1WYJA

Solution structure of mouse protocadherin beta 14 (26-137)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
125
structure length
125
Chain Sequence
GSSGSSGAGSATITYSVLEETDRGSLVGNLAKDLGLSLRELITRGAQILSKGNKQLLQLEQKSGNLLLKEKLDREELCGSTNPCILHFQVLLKSPVQFIQGEIQLQDVNDHAPEFMEDESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of mouse protocadherin beta 14 (26-137)
rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords protocadherin beta 14
total genus 11
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2005-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08266 Cadherin_2 Cadherin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 1wyjA01
4ZT1A 5JYMA 4NUMA 5CO1A 4XXWA 4ZMZA 3Q2LA 3FF8A 4ZMLA 3LNFA 2A4EA 3Q2NA 4ZMOA 3LNGA 2OMXB 1O6SB 2O72A 4ZMVA 3K6FA 4ZMXA 2YSTA 3MVSA 4ZMTA 3LNIA 3LNHA 4ZMNA 3Q2VA 4XXWC 4AQEB 1NCIA 2QVIA 1ZXKA 4ZMQA 1NCJA 3FF7A 1SUHA 2WD0A 4AQAA 3K6DA 4NUQA 4ZMYA 1FF5A 4AQ8A 4NUPA 1NCGA 3LNEA 4ZMWA 3LNDA 1WYJA 2X2UA 4ZTEA 4NQQA 5KJ4A 4APXB 2OMTB 4AK1A 4APXA 3UBFA 3PPEA 2QVFB 4AQAB 3Q2WA 2WBXA 2EE0A 1Q1PA 2V37A 1NCHA 1L3WA 2OMVB 4AXWA 2OMWB 1OP4A 2OMUB 4AQEA 1EDHA 2A4CA 5JYLA 4ZMPA 3UBGA 2WCPA 3K5RA 3QRBA 5DZVA 4QD2E 2OMZB 2YQGA 4OY9A 2WHVA 1WUZA 3K5SA 5CZRA 3K6IA 4ZI8A 4AXWB 3UBHA 2OMYB 1ZVNA 4AQ8C
chains in the Genus database with same CATH superfamily
3AMLA 2LT9A 1B88A 4I9XA 4Q58C 1K8IA 8PAZA 3SJVA 3EH2A 2FIRT 2QSTA 3VJ6A 4PJ7B 1E4WL 5KBDA 4N6QA 2XWDA 4B6ZA 1EVTC 1KB5B 1IGIL 2YJLA 3V6FA 1CE1L 3Q1SL 4JANB 2E3VA 1S7QB 4NCC1 4YHPB 3WELA 5HI3D 2RB8A 4GKZB 3SDDC 3NZUA 5CAYB 3FUJA 4RFOH 4OZGB 2HVKB 3KM2A 1CD8A 4KU1A 5I1LA 3SKUD 4FQ2H 1TEGA 4MJIB 1OWWA 1PZ3A 2BC4B 4AYBA 4JDVB 2A73A 4Y1AB 3LB6D 1A9EA 3VYNA 1N5AB 2W81C 3T2QA 8FABB 3NCBB 3PV6B 2A6DA 4PJBF 4YSTA 4K2UH 1MLBA 32C2B 4W9CC 5DMJB 3SJVD 5IIEB 4KKLD 3KYMA 4WFGD 5E6ID 3C5ZC 2P24A 3RWEA 2WN3A 2WXHA 2DLEA 2XX0A 4L9DA 2DMCA 2VDRL 1LEGB 1S6NA 3QUKB 5E94B 1CFQA 3EJYC 3IU4L 1P5UC 1GAFL 3T4YB 4XPFL 2ZXWB 4J3UA 4PJEF 3M7FB 4G7RB 1YAZA 3HI6L 3OLEA 4QIRA 5AL0A 4AQ1A 4NJAL 2WLKA 5D7KD 1N64H 3RX8A 4N0CD 5JIQA 4UQ3B 4WK0B 5GGVY 5DYFA 2I24N 1GMEA 1CXEA 3J7HA 4I0PD 2E27H 1J0HA 3IFNH 1S7RB 2F19L 2ZCHL 2FT6A 4JG1L 5IMOA 2ZUXA 4ZTEA 2IPUK 2VTFA 3AB0B 3D3VB 1G9EA 4I18B 4Z7IA 4KWUA 5FA3B 1CGVA 3PIQA 5DZAA 3UC2A 4JKPH 4U31A 3OG6B 1PY9A 5DR5L 3IN2A 1V7NL 2X4RA 3RG1C 1HEJC 3EJTA 1MCPH 4PGCB 5SX5K 4GKOA 5IB1B 1DJZA 3SKMA 2AERT 4JPWL 5KVFE 4AJWA 4YH6A 2ITDB 5K1NA 1ZSHA 1ZIBA 1G9NC 2VITB 4AKPA 1KYFA 2V8LA 2YS4A 3MROA 3EOAB 3VM7A 4HUMB 2XOTA 3KVDD 5K33A 1A6UL 2FCBA 1NFAA 2FVNA 3C2SA 1I1AB 3QS2A 4I3RH 4MZ2A 4P5RA 3SE8H 4J3XA 1OLZA 4NUJA 2P9RA 5HYQA 2DYSB 3RZWA 4FJ6A 3L1OL 4ZFOL 4ES9A 5A2JH 1A6UH 3STLA 5DMIH 2CM5A 2V9QA 1BJMA 5C0NC 5ILTH 1JPEA 2IOMA 2OULB 4QRRD 1I9JH 4HC1A 2G75B 5IQ9B 3BHBA 1HH6B 2YZ8A 1KELH 4HFWA 2UXTA 5B1BB 3GRBA 1BQHG 2QSQA 1UEYA 3WKNA 4KZDL 1IC0A 2WXQA 4ZUVB 3QEUB 4UYQA 9CGTA 4WK2B 4J4PD 3SKNA 2UX6A 4HSCX 4GXUN 2J5LC 4D2NA 3R8QA 3WL9A 1DQLH 4C4KT 1PZ2A 1C08B 2E4TA 2XVBA 4NENB 4P46A 2JK5B 4U3XA 4A04A 5GJSL 3UYPB 4QRPD 4OM1H 3IF1A 2N01B 5DUJA 2OJ1A 3QR1A 2XG5B 3TONA 5FAAA 3HHSB 4MB4A 4OZ4A 5E4IA 1DLHB 4NEHB 3QCUL 4A7SA 4R9HA 2PR9A 1AQKH 5ANMA 2MHAB 3LPFA 5I19L 2EH8H 1Q94A 3N44F 1KIRA 1WSST 5EN2A 1JDAA 4R6UA 3QDMB 3EFDH 4F33A 2OMUA 4EQ3A 5E2VL 2PW2A 2VUKA 5D93C 2GEQA 2DL9A 1NCJA 5ACMA 1NDTA 2JXMB 3O8XC 4UT9L 5TE6H 2JI2A 2WZ0A 1FQ9C 1YEGH 4PHXA 3QK0A 2QQQA 4CSSA 2KLSA 2LGNA 3IDGB 3RWJB 4CU6A 2CGRL 3P0VL 1RIVL 4C55A 5GGTL 4PJAB 4WJ5B 3QUZB 2ADGB 2G0LA 3PL6A 4PVLA 1CXHA 1KJVB 4ONOA 2A3TA 4ALAC 1X5GA 3O11A 3DMMC 3FTSA 2YD2A 1OTTD 3O9WA 4A2MA 3C6LD 2CGRH 4KGLA 1PAMA 1OSZA 3MA9H 1YNLH 4P8QA 2R1YA 1RCYA 2IDSA 1CCZA 1F0LA 2OZNA 4LCWA 5LBSA 5FECB 2O93L 1PIFA 1SDDB 1AFVL 1BZDA 4NJ9H 5LGHL 4LASL 4CADA 2IGLA 1E9OA 2A4CA 2AJYL 3L1GA 3LV3A 4JDZA 2P46B 3O6KL 1CIUA 3WGUB 3TFKD 3AREC 4QRTA 2NTFB 4F58L 4MJ2A 1S9KC 1BZ7A 4PI0A 1FA4A 3F7VA 1JWMA 2X1OA 4G1EB 4OGQC 5IW6A 3T1FB 1JTPA 5E8PB 5MI0C 4J3OF 4JN1L 3ILEA 4RSVA 3CH1A 5JIMA 2YRZA 4A7UA 3BN9C 4YHNA 3VDBA 4YEFA 2WB7A 4MGXA 1X7QA 4M6ML 3GI8L 3U36A 3OXRB 2OMNA 4DAGH 4WV1B 3FFCD 5D1QE 1J18A 3UBXI 2C3VA 3JV4B 4PH8A 2WJ7A 3LN4B 1DN0A 5DRXA 3FQRB 4P9HL 1JWMB 3W9DB 1OGTB 4K5NA 1Z9LA 1EEYB 2R9HC 4L8BB 3DX8A 4YAQA 3VFVB 1TJGL 4YGVB 1D3CA 1VERA 5HDRA 1RUAH 4WCYL 1L5GB 1I8KA 2YEZA 2RIKA 4HSQA 1AOHA 1HEZB 5C6TL 3MOQA 5JXEC 3MZGB 3KPOB 2COVD 2Q86A 4ZPVB 1KJ2A 5CGYD 3ABLB 5E4EC 2F6AA 1HYRC 1NGPH 4I7ZC 1T66D 3V5KA 3MODL 3VFWB 1A3QA 2WLMA 5TGBA 4FQXA 4P5KB 4LBEB 3SIKA 3F8UB 3FCTA 1XSOA 4HIXH 4J4PC 5C0GA 1RHFA 2CDGA 1P84K 4YR6B 1PZBA 2AK4B 4I3SH 3BVTA 2Z8RA 4L1SA 4OAWB 1FG2B 5MEOB 1KZQA 3DV6B 1CQYA 2EDJA 1U8OA 1PJ9A 3KPRA 4ZMNA 4E68A 1HHGB 4IOIA 4WUKH 1F58H 2HXAA 1CURA 1ZE3H 4XP1L 4N5UA 2YN5A 1BZ9A 1DJSA 4HWUA 4BHUI 3V6BR 4X9FA 4Y9BA 4HEME 1KPVB 5JOFB 4P23C 3O3AA 4G9DB 3KL0A 4JJHA 4C58B 5JA9A 1AD9B 2X4SA 4DGUA 3FPYA 2FAUA 3NCYS 4EI5A 1JERA 3THML 4GXUM 3GPSA 3HE6A 4PWFA 4KAQH 5CKAA 3JTSA 3H7LA 5DK2A 4F3FB 2W95A 3MV01 1L0YA 1I9JL 1KN4L 2IADB 4P3WA 1OZUA 2CH8A 