1WYJA

Solution structure of mouse protocadherin beta 14 (26-137)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
125
structure length
125
Chain Sequence
GSSGSSGAGSATITYSVLEETDRGSLVGNLAKDLGLSLRELITRGAQILSKGNKQLLQLEQKSGNLLLKEKLDREELCGSTNPCILHFQVLLKSPVQFIQGEIQLQDVNDHAPEFMEDESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protocadherin beta 14
publication title Solution structure of mouse protocadherin beta 14 (26-137)
rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 11
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2005-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08266 Cadherin_2 Cadherin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 1wyjA01
2YSTA 1ZVNA 3Q2LA 2QVIA 3LNHA 3PPEA 2O72A 1SUHA 2OMWB 4XXWA 3LNFA 4ZMPA 4ZMVA 4ZMOA 1EDHA 1WYJA 4NUMA 5JYMA 2OMXB 5CZRA 4ZI8A 4OY9A 2WCPA 4AXWA 4ZMXA 1Q1PA 3LNDA 4ZMZA 3Q2WA 3UBGA 2OMUB 1NCIA 4ZMQA 4AQEB 5JYLA 4QD2E 4APXB 1ZXKA 4NUQA 1O6SB 2OMYB 4ZMYA 3MVSA 4ZMWA 1NCJA 2OMTB 2WBXA 2V37A 4AQAA 3K5SA 3Q2VA 2YQGA 4AQ8C 2WD0A 1NCGA 4ZTEA 5DZVA 3FF8A 4ZMNA 3K6FA 3UBFA 4ZMTA 2WHVA 1OP4A 2A4EA 3QRBA 4NUPA 4ZMLA 3LNGA 2OMVB 3K5RA 2A4CA 2EE0A 2OMZB 1L3WA 4AK1A 4AXWB 2QVFB 5KJ4A 4ZT1A 3LNEA 1FF5A 4AQ8A 5CO1A 3FF7A 3LNIA 2X2UA 3K6IA 3Q2NA 3UBHA 4NQQA 1NCHA 1WUZA 4AQEA 4XXWC 3K6DA 4APXA 4AQAB
chains in the Genus database with same CATH superfamily
1TG8A 3EFFB 3G08B 4XCEA 3PUCA 5FFGA 4MSWB 3U36B 1U33A 2VN6A 3PP3K 4GMTH 4J6IA 1DEEB 1T0PB 3TVMA 4DEUA 4F8QA 3UC2A 2DJSA 5IBLC 3WTTA 3K71B 3FRPB 1BQLH 4BEIA 3OR7A 4XGZA 1D6VH 5INCA 1K9TA 3MRCB 5LBSH 1P7QA 2FRGP 3QRGH 4YDLB 2A6DB 2QKIB 4FZEL 4LT7A 5KYUA 2BS8A 3LAFA 5LCVA 4NLHA 1RULL 1GVIA 5I1KH 4PJCE 4UT9H 3WMQA 1E6OL 1EXGA 4OBSA 5C7XH 1NGWB 1HNYA 5D8JL 2YGPA 3I9GL 5JDSA 3K2IA 4ZO7A 5DD3H 3RGHA 3SYCA 4BFKA 4OCLC 1RQ5A 5IWLC 1MHCA 1YQVH 2WOYA 3RWFB 2AJSL 1S6NA 2Q20A 3I75B 3CC5B 1U3HA 5GHWL 5DHEA 3RU8H 4L9LC 3S3BB 1XVSA 4HULB 5GSRA 2QTEA 5L6YH 4IRSB 2O4EA 4I0PD 4UTBL 1ONQA 4GP5B 5B8CA 1NDMB 5ABAA 1RP9A 1G9NL 3ARGC 3EADA 4Y4HB 3HNTH 3VXSA 2IBGA 2WBJC 2JV6A 4XC3L 4DK6A 1NMAL 4AEHL 1KIPA 2L4OA 2WQVA 3BAIA 3PCYA 2I9TB 1QHQA 1T04A 1T80A 4FJZA 2NMSA 1YEDB 3BVUA 4ALAL 4KKCD 3MA9L 1UB6A 3HS0B 1UZ8A 1KXTA 3OKYA 5E9DB 2YMTA 1VB9A 3G6JB 3K0YA 3AQDA 3GHBL 4NC1C 1PKQE 1HL8A 1BOYA 1PG7W 5TE4H 3RKDC 1FFOA 4PJDB 4HX1B 2RR3A 3HI5L 1FC1A 2CA3A 4P2RA 4JVUA 2OSLA 1IVTA 4U1SA 1EFXB 4ZW8A 1OK8A 1L5GA 3MJ8B 2VXVL 3LMJH 1RK1B 1S5IL 4S0TD 1VZHA 5HPMB 1JGIA 3WFBL 4N5EC 2X2UA 3V8OA 4JRXA 3WNLA 1I9IH 2Y1YA 4ZK8A 1FZOA 3SPHA 3RTLA 1HHHB 4M7LT 3DV6B 3PDDA 2NX5A 2GFBB 1AXSB 4GIOA 2EAEA 3ZK0A 5LKNA 1DR9A 2BVEA 3WUZA 4AEFA 3DVFA 3MRRA 4PJ7B 4RAVA 1E4XH 3UC0L 4PJ9C 3QEQE 3QIUC 4JPKL 4PMEA 1NCBL 1OD7A 4UM9A 2B0SH 4YVUA 3WOVA 4AGLA 5F7WC 3VW3L 4NQCD 4HUVB 4KTDL 5DO2C 4WDIB 2ALAA 4MA1B 5TDPB 1YMME 3VFVA 2PYEE 3CNKA 4WNJA 3W56A 3ILPB 2CLVA 2VXSH 4O51A 2DJ4A 2TSBA 4QUOA 4A6YL 2XFGB 1UD5A 1L3NA 3M17B 3M1BB 3QIBB 1NCDL 1XMEB 4OH2A 5KG9A 4Z3HA 2R8SH 1EUTA 3OC5A 2A7BA 1A6TA 4IBYA 4J4PC 4NFBA 4TRPL 5KYXA 5DSCB 4PWJA 3RNKB 1QI3A 4KV5E 4OFYD 5EF1A 3MJ9H 2V2TB 2R9HC 2WBJD 1OLLA 1R5VB 1RMFL 2YGQA 5H4ZA 5IBUB 4X98A 3QQDB 1JIBA 4JUTA 1PZ5B 2X0VA 4I85A 1IM3D 1TO5A 1VGKA 2EDNA 1YEFH 3GKWL 4NO3B 5CJ5A 5CN1A 3MBEC 3B1TA 5LJYH 5DHDA 2PXYC 2ZOKB 4ZTPH 2B4CH 2NR6C 1H9DA 1X7QB 2Z8WC 2ZKMX 1FLRH 5GGVY 5GJTL 3KJ4C 1CGXA 3TX4A 2YD5A 1T5WB 3UROR 4ZDHA 1UOVA 4PUBH 3RWEA 2O30A 5E4OA 5B3NA 1KIRA 2D7OA 2K6ZA 3VFGH 1EJOL 3L2LA 4L4VA 4D3CH 1G7LB 5FGCE 2RTTA 4JO1L 2AQNA 4KNUA 1ORSA 2AXWA 5CXPA 5L4IA 1P2CA 3WEAA 1ZAGA 2VW4A 1KGUA 2BERA 3SYQA 1DSFL 4GXUN 3QPXH 1IGML 4LAQL 1IARB 1CXHA 2R15A 5DJ0B 3TONA 4MJIE 4JHWL 2OMBA 4WV1B 4P5SA 4YLCA 3VXUB 1JXJA 1CE1H 1F45A 4L2YA 4TNWF 5CEYB 5T3ZD 1CD1B 2YPLA 4P5KA 4XC1L 1L7IH 3BI9X 3VQ2C 3WGVB 1XT5A 5F8QC 4LSVL 3WEMA 3LKOA 3QJRB 2OL3H 2EUVA 1QFWI 1Q90A 5E8EB 4ZAKA 4FCAA 1WS7A 2DDQL 2LABA 4FTVA 5F70A 2P80D 4A63A 4F33A 2VXQH 2W0FB 5ESQA 5F21B 5A16B 4XP9H 4WO4D 3SDAC 1L9RA 1COBA 2BOCA 5DO2D 1TJIL 3AACA 5JHLA 5LGKA 1JNHB 3AG4B 1DBAH 4P46B 1KC5H 3TN0D 2L04A 4DZBB 1EO8H 2WO4A 4H5SA 5E6IC 4JFFB 1MCSA 3CGTA 2VO8A 2RCSH 3MV01 2XX0A 3E6HA 1K85A 2BP5M 4KKBC 5EF3A 4WIQA 3T0EE 1B4LA 2FB4L 5D4IA 4M03A 2N01B 2R9HD 1R75A 5EC2A 3ZUCA 2DYSB 2R2HB 2WOBA 3REWB 1H3PH 1T83A 4JR9H 4UOQA 5IVXE 4CVZA 4RMSA 1LMIA 3RL1B 5E70A 5A6IA 4OM1H 1CL7L 1JI2A 5E95B 2YPVL 1L6XA 2YLHA 3K4DA 3MBED 4U1MB 3RDTC 3CH1B 4DFHA 1EEUA 3OKMA 5CHNA 3S4SG 2NR6D 2X4TA 5IM7B 3HHSA 4I2XB 4RGMC 5I71C 1OTSC 1F11B 1FIGL 3HG5A 4R96A 5MENE 4Z7NF 4K3HA 3VFWB 2Q76B 5K5YA 2LT9A 1P69B 3JYCA 3NCJH 4LCYB 2FJFB 3PDOB 4H8PA 3V0VA 3WE1A 3L1GA 4R84A 2V2XA 1MELA 3CC1A 3KGRA 4ODXB 3SY0B 3GZQA 3KPSE 4OD3H 1FLTX 1LLAA 4XVUC 4BSVB 4E9VA 4G8GD 1F58H 1AYRA 4FP8L 4XMPH 2OSYA 1SXZA 1U8HB 3OKLB 1FYHB 3O45B 1TEFA 5KJ7E 5I75B 3SGJC 5DJAA 2FK9A 3JWDL 3MO1A 3SDXF 1PVHA 2CNZA 9CGTA 5DXWA 2XDHA 4B96A 1DTUA 4M7LH 4A2MA 3IMRA 4JM2A 1AHWC 4FG4A 2FQEA 3RWHB 3RI5K 5MERB 3MJ7B 2VERA 2VXTL 4L3CA 4JFYA 4DKTA 1I3GH 1JV2B 4LAJH 5F89B 2DQJH 3DLQR 5C0FA 5C3IA 5L88H 3MX0A 1TUPA 