2C1PA

Fab-fragment of enantioselective antibody complexed with finrozole
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
217
structure length
217
Chain Sequence
ELVMTQSPLTLSVTIGQPASISCKSSQSLLYSNGKTYLNWLLQRPGQSPKRLIYLVSKLDSGDPDRFTGSGSGTDFTLKISRVEAEDLGIYYCVQGSHFPPTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGK-C PROTEIN
publication title Crystal Structures of an Enantioselective Fab-Fragment in Free and Complex Forms.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 51
structure length 217
sequence length 217
chains with identical sequence L
ec nomenclature
pdb deposition date 2005-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2c1pA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2c1pA01
3U7YH 1U8KB 5CJOL 4P59H 3NFSH 2VISB 3QRFM 2BFVL 4IMLB 3ECBB 5BVPL 5EOCH 4QHNB 5HDBE 4Q0XH 3WS3B 5ENWB 4R90H 1FL3B 3DTXA 1MREH 2XQBL 3SKOA 3LSOA 1ITBB 4NO2B 5LG1A 3AS0A 1JF6A 4ZTPL 3RL2B 3WE6B 5IBUG 2MCPL 2YEZA 4NQTA 4A2MA 3D69A 4OLUL 1AI1L 4NFDA 2AQ1A 4X99A 5DZLA 1N26A 3O3UN 1PG7W 3U30C 5MP6H 2DWEA 1VSCA 4WU7A 1JPTL 4HS6A 3DUUA 4PJ9D 4Y2DB 5ISZB 2R0LH 2DBJA 1OTUD 3RIFF 1TZGH 3LEXA 4KZDL 1ZLWH 4U7KA 1BZQK 1SJXA 3D3VA 4TSCL 2EO1A 3QNYA 3KYAA 3EYUL 4GBXA 1KEMH 2FGWH 2FJHA 4NJAH 5EZIL 3WO4C 3RPIB 1R6VA 4JFHD 5F88A 4ZSOE 3B9KC 5JZ7D 1V7NH 4F15B 2CDGA 3UTTD 1U6AH 3NN8A 4LCUA 1OWRM 1C08B 1FGNH 1JWSB 3T1WA 5J6HB 2Q86A 3CIQA 1CXIA 5D5ME 2BC4A 4PR5A 4X4MA 1A8JH 4EVNB 4OZHA 1N3NA 3TJHD 1MFAL 1CL7L 3DX6A 1WAAF 1XGPB 3WL9B 3BQUD 4X0KA 3RY4A 3T1FA 3P0VH 1S7WA 4RAVB 2OZ4H 1IGFH 2F15A 4R7NA 3U9UB 3GSXB 2MKLC 3VRIB 5B8CA 1PBYA 1SY6L 4QRRD 5GZOC 3OKYA 4GG6A 1ORQB 5GRUL 2IF7A 3SDAA 1DVFA 1ADQH 2HVJA 3O0RH 2L7UA 2WUCH 5FO9A 3SCMB 1KCSL 1G7QB 3MFFA 3MRRA 4HFWA 5CSZB 5JOFA 1MIML 3TN0D 4U33A 4I48A 3X11A 1JPST 4N0UE 1HIML 4G6JL 1KLUA 2OMBA 4MZ2A 3C6LB 2VZVA 4YHLL 2K7QA 2PCPB 4E41E 5IMLA 2O61A 4IMKA 2OJEB 1F4AA 2EDXA 2NXYB 3QPXH 4LEOA 1T3FA 5EBMB 1HQ4B 3V5KA 3HZYA 3MLRL 4TNVF 3TYFA 4IRJC 1JFQH 4PJEA 5EUOE 5ILTL 3TPUA 4WW2A 4YC2C 1G9NH 2PW2B 4NUGH 4U2ZA 4MZ3A 5J12C 1A14H 3RNKA 3IFLL 1EEZB 3T0VA 2VDMH 4H5SB 5KOVC 3IFOB 3W0WA 3R1GH 4JPVH 3MOBH 1MFNA 3TBWB 3TZVA 1LO2H 4MQXD 4DVRH 1C7TA 2G2RB 5B3JE 3WFHB 4CVZA 4YFDB 2A83B 4QHLA 2H6PB 3S5LB 2XNAA 4LASL 3LQZB 1CTOA 2NW2A 3CX2A 3DVIA 3L5HA 1MVUA 4JFFB 3P77B 3DVFA 5KJRL 3EYVB 5DGRA 3MQIA 2VLJD 4M43L 1JI1A 2MWCA 4LEXL 3IAGC 3L3HA 1P6AB 5JHDA 3OKMB 5C2BL 4MXQC 5GGRA 4JO4L 4GLRI 3ZYZA 4RMTA 2IC2A 3OB0K 2D3VA 4K7PY 5CMAA 3O9WD 5DJ0B 1JWUA 5FGRA 2VC2L 4HUUA 4EUPH 3M45A 3T8XB 1EJOH 2YN5A 1CS6A 4PRPB 2XT1B 1U93A 1DN0B 2AJZB 4DN4H 1E6OL 3S4SG 4OV5A 4F9PA 5C0JA 2IAMB 1CGWA 4ZDHA 1Z3GH 4FQCH 2HT2D 5EC2A 4WJ5A 3BAEH 1CD0A 3PGDA 4NNYA 4JB9L 3NVQA 1UKTA 3U9PL 4LLYB 4PJ8B 3UJTH 1NDMA 1NLDH 2H8PB 3MRFA 4NDMB 4QRPD 1ZSDB 2HRPH 3PWPD 3CD4A 4GAFB 2HG5B 4NQDA 2ZUSA 2DQEH 3OJDB 5F1NB 2C7UB 3LKQA 5BRZE 2FECI 3VXRB 1U3JA 4YHKL 5JOPD 1MHHB 1UJ3A 2FJGA 4AIOA 2Y72A 2VLKE 3CSYA 5F9AC 5H37H 4C56D 1R3HB 4JZOA 4B7IA 4AY0A 4M1GL 5C09B 3T0BA 4ZOCA 4K2UL 1YEEH 5FYJL 5C0CB 1TZHB 2AGJL 3PV6A 4QOKA 3V4VH 2XG4A 5JXAL 2CUIA 1CBVH 4NKIL 5DD0H 3MOQA 4O2CA 5JIHA 4PB0L 4U3CA 3AY4C 1MIEH 2CLVB 4XCYA 3ZMRA 2CLZA 4R96B 5F1KC 2PXYD 4KDVA 4JO1H 4XPAH 3RNQA 4NRXB 1N7MH 3VWJC 3U1SH 1OW0C 4RMUA 1I3GL 4G3YL 4UDTA 1TCRB 4WEUD 4H0HB 2DKSA 4KKAC 1ZLUK 3SY0B 3VXPA 4MD5A 1X5XA 3WHE0 5KW9L 3WUWB 3KPRB 5MI0B 1G6RB 3KYMB 1P84K 3EYFB 1B90A 1QLFA 2QQLH 1PEZA 5C0IA 4WI2A 5DMJB 3OKOA 1LD9B 2J88L 4OFVA 4PJIE 4MA7H 4KI5D 4E42A 2O5XH 5DYOB 3H2WA 2WUBH 3LKPA 1FG2A 1FAIH 5EU6E 2FSEB 3QG6A 4JHWH 3I9GH 4ZUVB 1S7XB 4KKBD 5F3HA 3ECBA 3UYRH 2R23A 3D3VD 4F57L 4M93B 3GBML 3FMGH 1FZMB 2EH8L 1DBAL 3ARSA 4FP8L 3T2OA 4BUGA 3HRPA 1I1AC 3TBTB 1FNSH 2YUXA 4NO2A 4OKDA 4U1MB 3RWCB 4P57B 4L5FL 3G6JA 4OGAC 3WE6A 4F3FA 1YC7A 1DQTA 2W38A 3EOBB 4OFIA 2AKRA 3GSNL 4JQXA 1WWAX 3E8UH 4MVBD 4NWUH 4Y5XC 1U42A 3ULSB 5HHOB 4Y2DA 3QDGB 3N1PC 4UIMB 4JN1L 3L3IA 4AYFA 4IM8A 3KYNA 4JDVB 1ZVSB 2EH7L 2BNUB 4ZOEA 5TF1L 4PB9H 4J4PA 4ZQKB 1PQZB 2VDNH 3P4MA 4LKXA 4D9LL 4LIQL 1SEBB 1JZ7A 1I8KB 2YXMA 5MERA 3SDAD 1XCQA 4XZUB 2DL2A 2ZPKL 3CFEB 2R4SL 4P2OB 4L9DA 3RA7H 2IANE 1M6OA 3DXAE 2HJFB 2BVPA 3T2NL 4WWID 2DQHH 5IUSA 3EDDA 4LCWB 3P9MB 1NCWH 5D7IF 5J6HA 2AEIT 4KVNH 3E6FB 3Q5YA 3W2DL 4PRDA 4O00A 1ZOXA 1JGLH 1XGPA 3JXAA 3CJJA 2RCSH 4RAUB 1N64H 4FZ8H 2IQ9H 3HB3D 3VRIA 4P46B 4KC3B 3W0WD 2E27L 1ORQA 1BBJB 4FFZL 4F58H 3TZVD 4YR6B 5EA0L 3IKCB 2CRIA 1FRGL 5F8RC 1SEQH 5BO1L 1G7QA 2X4TB 4PRIE 1BZ9A 2GIYA 3R0MA 5CSZA 3KJ6H 3OG6B 5DHYB 2CUHA 2QHRL 4PJGE 3DYPA 4PYGA 1II4E 2GAZB 2X4UB 1R24B 1BF8A 4AMKH 1E4WL 3SDXF 2YMXL 2OJEA 4YDIL 4PRAB 3P4NB 1JHKL 1HQ4A 1A9EB 2VE6B 5JHDD 4NQCB 2NLJB 4LPYA 4X9GA 1ORSA 1QG3A 4FZEL 2OTPA 2PW2A 3Q6FA 3P4OB 2LVEA 1N0LA 3SGKA 1NCDH 5L7XH 3O3DB 4J8RB 3MA7B 1K6QH 4H26A 4H88H 1FO0B 4NC1C 3TBWA 1WZ1L 2G2RA 5SWZB 3WIIL 3WFHA 1QBAA 3GSWB 3B8YA 2C3WA 1JHLL 1JGEB 2WWKT 2A83A 3VGFA 3QNZB 5AZ2L 4CMHC 2NYYD 1O7VA 1YEGL 3LQZA 4YUEL 3QZWB 3VWKB 4YXLL 3Q6GL 4JFFA 3P77A 5FKAA 4OCYL 5FCUL 1YNKL 1EMTL 3D39E 3NCYP 4H8WL 