1WYJA

Solution structure of mouse protocadherin beta 14 (26-137)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
125
structure length
125
Chain Sequence
GSSGSSGAGSATITYSVLEETDRGSLVGNLAKDLGLSLRELITRGAQILSKGNKQLLQLEQKSGNLLLKEKLDREELCGSTNPCILHFQVLLKSPVQFIQGEIQLQDVNDHAPEFMEDESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords protocadherin beta 14
publication title Solution structure of mouse protocadherin beta 14 (26-137)
rcsb
source organism Mus musculus
total genus 11
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2005-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08266 Cadherin_2 Cadherin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 1wyjA01
1Q1PA 2OMWB 3UBFA 4ZI8A 5KJ4A 4APXA 3K6FA 5JYMA 4AQ8C 2WHVA 3K5RA 4ZT1A 3LNFA 3Q2LA 2OMZB 3FF8A 4AQEB 3LNIA 4AQ8A 4ZMXA 2YQGA 4NUMA 5DZVA 4ZMYA 4ZMTA 4NUQA 2OMUB 4AQEA 1NCIA 4ZMOA 4ZMQA 3LNGA 3K6DA 4ZMPA 2A4CA 2WBXA 1OP4A 2O72A 3QRBA 1NCJA 4ZMWA 3FF7A 3UBHA 4ZMNA 4XXWC 3LNHA 2OMTB 1WYJA 4QD2E 2QVFB 1EDHA 2OMVB 2OMXB 5CO1A 1NCHA 3Q2NA 3UBGA 3Q2WA 2A4EA 3Q2VA 3PPEA 3K6IA 1O6SB 4AK1A 2V37A 1SUHA 3MVSA 2EE0A 1L3WA 2WCPA 5CZRA 4ZMZA 4ZMVA 1ZVNA 3K5SA 2QVIA 5JYLA 1WUZA 2OMYB 1FF5A 4XXWA 4AXWB 2YSTA 2WD0A 4ZTEA 3LNEA 4NUPA 4AQAB 4NQQA 1ZXKA 4ZMLA 4AXWA 3LNDA 1NCGA 2X2UA 4AQAA 4OY9A 4APXB
chains in the Genus database with same CATH superfamily
1MH5B 2ROXA 3S36X 3T3PF 2FWOA 3S9DB 4TUUA 4PJ5D 4X6CF 4FLQA 3W0WA 3AXHA 3WLWC 3N41B 4LVNB 1JD7A 2VMJA 3QZPA 3BSZA 3HPJB 4P3DB 1HNFA 5JQHC 5FFOA 2VLKB 2ATKB 4B5ZA 5K39B 2BRRL 1EEYB 1T21A 1IKFL 4I0PD 3DVNA 3BP6A 4U1KA 3M8OL 2DQFB 2EVJA 2DLGA 2J88L 4TUKH 1AOHA 4KAQL 4Y5XA 5BZWB 1DQDL 4XWGL 2VDKB 4Z7VB 5JLZA 3KPNA 2JKLA 2Q10A 2EQDA 1TQCB 2IIJA 5DSCA 3ZE2E 4PUBH 2NZ1A 2PCPB 4PJ9A 2HYMA 4OLVL 4GQ9H 3V0WL 1JHLH 2X4OA 4O02A 1HKFA 3LZOA 3PWPE 4UB0H 2CRZA 3B34A 2B1OA 4P4RB 3S5LG 1HL8A 3SBWC 1T7WA 2FB4L 4YFLI 1TG8A 4QXGL 3CVCA 2YGPA 5JPMB 1GS7A 5FM4A 4UDUB 3GXFA 4HWEL 1VACA 3U30C 4LOEA 4NN6B 3Q2CA 5I5IA 3N42B 1QNIA 1N5AB 3P4OB 1S9KC 3VSVA 4G7YL 3WXWL 1YPZA 5CUSH 3V0HA 2FSEB 2XWRA 3O2DH 3T2NH 3M46A 2BVQB 4G8IB 1RJZA 4OCLC 3EDJA 4NT6B 4OM0H 4H20L 3DHPA 5EF1A 4AIZA 4W9JC 2CE6A 1CDUA 3UEQA 4GIAA 4IYKA 2WJ5A 2YEVB 3LS5L 5EUOF 2A4ZA 2VXQH 4KJWD 5CSZA 1MW1A 3IDMB 4NQXA 3RJDA 4MFHA 2F54D 4R4NC 5LWYL 4Y9BA 4U1GB 1QX1A 4OF6A 4Y5VB 4PJHA 3RWJB 4ABWA 1BM7A 2XX1A 3A67H 3A21A 1SHSA 5C0EB 1JZ8A 2BXYA 1FF5A 5T5FL 4DGWC 1R0AL 2VR8A 1M7DB 4IHBA 2IADB 4J4PC 4Q9RH 5T1LA 5AEAA 4B0MB 3IDXH 3FC8A 4NQEA 1WV7T 4TQHA 4ZOCA 4FTDA 3UTOA 5JXAH 1OM3L 4I48B 3CZKA 3C08H 1OOAA 2ZXAA 4CU6A 3ULVD 3ECWA 3TPUB 5MENE 4XB3A 1EPFA 3L5XL 5SWSB 2CLRA 1HVXA 1M4KA 1RUPH 2CR6A 2J8UE 3E3QE 1JZFA 1GGIH 4FQPA 3RURA 1E9QB 3OX8B 3US9A 3MLUL 1SBSL 4LLMB 1LEKB 1T2QL 2VZVA 2DWYA 5HTSA 5INDB 1WZ1L 1LE9A 2F0CA 3P4NA 3EBAA 5D70H 4JREB 1F8TL 4D0BB 4DPAX 1EFXD 5D71H 5HYIA 3QUKB 3RZCA 2VYRE 5CZXC 2XTJE 3TBCA 2Z93A 1M7IA 4CMMB 3SQOL 1TZIB 3MV9A 4ZK8A 2E7LA 3W38A 2HJLA 3OGCB 4LDCA 2V2WA 15C8H 1LJMA 1ZD6A 2BSRB 2QZQA 1F4WL 2WBJC 4HYTB 1JDDA 4GAFB 5BRPA 1JV5A 4AQEA 4WKZA 3VFGH 1OGTA 3VX1A 4LCUA 1S7TB 1FVEB 4HHAA 1IQDB 5AW2B 3CLFL 3QQDB 2R2CA 2JKRM 3VWKD 2BDNH 3VMNA 4JPKL 3FKUS 4WRLA 2VR3A 4MHHG 5TE7H 2EILB 1PD1A 4V1DE 3ZQXA 2FYVA 5DA0B 3ZIMA 1ZLSH 5B38A 4WTQA 3QNZB 1K9TA 1BFVH 2OXHA 5DYOB 2Z4TA 2J21A 1LDPH 2HKAA 3AT9A 3FOMA 1UD8A 1CD1A 1ACYH 4LSPL 4TVSa 3FYIB 3STLB 4M02A 4FF9A 4UDTA 1BFTA 1JPGA 3BPNC 4Y8AA 5IQLA 3L2NA 4OQTH 5K9KA 5TQ2L 4DZ8A 3MRKA 1DBKL 3QARA 5F89B 4JCMA 3RVWD 4ALAL 5E2UL 3CFNA 1ILUA 3LPGA 3SBPA 1XIWC 1A4JB 4JGMA 1AAJA 1PKQE 4XR8C 3ZTDC 1BVKB 3SOTA 3MA9H 2KLRA 1XZWA 3LZFH 1WF5A 3GHEL 2EYRB 1MLBB 1MEXH 4WNQA 5J89A 2Z7WA 2K0RA 1QYGH 2XN9A 5BUPA 3SE8L 3S37L 2A6KA 3JTBA 4LPXA 1FH5L 1L9MA 2EDHA 5L0QC 2I27N 3VXPB 2KZBA 1FZOA 3D3VE 1NGQL 4CC0A 5IK3B 3CDYA 1KG0A 4XNZB 3GS4A 4JDEB 3WIHL 3UTSA 4AVIA 1URLA 1T1ZB 1BDYA 4C4UA 3W9DB 2WLZA 3SJVD 2V2TB 4CADA 2QSCL 1JGLL 3GMPA 3MNWA 1MCOH 3P73B 3P4MB 2NXYB 4FQXD 4ZUUB 1LP9F 2X05A 3VUAA 3BE1H 4KO5A 1U8CA 2BWQA 2BIIA 3LH9A 2PW1A 2B5IC 5FGBC 2BVUA 4RMQA 2ZAHA 3RWDA 2NTFA 1OCCB 1F3DJ 1XXDC 1V3MA 2OMZB 1NEPA 3V52H 5F6HJ 5IROC 3T3ME 3X3GL 4L8CA 1CBVL 2PXYC 5T3XL 1XXFC 4HKJA 4M7LH 3TN0A 4YSQA 4NX0A 5DK2A 1CZ8H 3S34L 5GRVL 1ASQA 3P0VL 4Z3EA 3IU4H 3T08A 4YX2L 4AVKA 3P3YA 4O2CB 1GIGL 1I1RA 5IQ9A 3S4SG 1XB6A 4DP5X 4UQAA 3Q1EA 5KOVC 4LSRL 1BXVA 4IRSC 1A8ZA 3VGFA 4APQA 3MCKB 1HHHA 1BMZA 2E59A 2RIKA 2VE6B 1P4UA 3RVXD 3G6DH 3APMA 1A14L 3HAEG 2AQ1A 5KTEH 5H35A 5LDSA 5IJKC 1MCEA 3EH4B 5FYKU 2FATH 3P02A 2BS71 2WO3B 1DUZB 2FR4B 4N2MA 1YA5A 2IQ9H 1Z9PA 4XWOD 5C08D 2VDRB 1DLFH 3IFPA 1U8IA 5DU7A 1YEEH 1YN6A 4LU5L 4OCRH 4X4MA 4AEFA 2VJXA 2OYLA 2LVCA 1JOIA 3PG2A 3SCMC 3K2MC 3DOSA 3ZRSA 1Y0LA 1RD6A 2K8MA 3KBFA 4JFDE 4CGTA 5IP4A 4ONGH 3EOTH 3WO3B 2ICCA 3DTXA 3FAXA 1SMAA 3SGEI 5DVNA 4C55A 3ETSA 1P53A 1U6AH 3GKWL 5KVFE 2RQ8A 2JH2A 1NCDH 2W95A 5CFAA 4XNYL 4B0MM 3EGSB 3NZ8A 3U48A 1KY7A 2CHXA 4GAAA 4XCNB 4QIRA 1A6VL 1Y18B 2C7UB 3DJRA 4HV8B 4MDIB 1CFTB 4LCWA 5DRWA 4ELMA 4I1RA 2A2QT 2XVBA 1D5MB 5FLUA 3FOLA 