2FGZA 4PGJA 4KC3B 1TQBB 4PS4L 1CDJA 2J4WL 5F3BB 3ZE0F 2R4SL 2DQJH 3SO5A 3KPRA 5F7MC 3R06A 1Q9LB 1BWWA 2FECL 1ZLVH 3SDAD 5JQ6L 2E8ZA 3E6FB 1NANH 5HVGB 3MNVB 1RULL 2FO4B 2Q7NA 5GZNC 4Z0XB 3QDJA 3FB8A 3DX9B 5CINL 4G3YH 2PYFA 4U3HA 1T4KA 3V4UL 1T7WA 1G1YA 4PJ8D 5FHAH 3FT2A 3VFTB 3QIWC 2V2XB 5E1HB 5DQJA 3VG9C 5C07A 1PZ5B 5B39B 1NJ9B 5MERB 3DGCR 1RVFL 2DB8A 1OAYL 1I8KA 5D2NE 4PJIE 43CAB 2HVJA 3TZVA 3ULVE 5EU3A 2YRPA 4HUUB 5GS1A 4BZ1L 5AD0B 3ARTA 5ISZB 4MD5A 5ECJE 5I74B 3CX2A 1GOHA 3G5VA 2E6PA 1P1ZA 3C9NA 4NNXB 4S1SL 4HKXB 1DQML 3E3QE 3NPSC 2O5YL 3OKEB 1SM3L 4RGOH 3NZ8B 1JHLL 3CIQA 2GJ6A 2H26A 4FQ2L 4G8FB 3NIDF 3RZWA 4RFEB 3TN0C 1OTTD 4ZUTB 3L5WB 3FT4B 5E6YA 1F4WL 2E9JA 5TFSH 4OQTA 4LKXB 1G1CA 2X4QB 4A6YL 4WEBH 3QQ4B 5ERWB 3F7YB 3D9AL 1I75A 4HDIA 1NFIB 4FXKB 2C4FT 2WWMC 5KN5A 3K0WA 2X4RB 3OJ2C 3P4OB 2CKBB 5I74C 3U9PL 1VFMA 2LU3A 5EUOE 1TPXB 4KVCL 5HVHB 2GJJA 2UVFA 4QRRD 5LXGL 2RQ8A 1DQLL 4RGNB 3QIBC 2GHWB 3RWGA 1U8QB 1KF9B 4LEOA 4RX4D 4WW2B 2P5ED 3QNXB 1YQVL 1AP2B 3MRQB 2XWBA 2VTFA 1VESA 3SKOA 2C5DC 4EEEA 1GGUA 3T8XA 1Q9WB 3V6ZA 2D0FA 5EU5B 1MJJA 1F6AB 2X41A 2YN3A 3I75B 4LGSB 3T09A 1URLA 4NHUA 1K8DA 3S5LA 1NCAH 5I1IL 2YC1A 4X6CE 3HKFA 3SO3C 4XXCC 1ES0A 2YWYA 5I8CB 1XGUA 4HUVB 3WS6C 4PD4J 2Z9TA 3N85L 4Y5YB 5B39G 4UTAH 4RNRA 4JO4H 2JCCB 2Y36L 3JWDH 2ORBL 1UM5H 3O6KL 2F74A 5L9DH 1I8MA 1FNHA 4G6KL 3EOAA 3S96A 1FRGH 4HG4J 1LO2H 4PJBF 3S3JA 1T1YB 1QLRA 1T83C 5HI3D 3D9AH 4XXDA 4FG6C 3DVGB 3QI9A 1HCFX 5MERA 1WC7B 5JIIA 3G04B 2F53E 4ODBD 4QRSA 3QNYB 1MOEA 4G9DB 3QDMB 2MPAL 3CMOL 5BZDB 1KJVB 4LFHG 4DJMA 4S2SB 1IC4L 1KELH 3V4PH 1QFWH 3BSZH 1HZHH 1P7QB 3I3EA 4X5WA 4KKBC 3SCMC 5CZKA 4WTXA 2QBWA 4M6NL 1PSKL 2XOTA 2VH5H 4J2XA 5JDJA 4XPTH 3WDHA 2V6HA 3L3OA 3PL6C 4ZQKB 2J6EH 3FZUD 4OIIH 2GQHA 4XZUA 5DS8B 1QBAA 1GXEA 4DN3H 2XY2A 1G6RB 1CFQA 1KGCD 2DQEH 4I5BA 1QFHA 5KOVC 4GT7A 3K4DA 4MA8H 1MLCA 2DLFL 1FYTD 3MQIA 3NIFF 1JGDB 1M05A 4LARL 4JZOA 5DRZB 3TH3T 