3EYVA 4GAYA 3AU1B 1B0RA 3VH8G 1MFCL 4P4KC 5ID0A 2CKBL 1EFXB 4E0RA 4HAGA 4NQEB 2D7NA 4HWUA 4U6HA 1EGJH 5J7CC 4NQDD 2GJ6E 4WW1B 1OSPL 1QA9A 4MNGB 3V9FA 3WN5B 4GO6B 1HH9B 4JFDE 4LSRH 4NCC2 2YZ1A 5DJ0A 2ATPB 3MRNA 2MCG1 3T8XA 3NGBC 4GJTB 3DSFL 4NKDB 5HHMB 4MCZB 1DN0A 1I7RB 2AJZA 2Y06H 2JB5L 3H9SE 3U4BH 5HI4C 3TGXA 2FX7H 2QQQA 3F12B 3LZFH 1MF2H 2H1PL 4QOKD 1IGYB 2IAMA 4NO3A 3MGTA 1FH5H 1UB5A 1FPTL 1LDPL 3LQMA 3NH7L 3HS0A 4LLYA 4OCSL 3D18A 2H8PA 4AM0A 4CUCA 3AREB 4LL9A 3HNTH 1LK2B 4FTVA 1BFVH 4BK4A 3IDUA 3FL7A 2FNBA 3PJSB 4XTRD 1B3JA 1PY4A 3EDJA 5F1NA 1H3VA 4XP5H 4K3HA 2C7UA 1A1MB 1MRDH 2I60H 4C55A 3VJ6A 4JZJB 1WV7T 2B7DT 4LRIC 4WRLA 3NFNB 3VXRA 3HC4L 5K9OB 1WCBB 5ELIA 3MYJA 4JKPH 1IAMA 2C3VB 4TRPL 4NFCA 5T5FL 3VXTA 1KCRH 4AG4L 1YY8B 5C09A 5ESVB 3QEQA 1Y6KR 2ERJC 4XNUL 3HE7C 4AT6B 5C0CA 1ACZA 3MJ9H 3HG1D 3QIWB 5EPMB 3RVUC 2DIAA 3KLAB 1VKXA 3ZYIA 2MPAH 3DGGB 1IARB 1RZ8B 3S36L 5D1ZB 5EU7E 4EBQH 4K3JL 2P5WE 3B83A 4R96A 3ORJA 5C0AE 5I1EL 1IFHL 4XCFL 4FQ1L 3OAUH 3ULUE 4JANB 2OCFD 5ID1A 3ZZ1A 1WC7B 2RGSA 1KENH 4LFHG 4OD2B 1I3RA 5EIQA 1NCCH 2X4SB 4FXLA 2NCMA 1FG9C 3KPRA 2W60B 3DWTA 4OQTH 5E2VL 1FSKC 1OPGH 2QSQA 4IIQB 5TJWK 2XZCH 1NBVL 4P5TC 4WFHD 4FQ2L 4ENED 5FOJA 4NSKB 3J7HA 5CGYC 4GSDL 4AEEA 3ARXA 5DYOA 1KIQA 3DVGB 5EO0B 1JZ6A 3FB8B 3BIKB 3BWAB 3QIBB 2DBLL 1G9ML 4JDZB 4Y2DD 3GZKA 5E6IA 2IBBA 3WS6C 1ADQA 2N56A 1NCBH 4OSUL 5DGQA 1FLRH 5D72H 4XBGB 3FO9B 3FFCA 2WM0A 3EHBD 3IETB 4J4PD 5C6TL 3QP3A 2UWEA 4YHZL 2DYPA 1OM3L 2CMRH 1RU9H 4KFZC 3E2HC 2JE8A 3TBTA 4HUXB 1IBGH 4P57A 2EDNA 4JM2C 4X7TB 3OL2A 3WMSA 4HS8H 2Z4QB 2B1HH 2ED7A 3AS3A 3EOBA 4F7TB 5D7IB 1UWXH 4Y4KA 4EKXA 3GBNH 1G9EA 3CU7A 1MCEA 4O4YH 4PLKC 3CAFA 4PJHE 5I74C 4TVPD 1Q0YL 1WAAA 4UIMA 3L3KA 3EFDH 3M8OH 4MJIB 3QCTH 4FN0A 3WJJA 2BNUA 4DFIA 3HC3L 1PQZA 1D6EB 3FN3A 4R26L 1SEBA 2R0KL 1SQ2N 4O51A 3LVEA 4DZ8A 1A9BB 1I8KA 3MACL 3MLUL 4UMGA 1W72L 4HK3N 1UM6H 4XZUA 3BEWB 1J12A 4G6AC 4XHJD 1IAIL 5D5MB 1VFOA 1RHHA 2LQRA 5J9PA 2M8XA 2Y07L 4OCRL 1TDQA 3OHXA 4I0PC 2BMKB 1I8MA 1IGJA 4LCWA 4XCCL 5IB2B 1UZ8A 5J06A 4X7DC 3P9MA 1VPOL 3BRDA 4YFLF 4RGMB 3SKMA 1UWEH 1IM9A 2ZZUT 2NXYD 3SDXB 3E6FA 3LD8C 5IJVA 4LSQL 3LMJL 4GAJH 3CMOL 4RAUA 5FF6B 2NX5A 2VZTA 4IRZL 1GIGL 2RFXA 5EU3B 2J1KA 3QUZB 3VI3E 1FL6A 4ZFGL 5ESQB 4HLZG 4P46A 2FECL 4LSPH 1LDSA 2NY6C 4YR6A 3SKUD 3IKCA 2E3VA 4JKLA 3HC0A 4WHTB 3PGFL 1AFVH 5DHYA 3LB6C 1J0JA 1MJUL 3QJHA 2FRGP 4JFFD 1RZ7L 1KF9B 1Q1JH 4G8FB 5C0FA 1NEZG 1P7KA 2WP3T 15C8H 4PRAA 3C6SB 2AV7B 2VE6A 4QHKJ 1WIOA 2NLJA 1DDHB 5BV7H 5KSBA 3DV6B 1U58A 2B8OT 3WV0A 1I1CA 1RUPL 1IT9H 4K8RD 4LK4A 3QWRA 4OZGF 4PG2C 3A6OA 3HR5B 1FO0A 1ZANH 3UJJL 5KVDL 3CK0L 2R0ZH 3AVEA 1JGEA 3MRLB 4AEIH 5ALBL 2IAMD 4L4JA 4OCWL 4JO2H 2XYCA 3QZWA 3VWKA 3LAFA 5CSGA 4WI4A 3CVHL 3G5XA 4GLRH 3TF7C 2WK2A 5KSVB 1KGCD 4YK4C 3WSQH 4MA1C 1WBYB 4FTVD 4F7EA 1EFXA 1JGUL 5ICYB 1HSAA 3PWVB 4NQEA 2AK1H 4HPYH 4JO3L 5FUOL 2FL5B 1U8LB 4G7YL 4MNGA 3OJ2C 1U8PA 3VXRD 1A6VL 3EZ8A 3MLTB 4I9WE 5D71L 4ODBD 4LLMB 3TLRA 3HNVH 2BK8A 2VKWA 5C0EB 2VN4A 1ZT1B 1A7QL 1KTLB 3O4OB 4JRWA 4KV5E 1I7RA 3IDGB 5C09D 1I7ZB 1OAQL 1CXFA 4XC1L 3QEQD 2NY2D 5C0CD 1IGYA 3GJFB 5BZWB 3U36B 3CFDB 4Z7OE 1WWBX 2EZ0C 4UNUA 5I75C 3VXQA 5BCAA 3HUJF 1K5NB 2DQCL 2HJKB 4HGWA 2FBOJ 2R1YA 2MQCA 2Y9RT 3MCKB 3QI9D 3WXWL 3QPQC 4KTDL 5HYQA 1G7MB 5C1MB 5CJ5A 1AGBB 5DRNA 1BX2B 2AQ3A 3K7UA 2YOCA 3VCLB 2GUOB 1Z0MA 25C8H 3GM0A 4JZJA 4P23C 4LHUB 3FONB 5K9OA 4PJBE 1WCBA 1P4BH 2AEPL 4WTWA 5IF0B 2C3VA 3DRQA 5LCVL 2MQ0A 4MWFB 2UZYB 3UO1H 1OAUH 3L3JB 5FO8A 1WIUA 1YY8A 2FATL 2X1PA 4AT6A 1QSFB 5E6ID 1XMWA 5TQ0L 4RDQF 2Q1EA 1G84A 3QIWA 2XWJA 1KELH 5DS8B 1HILB 3FFCD 1NC4A 1VFAB 1RZ8A 2DYPD 1BFSA 5D1ZA 3GI8L 3ARBC 4U7MA 4HWBH 5K9JL 3QXVA 3CX5K 3SBWA 3TJEL 3REVA 1C5DB 4OD2A 4JRYE 1OAKH 5MENA 4GOSA 4ONFL 1OTSD 3MRJB 2X4SA 4BELD 5LWYL 2EYSB 1DBML 4RIRB 1A3RH 1ONQB 4HJ0D 5DT1H 2ATKB 2OL3H 4M6AA 2RBLA 1QBMH 3WIHL 3BISA 4ONGL 2DLFL 1S5IH 4Y4KD 5CFHA 4PRHB 3THMH 3DVGA 5EO0A 1QQDA 3U30B 3BIKA 3QIBA 4JDZA 4RSVA 1YN6A 3D9AH 3B4NA 3FB5B 3QUYD 3FQXB 2BSTB 1KB9J 3WBDA 5IHUH 4KRPB 4OCLC 1C5CH 5C92A 3CSGA 3RWFB 4RZCB 4NCDA 5J13B 2VDPL 4BUHA 2B0SL 4UB0H 5FA4B 5EZJB 3RIAF 2CDEB 1WBXB 3MLVL 4HUXA 3HZVA 5DLML 3BKJH 3MRHB 3E3QE 4M62L 2WLZA 4X7TA 1YA5A 3WO4B 4AZ8A 4CDHA 4LCWD 4DZBA 5JMRA 1HKLH 2B4CH 2Z4QA 3S34H 4YEFA 3MGOB 1JBJA 4KI1A 43CAB 3B9KB 5IQ9B 1F3DH 5HYSB 3ZKMC 4NHCH 5FUZH 4F7TA 5D7IA 4TULL 2FZ3A 1IM9D 2HWZL 1J1XH 4PG9A 1I1YA 4XVJL 1SM3L 3B3IB 3ZHDA 1R3IL 2C1PB 4HLJA 2IANB 2NX5D 4ZFOA 1JNJA 4XP1H 1ZXQA 3QUKB 2GTZB 2DS4A 5IJKA 4ZSOA 4MJIA 4RGND 1T2QL 5HI3C 3V5HB 1WISA 4UT6H 3ULUH 2JJSC 2V17H 4HFUH 2FEEI 4FQLL 1D6EA 4P46D 4QRQB 4XWOC 3UEZA 4YAQB 1UM5H 5FHBH 4M9PA 4KDTA 4HUVB 2IEPA 3BEWA 4N90D 5AWNH 2G75B 5HDOA 2Z92B 1A7RL 5D5MA 1LP9E 3BESR 3IDMB 3K46A 2ARWA 2D2OA 3N1MC 2C3HA 2BMKA 3QAZB 2Y25A 3BDYH 3ZTJG 4XXDA 2P5EE 2P49B 4WUUE 2ESVE 4M5YH 4J3TA 2OMNA 2DLHA 4O5LL 4LCYB 5IB3B 1N8ZB 1ZHBB 2D7TL 4NC2B 1H8SA 5INCB 4XWGH 3UPRA 4HBCH 4XVTL 4CU7A 1T7XA 1YN7B 2V2WA 1F58L 2W9LA 2F8XC 4PRIB 5FF6A 4LMQE 1WJ3A 1P9MA 1F4XH 1UWGL 4PJGB 