2AXGB 1AJ7L 3MGTA 5BCAA 1SM3L 1TEFA 5EF3A 4ODHH 1BEYH 3A67H 5ECGA 2QQLH 1IGIH 1Q9LA 1R5IA 2OL3H 4QYOB 1YNTB 1E50A 1KGCD 1RZJH 2ZOOA 3GSWA 4NERA 5JLZB 4S1DC 3T0EA 2AEWA 4N90D 3DMMA 1BLIA 4NQCA 5E6ZA 1HCYA 3TWYA 4L5FL 3KZ8A 4AQ1C 4YPGA 3MBEC 2DLIA 4LVOC 5KYUA 4AGMA 5KYXB 4PJ5E 1AG0A 2YN3A 1EZLA 1FE8H 5LBSL 1N7ML 1NCNA 1NMCC 2A2QT 3VNZA 3QCTL 3IDXH 1A6TA 2QFPA 2CO7B 2DQHL 3WNJA 3ZVVA 4WW2A 1O6SA 1QRNA 2NNFA 4G9DA 2E76C 4LP4A 4ZFOB 3LQAH 2HT2C 3VB8A 4NZDA 2VQ1B 2FT7A 5JR1H 3SY0B 4D94A 3JTSB 3R06B 5JHBA 4EE2A 4Q56A 1SJXA 1XR9B 4Q97A 12E8L 1M6OB 4YR6A 4FQHA 5HVHC 3UBHA 3EOAA 2Y25A 3GJEB 2EC8A 2GTZB 1U42A 4U1SA 1FN4B 4GAYA 5FLUA 2FTAA 2ZYRA 1CG9B 2AQPA 1L6ZA 1ZV9A 5EZJB 4K9JA 1KSRA 1G7IA 2CJUL 2X9XA 2YRPA 5I1IL 5J6GB 4P2OB 5L6YL 4KNQA 3VGAB 3F7YA 2OSYA 4NNXB 1N10A 5EU5B 1BQHA 3B9KD 3CTTA 4N5EC 3O3DB 1LE5A 1JP5A 2XKNA 3CZJA 4BK8A 1IM9D 1IILE 4LSTL 1CFBA 1GJWA 4M3HA 1BF5A 4HX1A 4G9FD 1M1XB 4K2UL 4PJFE 4QTHA 5F6HI 3GBLA 4OSUL 3CXHK 1G7QB 3VW3H 2PYED 4KI5F 2AVGA 2BNQE 4MZ3A 5LBVA 1TJIH 2AV1B 3GHBL 4W6YB 2VC2H 5TK2A 3QCTH 4O02H 3VH8B 4YSRA 3I9GH 2JF1A 2Q8AH 4Z76B 1S78D 3OZKA 4GSRA 4OF5A 2H2SD 1QWNA 5EZPA 1R0AH 4XN5A 5SX4I 2NW3B 3E9UA 4CW1A 3LKNB 2H5UA 4FZ8H 3MDJA 4J6IA 2DM4A 4NKDB 4HXAL 5GRUL 1T0MA 4I2XE 5IEKB 4F93B 3GNML 2W60B 4FTVA 4DKTA 5D7IB 1VSCA 2JB5H 1CBJA 2YK1H 4GAGL 4JS7A 3UFIA 3OAYH 3PGCB 4HISA 5FYKE 2FSEA 3QDHA 1QUNA 4K3JH 5EU7C 3S4SG 2QLYA 4PIRF 3RDTA 3A24A 4AENB 3WKMH 4ELKB 1JWUA 3KGRA 3G5XA 2OCJA 5GIRA 1HN1A 1JZ7A 1YUHA 1OSZB 2JCWA 3GHEL 3L5IA 4C8XA 4LZKA 4EI6B 3CHOA 1BV8A 3IFOB 2R2EA 5E5MA 1J10A 1W72A 1B4LA 1SDDA 1DVYA 5J1AB 1IFHL 4N0FB 4UNVA 4HKXB 3MJ7B 3F7LA 3BKJH 2RA1A 4RGND 2NNXA 3U9PL 2HFFA 3RDTD 1N2RA 1YC8A 2CHXA 1VGEH 2BZDA 3BPNB 4LRIA 2H0EA 2ITFA 5GGSY 5DD6B 2HFEB 2YXWA 3W1ZA 4ENEC 3OSKA 3F5WB 3VFPB 4UAOC 2XSKA 4CVXB 1E28A 3H42H 2R8SH 4WWNA 2A77H 3BP4B 4J6RL 2XTJD 3T4AC 2HPTA 5IHWA 3UTSA 3D85D 5FO2A 5AW7B 3IFPA 1R3HB 2OTUA 5F7AA 4WCYH 4D3CL 3DIDA 2HJKA 1I9EA 1RHHA 4UTBH 2GBVA 4MB3A 1DLHA 1GL4B 2G2NA 1YY9C 3GMMB 4ZSOE 2H1LM 1HHIA 2BNRB 4LSPH 4KV5E 3LQZA 2MHAA 1IGTA 4JO3L 3MJ6A 3FO0L 1QW9A 2Q20A 1BM3L 2VJXA 3DTXA 3E8UH 1G0YR 2DWSA 3WS6A 2C1PA 2IBGA 4FNTA 4TOYH 1OAQH 5LLIC 2E6JA 3ESUF 3VXPA 4P2AA 3I2CL 4NAQA 4JAMA 4Q74A 2MCPH 4MA8H 1KCRL 5F7HA 1SLWA 1QG3A 1YYLL 1P2CB 3BGMB 3M6DA 3S6CA 4U3SA 4HK3J 3LNIA 2QPUA 2HA1A 3ZZQA 1FH5H 5TH2B 2YAFA 4DUVA 4GMSH 2EE6A 3EHBC 3NIGF 3BSZL 5FUCC 1U92A 3FKUS 4MVBC 2OV0A 4LNVA 1LQBC 1ZRUA 3CVHL 4WHTA 4WU5A 1IO4C 3ISYA 3SB3A 5CLYA 1SLVA 1YAIA 4LP5A 3SDYL 3LXAA 3L17A 1QR1A 4M6MH 4N0YL 1S7TA 4UBDC 5ERWB 1ZGLB 3KR3H 1KXTA 3FH8A 4BM7A 1EAPA 1DEDA 1HWWA 2CGZA 2PTVA 2YGPA 4JPIA 3RWFB 3NUKA 2CO6B 3RA7L 4HIJA 3BPCA 4H8WL 2R0WH 1HHIB 4W1TA 5E99H 5CZVH 3SEPA 3EOBB 3NIDF 2Q0ZX 4A6YB 3ARDD 5J5EA 3ZSSA 1TZIB 3VDCA 3WXVH 3ZDWA 4NPYA 1PD0A 3IJYB 4DTGL 4DVRH 4J3OH 3FU6A 4ZOBA 3VI4B 2VDNB 5IB5B 3II1A 5DZJA 1YN6B 1XH1A 2XBTA 1WFIA 2DLFH 3EJYD 1BQLL 3T2NL 5H35A 4OJYA 5KYYB 3O6ML 4Y1SA 3HMWH 5TDOA 1PGRB 3OR7B 4ZOCA 3F5WA 1TTRA 2DMHA 4YGAB 2EC9U 1J0ZA 4JRYA 2CRZA 4UTAA 3TTYA 5EZIL 5CFHA 3VRJA 1MCOL 3AM8A 2B59B 5IVXB 1CR9L 1J86A 1XR8B 3GSRB 2CBMA 4N8CL 5D1QD 5AAPA 4CU7A 1BOGB 4GNKB 4E41E 1MW2A 4PMEA 4PV1C 1FCGA 1CXKA 5EU4B 1NL0H 1NEZG 3RX5A 1CG9A 2D31B 1HH9B 2ITEA 4QHNA 3T0EC 3ZJAA 4DNLA 3GLAA 3L9RB 1ACZA 1KCSH 1WPCA 2DL2A 3NACH 2EIBA 2XPYA 1TTGA 4KK5D 1FO0H 1ZAGA 1MFDH 3HLAA 3ZKND 5T3XL 2VISA 4MXWL 1ZA3B 4UT7H 5I6MA 4HIIA 4BELD 5D7JC 3R06A 4QTIH 3EYQD 3VRLE 4RDQG 2EIEA 5AVWB 4ABQA 1AI1L 2Q10A 1IAOB 2XTJC 1WG3A 5C07E 3K1DA 3C2AH 3RFRA 4OM1L 4ESKA 3ZRFC 4URTB 4ZQTA 2YC1B 2GBAA 5HHOA 1FFOB 4NGHL 3REWA 3LEYL 4DF9A 5BVPH 1MFVA 1U93A 3DX7B 1FZMA 3IDNA 4XBEL 3O4LD 2V5YA 3IJHB 5FYLH 1U8PB 1VIWA 3CFNA 4M5SA 5LAPA 2XYBA 3LRSA 2NZ9D 5KANG 3RVVD 2ZXEB 3ALPA 4N2DA 1SN2A 3QJVB 5JLZA 1HE8A 4D0BA 4NB7A 1AC0A 1T6VN 3AU1A 4WUUB 2D31A 4JREB 1R19A 2PNDA 4NCDA 5CZXC 3GK8L 4PHZA 3FOMB 4Z7VF 4YSSA 2WMPA 4XN7A 5HHOD 3F01A 2V5SA 1U3HD 1FHNA 3IDJB 2YD3A 3WMQA 4MA1B 4YEEA 4CAGA 4MQSB 4RA0C 4S1QL 5LGKA 2XV0A 4RAVA 3QXDA 4G83A 1KZYA 2ZUQB 2AV1A 4O2FB 5LG6A 4LF3A 1I82A 4CC4A 1G6VK 4MMZB 3WFZA 4FYRA 3MRFA 4W81A 2VXVH 2NQ3A 5E56A 4QT5A 4CSTA 3VD5A 5D7IE 5AW2B 3ARZA 4FQCL 1H3GA 1FORL 3RUGF 1P6WA 4BWWA 4IBUA 2Q1EA 3MLXL 4LIQL 1I1FA 1C1EH 5ITFA 2K0RA 1VENA 3EBGA 5F7DA 3SOTA 3N40P 3FZUD 1BCIA 3BP4A 2NSQA 5F1OB 3WI9A 3QQDB 2X70A 3P2BA 3UAJC 3ARTA 3S4SA 1JN6B 3S96A 4RISL 3FSVA 1CD0A 4TVPH 3U4KA 2EYTA 2DV6A 3KYNA 5EU6D 3IXAB 3SODB 1H8LA 2WKOF 3E3QC 3LCYA 2XWTB 4GPVA 1YEIH 4GSXA 2CIKA 3T8XB 4E41A 1ZWIB 2YQGA 1BECA 1QFUH 3VUAA 1B4RA 3QDGA 1W80A 4DERA 5CZRA 4AL8C 2XYCA 3A21A 3CFKB 3QRFM 3ZE0E 4MQXC 2ZWZA 4JX0A 5DI8A 3QXDB 1GC1H 4PRPD 4ORGB 4PWKA 3ZE1B 4P46D 4FI7A 1G6RA 1KIUB 4UV7H 5I6LA 2H2PD 2XKSA 4TF4A 2CIIA 1U8QA 4RESB 2GJZB 3KL3A 4QXTA 4UZGA 4YAQB 4D8PA 2LQRA 2YGQA 2CGYA 2VR6A 1RD6A 4JFDE 5KYXA 1LO3L 3E80A 3R1GH 4W6XB 5BJTB 4GUCA 3D51A 2V2WB 3CVHA 5DMYA 1KBPA 1Q72H 3D69A 2V3EA 3QUXC 3BUYB 2XPGA 4GMTL 5F1KC 3PHQA 4XMKH 3EGSB 1EFQA 2ZAHA 1HYSC 4PJDE 2XXGA 5DURB 5DWUH 