2C1PA

Fab-fragment of enantioselective antibody complexed with finrozole
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
217
structure length
217
Chain Sequence
ELVMTQSPLTLSVTIGQPASISCKSSQSLLYSNGKTYLNWLLQRPGQSPKRLIYLVSKLDSGDPDRFTGSGSGTDFTLKISRVEAEDLGIYYCVQGSHFPPTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGK-C PROTEIN
publication title Crystal Structures of an Enantioselective Fab-Fragment in Free and Complex Forms.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 51
structure length 217
sequence length 217
chains with identical sequence L
ec nomenclature
pdb deposition date 2005-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2c1pA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2c1pA01
1RJYB 2P8PB 2VLJB 4TVPE 3NPSC 1MY7A 1JVKA 5C09D 5IQ9B 3B3IB 4D0DA 1MIEL 2R2EA 3D18B 4I3SH 1UM6L 5KTEH 3WNPA 3QCTL 2XA8H 4I77L 5LKNA 1UJ3A 2VLRD 1KIUA 3O9WB 3ZYJA 4XP5L 3HMXH 3MODL 5FKAB 5KN5B 1G6RL 1RZIB 4NC2B 5CSBA 3E6FB 1S7VA 1MFAL 4M9OA 4MNQB 4RISL 2VDKH 4N8VA 3WN5A 4RMWA 1OAKH 5GS0D 3PWJA 1X9QA 1D9KA 3LMJL 3SDYL 3WS3B 4EUPA 1CFSB 2CSPA 5C0JB 2IAMA 4OZHF 4FQXD 4DW2L 3MUJA 2D31B 1FH5H 1H5BB 3RWEA 3DV6A 1U8HA 2P49B 2IPTL 4M5ZH 1ZLSL 1ES0B 4L8BB 1QLFA 1SJXA 3LQMA 4JFQB 4UIKL 5A40E 4R7DB 4YHLH 3HAEA 3AMKA 4MQXD 5IB1B 2IANB 3SQBA 1Y6NR 1AJ7H 5CGTA 1FFOB 5ADPL 5C7XH 1J8HA 3FFCA 3QG7L 1FBIL 1G6RB 4QTIH 3P0VH 3O4OB 1P5UA 4YHZL 3OG4B 4ZXBD 1F4WH 3PQYB 4F9PC 4Z78A 1KB5H 3DBXA 2AABH 3KAAA 3VXSB 4HGKC 1IEBB 3U0WH 1VA9A 1NGPL 3LEYH 5KSAA 2FEEL 4C56B 3D0LA 3ULUC 4PFEA 1WSST 2GEEA 3FONB 1J0ZA 4PBVC 1I85A 3AM8C 4BQ9A 5FYKU 1OGAA 1VACB 3A6CH 3UDWA 4Y4FB 5F7LB 1MREH 3QUXC 1QSEA 5T3XL 3T3PF 2VC2H 2CKBA 4FMFA 3RI5K 3C6LC 1YC8A 2DDQH 4R2GC 5CJBA 4BUHA 4EN3D 3UTQA 1J1XH 3TNMB 5FYLL 4KZEL 4U1KA 4PJHE 5HI5D 1WZLA 2C3VA 3K46A 5FO7A 3MGAA 3NAAH 3TA3D 4HZLA 1I3GH 1KJ2H 4QF1B 1IEHA 5DYOB 1J0IA 4OLZL 4TNVF 4U7SA 4G8GD 3DGGA 5ELIA 1D5IL 2AQ1A 1QR4A 1R3LB 1YYLH 5GGVL 4L8DB 1N4XH 4X6FB 5HGHB 3GSXB 4HWZB 4PD4J 4QHLA 2NY5C 1A6WH 5IESH 3ZKMD 2FBJH 3VH8G 3CK0H 2FB4H 2IF7A 1AD0A 3HZVB 4YDIH 5FA4B 3WJLA 4KVNL 1VFAB 5CKAA 1FVCB 4LHQB 4V2BA 2YXMA 5EUKB 1KEML 2WNGA 5MEPA 5ID0B 1YEGL 3MV9A 1IRAY 1NLBH 4G8IB 4U1IA 3VFMB 5BMFH 1N0LA 1H9VA 5CP7A 5IWLA 4MJID 1GRWA 4OIAA 5EIVA 2R1YB 3DROA 1OM3H 3WO4C 1RIUH 3UBXB 1U9KA 2ICEB 4FQXC 1BFSA 2D7MA 2UWEB 3LV3A 2W60B 4ORGB 3QFDA 4RMSA 3OKMA 2NY2B 3OQ3B 4A2MA 5I71B 4OZGE 1U8QB 2H9GA 1MIEH 3MGOA 3JTTB 1KTLB 1UM6H 3MTRA 1IM9B 3MOBL 2FHBA 4U1HA 2V9QA 1KV3A 3GO1L 2XTJC 1N0XH 2HG5B 4PJ5E 4I77H 3MROA 4P49A 5HGGS 4ZXBC 5B3JF 4XP5H 5E94B 1SJEB 5JOPE 2HA1A 3MODH 1CBVL 1G6RH 1P7QD 5DFTA 4NQCB 1MFAH 2EIBA 3E2HC 3QG6B 4RISH 1FCGA 5CJ8A 2JELL 4MD4A 5M95B 1TQBB 3HR5A 3LMJH 3SDYH 5ADOL 5EU5A 4Y1AD 5JHDE 3RPIB 3X14B 4DW2H 5HYEA 4ZDHA 3I6GB 4NZTH 3IXTB 3ULVE 5I1JL 3EHBD 4PGDA 1ZLSH 2N7BA 4NO3B 1MCOL 5IP4A 4JPIA 1U8PB 4UIKH 3LN4A 5BO1L 5C70A 3VXMD 1MWAA 5L2KD 4UQ3B 2WQ8A 5ADPH 2Z9TA 3IXAA 5FO8A 3QG7H 1FBIH 1MCPL 4MJ5A 1A7OL 4PJDE 5F89B 5E8PA 4S1DC 1IAIL 3U36B 1KJMA 5HI5C 3CFJB 5IEHA 1HE7A 3V6ZA 5SX5H 5C0GA 3QNZB 2EC9U 3NCYS 5IMOA 3VGAB 3OJDB 1E27B 3QXAB 5C0DA 3RPKA 2EDTA 2E5EA 2DQFA 3IDUA 1NGPH 4MA3B 2K7PA 1LD9B 4Z7UA 1NSNL 2DQDH 4OM0H 4WTZA 5E56A 1XIWD 4KV5F 1JIBA 4L9DA 2X6MA 5E6ID 3PL6B 2G5BB 4GBXD 1C08A 1ACYL 3GMNB 4G8FB 3SDAD 3ZKMC 4M03A 5T1KB 5E2VL 5T3XH 4U3HA 4S2SA 3E1F1 4PJXF 4MMXC 4X5LA 2DQTL 1MAML 1QLRB 1EHNA 4JVWA 3WNMA 1J8HE 4HV8B 1X44A 4XB8A 5GS1C 3MXVL 2CDEB 2QKIB 4ZAKD 4KZEH 5I2IB 3BN3B 2PYFB 2NW2A 4TVPD 4OCSH 2H3NB 1QRNA 4GAFB 2IG2L 1DVFA 5IW1B 4ODTL 5I74C 1LDPL 1ITBB 5EOQL 4NQTA 4OLZH 1J1OL 1AGFA 1D5IH 5GGVH 3RIFK 2OLDA 1FLRL 1DBKH 1URLA 1CFQA 4XNUL 5EN2B 2C9AA 3GMPA 1Q9OA 1QSEE 1UQSA 3O8XB 4POUB 4K7FA 4YZFF 1OAZL 3QI9C 1NUNB 3EO9L 3G5YA 4KVNH 5E1HB 4NRXA 3WFCL 2AK4B 2ZOKA 4K8RL 2WZPD 2CK2A 3DX9A 1S7XA 1KEMH 5LG1A 1DUYB 1YEGH 1OSZA 1OWWA 1UB6A 4LKCA 3ZKNC 3VRLE 2EH8L 2KQNA 3FB6B 1NCDL 4WW1B 1MELA 3QH3A 3MNZA 2VDRL 4PJFE 1NFDE 1T5XA 4G9FD 3TYFA 2BVPB 4EZMA 4RZCB 2DLIA 5FHAL 1LO5A 2VLKA 1RZ8B 3HG1B 3MOBH 2P5EB 3CSPA 3HZYA 1IEAA 5F7UA 3GO1H 3K0WA 3NN8B 3NCBB 1FZOB 1B0GA 4M6OL 5TDOA 3GUTA 4HH9B 2X9WA 1PQZA 4PGBB 4KRMB 4EXKA 5CIPA 2ILLA 1CBVH 3SKMA 4WO4D 3EO1B 1SEQH 5F88A 2ADIA 4AT6A 4WFEE 5IMKA 4FFZL 4CMHB 5HYFA 5C0IA 2JELH 5E6YA 5J13C 1BEYH 3NPSB 5F1KC 3MV7E 4AM0B 3ULSB 3QJHB 4ENEC 4M43L 3SE3C 4NFDA 3C9NB 4M7ZB 2DIBA 5E6IC 2D7QA 5F9JA 4XRCA 5I1JH 1IAKA 5CD3A 5BO1H 3V8CA 2APBA 4XXCA 4KKBD 1ZSDA 1U42A 1X5YA 3GMRA 4ODBD 1I1CA 3JBG7 1PD6A 3ALWA 2BFVL 1MCPH 1A7OH 1ZHLA 5IB2B 1OF2B 2F54D 1IAIH 4PJEE 3IDXL 1MY5A 5JLZA 5D1XB 1ND0A 5E08H 5EDXA 5FM5O 4XZUB 4LF3B 1OAXL 1MFEL 3U46B 3ZKXB 3PIQA 1NSNH 2ITCA 2CPCA 1A8JH 1KLFA 3K74B 5C0RL 3VXRE 3SN6N 2WW8A 3ARDB 1CLYL 3PWUB 4G7YL 1PKQE 4UTBL 2QQNL 5FK9B 3RWHB 1CXHA 1EXUA 5H37G 5E2VH 2BMKA 2HN7A 3LB6D 3VJ6B 1MAMH 3FO1B 3UPAA 4K7PL 5HHOE 1JYXA 5DZNA 1I9EA 1CQYA 1Q94A 5GGTH 3SEPA 1QSZA 4YHNB 3SGJC 2IG2H 5JTWA 2PTTB 4ODTH 1LDPH 3OKEB 1WIUA 2EDRA 2BVQA 3WHE1 1W0WA 1J1OH 4MX7A 1DQML 2E7BA 3AS1A 5BVJB 1FFRA 