1CF8L 4PJAE 4IRJB 1T1YB 4X9BA 4YC2B 3OB0H 3QWRD 2BNQB 3K0WA 4MA8H 2PR4H 1PYWA 4QHUB 4OZGB 5J12B 4E41A 1MPAH 4Z7NE 2J5LB 3C8KB 3KYKL 1X5LA 3DV4B 3IJYB 5FYJE 3X14A 2APFA 3BP7B 3VGHA 1U3HA 3DNKA 4J7RA 5KSAC 4WHTA 1NCAL 5EUOA 5GGTH 5F8QC 5ERWB 3EKCA 2DJ4A 1XGQB 3VWKD 4R4ND 2VDQH 1P7QB 5E2UH 4X9HA 1JZ2A 1HSBB 1GYAA 2F5AH 1CGVA 2D31B 5E8DL 5GSRA 2VQ1A 4S1DD 1S3KH 4TPRH 1R0AH 5CHNB 4LU5H 1CVRA 1IAOB 2X89A 2VIRB 1DDHA 4KUCD 5C0BE 1E4XH 3NACL 1RVFL 4OLYH 3SJVE 1U92A 4KTYA 4FRWA 1B0GA 4NKOA 1Q9WB 2A74A 4JY6A 3BGMB 4D0BB 1DQLH 5D2LE 1GGIL 1UB6B 1MAML 5I1CL 2V9RA 2WANA 3MJ9A 1L6XA 1NSNH 1QNZL 5E2WH 3OKLB 1QVOB 5K9KB 3LS4H 1MJ8L 5M94B 3BJLA 1A7PH 4QWWD 3JTTA 2HT4C 3CFIC 3GMMA 3MRLA 4R0LA 2GJ6B 1Q9LA 3GRWL 1OGAD 5T3XL 2VDOH 4ZODA 3GHEL 1SVCP 1N0XL 3TVMC 1KJ3L 3HUJB 4J6RL 2HLFC 2BXZA 1RULH 5KSVA 4EIZC 5ETUB 1K9TA 4KMQA 1WBYA 3D6GA 4L1DA 5D1QC 1ZV5A 1H3PL 3PWVA 4OQTA 1INEH 3H9SB 4H25B 2AJ3B 5CD3B 3EDKA 4M7ZC 1ZLUH 4UU9B 3AMLA 3RX5A 2E5EA 3QXWA 1MY7A 5C3LD 3MLTA 4WWKC 1Y18A 4LLMA 5C0EA 2Z31C 4MJ6B 1T4KB 1PZ5B 3WNLA 1KTLA 3GSVB 1K8IA 3R8BB 2CUMA 4QGTA 1J86A 4OF5A 5EORL 5IB1B 1I7ZA 3ELAT 5BJTA 2Y23A 2F58L 5EO1A 1TXKA 4JPWL 3ISWA 4GKSB 3CFDA 2YRLA 3QIWD 3QUMB 4HC1L 4PJXF 4XVUC 5BRZA 2HJKA 1NC4D 3RZCC 4XH2A 5HI5C 1FAKT 1KJVB 3H0TB 4OF6A 1KJMA 5D1ZD 3MCKA 4JDTH 2VOTA 4IDLA 5CD5D 4OZFB 1N59A 1SJHA 4MQ7B 1AGBA 1U2HA 1BX2A 1IGCH 5GS1C 4DGVH 2NXZB 2BRRH 2VERN 3UTSD 3JWOL 3O3BB 5MEND 1M05A 3VCLA 4F33B 2GUOA 1C12A 2BHUA 4MJ5A 1HN1A 5KN5A 4Q9QL 1J0HA 3RQ3A 4TNWK 2AABL 2ZKHL 5IF0A 4HJGA 5TDNB 4AL8H 1AR2A 2P5WB 1KTKE 1KT2A 1CDYA 3A0OA 4IHOA 5C0AB 3L5JA 3L3JA 3LQAL 3WFEL 3B2UC 3QIBD 1UZ6E 3GMQB 4ALAH 2BY0A 4XCEA 1IRAY 4YDLC 1V7ML 5DS8A 1HILA 3I6LE 1TVDA 1KCKA 4GS7C 2GSIB 4LNRB 2H3NB 1LO4L 3BW9B 3RY6A 1FQ9C 5HHPB 3PDOB 2B2XH 4OLUH 4PJIA 3KPSB 5F1IB 2VLME 4ODSH 4ODTH 1I1AB 3MRJA 5I1KL 3V6BR 3WJLA 3T0DA 3BH8B 2FD6L 2AS5M 3RX8A 1MNUL 1NUGA 2ATKA 1XGRB 2QADB 3NMEA 2DM3A 5IMKB 3UBXG 3MC0A 5I8EB 2NY7L 2C3XA 3VXME 1EBAA 3ZDYE 5ADPL 2CLRA 5E8PB 3F7YA 3GDBA 5F7FA 3EYUH 1KSRA 4RQQA 5DJ8A 4MJID 3FQXA 4QF1B 3EO9L 4YHNB 3VFPA 3ZDZF 2AI0H 4OAWA 1DBJH 4UOW1 5B38G 2VLRE 4UT7L 4ZS7H 2R9HD 2X4PA 3GMOA 1IEAB 3MBEC 4N0FB 5L88H 2XRAH 5FA4A 3V4PL 1WBXA 3RVXC 4Q6IC 1NLBL 4PV9A 3P11L 4UV7L 4DN3L 4NQUA 2OSLB 3NTCH 3BVNA 2AJXL 3GK8H 1MFAH 4JM2F 4OFPA 3G08A 3MGOA 1YMME 5CJQH 4HGMA 1E0OB 3PWLB 5B4MD 3TO4C 5IOPA 3GSQB 2CJUL 2EIDA 5DO2C 2P7TB 3HLAA 4OIBA 3TNNA 3RL1B 2PYEB 3B3IA 3VGEA 4ONHB 4HULB 4S2SB 2C1PA 2IANA 6FABH 3DXAA 1RMFL 3QUKA 4QXTA 4YO0B 1AJ7L 3O6LH 4XPBH 1KCSH 4EOWH 3EJJX 4OB5H 5A3ID 4TSBL 3QHZL 4QRQA 3VMPA 3V7MA 4E41D 5DF0A 4PY8I 3SOBH 5C08E 2Z92A 4K7PL 2FHBA 5F96H 1U3HD 5J3HC 4JFXB 1N2RA 5KZCD 3IDMA 1JNLL 3UBXI 2XTJB 2R2BB 1I8IA 5F7HA 4QRUA 5IB3A 4KH2A 3JZ7A 4PGBA 5INCA 4BA8A 4ZFFB 3HAEG 4TUOA 1TQBC 2GITB 1FYHB 4PRIA 3SQOL 4BFEA 4PJGA 3JBG7 7FABL 4DKEH 4YHYB 3LKNA 3DROB 1OP9A 2BNQA 4IOFC 2CKNA 2H41A 4QHUA 3SGJA 2X7LB 3C8KA 3TFKD 3TYGL 2GK0A 2IH1B 2W92A 1OF2B 3VFTB 5CUSH 4LEXH 4U1NB 1G0DA 1KB5B 3LV3A 3WNPA 4GRWH 3L7FA 5ERWA 1XGQA 1P7QA 1QR1A 2GEEA 1F4HA 3EZJB 4RGOL 4GW4B 1A6UH 1J0IA 2MFNA 4UQ2A 5D70H 5CHNA 1ZGLB 1IAOA 1FFPA 5SWQB 4WHCA 4HD9A 4AENB 4Y5VC 3MNZA 2OXHA 3PGCB 1TVBB 3FO2A 3PWJA 3O3AB 4GKNB 4S11A 4DAGL 4N8VB 1E6OH 3BGMA 3IRPX 1YEFL 3H42L 1UB6A 1MLBB 4M7KL 1DR9A 2BVQA 5K9KA 1R5WB 1A2YB 4JB9H 3RX7A 3NGBB 4A6YL 2DKUA 1AD9B 1RFDH 1XGTB 5FV1L 5IIEB 3PG2A 2GJ6A 5F89B 1GVIA 2YA1A 2PETA 4HLZH 5BRZD 5BW7C 5DVOA 4PJXB 3MROA 3T3ME 5DJYA 3VD7A 5FM5M 5IHBA 4JFDA 4Y4HB 2NNAB 2J2ZA 3O41B 5ETUA 1FE8H 5C7XL 1BECA 2FJFB 2ITDB 2GCYB 1WWWX 5FGBA 3H9SA 5DJ2A 4H25A 4OT1H 5KVGL 2CSPA 2OTUA 4UU9A 2F19H 1VESA 4FXKB 4P9ML 4ZTOH 4J2XA 4M1GH 4OI8A 1MCPH 2G5RA 1GL4B 5FYJH 3GMLB 2OLDA 3FRPA 1T4KA 3BKYL 3MBXL 1MFDH 3GNMH 5D1XC 3SDYL 4X4XB 3Q3GB 4RFNB 2QV2A 2QEJA 4GRLA 1JN6A 2R2EA 2XZQL 1RJYB 3QUMA 3HE7B 1SBBA 5C07B 5KTEL 3ZTNL 5T5NG 2FLBT 2VXTL 1HH6B 4G3YH 5GS0D 3ZO0A 4FXGB 2D4DA 2R56L 1MI5B 5KW9H 1I4FB 3RGHA 4MQ7A 2IADA 2GHWB 1NMBH 1ZHKA 1RUAL 4R8WL 1OW0A 4YNYB 1E4KC 2W65A 1H5BC 5FO7B 1S78C 5SWSE 5FCSH 4P3WA 2Q8AL 2AK4B 4L8SC 1EXUB 2DQGH 2P5WA 1FSKB 2H26B 5A2JH 4IRSC 5C0AA 3O2WL 4P5TB 1C16A 1QP1A 2OTWB 2Y36H 3FFDA 4APQA 3GHBH 3BD5A 2Z0BA 2W59A 5F6HI 5C86A 1U8JB 3ZKND 4XI5D 1UKSA 4UDUB 2GSIA 2ZCLH 4KRPD 4LNRA 4UIKL 1ERNA 4F37F 3BW9A 2R29H 3CLFH 2CK0L 1R3LA 3PDOA 5HHPA 3VFNA 3RJQB 4X9FA 1N6VA 3DX8B 5F1IA 5EFIA 1MCJA 1H0DA 3E2HB 3DO7B 2XICA 1Q72H 1GGBL 3QQ9D 4EZMA 4LCIL 3RAJH 2MOVA 1J05A 4HIIB 5J6GB 4Z7QF 5L8JB 4JM2B 1XGRA 3K2UH 4FQQB 5B39B 5GIRB 1U8QA 2EH7H 3Q1SL 5TF1H 5I8EA 4D9RE 3I2CH 5E8PA 2WSKA 5JDJA 1V3JA 5D2NC 5IVZB 3O2VH 5EN2A 2IAND 1EV2E 1MAKA 3HCVB 3DXAD 1FFQA 5I1JL 4FG6C 4BZ1L 5IB4A 4ODWA 2R4SH 4ZFZA 3ESUF 4YHNA 1L9NA 1MWAH 3BZEA 2AJYL 2DQUH 3DBXB 1YMHA 1XIWC 4KQ4L 5GGTA 3LN5B 1GSMA 5DJ6B 1OAZL 1IEAA 4ZNEE 4M48H 1N6QL 1JWMB 4LVOC 5K59E 4ELMF 1QFUH 5CGMA 5HD8D 4ZMAT 4PJHA 4JQVC 4Y1AB 3SE4C 3IXTA 2ARJA 4HGKC 1WCQA 2GSGA 2OSLA 2Q8BH 5ALCL 4I0PB 3BZFB 4X6BA 2B5IC 3PWLA 3NIFE 1JF5A 2EE9A 1NGWA 2C3GA 2P7TA 