5DYOA 4H8UA 2XWJB 4MVBD 3L17A 1DYZA 2V9RA 2K8QA 5HSFA 4YLBA 3SDAD 2ZXQA 5E4EC 5G5DA 2BRRH 2AQSA 1BREA 4L5FL 5T5FH 2UUDH 1YMHA 4N24A 3S88H 4J1UA 2IGTA 4NUPA 1FDLL 1MCCA 4QR7A 2C3VB 4LCCA 1U91A 1SJEB 4V1DE 2K1MA 3WXVL 3EDKA 4KV5F 4B60A 1MJ8H 1V3JA 3VXTA 2AJXL 2XA8L 2DQCH 1TVBA 2HT2D 3FCTA 1U3JA 4ZXBB 4R26L 1GYVA 2EYRB 5AW3B 5I9QB 4Y8AA 4CUCA 1S7VA 2P8MA 1SOXA 5IJVB 2MCPL 5C70A 4OIIH 4QTFA 3D87B 4Y9FA 4K3EH 5CJBA 3GRGA 5F6HJ 4WHYH 1RZKL 3TV8A 3IMSA 7CGTA 1A6AB 3DVGA 5ISZB 1CD9B 5A40E 2DQIH 5D2LE 3C5ZA 5GQBA 3W0WB 2XVBA 5DZPA 3GMNB 4UZGA 1I8AA 3PNWA 4UIMA 3STZA 5F72S 5KVFH 1D7BA 1I7UA 2WKGA 1KFGA 3GBMH 4YHYB 5K9JH 3IMVA 5HHXL 4YGVB 3KCPA 3NIDB 4QHMA 1TTFA 1ZCRA 2G3NA 2FHBA 2R0WL 2W9EL 2YXMA 1DVYA 3IPEA 4Z95H 4ENEC 3D3VB 4Y19A 3GSUA 5CCHE 1JNNH 1BYPA 1M71A 1ZGLP 1H0DA 1UD4A 1YUHA 1TLKA 3OC8A 4JGJA 1G7MA 4N8CL 3QZLA 5FKAB 3VVWA 3WKML 3BIBX 4OCWL 3ZZ1A 4I4WB 3JT0A 1QSFD 1YN7B 2HH0H 4J8RB 4YBHA 2WY3B 1BG9A 3QSKB 1KCRH 1XR8A 4P4KC 4KY1H 1SQ2N 1N7ML 4K5PA 5K93A 1E90A 1A2YA 1BMWA 4MQ7B 4GAJH 2NT0A 1RKRA 4Y1TA 3TEZA 2QLVB 1R3LB 3EDDA 5B4MC 3Q1SL 4OQTH 3UYPB 1I8KB 1OM9A 1I75A 1KB5A 1SLWA 4H40A 3C8DA 4MB5A 2OJZL 1EXUA 4HUXA 5DUML 4PJFE 3PF2A 3P40A 1JZ5A 4KZEL 5EV7A 4NKDA 2SEBB 3BT0A 4YDVA 1F6AA 4FFYL 2EVFA 5F3HB 1CIDA 2P5EB 1XSKA 4LCWA 4F27A 2PW2A 2HRHA 2EILB 1OSPL 5FHBH 4TM9A 2GBUA 4ZPVB 2Q3AA 1Q9WA 3MLRH 2NNFA 1F6FB 3T65B 1M7IB 4GBXC 1NZRA 4YHKL 4YHOH 3QBTB 2FWOB 5FB8B 1CI5A 4PRIE 2H1PL 2DWSA 3ULVF 2EVGA 1SJXA 3F84A 2WKLA 4TVPE 5KANG 4EXKA 1ACYL 4FHKA 1LWJA 2H8PA 2XPZA 2ATKA 4X7EC 4X9YA 3T5WA 3VRLE 5BUAA 2F58H 2W65A 5E2VL 1ZHNA 1TPXB 4YSUA 3IFNH 3L3OB 1GGIL 4PLJC 2Y1AA 2WANA 3D30A 4NGHL 2EADA 2YHGA 4JKLA 4P5TC 4PJGB 5MEQB 4Y1AE 2VDKL 1MN4A 4OIAA 4ENED 1TJHH 2GCYB 2I25N 2IPTH 3LD8B 1E65A 2DJUA 4JRLA 1DSYA 5AENA 4LBEB 2FYYB 2WUCH 3LZLA 4JQVA 5F1NB 1ULVA 5I1DB 1CVSC 3Q0HA 3T1FB 4AIOA 2QVMA 5E24E 1ZY9A 4WI8A 5T1LD 2O5ZL 4P4KD 4OF5A 1NIAA 3DJSA 2XG4B 1CMOA 1XGUA 5KS9A 1ILUA 3JWNC 2DQ6A 4G7RB 4RIRA 1HTYA 1TQBB 3SKOA 4FJ6A 1P5VB 2IDSA 5B4MD 2K3TA 4GUPB 4CADB 3ZDWA 4QRBA 5JO5A 3FUIA 4Z7IA 4WWKA 4XMZA 1RV6X 3ZTNL 1KPVB 2J57A 4DP1X 1JDCA 1QWNA 2MOGA 1MCWW 1BLNA 4KMLB 2Z35A 5GS0L 4HP5A 1N64H 3WSQL 1LWHA 4UDTA 3LV3A 1LILA 2AQPA 4H13C 1QFUL 3LH9A 3U9PH 1HHKA 3E8UH 1ANUA 2IDQA 3NCXA 5BUPA 1BF5A 3MRGA 2OZ4L 2Y22A 1MI5A 2O5NA 1RD6A 3HMXL 3PWUB 2WIIA 4WAFA 5IB3B 3V4LA 3TOPA 1D5MB 1F18A 4IBLT 4X4MA 1FAKT 5EMYA 2V7HA 4FQCH 1UWEH 3X17A 3FU9A 5K9QI 3BSZH 1IGFH 5MHSD 4OLYH 4KKAC 5D2LF 3FFCD 4JS7A 1LE5A 2DI7A 1HCFX 2O6PA 5KSBB 3ZKQD 4PYGA 2CIIB 5TF1L 4PJBE 1MCJA 3KPPB 3RVXD 2N7SA 2W9DL 3IDNB 4U3HA 5C0BD 4N0RA 2IXQB 4B3VA 4NKOA 4PLJD 3E8VA 1J9RA 2DWXA 2EIKB 4RRPA 3V55A 3CLEL 1B4JH 4PTTA 3M7FB 4WEMB 1MQ8A 1XH3A 3NACL 5KVGL 4K2UL 4P5TD 3ZE2F 4I77L 3MCKA 3B43A 3BVWA 4AV5A 1FYTD 1KJ2L 3BKYH 4N28A 4NOFA 4XO5A 5BUGA 5J9PB 1FQ9C 2OJEA 4Z7WF 2ZOTA 3HAEH 3MR9B 2C34A 1MFDH 1OP4A 1S5HA 4TULH 2VR4A 4RRPG 5CSBA 4HS3A 3LNGA 1CO1A 4GH7B 2VSDA 5BS0D 4AEEA 1K5NB 1U8PB 3BQUA 3D4YA 2DIEA 3TO4C 3DX4A 1ZGLA 4OD2B 1DLHA 5C09B 4X5RA 3L7EB 5DJYB 2GB2A 4N86A 3SD2A 2B1OA 2E7LC 1FN4B 1OY3B 1G6RL 2W0PA 2XV3A 1UH4A 1RIUL 5F7AA 4FADA 5E8NB 3X3FH 4EUPA 2BSRA 3DDFA 3EZJB 2OCFD 4PJFF 3RP1A 1I1FB 3OTTA 1NM4A 1A64A 5ICYA 3JV6A 4LEOA 4YNYB 3WTSA 1JZDC 3OB0H 1KZYA 3FUMA 4QMEA 2IAMA 1AO7D 3BHBA 4PQXA 4GS7C 2VGLM 1T1XB 5EUOB 4J39A 4N3TA 3FAXA 3HB3B 3P9MA 3TA3C 1V7MH 5D1ZC 1BFVH 3L3KA 4PFEA 5C3LD 4HT1H 2G4EA 2K7PA 1MIML 4DQOH 1F4WH 2A6KB 2MMXA 3QO0A 4JY6B 1SVCP 1SNRA 2VLJB 3KD4A 4QF1A 5MEOB 4U1NB 4KOBA 4YHZL 3GIVB 4P2OB 4F3FA 4Z5RB 2PCXA 4KKAD 1I85A 5DC9B 3NJIA 3FTZA 4HG4J 5JW4Q 3UZEA 4FXTA 5EOTA 4KQ4H 4WWPA 2D7PA 3VRLF 5JHMA 4ZMVA 1A0QH 3OLIA 5ITBH 3SEPA 1MFCH 5FA4B 4HPYH 3ECBA 2OX5B 1CQYA 1N10A 3ETTA 4OLEA 3SGEI 3B5HA 1WBXB 4XNUH 1AZNA 3EH2A 2ZQKA 4JKKA 3NZHL 4P3DA 5DHVB 2Y4SA 5IJKC 3HR5A 1I8IB 4XPAL 5LB1A 1U8CA 5T1KD 2X40A 4M1DH 3JWOC 3MRDB 1EK3A 4OF0A 4U6VH 2FECL 2DM7A 1ZXKA 3BRGC 3JZ7A 1PCXA 3ROOB 3F62A 3FB5A 3KYOA 3OZ9H 4E9LA 3JBG7 1LEGB 3BLBA 5JHBA 4YZFE 1GJWA 3BESR 3P77B 4I3GA 4X6CB 5EF0A 5KYWA 3IJEA 3G04A 4YMPA 3O41A 3RL2A 5EF2A 4QY8B 1N5AA 3LXAA 3WMSA 2PCPA 5E8PA 3V8CA 5EO0A 3JV0A 4DVRL 4UI2A 2VM3A 4EI6A 4TSCH 3RNQA 5JXAL 4NCC2 2CKBA 2HRGA 1XWVA 2BC4A 2FCBA 3TGXA 4JG1H 4X5WA 4E42A 1MRDH 2VISB 3AQYA 1F97A 5E9DE 5GGVL 1UM4L 2P7TA 4P5MA 4R0LC 4CKVX 5BXFB 4XOBA 1U95A 4D7BA 5PAZA 1KPUA 4G3YL 3TEYA 2AXFA 3FQWA 4PJDE 3QULA 2G3ZA 3RG1C 1ETB1 1DJXA 1JAEA 3ERXA 4UQAA 4QYOB 3BDYL 3BE1H 3V79C 5J12B 3MUGA 3TA3D 2FBJL 2NY5C 2NNCA 5FYJL 2DEYX 5D1ZD 5JLZB 3GO1L 2AEPH 1V5JA 2D73A 2LOEA 3PAYA 3ULAB 1BZEA 1PG7H 2NXYB 5FCUH 2EDDA 2XN1A 1OAZH 2FX8H 3S98A 2FLMA 3OL2A 2DBLL 3HC0A 2Y36H 1R5WA 4WI5A 2XQYK 3DX6B 3CN0A 3RPIA 1WA2X 2P5PA 4WI6A 5C3TA 4FQ2L 1R47A 2AJYL 4GAYB 4PJBF 4S1RH 4TVSa 1CICA 3HZKB 1Z32X 5E56A 4K23H 4KGLA 5KTEH 4NSKA 5F9OL 3ULVL 3BPCB 4HWEL 4TSBH 3SYPA 3B9KB 5J6GB 4PJ7E 3UJIL 3MXVH 2FJUB 4G42A 3RBSA 2E7MA 3TT1H 1QSVA 1T03L 3ZDYB 1OB1B 5FYKD 3VTAA 3GMPA 3ULUC 3WN5A 1LK3H 1DQQA 2XPYA 2VRAA 3PDGA 2E3VA 1S9WA 4W9HC 5AOMA 3IF1B 