3T2QA 4Z7UE 1OTTD 1ITCA 2ZCHL 3EKCA 1ONQA 1FLRH 4XNUH 4LSQL 3MRGA 4PJAA 5LGJA 4JFED 5T5NF 4UOW0 3OBAA 4HXAL 2EZ0D 2Q3AA 2I26N 3MRBB 5JOPD 5CWSB 1WTLA 3VH8B 2X4SB 2E8YA 4GRWH 5ID1A 2VAAB 5GSVB 1OAZH 5H2BB 1JGVL 1AKJA 3EO9H 4ZQKA 3U0PA 3QXTA 3BP5A 4NUJA 1N6QH 4PJGE 3WFCH 3HPJB 4K8RH 2HT2D 1FVDB 4XPHL 3VD9A 5CP3H 4YC2B 2UVEA 4D9LL 4XCYB 1LDSA 2H26A 3W5NA 2EH8H 1NCDH 1UADC 3AREC 3DRQB 1HKFA 4J12A 4NN5B 2VDRH 5GS0L 2H32B 2FHFA 4HIJA 2NY6D 1CT8A 2PF6A 1A4JB 1RHHA 5JPNA 1S7UB 3GMLB 1CGWA 2A6DB 1WBXB 4OF7A 5FHAH 5DFVD 3BE1L 5DD6B 3G6JA 1FG9C 1TMCB 2RFXB 3WE6A 1BBJB 1UWXK 2CLVB 1D9KD 3HRZA 4O9HH 1ZTXL 2IAMD 2F15A 2ZUQB 4JFPA 1NAKH 1EA9C 4KQ3L 3FQNB 3N1QC 3LKPB 3SGDH 5F7HA 1FN4A 4B5EA 2OSLB 4NSKB 3GSOB 3TFKC 1G7QB 5I76A 4FFZH 4FQXB 4GLRH 4I2XB 2X9XA 3EOAB 4R97B 3TBWB 3FQRA 1WZMA 4WCYH 1J8HD 4WU5A 3FFCD 3AC0A 1FQ9C 3AAZA 2NY4D 1GXEA 4R96A 4MLSA 1QR1B 2R15A 5IOPA 2FHCA 3T0WA 3BW9B 3LB6C 1PZ5B 3QWQB 3NTCL 5EZLB 3W0WA 2WLZA 5KSAD 4ZXBB 5F3BB 5C6WH 1B88A 5ICYA 5J6HA 1A3QA 3I75B 3J8F7 1IT9L 4MA7L 4MA1C 3IDXH 4NO0A 3MLXL 1OGAD 4RFNC 1OAXH 1MFEH 1LP9B 3PV6B 1QSED 3BQUC 1OTTC 1RUKL 4E0RA 3CFBA 2Q6WB 5TF0A 1D7FA 3Q5TA 1KUMA 2APTA 1CLYH 1BZ7B 2DMBA 4HMEA 4N9OB 3MCLH 4G7YH 4EVNA 5HYJA 3UZVB 3P40A 2QQNH 4Y8AA 1P84J 3RWCB 4EN3B 4M00A 3IDMA 3MUGA 2RQ8A 4MAUL 5DI8A 3ZDYE 1KFAL 5JZ7C 2FSEB 3PABB 3PJSA 4K7PH 4MYWB 3MRFB 2EKJA 3WXWL 3TJHD 5EUOF 4NKQB 3TA3B 3T0DA 1E6OL 4POZD 3QUYA 4G8GB 4KDWA 5CCKL 1F11B 5HDLA 3O11B 4DQOL 1YNKL 3DVNB 3P77B 4WGWB 4F7MB 1DQMH 4JFDA 3FT4A 3SKOA 4U1GB 3VFSB 2ZCHH 3PWPA 1OVZA 2P24B 2DLFL 4MDIB 3DX7B 1LGVA 1D5BB 1TCRB 4LSQH 4KI1A 3KPPB 1UJ3C 3HS0B 4HXAH 2C5DC 2NPLX 4PGZA 5HI3D 2H32H 3KGRA 2YA0A 5EBLB 2YD9A 3MV9D 2ZSVB 1FV1B 3C08L 3AUVA 4NQEA 5E00B 5IT2L 5J89A 4EIGB 5D6DA 5FGBC 3O3AB 4QY8B 3WN5C 5KAQF 1F3JB 1NCBL 1DN2A 1KLGB 1D9KC 4WHTB 1KGCE 3JWNC 2Z92B 3CXDL 5GPRA 5I74B 5FGSA 3FO9B 4M7KL 1HEZB 3QA3A 1SJHA 5D2LB 4XPHH 1HHHA 4MJIB 3TJEL 2GHWB 3P4OA 4D9LH 3GMOA 5EO0A 1ROWA 5I1IL 1HYSC 3P4MB 1A22B 3LRHA 5C8JB 1MSPA 2F53A 3W81A 2J8HA 1QTYT 1WK0A 2VITB 4IDJL 3V4VL 4YWGL 5I1HL 3H42H 1JRHL 3UJIH 3BEWB 4LIQE 1DTUA 4Z7NE 5B4MD 4N8VG 5IV2A 1WTGT 4K55A 2O93L 3BUTA 3ZT7A 2HMID 3BE1H 4EUPG 4NKOA 5DMIL 3KWWB 5KSAC 1VGEL 1BAFL 1Z3GH 4ZUSA 1ZTXH 1P7QB 1OP3K 2JKXA 3RUGF 5I19L 1I85C 4KQ3H 2V2TA 1A2YA 3U4EB 4J8RB 2FYYB 3HAEG 4GW1A 1MHEA 3BMWA 1A21A 3LKOB 4Y1AB 4AENA 2EYSB 3RIAF 4HKBB 1G9NC 5I75C 4JRXE 5CJOL 3ZHKA 3V5DB 2EDFA 4X5WB 3VXMB 5L2KB 3BEVA 1JPSL 4U7KA 1HILA 5I1EL 2XKSA 5I1AB 2BVYA 8FABA 2AJSL 3EDFA 1D5ZA 2BVUA 3TJHC 3RJQB 3BP6B 3ZTNL 1IT9H 1IC4L 4R4FH 4MA7H 4GQ9L 4POZC 2HJFA 4CMMB 4TVPL 3MLXH 4RDQF 5D71L 3L5XL 4HKJB 4HK0A 4OLXL 4Z9KB 1XIWB 4DKEH 4BQ6A 3MJGX 1AO7A 4KPHL 1RUKH 5E6IB 2ICWB 4HS8L 1SJVA 5E8EB 4GBXB 1GGYA 2ADGA 3SDAB 3TN0A 3MRIB 1EEYA 2EC9T 4U1SB 4JDZB 4YBLB 1L0YA 3DYPA 4IBLT 1XMWA 5HI3C 4DK6A 4FQ1L 3WIIL 4Z7OF 4LDEB 4S1QL 5DUBB 1QRND 5DJCA 4M1DL 1DVFD 4M3KB 1FL3B 1H8NA 1YNLL 1XCTA 3DOSA 3N1GC 4MAUH 3SGEI 3TVMC 4ZAKB 1KFAH 3VFRA 5IWLC 3LDBC 5FDYA 3D0VA 3WXWH 2ATKB 4L4VE 3G6DH 5HD8D 1E6OH 1FGVH 5CCKH 1RZJC 2EH7L 3BWAA 5E5MB 5I8EB 1PLGL 1YNKH 3TBTB 4DQOH 3MJ8B 3B9KC 1R5IA 5J1AA 3A6BL 1T22A 3L1OL 5E8OA 5TDPA 1OPGL 1BJ8A 5FB8A 5D7LA 2HRPL 3IFOA 1ETZB 1UB5B 1UYWL 2UV3A 5I0DA 1T4KA 4M61A 3QHTC 3QFJA 3GKZA 2OTWB 1J7VR 3C08H 4MNHB 4HD9A 1YN7A 4NIKB 1YPZF 5I0ZA 1DBJL 3GSUA 4PJBF 2EYRB 1B3JA 2D2OA 3CXDH 4M7KH 1KPRB 1DP0A 3QSKB 3K1KC 3G5ZB 5JIPA 2Z0BA 3TJEH 1TZHB 3AXLA 5I1IH 2VXSL 2VLKD 4RAVB 1HZHH 3OZ9H 4ZS7L 5CJ5A 3S35L 3BI9X 4G8EA 1B0RB 4G9FB 3RVUD 4IDJH 3V4VH 4XPAL 4YWGH 5I1HH 1JRHH 1EUTA 3CZJA 1JNNL 4BH7A 5CZXC 1J86A 4NZUL 1Q9KB 3ULUE 3U9UB 4W6WB 1U58A 3F12A 4JE4B 4JDVA 5KS9A 4XWOD 5JORB 3NCMA 1WWWX 5DMIH 4PJ7B 4OCRL 1EZVX 5DQJB 3P3YA 4PB0L 1VGEH 5GIRB 1BAFH 5ISZE 2CDGB 2SEBA 4I0KA 4WO4B 2NQCA 3QHFL 5I1LB 5D9SA 5I19H 3MCG1 2GK0B 3U2SB 2JJVA 1KXTB 1VFBB 5JW4R 4FXKB 4OZIE 4PRBB 4FG6D 5CJOH 1V7ML 5BS0A 1YN6A 1KJVB 3HLAA 4Q6IA 3GFUA 4S10A 2CK0L 3T77B 1JPSH 2X2YA 1NH6A 3KJ4C 3OXRB 5GSRA 4MJ6B 5I1EH 3MLWL 2VZOA 1JWSB 3F7PC 4PY7B 1F97A 2F54B 3SO3B 4N90D 4NM4L 5TDNA 5GGRA 3BHBB 4YQXH 3VFPB 3VI3E 1OLLA 4NO5B 3ZTNH 3QUZC 1IC4H 2VL5B 3JZ7A 4HGWA 4YXKH 4OB5L 5T1DL 4CW1B 4QHUA 1EFXA 2NLJB 4TVPH 2FJGB 4L1HA 3DX6B 5D71H 3L5XH 1LK2B 2VSCA 4FQJL 4JANA 3IS1X 4PJCE 4D94A 3HPLA 1F3DJ 4KPHH 1FE8L 4HS8H 4I0PC 2R39A 1VB9A 2YD6A 5EH1A 1UACL 1DBAL 4UIMA 1MCCA 1R3JB 3MLUL 4FQ1H 4WI6A 2R0WL 3TESA 4M1DH 4ZMAT 1YNLH 5CBEB 4Z7VA 4MA1B 5IEKA 1DQQB 1LO2L 1XF4B 2XT1B 1TZGL 4XBGB 4RFNB 2Y25A 4LHUG 1C16A 3DO7A 2EH7H 1XGTB 3ZZ1A 1G84A 2XWBB 3A6BH 3L1OH 3MRDB 1ZA3A 1U2HA 1AO7E 3R0MA 4EI6A 5CZVL 4JFEB 3ZE2F 5D96B 3LRSB 1AKJD 2HRPH 2X4QA 2JJWA 1K8IA 1UYWH 3IYLW 3WLBB 5ECJE 2A83B 2R4SH 5D4QA 3TC9A 2NXYD 2X41A 3B5TA 2WWKT 5INDB 3NCCB 4LAQL 4G6AD 3FB8A 5KVDL 2I07A 4XWOC 2ICES 2Z93B 4WFFE 3EYSH 2EKSA 1IQWL 5CILL 1DBJH 4XC1L 1E4JA 4MB3A 3O6FA 5EBGA 1XF3A 3UJTL 4D0DB 4PGJA 4I1NB 4JRXD 2R2EB 4X6DF 5GRWA 4GT7A 3HZMA 5DC4B 1O0VA 1I9IL 3RY5A 2AXGA 3JWOC 1R3KA 3PHOA 4ZS7H 5FYJE 2NY6B 4XXCC 3SOBL 