1QYGH 3M17B 4JRXE 1ND0A 5F1OB 4ONHA 2E27H 4FFYL 4PRID 4S2SA 3LD8B 4E5XA 1LP9B 2EDEA 3CCHA 4P3CH 4XPTH 4XNYL 4ZYKB 4GXUM 4UT9L 1ZK9A 3ZT5A 1G6RL 1CGYA 3STLA 1EDQA 3ARUA 3L6FB 2VWEE 3O8XB 1YZZA 1Z6JT 5HGBB 5GS3A 1QSEB 2I24N 2NY6B 2B39A 3O2DH 5ITBH 1I7UB 2YMXH 4DGYH 4P2CG 2H45A 2BX5A 3F5WB 1CG9B 3DIFA 1OARH 1TETL 4G8GE 4IOIA 1CDBA 3JVGA 1YYLH 3OF6A 4HDIB 1W0VB 5GRJH 3S97C 4FZEH 5DRXA 4HMCA 1CDJA 4ZFFA 4PJDF 3BN9D 4PJ7F 3PIQA 1K8DB 2GITA 1HK6A 3QO0B 2CGRL 3L1OL 3QDJE 1FN4B 5DEGB 1YYMH 1YEDB 4NPYA 4S1QH 4ZUWA 2ADJA 3KPOA 1HZHL 4FQXC 3DROA 3MMEA 3JTSB 4GXUN 4LGSB 3V52L 5AZ2H 3D39D 1CD8A 4X4YB 3JWOC 1YEGH 1T5XA 1S7RB 2X7LA 3T0WA 4YXLH 5AAWA 1YEJL 1GCFA 4Z7VE 4OCYH 5FCUH 2OQJB 1OF2A 1XT5A 3MRQB 2GJ6D 1KB5A 1MFCH 2CKBH 2MHAA 1ZT4A 2VZ3A 4LPVA 2QBWA 1EERB 3T3PE 5D2LB 2EC8A 1T21A 4JFDD 5JDSB 3RWIB 1EIBA 4YZFE 1BQHA 5DQDH 2ED9A 3G6DH 3IDNB 5CP3H 4YK4B 1ZGLA 4XMPL 4U49A 4MA1B 5SWQA 3H9SD 4GRMB 2WP3O 3PGCA 3VGAC 32C2A 4Q6YA 4KJWD 3HFML 2DIBA 1FYTE 3HMWL 4GKNA 2OBGA 1J11A 4N8VA 4WUKH 3N1GC 1RK1A 4Q9RL 2H1PH 4YHMH 1NAMB 1EUUA 4J3WA 4P2QE 4U6TA 1JZ3A 1A2YA 3ZE2E 1Z9SA 3RI5K 4ORGB 1KBGL 4OCSH 4OLZL 2WBJA 3AC0A 1XGTA 4GRLD 5DHVB 5IIEA 2X4QA 3FHAA 2AV1B 5F89A 1KIRA 3C5ZB 4KK6C 4NN6C 3L5XH 3OXRB 1Q94B 5TE4L 3QFJE 2Z93A 2JCCE 4PJXA 4XMLL 3FO1B 5I75B 4BZ2H 4Y4HA 2NY0C 5E4EC 5IP4A 1SBSL 3O41A 2KZ1B 3CXHK 3BE1H 1MCDA 2FJFA 2ITDA 4M00A 3HC4H 2DDQL 1F4WL 2GCYA 4K23H 4L29B 5DQJA 5DXWA 4KKCC 2NXZD 5E5RB 3GM8A 4K71C 1B6DA 1RIHH 4FXKA 3KLHD 4R2GD 5F7EL 4KROC 1KN4H 3RWEA 1RZIB 2NY3C 2XZAL 1NGYB 4YPGB 3O6FD 4XNUH 3GMLA 1G7PB 1PAMA 4JZNB 4P23B 4OV6F 5JUEH 2P5WD 5C0AD 1BVKB 4XBPB 3DGCR 3K1DA 3ULUD 3Q3GA 4APQD 4RWYL 4Z5RA 5FKPB 1HNGA 1ED3B 4K3JH 3OGCB 1IFHH 3QRGH 4XCFH 1MHCB 2N7AA 4GAGH 3HE7A 3GIZH 1U8IA 2OP4H 1OGTB 3VRJB 3KYOB 3IS1X 1A0QH 4JJ5B 4PJBA 2ZSVA 1D5MA 4FXGA 2I27N 5F93C 3U7WH 5I2IB 3FTGB 2Y4SA 3BMVA 3W39A 4EN3D 3ARBB 3Q48A 4EI5C 1J5OL 4G42A 1IMHC 3SGEI 3A6CL 4FMKA 1GGTA 5EZLB 2OR7A 2XY2A 5JW3L 1SY6A 4TYUA 1FFRA 1CZ8L 4ZPVB 2DBLH 1G9MH 4GKZB 1XF4A 2QADD 2AK4A 1P4IH 4FFWD 1RD6A 3EGSB 3ULVH 1OM3H 4BH7A 2NY5L 3UDWC 1YJDH 5EU5B 2HMID 1RZKL 2J8UE 4P3DB 2F54B 3MRDB 5D8JH 1YY9D 4LCCA 2E9WA 2WLYA 2A6IB 3BSZL 3OAZK 4UTBL 1IQWL 1KCVL 1NPUA 4QXUL 3STZB 3G9AB 3DX8A 3AROA 1CFVL 4ELMB 3CUPB 4L8BA 5D7JC 5AYUL 3QO1B 3W11D 1TQCC 3GIVB 4NIKB 3MRCB 3MYZA 1R5VA 4HIIA 4P4RB 4JM2A 2LU7A 4FQQA 5GIRA 4BFIB 4OJFL 1LEIA 4HKZB 3REWB 3HC3H 3K80A 4RCAA 2YA0A 3ZE1E 2V7HB 4JY4B 3S88L 3HCVA 1JMXA 1MCBA 3NIGE 1CDCA 3TCXA 3FQRB 4LKCB 3DBXA 3QEUB 4KK8C 3HMXL 4POUB 4X4ME 5KS9F 1CXEA 1IGIL 5HSFA 5MHSE 3KR3L 2XN9E 3BP6B 2E8ZA 5JIKA 5C2UB 4Y1AA 3LIZL 2HLAA 3VFRB 4HT1H 2APVA 2DWDB 4HH9A 4GG8B 1CFTB 3JUYA 2HKFL 2XTJD 1TPXB 3LMJH 1MH5A 3BZFA 1QPXA 1QO3B 1PKOA 4HHAA 4M1DL 3OF6D 1S7TB 1GIGH 3ARFC 3AS2A 4ZFGH 1AXTL 1RJZB 1RURH 4PJDB 4PJ7B 5D6DC 3RZWA 5INDB 1LP9A 3SDDC 1EEYB 3NCYS 5ADOL 5F9OL 6CGTA 4H1LB 1CE1H 4XNZB 1I8LC 2ITCA 3PGFH 3L6FA 4WUUA 2ESVA 3C5JA 3O8XA 3RTQA 4GQ9L 3LN4A 1YQVH 5JORA 5HGBA 2QKIA 4XC3L 1QSEA 2WWMC 3MV9E 3HI5H 4PLJC 1HHGB 1RZ7H 1U41A 3QWOB 4ODXB 1QKZL 2YUVA 1F3DJ 1X5KA 1QBLH 2VABB 1HXMB 4U1KB 1PG7H 3IF1A 4U6XB 4HMDA 1J18A 4ZS6D 3F5WA 5KSAB 3VRLE 3O4LE 4OF8A 2BNRB 4JN2B 4JQIL 4PJAA 4HIEA 4P9HL 2IMNA 3IFPB 4RMVA 4L3CB 2GQHA 4N5EC 4HDIA 1W0VA 3KWWB 4QYOB 1SYVB 3ZL4L 3BOVA 3MLXL 1RUPH 4W4OC 4YX2H 1LO0L 2XI9A 5FYLD 2R0WL 2FIKB 1WT5A 4XNXH 3C2AH 3QO0A 1CD9B 4X6FA 3CLEL 3R8QA 1YEDA 3N85L 1P7HL 2DKMA 3HZKB 2GI7A 1KXTB 3GKWL 3O6MH 3JTSA 1UEMA 2CD0A 2LU3A 1NFDE 2DRUA 1E4JA 2Y6SD 3QDME 4KTEH 4OCWH 5JHDE 1FZKB 1S7RA 4AEHL 1QFWI 4MJ4A 1WTGT 4MS8D 3CVHH 2DQFB 1FFNB 1JZ4A 1TTFA 1YDPB 2EYTB 2WBJD 5E9DB 3MRQA 4ERSL 5CCKL 1KV3A 1JF1B 5EC1B 4P2RB 3DUSB 2IGFH 1F90L 5D2LA 4I9WD 4JFZL 3WXVL 1IKNC 4ISVB 4Y4HD 5JDSA 1OTTD 3RWIA 3TVMB 4POZD 1T20B 3FOMB 3KJ4C 4EI6A 2GFBB 2DMBA 1EX0A 3TESA 4WY7H 4NNPL 1D5IL 3LEVL 3S35H 5DR5L 3D87B 4G8IB 2DLGA 5D1QB 1CTNA 4QO1A 5IWLA 2D7OA 3K3QA 1HYSC 4PRBA 3PP4L 4M7ZB 3UYOD 1T83A 1UXSB 4MDJB 1GOGA 3LKOB 2DJUA 5FK9B 3C5SB 4WWKB 2ZG1A 4JM4L 3BO8B 1T89A 2Z31B 3V79C 1WEJH 3QQ4B 1AGEA 5DDHB 3FT4B 3JWDL 3QXAB 3WXWH 5CILH 1KPVB 5DHVA 2DLEA 3TO2A 1D3CA 5DMIH 3C5ZA 3WHXB 4F7PB 3QUXC 3OXRA 1Q94A 5GSVA 5FUCC 5F9JB 2A9MH 3FO1A 4BSWA 4TVSa 1FNGB 2YPVH 1AO7B 1DCLA 3GO1L 4RFOH 1YEKH 4KMTL 4PTTB 3RZCB 3EOAA 3GSNA 4F2MA 1JK8B 3HA0A 2YRPA 3RBSA 3GB7B 1FCGA 4AJ0A 3V6OC 5BMFH 2DM2A 3MRGB 1I9EA 4KK5C 3CH8A 1Q38A 3PWUB 4NZUH 1I9IH 1NGYA 1INDL 4YPGA 2VQUA 4LRNL 4TNVK 5ESAA 5SX5K 5JA9A 2V7NA 4JZNA 4P23A 5DK3A 3SDCC 1A7OL 1W72B 4R9HA 1NJ9B 2WINB 1BVKA 3TBSB 2VAJA 5C8JB 3BRFA 1LO3L 2XPGB 5FKPA 5AEAA 2P45B 5L2KE 2ED8A 3BI9X 5IM7B 1YNTB 4LSTH 4Y16C 4LLVB 3T0EE 1OGTA 2YKLL 3KYOA 4YDLB 1PEWA 1FCCA 4YBQC 1YNLL 2VUYA 3FTGA 1CLZL 5M7QA 1FORH 3GMRB 2VO5A 5CBEB 1DLFL 2KBGA 1S9XB 1S7SB 3MJ8A 3VE0B 1LE5B 4X6DE 3WIHH 2EICA 2DLFH 5CJXA 3ARYA 4X7SL 4YE4H 4JCLA 5IESL 5DJCB 2A6JB 3NIDF 4ZPVA 1ZWIB 3FRUA 3I50L 4M8QB 5KVFL 3VFVB 2FH6A 4XMKL 5KBNC 1GH7A 5FAAA 1G7JA 3ZE0E 3QFDB 2EC9U 2NY4C 1XF5A 4M6OH 3MA9L 3WFCL 4G9DA 2I07B 