1J86A

Human high affinity fc receptor fc(epsilon)ri(alpha), monoclinic crystal form 2
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
174
structure length
174
Chain Sequence
b'VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIGH AFFINITY IMMUNOGLOBULIN EPSILON RECEPTOR ALPHA-SUBUNIT
publication title The analysis of the human high affinity IgE receptor Fc epsilon Ri alpha from multiple crystal forms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 29
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13895 Ig_2 Immunoglobulin domain
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1j86A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1j86A02
4M7LT 3V6OE 3CFDB 3NCEB 2C3VA 3VGHA 2LV4A 4KUZL 1P69B 5KVFL 4O00A 3ZYOA 2R8SH 4MDJA 5F89B 3TZVA 5LQBL 5I8EB 1HDMB 2BDNH 4G8FB 3L5IA 5E8OA 4HIJB 1JF1B 4NQCA 1OD7A 1QVOA 4P23B 2DI9A 2Z4QB 1YYMH 3VRLF 3O6KH 3BXNA 4OAWB 5E94A 4ZXBD 3VXSD 5DFVC 4U1JB 1MRDL 5LGHH 3H42H 1E27B 1MREL 1ZXQA 4X4YB 4OUUB 3RNQA 3PWPD 2VDOH 3KS0H 4WUUB 1J86A 5I8KH 2X1XR 1A3RL 1IVLA 1EIBA 1KT2B 1K2DB 2ATPB 1I3UA 3FN9A 1T0MB 3DECA 5L2JA 3PE9A 1HILA 1JI1A 1A6TB 4RGMB 1AR2A 1U3YA 3FO0H 3O2WL 5E8NA 1IKFH 3SJVA 4HH9A 4RFNC 3KYOB 2DLIA 1A3LL 5IHZA 5DMKB 1SVCP 2IPKB 2YPLD 5DJXB 1MHHB 1UWGL 1OGAB 1KYOJ 4Z7NF 5J9PA 1ZGLB 4UV4H 3SDAD 1K6QH 4RGND 1NCDH 2JCCE 5D6CB 2SEBA 1ZT1B 1GOHA 3QIUB 4J23A 1QUNA 3TYFB 4JPWL 2UWEA 1CR9L 3P2TA 2A6IA 5D7SL 4CW1B 1S7RB 2YMXL 1AR1D 3B2VH 4MVBC 3MA9H 4XVJH 5GRUL 3BPNB 5I75C 3TGXA 4NWTH 3B9EA 5DR5H 4YDJB 4U6VL 4QY8B 4CJ0A 1JPFA 4PTUB 1YQ2A 4YO0B 2OJZH 3KPMB 3HMWL 4PREB 3L3DB 3GKWL 4MNQD 3VFMA 1IGCH 3WFEH 2BY3A 4WGVB 4CADB 1A14H 5IVZA 5JW5B 3HAEB 4Y4HA 1N0XH 4I3SH 4KH2A 5HYSB 3NIFF 5AZEL 4WI4A 5BQ7B 4ZFOL 3BKJH 4K8RH 1BM3H 4YGVA 4WHCA 4NDMA 3G6JE 3KNBA 1D5BA 2QQLH 5T3XH 5KANI 1R3JA 3GMLB 4FMFA 4HG4J 5JLZA 1AE6H 5BMFH 5H37G 2L0DA 4GQPH 3S96B 3VI3E 1WWAX 1UA6L 1UZ8B 3O6KL 3SCMC 2FSEB 5K59F 4KUCF 3F58H 1AIFB 4HPOH 2MNUA 3BWUC 3H42L 3U83A 1NAKH 1RI8A 3VXMA 5I8KL 3PF2A 2Q7YB 1HHHB 2EDXA 2PYFA 3IAPA 2C26A 5GS2D 4D0BA 5FO8B 3FO0L 4L8BB 1JRHH 1IKFL 5MEPB 3DARA 5KS9E 3L1OH 1KG0A 2MHAB 3HPJB 5DYOB 4JFHE 1SBBA 4LSVL 4DJMA 4E9LA 5I1IH 4ELME 4YHLH 1EFQA 1G9NH 1VFBA 3DOSA 3GSUA 2IMMA 4UV4L 4GW1A 1BF8A 3DIFA 1K6QL 1H5BB 1NCDL 1T1ZA 4F7TA 4PB9H 2YSSB 2ID5A 4UIMA 4KJYB 1A6WH 4KJQD 1RUKH 4G3YL 4RMVA 2DLFH 3HC0A 2BFVH 5EU5A 5CUSH 2YUZA 3VXUB 3B2VL 5F8RC 4XVJL 3MA9L 4XC3H 1PG7H 4QEGA 5M7QA 4NWUH 1ZLWK 5I1LB 1KV3A 2AK4E 1FO0H 4NWTL 4XCNB 2RFXA 5DR5L 1MPAH 1XFPA 4F58L 1FYHB 4R7DA 1U92A 3FB5B 4GFTB 4NRXA 1IFHH 3WFEL 3QO1B 1MQKL 4E41B 2BNUB 3BPOB 4X4ME 3T65A 2JB5L 1QSVA 3L7EA 4L4TE 1N0XL 5DQJB 4I3SL 1X6NA 5F1NA 3QXTA 2QTEA 3VFSA 3D39E 3KG5A 1BGXH 3BKJL 4K8RL 1BM3L 5F3HA 4JAMA 1T0PB 4HJ0D 4WWKB 3DX9B 3JVGC 3MACH 4F9LA 1MAMH 4Z7WB 2QQLL 5T3XL 1U8HB 3BP5B 3V8OA 1AE6L 4MNHA 3BPCB 5BMFL 4R0LB 4EZMA 3FQTB 1HZHL 4FNLH 3F58L 4HPOL 3WIFB 4Q9RH 1OB1B 1T1WA 4HKBA 1EFXD 3TBTB 2EIDA 3BGAA 2JE8A 4AEFA 1D5IH 2MQCA 5KG9A 4C54A 1HCVA 5CHNA 3VCLA 4Z6AT 5DHVA 4PJAF 2D7QA 2VIRB 1KBGH 3RVTC 2HTKD 2EE2A 4M02A 2H32A 4AMKH 3L1OL 2J6EH 3RDTD 1DSFL 3QBTB 5IVNA 5DC4B 2GK0B 2MWCA 4FFZH 1XGQB 5DRXB 5I1IL 4MJIE 1G9NL 1QO3B 4ZPTA 4LHUD 1CDGA 1K5NA 1BFSA 2IBZX 4PB9L 3BGMA 3EYFA 1CDYA 2HTLC 1RUKL 4ODBD 2VXQH 1AGBB 2R1XA 1UKSA 5CUSL 5INDA 4XC3L 1LO5A 4LRNH 1PG7L 2YRPA 4NWUL 3GB7B 3NA9H 1QHPA 1XCQB 1IGYA 2Y5EA 2IFFH 1MPAL 3QQ3B 4PYGA 1KLUA 2P5EB 4KKLD 4LSQH 3BEWB 3MRIB 1IFHL 1I8MB 4QHKJ 1UB5B 1T21A 3BKYH 2FEEL 4Y5XA 4U3HA 3S4SA 3JV4B 4OUOA 1PKQA 1CXIA 2P43B 3WFDH 2FX8H 1UEYA 5C0GB 1IAIH 3MACL 3GSXA 1FZMA 2DDQH 3IF1A 2V7NB 5EA0H 3OAYH 3PGCB 4GKNB 4LGRB 5EZJA 5C0FA 4OZGA 4EI6B 1EDQA 3C5JB 3WUWB 3NFNA 4K94C 5FA4A 1IC5H 1SEQL 4FNLL 5BRZE 1QBLH 2BVPA 3TBVB 4JY4B 4PGDA 3ES6B 1K8IA 3KLAB 4K7PH 1AC0A 4KTEH 4ZDHB 3ARYA 4XCFL 1S7VA 4GS7B 5DK2A 3DXAA 1D5IL 3CUPB 3SKNA 2AXFB 4UNTA 3WNLA 4WW2C 3VWKC 1KBGL 1DTUA 3C2AH 5C0BE 3BN9C 3WUZA 1JZ6A 4OCSL 3F6LA 5KAQF 1KSRA 1RZIA 1WVZA 4AMKL 1TIUA 2J6EL 3TVMD 3FQUA 4D9QD 4MNGB 5A40E 2ZPKH 5D96C 5T1LA 3VXOA 5IBLD 4XNYH 4ETYA 3HRZA 3SDCD 2ZUTA 4Y19E 5HD8D 4HKXA 5DJ8B 1A7PH 2VAJA 4HLZG 4OCRL 2VXQL 1HHGA 2VLRB 3B3IB 3ZE0E 3MLXH 2DTMH 1D5MB 4LCWB 3HI1A 4PUBL 2F53B 3BISA 4OGAD 3C5SA 1KCVH 3NOIA 3BP4B 4CDHA 3TIDA 1EAJA 2IFFL 2QKIA 3PQYB 2GSGA 3MNZB 4ZAKA 3EYOB 5JHDA 4P46C 5GSRB 5JR1L 2OK0H 1FL3B 3TEUA 4QNPF 4UUJB 4TVPH 3BKYL 3KLSA 2OQJA 3QCVL 5C0JB 3VGFA 3IFNH 4V2BA 3FZUD 4JN2A 5FYLH 1IQDA 1QSFD 2H2PD 2FDBP 3DUSA 3KHQA 3TP4A 1M7DB 3WFDL 2FX8L 3DV4B 3ZL4L 3Q2CA 1IAIL 4PPTA 1K4DB 2DDQL 4LPXA 1QBBA 5D4QA 1G1YA 1MFCL 1AY1H 5IQ9B 5DJ6B 5C0CD 4I2XA 5EFIB 4JFDD 4XBEL 3T0EE 3QEQA 5LCVH 5CD3B 1QBLL 2J8HA 4HDIA 1CIDA 1J0JA 3UBXB 5HVWA 4YNYB 4K7PL 4YHZH 3MJ7A 1JJUA 2EDTA 3EOBB 3MR9A 3QXWA 5EPMA 4JFYB 3KWWA 3L3KA 1TTUA 3KYMA 4ZUTA 2CK0H 4DEPB 1MCPL 1NLDH 3C60D 3MJ9H 5CP3H 3T3MF 3C2AL 5MP6H 3O41A 1G7LA 5BS0D 1KULA 4ODXA 5GGSB 4BFIA 4CN4A 2KKQA 5CJXA 3CFBB 4HUVB 1KTDB 1JGDA 3GI9L 3MO1A 4IS6A 1UZ6E 1I7TB 2YZ8A 4JRYD 4XNYL 1BVKB 5TH2A 