1WYJA

Solution structure of mouse protocadherin beta 14 (26-137)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
125
structure length
125
Chain Sequence
GSSGSSGAGSATITYSVLEETDRGSLVGNLAKDLGLSLRELITRGAQILSKGNKQLLQLEQKSGNLLLKEKLDREELCGSTNPCILHFQVLLKSPVQFIQGEIQLQDVNDHAPEFMEDESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of mouse protocadherin beta 14 (26-137)
rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords protocadherin beta 14
total genus 11
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2005-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08266 Cadherin_2 Cadherin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 1wyjA01
2OMTB 2WHVA 4ZMZA 2OMYB 3K6IA 4ZTEA 4XXWC 1O6SB 1ZVNA 4AXWB 2YSTA 1EDHA 2YQGA 3LNEA 2OMWB 1WUZA 3Q2NA 5KJ4A 1L3WA 3LNGA 4ZMWA 5JYLA 3LNHA 1ZXKA 4ZMTA 3UBHA 1FF5A 5CZRA 4ZMQA 2A4EA 1OP4A 4AQEA 2QVFB 4ZT1A 4ZI8A 4ZMOA 2EE0A 3LNDA 3QRBA 5CO1A 2X2UA 2OMZB 2O72A 3MVSA 4APXA 3Q2LA 3FF7A 3FF8A 1SUHA 3K6DA 3LNIA 1NCHA 4AQ8A 3UBFA 2OMUB 4ZMYA 4AQEB 2QVIA 4NUPA 2OMXB 1NCGA 4AQAB 3K6FA 1WYJA 4QD2E 4NUMA 3Q2WA 4ZMVA 1NCIA 4XXWA 4AK1A 4AXWA 4ZMLA 2A4CA 3LNFA 3PPEA 4OY9A 2OMVB 4ZMNA 4ZMXA 2WBXA 3K5RA 4AQ8C 1Q1PA 2WCPA 4ZMPA 5DZVA 3Q2VA 2WD0A 3K5SA 3UBGA 5JYMA 1NCJA 4AQAA 2V37A 4NQQA 4APXB 4NUQA
chains in the Genus database with same CATH superfamily
5JIKA 2Z93A 3FONA 4TUOA 4XCEB 4KZ0A 3R4DA 5JDJA 3V4VH 4FYRA 1T03H 3OAWA 4ZTEA 3I2CL 4GSXA 4PIRF 3I6KB 4WFEE 4GRLB 4UBDD 1MWAB 1RZFH 4A7UA 3CLEH 1WCQA 3QUYD 4MNGE 1RQ5A 3D50A 1TVHA 3BAIA 3QB7C 2VDRL 4JM4H 5KYXB 3B2MA 3VE0A 5J5EA 5D8JH 4YXLL 1CYWA 3JV6B 4MBRA 4ONFL 1N4XL 3UPRB 3CN1A 1JZIA 1U2HA 2PCYA 2BSBA 3MNWA 4UAHA 4ZMWA 5DMIL 3FO0H 3QQ9D 1I75A 4UV7L 5DD1H 4I7ZC 3RIFF 1GAFL 3B2VH 3D05A 3W39A 4B3VA 5E1QA 1J5OH 1ILUA 1CD1A 2NUPA 4BE6A 1UT1A 4PJBA 3DX7A 5ITBH 1SJHA 2DD8L 3ILPB 2L7JA 4D8PB 5AL8A 5E08H 4QRRE 5LHDA 4P4KD 1F8TH 3SO3C 2XCMC 2FECI 5I1EH 5IP4A 4JFPA 1OO2A 2YA0A 5EIIG 4IOFD 1SM3L 1UYWL 1G6RA 3QRBA 3H3PL 3MLZL 4JPIA 4QDGA 4ORGA 1MJ7H 2R69H 3P9LA 5KSBB 3RVVC 4XC1H 1KELL 4XCNA 3TJPA 2EP6A 3PWPE 1MQKH 2EUZA 1FYTA 1IILE 2XTLA 1RZPA 1FRGL 2AJZA 3MV8B 4U49A 4QXTB 5KSUB 2AS5M 3B56A 1AQ8A 4B9YA 4PH8A 1NWOA 3JT0A 3P3RA 1JPST 3X1BA 4NHCL 3CN4A 2F61A 2FSEB 4HCRL 2YD0A 5EUOF 3A3YB 3CX5J 3GTTA 4NFBA 3ZYOA 3GF8A 1UKSA 3MLXH 4WDIB 4TUKH 1FZOB 1ZTXH 1DFBL 2KZ1B 3FSVA 2KPWA 3PP3K 1N0XH 3VFTA 5FO2A 3IFNL 3PWPB 1LO0L 3O6LL 3MLVL 4KTDL 2BOCA 3MNVA 2BNRD 2BCKB 1MELA 1UWXK 5IHWA 3EH1A 3HHMA 3DRTA 1R4XA 3J8F7 5D5MF 3FQTB 5EPMB 3FCSB 1QR1A 2VISB 4K0OA 4G6FD 5CLTA 3ULUL 1KIQA 5JLZB 5DHEA 3EJJX 4BIKA 5I16B 4OV6F 4O9HL 4OCMC 3WFBH 4YDZA 5D1ZA 1AR1B 4QGTA 1NCAH 5AB1A 1IEBA 3AREA 1MY5A 2XN9B 3UTTE 4HX1A 3OKEB 5DHVA 1YMHA 4DIXA 4KJQD 4TQIA 1H3PL 5IFAH 3KPSA 2OULB 1A7PH 1IO4C 3ZTDC 2VTFA 1NAKH 4OCNC 2B59A 2ORBL 2QGEA 1CU4H 3VFTB 5AAPA 5GGVL 3NJKA 3SDDA 3GPEA 4UUJB 4P2QE 2G75A 2Y69B 4OLYH 3ZQXA 2A9NH 2UZYA 3B8SA 4K3DL 4X4ZA 4YX2H 4Y19D 4U1MB 5D96C 1CFVL 4OFDA 4RX4D 2DBLH 3CLFH 5DC9B 1QKZL 2XV6B 1IGFL 1TQCB 4GW4A 3U48A 2IPUK 2Q2LA 2RALA 1UB6B 4ONOA 1RJLA 5AWNL 4AL8L 1U8MA 5F9OL 4OLVH 1KGUA 2YPVA 4KUZL 3SOTA 4AJVA 2XVKA 4HX1B 3RDTB 3SBWC 4L1DA 5C09E 1MAJA 2KZWA 3WFDL 3QUKA 2NTFA 1H3WM 4BFOA 5BNXD 4FX5A 4X9IA 1OLLA 2CHXA 1NGPL 2DQHH 2VLMD 4U1LB 2K70A 2AQRA 3GO1L 3MRJB 3DJSA 4KMTH 5IM7B 3H6JA 9CGTA 3UC0L 4RQQB 4BD4A 5D71L 2EUVA 3N42B 4HP5A 4U1IA 4Y9CA 5LXVA 5F8QC 4Y9BA 3DOSA 2AXGA 4H1LA 1OHZA 4D7BA 5CILH 5IMOA 1X5ZA 3CIAA 1NC4A 4NUJA 3NIGB 4MS8C 1M6UA 3M07A 4M61B 1JMZA 3IAQA 1XGZA 4MRCA 4LP4A 4DKFH 2FB4L 2VH5L 5IHUL 1FHGA 5IVZA 1NDMA 3SN6N 3LZLA 1RAMA 5J3HC 1BJMA 2XWJB 4WU7B 3HRZA 3OR6B 3M46A 3GGWB 3TA3C 3PUCA 2DAVA 2VGLM 2JELL 5T1LA 4B27A 1G9EA 4EN3C 3K2KA 1N3NA 3BH9A 3DROB 3ZLQC 4YUEH 3BUTA 1OARL 4KXCA 3HBZA 1BM3L 3V6ZB 2OXGB 2VLLB 4NJAL 1P7KB 3U4KA 2AKRA 3UTTD 3BVNA 4UOQA 1OPGH 1NBZA 3P0VH 4XRCB 2B5IC 4R96B 3GTNA 1GPOL 2J57A 4OJAA 5DJDB 5FO8B 4JQIA 2BC4A 1TZIB 3OAUL 4FHBD 3LV3A 5F97E 2NSXA 3L7EA 4JGJA 2EJ1A 4I0KA 5IQ7L 1ETJA 4N0CD 3RX7A 4HMDA 5AW3B 3EHBD 4GAYA 2BNRE 4AVIA 5LDSA 1A3QA 5EIVA 3UTSD 3HC0B 3MLSH 3IJEB 5JHDD 2C3WA 7FABH 4AT6A 3JWOC 1EUTA 3HZMB 4G70B 5I5JA 5E7FA 5EO0B 1UWFA 3U4EB 2A6JB 5IJKC 3W5NA 4HWBH 1VA9A 1ZAGA 4UM8A 3WXVH 1GHFH 2Z31B 2XIIA 1G7JB 5BRQA 3VGHA 4M6MH 2JIXB 1JF1A 4A2DA 3MA7A 1F3DJ 3FKUS 4OIIL 5IVOA 3G5ZA 3HMWL 3LPWA 1OSPH 4ZQKB 3B7RL 1ZLSH 3U9PL 3C6EA 3D0LB 4XXCC 1E4KC 5LB1A 2BVQB 1KBBA 1AGCB 4JFED 3O0RL 3QFJA 2FX7L 3TIEB 2VABB 1KJ3H 1W0WB 3ME0A 5D7SL 4B95C 2EE2A 1CGVA 2BP5M 1GSKA 3NPSC 1OGTB 4TVPD 4G6ML 4C58B 4HUKB 2VN5A 3FB8A 5KYYA 3X1EA 4W9GC 1QNZL 1RJZA 2GHWB 5LBSH 3EJPA 3SCMB 4EI6B 4UQ2A 2NY1C 1N12A 1UTDA 4JDTH 1AANA 5AW4B 3OX8A 1FL3B 5F9JB 2YPVH 3WJJC 1NBQA 1QACA 1IT9H 3MRMA 5HGDB 1SVCP 3B1TA 4U1GB 1OOAA 1FAKT 4U6YB 4Y4KC 3P3UA 4FYSA 4MDJA 4FTVD 3DHUA 2J43A 4J4PC 2XN1A 3CFIC 3FO0L 3U83A 2HX7A 2RBLA 3APNA 2ZONA 2QLVB 3N3EA 4JRYA 1UA6H 2XN0A 3S35L 4G8IA 5I1HH 2ZXAA 2AV1B 5JDSA 1BIHA 2ERJB 3IB4A 1EJOH 5FLVA 3UGUA 5ADPL 3DOHA 1F8TL 1VADA 4HPOH 3MRRB 4NC2B 5GGTL 