3BUYB

Mhc-i in complex with peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Epitope-specific TCRbeta repertoire diversity imparts no functional advantage on the CD8+ T cell response to cognate viral peptides
pubmed doi rcsb
source organism Mus musculus
total genus 13
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2008-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3buyB00
3G08B 3NIFF 2ID5A 3Q0HA 4QRUB 2P8LB 1X5KA 3WJJA 1KJVB 4GRMB 4BUGA 4Y5XA 1DN0B 5ACZA 5IEKB 4R3SB 3HPJB 1FBIL 5DRZB 5IIEB 3EO1B 5EIVA 5FB8A 1S9KC 1KXVC 2HT3C 4Q2ZA 2AXGB 4X6CE 2X4OA 1J8HB 4WW2F 1GPOL 1IQWH 4XMLH 3MRDB 4J23A 3O6MH 1UB5A 3VWJB 1WT5C 2VXUL 2P5EA 3C8KB 4NC2B 1AP2B 1T1XA 4N8PA 2BJMH 4YHYC 2VZ1A 3ZDXF 1XMWA 1FDLH 4YXKL 5TF1H 1UZ6F 5FUZL 2CUHA 3MUGB 2YPLA 2FATH 4S1RH 4ZODA 2GJ6D 1GYAA 5DGQA 1T04A 5IMOB 2P5WB 1CZ8H 1WZ1L 1HHHB 1T7WA 4FQLL 3VGFA 3JUZA 4JRWA 3UTTD 3DVIA 3MRPB 4ENED 3MBEB 3VFOA 1F3RB 5DDHB 1I3RB 3EZ8A 4GJTB 3BEVA 2MNUA 1L0XA 5I1IH 4Y19A 3O6LH 4XXCA 4ZOCA 4P2OC 1K4CB 3D1MC 3O6KH 3MXVL 3ZKMD 1UENA 1ZT4B 4G8IB 3QUML 4LLUA 2VITA 3OJ2C 1V7NL 5EU4B 1K6QL 1Y0LB 2FJHA 1VENA 3OJDB 4MCZB 5D1XC 2ZP0T 4LVHB 1JHLL 4S1QH 4MMXC 1NAML 5C86A 2LVEA 3U4AA 2AXFB 1KJ2H 3RL1B 4I9WE 2AK4E 3PWLA 3BT2H 4GMTH 1L9NA 3UBXA 1EBPA 3KPRB 2NR6C 5IM7B 2KDGA 3SGJA 2CH8A 2J8UF 4PJBA 2A73A 2V5YA 5H94B 5GRJL 1MREL 1UFUA 5B38B 4KJWD 4JHWL 4O2CA 3L1OH 2A9NL 1WFTA 2GIYA 2J3SA 2DYPA 4JJ5A 1FAIH 5KANG 3ARFD 2DM2A 3SPVB 3UEZA 1GOHA 3VDBA 2CDGA 5D7LA 5B8CB 4NP4H 1HHGB 1NBVL 3NCMA 3WJLA 4DZBB 4YDIH 4RZCA 1BOGB 1LP9B 3QIBC 3TNMB 1RHFA 3TN0B 3V5HA 2J1KA 3AS3A 2X42A 4NJAH 2P7TA 3NFPA 2PW2A 3IJSB 3CVHA 3AAZB 2RFXA 2XRAH 4QHKJ 2X4PB 5AD0A 3DYPA 1IQWL 2K1MA 4XMLL 1OGAE 1MCCA 3O6ML 4JN2A 4UOW0 3DXAA 3S5LA 2R23A 3QXAB 2BJML 4KMTL 2X4SA 1I1YA 1FDLL 1JK8B 1JUFA 1NCCH 1JGVH 1NMBH 5TF1L 3MRQB 5DA0B 1FZOA 2HN7A 2FATL 4S1RL 1KGCE 4FXGA 3L3IA 4PV8A 1LO5B 1CR9H 1FNAA 4M1DH 3BQUD 1CZ8L 2XT1B 1ETZB 2DQCH 5ITFB 3FQWA 3ILPB 3HB3C 4RGNE 4WRLA 5I1LA 5CJ8A 4NNXA 4P46C 1PZUB 1R5IA 1OTUD 1RZJH 4LSPH 4Y2DD 5F7EH 2WV3A 5DVLA 2Q3ZA 3ARBA 2GTZA 2X7LB 3MFFA 5IB3B 3HR5A 4MQ7B 5I1IL 3O6LL 5LAXA 1CXFA 2UZYB 3S9DB 3QIWD 3O6KL 5E1AA 1NMCC 2O26U 4ZUSA 5GS2D 3KGRA 2AJXH 1YEEH 3WFDH 5L6YH 4JPIB 1MAJA 5T1LB 3S36X 4S1QL 2AXHA 2A74A 2FEDD 5BO1H 2BOBB 4N0YH 3GSNB 1KJ2L 4P2YA 3BPCB 4JGMA 4PRHB 4XVUC 5DHYA 2R9HD 5GRYA 2YKLH 2OBGA 4OCWH 1RIVH 4GMTL 2OTUB 4PLNC 1HSBB 2C3XA 4WHCA 2HJLB 5EO0A 2ICWJ 2X05A 2FGWH 3OB8A 2Q7YB 1LILA 3MJ7A 3SKMB 5CKAA 3MC0A 1CICB 3NFNA 5FECB 1RZIA 3D69A 3L1OL 2VAAB 1FAIL 5DK3A 4HKBA 1ACYH 4HK0A 5DS8A 3F12B 5IW3A 4MA7H 4NP4L 3NZ8A 1J1PH 4OZFH 4YDIL 5E6ZA 1M71A 1UGNA 2EXYD 1SBBA 1TETL 3FONB 3LKNA 1DUZB 4NJAL 5E6IA 3GMOB 1VKXA 1M6OB 2EKSB 1A0QH 5LBSH 5FYJD 1E28A 2XRAL 5E2VH 3L6FA 4PGEB 4XBEH 1CDBA 5FYLE 5IK3A 3MRLA 