2W9DH 5K93A 1A1OB 2PN5A 1E6JH 1AD0B 4YHPB 3O11B 2F54A 3MRDA 4CRPA 1XR9A 1YEHL 3O2DA 5J11C 4D8PA 5GJTL 1FNLA 3T4YB 1AR1D 3KNBA 4I3SH 2A6IA 5FGSA 3TM6A 4B41A 2CRZA 3UP1A 3G9VA 5TDOA 3QQ3B 3OPZH 5KS9B 3IJHB 1DTUA 1NC2B 4XPFH 5ISZE 1DFBL 5CWSB 1MHEA 3VXMA 3O45A 2FB4H 4O2FA 2IFFL 3CUPA 2DQIL 4MAYC 1O0VA 3B43A 3DETC 2HWZH 4PGCB 3QO1A 1L7TH 4JFQA 4HUWA 4Q6IB 1CXLA 2H32H 2H2SC 2OR9L 5CLWA 3L7EA 2BSSB 2I25N 2UY6A 3S4SB 4LAQL 3RRQA 1KIUA 1T2QH 4HKZA 3TO4B 5HPMB 5IV2A 2XWTB 3BKML 4JY4A 1D5BB 1PSKL 4PGJA 1NBZB 4WU5A 4Z95H 3MO1B 4XRCB 5DTFB 1RZGA 2BVEA 1J1OL 3VXSB 2ZP0T 3RVWC 1BJ1J 2X6MA 4YHIB 4OM1H 2P5ED 1NBYA 2R8SL 3FQRA 3OKNB 4LKCA 2ESVD 3O8XD 4WUUD 1YMMA 3RTQD 3ULVC 2CKBA 2ZCHH 43C9B 3S7GA 1QSED 1BGXL 4W4NA 4U1SB 1YJDC 3MV11 2P24B 4JRXB 2VXUH 2PTUA 4G43B 1A4JB 5CP3A 2VDLL 4XVTH 2NR6D 1NGPH 3ARDC 2YBRA 1F58H 5D4QA 2ZOLB 1TJHL 4KPHH 4JREC 1MCWM 3H9YA 4C83A 4EUPG 1UWGH 4M6ML 4U3XA 4OUUA 3WDIA 1NCTA 1NCNA 2Q20A 5DK0B 5FYJD 5I30L 5C08A 1NL0H 3K8KA 4YBLB 4PJ7A 3R06B 5INDA 2PO6B 4I5BB 1LE9B 1TQBB 5A2KH 4JGUA 4H1LA 3OV6A 2EIZA 1NCAH 4G8GB 3LHPL 3J8F7 1AKJB 1X7QA 1P6FA 3CZJA 1JTOA 3SKNB 3UZQA 2YXFA 4ODXA 1TVHA 1ZKAA 3F7PC 5DFVC 4O9HL 3SO3B 2ICCA 4Q9CA 3BHBB 4YLQT 2VABA 3DX9A 1HXMA 1JPGA 4HIHA 4U1KA 3QDJB 3SJVD 3FB6B 5ACMA 5TE6H 3V0WH 4JN2A 1B4JH 4MXVE 5T1LB 1OB1B 3OGOE 4MNHB 4NGHL 4OGXL 4Z9KB 5IR1B 1JRHL 4RRPA 4I2XB 1CICC 4HQQL 4J3UA 4R6UA 1NFIA 1SYVA 2JJTC 4TOYL 4JGMA 4OZIF 1GGIH 1AXIB 2VAAA 4YJZL 1MJ8H 4GXVL 4Y5VB 1BVLB 4KHTH 3HZKA 3X3GH 4LBEB 1Y6MR 1DE4B 2Z91B 1UCTA 2BDNL 4TN9A 3GRWH 3PL6B 4M6NL 1FZKA 3D0LB 5E6YA 1N0XH 1TMCB 4FQJL 3B2VL 3V6ZB 2DQFA 1FFNA 3EJZC 4OTXL 1YDPA 3B5TA 2OYPA 1VGEH 4QLRA 3C5ZD 3QHFH 2YA2A 2A6KB 2Q7YB 1OWWA 4YIQB 3HI6L 5I17B 4PRPE 1M1SA 3DUSA 3CH1A 4ISVA 3X3FH 1T20A 12E8H 1BP3B 2IPTL 2R4RL 3FOMA 3L3GB 4MSWB 2IG2L 3CSPA 4P2QB 1A6WH 2FHCA 5DMKA 3QJFB 4YHOL 4OLVL 1BOGA 4I18C 5LGHH 3QDHA 4PREB 2HN7B 3LKOA 4NQSA 1NFKA 2HTLD 1F00I 1UACL 1J1PH 3TA3A 5MEQB 1F45A 3T09A 3C5SA 4QXGL 4WWKA 3OTTA 4HC1H 3BO8A 4KY1H 4CW1A 5GJSL 4QT5B 5D1XB 3K74B 5DDHA 1MJJB 3QXAA 4PJ9C 1BQUA 5I6XB 4BFBD 3EYQD 3VXRE 2EKSB 4C54A 2E7LA 1OTUC 3WHXA 2APWA 5GRVL 3QR2A 1RZFL 4BSVB 4F7PA 5I71C 5EB9A 1ROWA 2B1AL 3GBLA 1S5HB 3W82A 1FNGA 2D7MA 4ELKB 2VL4A 1FIGL 4G5ZL 2HVKB 4M7LH 1JK8A 1C5BL 1REIA 3LKRA 5D96C 3PQYE 4GRWF 4XP4L 3U0TA 2ZKHH 2FX8H 5B21A 5D9SA 2YPLB 4Z0BL 2Y1VA 1J9CT 1HINL 2LV4A 5JZ7C 2BOBA 3WFEH 1BEYL 5C3TA 3I6LD 4ZPTA 3ARWA 3V8OA 5FGCB 4W6XB 4JFPA 4M5ZL 4N68A 4OQ1A 5DUMH 5FM4A 5I73B 1ZE3C 1ZEAL 4J3OC 3BPCB 3TBSA 4ZUSB 1ZVHA 4LP4A 1KJ2H 3TJHC 5ECJE 4IRSB 1JTPA 1KEGL 3KPRE 1IEBB 2YD9A 2VLMD 2QL1A 1M71B 3BQUC 2FO4B 4DCQA 3NCEB 1H3WM 5HGHB 1YNTA 5C9JA 4PJCF 3MZGB 4PJ5E 5SWSA 4CADB 1XCTB 3UTQB 5LQBH 3GMRA 4WHYG 5CBEA 1MCCA 1YUHB 1S9XA 5I8KL 4BJLA 1S7SA 4O02L 3VXMD 1B9ZA 2P8LA 3CXDH 3ZYJA 4MMZC 2YD4A 2E9IA 4IJ3B 5IFHL 3TN0C 4XXCC 3N50A 2NY7H 4M61A 1MFBL 4DEPC 1LGVA 1CU4H 4CGTA 5DJCA 2A6JA 1ZWIA 4M8QA 3VFVA 4F9LC 3MXWH 1CLYL 2VDRL 3U6RB 2IH3A 1FGVL 1WUNT 2OJZH 4P9HC 1LNUB 1FVCB 1S7UB 1XF3B 1A1OA 1AD0A 3DHJA 4YHPA 3NOIA 1FNAA 4GKOA 3V2AR 4N0YH 3VH8B 2QQNL 4HIXH 4HV8B 1NLBH 1YMMD 3PABB 2C4FU 3QXDB 4WV1A 1MEXL 4DN3H 1CFQB 1TIUA 2AJXH 4Q58C 4WI5A 4MD0B 4MQXC 5HHOE 5GZND 3RKDD 1WAAE 3QDGE 5CWSA 4NZDA 2O5YL 4XHQA 1F13A 3VDBA 3UMTA 4Z6AT 1JPFB 2VSDA 5CZXD 4PGCA 3BN3B 1IC5H 2N1KA 2R69L 2BSSA 2QQKL 4UINL 5EBLB 2JIXA 3QULB 4IDJL 3PV7A 3S4SA 1T0MA 4G6FB 1XZ0B 3F7VB 4JR9L 1AJ7H 2B5IB 1IC4H 4KQ3L 4Y8AA 3U46B 3MLSL 3W9EA 4WHDA 4ZNEA 5HPMA 5I76A 5C08D 3QHZH 2ADFH 2XN9B 1D5BA 4AIXA 1NBZA 3MV01 1FVDB 4OCXL 1X4YA 1MUJB 1D5ZB 1G6VK 3CVHA 1G1YA 2FYYA 2IPUG 4R7DB 4YHIA 3VA6A 4YBQD 3OKNA 2F8VA 3JV4B 3I6KB 3O9WC 4DKDC 3NCFB 43C9A 5J1AB 5DEFB 5ITFB 4ESKA 4H20H 1BLNB 5IMMA 4U1SA 2BJMH 1I9RH 1KCUL 1CE6B 3BEVB 4JRXA 1LVEA 5ACLA 3MLZL 3LRSB 1MAJA 4G43A 4X5WB 3QH3B 5ICZA 4MLSA 1F11B 4I3RL 5C0ND 3WIFA 2HT2C 3BUYA 4O58H 3RGVB 3UTZB 1FZOB 2ZOLA 3BH9A 5T3ZE 1P1ZA 4UV4H 3BDBA 3UCRA 1RIVL 3FN0L 2RB8A 5DK0A 3VFOB 4MX7A 1J8HB 2DQDL 4OZIB 4DUWA 4NT6B 1NEUA 3NPZB 3PWNB 2PO6A 4K7PX 4RISL 4QTIL 4PY7B 3V4UH 4FABL 2ZJSL 2WMPA 2M1KA 5CGTA 4BKLB 1ZHNA 4G8GA 4P5KB 1T6WA 3MV7B 4GMSL 4FQXB 5ACZB 1AKJA 3QIUD 4NQCE 4W6WB 2V5SA 2APBA 3C60B 3I75A 3SKNA 3OJMB 2KQMA 5FIEA 5IFJB 3IDXH 4YXKH 3BHBA 2XQYK 1T1ZB 5I18L 5IFAL 2CIKA 1UCBH 5I1HH 2AJSH 3QDJA 3FB6A 2NY1D 4Z8FL 1OB1A 3QCVH 1IKFL 1DN2A 1JCKA 5IR1A 2ADGA 3B6SA 4I2XA 5SWZE 3QDMB 2HAZA 4W6YB 4DAGH 4GT7A 2PXYC 2IWGA 5DC0A 2DI9A 1ACYL 3UYPA 1QFWH 3U7YL 3NCBB 1P5VA 4P59L 4R4BA 1CFNB 2HFGH 3Q5TA 5EOCL 5HHQB 1U91B 4LBEA 4TVPH 3TA3D 2Z91A 3H7BB 1T22B 4Q0XL 3N1QC 3OX8A 4R90L 4NQEE 1W8OA 3PL6A 1MREL 3D0LA 3X13A 3I3EA 4HG4J 2FEDD 3V6ZA 4KI5C 4MNGE 2WBKA 3U48A 1PKQE 3EBAA 1XF2B 5E56A 1I7TB 3GSUB 2A6KA 5IBLD 5I17A 1VFUA 4J1UB 4NN6B 4XAWH 2ZUQC 4KKBC 5HHME 3WIHA 3F6LA 4K3DH 4P9MH 5MP6L 4OLXH 5IG7A 4MSWA 2NY0B 4P2QA 8FABB 1NUFA 2R0LL 1N6UA 3GUTA 5JW5B 2EDKA 3QJFA 3MBXH 4D9QD 2JF1A 1AE6L 1AXSB 1RJLB 4K71B 4Y5YA 4PREA 3WD5H 3DMMA 3QFJA 4NYLB 2JCCA 2K1MA 5MEQA 4S0TD 4JFOA 2NY3B 4MQSB 1KEML 