1D5XA 4P4RB 3WFHA 4JL1A 1UKTA 2JJTC 4J6RL 1DO6A 3QJSB 3B9AA 5I0DA 4UQ2A 5FECB 3O0RL 4XBEH 5C8JA 1USQA 3WTYA 2FIKB 2X1XR 1PBYA 2Q10A 3ZDXE 1WCBA 4TVUA 2FO8A 3BUBA 4XCCL 1YY8B 2OMZA 2WXKA 3ZLQC 3PG2A 1C16A 4MDJB 2H32H 3KEDA 3EDFA 5JW4M 1KT2A 4YX2H 1RSFA 3WIIL 2CCVA 3BKJH 5HYSB 3IT8D 3IPFA 4HEMA 2OMUB 3NPZB 4APQD 2HFFA 3L3DB 2J72A 2Y7SA 3SGDI 3ARDB 3C08H 1RVFL 4WNQB 2W60B 3WEXB 2CGRL 1DJHA 2OMYB 1QZNA 3GMRB 2NLJA 3BKMH 2N1TE 4JFEB 3RILA 3C9NA 1UC6A 3BPOB 1KTLA 3BAEH 2KPWA 1HHGB 3JTTB 1NGPL 1FO0H 1FORL 2NRDA 3CUPB 3IRCA 1K8IA 3LS4L 3AABA 5IMLB 1XF2B 1OOAA 3VFSB 4ZW5A 4DP0X 3EYOB 4BUQA 1I4FA 1MREL 1XGRA 2Y5TB 4OUOA 4N2OA 3KGUA 5DCCA 4Y2LA 3SPGA 4RMRA 2JTDA 1CLOH 1ZPUA 4ZMAT 3VXUE 2HKFL 4HKZB 4N2GA 4X6BA 5D71H 3FONB 1IQWH 3IXAB 4LKXB 5HHOD 3S35X 3TEWA 4FABL 5F7BA 3IVKA 1NGZB 4RQQA 5D1XE 3CFQA 4LPXA 4GT7A 5EU6B 3GRWH 5DHVH 1OAXL 2GTWB 1BIIA 1AXIB 3T6VA 1J86A 4DHLA 5C1MB 3DX9B 5E6ZA 3ULUD 1REIA 4ES9A 4Y5VA 1WFOA 2B59A 3T0BA 5SWQB 1P6WA 4OCMC 2Q8BL 4TSAH 3RZCB 1FVCB 4NI3A 2ADIB 5F1OB 2KT6A 2YD6A 1QNIA 4HGKC 4YZFF 4JFFE 3MGAA 4NQSA 4NWTL 4AK2A 3SPVA 4OGXL 3ZKNC 3QZWG 4XZUA 3B2UC 4P9HH 1ADQH 4B0MM 1NFDE 4JJOA 4PCYA 1ND0A 3VXPB 4BH7B 4ELMB 2XQBH 5BOZG 1HFUA 1JRHL 4YFEA 4HYTB 2ZXEB 5B38G 4NQEA 5BO0D 3HE7A 5KJRH 3G6JF 2JB6B 3R4DA 4F1SA 2IGFL 4I2XE 3IM1A 1EQWA 3VSQA 1SYSA 3ZDZB 1IBGH 4PJDF 4HXAH 3JWOL 2MQ3A 5CLZA 1OP5K 1ZEAL 2MNWA 4NKIL 1NC2D 3U46B 1A7OL 1MVFA 1TVHB 2EQDA 5EO9B 5AB0A 1HEHC 2IG2L 3D1MC 4A7QA 1KYDA 3H4FA 3W5NA 3DARA 2F54B 4GO6B 3BEVB 4WI4A 5IOKA 2BO0A 3IBOA 3X13B 5IG7B 3L3HB 4O02A 2EDTA 3NABL 4NUQA 3BKCH 4GMTL 2P47B 2QVKA 4BGLA 2IH3A 4XCEB 5I8EA 4LVOC 4PJ7F 1SDDB 3UCRA 1BQLL 1J8HA 3DI3B 1D6VL 3TVMB 4CRPA 2HTLC 4UYQA 3O3AA 3SE9H 3QRGL 2BIIA 1CLYH 1KY6A 3OR7B 4OCSH 1AR1C 4JPVH 4XGZB 5LXGH 2QLYA 2HMID 5JPMC 4M4RB 1J87A 5INCB 4ESKA 4XN7A 5I1KL 1QBMH 4UT9L 5KSAA 1YRKA 3WO3B 5C7XL 1DVQA 4JZJA 5EDSA 5IHBA 1AGBA 2P28B 5DD3L 1E2ZA 4A7VA 1Y1UA 3BMVA 1YQVL 4OF8A 2Z6FA 4U1IA 3ZKND 2B3RA 3H9SA 5JDSB 3B2UD 3KH4A 4ZT1A 3RU8L 3FDWA 1B0IA 2A6IA 3J2PA 1IC0A 1HQ4A 4X2UA 1GIGH 5L6YL 1K3IA 1MHCB 3LIZA 4KI5D 1E5ZA 1TNMA 3AXHA 1LP9A 4PWEA 1ASOA 4BA8A 3HNTL 4CBPA 2D3VA 1ONQB 5B8CB 4AQEA 1YEGH 3O9WB 5ISZE 1I8LC 1IGYA 1GH7A 1NANH 2DQUL 3VXSB 3CBJB 3W0WE 1J18A 1JZHA 3CDGA 3AT9A 3ISRA 4HH8A 3GZOA 1KIPB 3IAPA 2X6BA 5CMAA 3WS6C 2GC7C 3MV8D 3AREA 4FLSA 2Q6WA 1T04B 5JUEH 1BD2E 1A3LH 4MB3A 1J88A 2X4NA 4OQ1A 2H26A 3NIDE 1UB6B 3O4LD 1UZ8B 4Y4KA 5TE4L 1KXTB 4OCYH 3TH3T 4BBWA 3D3VE 4KUZL 1JFQH 3O3UN 5DT1H 5I73C 5HXMA 3CPUA 4KTEH 4PP1D 5DEGB 1A1NB 1MAKA 1FFOB 3LMJL 5F7MC 4P2RB 4Q6IC 4UILH 1EX0A 3VJ6A 2OSLB 4U1SB 1B4TA 2RB8A 1XB8A 1CJYA 2XXFA 4JZOA 1L5GB 1I9IL 4KFMA 3KPQA 1KB9K 1XD0A 3BAJA 1CDIA 1VACA 2HLFD 2HTLD 4E68A 2J5LC 3K8MA 3SGKC 4JRXB 5HHME 4ZX5A 1AR1D 1HWHB 1QAWA 1FZOB 3PU7A 1PQZB 4M7ZC 5EO1A 4ACPA 1E4XL 1P1ZA 2NX5B 1UJTA 2H45A 3G6AA 5BZDA 2B0SL 2NY2D 1NGXA 4D9QE 4PH8A 4RAVB 2Y7QA 2RIKA 4IOIA 3PV6A 1K2DA 4YBLC 4ZX3A 2I85A 4UM9B 1F1GA 2P5EE 3QUYB 4OB5H 4MA8H 5E1IA 5J4MA 3K5SA 1QLFA 2KLRA 2JKXA 1VFUA 2VXSL 3PWNA 2IAND 4HWNA 4G8IA 2FQDA 3VFVB 4DNLA 5DVOA 1RPUA 2CLVB 4O51B 2R8SL 2ZUYA 2H3NA 1FGNH 5D7LD 5HGAA 3PV7A 1MJUL 3MJ9L 5EULV 3GMQA 4LL9A 4A2GA 3B56A 3U4BH 1A6TB 5KYXB 4FN0A 4JFPA 2JJSC 1YEFL 3CZLA 3LN4A 3QG6A 1D7CA 5FS5A 1GL4B 3ZTCC 2CO4A 4X98B 3VD9A 2A9AA 2NZ9C 4ZTPL 2B4CL 1VGKB 4PLKD 3W9EB 4AQ8A 5DFAA 1FLRL 1EDYA 2XOTA 3O6FA 4PJGE 2A5UA 1PFCA 4NS0A 4UQ3A 4XP4H 4PUBL 4GXVL 5KOMC 1WZLA 3QYNA 2VR8A 4F15C 3N44B 2PP9A 4D3CL 1V3KA 4ZDHB 3P1VA 4F5CA 1E8YA 3RWEB 3BDXA 1HH9A 1KIRB 4OGAC 3QPXL 4L4VB 1ORSB 1BWWA 1UGNA 1J9TA 3FQUA 3UTTE 4HJEA 3RTQC 2AKRA 4NBZB 3QS2A 4N2KA 5KZCD 3H0TA 1CE1L 4MZRA 1PY4A 3W3BA 4JG5A 1L7IL 5B39A 1ZT4A 1RZJC 3F7RA 2OL3L 5DZJA 2CRYA 5FM5O 1GGBH 2OR7A 4JHAL 1PMYA 3DYOA 2YPLB 1XR9A 2VXQL 1X6LA 1KBGH 4GSDL 3LKOB 2HN7A 1LDPH 2QHRH 4XP9L 2GJ6B 3F7VB 4ZAKB 3LN9A 5T1DH 5KANI 1WFNA 1X5ZA 5EPMA 4F33B 5ESQB 1DBAL 4G7VH 2GBVA 3Q5TA 4KNQA 1Y6NR 1AOZA 1R33A 3FULA 4B53A 2BOCB 1EO8L 1JNJA 4M3HA 1JZEA 2RCSL 4QOKD 2KLTA 3IGKA 4WW2C 4F8TA 2VL4A 2ZOOA 1YYCA 3DGGA 1A9BA 4PRHD 3KCWA 1J1PH 1Q9OA 5LG6A 4AUJA 1T7VA 2GTQA 4HJSA 2X89A 3E6HB 1H3PL 3AS2A 4JR9L 3S4SB 5DK0A 3FQXA 4OM1L 3GUTA 3QEGH 1OLZA 1E40A 2DQDH 4HJ0C 2JNZA 3RUGA 5C9JA 4HCIA 5CEXA 2ITEA 2NZ9D 3IWVA 4RAUA 1KMGA 2HLAA 4NENB 1UWFA 3KZ8A 1BF8A 4P06A 1CIUA 2WUBH 3U4KA 1DSWA 5F71A 4S1DC 4FHJA 5IQLA 3OKMB 3R7QA 5CP7A 2ICWJ 3ISYA 2X4TB 3TT3H 3NCJL 3HHSB 4BFJA 2DM4A 3N1FC 4PMFA 1RUKH 3AAZB 4R96B 3VXNA 4DUXA 2OMWA 2X09A 4NKMA 4OD3L 4MZIA 3V0VB 4WJ5A 2KQNA 1F58L 2OXHA 2V2XB 3HE6C 5DGRA 4XMPL 2YAQA 2HTKC 4FD0A 3D33A 3EJRA 3VFRB 1EVTC 3RTQD 1W0WA 3QPQD 3O81A 4NNYA 3ME0A 2DIBA 4M7LL 3N2JA 2DKUA 5DJAB 3MO1B 4KHXH 4DP4X 1I7RA 3KPNA 3DYPA 4YE4H 1UGKA 1I3GL 3RB5A 3W81A 2DQJL 4JM2B 5L88L 2P8PA 3QAZC 2DYRB 3CU7A 1LEKA 4PJ5A 2VIRA 4IBZA 1C1EH 1MUJA 4L3CB 4JFYB 4QWWC 2ITDA 5C0FB 1DQKA 2BPBA 3MX0B 5DYOB 2BRRL 2FWUA 3PXLA 2ICCA 2ADYA 2VZVA 5EUOE 5T5FL 1HXMA 2KYIA 2F0CA 3S88L 3S96A 5G5DB 3TL5A 4JDZA 5ANHA 3TESA 4X6EA 2BSBA 1YMHB 1NA8A 2V5RA 2DZEA 