1LEKB 1CK0L 3SZ6A 4RAUA 2A74C 2NR6D 4RAVA 4W4NA 1TMCB 2WQUA 4JCMA 2R0ZL 1SQ2N 4WTQA 3MRNB 4E36A 2W07A 4L05A 1AMXA 3ZYZA 3RIKA 2KZKA 1WQVT 1BPVA 1A5FL 4H40A 4YNYA 5LBGA 1J9SA 1ZANL 1U3HA 3C8KB 1KGCE 5B38G 5D7KE 1RZ7L 1ZEAL 4XMXA 3V0EA 2NY7H 3PPSA 5HP5A 1JXJA 4N0YH 3ZKMD 1NFDE 4ADIA 2VXQH 3PPEA 2IPKA 5HHMB 1RPUA 1EAPB 1JPTH 1S9VB 3NEEA 5FYKE 2NY1D 3D34A 3D0VA 4OFYD 2H0FA 3GDBA 2G3NA 3S3CB 1F3JB 4MMZB 2QDVA 2C3XA 4BKTC 1XO8A 4NN6B 4NKMB 2GTWA 4OM1H 3DETC 4ZTPH 2WXJA 4N0UA 3WLBB 1BOGB 3CMOH 4HWEH 1SYSB 3C08H 1T0OA 2JB6A 3CFKB 3SE3C 3CFJB 3L6FA 1UQSA 3C6SA 3GMRA 3VXUD 4X8JA 3C9NA 1NCCL 2CHZA 1YEJL 4C4KT 1G6RB 5I17B 5A16A 4HCGA 3BRGC 3OGCB 1JFHA 4H4NA 3BLBA 4XHQA 2EO7A 3QUZA 4U1NB 5FHAH 1X5HA 4N2BA 4PREA 1QO3A 2Y7NA 3V52H 4I9WE 3MV7E 4YDKL 4TULH 1R3IH 3HC3H 1NGXB 5FECB 2QVKA 3FCUB 3GIZL 4GW1A 4HHAB 2P5WB 3MV7A 4AOFA 3CSYB 2BIPA 3PL6C 1SF3A 1I8LC 2CKBH 3DROA 3RFZB 3U9WA 4S1SL 5C0JA 3MRPA 4ORZC 4C4UA 5EEXA 3DIDA 5HVFB 3WXWL 5DVOA 3TBWA 4NCC2 4X5PA 1JHTA 2QADC 4EN3B 2LU7A 2WQSA 3KYMB 2DKSA 4HKXB 3US0A 3TJHC 3WFDH 1TZIA 4F7TB 3MLRH 3O4LD 3P73A 5DJYA 2XTJB 5L88L 3CXHK 1N10A 1NGQL 5JOFB 3O8XC 4ETQB 1A6VL 4YDIL 3ZR6A 2V7NB 3IJHB 4FTDA 2P5WA 3OTTA 2E7BA 1RERA 1B6DA 4GRLD 4HSQA 1A21A 4D0CA 4NKOA 2UX7A 1KTDA 4JPSA 1WBYB 1ZS8A 1FG2B 1I8LA 5B1KA 1USQA 1FGVH 1HXKA 3MCLL 1S3KH 4FMVA 1GGTA 4N8CH 2B16A 2RB8A 1JDDA 4YLBA 3L16A 2LVCA 5I6OA 3E1F1 2DYRB 3LX9A 4PRIB 2E7CA 3X14B 5IW6A 4NUMA 4IM8A 3QEQB 5IB4A 4PJ9D 5AW7B 5ICZB 3OKOA 3QG7L 3U36A 3N44B 5D1QB 3POCA 2H3XC 3MV11 5DUJA 3G04A 4G80B 2FHBA 4I18C 4FQCL 4U0RB 1FSKB 1GZQB 2J4WL 3LIZH 4ODXA 4PJ5D 3MCG1 4WI2A 1DN0A 4FKKA 4NZJA 4G6AD 1XGQA 4L9LA 4MJIB 3QIWC 4MMXB 4WW1A 1OE3A 5DZJA 1VCBC 1E7UA 2EYSA 3QUXB 5KBNC 4G8IB 4GMTH 1JZ7A 3OAUH 4HC1A 1UASA 1U91A 4CGTA 2W65B 3BZ4A 4ZJ9A 1U93A 2WVVA 1MNNA 1UH4A 2BERA 3WKML 1KPRB 3B7YA 4PG9A 1SBSH 4AIXA 3D07A 3MZTA 1JXDA 2V2WB 4KXDA 1NBCA 1JK9A 1QMUA 1MWAL 3EYOB 1Q8MA 1A7QH 4TVPE 4PI2A 2EDNA 2LTQC 5DRXB 5JW3L 5HGHA 3RDJA 5TE4L 4B5ZA 5LJYH 4WNSA 2AQPA 4TQPA 1DQIA 2XIDA 4M6ML 2FJFB 3IGUA 3I02B 4YNYB 4Z3FA 1FBIL 1MUJB 3QIUC 1FDLH 4FHJA 1N5AB 4ZXBD 3VTTA 3MOBL 2HWZL 1AP2A 3EBAA 3FUKA 5CLYA 2AEWA 2ZSWA 3QEHB 2I27N 5EUOA 5F88A 1EEQA 1NC2A 4R7NB 4RFNB 4DUWA 4QPEA 1A9BA 4HWZA 4OD2B 4MNQE 1U3HB 2CJ3A 4PJDF 4E0RB 2BSDA 1ECYA 4NIKB 3DIFA 4ZFOA 1A22B 1I1AB 4L3CB 1QNIA 5IW1A 1SFDA 4LDOB 4M1DH 3IDGB 2XKNA 1AQKH 1F11B 5DEZA 2ENPA 1Z6JT 1DUZB 5D7JA 1TUPA 2AV7A 2NLJB 3WO3B 4HHWA 4N90D 2JJWA 2JI2A 4GUOA 3O0LA 3JWNE 1HESA 4AT6B 1QFUL 4Q6IC 4ABVA 4EIBA 3ARXA 5M7QA 1CGSL 2IAND 1SUJA 1B0RA 5EZPA 2HXAA 1NICA 3MBWA 1KLFB 4NM4L 3T04D 4L8DA 2WYTA 1RIVH 2K7PA 2OSLA 4N87A 2H6UA 4AGPA 2OQJA 1G1CA 4PEEA 4AQEB 1MFEH 3K6SB 3MRIB 1WZAA 4LBEB 4P5KB 5BXFB 1OWRM 4Y88A 4YUEL 1NZRA 3K6NA 2D2OA 1YAIA 4KTYA 4PVLA 2ENSA 2G5RA 4M7LT 4XMTA 4G7YH 4ES8A 2NY5H 5I74B 5GSRB 1LXMA 2ZYIA 3BE1L 3IMWA 4GSUA 1QLRB 5E2VH 4XTRD 4YXHH 2N7AA 4JBSA 2CM6A 4AH2B 1UGKA 1KC5L 4OVVA 3ZJAA 1KJ2H 1NCDH 3MRDB 4NP9A 1K5WA 2O1AA 1ZLEA 3CSGA 1JHKH 1SDDA 1WWAX 4Y1AD 4FHKA 1O6TA 4LPYA 2NW3A 1KPUB 4OGAD 1UB5A 5L8JB 5JMRA 1W0VA 4BUHA 1SXSA 3PHSA 4JAMA 3WE1A 1ICTA 1T21A 1H15B 5K39A 1UH2A 5IB2B 4RZCB 1ZA3B 1J5HA 3TFKD 4MRBA 1U95A 3KR3L 5DUPL 4Y5VB 1SXCA 4NKOB 2CA4A 1UM5H 4JLRA 2OMYB 5JHDA 4S0SD 4LAJH 2DQFB 2PETA 3KPQB 4PJHF 2XOTA 4NCDA 3WN5C 5IOPB 5JW5A 1SEBB 4RRPM 4ELME 5FR3A 2E9BA 4KVCH 3UZEA 3QIUB 4IJ3C 1UWEL 2XTJC 5E8OB 4GQZA 2IEPA 5J8OA 4DGUA 1E2VA 3FSAA 3BZEB 1J1OL 4EKJA 4L37B 2WTPA 4EIGB 3N40P 2N59A 1CICA 1FNGA 3ARZA 1CDHA 2L7EA 1JZ2A 1PCSA 2IMNA 3EYVB 3F3HA 3H2PA 4IGBD 4N3UA 3QARA 1LO4L 3QUMB 4NKQB 1CD8A 1NPNA 3QG6B 3T0WA 3VWKA 1QNZH 3KYAA 5LBSL 1YDPB 2D03H 3UZQB 5IWLC 1A7NL 5F93C 2W8CA 5J9PA 4ZO9A 3UYRL 3ZE0E 1Y0LB 3GBDA 4GT7A 1N0LB 2C1PA 3FQYA 1HILB 5IROC 1T7WA 4HZLA 4ODUA 3GXDA 1O7DE 3CXDH 4YHKL 3MLWL 5CGBA 3GM8A 3QZBA 4EBQL 2F0CA 4WY7L 5HVHC 3ARUA 4MAYB 2QPDB 5D9SB 1RUAL 1XF5B 3QAQA 3WHXA 5B7FA 2PR4H 1U58B 3GI8H 1KTLB 2WN3A 2JSFA 4JFOA 4LOVA 4X7EC 2QKSA 2OL3H 3C8DA 5GGTH 3UZQA 1U93B 3ZIMA 4F2MA 5IMMA 5FWRA 4F8PA 1HI6B 3Q5YA 2MQ3A 3VB8A 5GRJH 4AE1A 4CU7A 5C0IA 1VACA 3AUVA 1UJ3C 3IFOB 1CF8H 4Y2DD 1CTOA 2QEJA 2QGBA 4AKQA 4XN9A 5ETUB 5AUMA 1I9JL 3LQZA 4D9RE 1HIML 1WZ1H 1AC0A 1AS7A 1FGVL 1JGUH 4LEXH 4FFZA 1WICA 3MJGX 2E59A 3ILEA 3T2OA 2PTTB 2VQ4A 4QTIL 2X4OB 3L1OL 5IB5B 1BZEA 2VXQL 4YSSA 2P47B 3GSXB 4D9QE 3IMUA 2OMNA 4XPAH 4M7ZC 1OD7A 1XH3A 4HMEA 4PJFB 3QUYB 5INCB 5BRPA 3C5ZD 3EAKA 5D7JB 3TPKA 4LCCC 4ENED 2ARWA 3ML9A 2NZ1A 2W38A 5F21B 3HB3B 2C3GA 4GW4B 4CVXB 4U3SA 5IR1A 3SDCD 5CNHA 3MLUL 3MRHA 3Q44A 5IHBA 4I0PC 1EEZA 4KI5C 4HWEL 5FW7A 3RWHB 4PP1D 1XSOA 1FNSL 4FF9A 3BP4A 2X6VA 1VENA 4YEFA 2YLHA 5AVVB 2NY4B 3AWFA 5A2IH 4MCYA 3EXJA 2J7LA 2WVSA 3RPKA 1MLBA 1W91A 2YD7A 2YRPA 2DMBA 5D2LB 3IJ9A 5BW7C 3N2JA 5IK3B 1KJ2B 4GP4B 4DEPC 3BFQG 1URZA 1BZ9B 1FZMB 4FD0A 4IRSB 5EEYA 2F53A 1ZWIB 3T0EE 1N59B 2A73B 1EAJA 4UUJA 4XMKL 1ZXKA 4KO7A 4AJYV 3FCTB 2ZCKH 3EOBB 4IK7A 4YIQB 5EO9B 3D0AA 2CKBL 4KK6C 1FF5A 3BWUF 1T7XA 3ULSB 5AZ2H 3REWA 2Q5BA 1SY6H 2J44A 2DDQL 3AXLA 2Z34A 