2BOBA 5DMIH 1MG2C 4B6ZA 3D51A 5F7EH 3K8KA 3ZE0E 1J0IA 3LB6D 5INCB 2QFRA 3KJ4B 4JMXA 5B39G 4J28A 5C7XH 3C5ZC 4ZPVA 4NRYB 2FT6A 4WFEE 3KPPA 5KANI 2F7QA 4L0YA 5KVDH 1WZMA 4ZAKA 5FDWB 4C4KT 3KLDA 3BQUC 2WKLA 2JKWA 5BVPH 3FFCB 4YPJA 4AQZA 3BW9A 4N86A 4OLUH 1RIVH 2HJKB 2YD4A 5AVRB 2Z34A 3EYUH 2MCPH 4D9RD 1JNJA 1CPUA 3G6JE 2UXTA 3L9EA 3LSOA 3RPIB 3K72B 4IBQA 3FNKA 2ZXQA 2F9BT 3S5ZA 4PJAE 5KYWB 2EKJA 2IBGA 4PRPE 5JQ6H 3BAEH 4KMTH 1VAHA 2ZXCA 4GRMB 3KAAA 1L6XA 3Q2LA 4OV5A 1GYCA 1CGSH 1Q72H 3EJQA 3KCPA 4I0CC 3F7KA 2OMNA 3L7FA 4AQ8A 5IVZB 3QJHA 3POCA 1S7WB 2BFGA 4KROC 1UGNA 4JPVL 5C1MB 4PYHA 3HIZA 1BGXL 2F6AA 2JV6A 4X80L 5BCAA 2Q3ZA 1DZ0A 2JF1A 4G7QB 1YMMA 2P44B 3ULVL 1WHPA 3RFRA 4JVPA 1XF3B 2FT8A 3NAAL 1B4JL 3TCXA 4QCIB 4IJTA 2RFXA 2VNCA 3L45A 3LHPL 2R1XA 1MPAL 4PW4A 2R2HB 4RISH 5GGRB 1RJLB 3RG1C 4AKQA 1ZSDA 1DQLH 2IFGA 3AQDA 1SPDA 2YD6A 4F7CB 1PIGA 3EBHA 3IGUA 3VGBA 3DV4A 1HESA 2K70A 1Z5HA 3DURA 5EUKB 2J12B 4NO0B 3K71A 2EEBA 5EDXA 1KTBA 5IMMA 1IC5H 3EZ8A 4FKHA 4QHPA 1AHWA 3D0VB 3H0TA 4YBQC 1G94A 5B8CC 5EIIG 2NT1A 5KANG 4WWOA 1THCA 2WOYA 5H8DA 3KMDA 4L3EB 5L88L 1PX3A 4FABL 2X1WL 5D1XE 3ZDYB 1O5PA 2VCOA 1KWGA 2X4SA 4AGNA 2HG0A 1OGAD 1JWSB 3QJOA 3S35L 3UYPA 5IG7A 4UQ2B 2G75A 3D8MA 4FQLH 1ADQA 1KB9K 2CRMA 4W4NA 5DC0A 4Y1AA 2IBBA 3T4YB 1XEDA 1QPKA 3AWFA 4XMPL 2ZXWB 3I02A 4ZTOL 1NGZA 3MNVA 3FZUC 3EO1B 4JM2A 5IV2B 3EHBD 5I6PA 4ZUSA 2FDBP 4Y1TA 2YSTA 3HR5A 3D25A 3GC3A 3U4KA 1OT1A 1YUHB 2HPOA 4PLJC 4J3OG 5B3SB 1RZGB 3U2SB 1W72L 1A4KB 1JXJA 5DZNA 4M4RB 4UT7H 3G9AB 3VFPB 3VMOA 4HQQH 1RPUA 1E65A 3SSGA 1JDCA 1SRDA 2CO6B 1HHKB 3WTWA 4CVZA 4PJ5B 3ZTNL 3P9MA 3RNKA 3FN0L 3Q3GB 1KTRL 4OAWA 4JQVC 5GISL 3DA0A 2HN7A 1JK8B 2PTUA 2X5PA 5KSBB 1SYSA 1IAIL 4MRBA 3RFZB 3QNYB 3KNBB 3SZKC 1OF2A 3HZ3A 3F85A 2FX9H 3P9LA 4Z77B 3X3FH 1AQDA 4K9EL 4AJWA 1JWUA 4DCQA 5E2VH 1JPSL 4AUJA 2FWUA 3QS2A 4EN3D 4YIQA 3AVEA 2B0SH 4L4VA 4OZFB 2R7EA 4XO5A 5FWRA 5HXMA 3HKZA 1TU2B 1FG9C 5KBPA 5F8QC 2VKWA 3NCJL 7FABL 4Y4FC 2R0ZH 3OXRA 4UNIA 5F7FA 5IREA 1U58B 2B16A 5CU9A 1YUKB 1UJ3C 2WSKA 3WUWB 3UAEA 1QEWB 3QEHA 4ZMQA 3HR6A 4YHIB 1A3ZA 1NGXB 4P2RD 3TWYA 3ZMRA 1TJGH 4JVWA 4A55A 2XRAH 4RGND 3GSVB 3VXNA 1QKZL 1TYRA 3PP3H 2J1WA 4X6FB 5E1AA 4G7SB 1JPTL 1KENH 2GK2A 2VN5A 3IDJA 4XP1L 2I9LB 3ENEA 2KPNA 1SLVA 4R7NA 4N0RA 4OFYD 3TH3T 1DQMH 2YAMA 1DCEA 1G1OA 4LCIL 4ZDHA 4B9JA 3IJYB 3WS6A 1NIAA 4OGYH 2V9RA 2P5WA 2WANA 4A7GF 1AD0B 2GTZA 3B43A 4MD4A 1OTSC 5D5ME 5EBMA 4UQEA 4WU5B 4PPTA 1BJ8A 4R5XA 4AIXA 5ILTL 2IALA 2ZKXA 3MJ7B 3PGDB 4K3JH 5IIEA 1DQTA 3LMJH 1YEGL 1TO5A 4TVPE 5DZAA 5DD0H 3NEEA 1JUFB 1PCXA 1OPGL 2CBQA 3KGTA 2W60B 4HLZH 4L5FE 2MRYA 5DWUL 5E4OA 4IBUA 4CVXB 2VR4A 1NM4A 3Q6GL 2X42A 1S7QB 3NEXA 3OBAA 4U7SA 5CSGA 3VFWB 1FZKA 2G2PA 2Z92A 1WJ3A 4MLIA 3WKYA 1RLBA 4LLQA 4KK8C 3PWJA 2ZTBA 4AQ1B 4WI0A 5BUGA 5D4HA 5AVVB 5F6IB 2I07B 3QCTH 5J57B 3GZPA 4QUOA 2Q6WB 3EJZD 4NBYB 6PCYA 3NRFA 4TNWF 3BD5A 3C6SA 4AM0B 2DH3A 1UWFA 1ZS2A 3D18B 4G1EB 4HDIB 1X5JA 4Q0XH 1MI5D 4L37A 4QXWA 5IMOA 1KEGL 2Z31D 5C09E 1BJ1H 1CFVL 1BBDL 5D2LA 2R0LL 4ZW3A 2HLEB 2W9EL 5D6CA 3T8MA 4GJTB 1NC2B 4J3VA 4WU7B 1FJ1B 4MA7L 4ZFFA 3OKDA 2EYSB 4DGIL 5C0GB 1M2VA 1EGJL 3KXFB 5I73C 2R0WH 2WXMA 4DP9X 5KSVA 4O51A 4HJGA 2J1YA 4P07A 2JVUA 2J6EH 4K3EL 4TM9A 1ET8A 4YNYA 3OC8A 4Y5YB 3SQBA 2FJSA 3FB8A 4NO3B 1LYQA 4HKBB 3UDWC 1A2YA 2EUXA 4Q9QL 3S3PA 4PVMA 3CMGA 3AREA 2JCCE 4JPWH 1EHXA 2FHBA 2XKNA 3O4LE 4URTB 5DR5H 4XBGB 3L95B 1XHHA 2EXYC 1BVLA 1YPZF 5C9KA 2BP5M 5E4EB 5D7IE 1BFOB 4BSWA 5E9NA 5DS8B 3MJWA 3B37A 3LN5B 4OF7A 4WK4B 5DRNB 3BVTA 4F1ZA 4HK0B 1TQBC 1NLDH 5FWQA 2VXSL 3CVHB 5HDBE 1RHHB 5JW4M 2GBAA 2EDXA 1C9SA 5CINH 1AMXA 4P04A 4DKEH 5ENWA 2WLYA 3CVDA 3I50H 4MCYA 1OK8A 5E8NB 5KS9B 1A7PL 4K3DL 1YNKL 2X53A 4PJHF 3QIBD 1EAPA 2X4RB 3A4FA 1W15A 1D9KC 3BJ91 5JORB 4A66A 1UWGH 3BKYH 4PGJA 1UEMA 1N6UA 3EDKA 1VGEL 5FYLE 5F9JA 2BCKB 3BO8B 4GBXB 1INDL 1X5XA 4AZ8B 3UBXB 2K4WA 4MVBC 4HCRH 4IGBD 2NQCA 2CRIA 5GGTL 1JVKA 2NX5E 2NNAA 4JDTL 5C0CD 3WMSA 2GCYA 3LCYA 5D1ZD 1XF4A 4ZX3A 4Z76B 2Q86B 1IGFL 5FYKD 3WNNA 3QG7L 4DN4L 2DLTA 2JXMA 3WY3A 4LLAA 4I7ZC 1K8IB 3KYNB 2N7AA 5MP6H 3MRMB 2V17H 4E5XB 3SDXA 3N9GL 4M7JH 2ZWLT 2NY2D 4QPEA 4LPYA 4F8LA 1J8HA 3B1TA 1GHFL 1CFNA 2CGRH 3QAQA 4U1NA 1UM6L 1F58H 2WXIA 3WAKA 2MQ3A 1GXEA 1ZHBB 3L4VA 1L9QA 1WBZB 1OTUC 2OMYA 3DX8A 1AFVH 1R34A 4NPYB 1HCZA 1BYPA 1ZGLB 2IMNA 3AGWA 5J1AB 1LO5B 1NWPA 5FAAA 1NCGA 1P4BL 2LTQC 1AXSA 3LKRA 4BA0A 1YO4A 2Y7OA 2C1OA 1YNTB 5HHPB 3QUMA 5E23A 5SV4A 4K71C 3C75A 4WI8A 5E4IA 2OYMA 1RVFH 4X8JA 2JMRA 3BVUA 5IESL 1Z5YD 3RDTD 2BNRE 1MHPH 2JJWA 3U0WH 4R5TA 1OHZA 1E2VA 3WXVH 1N6VA 5C7ZA 4L29A 3NJMA 3DX3A 4RMBA 5FUZL 3RWIA 4EDWH 3TO4B 2W38A 2WXOA 3ZDXF 2VQUA 1NOAA 3FTGB 1E6JL 4PTUA 1U8KB 2Z0BA 2J5LB 4HIJA 3LDBB 4X6BB 3CFCL 2B77A 2MWCA 3PRZA 2BIQA 1KEMH 2XNAA 3BAYA 1KWKA 3BRFA 3QQ3B 3AY4C 4CC4A 5ADOL 2V5YA 4RA0C 2VSKB 1MJ7L 2PCYA 3OZKA 5GS0C 1T22A 3VXOB 2X4TB 3E2HB 4U7KA 4C83A 1EHLL 2VDOH 5TK2A 4W9ZA 4AYID 2JIXD 1PJ9A 3O45B 4X9GA 3WN5C 2XTSA 4IOIB 2BIMA 2ZOTA 3TT1L 5C9JB 4C47A 4QXUL 5IB2A 2XDHA 1A5FH 2ADIB 2CKBL 4RMUA 1KCWA 2FBRA 