2VLJE 1MJ8L 1BX2A 4XNQA 4BK4A 4LCCB 2YQ2A 1U91B 1MHEA 3N5AA 2JIXA 5D1QA 3QR1A 2EXSA 3VXTB 2J4WH 4Q9QH 3BWZA 2CK2A 5AVRB 5HYFA 3RWGA 1N67A 1TVBB 4OIIL 1KXVC 3FCTB 3FUNA 4HJ0D 4XP6H 2P42B 3GDBA 1N6VA 1CI3M 5KUKA 1JPFB 3ZR5A 2P8MB 4N5UA 4QRUA 1CK0L 2DLIA 1Z2KA 2M1KA 2DQIL 3X1EA 4PJGF 4X0KA 4S1DD 4RMWA 2XIBA 4Q9BA 5KAQF 3BC9A 3DVGB 2WO2B 1RIHL 1N0XH 1S3RA 2QGBA 2GJRA 3D39A 5KVFL 3BZ4B 1CDGA 3C5ZB 4W4OA 3QXWA 3S37L 3GBML 4J3WA 1BJMA 4L0ZA 3PNWB 3WHE1 3STZB 4NN7C 1I7UB 4Z95L 3HE6D 5D93C 3OAUH 4D8PA 1MFVA 4X6CE 2V9QA 2HTKD 2CMRL 2NNXA 1JNNL 3WE6B 5FOBB 3KCPB 1N68A 1UM6H 1YEIH 2VLME 4J3OD 4QHMB 5IFAH 5LHDA 2L8AA 1NEZA 5F93C 4Y19B 4YC2C 1P6AB 3GSUB 5AZUA 3PPSA 1M71B 4KNSA 1M2OA 1QI5A 4A7GA 2HH0L 1YUHB 1G7MB 5AW1B 1INEH 1KCRL 2R0ZH 3FUFA 3KS0J 3SO5A 4KY1L 3TJEH 1T22A 3VFPA 1VGEH 2DWEA 2R39A 2CU9A 4UBDC 1UWXH 4H88L 1GY2A 3LRGA 4XBPB 3FMGH 1YJDC 3HG1A 4GAJL 3PWVA 4QTIH 5I66A 1XR8B 2Z31D 2A4CA 4L9DA 4M5ZH 4MNQD 1PLBA 3DNKA 3LX9A 4OQTL 4QWWD 3D25A 4YXKL 1LWRA 1A2YB 1G7HB 3Q6FA 2EUXA 4NP4H 1GZHA 4YEEA 4AYBA 1W0YT 2GITB 2G5UA 4QHPA 1NEUA 1KB5B 3BPNC 4UTBA 4HUXB 1EXUB 1S4IA 2DMKA 4LLYB 2B5IC 2BSED 1ERNA 3QJTB 2PP8A 2BNUB 3ZR6A 2GK0A 4G9FA 4C56B 1OGAA 3V9CA 4BH8A 4NKDB 4G1EA 4BV1A 2VLRA 5KSBF 5LWYH 5EIIG 5FHBL 4YDVB 5EB9A 3SD5A 1GYAA 3MLRL 4NAJA 4LCWB 3LS5H 4OIBA 4UNUA 4G43B 2JWYA 5FO9A 5E08H 2XPGA 5DJCA 5HDWA 1BECA 2CGYA 5IP4A 1Q9WB 5IOPA 5KW9H 5IJDC 4MAUH 2YSSA 2O6FA 4FLOA 3ROLA 1TJGH 1UASA 1P4UA 4UAOC 2ORBH 5IROA 3KL0A 3ZDYE 4PTUB 3NP3A 5GGSA 3L4XA 2O72A 1NBZA 2CJ3A 2D7TH 3LRSA 4FLHA 2F58L 2CBOA 4H7VA 4LVEA 3U6XS 3T8XA 4OUUA 4WI7A 4B9KC 1IKOP 3MBWA 4XB8A 2E9JA 5CIPA 3VGAB 1LJMA 3IFNL 4MAYC 1O75A 1PZ3A 2NY4C 4YQXH 3AGVA 2H8PB 2ATKB 4EQ2A 1HEJC 3VXOA 5LAPA 2W65B 3KH3A 5BJTA 1ZHNB 1ZANH 5E1AA 4NUMA 5L8LB 5C0EA 4L29A 5C08D 2XWTA 1TJHL 1EEQA 2IPTL 1AE6H 4QT5A 4R97B 5DD0H 3SDDC 2WCPA 1JZ6A 4MCMA 3PQYB 2V8LA 2WUCL 1NOLA 1HH6A 4X9FA 3TTYA 4FA8A 1JDAA 3OGCA 1ACXA 5I8CA 3MACH 1KXQA 3V6OE 3FSZA 3QT2A 4IRJC 4NZRH 5I6KA 2FVNA 4CJ1A 4UBDD 3IGLA 2JH2A 3SE8H 2E56A 1A7PH 1P7HL 2GSMB 5BMFH 2ZG1A 1Z9SA 4JFEE 1T2QL 4N0CD 2X0WA 5EUOF 4IOSD 5KS9B 2H0JA 4PSPA 4I18C 3UTSE 3UYOD 4RIRB 2WCSA 3F00A 1E3ZA 3GXFA 3SKOB 1JFHA 2UVEA 3CBRA 1IAII 1IAKA 3QCUH 3B3IB 5AVUB 1N64L 2FZ3A 4WWKB 2AJUH 1GYWA 2O26U 3LQAH 3SO3B 1A1OA 4DZ8B 2A2QT 4BZ2H 3U9PL 3E8UL 3GZKA 1BLNB 5M95B 2Z35B 3UH8A 1RHHA 2X9WA 4J3OG 3IRPX 2QPUA 4UDTB 3LV3B 1FAIL 1HHKB 2N7AA 1HOCA 3RB7A 3MRGB 3FOMA 5I15H 3B5GA 2WPGA 1Z66A 4FQCL 1UWEL 4I0KA 1WAAA 2AHIA 2W1NA 3VG9C 2WIIB 3BSZL 1JF6A 2Q9OA 4OLYL 4TQHA 4HKXA 1MH5A 2V7HB 3BW9A 2UXGA 2DTSA 4XVJH 3H2WA 4RMQA 5IGXL 4TUOA 6PCYA 4HKBA 4GB9A 1LE5B 1C8QA 3H9YA 1DO5A 2EYTA 4IW4C 1QX1A 2DI9A 2K9FB 1NUNB 2OTUA 3RFZA 3RX7A 1QKZH 5AEAA 1PSKH 4HLZG 1B4JL 1PJWA 1VDGA 1FSKB 4QXTA 4X6CF 2F53D 3V0AC 2ZYSA 2VLKD 4NKOB 4WTWA 3BKYL 4KVPA 4KZCA 5HTSA 1A3RH 3SDDD 4PJ8A 4KMQA 1XH3B 2WQUA 5AW8B 3UJJH 4CKQA 4TULL 3CHSA 3DROB 3DO4A 5IMKA 2EIMB 2YAHA 3G5XA 1J7VR 1OCRB 3OXSA 3EF7A 4XAKD 1ZTXE 4ELME 1NPJA 3GJEA 1S5HB 3DHUA 3HHMA 4GKSA 1N59A 3WJLC 4HS3B 1XSIA 1I1YA 3W2DH 4RAHA 1YY9D 1V3MA 3BQUB 1ZGLB 4KJQC 3ZDZE 1DLHB 3X3FL 2D03L 5BVPH 1A66A 1E50A 1XH0A 3QEUA 4WJKB 1SF5A 3LKSA 4PJIA 3ZTDC 4NYLA 4ABVA 3QZPA 5ESAA 2X9YA 4RSVA 4EUPB 2BSRB 2F54E 4PRAA 4B9ZA 1JVLA 2CJSA 1MRCH 4FQ1H 1QABA 3IXTA 6TAAA 5ICYB 3JV6B 4KWUA 3WJJC 3L3GA 2Z7ZA 3RA7H 5EBLA 4MXQC 3FUJA 2YRPA 3C6LD 5DRNA 2IAMB 3BHBB 2NUPA 1BFVL 5F97E 4HT1L 3RGVA 1F4WL 4HIXH 4DQOL 1FBIL 5C71A 2WBXA 3P9MB 5CILH 5JHAA 1EERB 3U1SH 3BZEB 3L3KB 3RURA 1JZ8A 3E6FA 2IMNA 3ZDYF 3QO0B 2DLFH 4OFIA 3SJVD 3GHPA 3IDIA 1HHIA 3V4VH 4KQ4L 4QF1B 3L5HA 4F3FB 4W9CC 1A0QL 1MFCL 2BIMA 1IKNC 4HPYL 1AHKA 2ENJA 5EOTB 1WHOA 3S3DB 2ZF9A 2VH5H 4GSUA 4MJ6A 1C12A 1OB0A 2OR9H 4LBAA 3P3UA 4XNUL 2JI1A 4BGDA 4GEJA 3NFSH 3ECBB 5JMRA 2EDKA 2H2PC 2V2WA 3ARGA 4PG9A 1DP0A 3O3EA 3MUHL 5A2FA 1FG2A 2CDEA 4M1DL 3X1GA 1WA1X 1UWXK 1G0XA 4U6VL 4P3DB 4WENB 4ONHA 2ZONA 3HR5B 3S9DB 1U8CB 3NK4A 3OZ9L 1B3JA 3AJ7A 1JJUA 4Y2DB 3T6QC 4HZLA 2FEEI 2Z8RA 3DO3A 4DW2H 3L45A 1R5IA 3N3EA 3KYOB 3FB5B 3UP6A 4XAWH 2YXFA 4HJUA 1HI6A 4KH2A 5C0BB 1A5FH 1CF8H 5KYWB 3ZQXA 1DE4A 3IJEB 3QWNA 3G04B 4U1JA 5AAWC 3O41B 4CGUB 2P52A 1FCGA 4XI5C 4IM8A 3RL2B 1N5AB 4TSCL 2PCPB 1PIGA 2NY7H 3EOBA 4OJFH 4Y89A 2CUMA 3MZGB 2GIMA 3DWTA 2YPKA 4JG1L 4XMXA 5EO0B 1MRDL 3VU1A 5AKTA 4JGMA 4EI6B 3RNQB 2CKBB 3OV6A 2BC4B 4X5WB 5JR1H 4E42B 5BO1H 3EYQD 4W93A 3L16A 4OGQC 1IB5A 2ICWA 1H6EA 2P7TB 4P5MB 2VN4A 2X1OA 1BPLB 4JJ5A 3BE1L 4KVCH 2VOTA 4MXQD 1WQVT 4PAZA 4QRQA 2YD1A 1KPUB 4I3SH 3S5LA 4F93B 2AXFB 1EHAA 3FQWB 1QSEB 3QULB 5EU3A 2AEPL 2YA2A 1PG7L 3EJJX 3I3DA 3HRPA 3MUGB 1OAZL 1XEUA 2FX8L 4JHBA 4NO5A 4PJ9A 3QIUA 6CGTA 1NDGB 1KYOJ 2ADJA 4AUUA 1UD3A 4JRXE 4S1RL 4LOVA 3EFDH 3HC0B 1R5WB 4K23L 5KTEL 1LD9A 1SUJA 1UKSA 3RPIB 4Z9KB 1YYLL 4KZ0A 4TSBL 3MGOA 4XNMA 3MXVL 2P4AB 5DGQA 1CICB 3LOWA 1UFGA 1A6PA 4NSKB 3TT1L 4GUCA 4CA4A 2Q0ZX 2C9VA 4LCUA 1RJZA 3BSGA 1SBBA 4J4PA 5C6WH 2H2PD 1DQLH 1LK3L 2KKQA 4LKCA 4MMXC 4G5AA 4G42B 5J1AB 1HAWA 1WITA 3OF6D 3SBWC 4HUCA 5I1CH 2D3LA 