5CEYB 1A1NB 4NN7C 2FGWL 1GHFH 4NJAL 2D7PA 2BSRB 3ZTNH 4GFTB 2XXMB 3FQNB 3LEYH 1JGDA 2P8MA 4MVBC 3OAYK 3HI1A 2EKSA 1V7NL 4BSVA 1IL1A 1U6AL 2R2CA 5DURD 5FA3B 5SWSD 3HPJA 1S5HA 1OQOA 1RUAH 5BZDB 3OKDB 3OAZH 3SDAC 4X5XA 3RDTB 2H32A 4LDLB 4ZAKA 2Q8AH 4XGZB 3P0VL 1MRFH 2OZ4L 5L2KB 2LU4A 2YPLA 3BMWA 1ES0A 3O2WH 3KLDA 1W8NA 4EI5B 1KUMA 3MPCA 2DTSA 4Q2ZB 3IKKA 1RQ5A 5BOPA 1X6NA 5TDPB 3HN3A 4IMKC 3QNXA 3O0RL 4ZUSA 5I1DB 4Z7UF 2XZZA 2GYSA 1WGOA 2YC1A 5SX4I 3SPVB 4UIKH 2CXKA 1IEBA 1M71A 2XQYG 2FO4A 4WW2C 4X6DB 5HGAB 1NEZB 3VW3L 3PUCA 4P49A 3CX5J 2EDDA 4WTZA 4NNXB 3HB3C 1N4XH 4QNPF 3OBAA 4NO5A 4DWHA 5EO9B 3CDGA 4UNTA 3QPXL 3TBVB 2NW3B 4OD1H 4LCIH 3V0VA 1XGYH 3TZVC 1YEIH 1YUHA 4U1GB 1JFQL 5JMOC 4U0RB 4D9RD 1OAYH 1H3TA 5JQ6L 3O6KH 4N9GB 3FKUS 4NO0B 1I9JH 1G9NL 4NUGL 4M7JL 4LGPB 2J8UA 2VDML 1RIUH 1AHWC 4K7FB 5D7JB 3G5VB 1T6VN 3R1GL 4JPVL 5T33H 5T1MB 2VZUA 1TQCB 2JIXD 4LQFH 1LO2L 4DVRL 3FCTB 4BZ1H 1QBBA 3RWDA 5E8NB 3IU4H 4K9EC 4RMQA 3GSRB 5E99H 4R3SB 4U6VH 2G60H 1Q8MA 1FVCA 1S7UA 3LH2H 1XF3A 1EHXA 5DSCB 5L0QC 3PHQA 5D7IE 4RFEA 3VH8A 1CD1B 5E95B 1KLGA 2W0LA 4GW1B 5KVEL 1DQQA 1CFQA 1KXVC 2C1OB 4MD0A 3F58H 5ALCH 2ICES 1MFEH 5JNYB 4JRXD 1KN2L 4MJIE 5IQ7H 4RBPK 1F3RB 1WFOA 2NYYC 4JQVA 4JGJA 4FFYH 4KRMB 3WKMH 5EBLA 4OF3A 1CLOH 3LPWA 1XZ0A 4XNYH 3GJEB 3F7VA 5GGSB 4JAMA 4HK0A 1G6RH 4HZLB 1UYWL 4A6YB 1IQDB 2A1WH 1EHNA 4X98B 1NMCC 3ARFB 4Z7WF 2XN9A 5J1SC 4L4TB 3GRWA 5TQ2H 3KXFB 4FQCL 2PO6D 5F9WB 3CFBB 2YD7A 3BAEL 2MKWA 4DVBA 1D5XA 1D5ZA 4P0DA 4G8EA 3QG7L 3SDDB 3UJTL 3D25B 1NLDL 4G8GD 2VLLB 3SDXE 3JV4A 3I6KA 1UJ3C 4XBEL 5HXMA 1K4DB 1AKJD 2HRPL 3ULVF 2Q7NA 1URLA 2YRZA 3LKSB 1A6PA 1CE6A 3BEVA 5KG9B 2DQEL 4X5WA 3PXJA 3IVKB 1XGUB 3QH3A 4PGDA 3D85A 1F11A 3MR9A 3QDJD 1HEZB 1CK0H 5E8EB 4JPKL 2LABA 3RGVA 2QHLA 1FZOA 1FBIL 1LEKB 2CGRH 3L1OH 3S37H 1XFPA 3FOLA 4HWEH 2NTFA 3MV9A 2A77H 5TH2A 3VFOA 1R5IA 1NANI 1JMZA 4OZIA 1VDGA 4XTRC 4NT6A 4OIIH 5DRZB 4HC1A 1CBVL 5I8CB 1YEJH 4JG0H 5HJ3A 3O4LA 4BKLA 4KAQH 1BFOB 4P5KA 4FQXA 5IVXF 2D4FA 4XPAL 1UQSB 3KS0H 3PL6D 3QEGL 1X4XA 4Y19E 1TNNA 5LAXA 1N7ML 3C60A 3U1SL 5E5MB 3CFJA 2VMFA 3RWJB 1T7VA 5GGQH 3VXUB 4XMPH 4DKFL 4XP6H 1FYTD 2QQLL 5FV2A 4EDWH 1NFDA 3QDMA 3HFMH 5FYKL 1FDLH 4MA7L 2O5XL 3TT3H 2WUBL 4MXWL 4NM4H 4P2QD 1K85A 5DUBB 1DEDA 3LS5H 4CNIA 4Q9RH 5IVNA 1T66D 5DC9B 4JHWL 3I9GL 1CGUA 5LBSL 1W2KT 4HXAL 1KB9K 3FO0L 3EYOA 3MCG1 3DMMD 1KJ2A 3QFJD 4QXWA 5EDXA 1CGXA 5SX5H 3UYRL 5BQ7B 3DVNA 3DURA 3H7BA 4NCC1 4PV8A 5JPNA 5DQ9B 2HTKD 4JFEB 2BXYA 4ENEC 1ITCA 1NQBA 3VD9A 1FNSL 4RNRA 1KYOK 1H3GA 5GGUB 5E1HB 3VGGA 1FVEB 1SBSH 4I77H 1DL7L 4Y2DC 1XF2A 5T3ZH 4KJYB 5MEOB 3RWHB 1CQKA 2EDRA 2AJVH 3EO0A 4LHQB 3K4ZA 3EHBC 3ILQD 4J4PC 5D7SH 3QUXB 1FZJB 5F7EH 2B20A 5HYJB 3HZMB 3G04B 1GAFL 3FQUB 4ZAKD 1PJ9A 4PTUA 8FABA 5F3BA 1CGSH 2X05A 2IMMA 2O26U 4L8DB 2SEBB 3GI9L 5F7DB 4ZUUA 2BVUA 3VFMB 4LP5A 1AXSA 4PB9L 2EIBA 1NGXA 4IEFB 2VDNL 4F15C 3T08A 4N5UA 1X5ZA 5E00B 1MCLA 5D6CB 4FQPA 1F4YH 1DQML 2VDKH 1NDGB 4KUZL 2BSRA 1A7BA 1JIBA 3RA7L 2AW2A 5IGXH 3PQYB 1FO0H 3VDAA 2DICA 3DX7B 4UUJB 2KUTA 2UZIH 1TENA 4UILH 4ZG1A 5FA3A 1NCWL 1YPZF 5JR1H 3L9RB 4Y16B 5BZDA 5JIIA 3HHRB 4KVNL 3EOTL 2ENYA 5JW3H 3RDTA 1QSFE 1JGLL 4XHJC 4XGZA 4MJ2A 1N64L 3EJYD 4FZ8L 4YDKH 1C7SA 4CBPA 5CEZL 4OF7A 1G7LA 5L2KA 2IQ9L 3U2SB 1F3JB 5C70A 4S1RH 5GGSY 4WCYH 4EI5A 3HKFA 1BBDH 1T80A 1UENA 3T0EA 4PJ5B 1J8KA 4Q2ZA 4TUKL 4HKJB 2VTFA 3CFCH 2NXYC 1LHZA 1BM3H 5I1DA 3U4EB 2JKXA 5IBTH 3K81A 2EDWA 3BSZH 4B50A 1X6LA 2NY4B 1U8KA 4X6DA 5A40E 4UTBH 2VISA 1IQWH 4HK3J 1KCVH 1NEZA 4L4VB 4IMLA 4TNWF 5T1KB 4AMKL 4L9LB 4NNXA 3H3PL 3SGKC 4QHNA 5EO9A 3BPLB 5ENWA 2W1NA 5AYUH 3WS3A 1NAML 1DUYB 4GBXD 1FL3A 5J11B 3WDHA 4PRHE 3RUGF 3MODH 5DWUH 1PY9A 3RL2A 2V5MA 2YSSB 4OJFH 4NKQB 4G6KL 1A22B 3BJ91 1NCDL 1ZLVH 3DHMA 5L7XL 1K6QL 4MAYB 5KSUB 4KJPD 4H88L 3PP3K 5T1MA 1T0NB 1KXQE 4UTAL 1A3LL 5ISZA 2OR8A 2CIIB 4R3SA 5MHSD 2XN9D 2ZUUA 2Q76B 3HMXH 5T3XD 2C26A 5EULV 5AD0B 3UZVB 3ARZA 3KR3H 5DSCA 5I1IH 4K8RC 1DVFD 4K3GA 1BQLH 2AAVA 2XWBB 4MNQB 3D48R 3VXNB 4GW1A 4OGYL 2HKFH 4ONOA 5F6HJ 2C1OA 2EXWD 3NPSB 1EGJL 1IEHA 3RPIA 3UXFA 1BPVA 1X9QA 2H2PD 2IAMC 3D85D 1AY1H 1ZAGA 8CGTA 3HPLB 4LSRL 1C08A 3RGVD 1EHLL 1JWSA 1SJEB 1GGCL 4JY5H 2F74B 3ARDB 5L6YH 4WHYH 4Z76B 4EVNA 2Y06L 1OP5K 5F9OH 4JREB 3MV9D 1UEYA 4HZLA 3INUH 2CR6A 2FX7L 3WL9A 4A6YA 3LZFL 4X98A 1MF2L 2FWOB 3RY5A 3SKJL 4GQ9H 4L4TA 3U79A 4RAVA 1FH5L 4XC3H 3CFBA 3KGRA 2DQJH 3GSXA 2VH5L 3U9UA 4D94A 5D6DA 4V1DE 3V7AE 3O4LD 1HQRB 4QKXB 3SDDA 3OXSB 3D25A 2VB5A 2VLLA 3HNTL 4FFVD 2Z8SA 1BFVL 5IVXB 1UM4H 1CT8B 3SCMA 3C60D 2GW5A 3LKSA 1JZ5A 5GQBA 4TQEH 4XP5L 4XX1E 3QYCA 1W0WB 4AIZB 2NY2C 1MRDL 3ZL4H 2FH8A 2YWZA 4DQOL 4IS6B 3C6LA 1HEZA 2BNQE 4GH7B 4NRZB 5E8EA 3JSSA 1QLEH 1K4CB 4OZGE 2PCPA 2BZDA 4JKPL 1JGVH 1UH4A 3PHOB 4K07A 4L3EB 1LEKA 3LCYA 1NKOA 4HUNB 1DUZB 4IOSD 1UH3A 3QI9C 4S0SD 5EBMA 2F53E 3QDMD 3ZDXF 4LLAA 3GKWH 3LY6A 1CICB 4LVEA 3V6FB 3C08L 3MFGB 1BVZA 5T5NF 1LMKA 2ZOKB 4FQIH 1I85C 2E6QA 4AQ1B 3F6IA 1EEZA 1RUKL 1S9VB 2K7PA 2MPAL 2PNDA 3CPLB 35C8L 4H5SA 3IFOA 1UVQB 4ERSH 1E4XI 5CCKH 5JA8B 5DD1L 