1NCUA 1TSHA 2JTDA 3IJ7A 5IQLA 1A1OA 4YMPA 2HWZH 4U7KA 2Q8BL 1FYTD 3U7YL 3I75B 2Z1PA 5IIEA 1UD8A 3E3QC 4LGPB 1BVNP 4AW7A 3O6FC 4N8UA 5FO9A 3BGMA 4EIZC 1UM4H 3RZCD 1LDSA 2GPZA 4WI3A 3WTXA 2OXGA 2VLLA 2OR7A 3BH4A 2YPLB 3UIYA 2H1PL 1ONQA 1NBZB 2WKGA 4I0PD 5AB2A 4I2XA 3LH2L 2EZ0D 4N2FA 4FXGB 1YNTF 2EKSA 4G6FB 5FYKH 4BSVB 2X7LA 4LFHG 4R4ND 5B1JA 5IVNA 4IHOA 4OZ4B 3F7RA 4NN7C 2ESVE 1VFOA 3CNKA 2DI7A 2X9XA 4BQBA 2H6OA 4YE4L 3VD3A 3O45A 5K59F 4HIXH 3CVIH 4G8EA 2XFXA 1ET7A 5C0AA 5IIEB 1T0NA 4WAFA 3T8VA 4DHLA 4NKDB 5JOPD 3D4GA 2AJUL 1XFPA 4AEIL 3PIQA 1PLBA 4KHXH 4EDWH 3VH8B 1JMXA 3EUUA 3WMQA 4HA1A 5AD0A 4EN3D 4M7ZB 2GTZB 3O4LB 2D7QA 4WWKB 3KLKA 5FM8A 1LQBC 3TV3H 3EBGA 43CAA 2IADA 2XN9A 4O02H 1AP2B 1TQSA 1CI3M 1XSIA 3A4DA 3CZKA 4YXHL 5FFLA 1YMME 4FFZH 1NFDB 4TUJB 5C0CD 4X0KB 1HN1A 1DBKH 1W72L 3KHOA 1A65A 3OD3A 1NLDL 4PIBA 4XPTH 2XUWA 4IIQC 1QP1A 2EDHA 2P4AB 4E42B 1YMMB 5AOKA 4Q2ZB 5B3NA 1FE8L 1NPUA 3BH8B 3JUYA 1HI6A 3UG5A 1FP5A 4JFZH 4JDZA 1N5YL 2IFFL 4NWUH 1WZMA 1EUUA 1SJEB 4J4PA 4YHMH 3R4RA 4BXSV 2CIIB 2G9KA 4NBZB 2WBJC 5CLZA 1KLGB 3AQYA 4MCZB 5J1TC 4R4NC 4LRNL 1CFBA 2PO6C 3UAAA 1D2PA 2IXQB 3VX0A 5GGRB 1FNFA 1L3WA 1LM8V 2PPEA 3BMVA 4TNVK 5JR1H 5J11B 3PAZA 1KY7A 2QHLA 2RACA 1MJ7L 3J27A 1HNYA 1RIUH 3CLWA 3GFUA 3UC2A 4QRPE 3Q9QA 2OCFD 4AEEA 3W81A 5KS9A 4HD5A 2I9TA 2F19H 2NDGA 3BKMH 2OTWB 5HHPA 4IBUA 4HKBA 5FK9B 4UTAH 4NQVA 1EMTH 1KXQA 4NN5B 5IVXF 4Y4KB 1Z32X 2HN7B 5F9DC 1O7VA 2OA9A 4QRTB 4ZUWA 1M7DB 1JS4A 1RUPH 3GHBH 3TCLA 1BVKB 3K80A 4XXCA 3B3IA 2WVUA 1J05A 1RK1B 3QXWA 3QI9B 1W8EA 1VPOL 5E9DE 3DRTB 2CBQA 2WXMA 1RJYA 4QTHA 5K9KA 3GMOA 1FH5H 3F01A 3BYYA 1XD1A 1AR2A 1D5BB 1KIQB 1HWGB 4N86A 4K15A 3HR5A 4AMKL 4J2XA 1T7YA 2G3MA 4IMLB 5KBMA 5TGBB 4YZFE 3D85B 3MAWA 4R90L 2CUMA 2OZ4H 4YVUA 2IH1A 3QPQC 2Q0ZX 2VM9A 4W9ZA 4QJ5B 3G5WA 2I26N 1ZVHA 5KZCB 3EFDL 1A4JB 4Z5RA 4K55A 1KGJA 1A25A 3L5JA 2UXGA 2JV6A 2E74C 3EH3B 3T0EB 3I9GH 4Y1AE 2DL9A 1N70A 2XBZA 3L9RA 3E80A 3QQDB 1E27B 4NPKA 4FQQB 4J7RA 4XNYH 4L3EE 2Y07L 3LKSA 4AV4A 2AEOA 2J88L 4ZMNA 1SN2A 3LKNA 4IS6A 3VXOB 2E27L 5GQBA 1BCIA 5J6HA 3KAAA 4DGYH 3HHSB 4DVRL 1E43A 1A1MB 5EOCL 4KRPD 2CCVA 2W80C 4FG6D 3RAJH 3VWKB 4NQDD 1RZJC 4OLVL 3W11C 2GJRA 1R46A 1AD9B 5KJRH 3NCYS 3BKYH 1PBYA 1VGEL 4FQIL 3DRQB 2ARJB 4JN2B 1WUNT 2NNAA 3X11A 4CA4A 3I6KA 2EEAA 3IDNA 1WLHA 2ITDB 1AXTH 4GKZA 4NUGH 1MIEL 2IANE 1UM5L 5ABZA 1TQVA 3PABB 5DZ9A 3L5XL 1G84A 3AWGA 4TQHA 4FQXD 2PYEB 3VSTA 3X1GA 5ERWA 4M4RA 1QVOA 5CP3A 1WPCA 1D7DA 4UNVA 4A7TA 1BFVH 4LBAA 1FNSH 2EIDA 3IFPB 1HZKA 3PL6A 3TJHD 2IVFC 3KYMA 4GW5A 2TSAA 3WN5B 3WG7B 1P7QA 1HOEA 3MFFB 3NGBB 1HJCA 1MPAL 2XACC 1LEIB 4ZS6D 1BVLA 5CJOL 1HX0A 3MLXL 4GMSL 1IL1A 2H32B 1N18A 2XFXB 2C9VA 4DVBA 4I3SL 4JR9L 4YDJB 3C8HA 5HD8C 4LKXA 3J07A 2R56L 4OLXL 2H0EA 1V3JA 1KG0A 5IG7A 3UX9B 1N0XL 2VR6A 4EEEA 4GG8A 2N1TE 2HRPH 4PB0L 5I76B 2XLLA 35C8L 3H9SE 4HK0B 1QBML 2XX0A 1XH3B 3ZDYF 3FB6A 4HW6A 1H5BA 1B9ZA 2VZ1A 3GJFB 4J12A 3HTLX 3HOGA 2UZIH 5GRWA 1CO1A 4O9HH 3WFBL 1G6RL 3UJJH 4NZUH 3S3BB 1A7PL 1MSPA 3RBSA 5ID1A 1KLGA 1M2VA 3F05A 1A9VA 3L3JA 4D9LH 2H1XA 2QQNH 5G5DB 4XNUH 5GRXG 3BJ91 2I25N 5CZXC 3F12A 3U4AA 5DD5L 1YY8B 2KDYA 3IRPX 3CVHA 3ZHDA 3PJSA 1PL3A 1UGNA 1GTNA 3ETTA 1E4WL 5GRYA 4AGOA 1QKZH 3VSQA 2XWTA 4JVPA 5I6NA 3WL9A 4EI5A 2ZCLL 1QQDA 3GJEB 4X6FB 2Q3XA 1QW9A 1CFVH 2APBA 3FCBA 5B38A 4GLRH 2YAQA 3NJVA 3VXUB 4KKZA 4ZMXA 1UCBH 2P80A 5F1IB 5TFSL 3VI4F 2HG0A 5D4HA 1HK6A 5HY9A 4Z77A 5FDWA 2BVUA 1HEZA 1L9TA 1OB0A 3AQDA 3H7BA 2AQ3A 4FDWA 1QSEA 2E76C 1PX4A 4RISH 4BUQA 4KHXL 1FCGA 4ZOEA 1IX2A 3WTUA 2AJSH 2XWEA 3OB8A 4UQ3B 2JKXA 2BP8A 1KYOJ 4WU5B 4X6DE 1ZHBB 4KXZH 1RPQA 5BJTA 2JB5L 4MJ6A 3MQIA 2GBTA 1NANH 4L2LA 3RZWA 5IB3A 2WXLA 1MCJA 4MQ7B 4HIJA 1MHEA 3KXFE 1VDGA 5B8CB 4Y16A 3WS3B 5IHZA 3OLDA 4KMQA 3U9UA 1FLTX 4BEIA 2DWEB 1IVLA 1DANU 3MV7D 5TQ2H 1LE9B 1IBFA 4H20H 4XVUD 1TLKA 2PCFB 2WBJA 4QO1B 4AM0A 3T71A 3WKPA 1PAMA 4GKSA 5GS0C 3CCHB 2EEXA 1OE1A 2GJ6D 5I1HL 1WFMA 2N7BA 1G7MA 3ARBC 3N85H 4PJ6A 4XPBH 3FFDA 4OGYL 4A04A 3KXFB 4JFEE 2DKUA 3QRGH 5E94A 1SXZA 1IFRA 3ECUA 4MJ6B 4OKVA 4WUUE 3NCFB 4G1EB 4OCWL 3O6FB 4JFXB 1VFBA 1V27A 3PHAA 5FHBH 2GUYA 1T0NB 4OFQA 1FVEA 7PCYA 4PJCB 1I8AA 1MDTA 3FFCB 2CRYA 3HG1A 5E2TH 5T3XD 5T5NG 1KLUA 4WQOA 1A5FH 3QEQD 4R4FH 4ODHH 4WWKA 4OGZA 4PJDE 2BIHA 1U21A 2F53D 3PABA 4MXWL 3HHRB 4UTBH 1YO4A 1KNOA 4LLDA 4X6DF 1GMIA 2XA3A 3J7HA 5F7AA 4YC2B 3QXUA 1XCTB 5J57B 1QSFD 3FQWA 4CW1A 1QLEB 4ZDHB 5A2FA 3QBTB 2B14A 4UT7L 1T5XB 2OCJA 3T3PE 5I1JL 3V0DA 1EEYA 4HCFA 2X12A 1V7NL 4LVNC 1Z9PA 1B3JA 1EDQA 3LV3B 5CEYB 5AW2B 3ZHNA 1E4HA 5B1JC 3ILPA 4V1DE 2DQEH 5A2CA 5IJCC 1KXVC 3NTCH 3F58L 4JMXA 3NN8A 5FKAA 4C47A 2WLLA 4GI6A 4OAWA 4JQIH 4WUKH 2VERN 3K71B 4IOFC 4K5LA 2BRRH 4PJDA 3CQFA 1NKGA 4HFUH 4PS8A 3BAJA 3EJUA 3P9WB 2IBZX 4UOW0 5FGBA 4LCUB 2QPFA 3I6SA 3OKLA 2CDFA 3GSWA 3M88A 4FGMA 3QHTC 4U6TA 4YQXH 3RWGA 1TFPA 2XG5A 1TKWB 5I0XA 1XIWB 3PXLA 2OJ1A 4CMMB 3TBYA 1XGTA 4FEMA 3EGSB 4K9EH 1YUHB 2UYLB 1HHHA 4YBLC 1KCLA 5FS5A 1D5XB 5ENWA 5HDQH 3UZVB 3WXWH 1E2WA 4BQ6A 4EN3A 1FJ1B 3ASOB 3S3DB 5IOKA 5K5YA 2VZOA 5DVKA 3HNTL 3IETA 