5LAXA 5JPMA 5IF0A 3RL2A 4JRYB 3P4LA 4MLSA 4CU8A 1DQDL 3KR3L 1U6AH 3F7PC 1KYOJ 3T65B 1S7SA 1KNOB 1SMAA 1N59A 3QUMB 1ZTXH 4MDIB 4YHZH 3C60B 1E4WH 4PJDF 2R2EB 5KSUA 4MNGA 1ZLUH 4GMSL 4R4ND 5F1OB 2P5EB 4MWFA 3HI6H 4OJFH 4ZDHB 3S37X 4ODSH 1NMAL 5GIRB 4WUUE 4ENEC 1P4IL 4QHKI 1CL7H 4L4TA 4WGVB 1P7KB 1HH6A 4N0UB 1JFQH 4FQHA 4YX2L 4MJIE 1FLRL 3RA7H 1Q72H 3PABA 5ITFB 3HS0B 3RTQA 1A1NB 5GGQH 5CILH 5CILL 1MCSA 2ED9A 5F89B 1G0YR 3KNBA 4AT6A 3K1KC 4EN3A 3FO1B 1LDPL 4G9FB 2IANB 4GJTB 4MX7B 2OSLA 1J87A 1UJ3C 2HRLA 2MJWA 5EC1B 2BSSA 1R0AL 3QA3B 1IC1A 4PJBE 3TBWA 5H2BA 4LCYB 1YPZB 1EAJA 5DHYB 5D7LB 3S36H 3X3GL 2UZIH 2YPKA 5FECB 4HCRH 1DQDH 5GRYA 5GRVK 1CFVH 3SGEH 3FONA 5LKNA 3QI9D 2QQQA 4WW2C 3LN4B 4I9WE 4XVJL 3FMGH 3DXAE 4UMGA 1AO7A 4UDTA 4GRMB 4APQD 4JZJB 4OTXH 5GSVB 2J8HA 3MX0A 1ZA6A 4OM1H 5C6TH 4PGEA 1T6VN 5I30H 1BVLB 1OP5K 5EO9B 2E7BA 2YSSA 3BQUC 1MHHB 2Q7YB 4PJGB 3RWJA 5FO8A 1YC7A 2B1AH 3VXUB 2LTQC 3TBVB 5D2LA 1A6VH 2R2BB 4Z7UE 2VZ1A 2OL3H 4JFDE 5F1IB 1C5DB 2Q1EA 1EFXA 4CJ0A 3FN0H 2GJZB 4KJPD 5DJ6A 4P5TB 4ZG1A 4NQXA 5I73C 2HWZL 4P3WA 2QJDA 3NIFE 3BPLC 5D1XD 4W68A 4ODWA 4AM0B 4GUPB 4K8RC 4KKNA 1DQLH 3KPPB 4LNRA 5HHNA 3IVKB 5GISH 4Y1AA 1I9JH 4XP4H 1NAML 1AQDA 3BDYL 4UINL 1IFHH 5C7XL 1A7RL 1EGJL 4OB5H 2L7UA 1VEMA 3FRPG 2EDDA 1JWMA 2VSDA 3VFPB 4P5KB 2JJTC 1WCBB 4GAGL 4NZUL 4ELKB 2IG2L 1IM9A 3SDAA 3QUXB 3P4OA 5M94B 1VFOA 4HJGA 4NOBA 3ET9F 3PP4L 4J23A 1QKZH 1YPZF 4E41D 4YDJA 2XKUA 3P9LA 5D2NC 2UZXB 4OLYH 3V0AC 9CGTA 3JV5A 4N5UA 1OCWL 2R29H 2Q6WA 4O02H 5HYJB 1FCGA 1X5XA 3ZT6A 3NBNA 3DO7B 5FIEA 2H6PA 1UJ3A 4M1DL 4KROD 4UV4H 3X14A 3NGBC 2DWEA 3OAUH 3QNZA 3LHPH 1AXTL 4JM4H 1H3TA 2XY1A 5DC0A 3Q5OA 2X05A 4JDVB 1TTFA 4HJJL 1A9EB 1XGPA 5DJDA 3MRRA 3UJIL 5IM7A 1YEIH 1NANI 2AQ2A 4NJ9H 3ZDXE 3VU2A 1TZGL 4HKBA 3BKYH 4YQXL 1OPGL 2DI7A 2R1XA 2Q8AH 5FHBH 5IMMA 5JXEA 1MI5E 3MXVH 4HZAA 3QUXA 4ODTH 3TO4C 3HPLA 4LCCC 3T2NL 3W9EB 1BVLA 2NY7L 4P4KB 3UXFA 5I1AA 4PJCA 