5SWZB 3GMPA 3BPOB 2CUIA 3WIFB 5KZCD 5FGCE 4R4FH 4XBGB 5AEAA 1J7VR 2APBA 1NCCL 1JGVL 1NMBL 1BEYH 1WWAX 1XF5A 1X4ZA 1XF4A 2GSIB 4JO1H 4O58H 4PJIA 5F96H 3F7YB 4PGJA 2C3HA 1VACB 3ARRA 1CR9L 2E7HA 2FECL 3AU1A 4P2RD 5E8PA 2Y5TA 4UU9A 4M1DL 1OGTA 3M07A 4G3YH 5CWSA 2DTMH 1ZV5A 2DQCL 2C3GA 3HA0A 3GMLA 4DKEH 2HVJA 3PL6D 1X3DA 5E5UB 3E1F1 2V7HA 4OI8A 4FZ8H 1RZJL 3P4OA 2BY2A 1TJGH 2SEBA 3CGTA 4LSPL 3RZWA 5F7EL 2FX7H 4JKWA 3QBTB 4KRPD 4G6FD 4Z5RA 3S8WA 3WKMH 2I24N 2JCCB 1TCRB 5JOPE 5EBWB 3ET9F 4O2EB 2AJXL 5DRWA 1YEEL 3ARTA 3OG6B 3PWVB 5F44A 3WFDL 2KZ1B 5L6YL 5EORL 2VZSA 1N6QH 1NFIB 4IRSA 5KAQG 3HR6A 4AT6A 3NCYS 4NIKB 5BO1L 3KNBA 2J6EH 4N0YL 5C3LD 1KB5B 1RHHB 3N1FC 2YKLL 4MXVE 2QTEA 4IJ3C 1RIVL 3X17A 5FEBA 3KYNB 3BPLB 2WBWB 2FGWL 3QWOB 4PJ8D 4PJFA 3U0PA 1EHLH 1IAIH 3P9MA 5E5MA 4N8CH 2EYTA 1RZJC 2R0LH 1GJIA 2KPNA 1PQZB 4Z0XA 1ACYL 3SDXE 1DQMH 4L1DA 1T3FB 3ABZA 1JYNA 1D3CA 1ZVSA 4MA7L 5J3HC 3TLRA 4ZSOB 1J1PL 1IC5H 5C0EA 5TE4H 2Z8VC 3F7PC 5HHPA 2NX5E 3ALXA 1HILA 2AI0H 3H0TB 3T0VA 2OTPA 4EN3A 2EYRA 5E08H 4H5SA 1A0QL 1GVIA 5LBSL 1S9XA 3QUXA 4Z7VA 5E2VL 5JIIA 3HI1B 4XBEL 5JLZA 4O2FA 4WNQA 1TENA 1UM4H 3C5ZD 2YZ8A 3KPSD 5ITBH 3JBG7 4I3SH 3IS0X 5A40E 3QZWG 1HCFX 4LSRH 3EKCA 5CD5D 4R4FL 1E4KA 2F5AH 1PG7H 4DFIA 5EA0H 4XCNB 1RZGB 3RWGB 3GJEA 4KVNH 1BEYL 1MHCA 4NHUB 3VH8G 4O58L 4JO1L 3ZHDA 4NQDD 1LEKB 4Y7MA 5F96L 1ND0A 1FL6B 4XP4H 4YR6A 3C60B 1JPGB 4I3RH 5HI4C 2PCPB 4ZD3L 1NCWH 4QOKD 3W9EB 4G3YL 2DTML 4GBXA 4YGAB 5FA4A 1BLNA 2NZ9D 4DKEL 3PIQA 5KSAA 2ADGB 2RQ8A 5B4MC 4HUMB 2WW8A 4M7JH 1WZKA 3MR9A 3O4OB 4WUUA 2PXYA 1KXTB 3DVGA 1MNUH 4FZ8L 3IAGC 3VFTB 1TJGL 4DZ8A 3MA9H 3OKNB 5A3IC 1BVKA 5IFJB 2FX7L 5IHLB 3DUUB 4JRYA 5E00B 3WKML 1G6RB 1MWAB 2AJ3A 1HNFA 3IFNH 5HGHB 1SEBB 4MA1C 2X4RB 3P0YH 3UXFA 4PB0H 4F7TB 1TZIB 2CK0H 4HIXH 2X4QB 43C9B 1N6QL 5GRVL 1CE1H 3QFJA 2QR0B 4QHKI 1U8PB 3LKSB 1J0HA 1RD6A 4HWBL 1M7DB 5B22A 3CCHA 2QJDA 4R90H 3MOQA 2J6EL 3CVIH 3WHE0 1FN4A 4QHUA 4GW5B 1J05A 4NQVA 4XX1E 4L4VB 1T1ZB 1FAKT 4WFED 5BRZD 2XN9D 1OTSD 4M6OH 4ETQA 1O5DT 2BVQB 5FOBA 5I16B 4KK8C 4XI5D 1EHLL 2Q1EA 3M45A 5CBAB 4MNQD 3HC3H 3W0WB 3PJSB 1IAIL 5E8NA 3RUGF 4GRWF 1T4KB 3E2HB 1QQDA 4N8CL 1G7HB 4G42B 4PRAA 3MRRA 4XGZA 4J3XA 2R0LL 3I02A 2OYPA 3SGEI 4HUNB 3HMWH 1GGBH 3I3BA 1DANU 4HV8A 3UP1A 1IC5L 3BP6B 4UV7H 2NY4C 5TE4L 5D1QB 1QSED 1UJTA 3HS0A 2KQMA 2AI0L 2CR6A 1G7JA 2JIXA 2P5EE 1PGRB 5E08L 1J1OH 3RGVD 1FJ1B 1JYXA 2X2YA 4Q6YA 4PJAA 4ZO9A 1AQKH 3T8XB 1XGTB 2RBLA 1H3XA 2VNCA 4R7DA 1UM4L 5JZ7C 2W0PA 4R4BB 5ITBL 4I3SL 1I1AB 2R0ZH 3F7VA 1IL1A 4LSRL 3NCJH 2EH8H 3CDFA 1WAAA 1IGJA 2EYSA 1PG7L 2F5AL 4FQIH 1NLDH 5EA0L 5D96B 4X6CB 4N5ED 2DQFB 1UB6B 4J3OC 4KVNL 3BMWA 4L8CA 1WFUA 3B5HA 2XWTA 4MJIE 1SYSA 3RWDA 4XP4L 4NO2A 5AZEH 5MEND 1TQBB 4I3RL 2YMXH 2YPKA 1NCWL 4ONHA 5E4IA 1C16A 1VSCA 2XICA 3L7EA 5FF6B 3O3EA 2BCKA 