3VVWA 5HHOA 1EO7A 4GSQA 4ONGL 1BYNA 5HDOA 1PG7H 3T0DA 4URKA 3AY2A 1WUZA 5ICYA 4MMXC 2WGNB 1NIEA 5SWQA 4H8PA 4K8RL 1RKRA 1ETZB 4HLZH 5I66A 4Z7WA 1TVBB 1JZFA 4GO9A 4UNUA 1SEQL 4TSAH 3IGAB 5LCVA 4KHTL 2IANB 3GXIA 1HNGA 3O3DA 2R1XA 5ABAA 5EIIA 5IEHA 3MPCA 4NHUA 1A6PA 1WD8A 4RQQA 3BDXA 4GI8A 1TXKA 4M1GL 1GZPA 5JDSB 1KIPB 3JTBA 3NFSH 3EYQD 3RKDD 1E8ZA 4Z3JA 1MVUA 4KKQA 3IDGA 2P5EE 4CU6A 1HL9A 3HFML 5C0CE 1E40A 4UQ3A 1YMMD 1CN4A 1WEJH 2O72A 4LHQB 5BS0E 5HPOA 3IFOA 5EF1A 5G2NA 1MI5B 1QEXA 4WCYH 2EIKB 3KYOA 3SBWA 1D6VL 1U8OB 2KKQA 3ARPA 4NFDA 3IWUA 4YL9A 5DI8A 4RGNB 4IMKA 3S36L 4PJHA 4L1LA 2ITFA 3QA3B 3DHMA 4L8BB 4XPFH 1MCSA 3X17A 4ZFGL 3IJYA 3R7RA 1DDHA 4MJ4A 4BH7B 1F13A 2WQAA 4LOUC 3OZKA 2FTAA 4AENB 4AQ1C 3IGLA 3FT2B 4Y5XA 5TQ0L 1RU9H 2NYKA 1EJ8A 1OAKH 4XBEH 3ZL4H 5FHAL 3QJRB 4ZNEA 5DQ9A 5K9JH 1MCHA 2XJLA 1QA9A 2O6PA 4PD4J 4UM9B 4XH2A 3QHFH 3ERXA 2AK4D 4BSWB 2X1XR 3OV6A 2HT4D 1A3LH 3U7WL 1B0IA 2WBXA 4K71B 4UDUA 1AH1A 3LS4L 4X4KA 3ZSTA 5FB8A 15C8L 3M45A 4YS4A 3EOTH 4K8RC 2D31A 2OW6A 4JDEB 5ESVB 5HGAB 3J2PA 4GUPB 3MRKB 5EEZA 2BLFA 1ZGLB 3BKYL 2DQTL 3HZMA 5I1GL 2E7LA 1UCBL 4K3GA 5AVYB 3ZE1F 3QP3A 3WGUB 4J27A 3SE8H 4NYLA 5D7LD 4PLJC 2KQMA 2WANA 3P11L 1NGXA 1XTLA 2WLJA 2E6JA 5IOPA 3ZOAA 4X98B 3TL5A 2DWTA 2JKLA 1QHOA 5E8DH 2FATH 5KN5B 1KB3A 1K9TA 3CQPA 4YHYC 3FB6B 2P5PA 4Z7UA 3DUHA 3POHA 4PPTA 2IBGA 3D3VE 1TJGH 4YDIH 5I0DA 4L1TA 5DJ2B 3FOLA 4ZS7H 1EHKB 1WFUA 5D72H 3MXVH 3IJSA 1HSBB 1T22A 4M43L 1INDL 2QTEA 3BSZA 2Y4SA 3B4NA 1U8KA 3L3KA 3KLSA 1EEYB 5J13C 5DHVH 3RVTC 4ZAKD 1N6QL 4HJGA 4U33A 1Y07A 3MCLH 4NQDB 5C08A 3VWKD 3BXNB 2EVIA 1SLUA 4HETA 1TTFA 2ICES 4IDLA 4ZK8A 2CBPA 1V54B 4J8QA 4DPRA 1A14L 3R0NA 1X44A 5MENA 2A1WH 1PVHA 2B4CH 3AB0C 1GCYA 4OZ4A 2YD5A 2H7WA 4XXDB 1NL0L 1KT2B 5KBDA 3IXTA 1CMOA 3V4PH 1QW8A 3L9BA 3P4OB 2PYED 4FQXB 4LCUA 1IGJB 3MRDA 2GIXA 4Y19E 4L8SA 4D9QD 5EFIA 3OAYH 1BFTA 4W9IC 3ESNA 1KXTB 2C9PA 4RIRA 1XXFC 1SOXA 3QIWB 4C4KO 3RWCB 3BKCL 1A2YB 4G8AC 4Z0XA 3ZKXB 1R6VA 4H1LB 4OZHA 5I18H 5C08B 3TEZA 3LN4A 1DEEA 5KVDL 1N2RB 1NANI 4WIQA 4MZ3A 1OK8A 3NIFE 1C08B 4OZFH 5F7KC 1RHFA 4M62H 4P57A 2J1XA 3Q6GL 2WQWA 3QDJD 1FFQA 1HINL 3LXUX 3ZIYA 3LHPH 4UF7C 4RDBA 4JM2B 3UTZA 3KGRA 3WV0A 4XZ4A 1MWAH 5CD5D 2PCFA 2PXYB 1YEGL 4YHNA 2E5EA 2FQFA 2RCSL 2YPLE 3DV4B 2OMZA 3NPSB 3C5ZA 5D6DA 5EU5A 4PVBA 2F7PA 2PW1B 4ABUA 3L17A 4E42A 3LIZA 4WHTA 5ID0B 5JA8B 2ATPA 2VDML 4FRWA 5D2NE 2KLRA 1KJVA 2M8XA 3U0WL 2E3VA 4NQEA 2A74A 1KB5H 1S9WB 5ICUA 2CR0A 4H8HA 1FO0B 4AE0A 3FU8A 1AO7A 2EE9A 4AI7A 4HVBA 5H35A 2P80D 4HF5L 3KYOB 2XKUA 3KDMA 3VXUE 2O4EA 4BUGA 4QNPF 3ZSSA 3DX7B 3ZDZF 3FFCA 3CFJA 4N2LA 1RUKL 2D9QB 5JNYA 1A7NH 2GCYB 4ODTH 5B3JE 2ZOUA 4RSYA 3VU2A 5T1DL 2DQDH 1YNTA 5T5FH 2MCAA 2EIJB 3RTQC 4KXZI 3JXAA 3FC8A 4RGOL 3U0PB 5CGMA 2R0LH 4ALAL 3VXQB 3M1OA 1FYTB 5FC9A 4NC0B 2AGJH 5CM1A 5TDNB 1ID5I 4YGAB 4K7FB 1FO0A 2AK1H 4Y2DC 1NFIB 4GO6B 1LP9E 2CXKA 1BEXA 4AIZB 2W9EL 1H8SA 1MFEL 1P2CB 1OSEA 5CZRA 5T3XH 2Q86B 2HJKB 5L4FA 3K4AA 1NQBA 2WBJD 3T8XA 3BEWB 3D1MC 4ZG1A 1FFOB 2ZG2A 3MGAA 1BG1A 2EC9T 4BFRA 3IJEA 1SYVA 1L0XA 1WAAE 2G9HB 5L2KD 4BZ1H 1JHTB 3C12A 4GQPH 5D1XC 4OAWB 1A4BA 3OMNB 3WIHH 1OB1B 4JM4L 4TN9A 3UG4A 5KVEL 4IQHA 5DK3A 2OKMA 1GC1L 2Y9RT 1XX9C 4PRNA 1JF1B 5ESAA 1HHJA 5F7WC 2VSMB 1NMAL 1QPKA 1G4MA 1XT5A 2IAMA 2NXZB 3UBFA 1RUMH 2CDFB 3GSWB 1YNLL 5IZ7A 2GSGA 3UO1L 3L9RB 5BQDA 1SXBA 1NWPA 2DWXA 3JV0A 3D30A 3KVPA 4WWKD 4XO4A 3H3BC 4LXFA 3CFBB 1U8CA 3M8OH 4HUUA 3EGSA 5DK0A 5DK2B 1TJHL 5MP6H 1XGUA 5BV7C 3BUIA 3GC3A 3MC0A 5DS8A 4EUPB 1WE5A 4GS7C 4GG6B 1G7IB 2QKIB 5C0CB 2EE6A 1MCCA 1M42A 1ASPA 5CUSL 3TA3D 1HQRB 3U0TB 3WAKA 1RJZB 4WI9A 4YDVB 3MLYL 4LF3A 4MBOA 5FUCE 3EDJA 4CC4A 4GP5B 3Q0HA 1LP9A 1I8MB 2CGRL 2FJGA 3DGCR 1RV6X 1C5DB 3TCXA 2WD0A 3T77A 1VZIA 2CLZB 3L3KB 4N25A 2FT7A 4HXBL 1LO4H 5EZLB 3B7TA 3UBGA 4YK4C 3US9A 4UT6H 4GRLC 4APXB 5K93A 2O61B 1GMEA 1F4XH 1A3LL 3BZFA 1QUNB 2ADJB 4W6XB 2WZPA 5E5LA 1EZSA 3S8WA 4YGVB 3VAEA 2YOCA 2LABA 4JCLA 3ZDYE 4JQXA 5HJ3A 1KB5A 3QR2A 2AJYH 2ZWKA 3AXLB 4ZX5A 5TDOA 5I19H 1TZOA 1W8OA 1T0MA 4L4VB 1HWWA 1UM6L 4O5LL 4PJ9C 4IBWA 5DO2D 2ZYSA 3KPNA 3QO0A 2LHAA 4V2BA 4ZYKB 4Y4KD 3DIVA 1EZUA 2WBWB 1ROCA 5MHSE 3E9UA 2F7IA 4L8CA 4J4PD 5IVXE 3BT2L 3FT1A 5E8PA 5I1KL 2GJPA 1PG7L 1DQKA 2JB6B 2WWMD 3CFKA 3IDYC 2P24A 3LNHA 4BQ9A 6TAAA 5I6MA 2P26A 3OC8A 4YHOL 2OSXA 2WC7A 1MRDH 5G4OA 3HS0B 2Q8AL 1UOKA 5KJ7E 4QKTA 1CDGA 1D5MA 2FT6A 1CU4L 4LVOC 3L7FB 4S0HA 1MCRA 1OTTD 5EWIL 1N3NB 3BH9B 2NY6B 2OTWA 4ZT1A 3WFEL 5GJTH 3FO9A 1Z5LA 5BZWB 3RGVD 5GISL 4KROC 4OUUA 4FP8H 3MXVL 4N8VB 4M43H 1FO0H 2QSCL 1L0PA 3BWAB 1QA9B 4DN3H 4JHUA 1WIPA 4J3OG 1UT9A 4UT9L 2J1KA 4UDTA 5GHWH 1RP8A 1PZ3A 3QZWG 4BSWA 2EO1A 3LZFH 3VWJD 1HQ4A 3F7LA 4APQD 5GGSA 3BT0A 3KCWA 3MJ8B 2WXHA 4I1PA 3OM3B 4HS3A 2ADFL 3HBPA 3VXSA 1RJYB 2AJUH 4HJSA 3B2PA 1LGVA 4PCTA 1ZA6B 1WG3A 3O41A 1A47A 3MN8A 4IBTA 4Y5XC 4AQ1A 3CZLA 4DETA 1NMBL 1BLIA 2WKOA 3UCQA 2ZSVA 1UJ3A 4GQRA 4XPHL 1JERA 4XN2A 3H9SA 3H53A 2GC7C 5E8EA 3WY1A 1T4KA 3MJ7A 3VFMB 2PYFB 3L9YA 3A6CH 1L6XA 3FN0H 2E4TA 5CILL 4Z76A 1MCOH 1JWSA 3CZSA 3L5WB 3HA0A 3K1DA 