2PO6C 5DD0L 2C3GA 4UTAL 1BD2E 3ARSA 4P9MH 1BJ1H 2K9UA 5DMJB 1CGUA 4PJGF 3G6DL 15C8H 3VGAB 3HFML 3A6OA 3K80A 1F8TL 4HWBA 2DTML 3NPSC 5ICZB 4NC0B 3ULVE 3B8SA 4HUMB 4PBVC 3FT2A 2QADB 5DRWA 1KCVL 3UDWC 1MOEA 4RNRB 1U3HA 1VFAA 1IRAY 2MJWA 1JIBA 3W5MA 4MS8D 4PIRF 4TVPL 2Z91A 5EC2A 5IHUH 1WICA 1RFDH 5HHPA 3IFNL 3KYNB 3RNKA 5FYLL 3CDGA 1WFNA 2AJ3B 4IRSC 5FKPB 4EI5C 2DQGH 3BGFB 4HMEA 3A67L 5D7JA 2CLRB 3PIQA 3L5WB 4ODSH 3LQZA 2D4FA 3QISA 1AY1L 3QUKA 2Y72A 3RZCC 4J6RL 2JJTC 4LVOB 1JNJA 1J1OH 1G6RH 4Y16D 2BNQA 3PWUB 2NY1D 1ZLVK 4H0IA 1DCLA 1WTGT 5LCVL 3OKLB 3S3PA 3FONB 3ARGA 5E2TH 2BCKA 4YDVB 2QJDA 3BHBA 1JTOA 1A9EA 3QFJD 1D3CA 4PRPD 1AXSB 2CK0L 4G8GB 5C71A 1NLDL 5E1AB 3MJ9L 5AUMA 5MP6L 4MAYD 3MOBH 3QXVA 1P7HL 1ZHKA 3F7QA 1ZWIA 5F71A 3BZEB 4P2QA 3EO1B 5DO2C 5IHLB 1A1MA 5FB8A 3X13B 2X40A 1ZOXA 5T5NF 1DANU 3QUZB 4GG6A 4IBLT 1I1CA 5FYJL 1CK0H 2AV1A 3QIWB 3U9UA 3D2UA 4M7KL 1G7JA 1SYSB 5IG7A 15C8L 1RHHA 1CZ8L 4OT1L 4XPTH 1XGTB 4WO4C 1PZ5B 1RURL 4PRHD 4UILH 3RTQA 3MRMB 3CSPA 2W1NA 3IGAA 1Z3GL 5F9DC 2CUIA 3TH4T 2GCYB 5L2KD 3VWJA 1OAXL 4M93B 1B0RA 4PJAB 1FFPA 1YMMA 4NO3A 1KN4H 1XR9A 4MXQD 5TGBB 2O61B 4QOKA 1R0AL 1CBVH 4LP4A 2YXFA 8CGTA 1N4XH 3WHE1 5IHUL 1NCUA 2AKRB 1WV7T 3GSVB 1RFDL 1SJHA 3ZYZA 1MWAH 2J88L 3ARXA 1D9KB 3U7WL 4P2RE 4HWBL 4CNIA 2XWBB 3HB3C 2E3VA 4PJ9C 5C0DA 1UQSB 4YDLB 5C0ND 4OCYH 2Y6SD 4I4WB 4L9LA 5D7LA 4ODTH 2LTQB 5B3JE 5HHMD 1S9WB 1J1OL 1G6RL 4MHHI 3GK8H 5D2NB 3VG9C 4P5TD 3TWCH 4OFPA 1JNHB 1KJMA 1NCAH 5E6YA 1AGEB 4OQ1A 5E2TL 3SBWA 1GC1H 2X1OA 5HGHB 4FXGA 1BOGA 1U8OB 3U2SA 4M1GH 2EE3A 1A9BA 1J05A 4Z7VA 3X3GL 3P4MB 3L3JA 2H6PB 4LHJB 4P23D 5IP4A 3KXFA 3BKCL 1KPVB 2HJKB 4JPIB 1GGTA 1MIMH 5LXGH 2ZG1A 3FRUB 1U41A 1NBYA 4WUUD 3R8QA 1P1ZA 3S36H 3EBAA 4OI9A 5DI8A 4BK5A 5D9SB 1Q1JL 4NN6B 3TO4C 4C58B 2XZQH 4CKVX 1MY5A 4OLYH 1P4LB 1CK0L 1RZFH 4N0UB 4XC1H 2ESVA 4YHKL 1Z9OA 5C09A 2CPCA 1U58B 3AVEA 3VRIB 3UTSE 3QI9B 3MRPA 4XPTL 4RMSA 1JRHI 3RVTD 4BZ1H 3JWOC 3DYPA 4Q2ZA 2VISB 2D9CA 4UILL 1IGJB 4NN7C 1OAQH 4CUCA 3QYCA 1OGAD 3UEZA 3FJTA 3UYRL 2X4OB 4ELKA 3QZWB 5EO0B 3I3EA 4RFOL 4EKXA 4ELMA 3QIUD 3U0WL 1KN4L 5IB3A 1NGYB 2NY5H 3QWRD 3RX5A 4B7IA 5GZND 1O7SA 5F97E 4UMGA 3QHFH 5EU3B 3FB6A 1LDPL 4GRLA 1CIUA 4DW2H 2I9TB 4HX1A 3IKCB 3H9HB 1IAOB 4MJ6B 5HVHC 4XVUD 3H6JA 4OCYL 5D7KE 4ODTL 4MD5B 3ROLB 2NY6C 4Y2DB 5EB9A 4U6XA 3VXPA 3MRKB 3QFDA 3GK8L 4J8RA 5CEYA 2FEEI 3LDBB 5FOBA 1NCAL 2FZ3B 3QDME 4JZOA 1GC1L 4PGCB 1JFQL 3C6LA 3G5XA 2GSIB 4KDWA 4LKCA 5CJ5A 4I0PB 2IQAB 4R4FH 1KB9J 3UPAA 4UI2A 4OM0H 5CBEA 1NC2B 2R1WA 4QRQA 3QDJE 3K4ZA 3PL6A 4ZS7L 5JIIA 4LLDB 2R2HA 4S1RH 2JF1A 4Q9BA 1MIML 3BIAX 5INCB 3JWOH 2FJHA 2VLKE 3SO3B 5LXGL 1ZSDB 3S35X 1U8NA 1RUMH 5KSBF 3QDGE 4FN0A 2AGJL 5HPMA 4HFWA 4R2GC 5CMAA 5I74C 3WO4C 4M7LH 4FZEH 4ZFOB 2XZQL 3IETB 4OLYL 1F90H 3QT2A 4M8QB 4PRIA 4XC1L 3O9WC 4NC1C 3RY6A 1R6VA 4EN3A 2P48B 1W72H 3LKQB 2KQNA 3T4YA 1NGPH 1TETL 3MPCA 4DGVL 3VWKD 4BUGA 1VEPA 3IAGC 4BZ1L 4MB5A 1T6VN 1G7IA 3VXQA 3TBYB 3LRSB 1G9MH 5E6IC 4F9PC 5E2WL 3TIEA 1OAQL 4KGJA 1HHKA 3OKYA 3C8KB 3EFFB 2V2WA 3ZHLA 4JFOA 3BEVB 3O45B 3T1WA 5GISH 3MLYH 1RZJC 3KR3H 4LCYB 5J0BA 4HC1A 2NY5L 1IEBA 4I18A 3NCJH 5FYJU 4U6HB 3VXUD 3VMNA 4CVUA 2IGFH 4HK3J 2P4AB 2NZIA 5LKNA 4JFZL 4MDJB 4JPKH 4PP2A 3QHFL 3ARDC 3ESUF 1NMCB 4QHUA 5DJCB 2VH5H 1JPSH 5CLWA 1CTOA 4NQCB 1OAYH 4WGWB 3VG0L 1T4KB 1YDPB 5KSAB 2VAAB 2VUOA 5GGVH 4ETQB 1CFBA 4E41D 3LKSA 1UJ3C 4ALAH 3UO1H 5E00B 1IGIH 4DGYH 3RNQB 4LF3B 1ED3A 4OF6A 1JBJA 2MFNA 1G1CA 4QO1A 2ZOLB 1X44A 4WWKD 4L4JA 1HILB 4WW2F 3RWIB 1CS6A 4R4FL 1KJVB 2YUWA 4KGLA 4Y4KA 4FZ8L 3UZVB 4OM0L 1UM6H 3QUMA 4PJDA 1L6XA 2OR8A 2Z0BA 5K9QI 4O5LH 1PD6A 5TDPA 2DQUH 1CF8L 2A83A 1UVQA 3AY4C 5BRZA 1ZEAH 2Q86A 5ALBH 2M2DA 4I5BB 4OD3L 2VKWA 5DZNA 2XFXA 4BSVB 4WHTB 2GTZB 3B9AA 4FZEL 4K2UH 2IMNA 3SE3A 4WJ5A 2WZPD 1LNUB 2RHEA 1W72L 3SGEH 5L0QC 4LMQI 1NGWA 1U8KA 3TFKD 5K33A 3FFDB 3AB0B 4YGAB 1G9ML 3PV6B 1GZQA 3BP6B 2V7HA 6CGTA 5DRZA 1Q38A 2GUOB 4Q0XL 4NT6B 1MCWM 3L3HA 1LP9E 2EC9T 3C08L 3MRFA 5J1SC 5IVZB 1NJ9B 2UYLB 3MLYL 4Y4HB 4R7NA 1AO7E 4DZBA 2Y5TB 5IHBA 4POYA 3SKJH 5FM5O 5JOEA 4JDVA 3HPLB 1FC2D 1YNTB 5C08A 4JPKL 5DSCA 4OF3A 3KNBB 3WLBB 2C3HA 3DVGA 1KLGB 3ARBC 2VH5L 5JW3H 1OVZA 5JW4Q 5JW4R 2P5ED 2OP4H 3QQ9C 3R1GH 4ORZC 1FFOA 4N68A 5GGVL 3EUUA 5F1IB 3GHEH 2WLYA 1VACA 3UO1L 1HQ4B 3P9MA 1IGIL 4DGYL 3U0PB 2F8OA 4MXWL 1ZHBB 1BBDH 2G5BA 4NKDA 5IR1B 4M1DH 1N6QH 1I1YB 2PYFB 4XPFH 1FFNA 1JNLH 1CCZA 3GI8L 4HUUA 4WFGD 3MREA 4JLRA 4U49A 4D0BB 4H5SA 4IRSD 2YHGA 5C07B 2RIKA 2X9WA 2CLVA 3G04A 5KVEH 4MD4B 1UM6L 4JFEA 3I6KB 4KZDH 3BP7A 4P4KA 5H8DA 3IU3A 1F3JA 4O5LL 1SY6H 1YN7B 3RGVB 2D4DA 2VYRE 4QTHA 3QUXA 3EYQC 3PXJA 3DUUB 4QRPB 1OF2B 5ALBL 1X5AA 4JREB 3D0LA 2QBWA 4K2UL 4Q9CA 2PW2A 3KPTA 3OJ2C 4L8SC 3GJFH 3BVNB 1S9XB 2FX9H 4HGKC 4PFEA 4B0MM 2VQTA 4J4PA 2W65A 3KPQA 4PJFE 3RBGA 2KBGA 4OCXL 3BO8A 3BIBX 1YMHA 1Q9WB 5FYKE 5MHSD 3RFZC 1WIOA 1XGPA 2DQFB 3T65B 3GNMH 1RQ5A 4HZAA 5CEZD 5DRNA 3TZVC 2ZJSL 3ZSTA 4U1MB 3SKJL 1IAIM 2VE6B 3CVHA 1VENA 5BZWB 5IIEA 4JAMB 1EZVY 4LCWD 4PRDA 4XWOD 2E9BA 1FRGL 3TA3A 1IGTA 3GIZL 