5LGHH 2P8PB 1QBLH 5C2UB 4U7MA 2WINA 4YGVA 4EI5A 5I2IB 1CD1A 4OUUB 3U4EB 1VGKB 5ICZB 1MNUL 1N8ZA 4Z7OE 5ENWB 1HQ4A 3L3JA 4YUEH 3MA9L 3QUYB 4U1KB 3VI4E 3VXMD 4P23D 2H6PA 1TDQA 1DLHB 1BP3B 3NVQA 3PP3H 4S1SH 3IFNL 5HJ3A 5JDJA 3BKMH 4GSDH 3P0YL 5I6XB 1LDPL 3K8LA 4PB0L 2CK0L 1I9JH 4HIXL 5E9DA 3KLSA 4RDQG 3S6CA 2DIJA 1CE1L 1N7MH 1PEZA 4TTDC 1AXIB 1IZJA 5C7XH 1VFAB 1S7WB 1D9KC 3QG6B 3V6OC 3KS0H 4PJBE 4R90L 4S1DC 5E24E 1NJ9A 3CVIL 3CXHJ 3G6AA 1B4RA 2MCG1 5DFWH 4PJ9C 5C0BA 2ZSWA 5SX5H 4TYUA 4M6OL 4TUJB 4PY8J 4XCYA 4P4KB 4Y5VA 5KN5B 1ONQA 1F11A 5F7KC 2YHGA 5I73B 3O45B 1PKQB 1MH5B 4HLZG 4AENB 2CLRA 3HC3L 1T80A 1DDHA 3BD4A 3FFCA 4YBLC 4JQVC 5GSRB 1U8OA 3SGDI 3DURB 4L29A 1GC1H 1J12A 1EAJA 2AK4B 3QNYB 4R8WL 3LQAH 2BOCB 1JIBA 4PG9A 3HMWL 1GGBL 4FG6D 1Z9OA 3MMEB 4K9EH 1DLFH 2VDRH 1CCZA 4HK3J 4UV7L 2RCSL 3RTQD 4K3HA 1HSAA 3VMNA 5INDA 1S9WA 1QRKA 3BFOA 2ITCA 1OSPH 2EZ0D 3DXAE 1EMTH 5DSCA 3VGHA 1J1OL 3WN5A 3SY0B 4XCFH 4LRIA 3B9KC 1KPUB 4LEOA 3ARDB 1AQKL 2GJZA 3PABA 1ITCA 1JBJA 2BRRH 1NGYB 5EOTB 3G04B 3D0LA 3OKEA 3VFMA 5D7JB 5JW4M 2R0ZL 4PGDB 5L2JB 1XCTB 3NCJL 4MJ6A 2EH8L 3GRWA 4I18B 3NPSC 4FQIL 2PO6B 1NLDL 2Z0BA 2ARJB 3QRGH 4LARH 4BFBD 1CGYA 2EDKA 5F7HA 1OGAB 4FFZH 5IG7A 4NQED 4UT6H 3HB3D 1RIHH 5AZEL 2QLVB 5GZND 2YMXL 3FRUA 3WUWA 4JANB 1T20B 5C07E 5C6TL 2HLAA 5FYJU 4LLDB 3ZE2F 1A7BA 3MUJA 5LGHL 1CDYA 1QBLL 5F7UA 4WHYG 1NUNB 3MYZA 4U6TA 1Q9WA 4U1LA 5F7WC 4YUEL 2XNAA 3OKLA 2Y6SD 1MLCA 4OM1H 4RGNB 4S1SL 4U0QB 1DBBH 1MHHA 3HG1D 3PDDA 3BKML 4GSDL 1I9JL 3VI3E 4AZ8A 1HIMH 4MAYD 1N7ML 4H25A 4WFFD 1JWUB 5C7XL 4I0PC 5FO7A 1KULA 3DX8B 4NO0D 2LU4A 4O51B 2UZIH 5KSUA 3P4MA 2PTUA 3BH9B 3ULUH 1L6XA 1J1XH 1Y18B 4F7PA 3QULA 4RA3A 3LN4B 2ADFH 4KHXH 4X80H 3S3JA 2GJJA 2DQGH 2X44D 1YUHB 1JHKH 3RY4A 2P46B 1MI5D 3UTZB 3L5HA 5EZLA 5F9JA 2HJKB 3LEYH 5GGRB 1GC1L 3G5YA 5D7KE 3LQAL 3FQXB 4BZ2H 4KQ3L 3ZMRA 4K9EL 1DLFL 2VDRL 1HCVA 4KDTC 3TIEA 1AXSB 3OAZH 1HEZA 3WXVL 4P4RA 3R06A 3HMXH 2VL5A 2BDNH 3M17A 5EU7E 1OSPL 2DJUA 3GBLA 4P2OA 1EMTL 2IWGA 4OZHA 4HUKB 3QDJB 3RWCB 3VGAB 1RZKH 4XCFL 5J11B 4QTHA 2DQIH 3MGOB 3RI5F 5AYQA 1AGFB 5CIPH 5D1XA 5IJVA 2BRRL 4PJIE 2J8OA 4KFZC 3ULVE 1P2CB 3WLBB 2ADJB 5IBUG 1DANT 1F00I 1PW3A 5DJ6B 1BBJA 3JWDH 3DOSA 1QPXA 4RAHA 5SWQA 5F7NC 3QRGL 4LARL 2ED7A 1VCAA 3CNKA 2VDKH 4FFZL 5EUOA 3LQAC 5KSVA 4PJ7F 4UT6L 4EIGB 4KTYA 3IB4A 1RIHL 2X40A 4K9EC 3O41A 5CJXC 5FGCB 2VLJA 1UG9A 3ZDXE 2PYED 1HYSD 4POYA 1UZ6E 1FFOA 1JGLH 1UJ3C 3IDJA 3I50H 2AGJH 2J5LC 3ECBB 3QIBA 3G6DH 3K80A 3QUMA 3O9WB 1NC4A 3ES6A 3NCCB 4HZLB 1NAMA 4OM1L 2AERT 1BFVH 4MGXA 3BRGC 4PJXB 1DBBL 1JZ8A 1TPXB 4PLKD 4HIIB 4OKDA 3GMQB 2WBJD 2FWOA 2E5EA 5HI3C 1HIML 5DQJA 1RZ7H 2EDLA 2XQBH 2CRYA 1D5ZA 4U1NA 4PJFE 4RAVB 2UZIL 1A6ZA 5K9KA 4HFWB 3ULUL 3WO3B 1J1XL 2YZ1A 1QVOB 4X7FC 5D1ZC 4K7PH 3Q3GB 2EDDA 3ESUF 5CD3A 2ADFL 4KHXL 4X80L 2Q6WB 