1VKXA 3S35H 6CGTA 1UJ3B 2B8OT 4LVNB 1PSKL 4XPAH 4FG6C 4PRHE 4ZFZA 1JNNH 1S7VB 3LVEA 3THML 3F7QA 4N8VB 3WN5B 4NZUH 4OFYA 5L9DL 5EPMA 3PWJB 1D9KB 5AZ2L 4EUPB 4LCYA 4PB0H 5IB3A 2R0KL 1OOAA 3MRRA 3RWEB 2FL5A 3DV6B 3T8XA 1U8HB 3T04D 5ANMA 1I9RL 3QHFH 1QLFB 5IBUG 1OT1A 4JAMA 3HAEB 2ESVA 5L0QB 2E7CA 1J8HB 3T0EE 3FFCB 5JQHC 3W0WD 2CKBL 2NY4B 1G9NL 4KJQD 2XRAL 4Z78B 4RSVA 1GYAA 2I24N 2ED8A 2CK0H 5KSAB 5D5MA 1JMXA 4NO0D 4LPXA 4XTRD 4JQXA 3D0LB 5KS9E 1W0YT 1TJIL 1T04A 2OR7A 5E03A 5GGRY 4NM4H 4PS4L 3E6HA 2WQRA 5HGBA 2ORBL 1OGAB 5IB5A 5ESQA 4OB5H 3IFPA 5T1DH 4IOFC 4D9RE 1QSEB 5HYJD 3EDKA 1B4RA 2EE6A 2PNDA 2VXTL 5E2TL 2CKBB 4ORZC 3KPRA 4FQJH 2OMBA 3UTQB 1YMHA 1FE8H 2M26A 1N7ML 4U1KB 2C3VB 1NQBA 2HT3D 4PJIE 5FO7B 1LWRA 5BVPL 1UACH 4QGTA 1DBAH 4HZLB 2D7OA 4GW4A 4TYUA 5JNYA 3MLUH 4XI5C 3QUYD 3DGGB 2NXYC 2R0WH 4XBEH 4W4NA 1S3KL 1BD2B 3QEQA 1O7VA 4JFDD 2NR6C 1Q0YL 2P4AB 4UV4L 3PWPD 2BERA 4QHLB 1LO2H 4MS8D 1T21A 1T66C 1TZGH 3N9GL 3MYJA 2C26A 3S36L 1AD0B 4FFYH 2VN7A 3HE6A 2H41A 4FQCL 4NQED 5CZVH 1V8HA 3MV9B 5C3TA 2FEDD 3SDXA 2EDYA 5FYKH 4U1IB 35C8L 4RX4A 1DBMH 3TPKA 5CP7B 1T03L 3DVIA 1OQOA 4LAQH 3HE7A 3DROB 3QIUA 5KVDH 4LLMA 5CJQL 1BFOA 1IQWH 3LV3B 1INEL 2C3HA 3QFDB 4XC1H 3VD3A 2VOTA 3OKMB 4IOSD 5DZLA 4EUPH 1MCKA 3RA7L 1T83A 2H9GB 2P43B 2QEJA 3MGOB 1EJ6A 1IFHL 3NIDE 1KG0A 1Z0NA 3RHWF 5KSBE 1EHXA 4U1HB 3NCJH 2XXMB 4UV7L 1EEZA 5J3HC 1I9IH 3ECBA 3FRPA 4GG6F 4OIBA 2DWEA 3P9LA 1KENH 1NCUA 2D7NA 3MROB 3SOBH 3PGCA 3HAEH 1MWAL 1PSKH 5CEYA 1XGQA 2J4WH 2MMXA 5EU7C 4HEME 2L7UA 3FKUS 2HJLA 4ODWA 3THMH 2EDLA 5L9DH 4MD4B 4WUUA 3HR5B 4K71C 5EU5B 3JTSA 1WFUA 3O6ML 2R0KH 4ZDHB 4WWID 4PJXA 3D9AL 2WWKO 4PGDB 3O6KL 4JPIB 3LN4B 3C6SA 4E9LA 1NBQA 2Z4QA 4YEFA 1MWAB 4X9IA 4IIQC 3LAFA 3D87B 4NGHL 3IXAB 5GS2D 5FO8B 2D0HA 4MNGA 1AFVL 4MJ5B 1NFIA 2Z8RA 2CLZA 5E8PB 2CKBH 4J6RL 1KJMB 4KJPC 3AVEA 3V6ZB 1G9NH 3ZT6A 5C0GB 3RGVC 2XRAH 3DV4A 5F9DC 5IMOB 1RIVL 5C0DB 2UWEF 3K4DA 3CDFA 5F7DA 3F62A 2DQFB 1TJIH 2PXYA 2X05A 1ZLWK 1AO7D 1A1NA 3OGOE 1INQA 4MS8C 2CRZA 2ORBH 1C08B 5D8JL 5I73B 3TN0D 4NJ9L 4TUKL 4S2SB 5E2TH 3QXDA 2ESVE 2FATL 4J3XA 3GB7A 4NP4L 4WFFD 1L9NA 1CYGA 5A3ID 4BKLA 4IDLA 2NW2B 5JHLL 1NUDA 4PRPA 4YDKL 3L3HA 1QRNB 1DVFB 1FL5A 4PIRF 3BPOC 4LU5L 2B1HL 1AGFB 4Z7WE 5F3HA 1TVDA 2YUVA 2ZUVA 2XNAA 4L3CB 1S3KH 5MHSE 1U0QA 3WS6A 1EGJA 1CFQB 5SWSE 1Q0YH 4UV4H 5D7IE 3CIQA 5D7LD 1UH3A 1TJGL 2AQ2A 3N9GH 5JXAL 3GMPB 3MUY1 4X4YB 4J2XA 5DD5L 3S36H 1T80A 1Q9OB 5IROC 1RZJH 3QFJD 1UQSB 3MRPA 4K7FB 4UQ2A 4MAYC 3TM6A 4MJ2A 3G5YB 4NNXA 4NRXB 3V0AC 2GYSA 2ZOKB 3QNXA 3P0GB 1FFQA 1S7XB 3DX9B 2Q3ZA 3I3BA 1OSZB 1XF1A 1UB6B 8CGTA 35C8H 4LKCB 3NPZB 4LAJH 3UCRA 4X99A 1J8KA 1T03H 5C0AA 2MKLC 4K7PX 3QH3B 3MNZB 5FOBA 2F19L 5CJQH 3GIVA 2Y07H 4AH2A 1ZAGA 2CR6A 3CFEA 4EXPX 3WFZA 4M1CD 1T5XB 3TYFB 2BY1A 4O5LL 3RA7H 3FOLA 1LO5B 3QPQC 2N1KA 1IFHH 2VLKB 2G5RA 2ZUWA 4FQIL 1UZ6F 3HZYB 4AY0A 4UV7H 1IEAB 3UYPA 1HQ4A 5MENA 5BW7C 1B0GB 2KZ1B 5TDOB 3GUTB 4ZUTA 1MWAH 1PG7L 4JO4L 3CZFA 3BD5A 1PQZB 5H35A 5CIPB 3VW3H 2YWZA 3SDXE 3IFLL 3SKMB 4GLRI 5EC1A 4CDHA 2XA3A 1LO0H 3PV7A 2ADIB 5F88B 5HBBA 5IMKB 2VDLL 1JHKL 5C0IB 2BNRE 3O81A 4I5BA 3DX8A 2OZ4A 1R5WA 3FQUA 3O6MH 5C08A 5F9JB 4P4RA 4XRCB 2R9HD 4FQPA 2AP2A 3D9AH 4NWUH 1IAKB 3O6KH 5IBUB 5BS0D 5CD3B 1L7IL 2ZSWB 1ZSDB 3GMRB 4CVWA 3MC0A 1AFVH 1ZHLB 1X6LA 3HI5L 5JLZB 4K9EC 1C5BL 3X12A 1ND0B 1RIVH 2VE6A 3CFDA 1I7UA 3PIQB 4WUUE 2ITCB 4FHBD 2DM2A 1CD8A 3KPLA 5I1DA 2RCSL 3DECA 4WFHE 4QLRA 3TV3L 4UDUA 5D8JH 1MAKA 4NJ9H 4F37F 3AGVA 1EXUB 4TUKH 3HC4L 1MLCA 2BMKB 3WNNA 2HN7B 1FG2B 1XF5A 4FP8L 2FATH 1WGOA 3VFGH 4Y19E 4L4JA 3WEXB 5JW3L 4NP4H 3B6SA 1Q94B 3DETD 4M3JA 4YDKH 2HRLA 2JB6A 3FZUD 4JM2A 4UT9L 4LU5H 2BVQB 1W0WB 2B1HH 4KRNA 4MX7B 5AWNL 1ONQB 4WVRA 3IU3A 3O41A 1PZUB 5HPMA 3MRGB 4PJAB 5L2JA 5LGJB 2YK1L 4M1CC 1TJGH 4TSBL 1BJMA 4MZ2A 5E8DL 5JXAH 3EW3B 5DD5H 4V1DA 5ID1B 3QDME 5GRVK 1KCVL 1AKJB 3AS2A 4ZQKB 3U0PB 1S9WA 1NANI 3S97C 3BP5B 4GQPH 4NUJB 4K3EL 2Q7YA 1DBBL 1L6XA 1F3DH 3VWKC 4YPGA 1JWUA 2NXYB 4PRPE 3O6FD 3QB7C 5HGAA 1A4KA 5CAYB 3MUZ1 2OTPA 2H26B 4MD5B 1FNLA 1MCBA 4P3CL 2WWMC 5IF0A 2F19H 4N0FA 1CIUA 5F9WC 4HIJB 5C86A 1S9VA 1YQ2A 2YWYA 1CT8B 1QUNA 3DUUA 3LQAL 1RHHB 1NAML 5JPNB 4QRUA 5DJ6A 4O5LH 4C4KT 4JDTL 4ELKA 3SGKC 1RJZA 3STZA 3Q5OA 1KIRA 4N5UA 3G6JB 4OFYD 4GXUN 2YZ1A 3WE6B 4FZEH 3HRZB 3JWOH 3O3UN 4JFPB 5DQ9A 5T33L 3IFLH 1FN4B 2OXHA 1JUFA 5I76B 2JIXA 2VDLH 1JHKH 3FAXA 4XCFL 3MBEA 2X1XR 1IAOA 4O4YH 5DRZA 2ESVD 2R1WA 3FQRB 1WFOA 3IF1A 4WU5B 4KJYB 4JPWL 3LS5L 3AAZB 1JGLL 5F6HJ 1IGIL 4R96B 5IOPB 2Z8SA 3BP7A 2HFTA 4XP9L 1JTTA 4BQBA 2AI0H 1L7IH 2PO6A 4PREA 3W0WB 3NFSL 1QFHA 3QNYA 5ICYB 5J6HB 2PW2A 2B4CL 3HI5H 2GUOA 3C5JA 1VEPA 4GW5A 3FO0L 1QNZL 1C5BH 2ZUYA 3FZUC 3V6FA 4NO0B 4D2NA 5GJTL 4K71B 2BSRA 5JW5A 2VR9A 1OAUL 2UUDK 5B21A 4E0RB 3CFBB 4K94L 3KPRD 4LPUA 3GHEL 5K9JL 2RCSH 5B3NA 4EVNB 2CO7B 2AJVL 5HYJB 3TV3H 4XX1E 5K59E 3X17A 3HC4H 3ARXA 2N4IA 4LQFL 1DQTA 3IDMB 5DI8B 5E9DA 3PJSB 2EDWA 1GC1C 5JW3H 1I1YA 4BFGA 3QEQD 4NQVA 5B22A 3LPWA 1UWXH 2XY1A 3QUYB 3UYRL 1TFHA 4G5ZL 4PJ8A 4UT9H 1CD1A 3ZYIA 5AWNH 