4M6NH 3C6SA 4P57A 2DIBA 2JJVA 3PQYD 1QSEA 4QKXB 3VRJB 3R1GL 3J8F7 4WENB 3O4LB 2XTJE 1W8NA 2EO9A 3FFCA 5ALCL 1UG9A 2GJ6E 3GHEL 3MRNA 4KY1H 2KH2B 5IMOA 3DETD 1NMAH 1BBDL 1M1SA 4M1DL 1R24B 2ZUXA 1N6QL 2FL5B 5ID0A 3NCYP 1B2WL 1CLZH 1ZT4A 4XPFL 1KIPB 2AAVA 4PJIE 1QFWH 5DHVB 5MI0B 1WBXA 4GBXA 3AXLA 2DI8A 3T2PA 2XN9E 1EEYA 1WITA 1IZJA 3IDMA 4PJ9D 3ULVH 3R0MA 4OLWH 2JCCF 2IH3A 5KVEL 2F19H 4KZDL 3RGHA 3GMPB 3MV9E 4ZNEA 2GHWB 3DHMA 4DVRH 1A6PA 1L9NA 3DMMA 5L6YL 2FEDD 4YE4L 4D0CB 1JF6A 2FWOB 3MV8E 5I1HH 5JQ6H 5T3ZD 1LO5B 5DS8A 4F57H 3KPSE 1I4FB 3W39A 4BKLA 1JUFA 4EUPG 4AENB 3U4BH 1M05A 3VXRE 3LN5B 1ZA6B 4ZOEA 1B90A 1PY9A 1TQCB 2EDBA 2EEAA 1S5IH 2GAZB 3G6JF 5IW6B 2XYCA 2CRIA 4Y5XB 5E9DE 3MV7A 1R3HB 2BC4A 3HG1B 3S5LB 1EVUA 3S4SB 3LKRA 4XXDA 2GT9B 4QYOB 1NDMA 5JHLH 1Q8MA 2J8UE 3VI3F 3FTGB 5HYJE 1F58H 3CZJA 4XP5H 1QBML 1RK0A 4I48A 4L3EE 5IJVB 5KSBB 3C5ZA 2QADD 4G6FB 1S7TA 3IF1B 3SGDH 2XQBL 4M6NL 1JHLH 1WAAE 5KVMC 1DQQA 2X4PA 1KOAA 3NIDE 4MA3A 3FT4A 1KTRL 3BUYB 4ODVH 3L5XL 3NFNB 4PYHA 5HSFA 5FA4B 3WSQL 4EIGB 2V2TB 1MCIA 4JKMA 1CXEA 3CDFA 1XGRA 4KY1L 3OWEA 4PGDB 1X5HA 5KS9F 3QO0A 5JOFB 1K85A 2DYPA 4ISVA 5EO9A 4L3CA 1CLZL 2IBBA 1LK2A 4HKZB 1Q0XH 1WCBB 4ELMF 3NVQA 4JGUA 2NLJA 3BH9A 1RZ8B 1XGUB 43C9A 3VFOB 4KXZH 5IMLA 3FCTA 2N56A 1RZIB 4LL9A 3ULVL 4OLWL 5EU6A 4LCIH 2AV7A 2FX7H 5AD0A 5DD1H 2F19L 1WSST 4U1GB 4XXCA 3THML 2NX5A 2F54E 4UAOB 4I3GA 2B2XL 3LN4A 4NQDE 1T04A 4BZ2H 4RMUA 4DVRL 3HCVA 4MDIA 2XV6B 4WY7L 3S9DB 5D72L 1MCHA 4QTIH 3EIFA 3FQNA 3MMEA 1XF5B 1FG9C 1G7PA 1NLBL 4PV9A 2Q8BH 1LE5A 1SEBB 5I1HL 3U36A 5JQ6L 5ISZA 2HT3D 3H9SD 3U9PH 3OX8A 4X6EA 4OKVB 1U93A 4F57L 3MYJA 4H1LG 3DBXB 3LD8B 4Z78A 1Z0NA 1JZ8A 3VDBA 4Z0XB 3MLVH 7FABL 3U4BL 3OXSB 1T83A 3ALWA 5BVJA 5E24E 1I8KA 3QXAA 4HK0A 4NN5B 5EH1A 1OP9A 2A74A 3QUZD 2IAMA 1E6OH 1S5IL 4PJHE 2VLMD 5MEQB 3QWOA 4S1DC 3LS5H 2OSLA 3WNMA 3PABB 1C1EH 4V2CB 3SDXE 4F9LC 4ZS6D 1FNAA 2MQ0A 3NGBC 5TPWH 2XIDA 4L4VE 3RVWC 1K8DA 4NO2A 3GBMH 1GAFH 2X09A 5DJZA 1DE4B 3VE0A 3VGDA 4Z18A 3M1BA 2ADIB 3L95B 4RISH 5D71L 1YEKH 1JHLL 1O7VA 1XZ0B 5GRVL 5ABDE 4HJJH 4D2NA 4ODVL 1DUZB 5D6DA 5DEGA 2UUDH 5I1EH 2EKSB 3QRFM 4LHUG 3VXSA 4L3AA 3ZKQD 2NXYC 4QT5B 1P84K 1P4IL 1HXYB 4WVRA 3KWWB 3L3KB 2CKNA 3SPVB 3KYMB 3PWPA 4ZUTB 2IF7A 1J8HE 3IRPX 2EYTA 2KL6A 3ARDD 1JMXA 5EBGA 4FQ2H 4M9OA 4GW5B 1WC7B 2PF6A 3UTTA 2QQNH 1KB5H 3HUJF 4F8QA 1FBIL 4MB3A 2YA2A 4LCIL 4ZUVA 2FX7L 5DD1L 2NW2B 1C5BH 1WUNT 1JGDB 3MO1B 3LOWA 1SJVA 3PWNB 2CIKB 4Y4FA 5E95B 3UTZA 2YPLA 5J8OA 1X5XA 3EYUH 4JO3L 3WIHH 4BZ2L 1W0WB 2VQ1B 5FUCC 3P4OA 5BOZG 3SDAA 1E6JH 1MCLA 3TN0C 3W9EB 2HT4D 2E8YA 3EJYC 3ZKMC 5JO5A 5F7KC 2Q8BL 5JW4N 5TE6L 2IWGA 3GDBA 1RHFA 1T66D 3LSOA 5DHYB 3BDBA 3D18A 4XAWH 3VFRA 1BIIA 1CWVA 4N90E 3MLVL 4U7MA 2IH1A 4YHIB 3QG7H 2ITCB 2A6DB 5HI4C 1A7BA 1CFNB 3HE6B 4GAYA 4P99A 2BNRA 4JZJC 5F7EL 2B8OT 1G6RB 3QHZL 1A1NA 1U42A 1E6OL 5C0AE 2Z93A 4MNQA 2BVQA 2DLEA 1MFNA 3LS5L 2AEQH 1HE7A 1C1EL 2QQKH 4ONGH 1A0QH 2P8PB 4PRAA 4LEOB 5LBSL 2D03H 5TPWL 4U6YB 3I3BA 3GBML 5K9KA 2YD6A 4Z77B 2A77H 2XI9A 1CLOH 4E5XB 4RISL 5J06A 3PIQB 2H32H 3CSYA 3LQAL 5AAWA 1FDLL 4EUPA 4HJJL 4QHMA 4NNYA 1HQRA 1R3IH 4UNVA 1S78C 3PP4H 1WBYB 5D7IA 5C2BL 1X5LA 4JY5H 4HF5H 3RWJA 4JGJA 4AT6B 4GRWE 4HS6A 3GGWB 1MHCB 3HS0B 1NDGA 4PG9B 5DURD 4NOFA 1V8HA 5D93C 5HGAB 4DKFH 3TCLB 4O9HH 5AUMB 2ICWI 1A4JB 3TPUA 2QQNL 2RR3A 1KB5L 2E9IA 1T5XA 4HWEH 4Y2DD 4G9FA 2VR9A 1ZWIB 5GRJH 4EI5B 4WV1B 4KK8D 1C5BL 2RGSA 3IFPB 2BHYA 3OR7B 4WTWA 5DUBA 1X5KA 3FAXA 3ZE0F 2C1OA 3MRJA 1FAIH 4G8IB 3WIHL 3RZCB 5DGQA 3K4AA 3K8LA 1E6JL 1PG7X 4X99B 3D2UB 2ARJB 1H0DA 5CEXA 4Y5VA 3AAZA 4ZAKC 4XP1L 2A0LD 1J87A 1KCRH 2G75A 3RTQB 4XNMA 4XAWL 2GI7A 3MTRA 3MV01 1BP3B 3QG7L 4PG2A 2F58H 3PG2A 1N5AA 3VFPA 3CX5K 4QRRD 3LS4H 3OGCA 3F7RA 4LIQL 2VRAA 4Y0GA 5TE4H 2JCCB 2AEQL 4NQEE 3OB0H 4ONGL 3ZDXE 1M71A 2GY7B 3QH3A 1A0QL 4X8JB 1A2YA 1XIWB 4RMQA 1OWRM 2ZSWB 2A6JA 4X0KB 1EAPB 3FB7A 4KKAD 3RUGE 2BERA 4TUOB 3SGEI 1T0NA 2A77L 3GHBH 5J56B 1CLOL 5I8CA 2EECA 3GMOA 4WHDA 5ESVB 5AG8A 1KUMA 8FABA 2ZUQC 1NFIB 4O2EB 3WN5C 4X8XA 3QULA 5B39A 1R3IL 5F88B 3JUZA 3RVXD 4JY5L 1S7XA 5JIKA 1FVDB 5D1QC 1FNEB 1FE8H 2AXJA 4FXGB 4GKZB 3TZVD 3V6BR 2XTLA 3B9KA 4F7MB 4C83A 4HUNB 3QIBA 4NCDA 5I0ZA 2FRGP 4XZUB 3P0VL 1J05B 1UZ6F 1ZHLA 3G6JB 4NQCD 1KJ2H 4FG6D 2B1AL 1NEZA 4O9HL 3V5HA 1PEWA 4KVNH 4WTXA 1J10A 1WZ1H 1WFTA 4APQB 4HWEL 2WINA 3A6CH 3D85B 4HMCA 5GRJL 3T4AA 5BW7A 3HHRB 3HNTL 3RDTA 1P1ZB 3VFWB 1KELL 4O4YH 4QRSB 1I3RA 5DI8B 3T2NH 4HXAH 1CVRA 1FAIL 1MJ8H 5EOQL 4AYFA 3ULVF 1UH3A 4DVBA 1LEGB 3FT3A 3HMXH 3SJVD 2NW3A 5BJTA 2VL5B 2ATKB 1QR4A 4M3KB 5D70H 5ADOH 2EKJA 5EUOA 5HHOE 2X4TA 1U3HC 4IIQB 4Q2ZB 3HNSL 2HH0H 1KCRL 2WANA 3AFLA 3DVIA 3H0TB 4M7JH 1CFVH 5KS9B 2P7TB 2R0ZL 1A7NH 1EGJA 1L0QA 2G2RA 1AGDA 4FQXC 2FYYA 4HQQH 4PJBA 5DEZA 4ELKB 3TF7C 1B3JA 4JDTH 4LLYA 4JRXE 4AEHH 5E2VH 3L3OB 4ELMB 1LEIA 3LS4L 1NFKA 3V5KA 4H8WC 2VABA 4K8RD 4EOWH 1AP2B 1UCTA 2HKFH 3VXTA 5BOPA 3KJ4B 4QXTB 4X7FC 3JXAA 3B9DA 3FB6B 5D2LE 4ZFFB 5D7JC 2CDFB 5C3TA 5IBUG 5E6ZA 3NZHH 3GSOB 4NHUB 3GHBL 2AK4B 4U0QB 3O6MH 3RVUC 4WHYG 