1A4JB 4YXHH 1W8NA 4JDZB 2DQGL 3MGTB 1JHKL 2VR4A 4FFVC 1T1WA 1JGEB 1ZT1B 4PP1D 4WW1A 5DYOA 4F2MB 2Z35A 3LEYL 3LEVH 3RFZC 1KJMB 4QHLA 2IPKB 4P46A 3VWKD 3RA7L 1TVBA 1MLBA 4QXUH 4JQXC 3WL9A 3IXAB 4BZ2L 2J8UE 1XCQB 1MJ8H 3OF6A 3F62A 4XPBH 1AR1D 3FB5B 3SKOB 4OLUH 3ZT5A 1AR2A 1OP5H 3QDMA 3OAYH 2FX9H 2YD7A 4XTRC 3SDXB 3EOAA 4R0LB 4LVOC 3CX5J 3QEHA 2DQIL 3ZKXC 3ULUC 3I84A 4KQ4H 2C1PB 2FSEB 4MJ5B 3IDNB 3B9EA 3JWDL 1KSRA 4PBXA 2VDKL 3SDCC 2EDQA 3FCTB 4PY8I 4X0KB 5I76B 3HNTL 4WUUE 2VIRA 4UOJA 5MI0B 4RMWA 2QSCH 3QA3A 1AHWB 4JRYE 4PRBA 1JGLL 3EOYG 1BFSA 2AK1H 3I50L 4LEXL 2AGJL 4PD4J 4WI4A 2GT9B 3G6DL 1RZKC 5FUOH 4F9PA 5EU5B 1A6TA 5EFIA 3S88H 4DUXA 3QFJE 4UILH 1DTUA 1N0LA 4WFHD 1U8HB 2MJWA 1GZPB 2Z4QA 5TDPA 1JV5A 2WQ8A 2EDJA 1BFVL 1KJ2A 1LHZA 4LPWA 4Q9BA 3AXLA 1ZEAH 3JWDC 3BGMB 3IS1X 5IVZA 1RZ7L 2HTKC 2XQBL 2B5IC 4YDJB 1KG0B 3NIGF 3TZVA 1HDMA 4PJHE 4UDTA 3WDJA 1EFXD 2NY6D 4RQQB 5DJDB 3BO8A 4WTWA 5HGBB 1KLGA 3BPNC 2F74B 2WAHA 1ES0A 2JK5B 3MV8A 2YEZA 4JVUA 3MV9D 4K7PL 1R3IH 2B20A 4RA0C 4YXHL 1YJDH 3TBSB 1NUFA 4KTEH 2LTQB 5C0CA 2YK1H 4HGWA 1BZQK 4NN7C 3LEVL 4QXUL 2JF1A 1YY9D 2OJZH 5EIQA 3QQ3A 5LXGH 1MJ8L 1YECH 2Z31D 1NEZB 1RUAH 4MQSB 1MCQA 1QSZA 4PJAE 3SDDB 2ZZUT 2GI7A 4UQ3B 4WIQA 4OLUL 4G6AC 1IGTA 2FX9L 2H26A 4ZAKB 4Y5XB 5IBLC 5ACZB 4W4NA 1CD8A 5FB8B 4Q2ZB 3MSPA 2UYLA 1KPVA 2X4OB 3LKPA 4KQ4L 1KTDA 3ARED 1WBYA 2P5EB 4JJHA 1T1XB 3TO4D 3BZEA 1OHQA 2EE3A 5EC2A 1LQSR 2DM4A 4ELMF 2YPLB 1JWMA 1GAFH 2DI8A 1WIOA 3IKCA 1P7QD 1T04B 5CLWA 5I18H 1FIEA 3LPGA 1KCUH 1OWWA 2QSCL 4PFEA 4LPVA 4B53A 4YHZH 1R3KA 2AK1L 3CC5A 3IF1A 4MJIB 1RMFH 5FUOL 5E9DE 3UDWC 3VFOB 3S88L 4CMHB 4XP6H 3C09B 5KVFH 4UILL 4U6VH 1EUTA 3HCVA 5D70H 5KVDH 3ILQD 3BEVB 5F6IB 4GKNA 4Y19B 5CP3H 4PGCA 4MYWB 2NY5H 3N0PB 2ZSVA 5C0BE 1ZEAL 3L5WA 4XMKH 4H88H 1Q72H 4PJ9D 3SGEH 1QLEH 1P9MA 2VITB 2ZOKA 1R5WA 2FJHB 3LKRA 4QXGH 3U2SA 4HMDA 3L5JA 5D93C 4Q9CA 1BZ7A 4NWTH 3FFCE 1ZGLA 4NQDE 4F58H 3O8XD 4C59B 2A77H 3PWLB 3GJFH 1R3IL 5K9JH 3UBXB 5I75C 1O0VA 2OI9C 4OZFA 3T2NH 4ZTOH 1YJDL 4PJBB 3W81A 5ISZD 2A73B 4KTEL 2V17H 3VRJA 1L0QA 2YK1L 3S96A 3C5SB 4O2CB 4JJ5B 2DYPB 3BOVA 3EDFA 2CDGB 5D7LB 2OJZL 5LXGL 2DL9A 2DI9A 1YECL 3PG2A 1RUAL 3X14A 2DQUH 4DUVA 2GQHA 4NBXB 1G0DA 3G6JA 3NCFB 3V5HB 3IXTA 4YAQA 4LQ1A 4NYLA 2NY1B 2M1KA 3V7AG 2P7TB 3NFPB 2HT2C 3VCLA 2PW2B 3CVHB 5HHVH 2D4DA 2RFXB 4LOUC 5AD0B 4XMPH 4JN2B 5BRZE 3GMNA 2XN9E 3MRMA 1IGYA 3DXAB 1VPOH 3S5LB 2R23B 1YJDC 2X4SB 3PUCA 3EHBC 1I1YB 3QT2A 1CL7I 1JUFB 2XTJD 3QEQA 4PJDE 1FZOB 4WHTA 2HN7B 2X70A 4FXGB 5D2NC 1GAFL 1ZHKA 3L3IB 4AIOA 4PV8B 1JZ6A 1JMZA 1UWGH 4UNVA 5ICYA 4RFNC 2QADD 4FNLH 5I18L 4UT7H 3GDBA 1YEGH 1JNJA 3L3GA 1KCUL 4G80A 3FQWB 4YHZL 1QSEE 5I1LB 4HKJA 5JIKA 4NNXB 3VA6A 1R5IB 1RMFL 4LGPB 5F1NA 3KDMA 4XP6L 5KVFL 4U6VL 2E7LA 2NY3B 3IDUA 3ARBB 5D70L 5KVDL 2GTZB 2HH0H 4WENB 2J6EA 3MFFB 