3T3PF 4X4MA 3M1CA 4EXKA 4YFEA 2FQEA 3O3EA 3GLEA 3SBRA 3NDYE 4JY6B 4R8WL 1E67A 4POUB 3FTSA 2Y1YA 4IDJL 3V10A 2RH0A 5J6GA 2EH8L 4LIQH 1KIRA 4Q9RH 4DFIA 3C6LA 3QFDA 5F44A 2N3JA 3UJTL 2ZCKL 1DVXA 1TTAA 3CUPA 1UJ3B 3VG9B 3OL2A 3SBPA 4FQ1H 3QEQA 1OAQL 1I7ZA 4Z7WF 3NFPA 2PYFA 4G7VL 3MGOA 6FABH 2R4RH 2WXGA 4YLCA 3QZMA 4PTUB 4YAQB 3O4OC 2MPVA 4JHVA 3LEYL 3B2XA 4JJ5A 3MRMB 3A6BL 1KACB 4RGND 3ZGIA 4JFYA 2IJ0C 2GEEA 5IUSA 2P1YA 3OKYA 5DZLA 2FJHB 4L4TB 5EZJB 2JI3A 1DVFC 2MH4A 2QQLH 3KWXA 3RA7L 1T3FA 2L8AA 1FC2D 1N59A 1VFMA 2EH7H 3EDKA 3PWLA 4MNHB 4XCFL 5JXEA 3T1WA 3IYLW 5AAMA 4FLOA 2YMTA 2OMWB 4R7XA 3GMLA 5D7LA 3PL6B 5E4AA 3Q2NA 4B9CA 3BKJH 4S2SB 1DP0A 4P9HH 4PR5B 1INQA 1GRWA 3JTTB 3TT3L 3LSOB 3PCYA 3P0YH 4Z0BL 3DA0A 3MYZA 1QFOA 1XEUA 1K8DB 3VFSB 2V0AA 4H88H 4IKJA 1ROWA 4PJEF 4RAUB 4FQPA 4QXVA 1E65A 4X5XB 5SWSA 3SGKC 4KZEH 1FH5L 1EHXA 2VDNH 2P45B 4JPVL 4TQEL 3WJLA 2H6PA 1FGNH 3EYVA 3L2MA 4WI7A 5FFGA 3A6OA 1OOWA 4YDJA 3IAPA 2B3IA 5JW4R 1XR8B 4L3ED 3CHPA 4YE4H 5D4QA 3WFZA 4BK8A 3GLAA 1A14H 1E6OH 2CO7B 2EYSB 3DVFA 3L3HB 1L6ZA 4FG6C 3BZFB 5D7SH 1S2EA 3R18A 4S2SA 1OARH 1R34A 2DLHA 4YVNA 4L9DA 4HU2A 5H37G 1IGML 1SOQA 4IHOB 2ADIA 4RETB 3VXME 3AC0A 4XVSH 1LO2H 5KYNA 3QDHA 3IMBA 3KPPB 1S9KC 3WNPA 1FYTE 1H3GA 2O6DA 1HCVA 5B22A 4F91B 3AU1B 1E28B 3VXNA 5I18L 4LOFA 2FQGA 3NACH 4X7DC 4M29A 4EI5D 1AVAA 2X2HA 5K59E 3DYMA 5HXMA 4NNYA 3QZNA 3VFNB 4LLUA 1U8QB 2X0UA 4HIIA 1C7SA 2Q7YA 4R2GB 3BUBA 2X9WA 4KAQL 4HT1L 5CGTA 5C08E 3C5SB 5CR8A 2XYCA 1XIWA 4R7NA 2WCPA 3AW5A 1ZT1B 2LFEA 3BDBA 4HPYL 3T65A 4BK4A 1P4BL 5E99L 1TENA 2YHGA 5DFVD 5B7EA 3PNRB 3A67L 5DHYA 5AVSB 3SGKA 2R0ZH 4O2CA 5A3IC 4O02A 1I7RB 3WUZA 3IDYB 4P2RA 3F62A 5I73B 2F58L 1EFXB 4HSCX 3UAJD 3VH8G 3VQ2C 2VZVA 4N8VA 2APTA 4CVXA 5GJSL 3QIWD 1Y6NR 3OKNB 3T9WA 4WENB 1TJXA 3TVMA 1JZJA 2G9HA 5DVNA 2CIIA 4GQQA 4G3YL 1AXSA 4Y9GA 3ZRCC 4UMSA 3MBWB 1S6NA 2QMKA 1I4FB 4RBPH 1KXHA 1TMQA 4PS4H 3Q7JA 4BJLA 1F4XL 2GIYA 1AZZC 4BCXA 2PTTA 3QJOA 2YUZA 1ES0B 4FNQA 3FFCD 5AB9A 3D52A 4WZ9A 1JYWA 1R5IA 4JFDB 4OJFL 2QJDA 5AKSA 4ZTPL 4F37F 5JUEH 3FFDB 1NKRA 4O58H 3UBHA 3MJ7B 3VFMA 1Z7JA 3FAXA 3VGFA 3TT1L 2OZ4L 3V5HB 2FJUB 3GS0A 5F3HB 5I8EB 3ARGD 1FCCA 3D4ZA 3WUWA 2WTOA 1X6LA 2UWEF 2Y23A 4BCZA 1LK3L 3DHJA 2B15A 4HEPG 4LHUB 3PDOB 3S9DB 3B9KD 4IBZA 4OGXH 5DEGA 4XNDA 3EFDH 4NQSB 2H0PA 2Q10A 1I4FA 3H1ZA 5DSCB 3V9EA 3HG1B 3OKOB 2F54E 5J89A 1A0QH 3GMOB 4N24A 3FRPB 4U1HB 3VXTB 1H15A 1ZE3C 4GNKB 3KVDD 4M9PA 4AGNA 3RNQA 2ZUSA 3HE6B 1CLCA 5F7LB 3S2AA 4DGYL 5G55A 2OP4L 3S97C 4DVRH 1JGVH 1G0YR 5E00B 4N5UA 3PF2A 3HUJF 1IC7H 3HW7A 2XWBA 4FP8L 3VFRB 5I1CH 5L2KA 3ZE1E 4J1UA 1KJMA 4Y5YC 5MEQA 3WAJA 3ISYA 4C56A 3N0AA 1CYGA 4L3AA 1HILA 1W0YT 3WIAA 3V5KB 3WEXB 1AXTL 2X7LB 4Z8FL 1ZT7A 2WN2A 2WO4A 2ZUQB 1HHGA 1LEGA 1Q94B 1H8NA 2CKBB 1P84J 5CKGA 5BOJA 3NBNA 5T33L 3LKRB 2LQRA 2M26A 4JKLA 5JXAH 5DCCA 4ZFFB 3Q2CA 1CICB 4CNIA 4JJHA 5HHVL 1JWMB 1SVZA 5AAWA 3TVMC 4AX3A 3FT0A 4G6KL 3WNLA 2PN5A 1EXHA 4ZYKA 1NLBL 4QRQA 2APWA 4MSWA 2C9XA 4BELD 1YYLH 4JGNA 3ZY7A 5EEWA 5C2BH 1KFAH 2IPTH 4A2FA 3GM0A 3CV5A 1UUSA 4OZHF 1ULVA 4XO3A 1MPAH 4ERSH 2QPUA 3GXPA 3O6ML 4ONHB 2A38A 2FSEA 1V7MH 2R2HA 3RY4A 4AWJC 2D7PA 1WRFA 4MDJB 1U8LB 1YAZA 1MNUH 4GMSH 4NRYB 3FHEA 2ZYRA 3CDCA 1RIHH 1YUHA 1BECA 1Y6KR 4Y2NA 3QRGL 2LLGA 3TM6A 4G8FA 2FLBT 3NEOA 3NJIA 5E6IC 4HZAA 2G30A 3MNVB 1P4LB 2R2BB 4AJWA 3PWNB 3WGVB 3WN5A 3CFEB 2NNXA 3HS0C 2ADIB 4MXVE 2NQDA 4AYBA 3W0WE 1QRNA 4CC4C 4F8TA 2ZWYA 5FUZL 4E41E 4KH2A 2VC2B 4LLUB 2XG4A 1O9WA 1XGPA 4WO0A 4Q58C 4YZFF 1DZ0A 2VL5B 2NNFA 1YEIL 1NGQH 3LH8A 1U8LA 3MRCB 1YJDL 3BAEL 2OSLB 2WLKA 3F7YB 4JKPL 3OBAA 6PCYA 2NW2B 2GSIA 3O2DL 2VC2L 1XHHA 3E3QE 1T2XA 3OLIA 4AQEA 5HVWA 4EDXB 3SKMA 4FYTA 2XWDA 5IB5A 2GEQA 1G9NH 1A02N 4HK0A 1FFPB 3ARDB 4N0UE 3X3FH 2OCCB 1R3LA 2IAMC 3P54A 1JZEA 2VXTL 1MCPL 4URTB 1ZRUA 2ZOTA 5TDPA 1MAML 1R5WA 4AZUA 2HKFH 5I1DA 3GYRA 3LDBB 2FEJA 2AJ3B 2AQ2A 5GGRA 5TE6L 2TRYA 3W5MA 3OSKA 2HRHA 4PJGA 1DUYB 1E6OL 1PG7X 5BS0A 3QULA 4X8JB 4JO3H 1DEDA 3QXAA 1NMBH 2AABL 1GA2A 4I13B 4G9FA 1DBMH 1TTGA 4Z7UF 5C0EA 2NCMA 1MJ8L 2QQKL 2VDPB 3ELAT 3INOA 3PV6A 2BWIA 4MJHA 4N2DA 5EU6B 4EVNB 3ULUD 2AXGB 3LB6D 3N6YA 4XXWA 1Q38A 3VB9A 2MFNA 3S4SB 1WSST 3AM8C 3VX1A 1KYOK 1F00I 2WLMA 3BVVA 3HC4H 3QH3B 4FL4B 5I15L 5DMGD 2BW5A 1ADQL 1DQQA 2Q76A 1QI5A 4PVNA 1NFKA 1J05B 3VXSD 2ZUYA 4E2OA 1J8KA 1XBDA 4P4KA 4NQSA 4JFUA 2VDKL 3FO2B 2F5AH 2IAAC 3FRPA 3VXTA 3DX6B 4APQB 2Z8RA 3QXAB 3X12B 4YSPA 1S7XB 1GGCH 4UYQA 5E6UB 2QV2A 2KYIA 5F9WB 1A6WH 3MV9D 4IOIB 2PO6A 1BHGA 5C70A 4Z7AA 2BIQA 2BK8A 4RMUA 1WZLA 3C5ZC 3GSRA 5E2VL 4N0FA 5LVEA 1QHQA 2ZUTA 1HL5A 2YN3A 5TPWL 1BVOA 6PAZA 3AXHA 4AL8C 1JTOA 2JF1A 1G0XA 1ZVSB 2HVKA 5D6DC 1J1XH 1DJGA 2Q1EA 1CZ8H 5KJ4A 3STBA 2Q87A 4QRRB 3H56A 4PJ7B 3D2TA 4OJDH 3AABA 4UTCA 4X5WB 2FIRT 2KLSA 4QHLB 2Z7ZA 1G1OA 1AQKL 4AYFB 5F70A 1CD1B 5LLIC 4W6YB 1LLAA 3P9LB 1BVNT 2HP4A 4WCYL 3RZCC 2BHYA 3FHAA 5ILTH 4XHJD 1V10A 1YEEH 3SO3B 3ARFB 4AW4A 3S96A 4DKAA 1ZJAA 3QCVH 4Q14A 1SN0A 4OZFB 5EUKA 1KBGL 1CLVA 4KPHH 5C08D 4KVNL 1A6UH 1IGIL 1R1CA 4DW2L 4ZW5A 1C5CL 1AGCA 5FO7A 4PGCA 1Z9OA 