4JFDB 3FT4B 3SKOB 3UZQA 4NO2A 4CVXA 3PWPB 1MF2L 3HE6D 4YHOL 1UXWA 2W92A 4R90L 1UGNA 2BVOA 3QAZC 1EPFA 1AR1C 2YK1H 4TSBH 3S5LG 5E8DH 1MCQA 1YJDC 4IMLA 2OTUA 1O7SA 2XG5A 4NQEB 1M7XA 4RX4D 3E3QC 1WC7A 1KCVH 4IRJC 4PBWD 1S7WA 3GEWB 4G6FD 1FP5A 3HE7D 4ZOBA 3QIUD 4BK4A 4K3EH 1HWHB 4HJJL 1DBBH 2VXVL 3BPOB 1LP9F 3QA3B 1SJHB 3FHQA 4ELMF 3UTSE 2WMPA 1HHHB 1RZKC 4FRWA 4QGYA 3P4OB 3GMOB 1FO0A 1UH2A 1MFBL 5EO0B 1OD7A 1CL7I 2XY2A 3W9EA 3HI1A 1MCIA 1X5FA 4P3CH 4HBQA 2F53B 3M1BA 2FO4A 4YFLI 4YHIA 1PJ9A 1NKRA 1HWGB 3LQAH 1Q72L 4JDTH 1A1OA 3DMMC 2GI7A 3MFFA 5IV2B 2QSQA 4WTXA 4NKOB 4OLVL 4Y88A 2P1YA 3MMEA 3D3VA 4WUUD 5CZKA 3VDCA 1VFOA 4XXDA 4ZUSB 4ZSOE 1JZ8A 1W72A 2OJZL 1JNJA 3ARVA 1N8ZA 2V2TB 1A2YB 3FFDA 4LMQI 5T33H 3NGBC 4X5XA 3GM8A 4GW1B 1MHEB 2J8OA 3S7GA 4XCFH 3TIDA 2A74A 4AENB 3BZDA 3UTTE 4P2QE 3BPNB 3ZDZE 1YEHH 2P45B 3LS5H 1JGLH 4YPJA 1IGIH 3NH7L 3RFZC 4XP9H 3BEVB 1HILB 3S35X 1ZEAL 3SDDA 4X4MA 5D2LF 3MLSL 3NFSH 3KXFA 8FABB 4NHCL 1D5ZB 4C4KO 5EORH 4HF5L 2PXYD 2B4CH 2BY3A 1TPXC 2HJFB 2OI9C 3RZCC 2DKSA 1QNZH 3FO0H 1IE5A 1I7RA 2O61A 5J7CC 5KZCD 1CDCA 4HUVA 4HK0B 2OR9L 5ACLA 4YO0A 1OAUH 2OXGA 1X5XA 2VJXA 4K94H 2J12B 1CFVL 2ADGB 3GHEH 5ICXA 5K9JH 4O2CA 3TN0B 1EEYB 5EU4A 4JO1L 2AJVH 5IR1A 4PRPD 1QRKA 3BDBA 3PF2A 4JFHE 5DJCB 4EQ3A 4X80H 4EKXA 1XCTB 2NZIA 3EJYC 5MI0C 1FVEA 4LQFH 3VFRB 1N3NA 2BJML 4V2CB 4MCYA 3D0VB 4Q2ZA 3QIUC 4JQVA 1RK0A 3UYRH 3BWAB 4LPVA 1C5CL 4CN1A 2V5SA 1AIFA 1R5IB 2EXYC 4PR5A 1OP3H 4NKDA 5F9OL 4Y5VC 1T83C 5J1AB 1T22B 5E8OB 3CC5A 5TDPB 1MF2H 4OKDA 2DB8A 5FB8B 4G42A 1MJUL 5D7LB 4KWUA 4R90H 3IKKA 4AIOA 3IFOB 5E2JA 1W0VA 4FXGA 4M61B 5I30L 3QFJB 3T1WA 4W6YB 1AH1A 4OD1L 4MLIA 4Q9QL 1YN7B 4ONGL 2VKWA 2FH8A 3CGTA 5C0AD 3KYOA 2JB5H 2VZ3A 3GSUB 2DQEL 1WZKA 4HJJH 2VXVH 1ZHNA 5K9KA 1A5FL 1NCAL 4K3DH 3IKCA 2W0LA 2X4OA 1IGJB 3JXAA 3HB3D 3FRPG 4ZPVA 5GXBB 4G8EB 2RHEA 4OBRA 5AG8A 3ZO0A 5MEND 5TGBA 3V0VA 4BH7B 5CEZH 4KTDL 4G7VL 1SBSL 1U58B 3F12B 4JDVB 5KS9B 3ARTA 5FHBL 5GRUL 2EIEA 4JB9L 4LCCA 4ISVA 4OLVH 4U33A 4JHWL 2CQVA 1MUJA 4OI9A 3RVWD 5GS2H 2DKUA 5LVEA 2SEBB 4OLEA 2OJZH 1ZE3C 5C08D 5D9SB 4R7NA 5F9WB 3IDGA 4EDXA 4Q97A 3MRMA 4CBPA 2CO6B 1E0OB 3TYGL 4DGYL 2V2XA 2DQHL 2YPLA 1TQCB 5BS0B 5JA9A 1YN6B 3HLAB 4Q6IB 3EJZD 4UUJA 3NH7H 2YKLH 4LL9A 2FWOA 5GSRB 1ZEAH 2PYEA 2YPVL 1SQ2N 5I8CA 3N50A 3JV4A 1WF5A 5AYQA 4UILL 5ILTL 1CDGA 4UINL 5TDNB 5GGRB 3W39A 5BCAA 4NHCH 4NPYA 2H2SD 3O3BA 1CGSL 4HF5H 2AJYH 3BKML 4HGWB 2XICA 4RIRA 5DHVA 4QHUB 1EFXB 4HFWA 4JANB 2OR9H 3JV5A 4HX1A 5JIKA 1CFVH 3P30L 1KTRL 4JO1H 4UIMB 4WIQA 4PJ7F 5LQBH 1RZGA 4P5MA 2PTUA 4JM2D 1G7IA 3H7LA 3STLA 1ZHKA 4Z7VB 1BMGA 5DA4A 5IEKB 3BKYL 5A2LH 2HYMA 4D3CL 3A6OA 5E5RB 5EFIA 5DS8A 1P7KA 3VFNA 3NZHL 3DO7B 1I3VA 1C5CH 3MLZL 4ZYKA 6FABL 3OV6A 5F9OH 3HB3C 1ZA3B 4C59B 4V1DD 4EI6B 4KC3B 2YHGA 1MJUH 5FCUL 2X4QB 3IU4H 1K8IB 3KLDA 2D0FA 1WVZA 5I30H 4TQEL 1G0DA 3ARFA 4OD1H 4Q9QH 1YJDL 2D4FA 4AK1A 3FB8B 4ONGH 2AS5M 2I07B 3TZVA 2JJSA 2EKSB 3UAJD 3WD5H 3T2NL 1F45A 1UM4L 2C3XA 1IM3A 3O6FB 2DQEH 3RVWC 1XF3B 5FFLA 4JN2A 2QADD 3LEXA 5MEQA 4PLJD 5C0CE 3BZFA 3HZMB 4D0CA 1U3YA 2AXGB 1R3KB 3PHOB 5J4MA 3QAZB 1GZQA 1VKXB 3VFUA 1JF1A 3S36X 2DI7A 4ZFZB 2ZUXA 4KTDH 3EJZC 2W59A 1WAAA 2H8PA 4G7VH 1RD6A 1SBSH 5EPMB 4NC1E 4XPGL 4LCYB 2JIXD 4JB9H 3OR7A 4LLYA 3MBED 4P46A 4JHWH 5E7BA 4P5TC 5C6TH 5IB3B 2F9BT 2H2SC 3MRRB 2FL5B 1I1AC 4OAWB 3T8XB 5ANMB 1IQDA 4YGVA 5TPWL 1KJ3L 1Y6KR 4O2EA 4JAMB 2XN9E 4FZ8L 1E6JL 3OR6B 2ESVB 4Y5XA 1IBGL 3EOBA 2CUHA 2PO6D 3HNVL 4KDTA 5HHVL 2R69L 5E95B 3TYGH 4DGYH 5HYQA 3BN9D 3JV0A 4U0QB 4ZOEA 1J87A 5LBSL 1EO5A 3I84A 5D5MB 4KI5D 5ERWA 2RAMA 4ZOAA 2XG4A 3EDDA 3O45A 3S3PA 4XMLL 1DR9A 1T04B 4UILH 5ILTH 4UINH 1IARB 3E6HB 1HXMA 5HHNB 3ZDXE 5HGBB 3DTXA 3JWDL 5IB5B 1FIGL 3BKMH 4J4PA 3BT2L 5ESQB 4WHYH 3IFPB 5B39A 1AP2A 5I9QB 2BHUA 3OX8A 4WUKL 5CSZA 1XCQA 3KPRB 1YMHB 4F8TA 4WW2F 3UTZA 5E9DD 4OFKA 3U30C 3P30H 4QCIA 3CUPA 4GW4B 4TOYL 4ZUUA 2ICCA 4CJ1A 5JNYB 3LOWA 1HQRA 4PJ8D 5C0FA 3QT2A 1PW3A 3GJEA 5KVEL 3QEQB 3DSFL 2OYPA 4LCWA 1TPXB 3W2DL 1DL7L 2GJJA 4X9BA 3BKYH 3RI5F 1G7PA 2OI9B 1GC1H 3RZCB 1YQVL 1T21B 1XGYL 4GG6A 3MYJB 3NZHH 1QHOA 4UOJA 2DKMA 3MLZH 6FABH 3HE6B 2X10A 4OGXL 3EZ8A 3QUKA 4KRPC 5FCUH 1LEGA 1ZXQA 4U3XA 3CMGA 4P57A 3SDXB 5T3ZH 4P5KA 4H20L 1BBDL 4HAFA 1T7WA 4TQEH 2EDQA 5DD1L 4Y4KC 5TQ2L 3UO1L 1MCFA 1JN6B 3IDYC 4G6FB 1YJDH 3HE7B 1A0QL 3QIUB 4LLMB 1BFOB 4Q0XL 4ZO6A 5KSUA 1MQKL 3MBEC 3T2NH 1UM4H 3H9SA 3RHWK 2V2WA 4LCUA 4ZD3H 3MLTA 5B8CA 3QISA 5KVMC 4F33A 4JRYA 5GZOD 1KG0B 4IRSC 1EEZB 3ECBB 3RDTD 4YHML 2DWEB 3P9LB 3TT1L 1GHFH 3CH1A 2X1OA 2PO6C 3PGCB 3VRLF 4F15C 5CEYB 1XGQB 3D3VD 3DURA 1OW0A 5IVXE 2HJLB 1KYOK 2D0GA 2DM3A 4ODWB 5TJWK 1KCLA 3ZKSD 2ZG2A 4PY8J 4BH8A 2Y9RT 4KI5C 2JE8A 4XPGH 3WL9A 3JTSB 3K2UH 2BNQA 4HSQA 2OL3A 2F5AL 4PJXB 5TPWH 2LU3A 2IPKA 3C6SB 1U2CA 4FZ8H 2Z4QB 1E6JH 4OIIH 3SY0A 1CF8L 4KGLA 1IBGH 1MJ7L 2H6PA 3ZHLA 5LGHL 4WY7L 4MNGB 2Z31A 3SDDD 2YOCA 3HNVH 1NFIB 1NDMA 4MXQD 4U1JA 4XWGL 2CLZB 3BX7C 3KXFD 4OUOA 2RBLA 3SE9L 2EO1A 2E9IA 2CGRH 2XWTA 1BP3B 4M02A 3CD4A 3DV4B 1PEWA 1PGRB 3STBA 2VWEC 2NNAA 5F7DB 