5EU7E 5I8OL 4YLBA 4UTAH 3TFBA 3G9VA 1EXUA 4DPRA 2CK2A 1RULH 1DVFD 2GJZA 3E9TA 5CJQH 3S2AA 1I7UA 3GMLB 1XBDA 1QWNA 2ICWA 2QQLL 1O9ZA 3PWPA 4QGYA 1EAJA 5EOQL 5EEUA 5HJGA 4AGPA 5C71A 3LQMA 3ATBA 4R8WL 5CKGA 2WYZA 1KNOB 4Y4KC 1XZ0A 4M5YH 3WLBB 1J9CT 3MRJA 3O3EA 1MFNA 4KH9A 2EZ0C 3CQQA 3VD5A 3BEWB 3BIBX 1IBGL 4GKOA 4PV8B 5DJZB 4LEEA 1NOLA 4XPHH 3TA3B 2H0PA 2WCSA 1F5WA 2QELA 3T4AA 5CIPA 4Z7WE 5D8JH 1A7RL 3FO2A 3X1GA 3AAZB 5BVJA 3UMNA 1HCYA 1NANH 3OKEB 4IKKA 1BAFL 3RY4A 5EF3A 2G4EA 4HIXL 3GWJA 4N3UA 3VFOB 4ZW8A 5DJYB 3ARDC 3VE0B 3IMTA 1MHHB 4YBLB 1S8DB 5EOTA 3MUHL 3OKYA 3FQUB 4Z0XA 1T1YA 5LO7A 2X9WA 1TQSA 4IKJA 2JQMA 2OJEB 3SO3B 4XI5C 1G9NC 3NDYE 12E8H 2R1YB 3FPXA 1TTAA 1NBCA 3O11A 2EE9A 3QC6X 3OKNA 5E6YA 2NY0B 2Y25A 4JPQA 3BXNA 5AAWC 3H6JA 3WNJA 1PLGL 1RUAL 1WC7B 1OD9A 2X6BA 4KKPA 2ZP8A 5DMGD 3WO4C 3ARPA 2AI0H 2VUKA 5FFLA 1A65A 3IJEA 4WFGD 3ZL4H 4QWWC 1EV2E 1ITCA 1RZJC 4LKXB 3F58H 2YRPA 3QZWB 1AO7D 2YUWA 1L7TL 4MJ4A 4GRLB 4P2QE 4OFVA 2X6VA 2J8UA 1IEAB 5DJAB 2XUWA 4M6ML 4ISVB 1GMEA 1HHIB 3NOIA 4Q9CA 3MO1A 3VJ6A 2ZCHH 4J1UB 1VERA 1G7QB 4PB9H 1JYVA 1INQA 3EYQC 2BVPA 1QBLH 2BY3A 3FCSA 1KJ2A 5G4OA 1E6OL 1MIMH 2D0GA 3KM1A 1IT9H 4F92B 4DN3L 1T0MB 4NQCB 4M6NH 1YECL 4ELMF 2ROYA 5IWLA 1UGKA 3HLAB 4FNQA 3RKDD 5L2KE 1NCJA 1DBAL 2NR6D 2QHRL 3HE7D 4LLWB 5D93C 4D3CL 3FB7B 4ZMWA 3C6EA 3WDHA 1S5HB 1QO3B 4MS8D 4X98A 2DQGL 2IDFA 2VDML 3K81A 1UKSA 1R5VB 3BDBA 3QEQB 2OL3A 5GS3A 4W93A 2ZG1A 1A7OL 1X7TA 2CR3A 3QFGA 2Z35A 1NMAH 4Z3IA 1H15B 1FGNL 2V0AA 4XPTH 4JRXA 3FQXB 4FYRA 4ZFGL 1QFWL 4PBWD 4AV5A 4AZUA 5DD3L 4JDZA 1OEZW 4OGXL 1SXZA 2OS7A 3DKHA 1WIUA 2WKOA 3IMSA 4F8TA 3ALXA 1NKOA 4L2LA 2ZWYA 4XX1G 1U8HA 2V5SA 5HHQA 1ZGLM 4N22A 4TN9A 4JFVA 3EAKA 3T0XA 1J48A 4WWID 4A7QA 1UM5H 1SJEB 2QVIA 2V4LA 3W9EB 3CIQA 5JYLA 2CJUL 4KUCD 4ACTA 3O6ML 5ISZD 4AUYA 3QULA 4FTVB 3TBTA 5FXCH 3D39D 3GLAA 3MGAA 3IMUA 4U1LA 3CFEA 5DURD 5I19L 5L4MA 1PKQA 1NCWL 1VZIA 4XPGH 5AYUH 5J12C 4CN1A 4HH8A 3WGUB 4D9LH 2BVTA 3QGVA 2BO0A 1HNYA 1IM3D 5MEOA 1R4XA 5GRUH 5FYKL 4F33B 1VF5C 5SX5H 4S0SD 3HUJE 5AB2A 4H4NA 1VFAA 4IMLA 3N43B 3DPDA 3NVQA 4LEOB 4XPAH 4A6YL 3D09A 1KY6A 1GC1C 1F18A 3IRZA 2BNQD 4QLRA 1NMCC 4NDMB 5E8EA 4XAKD 1UYWH 3X14B 1IC0A 4G9FD 1I1YA 4U3XA 3AG2B 3MMEA 1XAUA 4FE9A 3RB5A 5J13C 3VXMA 3VD3A 1NUNB 1HX0A 4NP4H 4QI3A 4KGJA 4N9GB 3HE6D 3QFDA 2M1KA 3L1OH 2QPEB 5C6TH 4BFJA 5T3XE 5J4MA 2JTYA 4XMWA 3FSOA 1ZVSB 4PJGE 2XG5B 2XPZA 4MMXC 4OW6A 1MCJA 4L8BA 1KXVA 2W65A 1R3LB 1YDPB 2P46B 5F44A 4WWKA 5I74C 2WXPA 4G8FA 3V0FA 2PWFA 2J5WA 3DUSA 1QLEL 4R2GB 2NCMA 1QSFE 1AGDB 1AQKH 2TAAA 3B8SA 4KQ4L 8CGTA 2BM3A 4OIBA 3MRHB 2OTUB 3G5XA 3BPOB 3VQLA 4DESA 4WEBL 2ESVB 5ESAA 4K3GA 1YQ2A 3SKNB 4F7MB 4N2OA 3TNMA 1P2CA 5E8OB 3TONA 2A1WH 3DOHA 1FYTD 25C8L 3CFKA 5IBUB 3HVNA 5HYSA 5GZND 4WI3A 1J05B 4XNQA 3Q8FA 2EH7L 2WCGA 2C3WA 3WIIH 4XCCH 2ZNXA 5HVHC 3MX0A 1J9TA 3OGOE 3GSQB 3T0EB 5B38G 2HX9A 1EVUA 1NCHA 1BZEA 3DROA 1AGBB 1JHKL 4JFPA 5CLTA 3ZZLA 4MASA 2YUVA 3UJJL 2FQDA 1GCYA 4YSOA 1KJVA 2Q1EA 1SF3A 5DD1L 4IU3A 4S1QH 3RHWF 3NFSL 3AW5A 1TZ8A 2YXVA 3GIZL 4E9TA 2ED8A 2NY7H 2KHAA 2WCPA 4PBVC 3TOPA 4CVUA 4TNVK 3AFLA 4RAUB 1TTRA 3M45A 4JPIA 4K5MA 4G11A 4Z7OE 2Z4QA 5FUCE 2HTLD 4FMFA 3O3BA 3Q6FA 3IB4A 1DDHA 1M2OA 3KYMB 4JAMA 5TDNB 3SZ6A 4AXWB 1JZ3A 4OM1L 2CM5A 3GSNB 1ZAGA 1D7DA 4U3CA 1WICA 2LHAA 2GY7B 4PLOB 3L3IB 2A9AA 3S35X 4F57L 4J3OD 3H3BC 3SPGA 4YSDA 3UTQA 2E74C 3IDIB 4HBCL 4Q74A 4OY9A 3ARBC 4OIFA 3QIWD 4KZCA 5HI5D 3AM8A 2P5EE 3MPCA 4FXGA 4PP2A 1KSRA 4MJID 4M00A 1Y1DA 5JIMA 1NGWA 2VDKL 5D72H 1NJ9A 3FRPA 1WPCA 5GRXG 2P8LA 4YXHL 4WW1A 3EO9H 2F54E 1REIA 3A0OA 3WI9A 2V8MA 1GKEA 2YAPA 4MB1A 1CGUA 3CJJA 4R7DA 4BIKA 5E2TH 1CL7H 4PGZA 2HX7A 4W68A 4Y4HC 4KRPD 2B7DT 4ZFOL 4GG6B 2AHIA 4IBWA 2CRYA 3CVIL 1SJHB 4WFHD 5IHUL 3IAPA 4Q2ZB 3G6AA 5EZJA 1EK3A 1QSVA 2RMNA 5HI3C 3PCYA 3HZMB 3BZ4A 4U1HA 3SDCD 4H8QA 3D2UD 1RZFL 1TENA 2V33A 1B88A 1BIIA 1MFCL 3VTMA 3ULVE 3IJHA 2VITB 4IOFD 5D1QD 1KIUB 5I1IH 4UZGA 1AJ7H 4JHBA 5SWQA 3N04A 1QSEE 3T1FA 5GRYA 4KKLC 3H42H 1SJXA 4CSZA 4S1RH 4Z9KB 2VIRB 1S7UA 4FN0A 1TT6A 3GM8A 5DJ0B 3RX8A 1A1OB 1UA6L 1QUNA 4NKIL 3IKCB 3VW3L 3NN8B 1TPXB 4G42B 5I1EH 3A4AA 1WFTA 5C0DB 3E6FA 5D2LF 4DP7X 4PP1C 4NM4H 1ROCA 1AD9A 5IOPB 1NOFA 1P4IH 1Y7VA 1P7KA 4N2NA 2ZSWB 1SN5A 4MZRA 3QFJA 3GRGA 4JY5L 1JGEB 4MA8L 4NENB 4QHLB 4OZGE 3CN4A 5EO0A 2MOGA 4MD5B 2AGJL 1SUHA 4FRWA 5I0WA 2GIMA 5ALCL 3BZDA 5CIPH 1BBJB 1G7JA 1JZHA 4OFIA 3QDGD 1JZ2A 5DEFA 4C59B 1CLZL 4A2FA 1HH6A 2YFNA 1A7NH 3PPSA 2CPCA 3KLLA 1JTOA 2VXUH 4LVNC 3D2TA 4KI5D 1HK6A 5DWPA 2D31A 4PJXB 3T0WA 1VADA 2NY1B 3QIUB 2OTWB 5DDHB 4LL9A 5IB1B 5DI8B 4G5AA 2PPAA 2I26N 2WIIB 4E9XA 1NCTA 4HJTA 4G82A 3LNEA 2DQUH 1QBMH 4OFPA 5CLZA 3BMWA 3FT4B 4JL2A 1MAML 2FIRT 3DPBA 4NCC2 1JHTB 1X9QA 2XWDA 4LEXH 3U2JA 4OZHB 1RCYA 3S36H 3CDGB 2HVKB 4HHGA 4L1DA 1VFOA 1RUMH 5DO2D 3GI9L 5LG6A 1TQCC 1CD8A 2D7PA 2L0DA 3IKKA 1VRSA 4H5SB 5ICUA 4CW1A 4FHBD 5JIKA 3CFTA 1FRGL 2E9BA 1QLFA 4ZBJA 2XN2A 4QTFA 1U36A 2Y5TA 4M93C 1SXSA 4TQPA 1UT1A 1TZGH 5IT2L 4O4YL 5E08L 2YMXH 1TR7A 1AQ8A 5E94A 1FNGB 5FK9B 1J12A 1N0LA 2ARWA 3QORD 4KJYB 