3W2DH 1BREA 3WBDA 3GMRB 3GSWA 3WDIA 4J3UA 4Y4HD 1H8OA 3ARGC 5LAXB 1CT8A 1EMTH 1BFVH 2XPGA 3O6FA 2OJEB 4W6WB 1OTSC 1OAUH 5FOBB 1ZE3C 4RIRA 4L4TB 2UY7A 1JE6A 5ICYB 4JQIH 4F3FA 1FE8L 2ZCHH 1KIRB 3C6LB 4LCCA 3D39B 2X6MA 4PR5A 1U3JA 4LKCB 5AWNH 2AJXH 5KW9H 2C7UB 2YD5A 4CMHB 3B5GA 1W72B 4TRPH 2X4QA 4Q6IA 4PJEE 4KVNL 4XBGA 1Y6KR 5BZDB 3NMEA 2W92A 1CDHA 3SDDB 1F02I 4HV8A 4XCEA 4JFQB 5ITFA 4MA8H 3VXMD 3STBA 3TVMA 5T5FH 1QLFA 4O4YL 4HXAL 3SKOB 4G8EA 5LG1A 1MJ8L 4Z5RB 4L8CB 5DLMH 2A6KA 3SQOH 4Y7MA 5HI5C 5C07D 2R4RL 4PRIB 3HMXL 1KEML 1QFWI 3GJFK 3BESR 4EN3B 3B83A 4MQ7A 1GCFA 2XXCB 3LMJH 4LSSH 1BF2A 3DI2B 4QRUB 2ICWB 3VWJC 3O0RH 4Y1AE 2HH0L 5EDXA 1PSKH 3RGVD 1HHKB 4ZQKB 4Q97A 1A7NL 4PJ5A 2HFGH 3OQ3B 4HQQL 2LVCA 1MIEL 3INUL 5E2VL 4AEHL 4MJIB 2B4CL 2DQCL 4I18B 1BLNB 5K9OB 4HIEB 2G60L 5TQ2H 3WNOA 4EIZC 4EOWL 1JPGA 2HKFL 3AS1A 4N5UA 5B3JF 5CSZA 1HK6A 3I2CH 1TVHB 4L9LC 4LPVA 1N2RB 4QHUB 4R2GB 4YEFA 1I7UB 3V4UH 3WO4B 3NZHL 5K9JH 5I19H 5HHXL 3O9WB 4JM2A 5IW1A 5I2IA 3W2DL 4JJ5A 4PJXA 5JPNA 4HSQA 4M1CC 3RA7H 1JZ3A 4ZODA 5IV2B 1BECA 2DM4A 4MXVE 5E6IB 4JDZB 3ARZA 4S1DD 4JFDA 3VGGA 3PGDB 4QCIA 4KMLB 4JQIL 2ZCHL 3FOLB 4OZ4A 3D3VE 4I0KA 3LKPB 3V0WH 3ARFA 2IJ0C 3OKEB 4GJTB 5KW9L 3OTTA 1FHGA 3SGDI 4TRPL 4AZ8A 3L6FA 3O4LD 5JUEH 4P2YA 2BHZA 2FBJH 4KRLB 2UZYB 2ITDA 3C60A 3QCTH 3VFVB 1IM9A 2P8MB 2W9DH 4I1NB 4Y8DC 1KPUB 4V1DE 3DYOA 4X7SH 4MA8L 3MRRA 5FYKL 5BS0A 5BRZB 1IC4L 4JB9L 4F15B 4IMLB 5T5FL 1E28A 3W11C 3HC3H 1ACYH 1ERNA 1MEXH 5DUMH 3P73B 1YNKH 1QRNA 1UT9A 4UBDD 3SQOL 2AERT 5IFHL 3NFPB 2DMCA 2DQTL 4QXGH 4HUWB 4U1KA 4OLVL 3CXHK 3TBSB 1A02N 5DD6B 3LMJL 5C0BB 4KXZI 4LSSL 5HVFB 4MQXC 3O0RL 1R3LB 5T1DH 2FHFA 1PSKL 2I9LA 2V7HB 3U7YH 4X9GA 2HFGL 1ZV5A 3HAEG 1QLEH 3WS6A 3DX7B 2BSSB 4KRMB 5ILTL 1XH3B 5FGSA 4R7NB 5HYSG 1PZUB 4DZBB 4Y19B 5L7XH 1F6AA 1I3GH 4LHQB 5TQ2L 3F8UB 2W59A 1MFDL 4WNQB 4H26B 1NUGA 1RVFH 3EJYD 4IEFB 4JDVB 4YDKH 3ZKMD 1DQDL 3GJEA 1CI5A 4N1EA 3I2CL 4EVNA 4A6YA 3DVGB 1G0DA 1FJ1A 5EBLA 5HDQH 2J2ZA 3IJSB 4XNQA 3U82B 3U0TB 3V4UL 4PLKC 5K9JL 3WDHA 1TZIA 3PDDA 2OTUB 3OG6B 2X70B 5EG6C 4M8VA 5GGRY 3ELAT 2HLAA 3HG1D 5A16A 1JWMB 4W70A 3P9MB 3RA7L 3I6GB 4P5KB 3SOBL 4FXKB 2ZNWA 4ORGA 1MCCA 2P45B 1QFWM 3EHBC 4Y16A 4ZYKB 3FQWA 1B88A 4EDXA 4G6FD 1Q9OA 2FR4A 1P2CA 1R5IB 1EEUA 4Q58C 3PL6C 4OIBA 1SHMA 3OMZA 4NO0A 3QFJA 4PRPA 1EXUA 5CGMA 1Q9LA 1QQDB 2XA8H 3FAWA 3PWJA 1YN6B 5JUEL 3MXVL 2FBJL 4NZUL 1I85A 4P4KB 5F96H 5E7FA 1JF5A 3HZKB 4U1IA 1F3JB 4BZYA 3FQRA 3I9GL 5KN5A 4NSKA 2W9DL 3JV6B 4MAYA 4YHPA 4X7SL 5HVGB 3T0EB 1PYWB 1UXSA 4NUJA 1G7QA 4N0CC 2EICA 1ACYL 1UWXH 5BO1H 5DUML 3V0AC 1AHWB 1YNKL 3C9NB 1Q9KA 5IFAH 4QHNB 2BOBA 2XQYK 3HKFA 3DROB 4QXGL 4D0DA 1KXQE 1U8LB 3UJJH 2GITB 1MHEA 2AJZB 3MFFA 2XRAH 1I1FB 4ONFL 4X83A 1S7QA 1P6FA 3QJHB 2YRZA 4CMMB 2W65B 5F1KC 1AQDA 1DBAH 5T1DL 1NAMH 3U7YL 2EE9A 3L9RB 3BO8B 4PRBB 4F7CA 4G6KH 3MCLH 4TVPD 1QOKA 4NKIH 1XGPB 1GGCH 4HCRH 4M48L 5HGBA 4XPBH 1U8IA 2W9EL 2YBRB 4HIIB 1VPOL 3PV7A 4CDGC 1FNSH 5L7XL 1I3GL 3VD4A 4F2MA 1ACZA 3IXAA 2EXYC 3RIFF 1F4XH 1L9MA 2JK5B 4R9HA 4Q9QL 5HDQL 5FUOL 3K0WA 5JHDD 4YHNB 2UUDK 2KZWA 1WTLA 2YD1A 4DN3H 1U8MA 3UTPD 2WBWB 3MXWH 1INQA 3Q0HA 4YR6A 1F4HA 4LQFL 4F80A 2RJMA 3MZTA 4HZLB 2DJSA 3P4LA 4HAGA 5GIRA 4P5TA 2NNAA 4QRTB 2Q87A 1DDHA 4Y4KC 3CFDA 4IRZL 4XRCA 2ZKHH 5GS1B 4GUPB 3AXLB 3UYPA 4JHBA 5F89A 2OMNA 5I8EA 1HDMA 4D9RE 4G8FA 2IH3B 4HIJA 1JF1A 4U05A 4YC2B 4WTZG 2X42A 1ORQB 5F96L 2Z4QA 2EH7H 5FGCE 3S36X 4OAWA 4P9HH 2PXYB 3CPLB 3MJ6A 4J3OC 3LY6A 4U1JA 5FYJD 4OSUH 4OUUA 4X4YA 3E3QC 3SE3C 4WUUA 1KGCE 5BO1L 4JQXA 4CVZB 1SYVB 2YC1B 3FMGH 2ATPA 5IFAL 3O3DA 3K2MC 1EEQA 1YNLH 1RSFA 2H8PB 1LP9F 5FXCH 1A6TA 4RCAA 4U1LB 3U46B 3UJJL 2D2OA 1U2CA 1FLRH 2C9AA 4R3SB 4WI8A 5HPOA 4IOIA 3KYOA 3W5NA 2P5WE 4OIIH 4PGEB 1I8IB 3S97C 4CU8A 5FYKU 5DMKA 1FSKC 5ACMA 2IPKA 5EIQA 5DJXA 1MHHA 1S3KH 2XG4A 4NKIL 1ZGLA 4HCRL 1AI1H 4U33A 4XPBL 5JDJA 2OR9H 3LKRB 5CSGA 4AG4L 5D6CA 1ZT1A 3QIUA 1ZLSH 3TYFA 3QXDB 3HR6A 4D3CH 1S7RA 1F4XL 5EN2B 2BZDA 1E4XI 2V17H 5GJSL 2J3SA 1DQQB 2X4PB 3HE6D 1U3HD 5DQDH 3K1DA 4JE4B 4YDJA 3EFDH 1G84A 3WUWG 4UZGA 4QY8A 5C0RH 3QJFB 4PTUA 4DN3L 1YEDB 5C9JB 4YO0A 3QWQB 2P44B 4PREA 3L3DA 4CADA 3VGEA 1UXWB 1JWSB 2EIEA 4N0FB 5JW5A 3HAEA 2HJFB 5I8OH 5HYSA 1J5OH 2VDRH 4L3CB 2CLZA 1O5DT 5BQ7A 4Z0BH 2ZKHL 5E8EB 4OGZA 5KANG 3BH9B 4P2RB 3IVKA 4NZTH 5IMLB 3GMLA 2AV7B 2D7OA 3QUXC 5AD0B 1IEHA 2BNQD 4NRYB 4KKNA 3S96A 3LV3A 1NGZB 7CGTA 4LVHB 1MLBB 1UZ8A 2EDHA 4NZJA 2FSEA 2NQCA 3FO1B 4P9HL 1AIFA 2FIKB 5E2UH 3PHQB 3WS3B 2DLTA 4OSUL 3FQNB 4LSRH 3PDOB 4U31A 1I1AC 4B7LA 2Q7YA 4PJFF 1HHHA 1G7PB 4LGPB 4PV9B 4E0RA 3FMGL 3CU7A 3WIIH 4DK6A 1G7MB 1AGFB 1RUQH 3KYKH 4J4PC 1DQJB 3UJTH 4LQ1A 3MYJB 5FO8A 4L8BA 1V3JA 1WZMA 5MEPA 5IUSA 1ZMYA 1FLRL 3RIFK 5J1TC 2MHAA 4OIIL 3HPJA 2YA1A 4YBLB 4C56E 1S3KL 4OGYH 1DQMH 3QWOB 1AI1L 3OB0K 2OR9L 1H5BA 5DD3H 2NTSP 2EIZA 2VZ1A 3D2UD 4MA1C 2RCSH 3PP3H 3UTQB 3TA3C 2VJXA 2YSSA 3BW9A 1ZLSL 5HYFA 5F7YC 2BRQA 4D3CL 2LAGB 4HS3B 1F3RB 4NO2B 1YEFH 3RTQD 5ACZB 1H15B 2CRZA 1ZTXH 4QWWC 3UTSB 3M1BB 5I1LA 4U4BA 1FLTX 1KB5B 4XCNA 2NY4B 