5TQ0H 3HR5B 5FM4A 4QKXB 5LAXB 4WI5A 4UB0H 5C08A 2XG4A 2NY5L 5T3ZH 3TGXA 5E1AB 4ZUSB 3SGDH 4HHAA 4H88L 1Q72L 3L9RB 4K7PX 1QLEL 4MAUH 4QXGL 3RY6C 3MJ9H 4K3EH 2A74B 4NWTL 3MNWA 1RV6X 4NNYA 4F58L 3LD8C 5DHYB 5MENE 2A77L 1OP3K 2M26A 4L4TA 5K9JL 2EC9U 5EO1A 5EO0B 4PJCA 1CD9B 2NXZC 3MJ7B 2V17L 4CKVX 4Z7WA 3NFNB 5HHME 1RZIB 3D69B 5JW4N 2XWJA 5C0AA 5BV7H 4HKBB 1I1CA 4Y5YB 1KC5H 3TM6A 4HK0B 5DS8B 4OZHE 3NZ8B 4KK5C 3LKOA 4GRWE 1M71B 2DIBA 4LBEA 2AEIT 4WO4D 1VKXB 5E6IB 1MCDA 5HHVL 3DI3B 5IHBA 4NN5B 3L6FB 1N6UA 1D9KA 4XMPL 3V6OA 3K4DA 1EJOH 3S4SA 5EUOE 3RJQB 2OZ4H 3DUHA 2WIIA 3HE7C 1I7TA 5IK3B 1VPOL 3MRLB 1DUYA 3GMPB 4OD3H 4HX1A 2DJSA 1DQDH 4CVZA 3RVUC 1AXTH 3ZE1E 2LE9A 3O6FD 5A16A 1CXHA 5HVHC 1WK0A 4NN6B 4X7EC 1XF5B 2BFVH 1XF4B 4PJIB 4RISH 2FIRT 2YPVH 4XHJC 1LMKA 1UWGL 2YA2A 5E8PB 3AU1B 3VXTA 2Y5TB 4FNLL 1OGTB 2NYYD 4UT7L 5CWSB 4GQPH 5MERA 2AW2A 3FAXA 3NA9H 2HVJB 3NABH 5HYJA 1F45A 3NZHH 3IU3A 2YSSA 1EFQA 2V7HB 4W6WB 2W0KA 2SEBB 3QXUA 2EIZA 4K7FA 3TN0C 5I74C 3UTPD 4DWHA 3SCMA 2HH0L 3Q2CA 5TQ0L 4Z5RB 1JPFA 4OM0H 3SQOH 3B9KA 4LIQH 3D39A 1NCTA 3C6LC 4UB0L 5T3ZL 1TLKA 2DAVA 2D4FA 1T6VN 1QLRA 5DRWB 4DTGH 3V79C 4IRSB 5B38G 4MAUL 4AT6B 1A7QH 3B5GA 3MJ9L 3KNBB 2F8XC 5GGTA 4P5TD 2EIDA 5DR5H 5DJCA 1DBAH 4YDVA 1D5MA 5C0RH 5F21B 4ESKA 2W92A 5F7YC 4EBQH 2ICEA 1T21A 3ARGD 4PJFB 3U0PB 5D8JH 3TVMC 3P9MB 2H2SD 3G5VA 3NCYP 2EDTA 5E5MB 3RVVC 3FRPG 2EYTB 4G9FD 4JY6A 1I8IA 1IARB 1JTTA 5BV7L 2GJ6A 4Z0XB 1KC5L 1HK6A 4V2BA 4ONGH 4HK3N 1X5AA 1ZVSB 4NZDA 3TJHD 5C0EB 5HHPB 4OGAD 1NQBA 5J12B 4RNRA 1HILB 1GCFA 6CGTA 5I1KH 2ERJC 1F6AA 4CVUA 4ZFGL 4I48A 4EN3B 2EYRB 1B90A 4H5SB 2X4UA 2WK2A 1S9XB 4AIXA 3QUXB 4M1CD 3HE6D 5JLZB 4O2FB 1EJOL 4WNQB 4XB7A 2OZ4L 2BNUA 1FO0H 3B2UC 5FGSA 4OD3L 3DGGB 1D7FA 2EE2A 1DQDL 5E1HB 1AXTL 4Y4FC 3DRTA 3AC0A 1MI5E 1CDCA 5L2KA 3GJEB 4JDTH 3BE1H 1MHCB 2A9MH 2BFVL 3Q6GH 4RISL 1Q9OA 3QWRD 2OMNA 1MVUA 3ARWA 25C8H 1ND0B 2YPVL 4NFDA 4YR6B 2BVYA 5IVNA 3FTGA 4JFHE 4OKVA 4GBXB 4JRXA 4M00A 5FA4B 1BLNB 1CXIA 3NA9L 4K7PY 3PIQB 3K8MA 4KDTA 3NABL 5KSAB 3B3IA 5I17A 3MROA 3NZHL 3ISWA 2HFEA 4R2GB 3MR9B 2BVOA 5CMAA 4WUUB 2PXYB 3DVGB 4UNTA 2E6QA 2EDRA 1A7OH 3SN6N 1BVKB 2Z8SA 3GM0A 5HYSA 1P1ZA 3P3YA 4JRYB 3BWAA 2CK2A 1U8QA 1NH6A 4OM0L 3VXRA 3SQOL 4OIAA 2AAVA 4LIQL 2OR9H 3KWWA 4GRLC 1RK1A 5C8JA 1EEQA 1NFDE 4HPYH 4F3FA 3MV8E 2D31A 2K3TA 3QFJB 3LEXB 4DTGL 5HYEA 3LRHA 1A7QL 1J0YA 3LKQA 3CCHB 2X9YA 3U7AA 1CTOA 3KJ4C 1FN4B 5KJRH 2M2DA 4QHUB 5C0CE 5DR5L 4NQVB 1DBAL 4ONFH 3BN9C 4MNHA 3R8BB 3SKNA 4I5BA 5H37H 5C0RL 4ETQB 5EZJA 4EBQL 2PYEE 2R39A 3CUPA 1WJ3A 4HQQH 5CJXA 5FOBB 5D8JL 2DMCA 1IM9D 5E8NB 2FZ3A 5C0IA 4JFPB 1DVFC 1QQDB 3WLWD 4GQ9H 1UJ3A 4NPYA 3MRRB 4XGZB 3I02B 3W5NA 1KV3A 4JHBA 2I25N 5I71B 4JGJA 2J4WH 4ONGL 5HDLA 4F15B 4HV8B 1RSFA 4F9LA 4JM4H 1IAOA 4M8VA 5I1KL 1N64H 1G7JB 3BXNA 2WANA 2JIXB 