4JG1L 1KFAH 3P30H 3WXVH 2H6PA 3S5LA 3D1MC 3T4AB 1NCCL 4NUJB 1QEWB 1CDHA 5E6IC 1LILA 5KAQG 3SN6N 2AXJA 4JJHA 1BQHG 1OPGL 3KHOA 2W0FB 2XZCL 2H9GB 5I1GH 1Z5LB 2APTA 3OKMA 3RHWK 3I02B 3ZT7A 1TJIL 2ICWJ 4XNQB 4N8VG 5LGKA 5L9DH 1T2XA 1NCBL 3E0GA 5DD6B 5E2TH 4NHUB 1PKQB 3CGTA 4JM4H 1FLRL 5D72L 3HUJE 5IKCB 1OTSC 1I1FB 5B38B 3K4DA 4F8TA 5BQ7A 4HJ0C 4I1NB 3D2UB 2CMRL 4PRPA 4I13B 1HDMB 5DQ9A 1MJ7L 4JFEA 2EC9T 5FECB 5IHLB 5CBAB 1G9NC 4Y4KC 3C8HA 3MLPA 2OK0H 2JELH 4KMTH 4DK3A 4KI5F 1IZJA 2AP2A 2EXYD 4HS8L 1ZGLP 5J4MA 4PJ9B 3QUYC 2BCKB 4TSAH 4CL7A 1GC1H 4AEFA 4LLUB 4PJ8A 1EPFA 4QTHB 1DBKL 4NDMA 1YPZB 4B5EA 2YUZA 3R0NA 3T2QA 5I71B 1ZTXH 1ZSDA 3CFKB 1T04B 1SHMA 2VZSA 4CMMB 1QLRB 4ETQB 3HZMA 3G04A 1A6TB 4O4YL 3RDTD 1V8HA 2HG5A 4MHHG 1ZS8B 3OJDA 5HYEA 4HF5L 1D9KB 2SEBA 3EFDL 5L2KD 3M8OL 4D3CH 1LO3H 1MHHA 5C0RL 1LQSR 3T0ED 5E00A 2YK1H 1UM6L 2YZ8A 1R3HA 3SQBA 5AG8A 3UTTB 2R39A 4YDVB 4N1HB 1EH9A 1TZHA 4JPIB 3PQYA 4P2YA 5CZVL 1YNLH 4OZHF 4UBDD 5DJXB 1CLZH 3DX7A 4UUJA 5DJZB 1EAPB 2PF6A 4QCIB 4RGNC 2CLVA 3BQUB 1KG0B 5EZOH 2AJUH 3L9RA 1UWEL 5LXGH 4P46C 3HAEB 1TLKA 4NRXA 4D0DB 4GG6F 1CCZA 5IESH 4QRRB 4GAJL 5JHLH 1TCRA 3RUGB 3SY0A 2EEAA 3BUTA 1SYSB 4LGRB 3U2SA 3WUWA 1F3JA 5SX4H 5HDQL 1G6RA 3KYMA 1FV1B 3BP4B 3EYFA 5JPMB 4XNMB 4LSPL 4PJ5A 4YQXH 2HT3D 4DEPB 1LD9A 5CAYB 3ARGB 3KPSE 5DJDB 4PUBL 1OAXL 1YEHH 3U4EA 5ISZD 1AFVL 1L7IH 1SJVA 2FSEA 1OT2A 4ZUVA 1HOCB 4OFYA 1B6UA 1S7XA 4PJEF 1ZHLB 3D0VB 4I3GA 4WW2F 5T1KA 4L9LA 1FZMA 4MHHI 3GJFH 1X5HA 3EYSL 1DUYA 5F7WC 4DTGH 3F7RA 2EDJA 3L95B 1CLCA 4U1MA 3RWCA 3JV6B 3WUZA 1JUFB 2VR4A 4LAQH 3H9HB 1G0XA 1IT9L 3P0YL 3VWKC 1KULA 1WK0A 4R4NC 5KSUA 5IB5B 5F7LB 1WZKA 4J12A 1ZANL 1T0NA 3K1KC 2X40A 1JI2A 2FLRT 4S1DC 4N0CD 3MRBB 3ULSA 5HHOA 2VLJB 1CL7I 3QDGA 4KVCH 4JO2L 4K94H 1JNHB 4JDVA 4NRYB 1ZVSA 4PJFF 3RVVD 1PX3A 1MLCB 4ZQKA 2J3SA 5E1AB 5H35B 1VGKB 4YWGH 3WSQL 1YECH 4PD4K 1A7NL 4QRSB 2XWBA 4LF3B 2VDLH 2PYEE 3SCMD 3CFEA 4P2OA 4CVUA 4MAUL 4QWWC 5GS0H 4WO4B 2HJFA 3WFZA 1PLGH 5F97E 2V5RA 3C6LD 2WBWB 3RJDA 3HNVL 1WQVT 2CXGA 2V5YA 3BZ4B 1O5DT 1SJEA 4NZTH 4XCNB 4LSUL 2F74A 4Z76A 4ODUB 5HY9B 3AB0C 4G7VL 2A73B 3HNSL 1A6ZB 1IC7H 2FWOA 4L8CB 2P1YA 2NZIA 3PWPB 4JCMA 2XTJE 1VEMA 5DHXB 3SE8L 4OBSA 1M4KA 2Q6WB 5HBBA 1DLHB 5HHVH 4JZJC 2YR3A 2X9YA 3N9GL 2VXQH 1BBJA 1P53A 2HFFB 3L5WB 3FQWB 4PIRF 1CT8A 1KNOB 4NGHH 2X4TA 5EH1A 4Z18A 2YD5A 1FFOB 4C56B 1W0WA 5DVLA 1LO5B 3SE3C 1LK3H 2KH2B 25C8L 1NANH 2GAZA 4IS6A 4TOYH 1MRCH 3QIWC 5FEBA 3QT2A 4Z77B 2X4UA 1R24A 3FZUD 1RPQA 1IAKB 4JHBA 4U6YB 3UX9B 1MCOL 5D1ZC 1DUZA 3P4NA 1A9EA 4GXVH 1OAUL 4NC1E 4NQCA 4Y19B 5CD5C 1K3IA 1Q0XH 3ZSTA 5GRWA 1U3YA 3A6BH 3SBWC 2PXYB 1NAKH 2ZOKA 4S1SH 1QUNA 3QDAA 1VACB 5LGJB 1T1XB 2LVCA 3P4OA 5EOQL 3SKOB 3O3DA 4J8RA 3MA7A 3RWGB 4PLNC 4PRPD 2Z8RA 4HWBL 1UVQA 4JFED 5FYLE 5SWZA 4ZXBB 3GSWA 3MX0A 2KPNA 2JTDA 3HI6H 4X99B 4WIQA 1ZLSL 4H0IA 4X5LA 3QNZA 1OAKL 3T4AA 2APXA 4ODHH 3OAYH 3QIBC 4JHAH 4NUJA 2VXSL 4LDOB 4QGYA 4WU7B 3B8SA 2IG2H 2ICWB 5DT1L 2X9XA 2OL3L 4YBHA 3HE6B 1QBML 4PJ8D 3AU1A 1JYWA 1ETZB 4NKMB 4OLVH 2ARJQ 2H9GA 5GHWH 1Z5LA 4W81A 3G6AB 3I02A 1F2QA 5I8OL 4LQ1A 3THML 2E9JA 3D3VB 1A3QA 3QNYB 1S9YB 4WW1A 3TT1H 1BAFH 3WN5A 2V9TA 3W9DB 5DD6A 4GMTH 4NHUA 1PKQA 3NCJH 4PJXE 1HH9A 2FJHB 5IKCA 2CRYA 1I1FA 5IHUL 4BSJA 3G6JF 3IDJB 4LMQI 4KKLD 5IEHB 3MV8E 2ATPA 5F88B 4KZEH 3ARVA 3D2UA 4NKDA 1HDMA 4MCZA 1RZFH 4UB0L 3T2PA 3NN8B 4LCUB 4HBQA 3F12A 4IBLT 4NN7B 5A1AA 3PQYD 3BKJL 1FIGH 4G5ZH 4URTB 3CXHJ 4PR5B 4PGEB 4OZHB 2YN3A 3S34L 1U9KA 4PJ9A 5IJKC 4X0KB 3BDXA 4OLWH 4XP4H 2C4FT 4NHCL 4QTHA 5AZEH 1YPZA 1IILE 3AREA 4YPJA 1LK2A 3QCUL 3QHTC 3CFKA 1OVZA 1J1XL 2OXGA 4R7NB 3RI5F 4KDTC 1QLRA 2R9HC 3PJSA 1CGTA 3AM8C 3IDYC 1BEYH 1G0YR 4HMEA 4GG6B 1ZS8A 2RR3A 4M5ZH 3SDAB 3UAJD 1D9KA 3BGFB 4XP1L 1A1MA 5C07E 2HVJB 3KPRD 1VB9A 4X7EC 3NFNA 3MFFB 3MJ7B 4UT6L 4B0MM 3ULUL 2V17L 4HFUL 2HA1A 3MLWH 3HMXA 1UM5L 5DJAB 1MI5E 4PJ5D 5FHBL 1KEGH 2FDBP 4K55A 1KLUB 3OJVC 5B4MC 4RGMC 5AWNL 3DYOA 4Y4FB 4EXKA 2BP3A 5ESVA 1DBBH 5HVHC 4K3EH 2A38A 4LEOB 3V5KB 3BDYL 3HZYB 5EPMA 4LPWA 5DJZA 4OFYD 3TYFB 3KLAA 3NCMA 1A4KB 1EAPA 4QCIA 5T1KD 3DGGA 4M5YL 2AK4E 4O02H 4PJEB 4N8CH 3QXUA 4WW2B 4YGAB 3TPUB 1T0PB 1DJSA 4NM8H 4NZRH 5A3IC 3HAEA 3BD3A 4XWGL 4JANA 4HBCL 4D0DA 3ROLB 4OCMC 1WC7A 4U31A 3VMNA 5B3NA 1U3HC 2P48B 3TZVB 1GC1C 1CLYH 1F4XL 2FBJH 2EDLA 4RBPH 2KQNA 1TZIB 4CVZB 2W60A 4MCYB 3UJIH 3BP4A 2W07A 1FGVH 4MA8L 1D6VL 2PR4L 4IIQA 4WFED 4OCNC 3ZDZE 3MXVL 3UC0L 2QSCH 1MPAL 1AHWB 4NSKA 1MVUB 3ILPB 3VFGH 3ARGA 5C6WH 5DI8B 4F9LA 3FB8A 3BWAA 5HHOD 2QSTA 3AS1A 3QDGD 3L3HB 3GSOB 4WEBH 1X5FA 1MEXH 1HOCA 4XBGA 3FO9A 2VDQL 3MUGB 5E2UL 3D0VA 3IETA 4PJFB 5JXEA 2F5AL 1OOAA 1B88A 1G7HB 2O5ZH 5L0QB 4JVUA 5EOTB 1IJ9A 4HPOH 3QUMH 4TPRL 1J0ZA 4LU5L 5CMAB 4PYHA 4F8QA 4P2OD 1JWUB 3RU8L 3Q5OA 4PP2B 3S3PA 3TFKC 3DLQR 3PNWB 4UINH 3G5YB 2V2TB 5DMGD 4R0LC 4OM0L 1JUFA 1AQKH 3H9HA 3VFUB 4OZFH 4OV5B 1DQLL 4KQ3H 1Q9KB 3MLSH 1GGYA 4ZDHB 5IHZB 4HS3B 5FYKE 1NSNL 5E2WL 5EC2B 1F97A 3LS4L 4WJ5B 4OCXH 1R3KB 2JJUA 1RV6X 3PGDB 1A7PL 4PS4H 3MRBA 4LOUD 4Y1AE 2YPKB 5EOCJ 4BM7A 4NRYA 