4PRID 1KELL 2AEOA 3GF8A 5I2IA 1A66A 5JPMC 5MERB 4F8NA 4NN6C 3ZE1B 3RX5A 4AW4A 1AI1H 1KJ2H 1ANUA 2H1PL 4PS3A 3VXQB 3PQYA 3B9KB 3RVVC 1KACB 4YDLC 3MLXL 4OTXH 1OSPL 3QCVL 2FYYB 1A3LL 1NANI 5E8DH 5EC1A 1O7DC 4PG2C 4MQXD 5E99L 3SDXF 2WXRA 1HL4A 1TJHH 1HWHB 3T1WA 2F19H 4FYSA 2AV7B 5ITBH 1OD7A 3BGFB 5DJDA 1J0KA 2YWYA 1VFBB 4WHYG 2CWRA 5PAZA 3KLKA 4O2EA 2FBJL 4JO5A 2CHDA 4JO3H 4LPUA 2GSGB 3HN3A 5TFSH 1UWEL 2OL3H 4FQCL 4ODHL 5L4FA 3VI3B 4NKDB 1NBVH 2FHCA 2O61A 5DHDA 4WJ5A 3V4PH 5HDOA 2HG5A 4XC1H 3C5SB 5J1SC 5B4MD 5C0ND 3F7VA 4UT9A 4U1GC 1T6WA 2IOIA 1FC2D 1A6ZB 3EIFA 4XC3H 1TOXA 2GJ6D 4Y5VC 5GJTH 4HZLA 4NZ8A 4BQ8A 4FFZH 2JKSA 3V6BR 1JNNL 4KXCA 3ZN6A 1KCKA 4P9HH 5I1CH 1XT5A 5IVOA 1RK0B 4B60A 1JK9B 4EI5D 4PJEE 3AB0C 4FHKA 4OCWH 1HI6B 3GRBA 3KLAA 4M8RA 3FU5A 4YZFF 3NTCL 1E2ZA 5I71C 1NBYB 1B0GA 2R29L 1IU1A 1F4YL 4LHUA 3MJ8B 5DGRA 3GBEA 3O9WB 2MOQA 1I3VA 3C8KB 5F1NB 4F37F 3TFKD 3CN3A 2X38A 1EZLA 1NLBH 2DM3A 4JREC 1M7XA 5C07A 4YDJA 5TJWK 7CGTA 4K8RC 5BV7L 5C08E 4A68A 1W91A 2F8VA 4KX7A 5I24A 1AR1D 4PJ6A 4GEIA 3TL5A 4ZRGA 1H5BC 4QY8A 5EN3A 3EJYC 3SDAD 3OZ9L 1PY4A 5I26A 4AQAA 3EUUA 3NA9L 1U41A 2OR9L 3TU6A 1RIHH 1HN1A 3RTQB 3HI5L 4HWZA 4MQSB 2BHFA 3WJLA 4WI2A 4C4KO 2DQIL 2XZAL 3Q0HA 1T04A 4GW1B 3PL6A 1K72A 5I15L 1CN4A 3J27A 2VW6A 2OXGB 1MQKL 1MUJA 3U1QA 1E4XH 3ZE2F 3BWAA 4G6ML 1C5DB 2AK1L 4YEFA 3NEOA 1FFPB 4PWKA 3CHSA 4GAJH 1DJYA 4KPHL 5AZUA 5DJ6B 1ZPUA 1A6UH 3EFDH 1X44A 1IC4L 1DFBL 1E5BA 1T20A 3GSOA 3RGVC 4H44C 4DF9A 5A16B 2PWDA 2HB0A 2HFGL 2WGNB 1XF1A 3FO9B 5F7DA 1AOZA 3TYFB 3R4DA 1ZTMA 4TNWK 1YJDH 3ZRFC 5D7JB 5DF0A 3VWJB 1GSKA 4XBMA 2V9TA 4D9RE 4UU9A 4CSPA 1WGVA 5DTFB 4MJ5A 5EZPA 2NSXA 1UVQA 3MLRL 4YC2C 4M62L 2HFEB 4HSCX 5D7IA 2H1XA 3NJXA 3SY0B 4F2EA 1C16A 1N7MH 2ICES 3IDYC 2CA3A 2I60L 2ZUSA 4NZDA 4W81A 2ED9A 5IHZA 5IJVA 4TLKA 5EN2B 4P5KA 4OQ1A 5HI4D 5L2JA 2LE9A 1FO0L 4YHKH 3WFCH 3KBEA 3N6YA 2A0LD 4GMTL 4QT5B 3TVMB 4A2EA 3O2WH 3LQAC 2P43B 1R33A 1GPOL 5TF1H 5MEPA 4XNZC 2NUPA 1C8QA 1YEJH 3VFRA 1CUOA 4I77L 1RV6X 4DK3A 4GSUA 4PG9A 3OPZH 5ICYA 4Z78B 1MFEH 3WTTA 5K1JA 3V8CA 1MCPH 4Z18A 4OJAA 5HHXL 4JFEB 2EUVA 2IGFL 3SBWA 2NXYC 2DI8A 3D4YA 1PL3A 1I9JL 1SBBA 2C9SA 3BQVA 1WWCA 2YXFA 5KVFH 4Y19A 1BPLB 4OCYL 1CDHA 4YDKH 2NX5A 4L4TB 4OLYL 3V0JA 5ISZB 5KVGL 1E3XA 4PRDB 4PUBL 3PHQA 2J8UF 4WEUD 1UENA 3QISA 4NQVA 3QA3B 2MQCA 4NO2A 1TEGA 2QPFA 1XSJA 3PABB 2D3VA 3LH8A 4FI7A 3CXDH 4FQHA 4QRQB 2N4IA 2ED7A 3BHBA 5GGQH 4QRRB 2AVFA 3M7FB 4K73A 3IDNA 3DX7B 1U8MA 4W70A 4XHJD 5JW4Q 3V9FA 3DV6B 1XGPA 1H3PH 4Y89A 5GSRA 3K6NA 3NIFB 2FGZA 4YDVA 3CX2A 2GB2A 4M7KH 3PHOB 2AEWA 2LFGA 3ETBJ 3KWWB 3DX0A 4ZX4A 4UOQA 3GB7A 2N0KA 4M48H 5DEZA 1CFQB 4K55A 5ITFB 4JY6A 2DZEA 2XPGA 4N2GA 1IFRA 4LAJH 3KS0H 3T2NL 3LNIA 3B2UC 4HXAH 1WDAA 4GXUM 4BD4A 3L6FB 1JGDA 3UG5A 4ERSL 3W0WD 1JS4A 5IJDC 1T0OA 4NC1E 1H0DA 1KPRB 1UH4A 2O6CA 3SE3C 1EZSA 1TVHA 4MDRA 5T33H 2HLAA 2OM5A 2YGOA 3GXMA 5E5MB 1DBMH 1BZ7B 4BK5C 1RZ8B 2WKOF 4JQIL 3U7YH 1ACXA 1YCSA 1AGEB 1PKOA 2IANB 4DFHA 2EXWC 3F2LA 2XXMB 3LXAA 4DVBB 3HZKA 4ANXA 4QYOA 3IDGB 4WUUB 2UXVA 5DHMC 1ETZB 1TIUA 4DIXA 4OD3L 3FT3A 2EYTA 2ZUQB 3RL1B 3MJ9L 4PJ9D 1JFQL 2IAMA 2QADD 3OC5A 3OKMA 1TLMA 1IAKA 4B95C 3G5ZB 5CR1A 2X7LB 4XCEB 1WGOA 4FNLH 3V7AG 3D9AL 5FKAA 1FP5A 3G5WA 2DQTL 3LEXB 2KL6A 4ODSH 4I87A 4N87A 1LWJA 4F9PC 2WBJA 4J6RL 4HF5L 3R18A 3SOBL 1M71B 3ZDZB 2YKLL 2WJ7A 4N0UE 4AL8H 3KZ8A 1DE4B 3TJPA 5JNYA 1DEDA 2XXFA 2HSIA 2PETA 3NFNB 1ETB1 2FSDA 5J7CC 3CPUA 3SKOA 1S7SB 3FQWA 1MFUA 4NCDA 1OQXA 2ZSVA 3FBKA 1UA7A 4K7FB 3U9UA 2D7MA 3KDMB 1CL7I 3GZQA 3GSRB 1SEBB 3DETC 2WYHA 2GPZA 3F84A 4DGUA 3BUIA 1MCSA 4JFFB 1S9VB 1KPUA 1X4XA 1NBZB 3GI8H 4XMVA 5GRJL 1F86A 1JGVL 2XFGB 3ML9A 5F70A 3LEVH 4ATTA 1M1SA 4WAFA 3RAJH 4PBXA 5C0BB 4ZFZA 5KSUA 2Q76B 3IMRA 5DD5L 2AP2A 2F2HA 1FNSL 3KVPA 5JDSA 4P23A 4AVJA 4OJYA 3MOAL 3H6AA 1ZA3A 2ICWI 4GQRA 3FW6A 4RGOH 3T3MF 5GSVA 3MLSL 1XIWA 4M5ZH 5IBTH 2DV6A 3S8FB 3FU7A 1CK0H 2ZKHH 4LLVB 4QRPB 5T1LD 2EKSA 2XHNA 4ZNEE 4KNUA 4NQED 3N50A 1P7QA 1Q1JL 3F7YB 3R19A 2VXTL 3P40A 3VFMA 1U91A 4HKZA 3LNFA 2H1LM 1NEZB 5JOFB 2HVBA 3UTTA 1YEFH 2G3MA 1QI4A 1Y6KR 1UXSB 1YG9A 4CC1A 4ZD3H 5KJRL 1A6PA 2WLLB 3DSFL 4GXVH 3E8UH 3VQ2C 4FL4B 1YNLL 4AM0Q 4KKNA 4E9YA 2EUWA 2XWJA 3RP1A 4DPCX 3RZCD 1IL1A 1P5VA 1MVUA 3QNXA 3MV9D 4XVSL 1PVHA 1E3ZA 2BY1A 5HHOB 2WVVB 3CZJA 3ARGA 1HQRB 1U8NB 2MHAB 3APDA 5J5EA 2BP8B 2H8PA 4POZC 2Z7YA 3OAZK 1KIQB 2BMKB 2XFXB 3QZMA 4EVNA 5FGBA 2YMTA 1JL8A 3I6GA 3U46B 1OAQL 3LN4A 3MOBL 4P59H 5IROA 4A38A 4L0PB 3NZHL 4JUSA 4C56B 4YHYB 1VGKB 3UEZA 4X0KA 3UGXA 4JDVA 3ARFB 5SWZB 3EH1A 1LP9B 3OR7A 5AVQB 2G60H 1UZGA 4KKRA 3TBYA 5B22A 3FT2A 5EMYA 4PJCE 5L2KA 2FEEI 4N20A 4ABQA 3OHXC 1FSKC 4D0CA 2WAHA 3ZE0F 3MROB 2D9CA 4O58H 4IRSA 3VA2C 3LKSA 5B21A 1XF2B 2W81C 3B83A 1FH2A 2JFCA 1MWOA 3HRZC 3BIAX 4GQPH 2APFA 2DDQH 4QRSA 4N8PA 3WHXA 2DI9A 4TVPH 4Z0BH 2XQBH 4M7LL 4FAAB 5IJKA 5DC2A 1RK1B 3K74B 1JCKA 3C09B 4L5FH 1ERNA 3H9YA 2XV2A 3HCVA 2GQHA 4LXFA 3L3GB 1BJMA 1YY9C 3RFZC 2JNZA 3BP4A 4I0PC 3COOA 3TEYA 4IU2A 2VDNB 1XTMA 3D1MC 2XN9D 5KYXA 5HHMD 1KPVB 1OAKH 1JN6B 4ZQKA 4A2DA 4GKSB 5C0CE 