2C4FT 2EEBA 3GMPB 4NHUA 3WN5B 1TVDA 1F3JA 1DQQB 2K6YA 3KL5A 1S9WB 4XBEL 1D5XB 4ODHH 4FA6A 1CFTB 3UADA 3VX1A 1TYRA 4ELMF 4XN8A 1X5IA 1KBVA 5GS0D 1PAZA 3MV9A 4A1RA 3AGWA 4UQ2B 2EDQA 1IGTA 2PXYA 3SYAA 5C8JB 3VWKC 3KNBA 4WK4B 5E2TH 5HDLA 1WCBB 1NIFA 4H25A 4NC2B 3KHOA 4YX2L 2ZX6A 2OMZB 3DURA 3BKJL 2E9WA 3F58H 3ESOA 1C16B 4XI5D 1S7TA 5DZNA 5HJBA 2UX6A 2J21A 3HS8A 1KT2B 1WGVA 3C8KA 3C08L 5CUSH 5DTFA 1ROWA 5CJQH 4W70A 2EINB 2C1OB 2HFFB 2O1AA 4GQRA 3EOAA 3KLLA 3ABKB 4PJEA 1JGEB 4FFYA 3LPWA 4QRPA 4YDIH 1EHLH 3BAEL 5E5MA 4M5SA 2P5WD 5T3XH 2D3JA 2NLJB 4K8RC 2PO6B 1FO0L 5HDOA 5I1EH 3IFLH 1N5YL 3C9NB 1KTLB 4K71B 4X6DE 1TQTA 2PCFA 4R7XA 1ECYA 3BUPA 5DEFA 4L4VE 1ZDQA 4AW4A 2VAJA 4GSXA 5EBMA 1K8IB 1KLUA 2NXZB 3HNSH 4JFDA 3W11D 2AFNA 3FU6A 4UTAH 3KL3A 4CMHB 4QRRA 1I4FB 1W16A 3CQQA 1GSMA 1XGRB 2CBPA 3NDYE 2I5YH 3BMWA 5D71L 1IQWL 1RZFL 2EDWA 4OLWH 1ZT1A 4ETYA 2FH8A 2AEWA 3ATAA 3QVAA 4LDCA 3FH5A 4NKQB 1IJ9A 4AZ8A 3GRWL 5CLTA 3TZVC 5E6IA 2R51A 4RQQB 3IU4H 3IVKB 2GJ6E 3QQ3A 4Z23A 3FKUS 1EZLA 3ARTA 1OM3L 4HMDA 2L7JA 3G9VA 1WZMA 4Z0BH 4TSAL 1E5UI 1OKEA 3OZKA 4WU5A 4RFOH 4WFEE 1KTBA 2HYMA 4JPWH 4JL2A 1XGYH 4Q52A 3TTSA 4Y5VB 2B59B 3D4ZA 3EHBB 2Y9RT 2J55A 3LRMA 1LNUA 4R6UA 1YMMD 4N2NA 3RDTA 2PYED 4R9HA 2EC9U 5AVWB 3ESVF 3RGBA 3VWKD 4KROC 3OKOA 4P9HL 1IKFH 4NQSB 3SPVB 3GM0A 1A02N 4HIEA 4XZUB 5A6MA 2ZX5A 1QHOA 2IOIA 4NRZA 5FUCE 3T0EC 1QPKA 2XQBL 2X2JA 3H9HA 5KN5A 3VYOA 2YQGA 3V2AR 1ND0B 3TBTB 1SGKA 3MBXL 5KJRL 2BIOA 2GYSA 3U48A 2BOBA 1ICTA 2H1XA 1KTDA 4AZUA 1IBGL 3WFCH 4NQEB 3AWEA 4HXAL 1YSOA 3HE7B 3QWOA 5D4HA 5I2IA 1GW0A 3HR6A 4CSSA 5I8KH 1H8SA 3SGJA 1SYSB 2ERJC 3HMXA 4K8RD 4M5TA 3FTUA 5GJSH 3UX9B 1N6UA 3TPUA 4F7TB 4JK0D 1XTMA 4Z0XA 2PCYA 3JZYA 3PIQB 4ZPTA 4ILDA 2AC0A 1LQBC 1ET8A 3BKCL 4WKZA 1HN1A 1DJGA 3INUH 4KJWC 4FXKB 4O02B 1KBKA 4MJID 4U1GC 3SB3A 5B22A 4OZIA 2IH3B 3QJOA 3OSVA 3SE9L 3SPIA 3TZVD 1PZAA 4GSRA 5CWSA 1CLYL 4OCSL 4PB0H 1J8HB 4JPVL 5LXGL 3PXJA 1LYQA 4RZCB 2R23A 1URZA 1QBML 3O3AB 4QYAA 5KBLA 1GXEA 2B3IA 3ARBC 2XACC 2YD8A 3UDWC 4G6FD 3I6GA 2ZJSH 5KSAB 3TFKC 3V5DA 1X44A 5FM4A 3DVNB 1OT1A 4GIAA 4JZJB 3E2HC 1AGBB 4LL1A 1TITA 5T3ZE 2JXMB 4NQVA 4XMTA 3VDBA 1XAKA 1KELH 1OIOA 1G6RA 2WCGA 3CVHA 3Q8CA 4HU8A 1OT4A 4IEFA 3KBHE 2X6CA 4U1IB 3H9SB 4UWQB 4FZ8H 1I9RH 2I60H 4H1LH 2A6IB 3T0ED 1MNNA 1QEWA 1HQ4B 1QNZH 3Q5OA 3QQ9C 4YSPA 4EIBA 3FTSA 5C6TH 3HCVA 1X9RA 4JRWA 1LP9B 3HBPA 1NCIA 5GZOA 3FRUA 3A22A 3IMUA 4PI2A 2LTQC 4ZS6D 2R29H 4D0DA 4AQEB 4S10A 4OLXH 4MNGA 4XP1H 3N44F 3ULVD 3B1UA 1KTCA 1YC8A 5HI5C 1CYGA 4L8DA 5IW1A 2RQ8A 5E9NA 4J28A 4OFPA 2JK5A 4EI5C 1A3LL 2OI9C 3CDGB 5I5JA 2EE6A 1U4EA 4OCYL 5CMAB 1JFQL 2EDHA 4HBCH 3ETBJ 3AREB 4JDEA 2Q6WB 2WNWA 1Q8MA 3DUSA 1NEPA 2X4NB 2H26B 4M43H 3KPSD 4Y4KB 2FHCA 1HQRA 4Y19E 2RD0A 4UILL 3MRQA 3QH3A 4KJWD 4OZHA 4BK8A 2MCMA 1OGTA 4TL4A 3R19A 5D7JA 5MI0B 2ITCA 3VJ6B 4K5OA 3WIAA 4JZOB 2UY6B 3BP7A 3PL6A 2BHZA 3ES6A 3KPQB 5TTRA 1VACB 2RH0A 2QVTA 4LSTH 1F4AA 1C08A 4K7PH 4G8GE 1NBVH 3ARBD 1J48A 2EACA 3QUZD 4GQZA 4GBXA 2NY0C 3QHTC 4R7LA 5IZ7A 1MZYA 1P1ZB 2WP3O 3LB6C 3MJWA 5K59E 2YZ8A 1WBYA 1O9VA 3QUMB 3G6AB 4C56E 3U0WH 5BZDB 5JZ7D 2CH8A 4OB5L 4MA8L 3FFCA 4FG2A 3CJJA 1NGXB 3LH2H 4G6MH 4IOIB 1DFBH 1K2DB 1M42A 1PF3A 2Z7WA 3PV6B 2DWYA 2MFNA 3LXCA 1F4YH 1J0YA 4LCWE 1OF2A 2CHNA 4XX5A 1QLFB 4Q9RH 3PWNB 1FGNL 4N1HB 5H8DA 3L13A 4G8IB 1DVXA 3QQ9D 2YWZA 1B9ZA 3SDCC 1AKPA 3U4BL 5BV7H 2H3NB 3ML9A 5HGAB 3T2OA 1TMCB 2E8ZA 2R2CA 2WKOF 4DGIH 2Y7OA 1ET7A 3DHMA 1L9MA 2W8CA 3MRJA 2VDPB 3V0FA 3GMQB 4XMVA 1KCWA 1NIDA 1MNUH 4QRFA 4PVBA 4JFPB 1BVZA 2VDRH 2A6JA 3QG6B 5T5NF 3OVUB 4A7SA 1UOLA 4EI5D 3LKQA 4GKNA 3V52H 4XP4L 4CC0A 1QTPA 1AFVH 2WWMD 1HL9A 1LGVA 3HRZC 5I1HL 3GXMA 3JV4A 2H0FA 3PQYE 3O6FB 1L7TH 1QD0A 3RY6A 4UQ3B 3MYJA 5ICXA 4ZMZA 4EN3C 3QFDA 3VD5A 3ZKMD 4KK9D 2WQ8A 5A2BA 1CDJA 3HPJA 4JM2F 1IMHC 1M1XA 1AR2A 1GC1H 4NFCA 5CGYC 4YN3A 5K9OA 3DV4A 1KWGA 3AZUA 3FQUB 2JI3A 1IBYA 1AQKH 4M62H 4NP9A 2YOCA 1ODAA 2AKRB 4MS8C 3F7QA 1GGBL 5BRPA 4AGMA 3H0TB 2Y5EA 2ROXA 4WKXA 1SY6A 4FQLH 4E9XA 3WAJA 1ZT4B 1KBGL 2Y7MA 5I5IA 2QHRL 1LDPL 3U30C 1WO2A 1NGYA 1X5HA 1JYWA 4IBUA 1IIKA 5T1DL 4KO5A 3QFGA 2I27N 4XO9A 1XR9B 3EKCA 1YG9A 2X70B 2ZX7A 1QSFE 4G7VL 2SODB 3ECWA 3GSNA 5EPMB 1S7SA 1S7QB 2AQ2A 2MHAB 1I3VA 2X4QA 2YGNA 3BWAA 4RFNB 3NTCH 1J1PL 3U7WL 1VERA 4X4ME 1SEBA 4JRYA 5CCGE 4UIKH 3SDCD 2E47A 3DGGB 2BHFA 4PS8A 4GIPD 2H47C 1OARH 3B7TA 1QYGH 1Q9OB 1BXUA 3P69A 1FL6A 1E9QA 1BVNP 4KI1A 4AM0Q 2FUQA 3QEGL 2DQDL 3EBIA 2H0EA 1WC7A 2XIDA 4JKWA 4OZGE 4FOMA 1E8ZA 4TVPD 2NYKA 3S5YA 2B2XH 1MHPH 3FQXB 5D7IA 5DK0B 4KKLC 2ESVD 2WUBL 3RUGB 5C9JB 2Z93A 2VR6A 4MMYA 4XNZC 4YFLI 5E5RB 4DVBA 4RAUB 5CEXB 2IANB 4X9IA 3TO4A 3VGEA 1WA0X 3MJGX 2HLAB 4PY8J 1ZHKA 2YJLA 3TT3L 4E5XA 1RUKL 3KVQA 5AVYB 4FNSA 5CP7B 2B14A 5FF6A 4EN3D 3EJUA 4NC0B 1UXSA 4QKXB 4FCHA 1NCAH 3LZPA 1U8LA 1L0PA 2I32A 3PFUA 3VXNB 1F41A 2OMWB 4NKMB 1K8DB 4GPVA 4KFZC 4DGVH 1N19A 2DWTA 4ZW6A 4WJ5B 2J2ZA 2OXHB 1EZSA 4U3XA 2ZNWA 1SHXA 5AQ0A 1BFSA 1W0WB 2VABA 4MS8D 4B9IA 4NNYB 4YE4L 4N26A 4P5RA 3IJSA 4GOSA 5J06A 1RZIA 5DC2A 4BE6A 1I7RB 1C1EL 3F7LA 3KPNB 4QPEA 