3DSNA 3MRNA 5LBSH 4LPYA 3RBSA 4PJ8C 2BSTA 3ARPA 4NQSA 1HH9B 3WFBH 1S7TA 4BFEA 1PG7X 3TT3L 4XMLH 2PXYB 2HVKA 5CD5D 1JZ4A 1A1NB 2YZ8A 1INQB 2ZG1A 3JWDH 1EGJL 1FIGH 4ACPA 1S78D 2DD8L 2O5ZL 4WUKH 3QXDB 3GRWA 4XVJL 4HWEH 3VCLA 3GB7B 4YK4C 1BWMA 2IJ0C 4BKLB 4NWTL 5DLML 3L3HB 4KZDH 3MJ6A 1F5WA 4TOYH 1FL5B 1DN0A 3MRHB 3QDGE 5F3HB 4ONFL 4C54A 4MWFA 5CKGA 1K9TA 2XNAB 2ZZUT 3S3JA 4OI7A 4E42A 1T0PB 5KVEH 1RJLA 3DSFH 4ETQA 3LEVL 2C4FU 1GAFL 3W2DH 1DL7H 2YN5A 2BHYA 1IGCL 2MFNA 1YY8A 1YQVH 1XGYH 1DUZA 3CJJA 1MHCA 5ITBL 5GZOC 4RBPK 3MRPB 1BWWA 4UQ2B 5DHYA 4OGXH 4NNXB 2HLFD 5EOTA 2NYYC 1U3ZA 4OTXH 3QNXB 4Z7UF 3RIFF 4HUXA 4X4XA 1UCBL 1AR2A 2A77L 4H20H 1BBDH 3MQIA 5JR1L 4AJ0A 4JQIL 1TZIA 5DD1H 3UO1H 5C0BE 5C0AB 4JKLA 5FOBB 1OP9A 2VISA 5HHXL 4Q0XH 3GIVB 4AH2B 1MQKH 3LRGA 1XFPA 3ROLA 3CFEB 3DUSA 3OAUL 4UZGA 3RTQD 1WLHA 2OZ4L 3FOLB 3C09B 1ZLWH 5GGVY 4UNVA 3B4NA 5BZDA 3BGMA 1QZ1A 5IMMA 4HUWA 4QHNA 5HGDA 1HQ4B 3TT1H 5MENB 3V79C 2VZUA 2R0ZL 4ZUTB 1U3HA 3CZFB 4UOW1 1P4IL 5H35B 5K93A 3OHXA 5EC1B 3V0WL 5I18H 1QFWH 5I8OH 12E8L 3D69A 1HXYA 4GSDL 5GHWL 3IRPX 4DGVL 1BZQK 1OD9A 4I5BB 3BH9A 1TNNA 3DX8B 3KLAA 1R5WB 3FQUB 3MPCA 3WIHA 2A73A 5C08B 4P4RB 2UYLA 1QOKA 3QO0A 2YPLD 5DVKA 1F6LL 2VLMD 4ESKA 4PY8I 4AMKL 4TUJA 3QDHA 3C2SA 5LGHH 4WY7H 2I27N 3SDCA 1CICA 4KKCC 4TRPL 4RRPA 1CQKA 3SE9H 4HKZA 4M48H 3X12B 4DKFL 1G9ML 4K3JL 2VE6B 3CFDB 2ZUTA 5DVMA 4QEGA 5F44A 5DFWH 1I7UB 1U8OA 1OT2A 2X4UA 4P5TB 3QIBC 3VG9B 4QXUL 2FECL 1RZ7L 3TT3H 3KPLB 4XCNA 1Q9WA 5I1DB 2BNQE 1R5VA 4KUCD 4P2RA 4RGNE 1OHQA 1EGJH 4UDUB 5D2NC 3E3QE 3WSQL 1MLCB 2DD8H 2O5ZH 4HHAA 1XF5B 1YUHA 4NN6B 3NA4A 4XVJH 2JF1A 4F7EA 3V6OA 1A7PL 3FN0L 4UNUA 3B6SB 3T3PE 1FSKC 4NWTH 1OAYL 2JB6B 4JFFA 4JM2B 2YD1A 2EDEA 2Z8WC 4ONFH 4P23A 3Q0HA 3O4LA 3AY4C 1CK0L 3IU3B 3O41B 2V5MA 1ZLUK 3LEVH 1GAFH 5HPMB 5L2JB 2VDPL 3WHXA 3GNML 5BQ7A 1CE6A 5CS7A 5ITBH 1NEZA 4V1DB 4HFUL 2COQA 3ARFD 3DXAA 1S9WB 2VDOL 3FOMA 2FX7H 3SQOL 3TZVD 1RY7B 1HKLL 2Q7YB 1OWRM 4LCCC 1QYGL 4WV1A 5ACMA 4YPGB 1JWUB 3W11D 5HGAB 1A4KB 1UCBH 2A77H 4C83A 1J0KA 3NZ8A 5JR1H 2BVTA 3OKKB 4O51A 1N5YL 3ZL4L 1EAJA 5IF0B 4N0FB 2GQHA 5HHXH 2EDXA 2GSIA 1JGDA 1GGTA 5HVHC 1S9VB 2QADB 4IM8A 3DUUB 2CXGA 3GBNH 3OAUH 2HTKC 4QRUB 5DJ6B 1BVLA 4JGUA 4N68A 4ELKB 1U92A 1PYWA 1RJZB 4WI3A 1MVUA 2HFEA 3STZB 3V95A 1KIRB 4B50A 2F8OA 1DFBL 4KRPB 5D7SL 2E3VA 4M4PA 3FQWA 4MSWA 5D6CA 5EIIB 4JKWA 5DJZA 5C09A 2R0ZH 1YNTA 5D7KE 4P46D 1P4IH 5DQ9B 2ZJSL 2DL9A 4Y16C 3UROR 4OD3L 3V0WH 1Y0LA 3D2UA 12E8H 4PJAF 1JUFB 2JIXB 1NGXA 1RI8A 3MBEB 1SYSA 4GSDH 1IAOB 5DRZB 2VLRA 4L3EE 4QWWC 2ADJA 3UC0L 4WU7A 3IF1B 5EOCJ 3WCYA 1FRGL 5C07A 1CLCA 3QO1A 2CMRL 1JTPA 1KPUA 3LZFL 3WLWC 4OV5A 4IJ3C 1CDUA 2QLVB 3BP7B 2F8VA 2KUTA 5FUCE 1NEUA 2PO6B 4PREB 4AMKH 4F15B 4CUCA 1B9ZA 5DMGD 4PV9A 4ODHL 2PW2B 4TRPH 1MCRA 2GUOB 3C5JB 1KBGL 2IFFL 4GW5B 5EG6C 3ZSTA 3FCTA 1BLNA 3V6FB 4RAHA 4K3JH 3HI6L 4N0RA 1E4KA 4J4PD 2E6PA 2BSRB 3R1GL 5JW5B 3B9DA 4KKAD 2WV3A 4QXUH 1ZT1A 1RZ7H 4FFWD 3B2UC 4UAOC 3CXHK 2ARJQ 3OPZH 3IAGC 2FJHA 1QG3A 3G6JF 3MREA 3ARSA 2DTML 4P59H 4ALAH 3WSQH 5IIEA 4KV5E 3VGEA 1CDHA 1IC7L 1X5JA 1KCUH 4KH2A 2ENSA 4UU9A 5E9DB 1A7PH 1I1YB 4NQVB 3FN0H 3L3DA 2JJSC 4LCWD 4PD4K 5HHQA 1OAYH 1G6VK 4PJ8B 1CD1B 3EYQD 2L4OA 3MLYL 4NO2B 4CVXB 1XR8A 4QRQA 2XIDA 1CK0H 1UXWB 1FO0L 4GAGL 2K1MA 1A3RL 1ZGLM 5A16A 5CGYD 2BVOB 2VDPH 1U91A 2IQ9L 2FIKA 3P73A 3C87A 3GNMH 4OCYL 4IMLB 4H0IA 4YK4B 4HFUH 1WC7B 1T6VN 1S7WB 3VA6A 5IFJA 3KYAA 3SQOH 4AYFA 2ZCLL 1HKLH 2OS7A 2AV1A 1QYGH 4ZTOL 4TTDC 1U8MA 1E28A 5C92A 3QR2A 4NQDA 1EERB 3H9SD 2HP4A 3RNQA 4ODUA 1FO0B 1W72L 4K7PY 3W9EB 3HI1B 4JRYD 1N5YH 1WWBX 4MHHG 4KXZI 2DLEA 3ZL4H 3M1BB 4GXUM 4WI9A 4M8VA 2FO4B 3VD5A 4YHIB 4Y5XC 2UUDH 1F58L 4KK6D 1JZ5A 4MQSB 4YX2L 4LVEA 2GJ6E 1H5BC 4XNYL 1A1OB 3MFFB 3QDJA 1JPTL 1KB9K 1VGKA 4J7RA 1DFBH 5D7SH 5TH2A 3MMEB 3D3VB 3LSOA 4XXDB 2O5YL 1AXIB 4I18A 5DMGC 5JXEA 1VERA 1W72B 4H88L 1N26A 2BNQD 2ZJSH 3GSRA 1N8ZB 3FFDB 1RK1A 4RGND 1YMME 4JG0H 4OD3H 4X5XB 3U79A 4J4PC 3TIDB 2A74B 3MJ7A 2DWDA 2R1XA 3IJHB 4FFWC 4ZS6C 3UC0H 2EE3A 1U8NA 1BVKA 2Z31D 3CSGA 4AL8L 5ESAA 4P9HL 2AERT 3LZFH 5KBNC 1KPVA 5I1KL 1BOGA 5AD0B 3F6IA 3QQ4A 3SDDB 2IBBA 4KROD 4Z7QF 1BJ1J 3D85A 3KXFB 3D39E 4ODHH 5IFHL 4P48A 2P8LB 2IFFH 5B39G 1FIEA 1I7RB 2IBZX 3G6AA 3JUZA 4PTUA 3HI6H 2O61B 3MV8A 4HUVB 4N0UE 3KDMB 3WFDL 4YO0B 3CFKA 4M7LL 4R4BA 3VXUE 5CGYC 5ICXB 2C4XA 4O2CB 3RVVD 4NBXB 5EU4B 4LSDA 1WUNT 3UTPE 1U8JA 5IR1B 2B2XL 2DTMH 1V05A 1BQUA 1NMCB 1HHGA 3PWNA 5KJRL 1K4DA 1NMBH 3P0YL 4MCYB 4Q2ZB 3TO4A 5HYIA 1RK0B 2MNUA 5FAAA 2X1QA 4LK4A 4R4ND 4PJCF 1A47A 1B6DA 3KPSE 4MQ7A 2NX5A 2ENYA 1AIFB 4PR5B 4PRAA 1UKTA 3MLYH 3CC5B 3CPLA 1E4XI 5TE6L 4G42B 4GAGH 1A3RH 1W0VB 2W9DL 4FXGB 1Z9SA 2IQ9H 1L0QA 2J7LA 4UNTA 1M4KA 1W2KT 1RFDH 2NY2C 4OCYH 1OW0C 32C2A 3TCLA 1C1EL 4RMTA 2W65A 5FKPA 4X9FA 4KKNA 2V6HA 2C4FT 4MA8L 3KYOB 5JDSA 1PG7W 3ARBA 2ZCLH 3MRCA 1ZHNB 4ZTOH 5K9KB 1TTFA 3SE8L 3QHZL 3IKCB 1W72H 2X4OB 3BDYL 4ZPVB 2QL1A 3UBXG 1KNOA 2DRUA 1MCSA 4RAUA 5CLWA 2VERN 1TQBC 4HKXA 1J10A 1F58H 1YEJL 2Z31C 5TGBB 2I5YL 1U3HD 1DQLL 3V0VB 4YX2H 4XNYH 2XI9A 