3EFDL 3GO1H 5C0RL 4PJIF 3FB5A 3QCUH 5E03A 3OKDB 3ILQC 3V5DB 3QDAA 5IFJB 3QO1A 2HKHH 2BNUA 3NN8B 3UBXG 2GW5A 5A2JH 5KSUB 5IWLA 3BPLB 2X4RA 1XIWD 3MJ8B 4U1NB 2AQ1A 4GBXC 2YRLA 4ODUB 1HCFX 5BV7H 3FO9B 5DQJA 4ACPA 2VDRL 2VL4A 2X5PA 1BQUA 1HWGB 3G5ZB 4X6DE 4CU7A 1TPXC 2DQJH 4OF5A 5HTSA 5D7LD 1OWWA 1XMWA 4IDJL 4WWKA 3DX9A 1BHGA 4NZTL 2CRYA 4UOW0 5E5RB 1U8HA 2Y23A 4X7DC 4CRPA 2BMKB 3BP5A 1VERA 3GM0A 4PBXA 3BPCA 4NM8L 3RU8H 5FDWA 2H9GA 4R0LA 1IC1A 4G80B 3RJDA 1RJYB 4HEME 2OZ4A 3DMMC 3FQTA 4XPGL 1FC1A 5E2UL 2X4SB 3WIFA 5SWZE 1OB1A 5HI3D 4D9QE 5JXAL 3QDMB 4LSRL 3TBTA 3GBLA 1N5YL 5DMIH 4LBEB 4GLRH 1RPQA 3WIIL 1RUQL 3TPKA 1MUJB 2VIRA 3UJTL 3LB6C 4APQD 2OL3H 3IJHB 3QDJB 1W0YT 3DO7B 1J0IA 3EOAB 3P0YH 4PRNB 2J8UF 5J57B 3F62A 2GK0A 4WTZA 5EZLB 1HYSD 1KXVC 2J5LC 3ZDZE 3DGCR 4ZSOE 1PEZA 1XGQA 2VLKB 5DRXA 2HT2C 4LLWA 1UEMA 1QO3A 3QDGB 4OGYL 1DQML 3C87A 3T3ME 3W11D 2E7MA 1BWMA 1WAAF 2VDPL 1DBKH 1TZHB 3NIDF 2RCSL 3C5ZC 2BVYA 2R15A 1F45A 4L8DB 3L3GB 1IAKB 1X4YA 1AGBA 4YDIL 1CLYL 5K9KB 1YEFL 3IDYB 1QBAA 3GB7A 4G43B 1QSFE 1XCQA 1MCRA 4K3JH 2HFTA 3BSZH 3QQ3A 3GO1L 4NNYB 4PJGE 2P5EA 1DJSA 3KPRE 3BEWA 5C70A 2W07A 1BIHA 2H41A 1OAKH 3IKKA 3MRIA 5D1XC 5FK9A 1I8MA 3RWJB 3CLFH 5EU7C 1MAJA 3F7YB 2IG2H 2NY2B 3ALPA 3GRWA 5C0CE 1U0QA 1T20B 4PD4J 4Z76B 1KB9K 4GRLD 2NY7L 5BV7L 3MFGB 3JV4A 3QPQD 4MD0A 5SWQB 1NDGB 2E7BA 1ES0B 1DBBL 4UQ2B 2AK4D 2GY5A 2DQJL 3HTLX 2ILLA 5C0GA 3LH2H 5GS0H 4XMPL 4XXCC 2V7NA 1JHKH 3PGCA 3WFZA 4G9FB 1AD0B 4GKNA 2K7PA 3RU8L 4GXUN 2IBGA 4EI6A 3C5JA 3WUWA 2Y07H 1N26A 1ZVSB 1MI5E 4L4TD 4AIXA 5FCSH 2C1OB 3C6LD 4KJPC 4JY4A 3D39D 4KROB 5HHQB 3ES6A 3KLAA 3FL7A 4Z7UE 4JRYE 3LKNB 1YC8A 1JL8A 2IQ9L 3CUPA 3P11H 3N9GH 1H0DB 5CEXB 2AXFA 5IT2H 3DURB 3PL6D 1S9KC 1T83C 4PJHF 3ECBB 4CN1A 1Y0LB 2G75B 2Y1VA 2KUTA 1YECL 2OL3L 2XA3A 3PHOB 2IAMC 1PLGH 3SDXF 4WI7A 1D6EB 4LFHD 1C08B 3P0YL 5JDSA 3MUGB 5E5MB 5I71C 2VKXA 3TJHD 1KEGH 1CFTB 4PRID 1VEMA 4EN3D 1M71B 1DBKL 2YEZB 1A47A 3CFEB 2EO1A 4KC3B 1T0NB 2VLRA 3B3IA 2P46B 1KJ2B 5D6DC 1D5MA 4LCWA 3D0VA 2F53A 2UZIH 5CWSB 1ZLWH 3QEHB 5FHBH 3TV3H 1IILE 4K3JL 3BP4A 5GHWH 3LPFA 5FCUL 4ZXBC 3EYVB 4CVXB 3PQYA 3MNZA 3EYOA 4WDIB 3SE4A 5GSRA 3EO0B 1OAKL 3CLFL 3MJGX 1AO7B 4GH7B 1SJEB 4HBCH 2RQ8A 4NGHH 3EOTL 2CXGA 2R23B 1M7DA 4QXUH 3QNYA 2X89A 3DV4A 1NEZB 3G9AB 5F7NC 3LH2L 5GS0L 4JQVA 5DJDB 1RULH 1JHKL 1RK1B 1JN6B 3MRCB 1NCCL 5IQ9A 3MA7B 3GSRB 5I16B 1JGEB 5EFIA 1CGTA 2Y07L 3SDAC 3GIVA 3M17B 4RGNC 4TOYL 3ZT5A 5DJAB 4TUKH 5CD3A 1YEIH 3UBXA 4DVBB 4LCUB 4YNYA 1T1YB 3FT3B 3EOBA 2B1HH 1IBGH 2NPLX 1AR1C 1MFEH 2WUBH 1F2XK 4JFYA 1ADQA 4RSVA 3KHOA 3QQ4A 5D1QB 5IT2L 5EUOB 2EDLA 2X4TB 1FYTE 32C2B 5GGSA 5KOVC 5DVOA 5BRZD 3ME0A 1GOFA 4LLYB 3QZWG 4H88H 3TC9A 3ZYJA 4PRHE 3CFBA 4RAHA 1KTDA 5HDOA 1LEIB 4WFHE 4HUVA 1MVFA 2B5IC 1I7TA 3SHSA 1FL5B 5EOCH 3V5KB 1M6OB 1BVKA 5JZ7D 2JJSA 2VABB 5L2KE 1TJGH 2PTUA 3BD5A 4P2OB 1KEGL 3S35L 3VXTB 2ZNXA 4U0RC 3AROA 2VLJE 4X80H 1YQVL 5LJYH 3BDYH 4S1QL 5C0BD 3I6LE 2I07B 5J3HD 2LVEA 5HJ3A 5F6HJ 1T7XA 1KJ3L 4OF0A 3EYSH 4GRWF 2CKBH 4XGZA 3NFSH 3ZKXB 2UZIL 3GSWB 4PJFB 2DKUA 1WWWX 1SJXA 4RNRA 2FATL 3O6FB 4Y19D 4ZUUA 4YXKH 2FJGA 3VFUB 5HHME 4HFUL 2E27H 3K8KA 1FIGL 4F3FB 4OJFH 3H7BA 3MNWB 4OFDA 4BQ6A 1CTNA 4HBCL 3KYNA 3UPCA 4NGHL 1FVCB 3O3EB 2AJ3A 4JVWA 3BMWA 4QXUL 5JIPA 5FKPA 2X4QB 4I8DA 1BFOB 3HE7B 4KDVA 4HV8B 5F7LB 2B0SH 1RULL 2CLRA 3L5WA 5ITFB 1H3TA 2XTJB 1TQBB 4NCC2 4P59H 5F9JA 4DZ8B 4M43H 1CXHA 1PQZB 2R2CA 2GJ6B 1RAMA 1F3DH 1HEZB 4FQCH 2F5AH 1UWXK 3ILPB 1LE9B 4S2SB 4NQVB 3OKLA 1YEIL 3FONA 2BY2A 2VXVH 4JR9L 2EYRB 4Y5VC 5KVDH 4YDVA 2BXZA 4KJQC 4TQEH 2B1HL 4PJIB 2WUBL 4YFEA 4PJCE 2PYEE 1AXSA 4G8GA 4JFED 4XNXH 2W60B 2XN9B 1BQSA 4P4KD 5E1AA 1QHOA 2XWJB 3S98A 1A8JH 1EH9A 1KTLB 1X5YA 3FOMB 1U9KA 3ZDXF 5IOPB 1RZKH 3VDCA 1T7VA 3QXUA 3CH8A 4KRNA 3BZEA 3MV9B 1GOGA 3EO1A 2YPKB 5CCKH 1IGFL 5M95B 2CJUH 1OGAE 1EZVX 2PNDA 4N0YH 3RUGF 1UYWH 4HBQA 5EOCL 3T04D 5I6XC 3DX6B 4OGXH 3QUZA 1TJGL 2ADGB 1LGVA 2XZAH 1JPGB 1BAFH 4D8PB 4HEPG 3WMSA 5HHVL 3WJJA 3MV8B 4DCQB 3QIWA 3BDYL 4HJ0C 4EXPX 5J12C 4ZD3H 3CNKA 3HI5H 4J4PD 1SYSA 3KPSB 1XGTA 2OLDA 1PZ5A 5L88H 4JM2B 2CKBL 5JOPD 5GS2H 5IW1B 3NFSL 4M03A 3MRMA 3VXRB 2KPNA 5I17B 1EA9C 3NIGE 2GCYA 1AKJB 4PJAA 2E6QA 1D5ZB 5TGBA 3B9KC 2O61A 4YXKL 1P53A 5E9DB 3QIBC 2MQ3A 5E08H 1JCKA 2FGWH 4JFFE 2E27L 3D6GA 5EU4B 3TBWB 4OJFL 3F7PC 4OZIE 3GSVA 2J8UB 3RZWA 2DQHH 2GYSA 3ARFB 4HS8H 5HYJB 1D9KA 4KPHH 3ULVD 1QSED 4L3EB 2HTKC 2JKXA 5BW7C 1UQSA 5HDBE 3FFCD 2FJFB 3WJLA 3RDTC 1C8PA 4I4WA 3B8YA 1TTFA 2B0SL 5EBWB 1JNNH 5I1JH 3FN0H 4P59L 2DLHA 1S9WA 2LE9A 4M43L 5JNYB 4FQCL 2F5AL 5D2NA 4RRPG 1JNHA 3CMGA 1EO8H 4WFFE 2VXVL 2ENYA 5J6GB 1S7WB 5KVDL 5HGHA 1YJDC 4GKOA 2Y7QB 1U8OA 2CIIB 4TSCH 4TQEL 4LPWA 2OI9C 3JWDH 4U1KB 3X12B 2GJZB 4M61B 1FNLA 3OKKB 1DN0B 4I13B 4XNXL 4NRZB 3P4MA 2H6PA 2YD4A 1BX2B 1WEJH 1V7NH 2PN5A 1CICB 4DTGH 2I9LB 4KQ3H 1KPVA 2HJKA 5ANME 4H1LH 4XP6L 2G9HB 1RZKL 4KKLC 2Z8SA 5IM7B 2F54B 5D2LF 3FRUA 1CD9B 2VZOA 4LSUH 4BFBD 5CCKL 4NQDB 2CJUL 4M7ZB 4N0YL 4IMKA 4LAQH 1UYWL 4OGXL 4Y5YA 1J0YA 4ZNCD 3ULUC 5D9SA 2XZAL 4DOHE 