4U31A 2BVEA 1HKLL 1EBPA 3L3KB 5TE7H 1KJ2A 1VERA 3P4NA 5E6IA 3FZUC 4XPBH 2ZOKB 5IBUB 5KVDL 1DFBL 3WNNA 4AH2A 1P6FA 3QXWA 4OV6F 5CP3H 4HMCA 1CZ8H 4D9QD 3N1MC 2YUWA 4XTRC 3WEXB 1W0VB 2G9HA 1LD9B 1OTTC 1YNKL 3UJTH 1R3JA 4KKBD 5C0DA 4ELMF 2RCSL 1YECL 1SEQH 4Y16B 2OR9L 4M6OL 1RV6X 5KVFL 5F8RC 1PBYA 3MTRA 3R0MA 2HG5B 1MRFH 2IWGA 4NQDD 4YXKH 3KYAA 3X3FH 1RURL 1WBYA 2R8SL 4NCC2 4HZLB 5L2KD 1V05A 4P9ML 4GXUN 5DEGA 3B6SA 5GJTL 1OF2B 1QBBA 4PD4K 5HYSB 4LSTL 5LAXB 4KXZI 1CBVH 5JOFA 5IVXA 1SYVA 3OR6A 3QJFB 3WDJA 5HDBF 1DZBA 2Z4QA 5J1SC 5CMAA 3RVWD 3NFSH 4OKVA 1IM9D 5KS9E 1NSNL 2BVQB 5C70A 3U9UA 1VKXB 4PS4H 1RULH 5I8KL 2B1HL 1TVBB 1J8HA 3OF6A 1SJEA 5EZIH 4DW2L 1FRGL 2BVQA 3JTTB 4LLVA 4OZGA 4CMMB 4KV5E 2EDBA 4GOSA 1YY9C 1R3JB 4ODHL 2UY7A 1FG9C 5FYLD 2J8OA 1QLFB 1NFDB 1NUGA 2H2PD 5IB4B 3S98A 2YUZA 3PXHA 1WITA 5FYKD 2PXYA 4GXVH 1UZ6F 3K2UL 2B2XL 1IEBB 2NTFA 2B0SH 4YNYA 3AS2A 1LO4L 1NMAH 4Y4KD 3EBAA 1MCHA 1JNHA 1YDPB 3WIHL 2N7BA 4NO3A 3IF1A 4ZUWA 1DVFA 1A3LH 1JFQL 3GJFK 2PYFB 4GKZA 5D7SH 2X4UA 1IC7H 5IWLA 4M4RA 4XBEH 4UOW0 4GRWB 4BM7A 2YD9A 4OLEA 3D39A 4XCCH 6FABH 4LDOB 2H32H 3VXRE 3VRLE 1A5FH 3IDGB 3IDUA 3SDCC 3K4ZA 4QWWC 2NY3B 1T1XB 2XI9A 3ZKMC 3QFDA 2AJ3B 2V7HB 3QEQE 1F4WH 3P4MA 3KR3H 1T66D 4L4JA 3X17A 1G7LA 3NTCL 1SY6A 2FHBA 2GUOB 3TJHD 1TCMA 1SEBA 4ZXBD 3GSWB 5JHDD 5DEGB 1F6AA 1ADQL 1X5ZA 1QRNA 3EFFA 4O4YL 1UM6H 3VFNB 4TSBH 3TYFA 4FFYH 3QHTC 4KDWA 4LCUA 2VZOA 4U6HB 4ZYKA 4JB9L 5IEKA 1Z3GL 5FO9B 3UTSE 1EO5A 4E0RB 2P49B 3BSZL 3O3EA 5IQ7H 1FE8L 5ABDE 4PGZA 4K7FB 2VDKH 2NY4B 3RNQA 3ULUC 4WHYH 3MRNA 3O4LB 4MNQB 2Y6SD 3IB4A 3NABL 3MPCA 4XWOC 2VZ3A 4UV4L 1J0JA 1AKJB 3PQYA 3O4LA 4L3EA 1P9MC 2JJWA 1AP2A 3SDYH 4UILL 5E8NB 5EU5A 5L9DL 1LO5A 4FMFA 2RB8A 3WUWG 5CSBA 3OQ3B 1JV5B 4JFOB 3PWJB 5GRWA 2I27N 4XWOD 3HR5A 4JZNA 1H9VA 1GIGL 2BFVL 4OF8A 1A6ZB 1CLZH 3B8YA 4LVHC 5DQ9B 4HG4K 4GRWF 3CCHA 3ULUD 3DUUB 4LPTA 1U93A 1VPOH 3DMMA 3SO3B 5MHSD 3BGFB 3U83A 5D6DC 