5K9JL 5KTEL 4MNQA 5FYKE 2E27L 3H4HA 4L4JA 2OV0A 4NQSA 1E27A 2GBTA 1TYJA 5I66A 1BREA 5GGUA 5GHWH 2AK4E 5T1DL 3APCA 1D5ZB 3UTSD 4YSTA 4AENA 5A6LA 4HIHA 3W2DL 4ETQB 3NSCA 4LP4A 5D9SA 1ZANH 4PJDA 5JXEA 4RETB 1OTTC 5FOBA 3VXRA 3AS1A 2V2XA 4NRXA 4G80A 3TCLA 4YE4L 3CHXA 3HUJA 1O75A 3C5ZA 2ZOLA 5B3JE 2XJKA 4NUQA 3MV8B 5E9DE 1EEZB 3A22A 1QSZA 1Q9LA 3T2PA 1T7YA 1J1XL 4KDWA 1NL0H 1DQKA 2LU5A 3ZYZA 1NAKL 4GFXA 1OV8A 3FXIC 3ZHFA 5T1MB 4AVHA 4YSRA 1E4WH 4HUXB 4O9HH 5EOCH 1QA9A 3D08A 4F8OA 4S0TD 3TN0D 3FRUA 3VFUA 4V2BA 2FECL 3HPLB 5JZ7D 3O6FB 3KLHD 2B4CC 4JN2B 2NY5C 2A38A 2O72A 4PJGA 4QRUA 3DX9A 4KJWC 3S6CA 3MA7B 1G6RL 4F2ME 4QKXB 4Z7QF 5I1HH 4E68A 3JUYA 1RZKH 4TRPL 3CUPB 4APQD 3EYOB 4I4WA 4AQ1C 2C4FT 2P24A 5BVPL 5J0BA 5LQBH 1JTTA 5AKTA 1QSFA 3LXUX 5F6IC 3U4EA 3WN6A 1FBIH 5C97A 2OMXB 2VN7A 3BSZL 4OZIE 4AI7A 1GY2A 3NQIA 2EH8H 9PCYA 3L2LA 4DO5A 1E4XI 1VJSA 4F7EA 4S10A 2E8ZA 5FYLH 2GTWA 3QEGL 4K94H 1WVZA 3H9SB 1C1EL 5E5LA 3FCTA 1KCBA 4OZ4B 2CUHA 3LPWA 2VW4A 4UM9B 4TV3A 2A99A 1TFPA 4Y5YC 1TQWA 1CGWA 4O02L 4ZX6A 1HIMH 1ZVHA 2EDTA 2VLJE 3BFOA 4JR9H 3W11D 5J6GB 5CZVL 2GG1A 2TRHA 2ZYSA 3B5GA 2ZAIA 1BWWA 4LCWD 4OGAC 5L7XH 1J9SA 3AT8A 1IVLA 4HUCA 1FL6A 3PWLB 4QXTB 3QUZA 2CIIA 2D3NA 1ES0B 4G43A 5E4EC 2GVYA 1F0LA 2H32A 3TXAA 3ZHKA 2BHYA 2YSSA 3CC5A 4ODVH 2VLKE 1YQVL 5HBBA 4BGDA 3CSYA 4F1SA 4NKOA 2EICA 4NJ9L 2RB8A 3HNVL 2K3TA 5TF0A 5HYJA 4S0HA 3FQ2A 1E5ZA 3NIGF 4EDXA 5TE4L 4ZAKD 3FHAA 5ABDE 2J8HA 2OZ4H 2F1AA 3MGOA 3MGTA 1XR9A 1WBYA 3EGXA 3G5VB 4YHPA 1BQLL 1O9VA 3KE0A 3RHWK 3GLDA 4WI9A 4YSEA 1EZUA 3FTWA 2CHNA 4MDJA 2P5EA 3MRDB 2WW8A 4M6OL 4HVBA 3VFTB 1R1CA 5KAQF 2VC2L 3MRNA 3VB8A 5CD3B 3ME0B 2B2XL 4J6IA 1IKFH 2PTTA 4GBXC 1QW9A 3GJFA 1BD2A 2YBRA 1M3IA 2CIKB 3M8OH 5BMFL 4R4BA 3V0DA 5HYQB 2BIOA 2J88H 3PWNB 4KAQH 4XWGH 1BZDA 5B1CA 1HU8A 2VJ0A 2YXWA 4PVBA 4KKCD 3REWA 4WHTB 1W2KT 4ZW5A 4L9DA 1IZKA 1QZ1A 1YMMD 1FLTX 4OLVH 5TH2A 3UCQA 4QLWA 5DMYA 4HG4J 4P2OB 3V0WH 3GYRA 3MN8A 4WFGE 3WE6A 4HH9B 4JZOB 2X28A 2R2EB 4ZX5A 4NIKB 4QD2E 4KBPA 5K9OB 3WMQA 1EEUA 4DUWA 3RIAF 5ADPH 2PPDA 3RILA 4WUKL 1QSEA 2FB4H 2C1PB 4ZO7A 4QXGH 5K59F 4ZNCD 1CD0A 2C9AA 3QYCA 4HWEH 5ERWA 1T3FA 1X4ZA 1K6QH 5I6XB 1EJ6A 4G7YH 3WXWH 2ZUXA 3MDJA 2EIJB 3KGRA 4EZKA 1J8KA 5DJ2B 4MXVE 3B7TA 5BRZD 2WQRA 4XO8A 5LN4A 3PJLA 4X5LA 3WNPA 4FQXC 5E2VL 4U1MB 2QPUA 2YPKA 43C9B 3D4ZA 4H20H 5IMLB 1UZ6F 1BQHA 2P7TB 3HC0A 4BCXA 5KG9A 1SXNA 5JHMA 2B59B 3NMEA 3IXAB 4OZGA 3LS5H 5LAXA 2R0ZL 2O1AA 2VDQL 2PWEA 4HJIA 4GSQA 3HS0A 4U4BA 3RWGA 4B9IA 1JZIA 3NJHA 1I8KA 5IQMA 2EC9T 5J6HB 3TO4C 3T3PE 2HJFA 2WTRB 4X6CE 5PCYA 5LWYH 3HG4A 1CFMA 4HS6A 4N28A 4Y1AD 3VGDA 3UOAB 3LDBC 2WZ5A 4UQCA 1A4BA 1BZ9A 4KXDA 4RA3A 1K2DB 3IPFA 4JM2D 1N2RA 2JCCF 2ENSA 3I74A 5T5FH 1R0AH 1LDSA 2UX6A 2ZE0A 4PRBB 4OUUA 4AGOA 1FVDB 5C8JB 4NUJA 3E2HC 1MHCB 1R6VA 1DJXA 4P99A 5D7IF 1OM3H 4AJYV 4KTDL 4PY8I 5TE6L 2PW2A 1T7XA 2IEPA 5CHNB 2MKLC 3M86A 4S1DD 5I0VA 4JY4A 4QJ3B 3JWNC 4MJ6A 2JKNA 4X7TA 4N2DA 5F1SA 3L5XH 4WJG3 4DUXA 3CXHK 3Q9QA 3IGAB 2BW5A 3MLUH 3LD8B 1SBSH 3O4OB 1T2QH 3D39E 5SX5K 3S88L 3QHFL 3FRPG 3TIEB 1XR8A 1WZ1H 4JG5A 3V0EA 4U1JA 1QRNA 1F8TH 3QI9B 5JQIB 1YEDA 2DYRB 2UY6A 1EAQA 3SQOH 3OL2A 2WWKO 1FI8C 5AB9A 1F4WH 3HVDA 4TOYL 4MJ2A 3LKPA 3O3DA 4L4VD 4GUQA 1AZRA 1OHQA 3MRGA 3V6OE 1MDAA 1YYML 1J0YA 4P5MB 4KQ0A 3UDWA 3VXUE 4AM0A 5LKNA 3CLFH 4XAKE 2K7PA 3TA3C 4G9FE 4TSBL 4JPKH 2CLZB 3V5KB 5DHXB 5CFHA 5JHDB 1NGYA 3KPRA 3BC9A 2QVFB 4UQDA 1QNZL 3DO7A 1C08B 4GP4B 4AE1A 5EUOE 1Z9SA 3IK2A 5BW7A 3LB6C 1DBJH 2E56A 5CO1A 3ETTA 3ZW3A 3EO0A 3LKOB 3WFHA 3KPQA 4R7VA 3PPEA 1CICB 4P46B 3VXUA 3WJJA 1ZHLA 2BNUA 3O2VL 4YBLC 5KYUA 5L4JA 4WNJA 3FU6A 4A2MA 1VACB 4LSPH 1GYAA 1CJYA 4RBPH 2C9QA 4H8UA 4I3RL 2CBMA 4JUTA 2EE0A 2P5WD 3AC0A 3HI1B 2GTQA 3VH8A 3ZBMA 4AYFB 3MSPA 5J9PB 5D55A 5DR5L 1RU9L 2E75C 3SDDB 1X5AA 5TQ2H 1XQ4A 2AJZB 1HZLA 1TDQA 3IETB 1DO5A 4ALAH 1G0XA 2NY0C 5E2UH 3MRCA 2MCG1 4FQIL 1S9XA 1X9UA 1EHKB 4DERA 1F3RB 3LIUA 1NLDL 3FSVA 3KBHE 2F8XC 3VXSA 3BH8A 3B3BA 5E4AA 5A2IH 3GHEH 5SV3A 3U1SL 2ENJA 5I6NA 4LHJB 3JBG7 3SE8H 4LK4A 3S37H 2K78A 2D7TL 4QOKB 1FH5H 5KUMA 4DO6A 2V7HA 2BSSA 2VABA 4MMZB 4NFDA 3T5WA 1UCTA 1NGQH 2G9HB 5DHYB 2XWBB 4PRNA 5CEXA 3CSFA 2YD0A 2FZ3B 4NZJA 2KDGA 3WIHH 3PWVB 4HPYL 3BSGA 3GHBL 4JFQA 4HX1A 4O2FB 2CBOA 4NP9A 4YJZL 1BQ5A 2QTEA 4MD0B 3UO1L 1WFJA 2QSCH 4YBHA 2YGVA 1AKPA 1JGLH 4TSAL 4HC1L 3O81A 5E8PA 2VLRA 3OKKB 1IUZA 1BXAA 3DIFA 3CGTA 1JWMA 3BH4A 2H2SD 1K5NA 2ZPKL 4OFQA 4XMKH 4ZMOA 4LOFA 3FO1A 3FQYA 3NFPA 2V17L 2FD6H 3VRIA 1P5UA 3LXCA 3X3GH 1CBVH 2YLHA 2H6PA 3ARED 5T3XH 4OIIL 5E6IB 1U9KA 2GIYA 2OMUA 3GMRB 4LKCB 4KZ0A 4QHUB 2BSBA 2HJLB 3S34H 1UZ8A 5KZCB 1L6PA 1PG7L 1F58L 3P0VH 4L48A 2OSYA 1Q9WA 4YX2H 2E4TA 3P9WB 3E9UA 2WVSA 3W5MA 4MJIE 1I7TB 1GIGH 1G9ML 3NZUA 3IJSA 3CNKA 3BT0A 3L3OA 1CF8L 3BUTA 5C0AA 4MBRA 4X5QA 4LSRH 4ZOEA 5HPOA 4G8GB 4ZO6A 2PNDA 5F9AC 4BH7A 3QPXL 1NC4A 1T80A 2XWCA 1A14H 3WELA 5JOEA 1T03L 2XC8A 3BRGC 4YGVA 1D6EA 4LO9A 4A7UA 4WFHE 3WNOA 5HGHB 3Q8AA 4WK2B 2Y07L 2EP6A 3U0WL 2AQ3A 5DEGB 3V95A 1P1VA 4AQOA 1LO4L 4MCZB 3ORJA 3WXVL 4LU5H 3QUYB 4RRPA 2N59A 1YSOA 