4Q14A 3HUJE 3OJ2C 3HZKA 2EXTA 2ZOLB 1IAIM 3IKKA 4PLKD 4GYBA 1R5VA 1ACCA 3UX9B 4MKTA 4U7MA 5FM5M 5I0DA 5TQ2H 5CMAB 1D9KC 4GRLB 4A7VA 1T03L 3I85A 1T4KA 2BSDA 4J2QA 1QUPA 3DHPA 1GSMA 3V0VA 4AC2A 2GJPA 3S2AA 4BRVA 5JOFA 3BZEB 4DVBA 4IRSA 5B38B 1I8LC 1CU4L 5K9JH 1A7QH 5I8CB 2CKBH 2XIBA 1J8HD 1WWAX 5ANME 5TGBB 5I30L 1K4CB 3GZQA 2C7FA 3V5KB 1Y7VA 3D05A 2MCG1 4U6VL 3ET9F 3LOWA 1FG2A 1WAEA 1VDGA 2E6PA 3KPOA 3ZHNA 4ADIA 3X3FH 4ZO8A 4C4KO 1JV5B 2C9XA 3SDCB 1XF2A 5IM7B 1JYNA 2X0VA 1PKQB 2NCMA 1AGFB 1DQVA 2Y1ZA 3JUYA 4PWEA 2Y69B 3RVUC 3BJLA 5LB1A 3RTLA 3OR6A 4KK9C 1UWFA 2P8LB 3TNMA 2VSKB 4YQXL 4R83A 4K0OA 4EDWH 3GS7A 1MEXH 4CNIB 4X4YA 1OM3L 1RULH 1IC5L 4XNXL 2Z8WC 2IQ9H 1GJUA 4GG8B 3CSGA 3CVHH 4MCMA 5KSBA 1T04B 3K8MA 3ARYA 1R5VB 4ZX6A 3EDFA 4LLQB 4X6DF 1KDIA 1DVXA 2DF3A 2OKMA 3LKOA 2YIHA 4HWNA 1H3TA 4N24A 1A3RL 1OTSD 1JXGA 2O5YL 1XSIA 4XP4H 3RI5K 3APCA 3TGXA 4H25B 1ET5A 1VFOA 2UWEA 3KJ6L 1IT9H 2WUCH 3L4WA 1AZRA 2QQKH 5T5FH 1W8OA 2H3NB 3DMMB 3BE1H 1JMXA 3N42B 4GI9A 2J6EH 3CK0L 3UG4A 1AQDA 4K9EH 4KTGA 1YJDH 5E9DD 1CLYH 1VADB 5T1DH 2RAMA 2WXGA 4GIPD 2BNRD 2BS71 5FS5A 1ES0B 4IU3A 1E6OL 1JAEA 4PY8J 2YSSB 5DURD 3RX7A 4UANA 5L2JB 1S8DB 2HN7A 4EPSA 2NYYC 4K3HA 4E9TA 3FFCA 4HS6A 4U7SA 5I66B 2FJSA 3O81A 4N85A 3ZZLA 3W9EB 2C4FT 1A4AA 4I4WB 2X6CA 4LESA 2ARJQ 2KKQA 1M1XA 5GISH 5ABAA 1H9VA 3QNYA 2B4CH 3B5HA 5CINH 1V55B 2DICA 4DP9X 3WAJA 1ACYH 3KGUA 5C6WH 1WEJL 4BSWA 2GIMA 3QAZC 4Q9RH 1FNAA 3PUUA 1JNHA 5GZNA 1DL7H 5I8OH 3DI3B 3H9SD 4HLZH 1P53A 5GZOD 5KTEL 3HUJF 1RZIB 2VOTA 2J5WA 1BVLB 2ZUTA 3VE0B 4UQ2B 4KK6D 4HCRH 1NTDA 1RHHB 2Z92A 3U0PA 1MREL 1MCEA 3TBBA 4N26A 4WTZA 1L9MA 1MRDH 4AIEA 3DUSA 1INDH 1P5VB 3H54A 1TMQA 4YVNA 1BYNA 2CPUA 2FNBA 5FYKL 3NBNA 2MJWA 3MRFB 1ZHLA 2UWEE 1F1AA 3SE3A 1W8EA 4DK3A 2MKLC 4JR9L 4RAVB 4HLEA 2RFXA 1C08A 1FFNA 4P46B 1JXFA 4G59C 1FYTB 4WI0A 1T6BX 3HI5L 1MSPA 2X4TB 1IM9B 3AABA 1P7QA 3HHSA 2B1HL 1BBJB 3T2LA 3FQRA 2V5MA 4XC1L 5DO8A 4PJBE 4HLZG 1U8MB 3UTZA 1UTDA 3BAXA 2NY4B 3UMTA 3AQYA 2WXRA 3S3SA 5IFAH 2ZX6A 3HOGA 1IGJA 4R7VA 1SYVA 4KHXL 2R59A 3IDYC 1PIGA 3OSVA 3K2UH 4X5LA 3VWKA 1SN5A 5IQOA 5HGHA 3G6JF 3QEUA 3QZWA 5DJ6B 1FDLL 1IEBB 3D2TA 3RWGA 4G7SB 3ULSA 5B1CA 5DT1L 3FOLB 3V0HA 2J57A 2V17H 4LKCB 1HXYA 3H2QA 5LHDA 4NWUH 3B9EA 5FB8A 4LCCB 4MJID 4DGWC 2ZOTA 1ZV2A 3LQAL 1JZEA 1ZY9A 3GRGA 3KBHE 3U2SA 4GQRA 3II2A 1JF5A 1BWMA 2VXUL 2H1PL 5E5RB 1X5ZA 3BN3B 5EPMA 5GHWH 3PWPE 3REWB 3VFUA 2LV4A 3WJMB 4Y16A 5DZLA 4APQC 3HJEA 1ET8A 5A6IA 1U8NA 2IJ0C 4JFHD 5M95B 1V8HA 2DLGA 1J5IA 2QHRH 1DVFB 4YLBA 5AG9A 4TTDD 4ZXBA 2W9DL 4W9DC 4P57B 4UTAH 2VR7A 4NP9A 5KZCD 1N0LB 3CC5A 3CSFA 4KK8C 3CVIH 3MOAH 2XZZA 4O02B 5HYJE 3D25A 3DX1A 1XZ0B 2AEQH 2WCSA 3JWNG 4HZLB 1AD0A 1FORH 2D2CC 3L9BA 1F4XH 1N9PA 1KC5L 4ZAKA 3WLBA 1DQDH 4X7FC 4XCCH 5E8EB 1Y6KR 4PJIE 4TNVF 3VB9A 1HINH 3H3PH 3O4LB 5HBBA 2BY0A 4GRWF 4M8QA 4AQ1B 5EEUA 1N8OE 5HD8D 4IM8A 1WEJH 4X6CF 4ZXBD 3WKPA 4FXTA 1NBVH 2E7CA 4XO3A 4WEBH 4FFZL 5G4MA 5BS0D 1NWOA 2BO0A 3HR6A 1PLAA 1KNOB 4OZGF 3VXMB 1XMEB 4FKEA 3MR9A 3V7AG 5DFVD 1NPNA 2WVSA 2ADYA 2HT2D 3O2WH 3IPEA 1MHCA 2DB8A 3CHXA 5HDLA 1DEEB 3PAUA 5IOPB 4QJ3B 2F53A 3JTTB 3D4ZA 4F7PB 3K2MC 4MDJA 4KUZL 3TCLB 4F5CA 3BPCB 5TE4L 2Q9OA 2F68X 4P2YA 4NRYA 5T5FL 3QQ9C 1WJ3A 4DEWA 3CH1B 3RTQD 4Z9KB 2VDPH 2DWYA 3QAQA 4AEIL 4M4RB 2CO4A 3I74A 4V1DE 4ATTA 5BO1H 4FZEH 4Y19B 1CGYA 2BFVL 3QH3A 4P5SA 5KVGE 4W6WB 2ZKHL 3FJTA 1WBXA 1IKOP 4LXFA 3UTTB 1SHMA 4TQEH 2C34A 3NMEA 4GRLC 1BW8A 5C70A 3J2PA 5JORA 2WQVA 1Z0MA 1YYML 1ZGLA 3DK2A 1MUJB 2OXHB 1EZVY 4GQPH 3VXSB 2JIXD 3PWUB 1YEWA 1ES0A 2EYSB 4ODTH 3HZMA 5I8EB 3BH8A 5E0QA 3FYEB 1THCA 3H9HA 5EUOE 1A7NL 4NNPL 3ILPA 4M7ZB 4XVTL 3NT0A 4NN6C 5KJRH 4HUNB 2GPZA 5E5UB 3MRPB 1M2OA 2ZX9A 1TVHB 2DQUH 1C5CH 2LFGA 1DBKH 2J1XA 1RSFA 3MROB 3KXFE 4NZFA 4HHAA 4MWFA 1CDHA 5CNHA 3OKMA 5I73B 3IDMA 5DD3L 5DUBA 1CGWA 1QPPA 5IEHA 1G9NH 4A55A 4OZGE 2OMVA 1UWEL 2DYPA 4JRYE 4N8UA 5HJ3B 2R0KH 1UYWH 2KL6A 4Z7OE 1BZ9B 2FWUA 1MIMH 4JFEB 5KSAA 3UTQB 1SPDA 3B3IB 3C87A 4Y16C 3FS9A 4PRNB 2BZCA 2IAND 4B9GA 2ZPKH 2I07B 2LW3A 3GLZA 5F9OL 2A6KB 2KQNA 4XNAA 3NPSC 2PWHA 1T21B 4PJEA 1LILA 1RIHH 5KUKA 2W38A 5HGGS 4G6FB 2PP7A 4XX1G 1FVCB 1H3VA 3X14A 1AGEA 3R4RA 5H2BA 5IBTH 3BJ91 5IVOA 1NICA 2PO6C 5ID1A 4TVPL 5AW0B 2YSTA 3LPGA 5TQ2L 5IW1A 1CDJA 4M61A 1WZMA 4XE0A 3M88A 2IH1A 5FO7A 1HK6A 2OXHA 3MJGX 1YEDB 1E8ZA 1NBZA 2R56H 4MLIA 1XT5A 4JFYA 1RPQA 4HFUL 4FQPA 3U30C 4ABWA 4GO6B 5SWZD 3T6ZA 2HRLA 3MREB 3U1PA 2FJFA 2BPBA 5GIRB 1A4KA 4H20L 3S35L 3NZSA 4G8EB 4BFJA 3DRQB 3MO1A 2IANE 3PJSA 4XVSL 1CFNB 3K6DA 4U2YA 1KPRB 4NZ8A 4Y4KC 2HX8A 1E6JH 2QVTA 3IS1X 4K71B 4BZYA 1NFDE 3P2TA 4MA1C 4OZGA 2HG5A 4BFFA 4NUPA 4RH4A 1MCWM 1XCQA 2YQ2A 1CF8L 2R69A 3DOHA 1WYJA 4Q2ZB 2ROYA 3ECBB 2FJHB 4KUCF 2J4WL 3T0EE 3VWJB 1K8IB 1MW1A 2P49B 5FO9A 2R7EB 4KFMA 2R4SL 3AY4C 3DOSA 1BBJA 4JPWH 5F9WC 5EF0A 1NCHA 1QMUA 4QRTB 1E27A 1SDYA 4IBWA 4PSRA 1ZS2A 3KJ4B 1D5XB 2B9BA 4MNGB 4X8JB 1KELL 3VH8A 1U21A 2IQAB 2W92A 3AS0A 4LCWB 1TPXC 4HGWB 1NDMA 4J3OG 1NSNH 2VN5A 3FUDA 4BCYA 2CA4A 2J2ZB 5I75C 1C16B 5I1GL 1D5IL 2X4NA 2YMXL 3B7YA 3V4VH 2X4UA 