2EDEA 3SOBL 2XIDA 5DYOA 4I77H 4JDVA 5DUML 3DMMB 1T1YA 2BMKA 4KGLA 1NGXB 4RCAA 4CGTA 4L3CA 1OGAB 4NZJA 4UT6L 4Z7QE 1UB6B 3VFUA 3X12A 2EDWA 3OAZK 2YPVH 4L4TE 2P8LA 3O11B 1NJ9A 5D5MF 5D70H 1RK1A 1H0DB 5KTEL 4U6VH 3ZT5A 3MR9B 2WBWB 3UC0L 3HC3L 4FQ1H 5A2FA 4XNUH 1P1ZB 4PP2A 5KVMC 1DUZB 3IXTA 3GIVB 4ALAL 1J10A 5GRXG 2AEPL 4PLJC 2O61A 1FO0B 4HLZG 1OGAD 1FFOA 1IFHL 1LP9A 3ZKQD 3QUYB 3CAFA 1CFNA 4PREB 1D9KA 5GGRA 1IGIL 2BVOB 3S36L 2XZQH 1NCCL 1LQSR 3MRIA 3MLYH 1G7PB 4HBQA 4ZXBA 1A02N 4ONOA 3O3EB 1PX3A 3W0WB 3KJ6L 3MCKB 2ZUXA 5K93A 3QCVL 5GGUA 4Y4HC 1JGDA 1F6LL 1M05B 3QWOB 4R4FH 4X6CA 4AG4L 1KEML 5CGTA 1FLRH 1CGUA 3D0LB 2E7LA 4FFVD 5D4QA 3QXDA 1F3DJ 1JGEB 5IFJB 3WDIA 5HYSA 4L4VD 3EHBC 1C5BL 2AJYH 4OGYL 5FECA 4M61A 4Y1AD 3HE6C 3ELAT 1MWAA 3IGAA 1DUZA 3GIZL 2B2XH 3FN0L 5JQ6H 3V79C 4MCZA 5IMOB 2ITCB 1MWAB 5E6ZA 3ZKXB 5HHVH 1MFAL 4XNYL 4MJ5A 5DRWA 2JB6A 1UG9A 3G08A 4YGVB 5BMFH 3EKCA 1TZHB 2VXVH 1TTGA 3ARGA 5D7LE 5CLTA 2VZUA 5D6DA 5EC2B 5F9JB 4YHZL 4G9FA 5IB4A 3V7AE 3QQ3B 3GK8L 3CFDB 3WL9A 3MV7B 1KC5L 3C6LA 4LPXA 3QQ3A 4G43A 3VXRD 4BYHA 4QTIL 1L0YA 1WFNA 3O2WL 2WLYA 3T2OA 2FCBA 1QG3A 3IDIA 4OV5B 3LH2L 3MA7B 4HJ0D 4PJDB 2VXUH 4OZFA 5J1TC 3MV9B 4UV7H 3DV6A 2YN5A 4MCZB 4QGTA 3UBXG 5C8JA 2WZPD 4BSVB 5IW1B 4YHKH 2GK0A 1RZKH 3KLAB 4NO0D 3RGVC 4MXWL 2NX5D 2JB6B 3G08B 3PWPE 2DICA 3S88L 1CR9L 2XN9B 5E6ID 4NQTA 5ELIA 3V8OA 4P2RA 2NMSA 1KN2L 1K6QH 4PJDE 3IYLW 1U2CA 4KJQD 1T5WA 1ZT1A 3RDTA 3HB3D 4NJAL 2ITDA 1U8IA 1KB9K 2FEEI 5FHBL 1BBJA 3CSYB 3MJ7B 3LRHA 5IBUG 3H3PH 1LVEA 3WD5L 1NC2B 3T2NH 3OXRA 4S1DD 1A4KB 2EZ0D 5D1QB 1N6VA 2EKSA 5A2LH 4LCWD 2NY3D 4ZO6A 5ANMB 5K9KA 3GMLB 2CLVA 3WBDA 3OKLB 1A3QA 2VDPL 3OKDA 4W70A 5DJDB 1DEDA 3ECBB 1WZMA 5E95B 4KQ4L 3RTQC 3QXVA 3PWVA 4LSPL 4GBXC 4L8BB 4LGRB 4PB0L 3TPKA 2NY2C 1OD7A 3JV6B 4ZPTB 5JHDB 1YEKL 4PB9H 3MZGB 5KBNC 4EDWH 1PGRB 2P42B 3FCTB 3DBXB 1E4JA 1AXTH 3LKSB 2E27H 1J7VR 1ZWIB 3VI3F 3UTPD 5DVOA 2OQJB 3VWJC 2H2SC 