1XH2A 1CDYA 3SGEI 1BMZA 4CSPA 4JM2D 4B9GA 5DS8B 1NDGB 3OAYK 4YSTA 2N0MA 4R9HA 4RIRB 1PZAA 2IDFA 4O02B 1IC5H 1U4FA 2BH0A 4E9WA 4XMUA 1T04B 1HQRA 2P5WE 3WEAA 4R84A 1AHWC 3WYRA 1KN2H 4B5EA 2QZQA 2MHAB 3DPBB 2VSCA 1K5NB 3DXAE 4JHWL 1IBYA 1R3JA 4PLJD 1JL8A 1A66A 2DKMA 3TTSA 3NRFA 1I8MA 2VQUA 4MCZA 1OIOA 4ZS6C 5GZOA 4ZMVA 4RZKA 3W9DA 4AK1A 1QYGL 1S7VB 3ZTCC 3AY4A 2A9CA 4JANA 5HDQL 4OZIA 5EOQL 3QZWB 3FSOA 5CJQL 2XQBL 4HT1H 4L3EB 1XF4A 2AEPL 3VXSE 1KCWA 1QUNA 1CB4A 4Y5VC 4Q97A 1SM3H 3SGJA 1Q90A 4JUSA 3MLZH 4A2EA 1NCBL 2ITCA 3NH7H 4TNFA 2WKOF 5TJWK 2X40A 1DVYA 3EJTA 1JZ4A 6CGTA 4K8RH 1SVBA 4OB5H 5GS2D 1NSNH 2JQMA 5EO9A 5D1QC 1YYLL 1CF8L 1JV5A 3GB7A 4IRJD 4FG4A 3REWB 4NHCH 3K72A 4HCRH 5C0RH 1D5IL 3VD9A 3VFUA 4JG5A 4K4KA 5DJXB 2NLJA 5DJ0A 5T1LD 4WI8A 2ADGA 1HIMH 1WZ1L 1Z9NA 3IGFA 2VDKB 3NZHL 3V6OE 4EI5B 1L9MA 1IJNA 3OLEA 3C6LC 1T2JA 4WEBL 4U1IB 5F7UA 3PV6B 5IBLC 3ZHLA 4XBGB 3OMZA 3W9EB 4KROD 5L2KB 4DFHA 5IMOB 4GBXB 3S7GA 1S7QA 3VGAC 3IDXH 1X9LA 3NQIA 1DQLL 2DM4A 4DTGL 4P2RD 4MMZA 2BCMA 1CD9B 2GJZB 4OJFH 3L4CA 2CNZA 5FWQA 1HQ4B 3MLUH 2MPAL 3P77B 4F27A 1K2DB 5KVFL 2NXZD 3LKRA 1SXAA 3MSPA 4XAWH 3GBMH 4H0HB 1GW6A 4PJ5E 2E47A 5D4JA 4R26L 5DJ8B 4EOWH 5J1AB 5IB3B 1NAKL 1XZWA 5EBWA 5B1BB 4HALA 2F08A 2LLNA 1PKQB 3ZTJG 3ZMRA 3TWCL 1H3PH 4RMRA 4GKLA 4NNPL 4DF9A 3B1UA 4KGJA 5LNEA 3VTMA 3LS4H 2DMCA 3QA3A 4RSVA 4TLTA 4ZUSA 4KITB 3NEXA 3K6DA 4RAHA 1GOGA 4LSSH 5D55A 3QUMH 2W95A 5EH1A 5KVEE 5TF0A 2VM3A 4H13C 3JBG7 5FA3A 4F7KA 2IH3A 1KGYE 5GS0D 1FNEB 2X6AA 4P99A 1T80A 3QEGL 4P2QB 2W0FB 3H85A 3R8QA 2ZP9A 2VUYA 3F7PC 4KUZH 1NIFA 5JW4Q 1DVZA 4HV8B 2B2XL 4M03A 3LVEA 4W68A 1CBVL 1G7PB 1XB8A 4MGXA 2GT9B 3LY6A 1ZMYA 3I74A 3U25A 5CAYB 1A8ZA 1BQRA 2R2BA 1TETH 3K2UL 3LRSA 4OF6A 4HAFA 3ARGB 3M17A 1X7QA 1ZLUH 2Q20A 2A0LC 3FQTA 4F8QA 4PJBF 3V0JA 4LHUD 3SQOH 4HIHB 4ETQA 2IG2H 3AS1A 4MZ2A 3GUTB 3PU7A 1MCLA 2CKNA 5F96H 1DBML 5FYLD 5ID1B 2I5YL 3PWPA 5IJVB 2NY2C 2C7FA 2IXQA 3D0LA 2JLLA 1INDH 2E8ZA 4L4VD 1PZ5A 3LEVL 4Z3GA 1YEHL 1HYSD 1IARB 1U9KA 2IGFL 4HEPA 3APMA 1N6QH 3A4EA 5DGQA 1N0LA 4F57H 1JUFB 5EN3A 2EECA 5B21A 4HIPA 3BAXA 2VN4A 5CCJA 4JFHE 1IM3D 3MNDA 2W94A 4L0PB 2CO3A 1YEDA 1ZLVH 4XP9H 1H5BB 1RLWA 4JRWA 1KYDA 3PP3H 1P5UC 5CEZL 3V4LA 4MA1B 3L5HA 1I1AC 4LAQL 3CQQA 1KXVA 3RGVB 3IJSB 3BGAA 5FKAB 5T1MB 3HR6A 1T2QH 3RDTA 3GK8H 1P1VA 1GPOH 3F64A 2VMJA 2E46A 4H25A 1AGEB 3FQXB 5F0LB 3WIHL 4OU3A 3CXFA 2PP7A 1JF6A 3QXVA 4L8SC 3RNKB 2R0WL 4A37A 4HULB 3BESR 3MUGA 4JHZA 5KVDH 4FAAB 3PDGA 4MQ7A 1ZLWH 3BKCH 4HJEA 4OCYH 4OZGB 1J0KA 4WI0B 2J5WA 4M62L 5C0FA 4M7JH 5EORH 4X9GA 4J23A 2EDJA 3GMQA 1A6ZB 2JXMA 3OZ9L 1EHLL 1NIBA 1HHHB 4G7SB 3WXVL 2W1NA 3QS2A 5F1SA 4JRYE 4GUCA 2ZKXA 3KM2A 2NY2D 2FEDC 3BPCB 3QWNA 1JCKA 2CIKB 3NCWA 3CCHA 5EFIB 1K3IA 3GRWH 3SSGA 1K6QH 4OIIH 2J5LC 4G83A 2VDMH 4KKAD 4YEEA 5HD8D 4UZUA 1IAII 3QCVL 4ILDA 5CUSH 1AS8A 1MXDA 1N64H 3AFLA 3EGDB 1I9IL 5I16A 3MNZB 2JTYA 4HIIB 4HKJA 4PBVC 3S5LG 2VO5A 4Y16B 2GW5A 2CLZA 1AD9A 4WJ5A 1JPFB 2YJLA 3WIIH 3KWTA 3D0VB 2YK1H 3N55A 3CDFA 3T6ZA 2L4OA 2Z91B 3QCTL 4XRCA 2FLMA 2BVEA 3U7AA 3P0GB 5T5FL 2YXFA 1ET5A 2BDNH 1XCXA 4PY7B 5F0MB 1XF3B 1ZY9A 1IGCL 1MFMA 2WWMC 4PRAB 4NZ8A 3DYOA 2YBRA 3HC4L 5I15H 1DUZA 1HSAB 1X5GA 4GAJL 4PBWD 3EYQC 3RKDC 2YPVL 2OTPA 4L4TD 2Y06L 3Q3GB 3Q2VA 2E75C 3GDCA 2YXMA 4L1HA 2WINB 3NPZB 4O5LH 3VQLA 1GJUA 4ZO7A 2AGJL 3QUZB 4NPYB 3D5OF 5KG9B 4NZRL 3CU7A 4HHGA 4WRLA 5HI5C 3LQAC 2GCYA 4M1CC 1ZHKB 5DLML 3TC9A 4B9FA 3AQZA 4NWTL 3QEUB 3E7JA 2AVFA 3VFVA 2E7MA 3GSUA 3I9GL 3L45A 1G6VK 3MX0A 2F8OA 3G08B 3MRLA 4HAGA 1CGTA 4OLUL 4TXVB 5TH2A 1USZA 4P48A 2V5RA 3IF1A 2PABA 5TDNA 3VG0L 1VRSA 3EZ8A 5AOMA 1NCTA 5A7BA 5C7XL 2KHAA 3D3VA 1MWOA 4X99B 1ADQA 1ZEAH 2J8HA 4JS7A 4JZOA 2F54B 3LH9A 5HVHB 3ZRFC 2R1YA 2VW6A 5KG9A 1ZGLM 3FTGB 1C12B 4MZIA 1SF5A 2IV8A 2PWEA 1M3IA 1J0JA 1LWJA 3S48A 4N0YL 5DWPA 1WS7A 2X9YA 3VSUA 2XQ0A 1QTSA 1AGBA 3PGDB 3KPMB 4ZQTA 3FO1B 2GC4C 2DQCL 2AHIA 1OB1A 3ALWA 3IDIA 3IDXL 4X9BA 1OAZL 4JANB 1W6WA 1Q1JL 3TNMB 4NQDA 4PSPA 4K5OA 4EI6A 1KBGH 2FYYA 2HJFA 1UXSB 5B39B 3A4AA 3A6CL 3PWJA 1D9KC 1IKFL 3ATFA 5KVGE 5HYEA 4U6YA 4OBSA 2CGRH 5IW6B 3QQ4A 3BHBA 3QVAA 1TKWA 3GBML 1ZHNB 3ENEA 3Q9PA 3QUGA 4OTXL 4DJMA 1CD0A 4QEGA 4L37A 1KT2A 1ML0A 4F3FA 3GZPA 3OXSA 4F5CA 1R5VA 2RMNA 4HDIA 4N8PA 1CFQA 2NY3B 2NZ9C 5BQ7B 2H2SC 4NXSA 1OT1A 1KN2L 5J06A 2H9GB 4Z18A 4JHWH 3X14A 4F9LA 3KPLB 4HKZB 4YDKH 3X1FA 1RH8A 3OAZH 1Y18A 2R56H 4OLXH 2FYVA 1G7JA 3BXNA 3GJFK 3DMMD 1UC6A 4Z23A 3CN2A 1FPTH 2AJYL 2X42A 1JGLH 4QHKI 3IJ8A 1BLNB 2K1MA 2Z8SA 3UZEC 5I66B 1DLHA 5EU6E 5GZOC 5KS9E 5A1AA 4YXKL 3T8MA 4N5ED 2BOLA 1JPGA 1EGJH 5KS9F 3QFJB 3VMPA 1A6ZA 2JXMB 3SDXF 4I87A 1AI1H 4DUVA 1OTSC 1MIEH 3BVWA 1JD9A 4KK9D 4N26A 1AKPA 2OBGA 3AGVA 1H8LA 2V5SA 3D2UB 5K9OA 5DVMA 3VTAA 1OCCB 3TVMD 4KJPC 4DP6X 5I1LA 2MOQA 5C7ZA 2X4TA 1BXVA 3PXHA 4PRBB 5GS1C 4YSCA 2Q8AH 1S7UA 1F1AA 4Z7OB 4M6OL 1GJIA 2F68X 4HC1L 3B6SA 3CZUB 5FUOL 1NGWB 2DM3A 4KZEL 5E4EC 4K9EC 4TQEH 2ZCLH 4AYGA 4NC1C 2YKKA 4KK5D 1WA0X 4LSTL 3NIDF 1DSFL 2ZUUA 4AGMA 1ODUA 4H8WH 5AW0B 1PY0A 3ROOB 1EZLA 4I3SH 3L3HA 2HTLD 4CBPA 4Z7VA 