3LZRA 3Q8EA 3VXME 1S7RA 1TQUA 5DI8B 2FHBA 3QZWG 2HVBA 3K71B 3WY3A 3K6SA 2VQTA 5ABDE 2A9BA 1G7IB 2F61A 3FULA 1F6AB 5DJYA 1DQDL 1WTLA 1H6EA 1ZLDA 4KJQC 3BZ4A 4ODSH 1E65A 2V0AA 5CR8A 1EJOL 2XWTA 2XKNB 5IHLB 1GYVA 4I2XA 5I6XB 2B20A 1LWHA 4HGMA 2ERJB 4NO3B 5K59E 2HRPL 1HT6A 1UA7A 4GRWH 2A6JB 4K71C 4P07A 4JKPL 3FUHA 3BKCL 1DQTA 5JPMB 4KZ0A 4R96B 3S35X 1TJHL 3K6SB 4H40A 4YIQB 3H3PL 3PHAA 4MXVF 1XGUB 4TKWA 4WLCA 4XCNA 2Y07H 2DJSA 4PJGA 4NC2B 3DHJA 4M48H 5GSRA 2MPVA 4OJFL 4F7CA 3DVGA 1EJ6A 2F7IA 5MERB 1DUYB 4HGWA 3ECVA 5F1NA 2W9LA 2P26A 3OL2A 2ZSWB 2ID5A 4FI8A 2X1QA 3QO1B 4JE0A 4JFZL 3SO3C 3M8OL 2UYLA 1JBJA 2ICES 5ALCL 2GJ6E 4EZLA 2E6QA 1M05B 2EADA 3I9PA 2B08A 1BZEA 1ED3A 1USQA 4R7LA 1W0YT 2YBRA 2JCCB 4PPTA 2HUHA 1D7FA 2AXGA 5DC4B 1MFCH 2GC7C 3A3YB 5TFSH 4BUGA 4GUOA 3DGDA 2X7LB 4J4PA 3T0ED 5IQ7H 4U1MB 5EO9B 2ZCKH 4A68A 5GGRB 3AS3A 4PWJA 5I8KL 1FFOA 1OF2B 3BWUF 1Y0LA 3VFOA 1KYOJ 3PP3K 3NABL 2E27L 4FXKA 1N70A 4Y4FD 5IFJA 4Q6IC 3TO4C 1TU2A 4DFIA 3B37A 3PNRB 4ZS6D 2VDQL 3LB6C 3U0WL 3VACA 2PWFA 2WQWA 1VCBC 2B0SH 2WQXA 4WW2C 3QQ3A 4WK4B 1HEHC 2ZQKA 3GO1L 3UG5A 1MAML 3GI9L 1AGCA 5IHBA 4MA8L 2MCPL 5CGMA 2BLFA 3U4EB 3GMOA 5C9JB 5IM7A 1T1YA 1TSRA 1TUPA 2GQHA 1HESA 4Q9QH 2VDLL 2ICEC 3HKZA 3PG2A 3BPOC 4NQEB 4QGTA 3IB4A 3RIAK 5DDHA 3DJZA 1YDPA 5CEYA 1HWHB 4JO3H 4OY9A 4ETQB 2Y7SA 1NAMH 3RVTD 4Q0XH 1TZHB 2VL5A 5D71L 2O6FA 3N55A 4KH9A 2AQTA 4IK6A 2P8PB 2DQTL 2VLRD 4PM1A 4L8CA 2K8MA 1LP9A 1D7DA 5KAQG 5EHFA 3KBEA 3RFZC 2D3VA 2ODHA 3NVQA 5T1LD 4O4YL 1U3HC 3G6AB 3R7QA 5D2NA 2VM9A 1ZVNA 4AYDC 3EXLA 3FQUB 4DQOH 2QGCA 4KJYA 4ZFZB 1OE2A 1FNEB 1G6RL 3EOYG 4X4ZA 3ZYOA 2PPFA 3JTBA 3PGDB 5E6RB 4CA4A 3NIGB 5JPNA 3PWJB 4O00A 1U9KA 3AXLA 4Y2OA 1AHMA 5DUBB 3D4YA 3KYMB 1IZKA 1WD9A 1VHPA 3KPRE 3WNKA 2KS0A 3IGUA 5KS9E 2YLKA 3RVWD 1SMDA 3H85A 4MHHI 1ZDQA 3RY5A 2GW5A 3BKJL 3AADB 5IESL 2VXQA 5C07D 1INQA 3BZ5A 5K5YA 5DJXB 3K1KC 2H41A 3U36B 4BQ8A 5HPOA 2EDOA 2X88A 2QSVA 4QRPE 3GHPA 4HT1L 1BX2B 4P23B 4JUSA 1JK8A 4FNSA 2O5ZH 3WIFB 5DUPL 2K78A 3CFKA 2APVA 2J6EL 4H0GA 1B4TA 1BD2D 3LH2L 3QIUC 4GS7C 3ZSTA 1ZT4A 1ZHKB 5F7FA 4M5YL 2Q6WB 1NC4A 3HEIB 1XAKA 2YGVA 1UXSA 2B3IA 4ODUA 4OF0A 4PSPA 3OQ3B 1NBZB 1FFNB 2ZWYA 2OJZL 5AUMA 4ZMWA 1UOKA 4I0KA 4DEPC 2HLFD 4K8RC 4JG0L 2CLZA 4JDTH 3OGOE 4EQ2A 4OVUA 3TEXA 3SBRA 2ATKB 5CF3A 4HCRA 4O02L 3JYBA 4M1DH 4MNHB 4BQ9A 3K0WA 3MLWH 3QDMA 5BZXA 1A7OH 1AZVA 4F7EA 1WGVA 1O6VA 2MNUA 4JHWL 3H53A 1S9YB 3ALXA 5L88H 5G4OA 1K8DB 2XN2A 2XJLA 5DFAA 2QVMA 1SQMA 3CN3A 3TN0C 4R7NB 3QJXA 3ZE0F 2DTMH 3EO0A 4I8DA 2BWQA 1O9WA 3NTCH 1JZ6A 1F90L 3S88H 1TQCC 2MKWA 4Y2DC 2CJSA 5DJDA 2QKIA 3EIFA 3TBCA 6PCYA 2QL1A 4KMQA 4GFXA 3L3OA 4EIBA 1MUJA 1O5PA 5BO0D 4XPBH 2BHFA 2N56A 2DDQH 4F15B 1QVOB 1D6VL 1IB5A 4RQQB 5AOMA 2XDHA 2XRAH 4K8RL 3UTTA 3H9ZA 4F58H 4G8AC 3DX7A 3IDNB 1A6AB 4OD3L 1AIZA 4HXAH 5KOMC 3ZDYB 2BM3A 1V7ML 3NCEB 4IOFD 2NY2D 1IVLA 4P46C 3RKDC 5CILH 1ZK5A 4LVHC 3LYRA 2VRKA 3LMJH 4AVHA 3MLUL 3O2VH 5ESAB 4C4BA 5B3JE 4C4UA 2G2RA 3DGGB 4JFOA 1ZLEA 3GGWA 2FEJA 2CUMA 2DS4A 1XB3A 3MJ9H 3MUHL 4ZMVA 2LTQB 1JGVH 4IOSD 1EXUA 5AOLA 3QDME 2CDFA 3IMTA 4ONGH 7CGTA 3TOPA 4MD4B 4GW5A 1QSFE 4X6DE 1JZDC 2JNZA 4NKDA 3TJHD 5DVOA 1ETA1 1T4WA 2IBBA 3B9KC 2X40A 5F7EL 4A2EA 4FDWA 1HOEA 5EOCL 4UOJA 5F70A 1XBRA 5I73C 4LCIL 4ZMQA 1QASA 1YO4A 1K8DA 2ZOWA 1JDCA 5FO8A 1OTSC 4XO9A 2ICWA 5I26A 2BERA 3GHBH 2Z6FA 1B4JH 1DBAL 1U0QA 4K07A 4NFDA 1LD9A 2CM6A 4IRZA 1MY7A 2LAAA 3BP6B 1JF1A 2CDEA 3FB8B 2W5PA 4QYAA 1TIUA 4LLDA 5FOBA 5HSFA 1BFOA 2E9BA 3RPKA 1AD0B 3JVGA 3RI5F 3CBRA 1A4CA 2Y07L 3PFUA 3UGEA 2OXGA 2QLVB 4QTHB 1QABA 2PN5A 2D7TL 5BUGA 3OZ9L 1TDQA 3QFJD 1F58L 4OGAC 1TXKA 4ZODA 5I1IH 4X9HA 1TR7A 5EU6B 4AL8H 1NDMB 3H0TA 3WJLA 4KTYA 4RMBA 1F2QA 1GW0A 1AC6A 1K4DA 2FD6L 5DQ9B 4B41A 1WHPA 1Z9SA 2EE2A 1N4XH 2FZ3B 1EHAA 2AMUA 4DO6A 1XL4A 4ZOEA 1JJUA 1KYDA 2NY3D 1LP9E 4MJ5B 3NIFB 1OT2A 5A2AA 5J6HA 4N2NA 4H8VA 4HUWA 1E5ZA 4DQAA 4MD0B 4JLRA 2E7LC 4YHOL 2JKWA 1E4XH 2PETA 1FNSL 1UKSA 5GGRY 4XNDA 4F15C 1ND0B 3PPSA 4B60A 4EN3C 5DLML 5C0EA 5ESAA 3UROR 1AXTL 3RBGA 3GXTA 5DHVA 4EN3D 5HGHB 3SDXE 4HIIB 1CC3A 3E9TA 1B90A 3D8MA 3APNA 4TULL 5FB8B 3S5LB 4LOVA 1U8MA 3L45A 4WI8A 3D3VE 1UB5A 2RGSA 1QBML 3D2UB 4HD5A 4M6OL 4G80A 4PJ8B 3MGOA 3QORA 3HLKA 1SY6L 1KXVA 1CGXA 3WO4B 2XV2A 1LK3L 1ZTMA 3C60C 5SV4A 5MP6H 5J0BA 3DGCR 2HRHA 3EH1A 1NBVL 1TTCA 3L4ZA 4XVUD 4B53A 5BW7C 5IB3B 3GDCA 4FCHA 2V7NA 1A7RH 2YPVL 2Y06L 3IFLL 2HX7A 4YHIB 1YEFH 1EGJA 1AKPA 3CX5K 4P5TB 2F19H 4HKZA 1IM9A 4MZRA 1OHQA 2L7JA 4ADGA 1FSKC 1NMAH 2VDOB 3BEWB 4PVMA 3FT2A 2NR6C 2FEDD 3CVIL 1AFVH 1C8PA 2ADIA 3D50A 4R96A 1U3HA 3EG9A 4Y2NA 4TUKL 3IJ8A 1SBSH 3ROOB 4HJ0C 3ZN6A 1QSEA 4RNRB 5EOCH 3X12B 9PCYA 2UX7A 3N1PC 4CNIA 1M9SA 3HVDA 3RU8L 1Q0YH 2CAKA 3DLQR 4YHZH 3GMOB 2BXZA 5GPRA 1AHWC 3P0VH 4Y4KB 5HVGB 5LBGA 5C0BD 4MNHA 4R5XA 3ARFB 3QZOA 1JTOA 1CLZH 5MENA 2IAMB 3TBYB 5I6KA 4DP0X 3EHBD 1LO5B 1XF3B 3FQ1A 3GMLA 1OV8A 4FQXB 2VDKH 2Y5TA 1E5BA 2R2BA 4NO0B 2W88A 1F02I 1BXVA 4HCFA 1DANT 4JQIH 4GG6B 3KGTA 3SDCC 4XPHH 1VADA 3QUXA 1E2ZA 1JVOA 4JM2D 4NLAA 1ASPA 4WHTB 5FHBH 4NO5B 1BXUA 4LRNH 3EYSH 