1KXTB 1OTUD 1P4LA 4N0UA 5J13B 5ECJE 1WBZB 5T5NG 1U58A 4ZD3L 1PX4A 3VXUE 3HI5L 3VRIA 1U2HA 3QI9A 1FL6A 5E7BA 2VISA 1EHLL 5L88L 2Z35B 1BQHB 1U3ZA 5DWUH 3RRQA 3RPKA 5IVXE 4S1SH 2HLAB 4OZHE 5A16B 2X4OA 5MENE 1ULVA 2H45A 1ND0A 3QZWA 5EO0A 4PJHB 2Q8AH 4LCCC 1NGYA 5GJTH 4E41E 4BH7B 5FEBA 2I27N 4PJEF 3FQWB 2FGWL 4OLXH 1XR8B 4Q6IC 3ARQA 4R26H 2DQHL 4HS8L 5EU3A 4GAGH 1M4KA 3RPIB 2I9TA 2V2XA 3IKCA 3H9HA 1IAOA 1HKLH 2APTA 4MJ6A 2IBZY 3IS1X 3PWJB 4Z7WE 4JANA 1TLKA 2NY0B 3TVMC 3O8XA 1XEDA 1XF3B 5I1JL 2WIMA 1MCOH 3O3UN 4MD5A 3FN0L 3ROLA 1INDL 2VZUA 5IBLC 3W9DB 4Y2DA 1DEDA 5IB5A 3MRKA 5HD8C 1ZLVH 3L3IB 3AM8A 4JFXB 3WD5H 5DJ2B 2FZ3A 4IM8A 5F1SA 1EO8L 3DGGB 4PGCA 4HULB 4P2RD 2BOBB 4NBYB 1NSNH 4LNVA 4TSCL 5KJRH 1J8HB 2R9HD 3JWDL 5M94B 4HPYL 1A7QH 2GSIA 5EU6D 4I0PA 2IQAA 1PJ9A 5ID1B 4OGAC 1BQLH 1NC2A 2NX5D 1WEJL 1V7NL 3V7AG 5B8CB 4HXBL 4DTGL 2MTPA 1XF4B 2YZ1A 4KQ3L 4LLDA 5FDYA 1VKXB 5L9DH 4QGYA 5DK0B 5INCA 3QUYB 2J12B 1J8KA 1ZKAA 1KLFA 5HGBB 1RU9H 1ZSDA 4LSUL 1KIUA 3PP3K 5EOTB 4XWGH 3RQ3A 2L4OA 4LAQL 3KYAA 3IDXH 1TTGA 1DEEB 3MLRL 3WLWC 5GXBB 1VGKB 4D9LH 1A6AB 2NY3C 4GLRI 2H2PC 3IETA 4M8QA 4K71B 5FA3B 4K3DL 1EJOH 4PY7B 4MXVF 2DM3A 3LKQA 1WCQA 4IRJB 1AQKL 3TBYA 3LRSA 1MF2H 4M00A 3T0AA 1U8MB 5DWUL 5I30H 4JJHA 3C8KA 3EFFA 3REVB 4Y88A 1P4BH 3BEVA 3O45A 2W91A 2V6HA 5F6IB 1JGVL 2Q8AL 4LCYA 5C0AB 2D7MA 4XCCL 5GJTL 3OKOB 4OB5H 1T7ZA 4U6HA 3S6CA 1DDHB 3RY4A 2VUYA 4XRCB 2E6PA 3CSBA 4S0TD 4GAFB 2HFFA 4R26L 2ORBL 2ZUUA 3IAQA 3C60C 4NFDA 5I1AA 5FO9B 1B0GB 2NY4D 2AQ3A 4U7SA 5DJCA 3GSNH 3FQXA 4U1SB 1T4KA 1YDPA 1X5IA 4B5EA 2VAAA 5KSAA 1J0KA 1NFDE 4ETQA 2V9RA 5CP7B 3ZT7A 3VW3H 3IDJB 1MFBH 4PJGA 4XPAH 3BKMH 5TJWK 5E00A 1QR1B 1LMKA 5SX5K 1IGMH 35C8H 4BQ8A 2OTWB 3BIKB 4LF3A 3B6SB 4GRWB 3ARUA 3WD5L 4P4RB 1W2KT 1I9RL 3O3DB 2ZOLA 2XKUA 3HZMB 1NSNL 3RWIA 3UTTD 5CFHA 4X6CE 4NM4H 1MNUH 1QSZA 1QYGH 2Y9RT 1A7QL 3Q5TA 1KJVA 5D7KD 2IALB 1JPST 4IOIB 5K9QG 3EO9H 1BQLL 3WS6C 2YWZA 5GGRB 3IXTB 2AVGA 4Y4FD 4XPHH 5KTEH 5JA8B 2HJLB 5L9DL 3G5VB 4QF1B 3S5LG 1YYLL 3QDMD 1MI5A 3BAEH 1RU9L 2ADFL 4MS8C 3S4SG 1EHXA 4J3WA 2QSTA 3RWEB 5JW4M 4R4NC 5DA0B 2J7LA 4I5BA 3IDXL 4RRPA 4BSVA 2WIIB 1U8PB 4WHTA 2GTZA 1U95B 1WZLA 4MA7H 4MGXA 5FUZH 3QDJD 1EJOL 1LNUA 3FN3A 4G5ZL 3X14B 2DOCA 4UTBH 3IRZA 2BNRD 1T2XA 1HHJB 4W6XB 4JY6B 3FFDA 2VLKD 1MF2L 1TVBA 3PV6A 3BP6A 5I30L 3QDGD 1ODAA 2GUOA 4NT6A 4Y16C 4DGIH 2NY1C 1RZ7H 4MLIA 1UH2A 2QHRL 1ORSB 4KQ4H 1NJ9A 2UYLA 3D25B 2ZOKB 2HVKA 2BSED 5DFWH 3T2QA 1DL7H 2Y5TA 5DQ9B 4NQEB 2M26A 2ARWA 3WFCL 4OB5L 2CLZB 4NO5A 1VFOA 5D1ZB 3HPLA 1YNTA 2R8SL 1I85C 3IVKB 3WLBA 2BDNL 3RUGB 3STLB 3T3PE 1KLGA 4MAYC 2V5SA 5IEHB 2KQMA 3ULSB 3GSNL 3LV3B 4RWYH 1RJZB 1YYML 3LEYH 5CIPB 2NY2D 5F1IA 1MFBL 12E8H 3BKML 3RP1A 3LPWA 1HQ4A 5LGHL 3U0PA 1IGML 2X10A 35C8L 4JPVH 1ZHBA 3GMQB 5IR1A 2VDOL 5DD5H 1I1YA 4E0RB 4ESKA 4POUB 5EORH 1ZK9A 4FMKA 4ODWB 4W81A 4LLMB 1V5JA 4NM4L 1MNUL 4A6YH 1QYGL 4NJ9H 4YXLH 3CDYA 5C07A 4G9FD 3VFGH 2XWTB 3EO9L 4MD4A 2D7NA 3I6KA 4XPHL 1YN7A 4MXQC 4RQQB 3RGVA 4KROD 4XX1E 3B2UD 1CL7H 1NMBH 1RIVH 3BAEL 3DUUA 3KAAA 3T08A 2EIZB 4QRPA 2HN7B 1OF2A 1J0ZA 2DAVA 4XNZB 3BW9B 2P1YA 4ZUSB 2QSCH 5BV7B 1MRFH 1Q0YH 3QAZB 3SGKA 4MA7L 1U91B 5FUZL 3BVNA 1S9XA 5HHOB 5I15H 4LLQB 3UTOA 2Y6SC 3U79A 5C0NC 4UTBL 5F3BB 1TJIH 1A6UH 3CLEH 3CIQA 2HP4A 3TNNB 2H26B 3GFUA 2OJZL 5TDNB 1PKOA 3C09C 1S7SB 4ZFZB 5C6PB 2WWKT 1H3PH 3Q48A 4JRXB 5SV4A 1IGCL 1EUTA 1Q9WA 3I02B 1UADC 4P5TC 4Y89A 3STZB 3HR5B 1A14L 2DQFA 4OV6F 2X4RB 2ERJC 1T2QH 2JB6B 3UPRB 2H2SD 3MYZA 3RWGA 4WRLA 4TN9A 4U1MA 2VE6A 2O5YH 5BZWA 5D2LB 2C4FU 3MUJA 2NTFA 5EUKB 1REIA 2BY1A 4AEIH 4MA1B 4P23C 2OL3B 4BQ9A 4OIAA 5CKAA 1CN4A 5FDWB 3VRJA 2H9GB 3LVEA 2P24B 2J6EA 5A2KH 4RWYL 3O4LA 1MCKA 2CO6B 3IDGB 2WP3T 2XY1A 5GGTH 4F37F 3UYOD 4X7TB 1AO7D 4JQXC 12E8L 5LGKA 3JBG7 1YEHH 2F15A 3B9KD 4FA8A 3QIBD 1NAKL 4LEXH 4KRPB 1FV1B 1NUNB 3FHQA 4JPVL 2I5YH 1MCJA 5ENWB 1R24A 5DD5L 2FL5A 4RGMC 2DL2A 1RZGB 1KIPA 3G6AB 5EORL 3AS2A 4XI5D 1KPRA 4YXLL 1FNFA 5DVMA 1JRHL 3VFGL 4PJEB 3EJZD 2FIRT 3O11B 3H9SE 3IJYB 1TPXB 3GMPA 1N8ZB 2NR6D 3QIUC 4LLWB 4YHLL 5CINH 1LO0H 4L9DA 1NMBL 1RIVL 3HUJE 4YK4B 4EQ3A 5GZNC 2GEEA 3S8WA 5C6WH 5CBAA 2QSCL 1MRFL 1Q0YL 2VLME 1A6WL 4D0CA 2EC8A 1GH7A 2X4UB 2DLFL 2FWOA 2BFVL 3MRGB 5J11B 2UVEA 3KS0J 2DWDB 1T80A 4XVUC 5I15L 1I4FA 1YEGH 3BX7C 3LCYA 4R97B 1FO0L 4Y1AB 4NC1E 1TJIL 1A6UL 3CLEL 3D69B 1UACH 4AENA 3LN5A 1ZA6A 2XACC 1OSPH 5JORB 2WUCH 2GIYA 2HVJA 4AQ1B 1F2QA 4P2OD 5FK9B 4LARH 2GAZA 5IW6A 1VADB 5KOMC 1R3HA 1EBPA 3HG1A 4ZOBA 3S5LA 2R4SH 2GT9A 4QYOA 3ULUD 4MD0B 1BPVA 3FTGA 2FD6H 1BGXL 1ITCA 2O5YL 4PLNC 5IJVA 5KSBA 4AEIL 1MAML 5JMRA 3QNZB 1Q94B 4GAJH 5FYKD 3O6FD 2XG5A 3BUYA 5B22A 3H7LA 2N7BA 4XVTH 1A21A 1UJTA 4OD2B 1J7VR 4JCMA 2V2TA 3D9AH 1U6AH 4Q9RL 3BH8B 3VGBA 4LEXL 2V5RA 5DK3A 2I5YL 5CZVH 2E6JA 1Z6JT 2Z8VC 5JOFA 1F13A 4PV8B 1DN2A 3VFTB 2VN4A 3BZFB 3D3VB 4HKZA 4MX7B 1WCBA 4ZO9A 3HE7D 3UCRA 2QLVB 4LKXB 1RZ8A 1XGUA 3VFOA 2W0FA 2XTJD 1URLA 2GJ6D 5JDSB 3LPGA 3OXRB 1H5BC 1N59A 5C6TH 2Q3AA 3BUTA 4FFZL 3BWAB 1FN4B 3EW3B 5CINL 1LO0L 3DVNB 1AD9B 1Z9MA 2F8XC 