2ZXWB 4L5FE 1KCBA 1NC4D 2N01B 4DP7X 2J4WH 5FM5M 5GGSY 5L9DH 1UACH 4KQ3L 1DQLH 1BYOA 2X4NB 5E9NA 3IU4L 1U3HC 2J1YA 3EJZC 4UQAA 4XPHH 1UA3A 5DQ9B 3RVWC 2ED8A 3TXAA 4LSPL 4L5FL 4GBXC 3T6XA 2CPCA 3L3OA 1QBMH 4ZI8A 1T5XA 4K3EH 1U3ZA 4L3CA 4KI5E 1QAWA 2DEYX 3B43A 1DN2A 4ZTOL 5FB8B 3ARGA 5CBAB 3BEWA 3NSDA 4I0CC 1DTUA 3NABH 3G5YA 4H26B 4JDEA 2WAQA 3ZYIA 5LAPA 3RP1A 4QJ4B 4MDIB 4PWIA 4KZDL 2QQNL 1MAKA 4XNUL 4Y8DC 4YHLH 3ZVVA 3G08A 4FFYH 3C5SA 2EH8H 4LIQL 2FO8A 4P46A 5TH2B 1PLGH 4LVEA 1A3RL 2B20A 4OIFA 4D2NA 3II2A 3KEHA 4XCCL 3FOMA 1AFVL 4JFFA 5LWYL 2WMPA 1FDLL 5I75C 2OZ4A 3WFHA 1O5DT 1Q9WA 4QKXB 2HA1A 4Z1PA 4P4KB 2G3XA 6FABL 1PSKL 1FFOA 5FA4B 1LNUA 2BXZA 2FEEL 3IKCA 5TE7H 1YYMH 2XA8L 5CP7B 1CE1L 3C6LB 4ZSOA 3LZNA 2GITA 5I17A 3DUSB 5EC2B 1AXSB 3KLLA 4OT1L 1JPSL 3RU8L 1Z9SB 2MCPH 4G9DB 1BIIB 1OZUA 3QHZL 4MXWH 4HOWA 2ILLA 4M1DL 1I7UA 4G59C 3RVWD 2DN7A 2FX9L 2A9MH 3K5SA 3TX4A 2UY6B 4P23B 2WMPB 1NIAA 3TT3H 3B9KC 1BGXL 4EZJA 4J5VA 1AE6L 5FYLH 2XY2A 4JRFA 4H88L 1FA4A 4MWFB 4KUCF 3FN3A 5CR1A 3LPPA 4JB9L 1EBPA 1NCOA 1I85A 4XXWC 1FQ9C 5DA0B 1Q72L 2ZNWA 4KQ4H 2ZG3A 4OSUL 4NKDA 3PWNA 3LRKA 4N2GA 4Q56A 4R97B 4XVTH 3VCLB 4OZHB 1T1ZB 2L04A 1L6PA 1Y18B 5DJCA 2HT2C 4BCYA 1MUJA 3NJHA 2XN9D 3KCPB 4GKNB 3EGDA 2XV2A 2C1PB 1QI3A 4FTVA 3B2DC 4UYPA 1QFWL 2ATKB 3CK0H 4FA8A 4G7YL 3TESA 1EWHA 2J8UF 3PQYE 1E3XA 1MW1A 1UZ6F 4M48H 2IADB 4JDVA 4IBYA 5E2TL 4L8CB 1IVTA 2VXSH 2OL3B 2HPOA 2BP0B 4PJEE 1XR8A 4YHPB 2C9AA 1HU8A 2PLTA 3CPLA 5ACZA 1IU1A 2EIMB 1GL4B 5IV2A 4OCYL 2ZKMX 1S9XA 2X4QA 3E8UL 1BLNA 2BVYA 1Q9KA 3CZFA 3L3OC 3L13A 5IJKA 3KYKL 2VXQA 3RPIA 1NJ9A 4KKLD 4UWQB 4A39A 3KR3H 1UADC 1ED3A 1J1PH 2FBJL 3MACH 5DUPH 1KCVL 3HI1A 4XP6H 2COVD 4KV5E 4LL4A 5TDOB 2Y7QA 3BFOA 2OR9L 3NVQA 3RDTD 4J39A 2YGQA 3F00A 3N06B 4XHJC 1MLCB 3LXBA 1YECH 3LMJL 4UT7H 4X83A 3FXIC 5DC4B 5I1JH 4PJ8D 1Y6MR 1DR9A 5FFOA 4QRAA 3U4BL 4X6BB 3BPNC 1J0ZA 4L8DB 4JW3A 2XNAA 4JREB 2QQQA 4PRBA 2WQ8A 1I9IH 4AC4A 2AI0H 4PJXF 5SX5H 2XWZA 1T5WA 4GPVA 4AQAB 4K5PA 1FFNB 2A6IB 2CCWA 2EXWD 3BPLB 3MRKA 1UWEH 4K7PH 3RRQA 5B8CA 4OBRA 2Z31C 2APFA 2UWEB 3HI6L 4WGKA 2E9IA 5SV3A 3WLWD 1I3RA 3LQAL 4TKWA 5GSRA 5GZNC 2ZXGA 1KCRH 5FEBA 4TNGA 3HPLB 1UXWA 1TLMA 4KY2A 4X8XA 4WUUA 2FK9A 4ZUUB 3QUZC 4OLEA 3VXMA 3SJVE 1SDDB 4IRJC 1CE6A 5EN2A 3KG5A 4P5TB 2YD1A 3OHXC 1S7RA 3VFPA 2E9GA 1GVIA 3DSNB 1Q0XL 5DK2A 3QDJE 2J6WA 4MA3B 2AMUA 2DIEA 1H19A 3NQKA 1NMCC 1OVZA 4NUPA 3ARBA 3KLDA 1AOZA 1EEZB 1B9KA 2Y3NA 4NZRH 1BZ9A 2EUWA 1NCAL 5EDXA 4I0PA 2VDLL 1HZLA 2BSTB 3TYGL 1VHPA 3FRPG 3A22A 3O2DH 5IT2L 1A6AB 3OJDB 4QRUB 5E1GA 4ZFOB 1W72B 5BO1L 2WLYA 4WV1B 3MV9A 1GTFA 2ZX7A 4NP4L 2VR4A 3UERA 1DJXA 3ARFD 3QZOA 1CFSA 4WHYH 4B0MM 1YMHB 1M71B 1ZVSA 4K23L 4G6JL 5J6GB 3RUGB 3RL2B 2DQIH 4I8DA 2B59B 3AVEA 2A73A 3CLFL 4IMKC 1XCTA 1MCPH 3AT8A 1M3JA 4FXKC 4MA7H 3M1BB 4U6HA 3MROB 5EG6C 2Z31D 3GMLB 3ARSA 2HJLA 4QHLA 4HUWA 3EH2A 1MRFL 3E2HB 4I4WB 4DPCX 3BW9B 4TM9A 1MAMH 2JH2A 4G9DA 5DEGB 1YN6A 2G0KA 3C5JB 4M5ZL 5A2JH 1KN4H 2WXIA 1F90H 2EIBA 3VQMA 4ZMOA 2VDOB 2VDNB 3O2VH 3BVXA 3HLAA 3PDDA 1P7QD 4WTZG 3SDAB 3GSQB 4OKDA 5FAAA 3QUMA 4EE2A 5J4MA 2JJVA 3RWDA 4C55A 3FUEA 1URIA 5E8NB 1TT6A 5EF3A 3O3BA 4QHUB 1E5ZA 4UQBA 4MD4B 1TZHB 3UABA 5LAXA 4A7GA 4QGYA 1UG9A 4IRZH 4ELMF 5KTEL 5C0AB 4ZTOH 2OTUA 4MCNA 4XNXH 4DH2A 3JSSA 5LGJA 4H8VA 2UVEA 3VH8A 4AEHL 2X0WA 3OHXA 4CMMA 1XF2A 1DJYA 1A8JH 1S9WA 5IBUB 3AADB 2GY7B 2GAZB 4GRWH 2AERT 2W91A 2VW4A 3G04B 3AMKA 4G80A 5KYUA 5F7EL 3ABZA 3MRNA 3S3JA 4TSCH 3D6GA 4BFJA 1JVLA 3EGXA 1IM9D 4XCCH 3T0XA 1NUGA 1MHPH 1X7SA 4OFPA 4QIRA 4XO5A 4E9VA 1D5MB 1SEBA 2CRIA 3BIKA 2CHDA 3NCCB 3GLDA 3FU9A 1F56A 2D0FA 4Q9BA 2F8VA 4FCAA 5IF0B 3O2WL 4LVNB 1NPJA 4BDVB 4AEFA 3BN9C 4N28A 1IB5A 3IXAB 3SPJA 2MCPL 1YJDH 3BAEH 3QFJE 2XBDA 3KL3A 5BV7L 5L8LB 3K72B 2YEQA 3CFEA 3L4TA 3BQUB 2J6EL 1SLXA 2VQTA 3NRPA 3U2SB 3UP1A 3LHPL 1XSJA 4DKFL 5D2LA 4JM2C 2D4DA 2LT9A 3SJVD 3MNMA 1X9UA 3MXWL 1DO5A 4G42A 5EO0A 3U4EA 5DEJA 1GHFL 2B1AL 4PRPD 4BKLA 4HBCH 1JGDB 1JZDC 4HIXL 3Q43A 2FHFA 5F89A 5JQIB 3HMWH 2DTML 4Q9QL 4JO3L 3SE4A 2YQ2A 3AS3A 3QI9A 4ZQKA 5DMKA 2X05A 2GK0B 1F3RB 2CO2A 3RVXC 4CL7A 3ES6A 2XETA 4DPAX 3QT2A 3MRPB 5IFJA 5DK0B 4MKMA 2AABH 3CAFA 1QFWH 2DJMA 3CK0L 5EF2A 3A4FA 1HCZA 2D7TH 4G6MH 3ZTEA 2CPUA 2HZHA 4RFOH 1W72H 4EUPA 1JSYA 3ETSA 4ZPTA 3MI6A 3FCGA 3JTTA 1F1DA 1E8XA 4F15B 1LE9A 1CLZL 3BN9D 4FL4C 2JJTC 4PTUA 3E8UH 3QYCA 3GXTA 3HG5A 3SPCA 5AYQA 1V3LA 2CAKA 3RNQB 2I85A 3B9VA 3ARRA 3NSXA 4FFYL 4RMVA 3LKPA 1Z5HA 5T3XL 3VFRA 3D3VD 5AAMC 3RVVD 1AFVH 3NK4A 5ANME 1KJMB 3RB7A 5D7IF 1NC4B 4HJJL 4POZD 4QD2E 5JHAA 3IMVA 4MNHA 4LL1A 3REVA 1CDBA 4YN3A 3MRHB 4ABWA 4OZGF 1S9YB 4HISA 4PJHE 2YIHA 3X2QB 4LEBA 5C6WH 5KUMA 1TF4A 2VSDA 4JO4L 3WHE0 1X7QB 1EIBA 4CDHA 4F2FA 5EEUA 1HL8A 4O51B 1IM3B 4IGBC 5MEPA 4HIHA 2FT8A 4YDLB 2GVYA 3DDFA 2CJTA 3RVTD 2ZAHA 4C83B 3FZUC 1RUPL 4TUUA 3SCMC 2YRBA 3DKHA 5E9DB 2JE8A 1GGBH 4LCIL 1F02I 1AG6A 3MOAH 1LD9A 2BX5A 2UUDK 4U2ZA 4A38A 1EXUA 2P28B 2L7UA 1BJ8A 1F6FB 5HYSG 2NT0A 1U8QA 3CDZA 1U33A 1S9YA 3BAYA 2JK5A 4M7KL 1I53A 4RFNC 1V3MA 3QIUA 1GKOA 2R2EA 1OSZB 2FO4B 3LZQA 