3MBEA 3ZQWA 5K9JL 2WLJA 1F3JB 4HEPG 4HU2A 5FF6A 2A9AA 2XG4B 3KH4A 4YBQD 2YPLE 3RHWK 4TLTA 4YBHA 2YBRB 2PP9A 4K8RH 4PRAB 1I9IH 1OB1B 1NAMA 5EU3A 1EEYA 4AKQA 3QYNA 2E9WA 2CO3A 2C3VB 3ELQA 1EFXB 2Q3AA 1RK1B 3QULB 3VA2C 4YDKL 5TTRA 3AY2A 2DI8A 3GMQA 3U1SL 3QEGL 4JM2A 4KPHL 4DGIH 4U1LA 2OYLA 4LARH 4QKTA 1HCZA 4GI6A 1UT9A 4H5SA 2CZNA 2Q7AA 5TQ0H 5E7FA 2W0LA 3RDJA 5F8QC 4CSZA 4PJHF 5F93C 3VI3F 2FBRA 3BP5A 2R4RL 1S3KL 2MFNA 4MBRA 3HPLA 3MYZA 2Y6SC 2ZZUT 3NJGA 1NGZA 4O51A 5DQDH 1XF5A 5IVNA 1JG9A 4L1DA 2DMGA 1FVDB 2UUDH 2DJMA 3E38A 3MRRA 2R83A 3VXMA 1XF1A 5K9OB 1QSFA 4X6DA 3TU6A 5C2BL 3SGEH 3V4UH 2GFBA 2Z93B 1T3FB 3T0BA 1XB8A 2F9BT 1NUNB 1RJLB 1AGDA 4M93C 4R90L 1DVZA 1BPLB 5CHNB 25C8H 4H8WC 1MVUA 2HFFB 5FCSH 3RFZA 4X6BB 1PMYA 1K4CA 1XFPA 2X4QA 2IV8A 1U3NA 2YO3A 1J1XL 3QCUH 3H6AA 4HKXA 4QXVA 2KMWA 3V0VB 4YHZL 4LCVA 2JKXA 3VXUB 3FNKA 4UTAL 3G5VA 1U8CB 3KW7A 5K9OA 5BQ7A 4Y4KD 5C0BB 1M3JA 3WIHA 1A1NA 2DI7A 3BQUA 2NR6A 3PL6C 4LLVB 3UBXA 4Y9FA 5DO2C 4EUPG 3HPLB 4UAOB 5JO5A 3HZKB 3BPLB 4CKQA 4WHYH 4WWKA 1EFXA 1I1AD 2IPTL 5JIPA 4LSUH 3V4PA 2BIPA 5IMKA 4DO5A 3ASWA 3C6SA 4N8PA 5EO9A 3O8XA 3V6ZB 1N64L 4N22A 5ISZD 3P9LA 3IGKA 2CK2A 3VFGH 4K73A 5D7LE 3NIDE 5ILTL 5KVDE 5FF6B 1KBGL 1NLBH 4JHVA 1M56B 2Z31D 3L2NA 3IU4H 1WIOA 4F2EA 3FOMA 3UL4A 3ULSB 1KLGA 1H19A 1U8LA 5EN3A 5HYJA 4LU5L 3ZDZB 3RQ3A 4JRFA 5CXPA 2HG5B 3RYMA 3VD7A 4E5XB 2I26N 1EFXD 3V7AE 5EORH 1EXHA 3KYAA 3QWOA 1NJ9A 5CU9A 3KNBA 3QQ4A 2IXQB 5A2CA 5IMLA 1RUKH 1OKEA 3MJ9L 3PJSB 4GOSA 4LSRL 4MJIE 1F18A 2EUVA 3FTGB 4PP2A 3Q3GB 1UA6L 4ZUUA 3MJ8A 4G9FB 3OKNB 2D7MA 3BUQA 3GIVB 1AXTH 3LMJL 5JO5B 4BFBD 3IT8D 5FOJA 3SE8L 3STLB 5AOIA 4EIUA 2IGFL 1ZCRA 4RMUA 3S96B 4XB8A 3WDHA 2ORBH 4POYA 5J6GA 3N2JA 3TBSB 4FG6C 4OD3H 4GFTB 3U46A 1H3UA 3BAIA 3SDXB 1BM7A 5B7EA 3HMXA 1YRKA 2CIKB 1JHTB 2X1PA 3DVNA 2B9AA 4KHXH 1P4UA 1RJZB 3T09A 4A66A 4N2KA 5IVZA 4EEEA 3MRHB 1VLXA 2WVUA 2YGNA 4ANWA 5I1JH 3B8SA 4GXFA 5HDQH 3ROOA 4Q0XL 4L1HA 4MMZA 5HHXH 1X5JA 2HFGL 1QO3B 3OZ9H 4FYSA 1Z6JT 4PG2C 4LLUB 5BS0B 4K7PX 2A9MH 3O2DH 4OFPA 1FH2A 4CMMA 1NMBL 4WFFE 1EEQA 2K70A 4N1EA 3MUUA 4PGBB 5EWIL 2I7SA 1FYTD 5LN8A 3CE1A 5L88L 5JIIA 1DUZB 2DY2A 2WQRA 3LIZL 5EU6E 2FHFA 5AWNL 2IG2L 5IB2B 3MRQA 5CEZH 2A6IB 3WLBB 3F62A 4PJ6A 4N25A 5IMLB 3UAFA 3X13B 2EDYA 3BD3A 4ISVB 4BKTC 1OPOA 2NY5C 3KPLB 1QLFB 2QQNH 1EUTA 3O6LL 3QWOB 3CMGA 2ZP0T 4QHLB 4R2GB 5E00A 1QYGH 3FCUB 3M1BB 1YNTA 4UIMB 3QWQB 5HI4D 3WFBH 5F71A 5CSZA 4H1LH 3QUYD 3DV4A 4PRPE 2G60L 3MLVL 1GZQA 3ULVH 2W91A 4J8QA 3EJJX 1BP3B 4XMLH 5CP3H 3BXNA 1VF5C 4D0DB 4P2RD 2HWZH 3ZZ1A 3D0AA 2YD1A 2DQHH 5GS1B 1FZMB 1WAAF 2KDYA 4ZTOL 4PTTB 2P5EA 1BQUA 4HPOL 5L7XH 1WCBA 5BNXD 5ALCH 2PWDA 5ADOH 1ZLUH 3A4AA 3PL6D 2FLMA 3LRGA 5HHXL 1ODAA 1WGOA 1KXHA 2EE0A 5JQ6H 4RRPG 4XMXA 1CQKA 4GG6A 2X6VA 1HH9A 2ZNWA 4WGWB 3HPJA 1AP2A 3T3PB 1S7QA 4YHPA 3MRDA 3W39A 1T66C 2V7HA 2ZYIA 1DDHA 4NRXA 3S34H 3HLAB 3BPNC 3D87B 5TDNA 4QXGH 1MN4A 2MNJB 5FGBC 5FLVA 3U2IA 1LDPL 2ZKXA 4FTDA 5IB2A 5EB9A 4LLDB 5EU6A 3M17A 3LZNA 1KN2L 3FCGA 43C9A 4XX5A 3U25A 2YKLL 2D4DA 1AGEB 3X3FL 5FDWA 4HG4J 4KQ3L 1BMGA 1EO5A 1I4FA 4JVPA 1NCAL 4EO5A 4W9KC 2X0UA 3CWGA 1XSKA 1VEPA 1AGDB 2KZBA 1G7JB 2GSGA 3NTCL 3FB6B 1TETH 2XZAL 5C08B 3RLSA 4L48A 4NZTL 5MI0B 2VR8A 3IU3B 2AJXH 5I5JA 3MNVA 1EQWA 2NY0C 3AG3B 2Y2YA 4N1CA 2FRGP 2WOYA 4YFEA 5IMMB 2YPLA 3IFPB 1XZ0A 1CTMA 1PTZA 1KB5H 5I1JL 1AR2A 3BVNA 4HWZA 4P5TA 3HKFA 3AB0C 3AMKA 5DJAA 1ETJA 1GOHA 4ZW3A 4NT6A 3EF4A 1GSKA 1VKXB 2CO6A 3DDGA 1UD5A 3LKPA 1MF2L 1UHVA 4JRLA 1L9PA 2Z31B 1Z3GL 2H6PA 5CD3B 1A3RH 1E4XI 1K3ZA 1TKWB 3CZFA 3VXOB 3VG0L 3OKEB 5T3XH 5FYKD 1PZ5A 3FQWB 3QIUD 4H13C 3GBEA 3GT6A 4GRWE 4MS8D 1J5CA 2R4SH 2O26U 1KLUA 1TLKA 1RUKL 2EH7L 1S8DA 3NSJA 5ABZA 3PQYB 3WY2A 4RETB 3BGFB 3H56A 3P0GB 3QNZA 2BHYA 4IRJA 2YQ3A 5GGTA 1IC5H 4XNXH 4RMSA 4KJPC 5E9DA 3CNKA 4JO4H 2NY2B 4FRWA 1HOCB 1TZOA 4B9KC 4X5RA 4L1TA 5J6SA 2CR6A 2D7PA 4H25A 5D4JA 2IADA 1CLOL 1PZ5B 3ZTEA 1K5WA 2Z0UA 4PJCF 5DJDB 2EXWD 3ZHLA 3E3QE 4ZD3H 1N0XL 1SDAB 4GG6E 2JB5L 4GAGH 4XBGB 5HI4C 4HW6A 4WGVB 4MA7L 5D7KE 3ZDXF 3EYOA 1J0KA 4M1CC 5I71C 1NAML 3IXAA 2J20A 2ZG3A 4GW4A 4CDHA 4OZFB 4UT6A 1VKXA 1QSEB 2DMKA 4FF9A 4BRJA 1NCCH 3MNVB 5C0FB 3D48R 1BZ8A 1OP4A 4HLJA 2H7WA 1YECH 5GZND 1G1YA 2WXKA 2XBDA 1UJ3B 2XNAB 3EH3B 5ICZB 2AZAA 1J1OH 1OO2A 4JHBA 3T3PE 1PLBA 1PX3A 1G4MA 5F6IC 2NX5E 3WNNA 1HS6A 3HG2A 3DX9A 4KOCA 2FWOB 3WKYA 2F5BH 1PLGH 2X2HA 4IBQA 1NFDF 5F9OH 1COBA 2F54E 4XWOC 4FA7B 2NW2B 4D9RE 2H8PB 4JCMA 5MEPA 2F58H 4FYTA 4ODUB 1JK8B 5C7ZA 4YJZL 4OGAD 3X1FA 2F8OA 3RZCD 3HB3B 1NGQH 3BUDA 1HJBC 4EI6A 1RERA 3CSTA 1MAMH 3IRCA 4QHPA 4GMSL 5DJXA 5AAWA 1ADQA 3NSCA 4NNYA 2YEVB 1FLTX 1BAFL 1V3LA 3I6LE 3QVAA 2BC4A 1CXLA 4QOKD 2A83A 3UADA 4OGXL 4XXCC 1OGPA 3OC5A 4WO4A 2GC4C 5DFTA 1JK9A 5F89B 4AEIH 5AW8B 4XCYB 5E1IA 3NSXA 1JD7A 4P4KB 1F4AA 3WHE0 5MEQB 3IFLH 3QJZA 1A64A 3FU3A 3AGWA 5E1AA 3LKNA 3SO3B 5D7JB 5T5NG 3TURA 4G3YH 3LKRA 4IS6B 4BZ1H 1JXKA 4UIMA 1MJ8H 3MRKA 3TV8A 2G9HA 5DMGC 1GYCA 2CWRA 1KF9B 2YD7A 4LLWB 2DLTA 1N67A 4HWBL 4PRDA 1IKFH 4TULH 3CJJA 2NW3A 1QHOA 2C7UB 1I3GH 4LDEB 1R17A 4DN3L 