5DEZA 1WBZA 4XNQA 4URTB 2OQJA 1U8KA 1EVTC 2EC9T 5MP6H 3LH2H 4Y2DA 5DFTA 4X8XA 2LV4A 4K94H 4G6MH 4PJAB 4WU5A 4PLOB 4R7DB 5D7IE 2FH8A 1FO0L 4U31A 3F7VB 4JHAH 1IL1B 5IP4A 3MV7A 3B9AA 5D1ZA 3RL2A 2EYSB 3LV3A 4UQ2A 3WFCH 4NQCD 4JDTL 3BE1L 4QXTA 4L8CB 2A9ML 3Q6GL 3BRDA 2PN5A 25C8L 1SYSB 4NO2B 3BGFB 2YPKB 5JW4Q 4ONHB 1C16B 2Q76A 4NCC1 4JQXA 2BNQD 3L7EB 4DUWA 1I7RA 2AVGA 5EU3A 3O3EB 2BCKB 4ZUWA 3DROA 4PJ7E 1A47A 3SE4C 2WINB 4YGVB 4EI5B 2AJZA 1CD1B 4BQ6A 5ADPH 3ARXA 1N8ZB 1P5UA 1HQ4B 1ZE3C 1A7OL 3L3JB 3BMVA 4DAGH 2XWBA 4NO3A 5DMJB 4IRJC 2H6PB 2DICA 1ZA3A 5T1MA 1OTTD 2OR9L 4S2SA 5AUMA 5HJ3B 1BD2A 1C08A 1NAKH 3GNMH 4HPYL 5E9DB 5BXFB 2DQJH 2KL6A 3SDAD 4WFGE 2R2BA 3IDYC 5DD5H 2NXYB 1NJ9B 3NBNA 3G6AB 5KJRL 2XZAH 5C0BB 4ONFL 3SDCA 3EJZD 2R2HA 4XCYB 2DLIA 1QLFA 1I8LA 4WHYH 4Y5VB 1ONQB 5MEQA 1F11B 4L8BA 2WLYA 1Q9LA 4HQQL 3LSOA 3MODH 2CLRB 2VWEC 3WD5H 3HMXA 1DDHB 3FFCB 5FYKD 4GQ9L 1U8OB 3BZFA 1K3ZA 5DMIH 5IFHH 4L29B 3G6JE 3CLEH 3OMZA 4N9OB 2F54D 1F3JA 4PG9B 4KI5F 2J4WL 2NTFA 5EC1A 3O3DA 3E6FA 1E0OB 5E2UH 5CIPA 4JM4L 1HSAB 3ZKQD 4U1GC 4GXUN 3VRIA 5INDB 1S9WB 1N64L 2ITCB 1EEZA 5JHDA 1V7MH 5BS0E 5MP6L 5DSCB 3LH2L 2HMIC 2C1OA 2YBRA 3WN5B 3C6SA 4K94L 1BQHA 3BP7A 4G6ML 1IRAY 1SMAA 3KLAA 4BM7A 2GJZB 3PABB 1BZ9A 1OD9A 1OF2A 1FC1A 1TZHA 1CFNA 4CGTA 2WNGA 1KF9B 3D0LB 3OKEB 3VFMB 1NC2D 3VA2C 1AO7D 4JHAL 4IS6A 4CMMA 3L95B 2AQ3A 3MV01 3WFCL 3DMMB 5FM8A 3V7MA 4QRRA 1OD7A 5IG7B 3DO7A 3KXFD 1WCQA 3E2HC 4X5XB 3FRUB 3WUWB 4WI2A 2HLAB 1CLOH 4PJ8A 4WV1C 1S8DA 4NQXA 3X3GH 4NWUH 3R0NA 2QHRH 3UJIH 1Q9WB 1QEWA 4ZXBC 5ADPL 3KYMA 3RI5K 4FQJH 4U1LB 4K94C 4DAGL 1O7SA 2XNAB 5MHSE 1J8HD 3OKLB 3JZ7A 1YN6B 3VWJD 1QOKA 4IIQA 1A6AA 3U0WH 4FQQA 1MHHB 5DHVH 1NAKL 3GNML 5GGVH 1PX3A 1G0XA 2DQJL 4KI5D 5DMKA 4H25B 4POUB 1XGRA 3GO1H 1WWBX 5FO7B 1I1AC 5DD5L 4YHYB 4X9IA 5JQHC 1LP9F 4PJCE 5KSUB 1PY4A 3P4MB 1UKTA 5IKCB 3O3AA 1IE5A 2XZAL 4Z7WE 2P5WD 1MJ7H 2DS4A 1IGMH 1EHNA 4EZMA 4F7PB 3QULB 1L9MA 4K3JH 3TPUA 1W72H 2XQYK 3MODL 3WD5L 1YEKH 2GTWA 5EZLB 5F9JB 1F4HA 3MBED 3VXQB 5DMIL 5IFHL 2BHUA 3G5YB 1QZ1A 1MF2H 1YZZA 1LO4H 4LHQB 3CLEL 4J3UA 3I3DA 1OAZH 3DARA 2DIAA 3UYPA 5GSVA 3BZDA 5E2UL 3TIEB 5D9SA 1HH6A 2R1WA 2IANA 3EGSA 2WWMC 1HEZB 4P4RB 4ZS6D 1S9VA 3R06B 5DC4B 5HHMB 3M17B 1CL7H 3V6OE 3QNZB 4P2OB 5CEYA 4C58B 4JEGB 1V7ML 4OZHB 2NW2B 1MY5A 4L8SC 1RUKH 5D1XB 3DECA 5IJVB 4LCCC 4K8RD 3QP3A 3KPRD 3A0OA 5HI5C 1YNKH 2HT4D 3MUZ1 1BBJB 4XHJD 5SWQB 2HLFD 1K8DA 3K74B 4QO1A 1FRGH 3V4UH 5EUOB 5HYJE 5KSVB 3R8QA 4D0BA 3O41B 1N0XH 2VLJB 1G9EA 4ZFZA 5CHNA 1BF2A 1NCAH 3FO1A 1IMHC 4ELME 3X3GL 1FFOB 2AXJA 4NWUL 1LWRA 3IDJB 3TN0D 5J6GA 3D39E 2QHRL 3UJIL 1RUPH 2VERN 1ZHLA 3QIBB 3QUMB 4FQJL 2XKUA 2MTPA 3GKZA 1NC4B 1WTLA 3ES6B 1ED3A 1MAKA 3PXHA 3O3BA 3U0WL 2LFGA 4MNGA 5C1MB 5GGVL 2EDHA 2FWOB 2YXFA 3GO1L 1D5ZB 3C5JA 4Z7NF 4U1NB 3DX6A 3AROA 2Z92A 