4ZO9A 1DVFC 3LKOB 1C5CL 3RIFK 3OJVC 4N8CL 3C5SB 2APTA 2ZCLL 3P73A 3P4NB 2A9NL 5JHDE 1W72H 1P2CB 5EH1A 4ZUUB 5CD5C 3O4LD 3H9SB 1QFWL 2HJLB 5DJ8A 5DF0A 3IFOB 3RUGF 4PRBA 1QO3B 5CCKL 4ZUUA 2VJXA 5F70A 1FVEB 4OI9A 5I6XB 2D3VA 3QUXD 1QA9B 3GI8L 2QQKH 2QQKL 1J8HE 3BH9B 1CDCA 5DD0L 4NNYB 3B3IA 2DJ4A 5KVGH 3PWVB 1ZGLP 1KT2B 2QR0B 1BQHA 5D93C 3CZFA 1LGVA 2GCYA 5A40E 4DFIA 1IM3A 4WFED 3G6DL 3PHOA 4JFEB 4XVUC 5F6IC 4IRSD 4TUOA 1QSFA 5IB1B 4PJ5D 3B9DA 2VITB 4RBPH 5HGAA 3BQUD 3MGTA 4QT5A 2X4NA 1I7TA 4CDHA 5IB5B 1LEGB 5C0CA 4W6XB 3BP7A 5E5MA 2DDQH 3RFZC 3TZVD 2ADIA 3MUY1 3H2WA 5DK0A 5E2WL 5H8DA 4YHMH 2VZVA 3Q1SH 1ORQB 1S3KH 4G6JL 5FM5M 4PJGE 2BOBA 3DSNA 3HAEA 5C0FA 1SMOA 3BGFC 4GUPA 1L7IH 1AC0A 3HI5H 1S9VB 2R69H 4RSVA 2GK2A 1GGCH 4R7DA 3VRIB 1QFPA 3IFLH 4OD3L 1WGOA 5L6YH 1EFQA 1RUKH 5TE6H 4YDLB 3QQ4A 2FGWL 4Y5YC 3QWRA 4LHQB 3FQTB 4X6CB 1KENH 2LQRA 2QQLL 3NMEA 4WV1C 3QJFA 4R90L 5CEXA 5IMKB 3SE3A 1VB9A 4N8VA 3WFDH 5H37G 3P30L 4OGXL 3UO1H 1OLLA 3UYRH 5K9QG 1H8NA 4L4TD 5C0GB 4XI5D 5CEZE 3K4AA 1Q94A 3WHE0 2BERA 2HH0L 1TVBA 4XP1H 4F7PB 1L6ZA 1DLFH 1D5MB 4QY8B 3MRMB 4OZHB 2DLTA 3OJMB 3DXAD 3ARDC 1RZIA 4JB9H 4MXWH 4OJFL 4RX4A 5DJXB 4HIXH 1CLCA 1X5LA 4JY6B 1PD6A 2X09A 1JZ3A 5IFAL 1SJHA 1QBLL 5D7IE 4Z5RA 1NFDA 5FK9A 2J88H 3WIHH 2JTDA 4KZDL 5CD3B 1BOYA 1SJXA 4PRHD 1PEWA 1SJHB 3MA9L 4M8QB 1WBYB 1NFDE 2DBLL 3CH8A 3KWWB 3IDMB 1VENA 5J1AB 1NCNA 3NPSB 5I1DB 3HB3C 1I1YB 1U91B 3DX7B 5DWUL 2EDHA 4XXDB 3GBMH 3WN5B 4KTYA 5C0EA 1U42A 3CZJA 4P5MA 1I9RH 3U82B 3KPOA 2IALB 4QRSB 1MPAL 2UZIL 1N8ZB 4Y4FA 3SDCB 4UAOC 4I0PA 5IROA 1MFBL 2CDEA 1KGCE 3P2TA 3SKNA 5EIIB 3L1OH 5GGSB 4WW1A 2J12B 5DVMA 1F3DH 5I1LA 2O26U 1YN7A 4P3DA 2D7QA 4YIQA 2OTWA 2J8UB 2J1KA 2HTKD 4PJXB 4AK1A 5EG6C 3KPRE 2EDJA 5DHXB 2FZ3A 4Q7DA 3F7VA 2N1KA 4PJAF 4NUGL 3QEQD 3V5DA 1X4ZA 2KQMA 1AD0B 1D9KD 2P44B 3L9RA 5D7JD 4PP1D 1F58H 1UH4A 4ODUB 3RKDC 1FCCA 1UEMA 4ZTPL 1GC1C 1N3NA 5KAQG 3UTQB 1S7QB 2GJ6D 4DGVH 