3T0XA 2IH3A 4X8XA 1JPTH 5TQ0L 2MCPL 1HOCA 1INDL 3IJYA 3FN3A 2FX8L 4KROC 4LCCB 4ISVB 5IGXL 1MUJB 2O5YH 4JZOA 3D25A 4H88H 2R23A 4KTEL 4TPRL 5DO2D 1QBAA 3MRLA 4X6CE 3GSVA 4R7NB 3IDGB 1ZLVK 4EDXB 5HVHB 3MRMB 3VGAC 5EC2A 3V7AG 1KXVC 5DEZA 2EEDA 4HPOH 3BIKA 3IGAA 2V2XB 2YPLB 3RVVC 3SDCD 5A2FA 1CICD 4AL8H 2D9QB 4P9HH 4UUJB 4DKAA 5I1KH 5I8CB 2PYEB 4OGZA 5DUML 3JV4B 2HJKA 3IDJA 3W39B 4N5EC 3MACH 4NPYB 4Y89A 5D7JA 4PJHA 4J3SA 3O3BB 3AU1A 5IFHH 1GOGA 1ADQA 5HDOA 2NXZD 4ZODA 3E8UL 4RIRB 5DHVB 4P2RD 4C57C 1ERNA 3MBXH 4HFWB 3O2WL 4AEFA 3WFDH 4NZJA 1RZFL 1MNUH 4NN7C 4HX1B 4NYLA 1I4FA 4M7LH 2D3VA 1RVFH 3MX0A 1F8TL 1AGBA 2XACC 3V8OA 5KS9F 3KPOA 4P2OA 4PG2A 5EOCL 2B2XH 1RZGB 5J11C 4M8QA 4P5MB 4H26A 4JFFD 4OFDA 1G7IB 5T5FL 3STLB 1ZHKB 4HIHA 2J8UA 4P23D 3BJLA 5KJRH 4JZJA 4RWYL 3O8XC 5TFSH 3P0YH 3O4LD 4X6BA 4F2MA 4W6XB 5EFIB 5DS8B 1P7KB 3VFNB 1QP1A 4L8SA 5L88L 4ZYKB 1P4LA 5EUOE 2LQRA 2ARWA 3C60D 4UAOB 3CSYA 4KAQL 1NBZA 5DQDL 1H3VA 2W9DH 4OZGA 3I6KA 5DC9B 1RQ5A 4OZFA 3FB5A 3ARFB 4DVRL 3J7HA 4U05A 3TZVB 1KULA 3TP4A 2WINA 3DPBA 4PJ5A 5C1MB 1IM3B 4JN2B 5SWZA 2Y36L 3LEXB 5MEQB 2EDDA 5EO1A 3WFHA 2G2RA 3SE8H 1EBPA 4YEEA 3BZFB 3MZTA 4D0CB 3BDYH 1K6QH 4I9WE 4X8JA 1GZQB 4MXVE 5JHDA 4CMHC 3EGSA 1L7TL 2KKQA 2LVEA 4FMKA 3VFUB 3KYMA 1YEJH 1JF1B 2P44B 1YA5A 1CICC 2I5YH 4M7ZC 4Z7VF 2H8PB 3KLSA 5GISH 1GIGH 1J12A 5TQ0H 2MCPH 1FC2D 3D2UD 3GHBL 2FX8H 3OR7B 3N0PB 4LLYB 4P46B 5IGXH 4PJDA 3WNOA 5KSBF 4I3RL 3NIGE 4KUZH 1IQDB 4YGVB 4KTEH 4TPRH 4O2EB 5C07D 4G9DA 4WW2A 3PNWA 1YECL 5D1XC 3RUGE 1S5IL 4Y5XB 3EOBB 5DHVH 1ZVSA 1DCLA 3ZKXC 4G80A 4RRPG 5HYQB 3K4ZA 4WI8A 3VGGA 3BVNA 2D7PA 3MOAL 2FBOJ 4E41A 3ARDC 3MCKA 1GGBL 1YEKL 4HPYL 4K23L 5ERWB 3I2CH 4IOIA 5LXGL 2WK2A 3O45B 4U1NA 4IS6A 4M5YH 2QSCH 3LPFA 1HXMB 4U1LA 1OAQL 1AGCA 4HUUA 5L8LB 4URTB 1UM5H 1NC2A 2KH2B 2P5WE 4CKVX 1F4HA 3OKOA 5B39B 3E8UH 2W0FA 1E4WL 1AP2B 3L5HA 1DJSA 1WIPA 1BFVH 3OX8B 4PYGA 1P84K 4WJ5A 2DM7A 5CSZB 1XCQB 1GOHA 1JE6A 4NM8L 4HULB 3UTZB 4MDJA 4X4ZA 5CMAA 1F8TH 5I66B 4QCIB 1KCKA 4PGEA 3CUPB 1AE6H 3BKJL 5EOCH 3SBWA 3MV11 4WV1C 1HQRB 1V3JA 1XR9A 4LRNL 5C0FB 3N1PC 2C7UA 4YHKL 1RULL 2EDNA 3GJEB 5T5FH 5D1QA 1A1MA 2BK8A 3JVGA 4OQTA 4LCWB 4K3GA 4R0LA 4RWYH 5CBAA 2LABA 1RHFA 5F8QC 3CXHJ 1G7PB 4HJ0D 1CFBA 1CS6A 1XZ0A 4GG6B 1JK8A 3FO2A 1MEXL 4ZUVA 2J3SA 3FQXA 4YC2C 3GI9L 4PJFA 1QPXA 5CEXA 1UXSA 3QUKB 2X4NA 4KAQH 5BV7L 4Z7WF 5DQDH 1LEGB 5D5MF 1NFDA 4NN5C 5HVFB 2IEPA 4P57B 5F1IA 1ZWIA 4PP1D 4P5KB 4FOMA 3S8WA 3MUHL 4NQDD 4DVRH 4YR6A 3INUL 2J8UE 4Z95L 1OARL 5EA0H 5KSUB 4MXWL 3H9HB 5F7EL 5TE4L 4DN4L 4S1RL 3H9SB 2V2WB 4LCUB 1GH7A 3MLTB 2Y36H 5B8CB 4F33B 3WUWA 2ZUQC 4JRYB 4L3AA 1MFCL 1GZPA 2M1KA 2OL3L 3ES6A 3RWGA 1Q9LA 3BMVA 1QQDA 2WP3O 3HFML 3QDJD 3CH1B 3RVXD 5GS0C 3MV7A 3ET9F 3QEGL 1L7TH 2JK5A 3OWEA 4ZOCA 4CL7A 1QFWI 4R97C 2AXFA 3FHAA 5JXED 3DURB 3UPCA 4LEXL 4WEUD 43C9B 2E9JA 3WV0A 3WUZA 4QNPE 4MQXC 4BH8B 3QCTH 1F6FB 1E4KC 1YEEL 3GHBH 3WL9B 1U8KA 2JLLA 3I6LD 2BNQB 4OI8A 5D72L 4I3RH 2OL3B 5I1CL 1JHTA 4PJEA 5KVFL 2C1PA 5SWZE 3GIZL 1CXLA 3U48A 5M94B 2IPKB 2XKNA 3SY0B 1KB9J 4U7MA 2ZPKL 1S5IH 1OL0A 2H6PB 3SDXF 5SV4A 2HKFL 1WZ1L 2Z31B 1DLFL 3VXRA 5FM4A 4U1JB 1NDMB 3D85D 3GRWL 2XWTB 1F4XL 1PKQA 5E0QA 2IPTH 3W82A 3MOAH 3NCFB 2Y5EA 2NNAB 2YRPA 4KROB 2BSTB 1GGBH 4NQSB 1YEKH 1S7TB 4K23H 3WS3A 3MV8D 2VUOA 5HHOA 4EN3C 4KRLB 1YEIL 2HVKB 4W4OA 4YHZH 1OAQH 2A2QT 3TWCL 5MEOA 1NGWA 3TA3C 3HZKB 1E4WH 1BX2A 3U7WL 2WLYA 3VCLB 5F93C 4NM8H 4J3WA 4U1GC 1I8KA 3VGBA 1H3XA 3TO4D 3PQYA 5E99L 3BKJH 4PP1C 4E41E 1DN0B 1CIDA 4XP1L 2NX5D 4LRNH 4MWFB 4YHKH 1RULH 1VCAA 4E42B 3MR9A 4JRWA 2MKWA 1RJLB 2CDFA 4XVUD 4ETQB 3D1MC 4I9WD 4PJGA 2B0SL 1Y6MR 5FYLH 1YY8B 1GOFA 1BJ1H 1FYTE 4D8PA 1DUZB 4U6XA 2OJEA 1MI5E 1EH9A 1MHHA 3RGHA 4NN7B 4OLYL 5DHXB 1MEXH 5DHYB 4QKXB 3N85L 3GI9H 5J0BA 1P4BL 3IETA 5EOTB 1UT9A 1T6WA 3GMQA 5J11B 2FGWL 3ARBD 4I18C 4HUXB 5JXEC 1QSFE 4O2FA 4X4XB 3ZE2E 3QRFM 1K5NA 5F97E 2VQ1A 3RKDD 3INUH 2VISB 4Z95H 1OARH 4X6FA 4MXWH 5F7EH 5TE4H 3GSXA 4PG9A 3ROLB 4DN4H 3DUSB 4S1RH 5FO9A 1FL6A 2DMKA 1VHPA 4H5SB 1S9XA 1WT5C 3WIHL 5BZDB 3BGMB 2QQQA 1MFCH 2OL3H 1BF2A 5IMMB 2GJZA 4HUWB 2EE9A 5JPMA 4QHNB 3HFMH 5HGDB 4X6DE 3QEGH 4LFHD 1U3HB 3T3ME 4XB7A 2AJ3A 2XZAL 4LLUA 5J57B 2WBJA 3EHBC 4LEXH 3OKNA 1NBYA 5B38A 5GGUA 3D69B 4L8CA 1HXYB 3VMPA 2R1YA 3AFLA 1VFMA 3BH9B 1BQHA 2V9RA 4EDWL 3KLAB 1ORQA 2A73B 5D72H 4DUXA 5I1CH 2UYLB 4DGIL 1JPST 3MLRL 3QO0B 3HNTL 3GIZH 4CVZA 2MWCA 2YBRA 1D6VL 4TUJB 5ADOH 1AGDA 2HKFH 4RBPH 4XH2A 1WZ1H 3SDCB 1DLFH 1CICB 4N0CD 1XIWC 4ETYA 3X13A 1I3UA 3K8KA 3GRWH 2R29L 4HKZB 1F4XH 5D7JD 1NKOA 3CX5K 4GBXC 3SDAC 1MCOH 4YBLC 2AVGA 1I8IA 1U8OB 4XVUC 4OGYL 4XCNB 4KJWD 1Q9WB 2VLJE 1YEIH 2HT4D 2YUWA 2VDNL 2NXZB 1R5VB 4ZAKC 4EIZC 4P2RB 3QJFA 3K2MC 2E6JA 2Q20A 1U8PA 3QBTB 4JKMA 4P2OD 4XP6L 3IDNA 4HHAB 1YUHB 1I8LA 3CVHA 1X5ZA 3H8NA 4GOSA 3U7WH 4F7EB 1KXQE 4XP4L 3EFFA 4RA0C 5J6GA 1G1YA 2EXWD 1B0WA 4LGSB 4BZ1L 4M6NL 1ACYH 5E99H 4JFFB 4PJ9A 3CFCL 5D93C 3HMWL 4F3FA 4ZUWA 3VXOA 3KR3L 3HA0A 4MA3A 4XP1H 4P23B 3O4LB 2DQTH 1KT2A 4U2YA 3RKDC 5K59F 4YNYA 3DHJA 5L8JB 3MXVH 1XF2B 