4R0LC 5D1QE 3WN5A 4H26B 1BVNP 1LE5A 3GSNL 5C0JB 5EU4B 1KCVL 3B2XA 3EYVA 2CM6A 5KAQG 3FCUB 3D0LA 5JMOC 2FO8A 4M1CD 4I2XA 4PCTA 3L5WB 2F53A 5BPPA 1TTCA 2A9DA 3GKWH 2HVJA 5D4QA 1AKJB 2EDOA 1GZPA 2IDSA 3FFCE 4XNYH 4DFIA 1J5HA 3MV7B 3X1BA 1A6VH 5KVGE 4R96A 4PD4J 2AXHA 3LN9A 2H32H 4KDTA 4LHUG 2HMIC 4P5TB 4UV7L 1ND0B 1I9RL 1J8HD 5CLYA 1N18A 3J8F7 1KLUB 3B3IA 4Y4KA 3VYOA 1R5WB 4DTGL 2MOVA 1T0PB 4FXLA 4LLUB 2NTSP 1WFNA 2DW5A 2Q9OA 4ZSOA 1KDJA 4I5BB 3QPQD 2WQUA 4G3YL 4R2GC 4D0DA 1T5WB 2G5UA 1F02I 3QEUA 4KHXL 3QDGE 4HWUA 1KTLB 1XGQA 4JO8A 2ARJB 4RGNC 3BPOC 4CKQA 1X7QB 2G2RA 1T2XA 4ENEC 3AG1B 3EFOA 4I9WD 4NJAL 4LRNL 3A6OA 2DM7A 1WZKA 4KI5E 1KCLA 4HOZA 4WZ9A 1IC7L 4GUPB 2PO6A 1II4E 2Y36L 3WEXA 3M1BA 1ADQL 2QGDA 4I85A 3DTUB 1KYOJ 2UXFA 4HSAC 4L8CB 4AYMC 3T0EC 4Z7AA 5CEZL 3QQ4B 1HNGA 1TJIL 1UHVA 4AE0A 3VFNA 4KFMA 5KBMA 4JPVH 4HFUL 1G7HB 2WQ8A 1F6AA 2DKUA 3HFML 2YMOA 5AAWA 3JVGC 1IKNC 4X80H 5IEKB 1ZIBA 3LKNB 3FUFA 3U6RB 5I0YA 2QEJA 4XP9L 2C9PA 5I8EB 1CYGA 1ZLDA 1ORQB 3GJEB 4N8VB 3VXTA 3NAAH 4YMPA 1B4JH 1LQBC 3HS8A 4RIRB 4PRIE 3LHPH 5CEYB 5GS2H 4CMHC 1MPAH 1SOSA 2IOMA 3EJZC 3S3CB 3Q01A 1YAZA 1QVOB 4HUVB 2Z9TA 4LRIC 3NSYA 1XCQB 1A6AA 3LPPA 1WG3A 4TULL 4I3SL 4QHNB 1OGSA 4KXAA 1PY0A 1SVCP 1JZ5A 1KTDB 1LK3L 2XT1B 4LBAA 1A3RL 1N8ZA 5B1JA 1BOYA 2GITB 3MVSA 5EBLA 3PWPD 4PCSA 3UZQB 4FP8L 5HHVH 4I1PA 3VO0A 3OD3A 2QFPA 2X40A 3BD4A 3FQRA 4XBPB 2XSKA 4OI9A 4A7TA 2W5PA 4Q4IA 5L88H 4PJDF 1CU4L 1LGVA 4FABH 4RFOL 3MKGA 1ACCA 3VD7A 1ZV5A 4PVLA 3UJIL 1K3ZA 2NOYA 1QTYT 2WZ6A 2BC4B 3HUJF 3ULUC 3S35H 3DYPA 3EOAB 3DECA 3PP4L 1WA2X 1DLHA 3UPCA 4PS8A 4LCWB 4RMTA 4LB8A 4XMPH 4W9KC 1R5IB 4ZODA 4ZTOH 4GXUN 2FGWL 3R7QA 1CDJA 3DO4A 4MWFB 4YFDB 2P8PB 1KJMB 1M42A 4X7SL 5EU6B 2WIMA 4G9DA 4L9LB 4AT6B 5A7BA 3SKUD 1H6UA 1W72H 3ES6B 1N68A 2AJVL 4PJGF 1JP5A 3CSTA 5JPNB 1S7VA 4LL1A 1HHGA 1AS6A 4LFHG 5BQ7B 3RNQB 1NFDB 2PXYB 5EORL 4NWTL 5IM7A 2Z91A 3OJ2C 4HBQA 5HY9A 3WNKA 1J7VR 1VHPA 1YY8A 3KPSB 1JIBA 3AU0A 1Q0XH 3LQZA 3HJ0A 5ES4B 3NPSC 3UGUA 3O41B 5GISH 3T2LA 1V27A 2Q2EB 4ONHB 5DLLA 5I1KH 2NCEA 1NUDA 1OP5H 1IAIH 3OKLA 1DUYB 3K4ZA 5D2NC 3V5HB 2VR7A 5ESVA 3W37A 4BXVA 3KCPB 5EZLA 1KN4L 2FIKB 4K9EH 2R27A 4B9CA 1IE4A 3LJ3A 1JPSH 5CP3H 5I0DA 2YPVA 3U6XS 5D1ZC 4UM8A 3ILQD 4B9KC 3CHOA 2GIXA 2G3XA 1Z3RA 2JI3A 2CDFB 4MMYA 1WD9A 3NCJH 7FABH 5C0RL 4EF3A 2WWMD 4G6FB 4U1IB 5EF2A 3WTYA 4MLSA 2MTPA 2HFFB 4ZOAA 2ZG3A 4HUUB 2NY2C 2AEQL 3UIYA 2J20A 3LNHA 3RVTD 4KMQA 2JB6A 5DJXB 1XF5A 3SCMB 2UUDH 4B9ZA 4F9LA 1JYWA 2R1XB 5IB3B 2NY1C 1JPTH 3HC3L 3QIUC 4XP1H 2BS8A 2NYYD 2RH0A 4Y2DB 2EIEA 2OX5A 4LCIH 5KOMC 1PZDA 5CBEA 5D7LA 4CN4A 1QFUL 3FB5B 4QGTA 3NPZB 2OZNA 2Y7SA 3AXLB 3BVVA 1DQIA 1LEGB 4NP4L 2NW3A 5IVXB 4R90H 3WKPA 5ILTH 2EEFA 4JRXD 3VYPA 3H55A 1YEGH 3RDTC 1LMKA 4Q6IC 3RWCA 2RD0A 1XB8A 3FUHA 1OPGH 2H9GA 2X88A 3VG9B 5DWUH 4WDIA 3RUGA 3Q6GH 2VDLB 3KXFE 3FHEA 4UQ3A 3IF1A 2NZIA 2Y1AA 3BQUB 4W9GC 3KVDD 5C3LD 3IBOA 1KB5L 1AZZC 5HVWA 4Y0GA 3QUXB 3DVIA 2WM0A 1PLAA 2ZOKB 5T1KA 3KWTA 1KEGH 3B7RL 3B9KC 3WD5L 4XN8A 4DZBB 1BBDH 4X5WB 2R0LH 1WT5C 5BS0A 3C6LB 3PJSA 2W9EH 3T77A 4MA7H 4DGIH 2QQNL 1I85C 1JZDC 2IWEA 2Y7QA 3KEDA 1EGJH 5KYYA 1SFDA 1NKGA 3BGFC 3SYCA 5A2KH 1YEIL 1W16A 2X4QB 3B5TA 2O30A 4K3EH 3WIFA 5FB8A 4YO0B 3RWEB 1PX4A 2BVYA 2IPKA 1DVFC 3QVAA 2AK4A 4Q9QH 5I1AB 3MZTA 3CDZB 2EIZA 4NQDA 2P47B 4MKMA 1QLRA 3VXMD 2CH8A 3ZLQC 1PZAA 5BXFA 3HA0A 3OSKA 2DWSA 4BYHA 1ZVYA 4CN6A 4E41A 3PGFL 4GAYA 4JKLA 5E9DA 1XSOA 3KPOA 1HDMA 4OCXL 4E9QA 2XYBA 4BINA 2BRQA 3QUML 1I8IA 1XSIA 2GSMB 4XPFL 4OZGF 4PJIE 3G5YB 3DI3B 5CM1A 2QR0B 4OH2A 1QR1B 5D6DC 3U0TB 3CH1A 2OAAA 4Y4HA 3C87A 3MRBB 1YEHL 4PREB 2DWDA 1TTFA 5EO1B 1A7PH 4N5EC 5LBSL 1HWGB 4K3DH 2VZUA 1KIPA 1S78D 5DD6B 4PRHA 5I16B 4JFYA 4BZ2A 4OI7A 2KI6A 5B7EA 1MWAA 3N2JA 4U6YB 1W80A 1RFDL 1VGEH 2QSVA 3GRWA 8PAZA 5GZOA 3AU1B 1O9WA 1INDH 4MNHA 4Y7MA 2P28B 4LOVA 3V0VB 1QPXA 5CNHA 2FL5B 3DBXA 1I8MA 2FX8L 5GGTH 2PYEB 4JDTH 2IG2H 3GMMB 3RTQC 4QF1B 2IXQA 3OMAB 4P4KB 1IGFH 2AXFA 1NDGB 2IQAA 1XV8A 3QG7H 4DN4H 3VRLF 1H9VA 4OBRA 4MA1B 4WSJA 1PZ2A 2QVKA 4P9MH 1FGVL 3N9GH 5EU5A 3ZZSA 3ZKXC 4PRAA 4ADJA 3BFWA 1ET5A 1GHFH 4BZ1L 2FO4A 1HSAA 3O3AA 1KGIA 1UM6H 4WI0B 2FX7L 1WSST 3MFFA 4NRZA 5F1IA 2HTKC 1FL3A 3ALPA 4AOFA 4FZ8L 1RUQH 2OK0H 4L37B 1R3KA 3RVUD 1TKWA 1GGTA 2DWTA 2YK1L 2PYFA 2VLJA 3SIKA 4L1HA 4Q52A 5D7JC 1YPZE 4XX1E 1KBKA 1MH5A 3VWJC 2DS4A 3ABZA 1P4BH 4ELDA 2DRUA 1T1WB 1GGCH 4PGBB 1CE1L 4Y9EA 1GTFA 3D5OF 5DFAA 3RKDC 3CX5J 2WLMA 4K4KA 4WV1B 3HE7C 3HPJA 4P3DA 2AVGA 3RX9A 1U8PB 2VLKA 2ATKA 5K39A 5A2CA 3LRMA 1EEYA 4NNXB 1BECA 4XNAA 2IMMA 4RWYH 4Y4FB 3L3DB 2DQFA 2FTAA 4H88L 2UV3A 5BZWA 5FUZH 1UJ3B 1GOFA 4M5SA 3ESMA 2LLNA 4ADGA 5IVNA 5EEZA 1E6JH 4PJHE 1A7NL 2O5XL 2YD3A 5F71A 5HHNB 1IQWL 4TPRL 3CFCH 2PCPA 4NBXB 4CVWA 4YDMA 2UWEB 1I75A 1NFAA 1TJXA 3A5VA 1IB5A 1PZBA 2CU9A 4OFKA 4S1SH 1ODUA 1RPQA 1UD5A 2WINB 2QV4A 4I18C 1OSEA 2IFFH 5DVPA 5AZ2L 4P4RA 1JNLL 1EHLH 3V5DB 1OCOB 1D3CA 3GDCA 4KKZA 1MCNA 2KQMA 3ROLB 1QQDB 4HS8H 3SGDH 1NIEA 1AZUA 5JPMA 4UDUA 3TT1H 5ENWB 4QXUH 32C2B 2CKBH 1N5AA 3P4OA 1AS8A 2ALAA 4X6DB 3RWHA 5I8OH 