3DMMD 1Y0LA 4AE0A 4ZMQA 4Y5YA 3OHXA 3HA0A 2P8PB 4D2NA 5DRZA 5SX5H 4PJ5B 2VIRB 5G4MA 1MUJB 1OW0A 2DYPD 3A23A 3FQ1A 2ITDB 3MZTA 1E3FA 4PPTA 2VM9A 5GRZA 1M53A 2VQ1A 3PGCA 3CZUB 3D09A 1HXMB 3DGCR 1R4XA 2GHWB 2X41A 3S96B 3ZL1A 1DN0A 2JQAA 4AT6B 4JDZB 3KPLA 3MNZA 4X6EB 4DP9X 5JXEA 1S3KH 5E8PB 2AV1A 2MNUA 3C6SA 2JLLA 1BX2B 4XNQB 2J4WL 7FABH 1IEBA 4Q9QL 2KERA 2KQMA 3VRJA 3ZE0E 4CVUA 2JIXB 5D1QB 5D5ME 2VQ4A 3NZ8A 4HUKB 4XP6L 2UZIH 4X7FC 3EUUA 4KTGA 4ZMLA 3K46A 3NSXA 4YDLC 2QKIC 1R17A 3RWGB 3E38A 2W07A 4KKLD 3ZT6A 2NY3D 4Q58C 3I9IA 4FNPA 1MFUA 2ED7A 3EUDA 3HZVB 1BA9A 5A2JH 1D9KC 5E0QA 5D55A 1N0XL 3CSFA 2Y0SA 4L3AA 4KITB 2Y2TA 1MCNA 1CVRA 4X0KB 3NGBB 4WHTA 4BFRA 3T3MF 5E03A 3VQ1C 4PWFA 2QT6A 3BH9A 4JM0A 3B2VL 3T0WA 1HESA 2EZ0C 5F7FA 3OAUL 1XF4A 5JOFA 1JZIA 4KHTH 2X7LB 4L3ED 2BW5A 1F2QA 1ZS2A 5DD6B 1UM6L 1YEIL 4R0LA 2XYCA 4UQ9A 5C0BE 5LBSA 4D8PB 2GUOA 4HISA 2C9RA 1IAMA 5I6PA 5KS9F 1PJ9A 4Y4HC 2HT4C 4PP2A 2GY5A 2XZCH 1X5XA 3WY2A 3O4OC 1INEL 1NEZB 3AY2A 4UT9A 1OE3A 4P05A 5DJ2A 3TJEL 1D3CA 1VGEL 5GIRA 1M05A 2JB5H 3H6AA 3PS6A 3R1GH 1O7DE 4W9EC 3VXQA 3V9EA 4C4KO 3FMGL 4QTIL 3VFPB 2AABH 1T22B 2DWEB 2YQ3A 3OMIB 1IGJA 4NP4L 4ANKA 3PWVB 4XTRC 5I66B 1CL7I 1LVEA 3BRDA 4MJHA 4ZW3A 4G80B 3D25B 1QSEE 2GI7A 5HHOA 3Q6FB 4OZFG 5AL0A 4KXZI 3KWWA 5C97A 3CCHA 2JSFA 4I1NB 4LNVA 4KRLB 5LWYL 3N06B 4N2CA 1UM5H 4ZODA 2WB1A 2GK0B 4G9FB 1OGAB 4BH8B 4IHOA 3QHFH 3LS5L 4F2FA 2VLRB 5E08L 2JJTA 3G5YA 4MMZC 5KW9L 4UT6H 4K5NA 4MAUL 2X1QA 5HDBE 4N68A 5FO9B 2ORBL 2XPGB 3BAXA 2LLGA 1X5JA 5DJCB 5L4FA 2ZSVA 3MFGB 5HHPA 2K78A 4HSQA 1CDUA 1MIEH 2YSSB 2D7TL 3ROLB 4P3CH 2LAAA 2VCOA 3F04A 2JCCE 2FWLB 1GYCA 2FX7H 2ILLA 2H2SC 3WS3A 4YQXL 3U83A 5CEZL 1HAUA 1NBZB 2X3BA 1DHKA 5DVKA 3WELA 4FC3E 1AY1H 3JV5A 5F7UA 3T8XB 1E4JA 3FC8A 4FJYA 4LPYA 4MA1C 4OUUB 3MBWB 3TBSA 3S7GA 1ZANL 3D9AH 5CIPB 3T77A 3B7RL 3L1EA 2KI6A 1XO8A 1IGIL 3KLQA 3FU8A 5DD0L 1AE6L 5DVLA 3DRQB 3PABA 5BJTB 1Y07A 3VD2A 5AOIA 4IRSD 1H5BB 2WBWB 5C0EB 3QIBC 4L29B 1A65A 3T2LA 1OAYH 1KPRA 3SN6N 1RXLA 4QT5B 4JDTH 3HKFA 3Q5YA 2HT4D 3MACL 4HGWA 4FL4C 4MA3A 1MCRA 4L37A 1HH6B 2LW3A 4NZRL 3ZHFA 2WNKA 1XZ0A 1CGSH 2BVQB 3OGCB 3HBGA 4XN5A 5BNXD 5I8CB 1A7PL 2DBJA 2BX5A 2E75C 2G75A 5BMFL 4P99A 4GW5A 3VQLA 2BWDA 4N6RA 1E2WA 1UT2A 4FQHA 2VZOA 4XTRD 5E9DD 4K7PY 5I30H 3QCUL 3MC0A 3QR0A 2AJUL 2F74A 3LQAL 2DQTH 2QQLH 3KPTA 3CHOA 4EE2A 4BZ2L 4K3GA 4A6YB 4F8NA 1IAKB 1JPGA 3OPZH 1EFXD 4KK8C 4LOUC 4WTZA 1FL5A 3NJKA 3OHMB 2FZ3B 4AL8H 4AYFB 3MJ9A 1C9SA 1A1OB 2PPAA 3FHEA 1U21A 4KKQA 1AIZA 2G2NA 4OF7A 1TTUA 1KJMA 4Q9CA 5I15L 1RHHB 3WEOA 3LRLA 2CWRA 3ZTJH 4NM4H 4JJHA 5D7KE 4BINA 3LCYA 3M45A 1HOCB 1U3YA 4OF6A 3UJTH 3FOMB 3T0XA 4XVJL 1TQSA 2G30A 1RJLA 5SWSA 2NNRA 3MLZH 2ZE0A 5D1XC 2LGNA 4IU3A 4HKXB 2VMCA 1MH5B 3BW9B 3ASOB 4WW1A 4NN6C 5CLYA 2EIJB 3H3PH 2J12B 1FCCA 4TUOB 3PXHA 4DKAA 2H2SD 4R7DA 4CN6A 1ESOA 2CHZA 1QKZL 2H4EA 4Y16B 1PSKL 2XX1A 2EYTB 2BIQA 2PMZA 2OTUB 5AAMA 2KHAA 3K2KA 2X1WL 1A3RL 1DBKH 1QBLH 4QXTB 3TEXA 5JORA 3UJJL 2WTRA 5L0QC 4GAAA 3QIBD 5LO7A 3OWRA 3FRPG 2D4DA 4PJ8B 5SX5K 2ZCLH 2OL3A 5IMKB 3G5XB 2V5TA 4TN9A 4YK4B 3OXSB 1YHPA 3W2DL 3SKMA 2C7FA 1OP9A 6FABH 2RQEA 5DMYA 1BV8A 5BQ7A 5EFIA 2VXQA 4I9WE 1GJIA 2CKNA 1N59B 5G4OA 3RJDA 5BVPL 1I1YB 1X6NA 4JEGB 4YHPA 5F1KC 1KXHA 1SFDA 4N2IA 2X42A 3QEUB 5D9SA 7PAZA 3LKSB 2QR0B 4DCQA 4NYLB 3PAZA 4IHBA 4MJ5A 5ESAB 1MRCL 4FQ1L 1Z0NA 4GO8A 4XMUA 5JNYA 2FATH 3DXAA 4JFZH 1A47A 4LOUD 4XE5B 3TBVA 3RA7L 3ETSA 4ZOAA 1BBDH 3IXTB 3VI4A 2OP4L 1BHGA 5JPMA 1AZUA 1ZE3C 3BGAA 4NUGH 4U1LA 4HIXL 3L3GB 4KUCF 5EBLB 5CILL 2CBTA 3VD7A 1NC4A 3U1SL 3K2MC 5DRNB 2NUPB 5I75C 1ZS8A 5J0BA 3RGVB 1HDMA 1GYUA 3VXUD 2DLFL 3Q8BA 1T4KA 3V4VL 4G8EA 3QE5A 3EOYG 4NERA 2R2EA 5FA3A 1AAJA 4F7MB 2XTLA 3E6FB 3QAQA 2E9BA 1T0NA 4XB3A 3CPLB 3HC4H 5GS3A 3IDIB 4R7NA 1HHIB 2VH5L 3H7BA 4MRCA 5LBGA 2MRYA 2V5MA 3N40P 2BVUA 3NSDA 1Q0EA 4NIKB 2BY0A 3NFSL 3WTXA 1FNEB 3V9FA 2WVSA 4MJ6B 1A4JA 1C12B 3MKKA 2NOYA 2YJQA 4P46D 4AV0A 4NAQA 1Q94A 4DETA 3AS3A 1SF3A 2N7BA 2IEPA 1GS6X 4DT2A 1ZRUA 5CP3H 4BCYA 2V2WB 3ARGB 1P0SE 4LZKA 2OYPA 4CU6A 3O3EB 4JFFD 1FG2B 2CDEB 3R0NA 3H9SE 5IB4A 3ABZA 2VN5A 4O4YH 4GRWE 2ATAA 4ONHB 2HVKA 4NQTA 43CAA 1NFAA 4DW2L 5IVZA 1L0YA 1RK7A 3KXFA 1RLWA 4ZXBC 3WS6A 4XAWL 5I9QC 4HZLB 3P3SA 3T4AC 1A5FL 1CF8L 3A4DA 5E6RB 4XBMA 1R5IB 2DL2A 4F58L 2CCWA 1BJ1J 1HI6B 4B9CA 4P8QA 4PJ6A 4P04A 2NY7L 4XNAA 2FL5A 3QWRA 1DE4B 2YD0A 4U1JB 3ZX1A 4G59C 3QK0A 5FK9A 5D70H 3ZU8A 3EOBB 3O11A 4LPUA 2X9ZA 3G7TA 2YPKB 2HA1A 4DN3H 3DPBA 5BO1L 4Z1PA 5JR1L 4KY2A 1QTYT 2WLIA 3Q2CA 4IOFC 3F85A 3DIFB 1N12A 1DN2A 2KUTA 3CE1A 4I3SL 4YPGA 4BXVA 3SE6A 4G70B 1VENA 4JJ5B 1JGVH 2NQ3A 4QRQB 3S5LB 3MAWA 1BP3B 4R4FH 5EU3B 4JFXA 4YDMA 2H6UA 3EJZD 4G5ZH 4F7CA 1OPGH 3NCMA 4PJ9B 3EFDL 1Z3RA 3QIUB 2G5BA 1W91A 4RH4A 2RBLA 2ADJB 4IS6A 4DPRA 2Y7NA 4H8HA 2ZAGA 2J6WA 2ZP8A 2XVKA 1QFWM 3VFTA 4F7PA 5EN3A 2IDFA 1CFNA 3MGOB 4C55A 1E7UA 3C6LB 1DQLL 3F64A 4KVNH 2J7LA 4EXPX 3V95A 1XL6A 3HC2A 5I1CL 4LCUB 1RJZB 1KF9B 1E4WH 3NIGB 2EXWD 4LKCB 3I84A 1G6VK 4MXVE 2JJSA 4ODHL 3NJLA 5EEZA 3HIZA 1MFBH 4E41B 4NHUB 1F3JB 3V0IA 5HGDA 3L6FB 