2VDOL 5GRXG 5F1SA 1GOFA 1MLCA 2VSCA 3ARTA 3EDFA 5E1AA 2Z8WC 4KGJA 5H35A 1NMAL 3QA3B 1A9BA 1TITA 3LKQB 4O2EB 2R1WB 5T3ZD 1BQSA 4QRSA 4LF3A 2XA3A 5JOEA 1INEL 1UJ3B 3OMZA 3CSYB 4WO4A 3W5MA 1T03L 4JZOB 5BVJB 1RIVH 5IB2A 1N5YL 2DQDH 2I5YL 4QOKB 3PV6B 2ZWLT 4V1DB 4XPGH 1XAUA 3NZHH 1QSEE 4XCNA 2XA8H 3SDXA 4ETYA 1C1EL 3CC5B 5IT2L 4ODUA 3LDBC 4NQCD 5HY9A 4AQOA 4XCYB 5SV4A 5E8OB 5IMOB 2V6HA 1QFHA 3EDEA 5EG6C 4LLQB 4L8CA 1MHPH 1BREA 3RNQB 1KIPB 1OP3H 5EU3A 3QUZA 2DM7A 5ESQA 1DLHA 4CVWA 3K2MC 3VXPB 4OD3L 3TIDB 4BZYA 3ZKQD 5DVNA 2HFFA 5SWZD 4K94C 4C59B 3L5WA 4KXZH 3FQWA 2F53B 1IGCL 1KNOA 4DGVL 1IKFH 2BRRL 5JTWA 1FFOA 1LO5A 3OKOB 4B7LA 1TFHA 4E42B 1XR8B 3C87A 4QRTB 4G8FA 4U6YA 1IGTB 3HG1B 5GS0C 4AL8L 1L4IA 3C6SA 3K8LA 1EFXD 2AV7A 5FHAL 3OR6B 4NQED 3RY6C 5F3HB 4Y19A 1A02N 4ZD3L 2R23B 3DV6A 5CEZE 3AUVA 1EHLH 4MGXA 2PXYA 4ALAL 3TV3H 3L3OB 1VACA 5LGJA 4OLEA 4LSSH 1T1XA 3WFDH 4BYHA 3OR7B 3WJLC 3RWGA 3G6JB 3D2UD 3HR5A 3IS0X 4F3FB 3DECA 5HHMD 4ZO9A 3AMKA 2B2XL 4ZXBA 4MMXC 3NA9L 4U7SA 4HJJH 4ODSL 2ORBH 2HJLB 4ODTL 2BVTA 2AKRB 3ZKNC 4ZOBA 4KHXH 2ICWA 4KRNA 4XI5C 3HE6A 4S10A 3L3IB 4PGZA 1ETZA 4KRPC 3ARED 3KYNB 4NKMA 5BS0E 3NA4A 4DJMA 2C4XA 2UWEF 1AE6H 2X10A 3G6AA 5BXFB 5ICYA 2CQVA 3P4MB 4LKXB 5J13C 4QHMB 1PZUB 2FL5A 1S9YA 1U8LA 3CNKA 5MERB 1XCQB 1D9KD 3WLWD 3W9DA 4R4FL 1JPSH 1QRNB 3KS0J 4RAHA 3QQ9C 5CIPB 2D7QA 1M6OB 2PW1B 3IDJA 2AI0L 2BVPB 1DBJL 5D93C 5IEHA 1ZT1A 5BV7C 4ZS7L 1IZKA 5FM5O 4WI9A 5DFTA 3UTPE 5L88L 3IDGA 4BQ9A 2XRAL 1ZA3B 5GGRY 2ID5A 3GJFA 5BZWA 1PVHA 3U36A 2J12B 3NTCL 4LIQE 2D03H 4MD4B 4PGEA 1K5NA 3GK8L 4PRDB 2FX9H 4DW2L 3VG0L 5CJQL 1CVSC 3MLYH 1JNNH 4G9FE 3A67H 1RZJH 1KB5H 1G7MA 3VI4F 1QFWM 4RMSA 4W68A 3IFNH 6FABL 3VWJB 5HD8C 3QXTA 1A47A 4X7FC 3O6LL 3FONA 3I3BA 4HX1B 2A0LD 3MJ7A 4LHUA 3QAZC 1BZ9B 2EEDA 4EOWL 4OB5L 4U0QB 3FT3B 2YD8A 5FYLH 5TF0A 1D7FA 1M7IB 2AEQH 5DJAA 3PP3H 3RVTD 2JK5B 5CJOH 1XF1A 4MWFA 2BFVH 3SOBL 3VW3H 3ARGD 4Y4FA 5F96L 3WCYA 3KPPB 5BVPH 1QSFA 3GGWB 5I16B 2XQBH 3PDDA 3RFZC 5GXBB 4KJQD 1A4KA 4KU1A 1VFAA 5JXED 4Z7QE 1WWCA 1ORSB 4ZTPH 1CFSB 5JIPA 4M1CD 1U0QA 5JQ6H 2MCPH 1HNFA 3Q6FB 4M7JH 1GPOL 3UPAA 4Y88A 3SGJC 1AI1H 2J5LC 3ROLA 2DOCA 1QSVA 1CDUA 1C5DA 1EZVY 4H26B 2Y7QB 2F54E 2EYSA 2DMKA 4RIRA 1ONQA 1TZIA 4DKEL 1JPTH 4MCYA 4KZDH 2NZ9D 1AHWA 5IW1B 3MOAL 3ILPA 5FKAB 1OP5H 2PKDA 4PRHA 3S37X 2ZG2A 5DI8A 4ELME 4I4WB 4TSCH 1HHJB 4GAYB 1B0RB 5CUSL 3NZ8B 3BN9C 5ID0B 3GSOA 4E0RB 4Y5XB 3FB5A 5KVEH 5KSBF 4U6HB 3MUGA 1F6LL 4PJFA 2BSTA 5EZIH 3OZ9L 1QA9B 1A6UL 1KN2H 1G7HA 2Y5TB 2CPCA 3RWFA 4RZCA 5EOTA 4NN5C 2ENSA 4OFKA 5D70L 3I84A 2LAGB 4X83A 5EZJA 2CDEA 4PP2A 1IAII 1JYNA 3MRNB 4WO4D 4TTDD 3PNWA 3MRHA 3G5YA 5TE7L 2ADIB 2V2TA 3VFUA 1CL7H 3S98A 1Q9KA 1UYWH 5IQ9A 43CAA 3B9KA 5HYSA 2K3TA 2IBZY 1OLZA 5IHZA 4HS3A 4NO3B 3MGTB 1DEEB 1UB5B 1AH1A 1R3KA 4HCRL 3HS0B 5FOBB 5ANMB 1SY6H 3QG7H 3D18B 2YPKA 1RFDL 4AM0B 5FGBC 4XBEH 5GRUH 5H2BB 5SV3A 4FTVB 2GTZA 4KDWA 3QUZD 4KUCF 3V5HA 4X6CF 2W0PA 4KJWC 4U3HA 1DZBA 1VFMA 1MIMH 3QA3A 4YAQA 3DI2B 1HIMH 2R1WA 1FE8L 3P2TA 4G6JH 4O2EA 3VJ6B 1MQ8A 4HUVA 1Z9MA 2G75A 4YHLH 4PJDE 4JPKH 2WZPD 4PJ7E 3MYJB 4OT1L 1FBIH 2X4NB 3H6JA 2F19L 1R3JB 4GRLC 5BVJA 3VXTB 4ZTOL 5HVWA 3MLRH 1MCPL 2A6DB 3QEQB 2NY2B 1HHKB 5ILTH 4V1DA 4LCYA 1N8ZA 3ZKSD 1ZHBA 2AXFB 1MFDL 3GNML 3CC5A 3IFLH 4XVSL 1VKXB 2X89D 4Y19D 1YN7A 2B4CC 5E8OA 5IMOA 3QEHB 3QI9B 5GPRA 4LLQA 2NXZC 2BNRE 3QEGH 1KIPA 5ID1B 5DVMA 4IRJA 1Q9OB 2G5BB 4L3AA 1T1YA 3KLHC 4R2GC 1X5JA 1I3RB 4N1CA 4OZGA 4LASH 3TIDA 3O6FC 1EBPA 3DV4A 9CGTA 3IJYA 5EU7C 4ZXBD 3BP7A 2F53A 4U2YA 4DKFH 5KJRH 4PP1D 3ULUC 1NMBL 4APQC 4M43H 2KDGA 3MREB 2M26A 4NBXB 5FYKH 2FGZA 4MQTB 3CSBA 5C2BH 1XR8A 1KIQB 4MXWH 1HSBA 4CMHB 1KACB 4QRTA 2D31A 5E6IB 1IGTA 3HE6D 4JO4H 3HG1A 1FHGA 2DQGL 2VN7A 5LBSH 3FFCB 4HXAH 3OR6A 2Y36L 3OG4B 3FO0H 2UWEB 3GHBL 2DYPB 2VIRA 4P4KB 5E9DE 2VC2H 4EN3C 3L3OA 5F70A 1Q9WA 4KK9D 4P2RE 4D0BA 2P4AB 3KPTA 2YD1A 2ZCLL 3OR7A 1MCQA 5GRYA 1DL7H 4KMLB 3OKLA 1QVOA 2QADC 2R29L 3CLFL 1HWGB 3U9PH 5HDBF 4FFWC 4JVWA 2HJLA 1Q72L 1LEGB 4Y4KB 3RAJL 1GAFH 2HMIC 3HUJA 4MB5A 2WWKO 1YY9C 3K2UL 4GQPH 3L3KB 3MV8B 3GI9H 4MB3A 5GGVY 3QUYB 4WEMB 5GISL 4YHKH 5BXFA 3I2CL 3M07A 1P4LB 4QHMA 4O51B 2AJ3A 3HRZB 1OD7A 2EO9A 3O2VL 4DZ8B 5CD3A 2EE3A 5F72S 1KOAA 1DQMH 2UUDK 4JKKA 4JKMA 1QRNA 4LVNC 4KUZH 1RHHB 4LHUD 5CIPA 2IFGA 4K2UH 1AO7E 1MWAL 2PW1A 3W11C 2AGJH 4U1IB 5J9PB 2DQUL 3S6CA 3ZLQC 4MJ6A 3OHXB 1PZ5A 5JXAH 1I8MB 3GSVA 1IGJB 2D0HA 4NKIH 1A5FL 1J0KA 1UZ8B 4M48L 4PB0H 4Y4FD 5IB1A 1QFUL 1VADB 4XPBL 1ZA3A 2P46B 1PDKA 1QSFD 2D0FA 3SKMB 4D9QE 4FS0A 4HEPG 4PLOB 1IM9B 1Z2KA 4GKSA 5GRZA 2ERJB 4MD4A 1T7ZA 3EOTH 2Q8BL 5IJVB 1I3GH 2MMXA 4J3SA 4EUPB 1KJVA 3H0TA 2NX5B 4Y8DC 5CEZH 2RFXB 4LPCA 3AY4A 1SVZA 1QYGL 2FEEL 4OZFA 4RGNB 1FC1A 1FL6B 3FB7B 1KC5L 1TNMA 1OSZB 1OY3B 3O3BA 1NGZB 3QB7C 4P3CL 3VWJA 4F33A 4XPTL 5D5MF 4TUKH 2J88H 1MCRA 1IVLA 4HX1A 3HC0B 3FT3A 2XTJC 1NUNB 1M7IA 4NOBA 4DUVA 1IE5A 3QJHB 2JK5A 5TDNA 3JVGC 2E6PA 3VG9C 4PRHD 3KPPA 1KTDB 5C0FB 1P7KB 2UY7A 3H3PH 3O2DL 4F57H 5ITBL 3GBMH 3GGWA 3GMQA 2EH8H 1FNEB 1DBAH 4WTZG 4DGYL 5I16A