2A9NH 2E7LC 4PB0H 1GVIA 1U8JB 4DAGH 5E8PB 3O2VH 1XF5A 3MLZH 1HIMH 1SEBA 5SWSE 4NP4H 1Z2KA 4LRNL 4OKVA 4O2FB 4PJ5D 3D0VB 4XNUH 1OLLA 3DBXA 3NA9L 1YEGL 4Z0XA 3MV9D 1UACL 3BPOC 3OXSA 5IWLC 3IU4H 4PY8I 4WW2A 2WUCL 5I73B 4LSQL 4EQ2A 4X6DF 3W0WE 3WNKA 3SGJA 5E2JA 1R5WB 4DKEH 2EDEA 5MEQA 1T7YA 1CQYA 3PABA 4K94H 4LLVB 3MV8D 4F37K 2R4SL 4WWKC 3WLWD 2NY3D 3KPSD 3OKMB 5I71B 1JPTH 4NQSB 3QNYB 4JM2D 2X1QA 1GGBH 1DE4A 3JSSA 3O3AB 2BVUA 25C8H 3MJ9A 5GQBA 3LIZH 2ADIA 3L95A 5CP3A 3UP1A 3OZ9H 3UAJD 5EA0L 1XZ0A 1ZA3B 3ARRA 5E9DD 1DUZA 4WIQA 3QQNA 3ARVA 3GIVB 3HZYB 1IC5L 2FBOJ 2W9LA 4NKOB 2R0KH 2VR4A 2EKSA 1U6AL 3ARFD 5HYJD 4QT5A 4KTEL 5CZVL 4P46A 1HXYA 4L3ED 2A38A 5E5UB 3SPVA 4NFCA 3QQ4B 3ZDZF 3KPPB 3LKOB 4U1HB 3RJQB 3TM6A 1YPZE 1ZAGA 3ZYIA 4DQOH 1IM9D 1LO2H 3TFKC 1FNHA 4GW5A 1WC7A 2R1YB 3TNMA 2CKBB 2MCPH 4NC2B 5HYQB 1KIQB 1WIPA 2YKLH 2NW2A 1DQTA 2ZPKL 3UZEA 1ZT7B 1QRND 5TDOB 1A7RH 2AK1H 3PWNA 2CIKA 2Z9TA 4KHTH 1W0WA 3RL2B 3WFBH 2VQ1A 1LD9B 4QRRE 4PB0L 1A7PL 3OR6B 3W9EA 1FVEB 3O2VL 5SV3A 2ZCLH 3CGTA 3MLZL 5HJ3B 1HN1A 4WEMB 1HIML 1WGOA 4PLOB 2V5MA 1F4AA 4FTVE 3MLXL 5DHYA 4PJ8B 4XGZB 3NCMA 1HXMB 2F54D 1IT9H 3I50H 4YHIA 3LEXB 2ITCA 2A6DA 3AS0A 1CFNA 1RIHH 3HE6A 3IU4L 3H3BC 4K55A 1JHTB 4P3DB 2OK0L 2MKLC 1XCTB 4ZUUB 1T1XB 1G6RA 1LO3H 2D0GA 1IL1B 2FJGB 2R29H 4DKEL 5ERWB 4R4ND 1FH5H 2HFEB 3H7BB 4K94L 1A4KB 2P8PA 3FB8B 4LEOA 1S9YB 4M5ZH 5D5MF 4KWUA 2NXZB 4U6YA 1R5VB 1GGBL 5H35B 4Z77A 2A73B 1LILA 5F9WB 25C8L 3KLDA 3LIZL 1UH4A 4E5XA 1VSCA 2IANE 3OZ9L 4D94A 5F7FA 4UQ3B 4Z7UF 5F9JB 4LFHG 5GGSY 1I8LA 3N50A 1WBYA 3MRLA 2APFA 4GS7C 5EIVA 3P9WB 4YIQB 4NYLB 2YWYA 4AT6A 3GGWA 1C7SA 4YHZL 5C8JB 5CJBA 4X4XB 3V6OA 1MHCA 2FLRT 3HS0A 4OI8A 4NO0D 2F74B 4PG9A 2NY0D 2FH6A 5HGAA 3TCLA 5ICXB 1LO2L 3SJVE 4YBQC 5IB4B 1A4JA 1PGRB 1QTYT 1NL0H 4G6JH 1FZOB 4WW1B 5FGCB 4EI5A 4WV1A 4LPUA 3IFPA 3OR7A 2D3VA 1A7RL 2AK1L 1I9EA 5EBMB 4G8IA 4KHTL 3RZCA 3ZO0A 3WFBL 1BJ8A 1J8HD 4TULH 4XB7A 4P9ML 2UWEE 4FFWD 4XWOC 1QFUH 4X99A 1MWAA 1F11B 2ZCLL 2ARJA 3SDYH 2I60H 2ICEB 2HRLA 1VGEH 5I76B 2P5WB 3QUYD 1IT9L 1GGUA 2Z31B 1VESA 1LO3L 2OTPA 4HWZA 1M7IB 1YUHA 3DETC 4FQIH 2D31A 2JCCA 4U7KA 1FH5L 3LRGA 1OOAA 4X8JA 1XIWA 4IRJD 2ZSWA 4X0KA 4M4RA 1EAPA 1TCRB 4LVNC 2VDKH 2DQDH 1EBAA 4K3HA 4KI1A 3Q6FB 4TUOA 2DQGL 4K9EC 4J3SA 1TVDA 5ESVA 4ODSL 4OFYD 3ZKNC 4H1LB 4N5ED 1Y6MR 1NFIA 5C0AD 1H3UA 4O2EA 5FFLA 5F88A 4YHYC 2Q6WB 3D1MC 2I24N 4POZD 1FVDA 1FNEA 3VXME 2FEDC 4WFED 4DEPC 2HMIC 4GKZA 4HWUA 4JEGB 4F7MA 5CILH 1FCGA 1U36A 2ZP0T 3KLHD 3E0GA 1MLCB 4XZUA 4PP1D 3G6JA 5F44A 4NBZB 1OP3H 5DGRA 4MCYB 1RIUH 3ZMRA 4BYHA 3MOBL 1NCWH 3HNVH 1Y18B 4APQA 2VZVA 3C8DA 4OQTH 2JJSC 3D85A 2EIBA 3BN3B 1WISA 1DVFB 1DUYB 4OF8A 3VFWA 1EEZB 4QRSA 1J12A 4ZTOH 4Y5YB 4AM0B 1UM4H 1WLHA 3P77B 4OM1H 3VGAC 1IEAB 3ZTJH 2AXHA 1LEGA 3MCKB 4LHUB 4N1CA 3CFCH 2VL5A 1GRWA 2ATKA 1QFUL 2NMSA 4TNWK 1A3QA 2QADC 1LEKB 2PKDA 3SDYL 1FL6B 2I60L 4B53A 1TFHA 4AQOA 4IIQA 3N06B 3H0TA 5KS9A 2VLLB 1CXFA 2A9MH 2P7TA 1JTPA 1BJMA 2DQEH 3B9VA 3U1SH 3U30C 4QGTA 2N1KA 4HHAB 1V7MH 1ND0B 4KKBD 3L3OA 4C56B 1EK3A 2AXGB 1MCQA 2XZZA 1CL7I 1CBVL 3S3JA 1TDQA 1G7HB 5I9QB 4FQIL 1N4XL 4XMKH 2X9XA 1AP2A 3UC0H 3ZHKA 4QXTA 1MWAL 3BGFC 1EO7A 4ZFFA 5IGXH 2CDFA 2V2XB 3WEXB 5E56A 3TO4A 4LVOC 3GSOA 4NHUA 3MBEB 4Q6YA 4JANB 1BJ1J 2AK4A 4JO4H 3AREB 3O8XB 3I75B 4ONOA 1OTTD 3GMRA 5DXWA 2OXGA 2EDQA 4PJCF 5LAXA 3U6RB 5IB5B 3OL2A 3PUCA 2OJEA 3TWCL 4X4MA 3E6HB 4LSPH 5EIIB 1PG7W 3WL9B 3VXNB 2DD8H 4L4TA 5ICYA 1KIRA 4LRIA 3E8UH 5TQ0H 3D39A 2R39A 2CUMA 2HT3C 4M1GL 4X6DB 3T0WA 3V95A 2BRRH 2C7UA 4TVSa 1GJIA 4NQXB 3S37H 5HHNB 6FABH 3VJ6B 1W72A 4PTTB 4X5XB 3DO3A 1MJJB 1EHNA 5BZDA 1RIUL 3SDDA 2WBJB 1MCWW 1NCWL 4MZ3A 3JUYA 4JFQA 4P48A 4OQTL 1TENA 1A7OH 2EDDA 3QUZC 4X5WB 4W68A 4HMDA 1RUPH 4O2CB 3BQUB 5SWZB 3S36L 3WJJC 3QIWC 3SKOA 4JO2H 2AP2A 4Z5RA 4L8CA 1UM4L 4G6MH 4ZS6C 5F7DB 4HWNA 1GXEA 1RZFL 3NIGF 3SDCB 5FUCE 1KCSH 1T89A 2VR5A 1CGSH 4EDWH 4QRUA 1HSAB 2ICWA 4XBPB 5ACLA 4M93C 1S8DB 2PTTA 3GSNB 4ZO6A 1MFAH 4OV5B 2A9ML 4OZIF 4ZQKA 5A2FA 2DQEL 3DX8B 4LVEA 1XGYH 5IEKB 5DMGD 4ZSOB 1V7ML 1XF1A 3E2HB 4MJIA 4ZTPH 3P9LB 1BLNA 4PJ7E 1NBQA 4JKKA 5K9OA 4HIEA 5C0IB 1D9KC 3HUJA 5HDBF 1XAUA 2E8ZA 1EVTC 1FPTH 1MQ8A 4WI6A 4X5LA 2Q76B 3UC0L 2HFFB 3RBSA 4YDLC 1PKQE 3WJLC 2ZWLT 5I1AB 1TVHA 4GO6B 1N2RA 3SKUD 2VC2H 4DW2L 5IGXL 2LTQC 3V52H 3DTXB 1I7UA 4OLUH 1IM3B 3F7VB 1QSFB 3FQXB 3SY0A 4JO4L 4LOUC 5C86A 3O9WA 5D2NC 2DMKA 4OZGE 4PJGB 4XAKE 3BMVA 5I18H 3KPRB 1L0XA 4JM4H 5IV2A 3LHPH 4RGOH 4C4KT 4OZFH 5E6IA 4F9PA 2OS7A 5C0CB 4JDZA 4MLSA 4LSPL 1FZKB 1G0XA 2HT4C 3PGDA 2DD8L 4UU9B 1KCUH 2WSKA 3GUTB 3DXAE 3FOLA 2QSVA 3E8UL 4W6YB 2JIXA 3LKPA 1T66C 3OKEA 4KV5E 3S37L 4JG0H 3T09A 3MOQA 3SO5A 4GRMB 3JZ7A 5HY9B 3KPNB 5A43C 2EDOA 3ISWA 3K74B 3REWB 4S1RL 1HH6B 3VFVA 4N8VA 4IMKC 4G42B 2P8MA 4X4ZA 3JWOL 1A7OL 1KPUA 1MI5B 4NNPH 4NN6C 2AW2A 1RUML 4IMLA 4LASH 4HK3N 3P73A 2DWEB 1UJ3A 3VFNA 1FP5A 4Z7UB 4JRYB 4JO1H 1RZJH 3QI9C 4M7LL 5IVXF 1F90L 1WQVT 4OZHF 3NFPA 1IAMA 4HUWA 3H3PH 1KCSL 1NGPL 3TBSA 3WKNA 5DD6A 1CGSL 5C0BA 4EDWL 1R3LA 1TVBB 1P84J 2YUXA 4PD4K 