4YFLF 2FHBA 1JF1A 4L5FH 5AWNH 1A6ZB 5K9KB 1MJ7L 1IGML 1Z9MA 4NSKA 2IADA 4K3JL 1M7XA 2BX5A 5CD3B 1W72L 1XGYH 3VXPA 1J11A 4ODUA 3DETC 1FIGH 1YEKL 3DRQA 1T1WB 2IG2H 2QV2A 3NAAH 3IVKA 5DXWA 5EZIH 4WW1B 5DYOB 2Z35B 2Y4SA 2J2ZA 3QXDA 1Z5LA 1MF2L 1QSFA 3QDAA 4QHLB 1LO4L 4P46B 1TVBB 1HXYA 1OAZL 1PY9A 1MLBB 3OR6A 3WL9B 3PGDA 2ZUWA 5BZWA 4ZPVA 5DQDH 4P5KA 43CAA 2I26N 2VLRA 1CL7L 4LHJB 1BJMA 3QDMB 4JKPH 5T1LD 4NBYB 5DHXB 3EOAB 5H2BB 3QHTC 2I9TA 5IVXE 5IMMA 3QEHB 4PRHD 2K7PA 1RUKL 3RY6A 2CDEA 5L2KE 2H3NA 4MJ4A 4LSQH 3BVNA 3FT2A 3QQ4A 4NFCA 3ORJA 1YNKL 3BD5A 2OCFD 1T0MA 4M5YH 1CICD 4JRXE 2JCCF 5JW5A 1FRGL 3V4UL 1AJ7H 1I1FA 1HNGA 1N0XL 3HUJA 5FDWA 4LSSH 4JREC 3WNLA 1JHTB 2NY0B 4L3AA 1NCAL 3BP5A 2R69H 5HTSA 3T08A 3QA3B 4PRBB 5CP3A 3LQZB 4I13B 1RUQH 4XNXH 1MIEH 2X10A 4KGJA 1RUPL 3ZDYE 5GS0C 1YMMA 4AJ0A 1A6TB 5EFIB 5FKPA 1YPZA 2EE9A 1FC2D 1Q94A 5TDPB 2Z4QB 4MS8D 4Y2OA 1JV5B 2GFBA 4Y4KC 4TPRH 2X41A 3VRLE 4DEPC 1KJ2B 5SWZD 3VGAC 3NGBC 3SQBA 5J57B 4MVBC 3DYMA 3GJFA 5E03A 4OLVH 3H9YA 3HE7A 5IVZB 3BN9D 1NGPH 3LY6A 5DMGC 3TZVB 1HDMB 4UDTB 3UO1H 5IHZA 3BO8B 3TJEH 1ZKAA 4L5FL 5AWNL 5IB2A 3GM8A 1KLGB 2P24A 4NZUH 1I4FA 1ES0B 3RKDC 3MV8B 2YEZB 1XGYL 1RJYA 3VD4A 4GLRI 2R1XA 3EYQC 1ERNA 3T0EC 1FIGL 4RAUA 3KPMA 2IG2L 2IQAA 1J5OH 4G8GA 1EEYA 3NAAL 5EZIL 5C0CB 4HGWB 4ZUUA 4YHKH 3PWNA 1IGFH 1M1SA 1H5BA 3QQ3B 1A5FH 1RK0A 2ZUVA 5DQDL 1HKLH 1K4DA 1A3RH 4JKPL 2VDPH 2H41A 3S7GA 3SGKC 4LF3A 4POZC 3H8NA 4O00A 4R6UA 3BYTA 3QDGE 3MV7E 5ANMA 4IMLA 1QTYT 4UDUA 4LLVA 3PQYA 1G0YR 5IT2H 1MCIA 1J0KA 2UYLB 1KPVB 4BYHA 4CVXA 1G7QA 3LKPB 5FYKU 2PR4H 4LSQL 5CKGA 1BOYA 2R0KH 1KTDB 3BHBA 1WBYB 3ZKSD 5HPMA 4IJ3B 1W8OA 4M5YL 2GW5A 5EC2B 1N3NA 1UQSA 1NKRA 2DWDA 4YE4H 4G9FE 2EDFA 3L5XH 4XPHH 1JWMB 3TVMA 3ROOA 5C0ND 1AJ7L 3IKCB 4KJQD 4LSSL 3AM8C 2R69L 2E6JA 4NQUA 2C9AA 1R3KB 3WIHH 1RUQL 4XNXL 1MIEL 3CC5B 3IF1B 4Z7UA 5IQ9A 1JF6A 1H3WM 2IAMC 2WLZA 3HCVB 3MJ9A 1AY1H 3GI9H 1ZA6A 3SHSA 4GKNB 4TPRL 4PGCB 5F89A 5FYKH 1ZWIA 2DBJA 3OB0H 2ZSVB 4ISVA 4X5WA 3BUYA 4OLVL 3L5WB 4ZUVA 1EJ6A 2BK8A 3OGCA 2NLJA 1NGPL 2ZOKB 1R5WB 4RMRA 3U2SB 4Y4FA 1I8MA 1BZ7B 3SO3C 3UO1L 3WHXA 3LPWA 3TJEL 3C60D 1ZGLB 2DKSA 4S0TD 5HHOA 2FNBA 1HHJA 4NRYA 4G8FA 4NZUL 1MUJA 3PWJA 5D5MA 4TULH 2C4FU 4A6YB 1Q0YH 3DSFH 3UZEA 4ZNEE 1AI1H 2FO1A 3KPTA 8CGTA 4OZFB 3MLXH 2G2RA 4E0RA 1I1RA 4CADB 2D7OA 4LPXA 5DUBA 4AQ1B 1J5OL 3VRJB 3KLHD 5DFVC 3S96B 3L3DA 4JFEA 4YHKL 4CRPA 1AHWC 3H9SA 1IGFL 4YDKH 1ZLWK 4X6CF 1OAYH 1A5FL 1B3JA 1HYRC 1DJSA 3X14B 1HKLL 3EYVA 2OZ4A 1A3RL 3G6JB 4GRLA 2VDPL 1KXQE 3IXTB 4X6DA 4YAQB 4NYLB 5J6HA 4MA1B 3VCLB 1B0GA 1CXEA 1Q9KA 1JTOA 4LAQH 3VG9C 5IT2L 4L4VD 2V9QA 2Z9TA 1IKNC 4O4YH 3N1PC 2PR4L 4M6AA 4D3CH 2R0KL 4WWKC 3GMNB 3MRMB 1IGYB 5BS0B 1QBBA 3W0WD 1H3PH 4P48A 4OD2A 2CPCA 3EZJB 3QEQB 4YE4L 2CR3A 3L5XL 4WHTB 4XPHL 2X70B 1FVCA 4HIJA 1V3LA 1DVFA 