3IGAA 5E2TL 1UKQA 5IJBC 4ZXBD 5CJXC 1BEYH 3TH4T 2BSTA 4IBSA 3MV9B 3HC3H 4WFFE 1IGTB 1VFOA 2PXYB 4M6NL 3EYFB 3TCXA 2BY3A 2BZDA 3F58L 4OQTA 3LHPH 4H25B 3WKQA 1UWYA 3F7YA 3QDMA 1VLXA 3KJ4B 1U58A 2YR3A 4YEFA 5C2BH 2R0LH 5ISZD 3DURB 5CUSL 2FLBT 3FT0A 3MRNA 3WKNA 5IEKA 1XSJA 2ZZUT 4H0IA 5CJQL 3FHQA 1S7TB 3W0WD 5JQIB 4OY9A 3C8KB 4X5QA 3S36X 3EGSA 1TPXC 4KRNA 4YDIL 4KI5E 5DTFB 1EHLL 4G8AC 3RTQA 3SODB 1HEZA 3E9UA 3NJHA 5EBGA 2D0GA 4OKVA 3EOAB 4IOFD 5T3XL 2CGZA 2XUWA 5I1EL 1FH2A 4PJEB 3IFLL 1C5DA 4QRPB 3UBGA 1WFUA 2UZPA 4KXDA 2EC8A 1XL4A 3D3VD 5ADOH 2NPLX 3EYSH 3LD8C 2XN9B 3HNSL 3APMA 4UTAL 2Y7LA 2IALA 1IVLA 1M6UA 4N25A 1MLBA 3UAJD 2PCFB 3T2PA 2XV0A 5EBMB 1KLUB 2C3WA 2I5YL 2XY1A 4HD5A 4JFDB 2Q3ZA 4OLWL 4AQAA 3MV8E 1G7PB 1OAQH 4QRRB 3ZRSA 1EIBA 3WNPA 3MN8A 3VWJC 3U9UB 2FT8A 1ZT1B 1RK0A 2XQYA 5J11B 4G6AC 4WW2A 2YBRA 1JHTB 2V17H 1NUDA 4AZ8B 2QKSA 1CXKA 1HSAA 4Z0BL 5AW7B 5E6IB 3FN0H 4RFOL 1CLCA 3DI2B 1UB5A 3QQ3B 2HX9A 1XGYL 4D9QD 1JPEA 4JZNA 2XQYG 2VDKB 2P44B 2GABA 4WU5B 4B9YA 1ZLVH 2XT1B 4MZ2A 2B1HH 2P5ED 1JD9A 1FV1A 5ERWA 1BM3H 1PD1A 4W6WB 1IKFL 1LP9F 1LNUB 2GQHA 2W0KA 4A2FA 3RDTB 1XB6A 1ZK5A 3RE0A 3HG3A 1G1CA 2BLFA 2DIJA 1WTLA 3OKOB 2V8MA 3AU1A 1KYUA 2HRPH 4PGZA 2H6PA 1G5GA 4RGMB 3TF4A 1RLBA 4IBTA 4IMLA 1YQ2A 3H9HB 5KN5B 4M29A 3RUGE 3WMPA 2D7NA 2O5XH 5FDWA 4XHJC 3WFCL 2APVA 2IANE 3GXTA 1TQWA 2NSQA 4TNVF 2VMEA 4PBWD 1AKJA 2XWCA 3OPUA 1D7FA 4YDKH 4LPCA 3E1F1 1KTDB 3L2MA 2Y07H 2XWXA 5D7LE 4KZDH 3QWOB 2X4RB 4PV8A 3RX5A 5I2IB 1AHMA 2AI0H 3T8MA 2H9GA 5AKSA 5T3ZH 1FNLA 5GJSL 2IDTA 2R27A 4NHCH 2QL1A 1AMYA 3D2UB 3FT9A 3O0LA 4RBPK 2OULB 1IAIL 3U7YH 3BH8A 4OW6A 3F65A 4Z0XB 2J1WA 1FZKA 4ZPTB 1UCTA 3INUL 1U8QA 2VDLB 1GOGA 4XNYH 1EBPA 2WVVA 1USZA 2IOMA 1FNAA 3IKCA 4LARH 3WNMA 3FAWA 1W0VA 4O2FA 2BSEA 1FFQA 4PB0L 4BQ6A 4Z7OE 3WXWH 1KBWA 3R8BB 4OZIB 4GP8B 4XCYA 3VH8A 3CU1A 5CWSB 4N0FA 2EECA 1F4HA 4G7SB 4N2FA 3I3BA 4J2QA 1TZ8A 2R23B 3ZY7A 3NOIA 2ZJSL 1T1ZA 2ADGA 4YE0A 3UAFA 4JMXA 2G9HA 2NSMA 3BP6A 3LJ3A 3APCA 3HB3C 5C92A 5C0NC 3RRQA 3I74A 3I6GB 4ZUWA 5HGBB 4X9GA 1DCLA 3V5DB 1KELL 1U2HA 2CO6A 3K6FA 3NSYA 3HAEG 5ANMA 4NQVB 4FZ8L 1I9RL 2I60L 3MA7A 1MDAA 5FOJA 4P2OC 4QHLA 1G6RB 3LRHA 5D1QE 3SZ6A 4L4TA 4IEFB 1QNZL 3PJLA 5K1NA 2F15A 1CS6A 2VERN 3TA4D 1T4WA 5C6TL 2GAZA 3QUXC 1WDAA 1NCWH 1QEWB 5KSVA 4LHUG 2MKWA 1RP8A 1E2VA 3MMEA 3ZBMA 1KEGL 4XHJD 1VEMA 1Q4NX 2EKSA 2R29L 1N6QL 1OSEA 5IR1A 2LAGB 4XP1L 1KLFA 4ZYKA 2HVJA 4MWFA 3THMH 3OJMB 3QXAA 3FRUB 4D0DB 2J8UE 1MCEA 4PRHE 4UV7H 3ZRFC 3GJFA 4XVOA 1WTGT 4MNGB 1JP5A 3IPBA 2AAVA 4BFOA 3WIHH 1KYFA 3VGGA 2ZKYA 3DRTB 4L8DB 5IW1B 3TLRA 4YBQC 2CPCA 3TCTA 3T04D 3WDHA 4HBCL 1N5YH 2JK5B 3RVWC 2HVBA 4M43L 1ZSDA 1JZJA 4GXFA 4HUWB 3IJ9A 1S7XB 4JDEB 1WK0A 4IOSA 4AQOA 5JIKA 3DUSB 2D7MA 5EEXA 1PNDA 5C09D 2EDXA 1HQRB 4M00A 3SQBA 1G7QA 1SMAA 3MRQB 2Z9TA 3QH3B 4OZHB 3KS0H 1RUQH 2WXNA 1NKOA 1OGTB 3K8KA 2D3NA 5D7JB 4JG0H 2ITCB 4GW1A 3M46A 3I6LE 2WXOA 5GGSY 4LSTL 4K7PL 4LDEB 3W9DA 3BP7B 3PL6B 3FQ2A 3ES6B 3UO8B 1JRHI 4MCYA 3LKNA 3KW8A 1C08B 4N9GB 5D2NA 5IY5B 2PUQT 2H41A 2W81C 2R4SH 5KAQG 1CT8B 2HFGH 3H3BC 3U0WL 1J11A 4GBXB 3HB3D 3MRLA 3CIQA 3LH2L 4G6ML 2QPSA 3PWPA 5H4YA 1DFBL 1NCUA 1WBYB 4G9FE 1OGAE 2NXYC 4G2AA 1F4YL 4Q9RL 1TSHA 2VLJD 2HFEA 3CWGA 5IHZA 3FH7A 2EDMA 3PE9A 4MAYA 4P2OD 4C59B 5HP5A 3MLUH 3MVSA 3S35H 1OF2B 1AYOA 5SWZA 3RUGF 5BV7L 4DGIL 3CLWA 2FEEL 2NTFB 2YFNA 2EE3A 3QJFA 2P43B 1YPZA 2MWCA 4QHKJ 1MNUL 5DEJA 3S37X 2UWEA 2VDRL 4RA0C 2IAAC 3C09B 3CFDA 5CINH 3MRJB 1MRFH 4FXLA 1U8NA 2C26A 3H54A 3V52L 2CRMA 4N8UA 1OHQA 5I8OH 2A6JB 3OSKA 4YO0A 2OYMA 3C5JA 3PGDA 4IRJA 1AFVL 1YDPA 3WLWC 1WEJH 3RVWD 1KNOA 3FT1A 1L7TL 3LKQB 4GKNB 2EE0A 3MRIA 1SXSA 2E8YA 2VDLH 4P23A 3L9BA 5E99H 1EEYA 1CWVA 3IFOA 3FBKA 4WEUD 3JV4B 1TQCB 3MYJB 4ACTA 3CFBA 4WEBH 3U79A 4FQJH 4HQQH 4XP5L 4XWOC 3QFDB 3WG7B 4AYEC 1GC1L 1SOSA 4JPIA 3ATEA 3UIYA 2IWKA 3HPJB 2D0HA 1KXQE 4JO8A 1KCKA 1UFUA 3STBA 3V6OC 1AQKL 1G9HA 3SIKA 2DLEA 5K9OB 4O2CA 3DYMA 3VFUA 3DV4B 1QW9A 5I5MA 4ICXA 4BFEA 3P2TA 1SDYA 1OL0A 4FQLL 2VQTA 1HYSD 1IJNA 4GUQA 1HK6A 3QZBA 3FTXA 3BPOC 4B41A 5JW5B 3VD4A 3BVNA 1JHLH 3BUYA 1EV2E 4ZG1A 2BP0A 1NGYB 3HEIB 1I3UA 2H32A 2WLKA 3M7OA 3CVHH 2NXYD 4IIQC 5C0AA 2KZBA 3HLKA 3BZDA 4PW3A 4MNQE 1B9KA 2GC4C 3NTCL 4N0YH 4NUJA 1S7SB 2JFCA 3CHQA 1AD9A 2X4QB 4MZ3A 5DS2A 3VI3A 2ZKWA 3BWAB 1AMXA 1Z3GH 2NNAA 2OCJA 1NBCA 1OARL 4XN9A 3QUZB 1Y6MR 1QYGL 2QV2A 3TPKA 5DWUH 1CG9A 1SEBB 1XX9C 2D7QA 4JGUA 4JRYB 3B9KD 3WUWA 1BZ9A 5E1HB 5H37G 1VZGA 3SCMA 5IQ7H 4JFQA 1RZ8A 1C5CH 4XXCC 2B2XL 1MHPL 1FO0A 4K7FB 1FL6B 4CC1A 1MQKH 4R5TA 1G7IA 3EO1A 1WC7B 5TJWK 5D7IB 2IC2A 2OCCB 1TJMA 4D9RE 2DAVA 2Z93B 3WLWD 5JIQA 3WFZA 4DVBB 4ZOEA 3VFOA 3TO4B 4XODA 4TQPA 1E4XI 5HDRA 2OTPA 4LVHC 4E5XB 2DV6A 1NCAL 1P4BH 1IE4A 5TDNB 5A3IC 4IGBC 2EKJA 5FF6B 3IAGC 4XWOD 3MV11 3VTTA 4A7GF 1DUZB 4DGVL 1UXSB 2D2CC 4NZDA 3GRWA 3NUKA 4AQ1C 1U8LB 5AW4B 4QAMB 3QXVA 1OAUL 3V7MA 3IS1X 1RUPL 2DH3A 2J2ZB 3M86A 2NW3A 3WJJA 3ARDD 5I16B 4KQ3H 4J3TA 4ICWA 4PY7A 1T6WA 2A77H 2OW7A 5B1AB 4LLMB 4A68A 4GS7B 3BGFC 3S2CA 2VABB 3B9EA 2XZZA 3NCFB 4JFED 2B16A 2VDMB 3IJSB 