2AJSL 1RJCA 2J8UF 3MV9D 4U1GC 4U1IA 4IJ3C 1T3FA 2P8PA 2NCMA 4QF1B 3HZKB 4QHUB 4G6FD 2A0LC 2DIAA 3TCLB 5I1GH 4CMHC 4KU1A 4R7NA 3ROOB 2W0FA 4OFYD 3RNKA 5E8DH 5C0AE 3VFGL 1I4FB 3MNZB 3MFFA 4HXBL 2VSCA 4PP1C 1FORL 5I1EH 5SX4I 5IQ9A 4Y0GA 4NZUH 3P11L 4J7RA 2AK4B 3F7YA 4P4KD 5MENA 4D9RE 3D2UB 5T3ZE 4U1MA 4XVTL 4AIZA 1YN6B 3IFPB 5GHWL 4Q0XL 2CKBA 1QTYT 3S37L 4YHYC 1SBSH 1FE8H 1IGJB 2BNQA 2X70A 1LP9F 3P4MB 4DOHB 3L3DB 4JO2H 4CN1A 1Z3GH 3AS0A 1RK1B 1JPGA 3C5ZC 3VMOA 3TIEA 5E99H 3L3DA 3G6JE 3ULVC 3BEWA 1NL0H 4KJWD 2OZ4A 2E8YA 5HYQB 4OIIL 1QR1B 3X11A 1EJOH 1J0HA 1FN4A 5KSBF 1EGJA 1ZHKA 5DO2D 4V1DE 2DL2A 1E6JL 3O3DA 1UH3A 4N9GB 1FFPB 1HWGB 2Z92B 3ZYJA 3JUYA 4R7NB 5KVDH 4NZRH 5DJ8B 4NO3B 3O3DB 4O58L 4U0RC 1T0NB 4TPRL 4UIMA 2NTSP 5MENB 5HPOA 3QQ9C 1HXMA 1Z9OA 3TBSA 4C59B 3VA2C 4X6CF 1GIGH 3SY0A 3D69A 4TUJB 1LK3H 1LK3L 1G7IA 1MIEH 4JN2B 1QRKA 3MRQA 1HIMH 5GGTL 2ICES 5IBTH 3RZCD 5D9SA 4AIOA 4XWGH 3BP6B 1NGWB 1NCAL 5I1IH 5GS0H 2DBJA 4XCEA 1OAQL 4EI5B 3O3UN 1W72B 2P8PB 3BDXA 3VDBA 4LSPH 2DM4A 4XRCA 3PWUA 2BRRH 4MJ5B 5DRWB 2AI0H 5K9JL 1MCEA 2A74A 2IPUK 2XKNA 4JPWL 3B5TA 1PAMA 2NY5H 2R9HD 3A6CH 1JPFA 3NGBB 4ZUSA 2YBRA 5T3ZL 4D3CL 4DCQA 4MJ4A 4HT1H 5DTFA 1HSAA 1U9KA 1GZQA 4P2OB 4U1SA 3CK0H 4C54A 1C1EH 5BW7A 5I8EB 2OM5A 4PJBA 4LCWE 1Y6NR 5HHMD 4DKFH 2IFFL 3HMWL 4O2CA 3WFEL 2ARJB 3RX5A 2WQRA 1TXKA 3FFCE 4QHKJ 5FAAA 3MO1B 4PJ5E 3E6HA 4YUEL 3LKPA 2XZAL 1EUTA 3WIIL 2CIKA 5DI8A 4YBLB 5IEHA 3STLB 3SN6N 1G6VK 4KRPB 3TZVC 3HUJF 4MJIA 2EEBA 1U3JA 4PRHE 4KTEH 4PFEA 1FL6B 2XPGB 1JWUA 1B4RA 5T1KD 1I3GL 3GBLA 4W4OA 3QAZC 4E9LA 5F9AC 4JGUA 5ID1A 5TDOB 4YDLC 1EIBA 3ARGB 4FQHB 1IGFL 5BS0B 5MHSE 2EDQA 1F6FB 2VXTL 5ALBH 2YEZA 1FBIH 1HSAB 5CIPH 3ZT7A 5D7LD 4JFFE 4UV7L 1NMBL 2I24N 3DXAA 1GRWA 3UTZA 2D4DA 3FO9B 5E4EC 1JK8A 4EDWL 4XNXL 4KQ3H 5JMRA 5C08E 3BW9B 3B9VA 3TEUA 2UVEA 3RY4A 2X4TA 4IOIB 3IT8D 3G04A 4N90E 3TBTA 5B4MC 4QHMA 5T3XH 2NY0C 2B1HH 4MNGB 3BP6A 2EYTB 4PJFF 