2MPAH 2DLTA 2QSTA 3ZTNH 3G5XA 5SV4A 4HPHA 5IESL 4K3JH 4PJ5B 4FABL 1Z3GL 2QMJA 3W1ZA 2AP2A 4K73A 1EVUA 3E6HA 2VXVH 4MJID 5DD6B 3EO1B 3EO0A 4GEJA 2C4XA 2F5BH 3I50L 4PRIE 4H44C 5MEOA 4I5BB 5KOMC 4OD1L 3IT8D 3V0FA 4KUCD 4HWBA 3CHOA 3NMEA 3DO3A 4S1DC 4B9PA 2BNRA 4TNEA 5AKRA 3FYEB 2HFFB 4QHMA 1ORSB 3DX1A 1JVKA 4P9ML 4QHNA 5A16B 4B96A 1AY1H 1W2KT 1GGUA 1DBBH 1OCWH 1X5YA 1VAHA 2EYRB 1JXKA 1I3GL 1RZ8A 1AGFB 3ZZ1A 3MRCA 3OQRA 2DQIL 1ZT1A 3IDMB 3T65B 3MLTB 1VGEH 1M7DA 1UFGA 3ARQA 3L3JB 1OGTA 1UM6H 4LSUH 5L0QC 4JRXB 2PYEE 2MCMA 5HHPB 5MP6L 3BQUA 4KJYB 2OMVA 3IPBA 4NQEB 5E6ID 1TEFA 4FEIA 5DT1H 2AEPH 1T66C 3DURA 4OD3L 1ORSA 3GJEA 2I07B 5HYSA 5AYTA 1I8KA 4XOAA 1COBA 3WFCH 3A24A 4XR8C 1I1AD 1YEKH 2VZSA 3D39B 1JRHH 3CBRA 4I89A 1NSNL 2BP3A 4JFQA 2HKHL 3QULB 4LHUG 1RSFA 3BSZL 4C56E 4JQXC 3DVNA 1T83A 4CKVX 3ZDXF 5KUKA 2FNWA 5DMKB 1E50A 1F5WA 1D5IH 2CLVB 4YHIB 3S5LA 5EZIH 1OCRB 4FQQA 3V4UH 4JR9H 4PBXA 3O81A 2E86A 3LKSB 3R1GL 4K5NA 3QAZB 4TLKA 4ZX6A 5I8OL 5CEZH 3S34H 1AHWB 1F97A 3W38A 4ZPVA 3D33A 3T0EA 4DTGH 4XBPB 1P69B 3LCYA 5AYUH 2HRGA 4YLQT 5ESQA 3RPBA 4NQUA 4AK2A 1SY6A 2D3VA 1E9QA 5E2UH 1I82A 2GUOB 1HHGB 1LEGB 1P6FA 2CKBA 4HSAC 5F7YC 4J8RB 2X87A 2CK2A 3W56A 4OCRH 4B9IA 4DNLA 5KVFH 4PJAF 4D8PA 1MEXH 1GGIH 4CNIB 1WCBA 1PCXA 1ZA3A 4PJXE 3UBXG 4EO5A 4XP1H 4CN1A 1NTDA 3T3MF 1CFMA 3K6IA 4KC3B 1KDJA 2UZIL 2QFPA 5CSZB 1FORH 3DO4A 3N41B 1EZVX 4J3WA 1HS6A 2KBGA 2ZAGA 4FXKB 4MHHI 3RYMA 3VXMD 1TR7A 1ZWIA 2QELA 1ADWA 1P4IH 4PRNB 3BCFA 2QDWA 3DI2B 4NOBA 4QRTA 4ZUWB 3SKJH 4UM9A 4AG4L 1DBAL 1N8OE 3H9SD 4CADA 2Y3AA 2TAAA 1ILSA 1RK1A 1TU2B 1IIKA 1SMDA 4MVBC 1MVYA 4K23H 5BRZA 3OXRB 2KUTA 5TD4A 1WWCA 4JM0A 4NT6A 1VEMA 3UJTH 3IRZA 1I9RH 3P4MB 1PJWA 5ERWB 3UYOD 5DU7A 1ZCRA 4FQXC 4GEIA 1WFTA 2VLJD 3KXFA 4X6EB 3QEGH 5H94A 5I24A 4P5TD 1JK9B 1UZ6E 3V0VA 1PIFA 4K9JA 4ODVH 1CFTA 1BP3B 2FD6H 4GRMB 2H8PA 4TUOB 4XCEA 3VGGA 1QEWB 25C8H 4M5ZH 1T6VN 2HTLC 4B50A 4KU1A 2DQGH 4M7LH 3U1SL 3O9WC 2NY3D 1VFUA 3MREB 1JZ5A 2FEEI 3HZ3A 4TLSA 3QNXA 2X4SA 3FOMB 4JFFB 2Z91A 1CFNB 4JHAL 4DO6A 3MVSA 4PGEA 5BCAA 3KW7A 4NX0A 3MGTB 5FKPA 4X42A 3DMMB 1Q9WB 3NCJH 4E9XA 1UWYA 5FA3B 2V3FA 4GAGH 2IG2L 5F88B 2SODB 2YBRB 2GSIB 3P30H 4PY8I 3KWVA 5DJAA 5D9SA 5SWSE 4GRWB 1NUFA 4E41B 1UENA 4AYMC 3RHWF 5IQOA 3CDZB 3KPSD 1E8WA 3QFJD 1OLZA 4QXUH 4ZW8A 4UI2A 3DGGB 4F2MB 5CEYA 1BIIA 2NY0D 3BVTA 4R5VA 5E23A 1DLFH 4FQJL 5MEND 3NIFF 3D2UD 4NN5C 1R3JB 4HFWB 4NRZB 2F2HA 4F5CE 4JFPB 4DESA 1GC1C 1JGIA 3GHEH 1QWNA 2BZCA 5TE4H 3DPDA 3EYFA 1RIVL 4IU3B 1XGRA 3L9EA 4PN6A 5E1HB 5C8JA 5G5DA 1MF2H 3QRLA 1H6FA 1DANT 2NW2A 2DS4A 4HJJH 2FSDA 5CZXD 1DUYA 1IGMH 4FG2A 2A4ZA 3C75A 2IH8A 3HG2A 4YJZL 3GRBA 4UQCA 4X7SH 3G6DL 4B53A 4D0DA 4QUOA 2EICA 3P9MB 5DMJB 4XNMB 3V55A 1AGDA 1T7VA 4KDWA 1CT8B 3BE1H 1ASOA 3G6JF 1P6AB 4PJFA 2OK0H 1XIWC 3O9WD 2NY3C 4Y2DB 1CDIA 5IB4B 4PJ8A 4WDIA 5I5RA 3TBYB 3NACL 1NCDL 2FBRA 3EYUH 1D9KD 2VR8A 3ZR5A 1CIDA 4WKXA 5EUOE 5TDPB 1F58H 1G7QB 2XX1A 3B83A 4U3XA 2JWYA 4A68A 3DETD 1S3RA 1S78D 2AQ1A 4LKXB 5CEXA 1L4IA 2DWSA 2BFVL 4L9LB 3L4WA 5F7MC 3DX8A 2YEVB 4H25B 5IKCB 3BX7C 5D7LE 3G9VA 1KB9J 4MB5A 1G5AA 2Y2YA 5ITBL 1AZVA 3GSNA 5I76A 1XF4B 3C5ZB 5EU5B 2BIIA 5JYLA 3SIKA 1U95B 5JZ7C 3EXLA 4KKLC 5CJ5A 3HB3D 1RZIB 2WP3O 2ALAA 5KBLA 3A67H 4NDMB 3SDCB 4ZMTA 2YKLH 4B7LA 4IJTA 4H1LH 4J1UB 3B34A 4A2MA 1WTLA 2ZWNA 3H4FA 1WP6A 4E9YA 1T03L 3O11B 5I8CA 3O6FA 4WWID 2HFEB 3CFDA 3HLKA 1BZDA 4WWPA 1PYWB 2G5BA 4ZX4A 2KERA 1SLWA 4BH8A 3BD3A 4X7TB 5FO8A 2NUTB 2VDRH 5LGHH 3ETBF 2AQTA 1GW0A 4XE5B 4PTTA 1WHPA 3ARBD 5IBUG 5HGBB 4GRWF 1DQJA 3SGEH 5HJGA 1E4JA 4GS7B 3W2DH 1T83C 3WNKA 2K9UA 1JHKL 2COQA 4A67A 3HI5H 4PRPA 1UZ8B 2YA2A 3RG1C 4TPRH 3ULVE 2Y06H 4BH7A 5KYXA 4TVUA 4Q4IA 5T1KD 3E6FA 5C0GA 3G5VB 3FT2A 4W9KC 5GZND 3MLVH 3TO4C 3C6LD 3MTRA 3VXQA 4PREB 1A1NA 1GJWA 3VJ6B 3WENA 3VM7A 4N6QA 5JIHA 3LVTA 3BZ5A 1ORQA 1RI8A 1P5UA 3CHSA 1MN4A 3CXDL 1X5MA 1PYWA 3HFFA 4HHAA 2R27A 1I1CA 4LIQE 4UDUB 5KSVA 3U79A 4YHZH 1M05B 3ARVA 5CD3B 1W80A 4NB7A 4YDLC 2B1HH 5HHNA 3RFZA 2E7LC 5CCGE 3HAEG 3FK3A 4QRRA 3DOIA 1GS8A 3OKMB 4H0LC 2V2XA 3LRHA 4RA3A 2ZWZA 3B6SB 2A2QT 3OF6D 4PJEA 4M5YL 1MHEB 1G7PA 4LMQE 1PKQA 2VR7A 4JO4H 1KOAA 4NAQA 1ZTMA 1EHNA 4KHTH 1X7TA 4MQXD 3SE3A 4UINH 1JGVL 1I7UB 4DGIH 5CU5A 2HCZX 2SEBA 4E9QA 2D3LA 3D9AH 4OQ1A 32C2B 1JGUL 3O2DA 5C07D 4F1SA 1YEWA 1ASQA 3QYNA 2EINB 5F6HJ 3NCMA 2EDKA 2PCXA 1CFSB 5I8OH 4QOKE 4G6AC 3PNWB 4ZOAA 1OT4A 2LFGA 2D0GA 2EXTA 3TO2B 5F3BB 1FZOA 5IMLA 3MLTA 4LVOB 4RLDA 3HJEA 1KPVA 2HX9A 4DPBX 2AZUA 2R4SH 4AH2A 4PJAB 1QD0A 1D6VH 3DJRA 3D3VB 4DQOL 2YD3A 3EJCA 1P0SE 1YLBB 1IKFH 1P5VB 1U6AH 2Y6SC 1X9QA 2K9FB 3LNEA 1MEXL 4TRPH 4HUXA 3EJYD 1F2XK 1TITA 5DJCB 4IGBA 1M6OA 4OM0H 2AXWA 5C0DB 1UATA 3OQ3B 1LMKA 4MMZC 3SDAA 2RGSA 3ECBA 1UXLA 4E9LA 2ARJQ 4ODXB 2YUVA 3ZQWA 3NRQA 4CVZA 5D96B 5K9JL 4B97A 3VFUB 1YY9C 3RWIA 3ARFC 4AV0A 5DYFA 3PG2A 4PJIB 5JLZA 2R1XB 1SHWA 4IRZA 3HE6C 3MA7B 4NI6A 4V33A 3PWJB 1FVDB 5AL0A 2CLVA 4PGJA 1MH5B 3CDGA 3P3SA 1PX8A 4FJZA 5EEVA 3KPRB 1MFBL 1AO7D 3GJFA 1DVSA 1ED3B 4I18A 5HDWA 5SWZE 4AYID 3BZEA 3L1OH 4X6DB 4WI5A 1M1XB 4OJCA 2QSQA