4JY5L 2B0SH 3BAEL 3WKML 2FZ3A 2LAGB 5L8KB 4JHBA 3WHXB 5BQ7B 1CE6B 5EOQH 5T1KA 2YR3A 1NEZB 2ZUSA 2IANE 4OLYH 1N64L 2HFFA 5K33A 1C12B 3DXAB 1M1SA 3N85H 3FOMB 4GKSA 1P4BH 4GG8B 1M05A 4LPTA 3N06B 4PJ5D 2AJZA 4WV1B 2W9EL 2FGWH 3PQYE 3QUMA 4C83B 3VXSE 5SWZD 1DEEA 3NZ8B 4KFZC 4YDLC 2Z91A 4Y2DA 3LHPL 4AEIL 4C56E 4BQCA 3GSNA 4XGZA 1R0AL 4G6KL 2GSIB 1JGDB 4JKPL 1CXFA 4D9QE 5JHDD 1BVLB 3VRJA 1NGYA 3NVQA 3ULVD 4WO4C 1U92B 2IH1A 3WIHH 1PYWB 2AEQL 1MVUB 2HFEB 4OFIA 1MOEA 5GGTA 1X5GA 3FQWB 4JM2F 4MSWB 4DN3L 5C09B 5DJZB 4JY6A 4PRDA 4LRIA 4N0CC 1YNTB 4JRXA 5SX4I 3TGXA 4DTGL 3WXVL 2XZAH 5D7JC 3NIFF 3EDEA 1Y0LB 3F65A 3D2UB 5FF6A 3ILPA 3U7AA 1NGXB 4W70A 1SYSB 4PLNC 4KKBC 2VLRB 4S0TD 4KVCL 2ADJB 1IL1A 4M6OH 4WU7B 2OK0L 2QSVA 4LNVA 2HT4C 5E1AA 2NW3A 5T3XE 5FECA 3OXSA 5C07B 3SO3C 3LS4L 4DGIH 3QO1B 4RZCA 3MLRH 4TNWF 1ZLUH 4QRRA 4OKVA 1KPUB 4HQQL 3HNTH 4BFBD 1WV7T 4OV5B 3TIEA 3WDJA 4FTVA 4E41D 4P2OC 4RCAA 2DQCL 1D6VH 3PDGA 3EYOA 1NAMA 4BSJA 1TDQA 4ZNEE 4PV9B 4M43H 4NNYA 1T89C 1ZVYA 1P6FA 4JZJC 5DJYA 4Q9CA 2R29H 4RMRA 3FCTB 1BLNB 3QQ3A 1NC2D 1IC5L 2A6IA 4JJHA 4L8SC 2KPNA 5LAXA 4AM0A 3BJ91 1ZT1B 1OSPL 4I4WA 4OGYH 3V4PL 2UWEE 5GS3A 2BFVH 4UTAL 4L4VA 2VDNH 3R4DA 2FJHB 4L9LA 3H6JA 1U8IA 3MREB 3EDJA 3CX2A 4HWBA 4M7JL 4X7EC 1WBZA 5IIEB 4LBEA 4XP6H 1CE1L 3L3KA 7FABL 4UU9B 4ELMB 5K9QI 4XP4H 5D1QD 5C0RH 3L3DB 4BZ1H 1REIA 4NCC1 5HHQB 5D96C 4H8WL 4M6NH 2EZ0C 4UTBH 3ARUA 4NQCE 3CFCH 3HMWH 1A6VL 5C6PB 2XWJA 3KR3H 2MPAL 4HS6A 1P9MC 1XR8B 4JJ5A 4JCMA 4QRQB 1NGZA 3E0GA 5A16B 3RKPA 1CGXA 1K3IA 2GK2A 1U91B 5FM8A 2HT2C 2FIKB 3P73B 5FK9A 1IAIM 3ULVC 3LN9A 2FJFA 1N64H 4NFBA 4KI5F 1II4E 5IFJB 1Z9MA 4F9PA 4Q9RL 3DRTA 5KG9A 2AV1B 3NOIA 2NY6C 1IAMA 1U8MB 1E28B 2W9EH 4NQDB 1A6UL 4LVNC 1A9BA 3RNQB 4Z77A 2M2DA 1BQLL 4ODUB 1AHWA 5DFVC 5FIEA 1XT5A 5BVJA 4WW2C 4WFED 1JGVH 3AM8A 4ERSL 4J3UA 1UH4A 3JSSA 2CH8A 1R0AH 5IJKA 4JKPH 2Y06L 3MV7D 5ISZA 3BZEA 3QUXA 2IAMC 1MAJA 3C6LA 4GFTB 5M7QA 4FQHA 2QR0A 3QDJB 3KPMA 1BZ9A 3K8MA 1VGKB 5JA8B 1B4JL 1T2QL 5FGCB 3HC3L 5TH2B 4OZIA 3LSOB 4DEPC 5GS0H 5L0QC 4DN3H 4I18B 5EZJA 5I8KL 2B39A 3QZWA 3GSRB 3WXVH 1RK1B 2NY4C 4Z0BL 4LKXA 4JEGB 3VI4F 3RWJA 4ZPTA 1LO4L 3MA7A 3MJ7B 2DWDB 4JVPA 3ZHDA 4KVCH 2R1XB 5DEGA 1IKFL 2AXJA 2CKNA 2DF3A 2OK0H 3S37L 1U8NB 1BVKB 3VXRD 3C8KB 3AS3A 3NFPA 5ESAB 1OQXA 1KPVB 3SO5A 4F7PA 1BOGB 4G6ML 3UDWC 3QQ4B 4FQQB 4PJCA 2DQCH 4OCWL 5GGSA 3ROOA 5HVGB 3D85B 3RQ3A 2AK4E 3JVGC 1CFNA 1R6VA 3M17A 5HHOD 5J1SC 4HUKB 4XMPL 1CXKA 3FN9A 3G6AB 5C3LD 4PTUB 1IC5H 3MV8B 3ZE0E 5I6XC 1DE4A 2I9LA 4CN6A 1F3RB 2X09A 3PE9A 3CFKB 3QQNA 3NTCH 4KMTL 3NABL 4R4BB 3V4PH 4UTAH 4YFDB 1VENA 4GRWE 4YBQD 1GSMA 1KEGL 1JMZA 4MB5A 4QRRE 1U8JB 3PQYD 5I16A 1H15A 2DJSA 4FTVE 1HHGB 4M7JH 3PWNB 2P5EE 1CE1H 2DQGL 2HH0L 2NY7L 1K4DB 2ZKHL 3TO4B 1Y18A 3WJLC 2ED9A 4PRNA 4D9QD 4H8WH 4MQ7B 2NX5B 4LEOA 4PRAB 1A6VH 3Q1SL 1EEQA 5JDJA 2MPAH 3CPLB 3T4YA 3VMNA 5E8NA 3RWDA 3H7BA 4YFEA 2P8MA 3C8DA 1T7XA 32C2B 3TCLB 2W65B 5FKPB 4NKMA 15C8L 4LGRB 1ZA6A 3W9DB 3GBML 2DLFH 1IVLA 5JDSB 3ARBB 1I3RA 2YD3A 4Q9RH 3MRCB 4PRHA 5D93B 5E70A 3BKCL 3CSBA 1WIOA 2GTWA 1A6UH 3QXWA 3BUYA 2RIKA 1A7NL 3O0RL 3WUWG 4N1CA 5B4MC 1JV5A 1BQLH 3R0NA 3G9AB 1JPFA 4DAGL 2W1NA 5IT2H 1I8MA 2HMIC 1EJOL 4ERSH 1KNOB 1RV6X 1NCBH 4RAUB 3X3GL 3PGFL 1NBVL 2Y06H 3KHOA 4HKXB 5I17A 1CD9B 1MRFL 3WNKA 2JJUA 3UX9B 4YHYC 3NACL 4GO6B 3RWFA 4A6YA 2VSDA 4XNXL 2IH3B 1EMTL 2WBJD 5GS1A 1HOCB 3SPVB 3IJYB 1B4JH 1T2QH 1QSVA 2ITDA 3T0EA 3HC3H 1TETL 3ZKQD 2VQUA 4WHTA 3WIFA 1GGCL 2UZYB 2PN5A 4XVSL 4JZOB 1X6NA 5I8KH 3D25B 3MRQA 4H1LA 2R23B 4YDLB 3JV6A 3ARYA 3DUHA 4Z0BH 3MRLB 1C5DA 3GSVB 3BYTA 1ADQL 1T2XA 3AMLA 5EC2B 4HDIA 1LO4H 3K81A 4FFVD 4NOFA 1IKFH 3S37H 3BIKB 2LTQB 3IGAB 3QP3A 3B9AA 3BEWA 4LSPL 3QI9A 5EB9A 5FEBA 5I73C 4G6MH 1PBYA 4S11A 4I48A 4OCWH 3CMOL 3NFNA 3K4AA 2HJKB 3IDJB 3U0TB 5C2UB 4M93C 5D7JB 4PJHB 5J56B 1MQ8A 3AU1B 1MHPL 4M6ML 4PJIA 4XMPH 1M7DA 4HT1L 5IHUL 4GRMA 3B2VL 3O6LL 2OCFD 3PDOA 3LKOA 3U1SL 1DVFC 2VYRE 4ZTPL 4U1MA 2XQBL 4WTZG 4NYLB 3KPTA 3KPQA 1I4FB 5ACZA 4KMTH 3FRUA 3NABH 2AJSH 3K80A 1AGBB 1KEGH 4XPTL 3KPOB 2Q7NA 4N8CL 5HD8C 4GQ9H 3CX5J 1DANU 4P2OB 3TF7C 4AZ8A 4M8QB 3LD8C 2VO5A 4H26B 3U82B 4PJ9D 2YC1A 4HIHB 2J8UB 2DQGH 4OLXH 1F6AA 2HH0H 5JO5A 4JZJB 4HUNB 3ARQA 2ZKHH 4X6BB 1GJIA 4F2MB 1H3PL 4MD0A 1H3WM 1KGCD 3PL6D 3BPLB 4M4RA 5FM5M 4L8SB 3L7EA 5DVLA 2KZWA 3WIIH 4S1QH 1JL8A 4HKJA 4I2XE 3CSYB 5T1KD 4LASL 1NGQL 1NBZB 4RNRA 1N2RA 1ZLVH 1P5VA 1TVHA 4OZGB 3OAYK 4KQ4L 2PETA 3I6KB 5KANI 4OZFB 3FB5B 1FYHB 1PLGH 2XTJE 5KSBA 2W9LA 3ULVL 15C8H 2WINB 1OPGH 4Y2DD 4PJ5B 4O00A 1H0DA 3RVUC 1WICA 4OF0A 4QRPA 4BQ8A 3MNVA 5SWZB 3FT3A 1UKQA 3F7RA 3T0AA 3WFHB 5EO1B 1A7NH 3O0RH 4KUCF 2G2RB 3PWVA 4HK3N 4XAWL 4DAGH 1MJ8L 5HHME 5F21B 1EJOH 4X8JB 2ZCKL 5JHDB 4FFVC 5KVGL 3EGSB 3X3GH 3PGFH 3KYMB 1DQJA 2VZ1A 1MRFH 3NACH 2PCPA 4U6VL 1SVCP 3HHRB 1EMTH 3O3EA 4KMLB 2DJUA 5A2KH 1IJ9A 4WRLA 1BQHG 2VXSH 4YDVA 3DO3A 3ZE1E 1TETH 4PJDB 3QQ9D 1WJ3A 1GGCH 4XVSH 4BA8A 3SGJA 4BZYA 3LPGA 4OD2A 4G9DB 4QRRD 4WW2B 3PNWB 4GMTL 2XA8L 1ADQH 4FTVD 3RVTD 3BISA 4NDMA 1ZVSB 2IAMB 5FCSH 4OCRH 