5FPIA 5D2NB 5K9QI 5KSVB 4L4TB 4OIIL 3VSQA 1PD6A 2I69A 4JPQA 4LE8A 3QI9D 3RWHB 4M7JL 4R7DA 1PY4A 2PMZA 2WLNA 1XTMA 3CFBB 1CYXA 2QR0A 3ISWA 4JREC 4DKFL 1ZDSA 2BIOA 2EUWA 1UXLA 2FWOA 5D1ZC 4XNZB 2DIAA 4Z7QF 2HT3C 4RIRB 4XZUB 3CPUA 2AQRA 1T20A 4BSVB 3ZTNL 4PREB 1QRKA 2VLKD 3L5XL 4NBZB 1XGRB 5HI5D 2EDWA 5IP4A 5DGQA 3FQTB 4CC4C 3II3A 4XNUL 2R1XA 5CJQH 1Y0LB 3GHEH 3VFOB 4LHUB 4Y5VB 2F08A 3UPRA 3QJTB 3UTPD 3ZDXE 1MFMA 2C26A 2PABA 1FV1B 5B39A 3EDKA 2X3BA 3GSXB 2WO4A 4DKFH 2Y0SA 5CZVL 1G7PB 4BUQA 4XBEH 3GRWL 3MXWL 4X5QA 2Q7NA 1ETB1 2CXKA 3KLHD 4M8UA 2NY0B 2UZXA 3WLWC 3F85A 1NCBL 2UY7A 4N0YH 1PCSA 2IXQA 1CT8B 4HS8H 4JANA 4OZHF 4APQB 1BGXL 2R23B 2YQBA 1XCXA 4F7KA 5HTSA 3BW9B 1KTJA 2E47A 2CO7A 1KCKA 5D96C 1VFBA 3UJIL 5F3BB 1XWVA 5T3ZH 2MOVA 3E6HA 2P47B 3D06A 1AANA 4F7CB 3WO4C 4P4KD 2CLRB 5JYMA 3KWVA 4IBTA 3OKOB 4HC1H 2XV3A 3PXJA 5DQDL 4OZIE 4ZMZA 2EXYC 4XGZB 4FABH 5LVEA 5K9KB 3VXNA 1D6EA 4Q6IA 3MRQB 3TO4A 4XVTH 4JFFE 2Z35B 4FQ2L 4JQVC 5BZDB 2HMIC 3Q6FB 3DVGB 3Q13A 5E99L 3SDAD 5I1HL 3GI8H 1W6LA 2GJJA 3U6XS 1NEZA 4HOZA 1RLBA 4ZFZA 3VVVA 3IBOA 5F44A 5D8JH 4Q8BA 1LP9F 3D0VB 3QDJA 2VM4A 4NO2B 4HUWB 4XP9L 2UZXB 3SGEI 4P2QB 1H6UA 2A6JA 3DTDA 4KO7A 4J3SA 3VU1A 2W9EL 2AEQL 3I50L 2P8LA 4HJSA 3UBXB 3L4UA 4LPCA 1CZ8H 2GTQA 3G5WA 2QTVA 4JPKH 1H5BB 4X7SH 1RI8A 2A99A 2XWCA 1IM3B 1F13A 3EYVB 4FTVD 4IJ3C 1MVUB 5GGSA 5CBAA 2CR3A 3ZOAA 1DQIA 1A7PL 3UYRH 3GXFA 4GKLA 3T0DA 1LNUA 2ZONA 3BEVB 3IDXL 3SKOA 5KS9F 5IQNA 2R29H 3W56A 3E8UL 1ZSDA 4H8WH 4MNGA 2DQCL 4X6BA 4BQBA 1NBYB 2X0WA 2NXYB 2X38A 4JZNB 4DP4X 3BVVA 1OCWH 4A7TA 1E3FA 1UJ3A 3ARQA 4FXKB 3VWKC 2Y5EA 4JZJA 5TDOB 3WG7B 3Q5OA 5BMFH 1I8KB 1V05A 3WNPA 3NAAH 4KXCA 4R26L 3K2UL 5F9AC 4TSAL 3N1QC 5H4YA 1K9TA 4YDJB 5EBGA 3G5XB 1OL0A 2EDEA 2JCCE 1KN4H 2HTKC 1XZWA 4FKKA 3WIAA 3G6JB 3PGCA 3H8NA 4BK4A 1U58A 3EGSA 1F4YL 4YXLL 3DTUB 1SEBA 4GQ9H 1SEQH 1H0DB 4WW2F 3P9LB 4PRAA 1RVFH 1X5XA 4WJG3 4Y2OB 1WK0A 5A3ID 3KEHA 2OZ4A 3TBWA 5L4FA 1BZOA 1YEFL 4IIZA 2IH9A 4IRZH 4Z6AT 3HG4A 2LU3A 5H37A 1KB5A 5T1DL 3KWUA 4UUJA 4PRBB 5F1IB 1BYPA 4YZWA 4UNIA 3OV6A 5IHZB 1T7XA 4C47A 2AXFB 1JK9B 1NBCA 5DEJA 1I53A 3V4LA 2IDCA 6FABL 2QPEB 3FBQA 2HCZX 5E08H 2G5BB 3H1ZA 5CJBA 4C83B 2P80D 4G7YH 4M93B 4NO5A 1KIQB 1ULVA 5BRPA 4X5XB 3NSFA 4XO8A 3SSGA 1H3PL 3NDYE 3US1A 3QXUA 1JV2B 3QQXA 3B9KB 1IC1A 3NK4A 3MVSA 5DUML 4NKIH 1A9VA 1T5XA 3FZUC 5JNYA 2NOYA 3L54A 2YKLH 1IGTB 5MENB 2VLRB 5JDSB 2F8XC 2FO1A 5EZJA 2J8UF 3U30B 3FH7A 2I07A 1IGFH 1I1AC 4QWWD 4DP7X 3O0RH 1DQQA 1ADQL 1XF5B 2NYKA 4FS0A 1KXVC 3RNQB 4NX0A 1PKOA 2X2YA 4HHAB 4W4NA 2CCWA 2UZYA 2F7QA 2QMKA 3FAXA 4NQUA 4NSKB 1HZHL 2X4UB 3OGCB 3ZO0A 1M3IA 1CXIA 1JFQH 3GXDA 1V3KA 4IJ3B 4WFEE 4H88H 4H26B 2ZSVA 4JO1L 4L9LC 1EJFA 1J1PH 3I6KA 3FT4A 1E28B 3HN8A 4LCWE 3CK0H 1AY1H 2IH8A 1OM9A 4U1LB 2YAEA 5C0BE 4O5LL 4BINA 1DHKA 4MWFB 2JTDA 4WWID 4FN0A 1A8ZA 2C3HA 4JEGB 3EAKA 1WFUA 1KCBA 2ZJSH 1RJCA 4I18C 1CBVH 3KLSA 1N18A 2E74C 4PJXE 2VXTH 4BH7A 4CBPA 4NAJA 3HS9A 5IF0B 3HZMB 1SQ2N 1TPXB 3DXAB 5T3ZD 4NJ9L 5LGHH 4PQXA 4D7PA 1SJEB 1E67A 3F00A 4FG0A 4YK4B 4Z7QE 1EHXA 1OQXA 1HCVA 1GAFH 3DURA 4ZQKA 4H4NA 3NP3A 3QT2A 2DQIH 3AW5A 2BW5A 1SUJA 2ODIA 3TBVB 3BT2L 4DGVH 1TT6A 1QYGL 4M6NL 4XN1A 3BAJA 4JGNA 1Y1UA 3HW7A 5HDOA 3AG4B 5D6DC 2I60H 5JHDE 1BXXA 4BE6A 4XMKL 3TJEL 2FEEI 5I74B 3D12B 2E9IA 4BZ2A 3IDYB 3SPCA 1JGVL 3OWRA 3DX3A 4GRWB 4Z7UA 3Q0HA 1JNNL 1ZHBB 2XWBA 1OP5K 1OAZL 4PP1D 2O5XH 3HCVB 1W0VB 1NFKA 1U8HB 2GBUA 2YOAA 1FNEA 4NI3A 4XP1H 4PGCA 4LGRB 1DE4B 3S5YA 2FQGA 1L7IL 3BE1L 3BQUB 3OHMB 3CZLA 1GIGL 4F57L 5CJQL 4YZFE 1IV8A 2CBQA 2VITA 4PWHA 4ZT1A 5IW1B 5ID1B 4LHUD 5E8NB 1AACA 4JRXA 2JELH 4MTMA 2ADIB 1UOWA 2W9EH 4XPAL 4UZUA 2G4EA 3L3DA 4L8DA 1CD1B 1URLA 5F8RC 3SJVE 3O4LA 4G1MB 3V52H 3THMH 2EO7A 2C7UA 4LIQE 3K81A 4MS6A 3V8OA 3LQAC 4LLUA 5JUEL 1M71A 1BFTA 1PQZB 3N85H 5F7KC 4APQD 3B2VL 1FNFA 1L7TH 2F0CA 2XWEA 4D9QE 5I1CL 1RXLA 1XR8A 3GSRA 4H0IA 3TPUA 3GSOA 3HCVA 5AAMC 3I6GA 3QZNA 4I1RA 2ADFH 1NOAA 3H4FA 4M1DL 1MIEL 3ZQXA 3S36L 4IKKA 2ERJC 3D33A 4JZOA 2G4GA 5CIPA 5EUKB 1M6UA 1OAXL 5D96B 4S1QH 3IETB 4ZMYA 2NNAA 4X6FA 1MLBB 32C2A 2J8UB 4NS0A 1NGPL 3CHRA 1SYVB 1XXDC 4PI2A 3L16A 1AE6L 1R3LA 5C0ND 1O0VA 1QFHA 1ZV5A 3NESA 4P05A 5HY9B 2AJVL 3P0YH 3DIVA 4QHMB 1MOEA 1CWVA 5F96L 4W9GC 2V5TA 4NAMA 5DJ8B 3V5HB 1RJYB 2KI6A 5C0DA 3ARDB 4JDEB 3IAGC 3MACH 1Y18B 2FDBP 2R0ZH 1E9QB 3TV3L 2GBTA 3B1TA 4RDQF 4DUWA 2LOEA 4TNWF 3QO1A 2P5EE 4KDWA 3ABGA 4NQCB 3BRGC 5C0JB 4ZW7A 5CJOH 1TZAA 1GMIA 4MAZA 3HUJB 4M4PA 1RH8A 3Q6GH 1CS6A 1X5FA 2AEPH 2X6BA 3SO5A 1ZK9A 2F1EA 1PW3A 3Q9QA 3HVNA 4LCCC 2A74B 3ZIYA 1BJ1J 5ID0A 4KY1L 4XXDA 3TH2T 3DTXB 4F8LA 2WGNB 2FSDA 1OE1A 1CGTA 5KWYC 3IJSA 1N6QL 4UT9H 3T2OA 1KTRL 3NJXA 3ZHDA 3O8XB 4G5AA 3V6ZA 3LXBA 3MTRA 2ZXQA 3DYMA 2XFXB 3CZKA 1UWYA 4S0SD 1NSNL 5PCYA 5C3LD 3FBKA 1ONQB 4NYLA 3L3HB 4FLOA 4JGJA 4UDTA 5FC9A 3ZE2E 3HBZA 4ZO7A 5HPMA 1IBBA 1EVUA 1HL4A 2ZYSA 4OW6A 2NY6D 4IIQB 4ZAKC 2OJEA 3O3UN 3V6OE 1XGTA 2F2HA 5I6XC 4GB9A 5C97A 3UTSD 1U4FA 4B27A 3M1CA 3FW6A 2I85A 3GIZL 4OQTA 1YNLL 2BOBB 2AJZB 5HHPA 1ZGLP 3EJCA 2PWGA 5JDSA 2DQCH 1MRFH 3N42F 