3T0ED 1U8LB 3QB7C 5MP6L 1YEDA 1CDUA 3EJYD 1DQTA 2H9GA 1RY7B 4ZS6C 5SWSD 3VWJD 4P59L 5J9PA 1FV1B 3M17A 2OTUB 4LOUC 3FQXA 1K8IB 3NTCH 1AGEA 4IRSA 4OUOA 4I0PD 1FSKC 2NX5E 1JF1A 3I6GA 1FFQA 4PJEF 2X7LA 3M8OH 3NABH 1XCQA 4B0MM 3C2SA 2AQ1A 1FFNA 4AYFA 1RZKL 1PKOA 3PGCB 3V4VH 3T2QA 2XTLA 3ISWA 4OLUH 1IRAY 1MCNA 2AJSH 2EZ0C 1IC5H 5KANG 1LE9A 4UQ2A 3D3VD 3LSOB 4U1IB 3TGXA 2DAVA 2GIYA 4H1LA 1FHGA 4RDQF 4LLUA 1AY1H 5FYLE 4MD4B 1DEEB 5HYFA 3CFJA 3IVKA 2IPTH 4Z77A 1KTLB 4WUUA 5DZLA 1D5IL 1Y18A 4OD1L 1YYLH 2DL9A 2ICEB 3MRGB 2ICCA 3MOQA 2AJVL 1KTLA 2LU4A 4Z7WB 1Y0LA 3GMMB 4QRRB 1RZ7H 4OZIB 5F7DB 1F5WA 4OB5L 4LQFL 2YA0A 5T1LA 2FD6H 2IAMA 4OCXL 3CD4A 1CFBA 3GM0A 1HQ4A 1UQSB 1FNEB 3PL6D 3IFNH 4JQXC 1T83A 3CGTA 3MZTA 1WFOA 5CBEB 4UOW1 5ICZA 3TH2T 1HE7A 3MCLH 4HPOH 5JIHA 1DQJA 3TCXA 5E8PB 4YHOL 4M5YH 5C08B 3BI9X 3CVIH 4XP9H 1BD2E 2HFFA 2AEWA 5FDWB 1Q0YL 4V2BA 4CJ1A 2D03H 3K8KA 2X1OA 4HJJH 1U8OB 3Q2CA 4NC0B 4JFXB 4JO4L 5FDWA 1EO7A 4WFFD 1QSEE 4OQTL 2QSTA 3UDWA 1G9NL 4JREC 1HNFA 3CXHK 4PRHA 5D71L 4LLMB 4X6DE 3D5OF 3H9YA 4JPIA 1L6XA 4K8RD 3SQOL 2DDQL 2VUYA 5J9PB 1D5ZB 3ZE0E 4MSWB 3MBXH 3MRCA 2WBJB 4K9EC 4KK9D 1HKLH 3IRPX 1DQQB 3VWJB 1PFCA 3WIHA 3RWHA 3KYKH 2I5YL 1NUNB 1SHMA 4FOMA 4P2RB 2IADA 4DW2H 1RUQL 3UJJH 5JXAL 2CDGB 5DMKB 3VFSB 4ODSL 3BZDA 4I0KA 1NLDL 1S7UA 5I1KL 3G5VB 3S35X 2Q7YA 4XC3H 2V9TA 4P46C 1FPTH 1C1EL 3ULUL 1MCLA 3GSWA 4MNQE 3NZHH 5I19L 3EYVB 1DFBH 1QRNB 5E1AA 3MJ7A 4M48L 4D9LL 5FYLL 1QACA 3GB7A 2FX8L 2F15A 1CLYL 4P2RE 3MV7D 5DJ6B 3RWCB 1HHKA 4H25B 4BUGA 1XGRA 3QDAA 4UIKH 1B6UA 1WAAF 3BN3B 3FT4A 4K3DH 1LE5A 3F5WB 2A38A 4LARH 5E8OB 4D0CA 5LWYH 1R3IL 1QPPA 2VDQL 7FABL 3O4OC 5IOPB 2NXYC 1R5VB 4X4ZA 2AERT 2DIBA 5I1JH 3LDBC 5IGXH 4HW6A 1J0ZA 3MYZA 3KPTA 3MRKA 1F4XH 3GGWB 1BLNB 2J88L 2DYPB 3SE3C 3MO1A 4OTXL 5EOCL 3H0TB 1QNZH 4HWUA 3EYOB 1RI8A 2VAJA 2E7HA 4PJHB 5IHUL 4KTEL 2Z8RA 5KVEL 2H32B 5CWSB 1A6UL 5T5NG 1IEHA 3HG1E 1E27B 4YO0B 5E70A 3U0WH 4TSCL 