4MHHG 2UV3A 3DTXA 2VITA 2WSKA 2Z34A 3FS9A 1RZIB 1ZJBA 4A67A 4HWZA 5KOVC 3FQNB 1XFPA 3L4UA 1ADQA 1Y0LB 4Y5YB 3OHXB 3WKYA 4WSKA 2EO7A 2ZP9A 5DRZB 4Z7WB 4ZD3H 2IADA 1IKNA 3K8LA 4OAWB 2OZNA 4P2CG 1ZD6A 3TWCH 4OVUA 4FA7B 4M93B 3EJPA 2Z0BA 1A8ZA 2VQ1B 1MEXH 3PGCB 1S3KL 1ZKAA 1MFNA 4PJCA 1DN0B 5AZ2H 5F88A 7FABL 1EVUA 3KPLB 3MNZB 4M6AA 3OKDB 2G3MA 5CFHA 3FZUD 1CGVA 5D4QA 2XBDA 3TVMC 2AV1B 3C6SB 2UZIL 3O8XC 5EU6D 2YUVA 5HD8C 1IEBB 5JPNA 3VRJB 3BGMA 5FV1L 1Z6JT 1UJ3A 3QR2A 5E6SB 3NZ8B 2GBTA 3S2AA 5J7CC 4KJPC 1XIWB 5A2KH 3RZCD 1JWUA 3L5XH 4J3XA 3T1WA 2F2HA 2Z4QA 4LK4A 5CZVH 5K69A 3D06A 2V9UA 4ZMOA 3JWNH 1I8MA 2OR8A 3K6NA 5AAWA 3TBYA 3VXRA 4XXDB 3BAKA 4ELKA 5C07A 4YFLF 1FA4A 2WTOA 2XU9A 4WHTB 4KHTL 2WQRA 3P54A 5JQHC 3BH9B 3GMLA 4LLQA 5FR3A 3TJPA 3OAWA 1JWMA 3D2TA 1XF4B 3VYPA 1KGJA 1EHKB 1TDQA 2DTMH 1PEWA 2ZXGA 2GJZA 1NWOA 2XZCL 3HPLA 1V7NH 4Z77A 2BMKA 2GUOB 2YBGA 1E4KA 2V5SA 3IWUA 3O9WC 1U41A 5IUCA 2OK0H 1PKQA 2F8IA 3NA4A 2JB5L 3L9RA 1ZLDA 3EZ8A 3R1GL 4PP2B 5IHUH 1SY6H 1SHMA 5DJ2B 4ZSOE 1AXTH 2AABL 4L5FE 2UY7A 1MDTA 5GIRB 2GSIA 3J27A 1M05B 1K3ZA 5K9QG 1A6VH 2ZXDA 3C5SA 5GS2H 3STLA 4ZOBA 2F54D 5DUPH 4NT6A 3CG8A 1Z9MA 4JG9A 1BWMA 1IGJB 3B34A 3GSNH 4S1SH 4YOKA 1CDYA 1HU8A 5IHHA 1KEMH 1E30A 2F7IA 4IQHA 3TYGH 5IUSA 4IKLA 1UG9A 3OR6A 2I7SA 5TE6H 1WAAF 2J1ZA 4ODUA 1EGJH 4HOMA 1A9VA 1DJYA 4MQSB 1UM5L 4HGMA 1VJSA 5BZWA 5M94B 3KWWB 3FU5A 3QRFM 1QHPA 2GHZA 3CCHB 4MMXA 5BZZA 3POHA 3QHFL 3TJHC 1XZWA 3BWUF 3QEQA 3RYMA 4A2HA 1SBSH 4DP6X 4UT6L 3TVMD 3C2SA 1SVZA 5I23A 1IAOA 5HD8D 4IDLA 1RZ7H 3G5YB 2GK2A 1QQDA 4NQQA 1YMMA 3QIWB 5F0MB 4KJPD 1MIEL 1BVNT 4ADGA 2WO3B 4P3CL 4ZO9A 3MLWH 1EWHA 4P2QA 2FX7L 4APXA 2ZSVB 5HHPB 3B5TA 3N50A 2YAMA 1MY5A 1AY1L 3AITA 4HJJH 4PCTA 2R1WA 1I1AA 5EIQA 2BY2A 2EDJA 3D9AL 3K91A 3SJVE 3QUYC 3SQOL 4E41E 1KDIA 1TU2A 1AVAA 1X7SA 3QJHA 4RGNB 5IBTH 3FO2A 3OJ2C 3TBSB 3T77B 5J8OA 3MRMB 3MV9E 3ZUNC 3DX1A 3ZT5A 4FAAB 4HC1H 1KENH 1OAYL 3TWYA 3HG4A 4DPCX 1S9XB 25C8H 1G4MA 2ENQA 3K6OA 4JDTL 4MFHA 5AVZB 5F7EH 1TZGH 3PABB 1MCBA 4YSEA 4KJYA 4F9LA 1FP5A 4KDWA 2DQEH 5TQ2H 1CBJA 2C9UA 3NBNA 1KPRB 4JREB 3O9WD 2MPVA 5FUZH 1CGSL 4UB0H 5HYJA 2VJ8A 4PJIF 1YEKH 2ARJB 2X0UA 3ASWA 3VXSD 3LZQA 1KWKA 4HGWB 4F92B 4MA3B 4L37B 5IMMA 4M3JA 4AJ0A 4A04A 1XZ0B 4U1HA 4HLJA 4IK7A 4HIPA 4D0BA 3BX7C 3WDJA 3ZKXB 3M1CA 2WZ5A 2G75B 5FO2A 2C9QA 3RJQB 3FCBA 2PWEA 5I30L 1DVTA 3I02A 4L3EB 1E27B 4PJEE 4GW5B 4I5BA 4N6RB 1TJXA 2M83A 2DQTL 2QQLL 4FQHB 4I0PC 3L8QA 2V7NA 1GZPA 2O6CA 4M1CC 4OU3A 1TCRA 3OJDA 4XPBH 2XN9E 3OPZL 4AL8L 2F74B 2DQGH 3DBXB 2JKNA 3DJZA 1AP2B 2NT1A 2PPFA 5FYKH 4P2RD 2H0PA 1JPGB 4OJEH 3TJHD 1FL5B 1E0OB 4N0UB 4AH2A 2RAMA 2WWNA 3U25A 5LVEA 2A38A 4NM4L 3WHXA 3UJTL 2DKMA 1KJMB 1JPTH 3GSRA 1TOXA 1CFVH 2COVD 4JRXD 4PV9A 1EAPA 2R1YA 8CGTA 3LKRA 3MLZL 5G55A 5CN2A 2BINA 2NX5D 3L5WA 1RJLB 1HE8A 3H3PL 5SWSB 3VO0A 4FYRA 2DLTA 4K9EC 3WNNA 4IU3B 3CVCA 4ZAKC 1DVUA 2ZCZA 3V0GA 1M7DA 1AS7A 4NO0A 5HPOA 3G5VB 4R7DB 3IYLW 4UM9D 3QUYD 5EOCH 3KBPA 2Y5QA 1BFOA 1DBKL 1QBLL 3F01A 3PHQA 5IVXA 2Q7NA 3Q06A 1BG1A 2HUEA 2ENSA 1JXGA 2VSMB 2G4GA 5EU5A 5DEZA 5JORB 2AMUA 2ETWA 1WLHA 2ZCLL 2WTRB 4X4YA 2GEQA 2G2RB 2IQ9H 4BKLA 4YDNA 5A7BA 2NY5H 5MENA 3NQIA 3WY4A 1UZ6F 2OL3B 5FUCC 1VA9A 3U0PA 3SKMB 1HKFA 1S9KC 1T83C 2N0KA 4L1LA 5D6DA 1L0QA 5EFIB 3SPJA 5BQ7B 2OM5A 1A9EA 4JO4H 4MB4A 5GPRA 4LEBA 4YHPB 1VFAA 4G7QB 1N8ZB 3WV0A 3X12A 3N04A 2DWDA 4LLWB 4M1CD 4RMBA 2FATL 2LU3A 3PYCA 2YMXH 3U2SA 4JFZL 4AC4A 1DUYA 2OV0A 1AD0A 4PN6A 2J44A 3FHAA 1BBDL 4MJ5B 5JNYB 3TS8A 4NRYA 4GRWH 2ZXCA 1OOWA 3DXAB 3ULUH 4NUGL 4LHQB 4L4VD 3TBVB 2QELA 1Z5YD 2ZYRA 1MFEH 3ARBA 3VI4B 5EHFA 4GRLA 5E00A 3UDWA 5JPMB 4B95C 2NYYD 1DANT 4DKFH 2ED8A 1NC4B 5JYLA 1T2XA 2P5WE 4ZUUB 3CFTA 1ZS8B 1MHHB 1ILSA 4WSJA 1HDMB 3HC4L 4JM2C 4MB1A 1T4KB 4G8EB 2VMJA 2YPLD 3NIGF 5FGBC 5A2AA 2R2EB 5FA3B 1LO4H 4V1DA 5KVGE 4Z7NE 4X4KA 4Q89A 5TH2A 1T0NB 2GEEA 2GJ6D 4URTB 4E2OA 4ZAKD 4R7NB 3VFMA 3ZHKA 5LQBH 3H7BB 2X1PA 3KR3H 4LSUH 4FF9A 3WENA 4WFED 4NAMA 4R3SB 1MCOH 3NEOA 4FI8A 5DS8A 3WGUB 2F08A 2O93L 3CSTA 5GGQH 5DD5H 2B20A 1B0RA 1Q94B 3UYRH 5B3JE 1ZHBA 4O4YL 4LPTA 3SDXE 3ULSA 2OMVB 5EN2A 3MREA 2FJGA 2DJMA 3VX0A 1MVUA 3AROA 3BT2H 4HJGA 4N22A 1L3WA 4WUUA 4HSCX 2IPUK 2HVKB 3UTZA 43CAB 5IVZB 3TXAA 3KXFB 3T0AA 3GC3A 3SKNA 4WO4C 2HZHA 5DJXA 1MJJA 2CE6A 1JXDA 4PJEF 2A4ZA 1HL4A 3VGDA 1CDHA 2Z7UA 3TN0C 3LRKA 2ODIA 1XMWA 1YEWA 5D70L 4CVWA 5GS1C 2FL5B 1YYMH 3NH7H 3K1KC 4DN3L 3TIEA 4RSYA 4N1CA 1H3GA 3C5ZC 4PRPA 4ABUA 5F9JA 5FK9B 4KDTA 1TR7A 2HX7A 3O11B 1GCYA 1AS8A 3DPBB 3UEZA 5FYJU 5ABDE 2WLIB 2YUZA 5CEZD 3D48R 4N8VA 4KRPB 3V4PH 1P4LA 2H5UA 4PJAA 1JGVL 1X4YA 3GHEL 4DJMA 1HJCA 4R4FL 2ZKHH 2CHXA 4NQDA 5I1JH 2ZICA 4G5ZL 1OQXA 4EVNA 5D72H 4YSQA 3GFUA 4JFXB 3IDYB 1BVOA 3DETC 1BMGA 4JM2D 3ARPA 3SY6A 4F7CB 3CHRA 3MTXA 3NPSC 1CE6A 2W38A 3HFMH 2G5BB 5EDXA 3LPGA 4GG8A 1KCVH 4XHQA 4IS6B 1QW8A 1J5DA 1I7TA 2QFRA 4KVNL 3AS0A 1S9VB 3NFNA 3GXPA 5F0PB 3VFTB 4F7PB 4XNBA 1CFNB 2DMGA 2XTJB 5AOJA 1E4WL 1RU9H 4R90H 4TOYH 2ZSWA 2APSA 3VM7A 4PRIA 5GRYA 1HWGB 4S11A 1J1XH 1NKGA 2IF7A 4MTMA 4QO1A 4WGWB 5J13B 4LQ1A 4OCRH