1JPGA 2ADJA 3V0EA 3B7SA 3ELAT 2X9YA 4LVHB 1XR9A 2DQ6A 4FQXD 4TPRH 2X44D 4OD2B 3UTPE 3VD2A 3BCDA 1A7PH 1JZIA 3AACA 5JIDA 5IHZA 5DEGB 5EBLA 4AK2A 2WKLA 3NYKA 3VG9C 1MCLA 4YDKH 1P84J 3B7UX 1MWAH 1KYUA 4XHJD 1UOVA 5IB3A 4PJFF 1BIHA 1QZ1A 1E9QA 4FEIA 4TUOA 1G5GA 4PLNC 4OZHA 4A6YL 2MCAA 1OGAD 2ZKWA 1KGCE 1RQ5A 4HIEA 1MFBH 4PGEA 3RDTB 4M4RA 1FYHB 3PDOA 4HV8B 5J1AA 2F53D 4M5TA 4YVUA 2X6MA 1BD2B 3NFPB 4B96A 2BSSA 3LKPB 3KPSE 3SPGA 15C8L 1GJIA 1GS7A 3QEQE 4FTVB 4NUJB 2DTML 2FUTA 1YEHH 4FQJH 5BRQA 1JWUB 3Q9PA 3C8DA 3MRMA 5DJAB 1UWGL 5CCKH 3US9A 3KPMA 1RK1A 2G3ZA 3QULA 1O9ZA 3CCHB 3MRBB 4WEEA 4PGEB 4YWGL 3G6AA 3MR9B 5J13C 5EZIH 3KVPA 1A2YB 2N7BA 3C6EA 1TLMA 1JGLL 2ZWLT 4BSJA 1LMKA 4BCZA 1UYWL 1AGFA 3OAWA 5E23A 1PNDA 2FQFA 5T1MA 4OM0L 3K74B 1ZLSL 1E4KC 1BIIB 1EHNA 5IJVA 3MOBH 3AFLA 1Q9WB 5E6SB 4OZIB 4RBPK 4FL4B 3V0WL 5J3HC 3WXWH 1UM4H 2EDTA 5D72L 3R4DA 4MS8C 3DKHA 3O9WB 1HHKB 2F1AA 3BT0A 3QPXH 4KKLC 4W9ZA 5B38A 4X9GA 1MQ8A 3OM3B 1XCTB 4XMWA 3SDCA 1XF2B 4UM9B 5BV7L 1Q9OB 2Y1AA 35C8H 2ZUUA 4HDIA 1RUPH 1G7QA 2UZIH 3C08H 4K55A 4OCRH 5E2UH 5JHAA 1OAKH 3G9VA 2AJZA 5HHPB 4NXSA 3N04A 3RA7H 3MLRH 3KYKL 5JOEA 4HOXA 4ELMF 5FO8B 3C5ZA 1KTDA 3M07A 4PJIB 3QB7C 3T4YA 1SJVA 5FV2A 2YBGA 5EU5A 4YBLC 3I3BA 4R4ND 3WIFA 1LE5B 1JZ5A 3WYRA 1U8NB 2NY5H 1E8YA 1MJUH 5I17A 5INDA 4XMTA 5JUEH 4S1SL 4CC0A 4F8NA 4FFVD 2F54A 4JN2B 5F88A 4XNYH 2BFVH 2IALB 4G7QB 5JQHC 1SXSA 4KQ3H 3FB5A 1MI5E 2PLTA 1DQMH 4QCIB 4PS3A 4QI3A 1LYQA 1OF0A 4Z18A 1AE6H 4GEIA 5EF1A 3GZOA 4ZFOA 2DTSA 5DD3H 4PR5B 1DN2A 1KC5H 3BP5B 3RX9A 3S3BB 2O72A 4L8SC 3INUL 3SDDB 3WS6C 3DV4B 1EIBA 5GZOA 1OAXH 3LRLA 3N43B 1UVQB 4X6EA 4OIIH 1G6RH 3ULUL 3FU0A 3O3BB 4GXVL 3UYPA 4LMQE 3PABB 2NQCA 5CLXA 5E9NA 4KHTH 3FQXA 3F58H 3LIZA 1SOQA 2V2WA 4M6OH 4CJ1A 2FUQA 2WXJA 3WKML 4HWBH 1L9RA 3UZEA 3HS0A 3ZTJH 3NH7L 3QORB 4NM4H 3V5HA 3PLYA 4YX2L 2CJ3A 2UYLB 2NTFA 1G5AA 2YGOA 4QHMA 4J8RB 1MCPL 3V6OC 3LPOA 4IOFC 1MJJA 2E46A 4N6RB 1FPTH 5KVGH 3VGDA 1GZPB 3QFDA 3QUXB 2YARA 4JFEE 2VMEA 3TJEH 1JZ8A 1SZNA 4DZ8A 5J11C 1J8HE 3K91A 1DBBH 2BIHA 5C08E 4LCUA 5INDB 1I1AA 1N68A 3OGCA 5DJCB 4OF8A 4C56E 4OUUB 1PG7L 2MMXA 3JTTA 1WWCA 1H8SA 1YG9A 3BDYH 3PHOB 1J05B 2JELL 3RIKA 4QCIA 5F97E 4WSJA 3ARFA 4HH9A 1R6VA 1KG0A 3ECWA 5FFGA 3Q43A 3QRGH 5DD1H 1KEGL 2ZX7A 2UY6B 4L05A 3ARGD 3WD5L 3E7JA 1QTSA 4UDUA 3R7RA 1JGUH 2Y5QA 2BSEA 2JJSA 2UXVA 1K2DA 3MJ9A 1PX8A 1AY1L 3FFDA 3MLZH 5GGUA 1IGMH 4WI4A 1DZBA 1IAKA 4K3DH 5K39A 1U3HB 3U48A 3G5ZA 2I5YL 3UO1H 4XWGH 5IHUH 5E1HB 3IJSB 5FUZH 1ECYA 3B43A 5AKSA 4ZUSA 1KJMA 3FO1B 2FLRT 4P2QE 5HDBB 5FX3A 4AZ8A 1T4KB 3O2VL 4J8RA 3E0GA 4LSRH 1UH4A 1NFDB 1QNZL 1HNFA 4NIKB 2OR9H 4IS6A 4P06A 3VFMB 5I0WA 1WRFA 2ZUWA 3P4LA 5E6UB 5EORL 5K1JA 1UQSA 2IQAA 2NX5B 2G60H 3MLVH 2WZAA 1RMFL 3NP4A 4I0PA 1CFQB 2OL3L 3HMXH 2B14A 3RB5A 2ZNXA 4KO6A 2V33A 1U8HA 5KW9L 2B1HH 1I85C 3L81A 4J3VA 2B2XL 2LABA 1SXCA 1H0DA 3Q8BA 5E6IB 5C1MB 3W9DA 4FI6A 4B3EA 4FXGC 4WGKA 5D1XC 1FE8L 5C0CB 2APSA 2XKUA 5LO7A 3CH8A 3JBG7 3O41B 4LLQA 3GSNL 2ALAA 1JFHA 2X42A 4PY8I 4UIKL 3GUTA 1D5BA 2P8MA 2XLLA 1AXIB 1HAUA 5KJ7E 1L9OA 1MRDL 4L8SA 2EINB 5CIPB 5EUKA 1PS3A 2NW2A 3I3DA 2EXSA 4GO8A 1YEDA 2ZF9A 3CU1A 2MCMA 1X5AA 2BY2A 4ODHL 2K3HA 4GW1A 4JBSA 4YXKL 4GI8A 4EI0A 3MYJA 3KWWA 2HJLA 3MCLH 2ITDA 2BNQA 1HVXA 2WXMA 3BPLC 3D4GA 3EO1A 4ZFQA 4DESA 2OK0H 3ERXA 4NKIL 4XP6L 4JFYB 5BV7C 1CJYA 1WIPA 4ODXA 4UM8B 3ECUA 3LN9A 4LFHG 4O2EB 4U1IB 2A1WL 2L3BA 4LPUA 2WTRB 3MCG1 2COQA 4DZBB 4P5TC 5DRZB 4L9LB 4KOBA 2R9HD 4QHUB 5DD5L 1IQDB 2Y7OA 3V0IA 2IGTA 2FATH 4GKSA 4UV4H 5D4IA 2AJSL 4X8JA 4YXKH 2NY7H 4XBGA 4ZBJA 2Y22A 3JZYA 1OD7A 2GAZB 3RIFF 1KIRB 1PZCA 5EN2B 2G3NA 1HHJB 1EDYA 1IGFL 2ICWB 3P9MB 4GP4B 5ELIA 2RMNA 2NSMA 4HJGB 3VWJA 4D9QD 5I8OL 3KPMB 1GGBH 1R24A 3QCVL 4OZ4B 1F45A 4I85A 5EC2A 3B2MA 3IF1B 3GTTA 3VFTB 2XPGB 2X6AA 2ZUQC 4K8RD 1MJ7L 3BMVA 4LQFH 4NQSA 1KIPB 1YVLA 4FGMA 3I6LD 4OJEH 1KJ3H 4JDEA 4MQTB 4CN1A 3QH3B 4E9VA 1FFPB 3AAZB 2GJRA 1U8QB 3L3OC 4RAHA 4ILDA 3VXSA 1A25A 4OZHB 1E6OH 2JVUA 4GKZA 2FH6A 4K94H 4Z3FA 2GCYB 2NPLX 4FMVA 5SWQA 3UCRA 2NT0A 3U2JA 3U7YH 4YLCA 5EZOL 2I9LB 3C5XA 3WN5B 5CBEB 5TE7H 4JFHE 4KZEH 2R0LL 5ADOL 1N8ZB 3KXFD 5KZCB 3VXQB 3FCSA 5CJXA 5C6PB 5I23A 3D08A 1NMCB 1TNMA 2DM2A 2VR4A 4I3SL 2FJGA 4JAMB 5GGTH 3RWIB 2X10A 5KBLA 1IEHA 2BSTA 2XN9D 3HRPA 1R24B 4XCNB 5DHMC 4BFRA 5DVMA 4HGKC 4OD1L 4H8PA 1SGKA 2EIZA 3DHUA 2HG0A 3OLDA 3U4BH 3ESNA 3MXVH 5CCGE 2GHZA 3VFTA 1NGXA 2R2HB 1FVEA 1L9TA 3MSPA 4JPKL 3BSHA 1GR7A 2MOGA 4U4BA 4MQXD 3SY6A 2QVIA 4HKBA 3MJWA 3FQTA 5CIPH 1ZXQA 3IMRA 4M7LL 3EFDL 3KW8A 4MJ6B 1B6UA 1QWUA 2D9QB 4YHML 4NQED 1A6PA 4RIRA 4EDWL 2EDMA 2OMTA 3J07A 4NN6B 4QT5B 2MIZA 4FD0A 5FYJD 2IIJA 4WIQA 4V1DD 1CL7H 3L3IA 5BUPA 3IDMB 2XTLA 4MD5B 1FNLA 1YEGL 2X4OB 4M3KB 5G5DA 1DBBL 5FYJL 3K2IA 1A7NH 1QEWB 4JCLA 4M9PA 4NNPH 3UTSE 1PLCA 5FFLA 4KO5A 1LO2L 1QLEB 4APXB 2ZCKL 3RU8H 5HHVH 1PSKH 1YCSA 2W65A 3UAAA 5CEYB 4AV4A 5T1LB 4A1RA 3P11H 1YHPA 2BIIA 5AQ0A 3SGKA 3F12B 3TWCH 1DVFA 3NCWA 5T1KA 5L2KA 4YK4C 2AP2A 4NM8L 1EH9A 3L2MA 3VXRA 4W9FC 2IVFC 2VDQH 1AGCB 5ESVB 4PLKC 3HAEG 4FZEL 2GTWA 4N5ED 