1ROWA 1FZMB 3BEVB 2D73A 5KN5B 5E00B 2FSEA 3N1GC 1P9MC 1U33A 2BVQA 4G8IA 1Z3GL 2NY6B 2X89A 5KJ7E 4HJSA 1UTDA 2QQLH 5F3BB 3MUGB 4HSQA 1T6VN 4ICXA 5EOQH 4JHZA 2WWOA 4E0RB 1HINL 4R8WH 4BSVB 2AQTA 5HGDB 4Y9GA 3BPLB 3QFJD 3IDMA 2GCYB 3OXSB 2ADGB 3VD1A 1AY1L 1PEWA 2WNWA 4PJ8B 4LNVA 1IBGH 4IRJB 4TUOB 5G4NA 2GHZA 4Y5VA 3RWJA 2IVFC 4KOCA 4WTXA 5C0EA 1ONQB 5E8DL 5IGXL 1YC7A 1M7DA 4WY7L 4E9SA 2IADA 4MJJA 2EVGA 1I4FB 1A7RH 1J9QA 2VDPL 4ZJ9A 3N1PC 3JWOC 5I73B 4XNDA 3KL3A 1XGTB 1BAFH 2E0PA 4I48A 3LV3B 4HIXH 1EBAA 1KV7A 3ZIYA 3MNZB 2BLFA 2OL3L 4MRCA 4P3WA 3ZDXE 4EUPH 3RIAK 1B0RB 3ZZ1A 4NWUL 3DX8B 1FPTL 5HDRA 5SWSA 2C9XA 3OX8A 2EECA 2W80C 4LLMA 5ID1B 5IMKB 4MNGB 1LEKA 2C1OB 3EF4A 5INDA 2MH4A 3PAZA 3D06A 3L1GA 4D0BA 2ZUQC 3QUKA 4QHKI 4CMMA 1TZIA 1PLGH 1RUAH 2RA1A 3B56A 1DVYA 3OGCA 4NQCE 3MRRB 1HE7A 1I1AB 4JHWL 3BWUC 2BSRA 1A47A 1OALA 2QQQA 4K3HA 2XN9E 3DOIA 4DUVA 5HHME 4FERA 3CZEA 3FTSA 3PNRB 1KBVA 3WBDA 1L7TH 2P48B 1S7TA 1A6WL 2ITDB 1FVEA 4KJPC 1IQDA 4ZPTB 1U8QB 4ZMPA 3QQDA 4KVPA 4G71B 4M6MH 4IHOB 4JKPL 5K1NA 5CD5C 4UV4L 4H0LC 4PHXA 3UTSE 4X4KA 3PQYD 1FNFA 1XL4A 3JWDL 1D9KB 1FVCB 1E6OH 2QSQA 4DN3H 3QNZA 2F58L 2OMTB 1YECH 2D03L 2NZ9D 5DYOA 2DPKA 3CFMA 1G5GA 1PG7X 4MBOA 2XQYK 1DBAH 2QHRH 4D3CH 5E6UB 3STLA 3V6OA 4YHNB 5TGBB 4W4OA 5B7MA 3GDBA 3U79A 3ZE2B 2DQGH 2VDMH 2KC0A 1NPJA 4PIRF 1S6NA 2RCSL 3SYPA 3B2VL 5E6ZA 5F89A 1A7OH 4FTVE 3SYAA 4FNTA 3KJ6L 2YPLB 1FGNH 3AG4B 2VDNL 4ZFGH 1A4JA 4H8WL 5DD3H 4ZXBB 5IF0B 3D4CA 1BVKA 2AEIT 1IAII 4OGXH 1GGYA 3O3EB 2EYRA 1MLBA 5FX3A 4BWTA 5EZOL 2KZ1B 1RJCA 5EIVA 5KVMC 3SE6A 1AGCB 1FNEB 3N1FC 3IPEA 2ADFL 3A6BL 4XNMB 2VMEA 1WTGT 3L3HB 4LHUD 3VXPA 4MGXA 4UMSA 2JWYA 5IKCB 1BQHG 2SEBB 5DHVA 2DH2A 3BWSA 1H3UA 5IK3A 2CJUH 5CIPB 4RQQB 5DXWA 2FH8A 4WTWA 4JJHA 4JDEA 2DJ4A 3O6MH 2BWDA 1G7MB 1SUJA 1RLWA 2DTSA 2XACC 1AH1A 3S97C 1T1ZA 3V9EA 5C07D 3IVKB 3W9DA 3IN0A 1S4IA 3BZFB 2V2TA 4OFDA 5I19H 5F2FA 1NCWH 2VGLM 3O8XB 1Q38A 4JJ5B 4WW2B 1JGUL 1MCCA 2AZUA 4FMVA 4GIOA 1YYLL 4IOFC 3P73A 3P4MA 4J3WA 3RJOA 4ZUUA 4YHKL 2H6OA 5E5UB 5FYKH 4DHLA 3C60B 1T89C 3QJSB 3MREB 2BP0B 2YQGA 4GKZB 1NMBL 2HCZX 3O11B 3RKPA 2NLJB 4Z5RB 4YHYC 3EJCA 3PL6D 2DB8A 1MFEL 3ARFC 4J3TA 3SBRA 3WHE0 5CBAB 4PWEA 5GS1C 4O2CA 4HS3B 3WG7B 3TPKA 1KTKE 5MENB 5I76B 3NABH 2J8UB 4FFVC 3WNIA 2QKIB 3GMQB 2XXGA 1SLXA 4KNSA 4EQ2A 1F42A 3MCKA 4GSDL 1BQUA 1SXCA 1QLEH 2VE6A 4M1DL 1WAEA 4W9EC 4XGZB 2IWKA 5TD4A 5AAPA 2XTJB 4KQ4H 5FB8B 1UURA 1DVZA 2FR4A 1DUZA 4WEBH 4UANA 3WLWD 1FL5B 2OKMA 3KYOB 3IFOB 2W07B 3GTVA 2IPUK 1AZNA 5IR1B 2NW2B 3MU3A 3VU2A 2YRZA 2H3XC 3DX4A 1CXLA 25C8H 2WYTA 3IT8D 5KSAB 4J39A 4NC0B 4XHQA 4BK5A 3ZUNC 4J8QA 2VQ1B 2J72A 4NHCH 4XNBA 5AVSB 2EH7H 3NRQA 3C2AL 5EULV 4GUOA 5E95B 4Z7UB 2OYKA 3KD4A 1BF5A 4POYA 4RESB 4F7KA 1JHKH 4V1DB 3V4PB 5JDJA 1FFOB 1WWAX 3EGSA 3CZUB 2VLLB 1GKOA 4HCIA 4XCNA 2C7UA 1Y18A 5DD1H 3L16A 4HV8A 1CFTA 1YMME 4JDZB 4K07A 4MDIA 4U1SB 5DYFA 5FV2A 1NSNL 2XBZA 2I7OA 4Q6KA 1D5MA 2ZOOA 2YRLA 3GIZH 4IKLA 3VH8G 4HULB 2KLSA 3ARDB 4OD1L 3U4AA 1OSZB 5A7EA 1IAMA 2OR8A 3AG3B 5FYLD 2LW3A 1SFHA 5I9QB 3QORC 5F3HB 3UZEC 4NRYA 4YWGL 4Y19D 5B7FA 2X44D 2X2UA 1M9SA 5HJBA 2NX5D 1TMCB 3JV4B 4XMLL 3OVUB 5FDWA 1VZHA 1UXWB 2CR0A 3GMOB 2I5YL 4OM1H 3FFCA 2J71A 3L3JB 4UZSA 4X5XB 3S7GA 1QI3A 4JO4L 1QATA 1WA1X 4Z1PA 5CAYB 4ZOBA 4F57H 1QACA 4LNRB 4ODSL 1W9XA 5BRZE 3RPIA 1DFXA 3K72A 1UOVA 4MQXC 1IBZA 4HBCH 4R7XA 5I0XA 1JJUA 3O6FC 2A6JB 4GKNB 1OK0A 5KYWA 1IAOB 3AS2A 3L7EA 2VN3A 4GRMA 3D3VB 3MYZA 3TZVB 4BJLA 2VDKH 3OG4B 5FUOL 3RWFB 2GJRA 2Q7NA 5EFIB 1ED3B 3KYAA 5IVZA 4BHUA 4YXHH 1S7WA 5C0NC 1Q94B 4U2YA 3QDGA 4EN2A 4BCYA 1VKXB 4Y1AE 4PM1A 2AQ2A 1IRAY 4P57B 1CDBA 2DYPB 4B53A 5CEZE 5BJTB 1SOQA 3P3RA 3SPIA 1SQMA 3CVIH 5IHUH 1I9IH 5HJ3B 4EI5C 1MIEH 3GI8L 3QPKA 5D93B 1HZHL 1XF3A 4GRWF 1TF4A 5DRZB 2DN7A 4WWKB 4EXPX 2AQRA 2X9YA 4PJCF 1MZZA 4QCIA 1RZFH 4CU7A 1MFCH 5C86A 2R2HA 3RUGF 5GGRA 1RJLA 2CO2A 2BZ7A 2XIIA 4F7PB 1F56A 1F4AA 2MQ0A 1KBBA 3R7RA 4BFNA 4TKWA 3TFKC 4F7CA 2R9HC 4GG8B 4RGOL 4JQIA 5JO5B 5BOJA 1ZA6A 2JTDA 2C3HA 2WZAA 5EUKA 4NO0A 3CLWA 4GSXA 1E8YA 2IAMD 4PJFB 2ZX6A 4L8SB 5KYNA 2IWFA 1AR1C 1UA6H 4N1HB 3D0VA 2YBGA 4NKIH 3NQKA 1JPFB 3VW3H 3F01A 1UD6A 1IJNA 2LR4A 3HS9A 2FT7A 2CUMA 2HT2D 4L3EA 4TXVB 2WBJD 3SDAC 2APWA 4L1BA 3PXLA 3GS7A 4EXKA 1ZVNA 4FXKC 4L4VE 5KW9L 3KR3H 1JWSA 4JY5H 4MA8H 4UQ2A 2XVLA 1YYCA 2JJSC 2AGJH 4RRPG 4KV5F 2EDDA 2ENPA 2ORBL 2WXGA 5ALCH 1ZMYA 3T4YA 4EPSA 2BSTB 4RBPK 2Y22A 5J12B 1CLZH 3EO1A 3HAEH 2Y7LA 4NAQA 3DJTA 1J8RA 4QTHB 5IV2A 3MUY1 2Z4QB 1YUHA 1MW0A 4PWIA 4JFDB 4B3VA 4BXSV 5CF3A 3U2SA 1RZGA 3CCHB 1U3HB 3V0GA 4B7LA 1A4KA 1W0YT 5F96L 4UT9L 3R0MA 4M4RA 5E24E 3FCBA 3VFPA 2YR3A 1NMCB 4GLRH 3SGDI 4U05A 1MAMH 2CO6A 1HHKA 4PWJA 5JIPA 1I7RB 2EC8A 3FAWA 4LPWA 1AQHA 4P23D 1JXGA 1FE8L 2E6PA 4RRPM 3Q3GA 3GI9H 4QRFA 1U0QA 2IDCA 3ZE0B 3TTYA 1XIWD 1JK8A 3OG6B 5KSBA 1EO7A 4QXVA 4MMXB 3QNYA 2V5RA 3RFZA 2XU9A 1FRGH 3KNBA 1V8HA 2IBZY 3CZSA 2ZUVA 4G72B 1P7QD 2N01B 4Z77A 3GUTB 4LEBA 5I74B 1PSKL 2QKSA 5HI4C 3AACA 3O0RL 3ELQA 5DMKB 5IT2H 4O4YH 5ANMB 5E08H 1WK0A 4OZFA 2A0LC 2CUIA 3RB7A 3ZVVA 4HLEA 4DP4X 