4OGAD 4G80B 3BVNB 4E41B 4LSPH 4QOKA 2MOVA 3MCKB 2H1PL 4PJ9C 4DEPB 4IOIB 3CMOH 4U1NB 4IS6B 1WCBA 4X6EA 4W81A 4XVTL 2AEIT 4U1LB 4AIXA 4XNZC 1AGCB 4HUUB 1NC2B 3H3BC 1MHPH 4M6MH 4OQTL 1V7MH 4L4VD 5D2LE 2IBZY 3DBXB 3OKOB 3BP4A 3BSZL 4HT1H 4JN1L 2W0FB 4MJIE 5IHUH 2DL2A 1LE9A 2FEEI 3AREA 1SHMA 4M6AA 4WJ5B 3B2VH 3O6LH 1FFNA 4Z7WA 4ZTPH 5FUOL 1JYVA 3MLWH 3F7VA 2PUQT 4WWKA 3P0VL 1G7JA 5SWSA 1WAAF 5D7IA 4MDJB 5CMAB 3VFWA 4XPTH 4PGEB 4N8CH 4QHKI 5ENWA 3HUJA 1AD9A 1XGPA 3U0WL 1XR9B 2C7UB 2V7HA 2J5LC 5D1QB 2AEWA 1A1MB 3UXFA 3EYVA 4R0LB 5CBAB 4WENB 4DVBA 2DLTA 1B2WL 1OTSD 3ELAT 1XZ0B 1H3PH 4JFXA 3A6CL 1JK8B 5I6XB 3FO2B 1JNLL 4JFYA 4ZUVB 3FQXB 3ZYZA 4Y1AE 4G6AC 1JCKA 3O2VL 4PJFB 3UPRA 4LASH 1UXSB 5CEXB 2BSSA 1NGQH 2X4NB 3N1MC 3UBXI 1WWAX 1NFDB 3IAQA 3FL7A 2DICA 1ZWIB 4KQ4H 5F1IB 3VXME 3B8YA 5L2KE 2DYPA 2HVJA 4KTYA 3ULVH 2CR3A 2ID5A 1NCNA 4PB9L 4YR6B 3ULUD 1PX4A 3SGEH 1DQQA 5MEPB 4LMQE 2NY1D 5ISZD 5IESL 3QUXD 3WUWB 3CK0L 1J9CT 2FB4L 3BQUA 1GZPB 3GBLA 2X4PA 3C6LD 3ES6B 3RWGB 1MJ8H 1Q9LB 1QQDB 2BNRA 5A2JH 4R2GD 2HKHL 4PLOB 5DJ0A 3MV7B 3EO0A 4LLQA 4LLWA 1FCCA 5CILH 2XTLA 3LQAC 4ZO9A 2AXFB 3UJTH 2Q86A 2X1PA 5BMFL 1S7SA 1OM3L 2RGSA 1U8KB 2KL6A 4LOUD 3VE0A 4RWHA 1BGXL 1JHTB 4PJEB 4QRPE 2C1PB 4KJQC 4PRIA 1R3HA 4L9LC 2XKNB 2CRMA 4GMTH 4DKDC 2VABA 3FQTA 1N0XL 4XTRC 5AZ2H 1KCRL 3UJJL 3VXRB 4LDOB 4YHYB 2I9TA 1PKQB 1NFKA 1I9RH 3KJ6L 3ALPA 1RURL 4KK9D 5FGBA 4Q7DA 2H1PH 2APWA 2B20A 2DMCA 4Y19A 5J06A 1IAII 1HINL 5HHOB 4IRZL 2B4CC 4NZTL 4XVTH 3RZWA 3V52L 1T1ZA 2Y5TA 1OTSC 2HT3C 4HH8A 5IEHB 4OQTH 5MEOB 1NGWB 4YJZL 4JN1H 3BSZH 1AQDA 4UDTA 5EO9A 1LNUA 1LEIA 4LNRA 3QUYC 5IMLA 1BX2B 2XTJD 4Z7UB 4DZ8A 5FUOH 4K94C 2R2HA 4G9FE 1I8KB 4PS4H 4IMKA 4NFCA 1Q0XL 2VXUL 4QOKE 1VPOL 1UKSA 4U2ZA 4M93B 2VXTH 3QDMA 4X0KA 2DQDL 4ODVL 4OM0L 1AY1L 3MR9B 4X7CC 1AHWC 2CDFB 4PJ7E 5HHMD 4PJGB 4YE4L 5HDBF 5D6DC 1N7MH 1B2WH 5IJKC 4D8PB 2NY1C 5BVPH 2FEDC 4U6XB 2OJEB 5KSVA 1TITA 1MHHB 3A0OA 1JNLH 5SWQA 1J0YA 1KN4L 3G08A 1M7IA 3IETB 1HHIA 3O2VH 4JO2L 5JIIA 4S1DD 4O02L 5FYJD 1JWMA 4OCSL 3GMQB 1YZZA 5F8RC 3TBYA 3LD8B 4O2FB 2QJDA 2R8SL 4PRHD 5F7MC 1K5NB 3HUJE 4Q58C 3B5GA 4C55A 4BSVA 3VMOA 3L6FA 1BD2A 2VQ1B 4PB9H 1DBKL 2F54E 4FQCH 4GKZA 4LOUC 2V17L 3LKQA 4PG9B 1TTUA 1EO7A 4HIIA 3T08A 5FO9B 3LKRA 1FL6B 4MQTB 1S9XB 3VXNA 4LPCA 1S7QA 1FNFA 2GJZB 5JPMB 1QBLL 2HKHH 3GMMA 3T0ED 1INEH 4LSUL 2BX5A 2AJ3B 3QZWG 4PUBL 1K8DA 4LLUB 3MXWL 4L4TA 5I1GL 2WBJB 3BPNC 3L3OA 1CGUA 1D5XA 2EC8A 3OKNB 5JUEL 4KK9C 1NBYB 4OF3A 3TVMA 1QPPA 5GGUB 5B38B 1FGNL 4LPWA 3RX8A 4L8CB 3TNNA 3UYOD 3PDDA 2YN3A 4LQ1A 1BQHB 1YEDA 2VTFA 1ORQB 3RY6A 1Q1JL 3SGDI 3B9KA 1BGXH 1X4XA 4DFIA 2PKDA 2Z35A 3VU2A 2AJXL 3K7UA 4CVZB 2OP4L 25C8L 2YBRB 4AT6B 4F9LA 2C1OA 3QI9D 2IADA 4D9RD 5F6IC 1AGDB 1KCRH 4XH2B 4JFEE 3UJJH 1JJUA 4CAGA 3QPXL 3CVHL 4X7FC 3X13B 1QFUL 4HMDA 2EE2A 1KELL 1KN2L 3KJ6H 3T2OA 1SEQL 3DVGA 2XZCL 3ZKND 1RURH 3TN0C 5GQBA 5F72S 2BVEA 1HDMA 1I8IB 2HAZA 4GAYA 1BEYL 2FX9L 4NGHH 3P2TA 2JCCA 5ALBL 1HINH 4IRZH 2Q1EA 3DARA 3V52H 4J6RH 1FORL 3QJFB 5A3IC 3ARWA 3GGWA 4PRIE 4LVOC 4AEHL 3DI2B 3IDNB 3CVHB 4XHJD 2EIZA 3ESUF 3EFFB 5C71A 5FYKE 5J6GB 2CIKA 5EWIL 4TVSa 3P4NA 2Y1VA 1Q0XH 5E08L 4PJ9B 2VXUH 5DJ8A 4F3FB 4XCCL 4ZUWB 3VXOB 1VPOH 4AQ1B 5DZOA 1WFTA 4LIQL 5BOZG 4ODVH 1I7ZA 3QUML 1AY1H 1KT2B 3HC0A 4XNZB 1HNFA 4YNYB 4ENED 4HMCA 1OLZA 5CFHA 3L5IA 4YE4H 1DANT 3GSNL 2FZ3B 1CDBA 3EAKA 5JHLH 3UTSA 4PV8A 1FNGA 4QXTA 4GAJL 2HFFB 4DUWA 1KN4H 3T2PA 3FFCE 4GKSB 5GRJL 3HN3A 4WI5A 1M05B 1VSCA 4JO2H 2H2PD 1TLKA 5HYSA 4O02H 3T0EC 2AJZB 1IZKA 5GGTL 3QUMB 1NC4A 2R8SH 4QRPD 2W38A 2J5LB 1DEEB 4OLUL 2Z91B 1FAIL 4Y2DB 5HJ3A 4L3CA 2LU7A 3LQZA 4RFOL 1EO8L 3GSNB 2N56A 4XGZB 3QUZA 5IM7A 1FZKA 2V17H 4H0HB 4ZSOA 7CGTA 5J9PA 4KGJA 4LHUA 1OGAE 4ZFGL 3VRJB 3Q2CA 4FS0A 4X4YA 1NGYB 5DK0A 3BYYA 2DM4A 2IH1B 3QWRD 1PDKA 1AI1L 4I0PA 5CIPH 3UTTA 1QBLH 4P2QA 1N6QL 4JY6B 4PRDB 3GJFA 3S3SA 1MRDL 2G9HA 2YEZA 1EHAA 4H1LG 4JRXB 4LSUH 4PUBH 3PXHA 2R9HC 3MXWH 5I1GH 2R4RL 1BREA 1J18A 1GVIA 3R8QA 4EJ1C 5JUEH 5FF6B 1TQCC 3GDBA 5DJ2A 5EBMA 3ILPB 1FGNH 3DIFA 1QHPA 2DJ4A 4FQIH 4Q6IC 1BD2E 3QULA 2XXCB 5DDHA 1IL1B 4TNWK 2ICWJ 5EZOL 5E1AB 2NW3B 4GRWB 5FECB 1PG7H 3OXSB 4JO4H 1Q1JH 3BRFA 3L7FA 4QRRB 4GKNA 5FDWA 5JMRA 4OKVB 1C7SA 2AJXH 1A7BA 3TIEB 2OP4H 4FTVB 3MGTA 25C8H 2MQ3A 4QOKD 3TO2A 4MVBD 4QXGL 4XHJC 3EYOB 3OB8A 4WI4A 4R8WL 1NAMB 2CJUL 3Q5YA 4HWBL 4O9HL 4QXWA 1BHGA 3TBSA 4NNYB 3QPXH 1NAKL 3CVHH 2BXZA 5DJYB 1QFUH 3GJFK 5E5UB 3MV9E 5DGRA 3OMZA 1G7HA 1P69B 4RGMC 3QQ3B 1KELH 1KN2H 4L4TE 2CUMA 2XZCH 1A6TA 2A6IB 3ARED 5LAXB 2FX9H 3SKUD 4I4WB 2UVFA 1PX3A 5ALBH 4WCYL 5MHSD 4L4VB 2KDGA 4WWKD 4L9LB 5SWSD 1FORH 1U8IB 3DETC 1MCDA 4QT5A 1WBZB 2K3TA 4AEHH 4LBEB 5HXMA 2ZSWA 1MCEA 3L3KB 2BDNL 4CU8A 3VGFA 3S37X 4RFEA 2H2PC 5EWIH 4R26L 4NT6A 2RJMA 4J1UA 4XCCH 3TFKD 2XWJB 4HS6B 1JYWA 4FP8H 4LIQH 3MUGB 3QUMH 5CHNA 4YH6A 5F7YC 4JJ5B 2JCCE 1NGZB 3ULUL 4WHYG 1A14L 1H8OA 3MCLL 3GSNH 3A67L 2YUXA 3O6FC 4Q9BA 2F8XC 4LCIL 5L7XL 4HCRA 4GAJH 1FG2A 2FJFB 2DYPD 2V5RA 3WEXA 1I1FA 4PGCA 3WKNA 5GRJH 4D0BA 3KHQA 3DRTB 5KG9B 4NUGL 2W07A 4QYOA