4P2QA 3KE0A 4R5TA 3RWFA 1V3MA 3ATBA 4G6KH 5FO9B 4PEEA 1W15A 3QDJE 4OLVL 2J56A 3ZK0A 1NCTA 4AYID 2OMXA 3GTVA 4GXVH 4PRHA 5ERWA 4WNQA 5AW4B 4HAFA 2QMJA 3QUYA 1GRWA 3PP3H 4JY4A 1DVFD 1Y6NR 4AYEC 1DQLL 2HVJB 2EVGA 4LVNC 3MRNB 2C9VA 3BVXA 5KAQF 1YMMB 2R1WB 3F84A 4K5MA 5KG9A 4Z76A 4X8CA 4DHLA 2A0LD 3O41A 5I15L 1SHXA 2K4AA 1IE5A 2XWZA 4P2RE 2EE3A 2CRMA 2OMYB 1RP8A 1NH6A 2C4XA 2HVKA 2UXFA 2WB1A 3HE6D 3NQKA 4FQLH 5T1LA 2HP4A 1GS6X 4OZHE 4KXDA 1O7VA 4KXAA 1FIGH 5DD0L 4OV5B 4L4TD 1S5IH 3KHQA 1KLFA 5D5MF 5AL8A 2EIKB 2VT0A 4ORGA 5A2LH 3MCKA 5FUOL 3ZUCA 5LDUA 3IM1A 3W11C 1SJEA 3D39D 4ZOAA 3DUHA 3ZKSD 3D2UD 4MD5A 1TVDA 1OCRB 3V0FA 2X9ZA 5FOBB 3PJNA 4QF1B 2KPWA 1GCYA 4W9IC 4Z0BH 1IRAY 2YUVA 4J27A 3CX5J 1EO8H 4QAWA 4AV0A 3IE9A 1R3JA 3D52A 3AT0A 2NY4D 1IKNA 1CVSC 3ARUA 3QW9A 4Z0BL 5F9DC 5C0AD 4PJ7F 1D5IH 1FGNL 4L3AA 1MRCH 1TO5A 4FNLH 5ESQA 3QFJA 4ZTPH 4AIZB 1J9SA 3ZDXB 3MC0A 3VFPA 3ARBD 3QO0A 1J8HA 2VE6A 1PD1A 1OM3H 3VM5A 4FQHB 4UDUB 4IKJA 4QOKB 3TP4A 3MNZB 2VWEE 4P9HH 3MJ8B 1WWWX 2CA3A 4G9FA 5GS0C 3H3KA 4L3EB 3V2AR 3JSSA 1IL1A 4K3EH 4C56D 1RZQA 3MJ7A 3PWNB 5HYIA 1L9SA 4PD4J 5DMKA 2B7DT 2I60L 3RWHA 2WVTA 4FNQA 1AI1H 2AK4E 4JFSA 4NBYB 2I9TB 5GJTL 1WBZB 2DWXA 3BIAX 4FKHA 5F7EH 1J48A 4TLSA 1E0OB 3RKDD 3EJZC 5I1DA 2VMFA 3FDWA 3N9GL 5IFAL 1DBJL 3VWKB 3T5WA 4WDIB 3AWFA 3T3PF 4UOW0 1F11A 1HNYA 3GSUA 4JFQA 3VVWA 3LEXB 3LRSB 2ZD0A 1OCZB 2JCCA 2NSXA 1X5MA 2ITCA 2YSSA 5L2JA 3PAVA 1WA2X 1OGAB 1JCVA 1M2VB 1ZLWH 4N90E 1UZ8A 4R3SB 2MPAH 3WKQA 1UKQA 1CLOH 1TTBA 1X9LA 1ZT1A 4LCWD 5SWSD 3ZYJA 3IAQA 5EZOH 1SN0A 4FHJA 4LFHD 3N40F 1I3UA 1JHLL 3LQZB 4AIXA 3NJNA 2Y4SA 4FL4C 1H5BC 3I75B 1QATA 3MN8A 3GMNA 4PJCB 1CK0L 3CLEL 2AQNA 4QRUA 3HZ3A 1G1CA 3G6JA 3NCMA 3POCA 4KK8D 1T80A 4MAYC 3JV0A 2E8YA 3GSXA 2WCPA 3IJEA 4LLVA 2SEBB 3BDXA 3EYUH 4IDJL 3VDAA 5IWLA 5AD0A 4UQ2A 5F9WB 4MMZC 5DMIL 2X9WA 1NLDH 4MZIA 4NOBA 2B4CC 2UZPA 3V8CA 5MEPB 3I84A 4O9HL 3AVEA 3QISA 1PG7X 4O58H 1NL0L 4JDTL 3P77B 4X5WB 3EYFA 1LO2H 2OS7A 4PJXA 1HQRB 3P4OA 2WNKA 3C5ZB 5CUSL 1OAZH 1CLZL 4UINL 3VNYA 5F0JB 1XF4B 3M45A 1B0RB 4WFHE 4X80H 3D4CA 4ZMTA 3WS3A 1KIQA 3DO7B 4Y5XC 3P3SA 4HIQA 5AW6B 4Y7OC 3G08A 4D3CH 1UA3A 5I5MA 4OFVA 1TCMA 4L4VA 2H1XA 5H35B 4DKEL 5KYYA 4L3ED 4PG9B 3RJDA 1BMWA 4W9HC 2EICA 5DUPH 1ZXKA 1T0NB 1I31A 1IBGL 2DJ4A 5I8CA 1G9NL 3QDGE 2YPKA 4K23L 5EO1B 4HT1H 4XTRC 3RURA 5T3XE 1ITBB 3FU5A 3BFQG 3KYOB 3CIAA 3VTMA 5LXGL 5D2LE 5KOVC 3ZHKA 4FX5A 4AJ0A 1F4YH 2XVKA 1HHHA 2WN2A 1BQ5A 2OQJB 3OB0H 4BDVB 5BOZG 1GHFL 1URIA 4NQCE 1GGBL 4L3CA 5ISZE 4JM2B 2H6UA 4EOWH 5KJ4A 4O5LH 1ZS8A 2AHIA 4EMZA 4KX9A 3GSWB 3T0EB 3MA7B 4G8GA 4QRRE 2E75C 2VH5H 4YHLH 4WNSA 1MHEB 4Z7NF 1M2VA 4IRJB 4FE9A 3V9EA 2YXFA 2PWEA 1HKLL 2CPCA 2J1YA 1HU8A 3C60B 4JJOA 5AAMA 3TN0B 3QEQA 2WBJA 5BZWA 3ABKB 3MBED 3QIWA 4LOEA 3IGLA 4LB8A 5AYQA 3DX6A 5F7LB 3US0A 5J9PB 4UMSA 4AZUA 2Z7WA 2AQSA 2GITA 5BXFA 4CL7A 1CGUA 3QR2A 1XEUA 6PAZA 2FEDC 3K4DA 4LP8A 4Y4KA 3B2VH 3D0LA 3T0XA 1G7HA 3GWJA 5I6PA 4FFZH 3FQYA 3RBSA 3ULVD 4OD2A 2Q5BA 3UYRL 4NQCD 1NCAH 4N2HA 3KL5A 3FONA 4Z77B 4PJGF 5EIIA 4P2OA 3BI9X 5EUOF 2BMKB 1N3NA 3WIIH 2FR4A 1XF4A 3PGFL 2B5IB 3KS0H 3V5DB 2BNRE 1XH3B 3WE6B 5DTFB 1JXDA 4GINA 3QNXA 1J05A 1RJZA 5B39B 4PJEB 2MQ0A 2MTPA 4WHCA 1CUOA 3ZL2A 4Y9EA 1C5BL 1BXAA 4LO9A 3RL2A 3FTWA 4Z3GA 4N86A 2WKOA 3QWRA 1FC2D 4JNXA 3PWVB 4R97C 5D70L 3FONB 5EIIB 2D7TH 4Z77A 5EWIH 3FO2B 3KCWA 2EQDA 1THAA 3PWLA 4L29B 3SE4A 3ARRA 3N1MC 4YE0A 4Z7VE 2BWIA 3VFVA 2XT1B 1RIUH 4FFZA 3PCYA 1X5HA 5JDJA 2MNWA 4HBCL 1X5YA 3NCJL 2WLLA 1UB5B 4X42A 3JV4A 3O3EB 3VI3A 3ZW3A 1GVIA 1J0YA 4HAKA 5C07B 4F57H 1OT4A 2K4WA 2YR3A 3WL9B 4NRXB 4I9WD 1M7IA 3HRZA 2YLHA 2KERA 3M8OH 2DQIL 5HYJD 3A22A 5C0DB 4PJHB 5CR1A 3WUZA 2KLRA 1NFIA 4X9IA 3S5ZA 4FEMA 2Q2LA 1ZS8B 2IGFH 2CKBB 5A6MA 2BCKA 1CO1A 4YMPA 2XWJA 1FPTL 5TFSL 4Y16D 2AV7B 4PS4H 2EEXA 4EZMA 4QEGA 1XD1A 1UCBL 2DD8H 2VDLB 4G71B 4LSTH 4V1DB 2J5LB 4NM4L 3T8XA 5E1AB 1TJHH 4PS4L 3EOTH 2WOBA 4AIOA 3PAYA 4TNVK 4POZD 4FJYA 4UQIM 5FKAB 3SDAA 3SE9L 3FFCE 1XL6A 1MFNA 1NFIB 3TNNA 3MLZL 3OAYK 4X6FB 4B3VA 2EKSA 3CVBA 4I89A 4OT1H 3D18A 3HG0A 5KANI 1U8OB 3BZ4B 5CLZA 3W0WB 4KI5C 2FJUB 2Y9RT 4QJ5B 4CMHC 4GEJA 3Q48A 3B56A 5EO0A 3KCPB 1E2VA 4LVOB 1S3RA 1ZTXE 2VLKE 5FEBA 3BVUA 3H0TB 3QXTA 2BHZA 3L3IB 4O2CB 4UQ3A 1DJWA 2FWSA 2Q76A 1JF1B 4FLRA 4HCIA 3VTAA 3BIKB 1G1OA 3SGJA 5DS1A 1J1PL 2OXGB 2WWNA 4HUUA 3TO4D 3EOTL 4JG5A 2YD6A 4M62L 5FGBA 1T3FA 1ZEAH 3K6IA 1G7JA 2GSGB 4AV5A 4JRXD 3MLSL 4DOHE 1BM3H 3BD5A 5J89A 3WTYA 2FB4L 4AXWB 2NXZD 1P4LB 3BISA 1BREA 1G1KA 2ESVD 1G9ML 5MENE 3BWAA 1D9KA 3HZVA 3IWUA 3QZBA 1PU0A 4D0BB 4LEEA 4PRDB 3T6XA 3OKYA 2VR3A 4I87A 3U0PB 3H6JA 3ESOA 4WO4C 2DWDA 5A2KH 2RQ8A 1U6AH 2DWEB 2DIBA 1X6NA 3LEYH 2P24B 4LDLB 3FCSB 4L4VE 5EMYA 3QYCA 2G3MA 4U7KA 5HHNA 5B3NA 5DSCA 2Z31C 2NT1A 2VQ1A 1J0IA 3UIZA 5GRZA 1YQ2A 4KC3B 2BSTB 1O6SB 2WWMD 3GYRA 1IGCH 3WJJC 1J8KA 5C0RL 1IBFA 1D5ZA 4LQ1A 4BH8B 5LXGH 4H8QA 4EUPA 1TJGH 5GRVL 4ANXA 4G9FE 3BHBB 2EDNA 1UOLA 4UILL 4YPGB 3BXNB 3ILDA 1OZTG 4Z7UE 4XXWC 1MH5B 5FECA 1KYOK 1RFDL 1FL3B 1WFNA 1PX4A 5EIQA 5AZUA 1QR1B 1MNUL 3QJHA 4FQ1L 3P30L