1A1NB 3UTTD 4YAQA 3ULSB 1TU2A 1KELH 4R7DB 1Q9OB 1SEQL 2G5RA 1U58A 1DDTA 3G6JB 2N56A 1IEBB 5C0IB 3WUWA 3NSXA 1QEWA 5IBLC 3KM2A 3JYCA 4YHIA 1NGXA 2H1PH 2DBJA 3Q43A 4HJ0D 4PJAB 5D2LE 4PRPB 3STZB 4OZIF 2OP4L 3O3UN 4J3BA 3MLXH 3DVFA 1B4LA 1OSPH 2FLRT 3GSVA 3MOQA 3QCVH 4OD2B 5E1HB 1A3LH 4X6FA 3MRFB 1I3GL 5DJCB 3ARGD 2AJUL 5E99H 2I9LA 4ADIA 1NIFA 4WLCA 1EDHA 5EO9B 1MKFA 3FQTB 4AYBA 3SN6N 1QWUA 1UQSB 5GRVK 2FBJH 3CU7A 2I24N 1FNAA 3II3A 1YN7B 5B1AB 4FQCH 3ZKND 3FUJA 4ODHH 3ALWA 5IROD 1AD0A 1P7HL 4WU5A 3FUEA 1EXGA 3ARUA 2NY3D 3TBVB 2GAZB 2K3HA 5EEWA 1PZSA 3PGDA 3MJ7A 1UB6B 1JUFA 4IQHA 4GUCA 5DGQA 1JNNH 2W60A 1X6LA 4CVXA 3G08B 5E0FA 3VFWA 1QOKA 1S7QA 5L2KD 2P26A 4G7VL 4GINA 2X3AA 2MCAA 4IRSD 4IDJL 3X12B 2WXHA 5FGSA 1LWRA 3FO0L 1NL0L 4AQ1A 3ILEA 4H25B 5DHVH 1PFOA 4WNSA 2GUYA 2I07A 2R29H 2Q6WA 3V7AE 4J5VA 1F4YH 1YAIA 3W81A 3CPLB 3IS0X 4HDIA 1ZXKA 2E7MA 3D18A 4G1EA 1TLKA 4GO8A 4PQXA 3LNDA 3U4BL 3O4OC 3DHJA 2Z6FA 2BK8A 3H7BB 3CQFA 3ARBB 3QC5X 1E8WA 5LG1A 3EGDB 2I25N 1XX9C 5BV7H 5D1XB 2DQMA 4WU7A 1NC2A 1AGFB 1T0NB 1FJ1A 5ID0B 2EYSA 5C0GA 1TFHA 2NY4B 2TSAA 3HG1B 4ELKB 3KXFA 1D2PA 3I9GH 4LSVL 2VT0A 3TYGL 4P3CL 1PZ3A 3KLQA 2HX8A 2L04A 4IBYA 4XX5A 3OZ9H 3MXWL 4Y5YA 2V8LA 2CAKA 4Y2OB 3CU1A 3H54A 5IHBA 4NO3A 1JG9A 2OQJB 3NA9H 4HKBA 4MNQD 2G0KA 5IW6B 5I75B 3BP7B 3HI5H 1S5IL 4PJ9C 2CDEB 2QADC 3MBEB 4HXBL 2XZAH 1PZ5B 2Y1YA 4AW7A 4EMZA 5I15H 1NCCL 3SDXE 1OAUL 3NDZE 1MQKH 3L95A 4X7EC 2ZUTA 2BX5A 1J8HE 4G6MH 5HGBB 2AK1H 5LCVL 1BFOA 4LMQE 5JXED 2COQA 5DS8A 3VXRD 1J5OL 3PIQB 3LN5A 3CSGA 3D4GA 1CDYA 1K4DB 4XXDB 1ZT4B 5FDYA 4KPHH 5DRNA 5AOZA 4HK0A 3C5ZD 4P46C 3RY5A 1R24B 2JJUA 1IC4H 1J1OL 1DFBH 1GJIA 2XBTA 1WWBX 3CVHA 4H2AA 4J3OH 1AMYA 4Y16B 5GGVH 5E2WL 2HFGH 4JFZH 4F2FA 1HQ4B 2ZCLL 2VO5A 3F7QA 5G55A 1EHNA 3S3JA 1S9YB 2KH2B 3QRLA 4R26L 2EDWA 4I9WE 5E8NA 3SDDC 2Y7NA 2XY2A 2CDGB 2ARJQ 3JZ7A 1KCRL 4Z3JA 3BFQG 3MLRH 2X4RA 1O5DT 4M62H 5JORA 4YZFE 4PMFA 2FHFA 3BUYB 4O2EB 1BF8A 2I60H 2F1BA 3T65B 2BCKA 3BO8A 4GBXA 4EQ3A 3VDCA 4AZ8A 3UBXA 4X4YB 2O61B 1D6VL 2J7LA 1FDLL 1SM3L 2X1XR 1FO0H 4R6UA 4N2CA 1QSFD 4KROD 3D12B 4GMTH 2DAVA 5K93A 1T4KB 3NESA 2Q86A 1MJJB 4MMZC 4JN1L 1J10A 3ELAT 4S2SB 5AYTA 1GPOH 2HWZH 1K8IA 1ZIAA 3KYNA 2FJGB 3MRMA 4E5XA 4AEIH 1I53A 4HCGA 3MRIB 1WP6A 4QRRE 4JANB 4I77H 3FS9A 3BIKB 5GJSL 4M29A 4OUOA 4NUPA 4ODUB 4NQQA 5HHXH 2IGFH 4RX4A 1ZHBA 5J06A 1RPKA 1I9JH 4ZS6D 5D5MB 4OCYH 2HRGA 1WBZA 4OLYH 3BVDB 2B08A 4PY7B 3QUGA 4NN7C 3CFJB 4APXB 1XMWA 4NPYA 3WEMA 1SN0A 5KVGH 1ZGLA 4GEJA 4JRFA 1LO5A 5J1AA 5DQ9A 4KUCF 4ODXB 1MF2L 3AWEA 1YNTA 5E6IC 5HHPA 1IBDA 5L9DL 1GS6X 4YBQD 1JF5A 2ADJB 1E30A 1Q9KB 2KS0A 4M93B 3IRCA 5L8KB 4OGZA 3DK0A 3QUZD 5ACZB 3MXVL 5J3HC 2M8XA 3E6HB 5ADPL 5FF6B 4JRYB 1WTLA 1JAEA 3DC0A 3M6DA 1KUMA 4NSKB 5HYJD 4X7FC 3DXAB 5F7BA 1K6QL 4OLWL 5C09B 3ZKSD 1QW8A 3FTGA 4ANKA 1U8KA 2ODHA 4WUUE 5AW5B 3TIDB 1KBGL 2ETWA 2D9QB 4X6BA 5DVMA 4BE5A 4YDLB 2CGYA 5I30L 3HNSL 2WNGA 3QQ3A 4TUJB 4ERSH 2IH8A 4X83A 3JTTB 1M3JA 4QDGA 2K9UA 2P5ED 2X4TA 3VXOA 4MHHI 1J5DA 1BYNA 3QRBA 4FJ6A 5EC2B 3EOYG 3QUYC 3O45A 3KHOA 3ZDZE 1WH0A 4IOIA 1BD2D 1GY1A 4JQIH 1OP5K 5C9JA 4MAYA 3INUL 1HYSC 1IE5A 3D48R 2JCCB 2ADIA 4MB4A 3O4LB 1X6NA 3HBZA 4L18A 3TCTA 1W8EA 1E9PB 1WFIA 4MJ5B 4B9PA 4OD3H 1ZCRA 4LOUC 4PU2A 1BOGB 1F45A 3MJ9H 4DP2X 3GMLA 1JFQH 3L4YA 4R97B 2NDFA 3DYMA 1IGYA 2X2YA 2AKRB 2D7NA 3AB0B 4P5TC 2IWGA 1R75A 3D9AH 2GJJA 2DQTH 4NZUL 5AZEL 4AMWA 5HDBB 4JFFE 3ZTJG 1ZHKB 1KNOA 5I71B 3DNKA 4J6RH 1U93A 4HF5H 3TNNB 2LABA 3SOBH 5AVUB 2YKLH 4Y1SA 3WLBA 4HUKB 3QRGL 1QSED 3BEWA 3MRQB 2UUDK 4B41A 5HGAB 5C0BE 1A1MB 1O7SA 4PV8A 2HUHA 5DJZA 1JZ7A 3BMVA 5GS2D 1DEEB 3TA3A 3CBJB 4FI6A 4CILA 2N7BA 3QDMB 2ZWNA 4KZEL 4ZTEA 3AAZA 3VCLB 5D4IA 3OKEA 5EU3B 1MXGA 2EAEA 1H5BB 4NM8H 1OANA 2CG9X 1J86A 2H4EA 4QEGA 1T83A 3VFOA 5DJYA 3VE0A 3I6KB 4PJ7B 1MHHA 3VG0L 1S8DA 5F7AA 2E9IA 3T0DA 3FQUA 4TLTA 1CFSB 3BKML 4DP0X 5GRJH 3WY4A 1JGVH 2YZ1A 4ZYKB 4NLHA 4MA3B 2YS4A 4NNYB 1V3LA 2OJEA 4ZTPL 4QRBA 1OTSD 4BDVB 5DD5H 4XVJL 2R1YA 1FNSH 4XVUD 4XZUB 1U8MB 1R3IL 3DX6B 3X11B 4JRXE 3MOAH 4J3OF 1DBJL 3GZOA 3MLSH 1AZVA 1WC7A 2F74B 2ZZUT 4LCVA 4U31A 3MYJB 2P42B 2HH0L 3RGVB 1Q1JH 5F9OL 2BH0A 2VXTH 2WUCL 4LKXA 4IOSA 2XVKA 3QZWA 2CBPA 3CFQA 1EIBA 4KK8D 4GRLA 3HB3D 3QH3B 1IEAA 3CMOL 4ISVA 1HHIA 3EDFA 4N85A 1V54B 3FFOA 3CZLA 4J1UA 1G7QA 5KJRH 1XEUA 4M9OA 3H1ZA 1XTLA 5FO7B 3DSFH 4YC2B 5DFVC 2ITCB 1YNLH 2BNRB 1QRND 4BKTC 2VWEE 4Z8FL 3IDYB 1T0MA 4NQCA 4NO5B 1CXIA 1QZNA 5FFGA 3I75B 4JVUA 4XVSH 4DJMA 3HLAA 3CH8A 2IC2A 2DL2A 3BD3A 5LNGA 3FB7A 3V0IA 1QMUA 2PN5A 1BLNB 1S5HA 3B2PA 2OMVB 4UOW0 4Y7OC 1QO3A 5BO1L 4GXFA 3BLKA 3WCYA 3BYYA 4PWFA 5D96C 3OWRA 4GLRI 5DRXB 3P2TA 1R5VA 3QEQA 4PGDB 1OAQH 3MOBH 4Z3TA 2YFOA 2IAMB 4PGCB 3WS3B 3NZHH 1ZE3H 4AK1A 1XD0A 4LE8A 3IDUA 1H15A 3VXME 3FQXA 3HHRB 2EXYD 3KPRD 5TK4A 4IW4C 3X17A 4HLJA 2ILLA 4JFXB 2EDKA 2Q3AA 3UP1A 1NUGA 5C3TA 5I8CB 3QJUB 3JUZA 4FQJL 2W92A 4PIBA 3D85B 3F00A 4L9LC 4RAVA 5DUJA 5CR8A 3VXUD 1XGRB 4WTZA 4OLZL 5JPNC 3E38A 4XMKL 2ATPB 1A9VA 5FHBL 4XCFL 1RUKL 2ALWA 2FD6L 1SJEA 4IMKC 1HILB 2VXVH 2EE2A 1T7ZA 3VFVB 3W9EA