4NKMA 3BRDA 1SJEB 4JKWA 4PLKC 1UACH 2CKNA 3REWA 3JXAA 4S1QH 1EK3A 3ZZ1A 4M48H 4M1GH 3JWOC 5EB9A 3REWB 4R90H 1QLFA 1T0PB 4OCRL 1YJDC 3ULVH 3GNML 3EOYG 3MUZ1 4HUKB 4RDQG 1CDBA 2DLIA 4KK8C 4ZNEE 1ZLWH 5HHPB 2C3XA 3DX7A 4JG0H 4GG6E 5I0ZA 1J5OL 1R5VA 5GS2H 2VDMH 4X7DC 5D1ZC 2JIXB 3KHOA 2Q76B 3HFMH 1CK0H 3QCTH 5DJAA 3MRKB 3F6IA 3RWHB 2GFBA 4X8JA 4POZC 2XA3A 1H5BA 3OAYH 3I2CH 2C3VB 3O3AA 4HPYL 4IMLB 3U7AA 4OM1L 2PW2A 2PYEE 5JXED 1BZ9B 4ZD3H 3BP7B 5E5MB 2PKDA 1I1AC 2OCFD 4HFUL 3MJ9L 4PRNA 2CLRA 4HGWB 2V17L 1RZJC 3CH1B 3FB7A 5DK0B 5DVLA 1KPVB 4G7VL 4XCNB 1MVFA 3VXUD 1WICA 4GKOA 1MH5B 1I7UB 5KSBA 2XICA 3HNVL 1QRND 1NMCC 1NDGA 4NQSA 1SY6H 4PJXE 5FYJL 3W0WA 4NKIL 1KC5H 2IQ9L 3G5XA 3CX5K 3A6OA 3QUZD 3JZ7A 4GAFB 5IMLA 1CGTA 2PF6A 2GSIB 5LVEA 5DC4B 2YRZA 2G60L 2A6KA 4M6MH 3A0OA 1AFVH 1BIIB 1HHJA 5HDOA 1VADA 4PTUA 3LKNA 3C6SB 1HH9A 4KGJA 3G5YA 4NGHL 4NQCE 1U3HB 1AR2A 1JTPA 4Z8FH 2ZUWA 2YD6A 3B43A 3B9AA 4ZTOL 4MA1C 2EH7H 4RGMC 4X4ME 1U8KA 2A73A 3CLFL 3D48R 1RUAH 1NFDF 2ID5A 4NCC1 1F90L 1D6VL 4F7MB 4YC2B 1NL0L 1I8LA 4KJQC 4QRTA 1I1AA 3MRGA 2K9UA 3DARA 4JKMA 3G6JB 2BNQB 3RVWC 2P48B 2R23A 2Y5TA 3WFHA 5EO1A 1ZKAA 3D3VB 4YXHL 3UPCA 3SGJC 3EYFB 2BNRD 4ZNEA 4D2NA 3M1BA 3GMPA 5AD0A 5EZLA 4K23H 5GHWH 1LNUB 3BEWB 1RUPH 4BSJA 5HYQA 4U1HB 2VLJE 4NBXB 1QR1A 5D1ZA 1JE6A 5T1LD 4EI5C 4FABL 1XIWA 1FNAA 3HMWH 4WHYG 4BZYA 4GRLB 5J13C 5CP3A 2XQBL 3DJ9A 4F37F 5I1HH 3HE7C 5H2BB 2FJHA 4HWZA 4L9LA 3DX9A 5HHXH 5SWZA 1K4CA 2FEEL 5E2WH 2BVTA 4UT6H 1CICA 4LMQE 5KSVA 3LN4A 5A16A 3SDDA 3DV6B 4HUWA 5F1NB 1QQDA 5KOMC 1Q72L 3CH1A 3FB7B 2I9LB 4QXGH 5IUSA 2ZUQC 1MH5A 2XTJC 1KN4H 4D0DB 2CDFA 1KPUA 2I60L 5EBGA 3ARVA 1PX4A 3EO1A 4PGBA 5L8LB 4WFGE 3V6OE 2HJKA 1GHFL 4TULL 1T5XA 3V5DB 5E2TH 3P0YL 4HWEL 3P0GB 3SE9H 5JA8B 3QIWD 3PWLA 1ZTXL 4AL8L 4ZUVB 4RAVB 1AGCB 3JWDL 4RGND 4HIHB 4I48A 4JREB 4EQ3A 1UC6A 1K85A 35C8L 4JHAL 5SV4A 1YMHA 4LNVA 1NEZB 1S8DB 4G9FE 1DANU 3O6MH 2OJZL 5J0BA 3JWN