2R0LH 2P42B 1QRKA 1W0VB 1XGYL 5DEFB 1MCFA 4RFNB 5JHDE 5GISL 3O2DH 1L4IA 1UKTA 2R69H 3DX7A 2BSSA 4ZTPL 3RL1B 3KR3L 1K3ZA 1XH3A 2HVKB 4HIHA 3NCJL 4ZPVB 5IQ7H 5HBBA 4Y19A 4Z7WF 4NO5B 1JWUB 2X05A 4WNQA 4H26A 2IGFL 3RWCB 3NTCH 5GS0D 4O51B 1NUFA 4YLQT 5SWSA 4KI5D 4Y1AD 3G5YB 5A1AA 4KDTC 3M8OH 3IJSA 3V52L 5HXMA 3U0TA 1JPSL 4OLUL 2ADJB 5IB2A 1OAYL 2CSPA 4Y2DC 1WIUA 4TSAH 2OTUA 3ZHDA 2X70A 4KK8C 3LDBC 4K3EH 5I75B 4I2XE 3AM8C 4ALAL 3VDAA 5I18L 1JWMA 4YFLF 3U7AA 3GKZA 3I6GA 3MLTB 4JM4L 4P5KA 1HHIB 4JKWA 4RGOL 1CU4H 4FXKA 3QEQE 2BSTB 3RWDB 4BSWB 3K2UH 4ZYKA 4I0PC 3QG6B 1QKZH 2COQA 2VN7A 5A3ID 1KCUL 5FYJE 1JK8B 5DVLA 1R5IA 1ONQB 5DTFA 1AXTH 3OF6A 1GZPB 4GXUM 4LNRB 1N3NB 2A0LC 3GJFA 3IDUA 4JG0L 3S34H 5CJOH 3SO3C 1FO0B 1QQDA 4FABH 1YN6A 3HZKA 5JXED 2DQUL 3JV6A 5HGDB 2JLLA 3T0EA 1PYWA 1MRDH 1ZEAL 5IK3B 1KACB 2V5TA 3SCMB 1AHWA 1P7KB 2WAHA 3C9NA 1RZJL 4QHNA 2FHBA 4KKAC 3DYMA 1FAKT 3DROA 1U8LA 3H3PL 2GITA 4LU5H 2AJZA 1I1FA 2VXUH 1FYTB 4YBQD 3OJDB 3QJHA 4CMMA 2VERN 2MCG1 4IDLA 1A3LH 2R0LL 3L9RA 4PRHB 4PRBA 2PW1B 1UWGH 4P5MA 3O2DL 2AQ2A 3RVXC 2R69L 4BH8B 2X7LB 2YBRA 5L2KB 4HIIA 5IQ7L 1BD2A 3RWGB 4UOW1 5ESQA 1NMCC 1OQXA 2VLRD 5CS7A 2VLJB 1NFDF 2YMXH 4XHJD 2NTFB 3BRGC 4R4BA 3NTCL 2F53D 2XKNB 4N9OB 4UIKH 4WCYH 2JK5A 5GRUH 5KSAC 5E0QA 4FG6C 4RFEB 3IYLW 4W4OA 3MRHA 3BE1H 5JW3L 3KPLB 2OP4L 3MSPA 1BZ9B 4YHNA 4TSAL 1ZGLM 3IB4A 1ITBB 2WWMD 4K3EL 3T8XA 2GTWA 4X6CF 4CU6A 2BNQE 4MJ2A 4ZO8A 2E7HA 5DT1H 3PJSB 2Z92B 5HHMB 4HZLA 1TNNA 3K2UL 4QRTA 1QKZL 2X89D 2AJUH 2EXWD 1JNLL 5GS1A 2ERJB 4YFLI 1GGIH 3CX5J 1TXKA 4GUPA 5FGBA 1KPRB 1AXTL 5T1KB 5IESH 5IW3A 1OPGH 3WNNA 3S34L 1PDKA 1X7QB 2E9WA 4M4PA 2YD9A 5CJOL 2IANA 4FABL 1ORQA 3ZKND 1UA6H 1SY6L 4P2QE 2ICWJ 2PXYA 4MCZB 3CPLA 4CJ1A 4K8RC 3Q1SH 4GG6E 5CBAB 4CVZA 5FM5M 1SYVA 2YC1A 3V4VH 2HMID 4KK5D 4PJCB 2PYEB 3RKDC 3AB0C 4WU5B 2H8PA 3N1QC 2EDYA 2FX9L 4U1LA 3U46A 4LU5L 4JHAH 2VXUL 4R3SA 2EDRA 3R4DA 4PGEA 1I8IA 1NC4B 2HA1A 2VTFA 4Y4HC 2HVJB 4FRWA 4LSVH 1WK0A 1YMME 3O3BA 5F70A 3GNML 4QOKE 3GMNB 5DUPH 3T3PF 1EHAA 4KUCD 2YD2A 1A1OA 2DJUA 2VDQH 3QXDA 1JTTA 2V9TA 4G3YH 3D48R 4PJ8D 5EN2A 4UIKL 4WCYL 3ZLQC 1CFQB 3CFKB 3EDKA 3TT1H 1I7ZB 2AI0H 3BE1L 2LQRA 3GMMA 5D7LE 1G9NC 2R0WH 3QJFA 4F58H 1YEDA 5C9JA 3FHAA 4H20H 1MQKH 4G7YH 1UXWA 1JWSA 5GRZA 4N0FA 5DT1L 5HGGS 2HJFA 3AMKA 1NMAL 2JB5H 4JFFB 2H3NB 4OZIB 2NXZD 4KJWD 4XCYA 5T1MB 2AJUL 1MCDA 1QFWL 5E8EA 2QV2A 3V6FB 1GGIL 4TUJB 3MRDB 5FM8A 4P2RA 1PAMA 5IESL 2W0FB 4Z7VE 1OPGL 1K3IA 3RGVC 1Z5LA 1L7TH 2GFBB 3KXFE 4FS0A 2F5BH 4J1UB 4NRYA 1N59B 1NCBH 1NGZA 1MLBA 4UOJA 1HZHH 3UMTA 3FO1A 3V6ZB 2FIKA 3SGKC 3PHQA 4JREC 3P4NB 4DWHA 2DB8A 5FAAA 3WS3A 4P2CG 5GSVB 3PDOA 1BVLB 1OAZH 3Q1SL 3WNPA 4G8GD 3MLSH 3SKMB 3V4VL 4D9RD 1G7MA 2ESVE 1AGFA 4K7PY 5C09E 1NQBA 3CH1B 3WO3B 1DQJA 3F65A 3OJVC 1TMCB 4JHAL 4G6AD 3PNWB 1MCBA 1MJ7H 4TPRH 5GZOD 5ANMB 5B39G 4OTXH 5F1OB 1J1XH 1DSFH 4WW2B 3VWKB 4IOFD 2HLFC 1S9VA 1HI6A 1KGCD 3PWLB 4HJGB 4YUEH 5DUPL 5KZCB 3QIWD 4LLUA 5D96B 3UTQA 5JHLL 4DOHB 2VDQL 4YPJA 1F97A 4I9WE 5DFTA 4QHLB 1F58L 4XP5L 1NEZG 4HS3A 1MSPA 3GZKA 5ACZA 1H15A 2P5WD 3UTSA 4KKCD 4NOBA 3QNXA 3T77A 2Z31D 3TT1L 4J2XA 1BWWA 2AI0L 1KB5A 5IVXB 2R0WL 4YX2H 4OZHB 1FFRA 1PX3A 2CRMA 4YPGB 1IE5A 3OKDA 5H2BB 3IT8D 3V5DA 5MENB 4H20L 5IFJA 1JZ4A 3NN8A 4G7YL 5KSUA 2IPUG 3WIHA 1XT5A 2QR0B 3MJ8A 4U1NA 5MI0C 4X6BB 1D9KD 4P46B 4UBDC 3UBXI 4ODUA 3FO9A 1CFSB 1ZHNB 5J1AB 2APWA 3CZFB 1Q0XL 3G5ZA 1OP3K 3KPOB 4N8PA 3HA0A 3M45A 3TNMB 4F33B 1JP5A 2BMKA 2OR7A 4M62H 4MZ2A 4NHCH 1L7TL 4RDQF 3T1FA 4LOUD 1FCCA 5CSBA 2F5BL 4YHOH 4G80A 1NCBL 2VOTA 1RJYA 4GKSB 1SEQH 2AS5M 4K7FB 1UB6B 2X4SA 4QTIL 2DIAA 1L7IH 3QDMA 5DJ0B 1OAZL 4KK6D 4XCFH 4LBEA 3MLSL 4PRIE 4NZRH 3U9PL 1MUJA 1TQCC 2RAMA 2ZG2A 3IJHA 3QDJA 4OCSH 3DO7A 2ENSA 3V4PH 1MJ7L 4TPRL 2GK2A 5ETUB 1DVFD 4OTXL 4Y5XC 1J1XL 1HSBB 3EOAA 4ONHB 4PRNA 4X98A 5EZLA 4MQTB 3X11A 2AJYH 2VLKA 2NYYD 4B50A 3QDGA 4YUEL 1NCNA 2VO5A 4LDLB 3K46A 1TZHA 5JPMB 1CE1H 1LDSA 3QI9D 4L8DA 4OCRH 2PO6B 3CAFA 5DHVH 3L3GA 1IAKA 3MCG1 5EWIH 2UY6A 4Z9KB 4LPCA 1GAFL 2M8XA 3BZ4B 3TN0A 1CDUA 3T0VA 4G43A 1YEKL 4PUBH 1RD6A 1QNZH 2EDFA 5LGJA 4C56D 1FGNH 5DZLA 3MROB 4L29B 5ELIA 4YX2L 5A2IH 3NPSB 3EDFA 3ZSSA 3MRLB 5JR1H 3CXHJ 4GXVH 1FZJB 5I1EL 1FG2B 1UCBH 3UXFA 1V05A 3F7YA 4PJ7A 1T20A 4Z76A 1ZLUK 3QCVH 4JZJA 5SWQA 4JHZA 1ES0A 3L7FB 2BVOB 3KDMB 3N1FC 3MBED 4UQ2A 3ARED 3O8XD 2EZ0D 1CGVA 3ZL4H 2Z8WC 4FQ2L 4U1GC 5TF0A 4PJDE 4UAOC 4M62L 4IRSB 4NHCL 1AD0A 1MFCH 1I9JH 3GM8A 1NFDB 4S10A 5IMMB 4IHOA 4YHOL 1VCAA 1VDGA 3H9YA 4FOMA 1QA9A 1ZVSA 4WEBH 3ZE1E 4XBEH 5EULV 3EYUL 2P8LB 1UFUA 2DM7A 5HHQA 4FQLH 1L7IL 4I0PD 3LKNA 3F12B 1MWAB 3LD8C 2XT1B 1NC2D 1OARH 1DQLH 4X6CB 3E3QE 2CQVA 4NZRL 3DURA 1E4XH 1MCPH 5GRYA 2WBJD 3ECBA 4YJZL 1Y0LA 2ZUVA 3OG4B 3SEPA 4LGSB 4NN5C 1DP0A 3PHOA 3SGJC 3V4PL 3OAZK 3VH8B 1ETZB 1D6EA 3S88H 1C08A 3BQUD 5SWZD 1CG9B 4FQ1H 1YZZA 3GI9H 5FKAB 2AJYL 3MUGA 2IPTH 4HWZB 5E5MA 1YUHB 3DSNA 3MGOA 2D31B 1C5CH 5DD0H 1CFTA 1ZS8A 4UTAH 3MGAA 2QQKL 2YEZA 3WXVH 1CE1L 1YEJH 4ZUWB 1HWHB 2D03L 3CFEA 4H25B 3G6DH 5EWIL 5C08E 3HFMH 1OT1A 2VITB