4LHUA 1ZHKB 4GKZA 4LK4A 2LTQC 5ICYB 4C54A 4L8DA 4FTVA 5D1QD 3QZWA 3L3GB 3RWIA 4DW2H 4G80B 4L9DA 3WIHL 1U93A 4HKJB 2NY4B 1EERB 3FN3A 1KNOA 3VH8A 3GFUA 5I66A 4APQC 4X6EA 5F1NB 3KDMB 3QG7H 4LPTA 1NCNA 1AY1L 2D2OA 1F5WA 2W9DH 4HCRH 1U3HA 5JOFA 1I1AD 1E27A 5C08B 5FYKL 2JB5H 5DZNA 4HHAB 1G7PA 1ZLUK 4OF3A 5JIHA 2Y23A 4XX1G 1RAMA 4H0GA 5F1KC 3AMKA 2X09A 4NQCE 3MNWB 1MEXH 4OSUH 3R0MA 1U36A 3BUTA 3LB6C 4NNYB 1A8JH 4CN1A 4DKDC 2F58H 4TULL 1Q0YL 3DSFL 4L4TB 4OCSH 1AI1L 2DQHH 1IGCH 5EO1B 3EBAA 2BNQE 4Z9KB 4PJCB 3MLXL 5CJQH 3OKOA 3TA3C 5C3TA 1BQLH 2V7NB 4Z7WB 3RVTD 1EV2E 4K8RH 4YDKL 5C0AB 4UTAH 3QUYD 3SE4A 5CEZH 4TN9A 4KK9D 1OAYL 2ZUXA 2XPGA 3LKOB 1SY6H 2FIKA 4IRJA 3U30C 3I9GH 3AY4C 1FO0A 4LBEB 1BAFH 1OPGH 2DMBA 3CFBB 4AYFA 4BFGA 3QH3A 2XKNA 4LAQL 1ZLSL 5FCUH 3WCYA 3O2DH 1D9KB 4O4YL 3S4SB 3TYGL 4P4KD 4D3CL 2WIIB 1I7TB 1DUYB 2GAZA 4XPFH 4HX1B 5J7CC 1GOFA 3PDGA 1LK2A 4CVZB 4LLYA 5GJTH 1H3PL 1T66C 5GGVY 5C0GA 4PRNA 1ZK9A 4E5XA 5A16B 5GHWH 2AK4D 3T2QA 4KU1A 4YBLB 1OT2A 4RX4A 5T3XH 2YA1A 2EIBA 1AD0A 3DTXA 4G9DA 4ODHH 3F8UB 5MERB 1BIHA 3D85A 4DW2L 4XH2A 1WZMA 1A4KB 1WIUA 5HYJB 1YNTA 1F2QA 2OP4H 3IU3B 3JV0A 2YSSB 4MNGE 4JLRA 4F7CA 3ARDD 2EIZB 3QG7L 4K7FB 4R4NC 1P7HL 1XZ0A 3GB7A 2W9DL 4HCRL 1JPFB 3B9KB 3UBXG 3D39B 4QT5B 5D7JD 3FZUD 1RULH 2I27N 5GGRY 2JB5L 4GKOA 1AO7E 1QLRB 2H32B 2PO6D 1MELA 1U6AH 5D2NE 5IBTH 3VGGA 5C09A 2X9WA 1NBQA 2WWKT 1OGAD 3NPSB 1MEXL 1ZHNA 4OFIA 4GG6A 32C2A 3QQ9C 4OSUL 3OHXA 5I1CH 3CZFA 5I1DA 3EOBA 1K8IA 5DJCB 4YDVB 2C4XA 2F58L 2RHEA 4FQ2H 5B3NA 1QSFE 1RU9H 1D5MB 4OCSL 3ARYA 2DQHL 3QAZC 2ICEB 5HVGB 1IGCL 1T21B 2YRPA 4GT7A 4MD0A 5DVKA 4MA8H 5CJQL 5E0QA 1XH3B 3GEWB 1BQLL 3HC0A 4WV1A 4U4BA 3V0WH 2VLRE 1I8IB 3ZKNC 4K8RL 4UTAL 3DJ9A 4LPYA 5CEZL 3EW3B 1UWXK 4ZXBA 3C8DA 4RGND 1J8HE 2BSRA 1OP5K 3T09A 5SWSA 2VDOH 1U8JA 3NOIA 1SY6L 4G43A 3QJFA 4RNRB 3I9GL 4BK5A 2WWKO 1BAFL 1OPGL 1F6AB 4QLRA 4Y88A 5DJ0A 4I48B 2YD6A 3EJYC 2N1KA 3IDIA 1U3JA 3FN0H 3RX5A 4BSWA 2VXQH 4I0PB 5FCUL 4CU6A 3O2DL 3RVXC 1YEHH 3ARVA 1KIQA 4D9LH 2P5WE 1NFKA 5T33H 2BNUB 1T22B 4I4WB 4XPFL 4YBQD 1MCPH 5E6YA 4TTGA 5IVXB 5FKAA 1LDSA 5GJTL 4EVNA 3DRTB 5GHWL 5L2KB 4PJXF 5JNYB 1CE6A 3G5ZA 5T5NF 1Q9OB 4WGVB 1MVUB 5T3XL 3U7WH 1FZKA 3CSBA 4CU8A 5BZDA 2BVEA 5LWYH 4X4MA 3FTGB 4ODHL 4JRXB 1YPZE 2DL2A 3B3IB 3OQ3B 5I17B 1UM6H 4N1EA 3MROB 2OP4L 3QDJD 4L3EA 2HFEB 2BVOB 1FYHB 5CMAB 4WU7A 4JGUA 2ZG2A 2NTSP 5HYSB 4OCYH 4MWFB 1XF2A 3BWAB 4PTUA 2IF7A 1U8QB 4L8SA 3VXRB 3KWWB 5C8JB 4MXVF 3GGWA 1RULL 1NGWA 3O11A 4LCCA 2AABH 3UCRA 4YZFE 4F3FB 2D31B 1U6AL 3HPLA 5IBTL 4Z0BH 5FYLD 2BSSA 3LKQB 4Z18A 2E7MA 2ZJSH 2DF3A 1KN2H 1EH9A 2B1AH 1S7QA 4G8GE 2VE6A 1VFBA 5EH1A 5I1CL 4J4PD 3SDXF 4IOFD 3D48R 4MNHB 4NN6C 4KKCD 4FQ2L 4U3HA 3SKNB 1FGNH 4I5BB 1RU9L 5FUCC 1NDMA 1FHGA 1T2QH 5EZJB 3SJVA 4RBPK 4XPGH 3CUPB 5HVFB 1LP9E 4HIHA 3P11H 4MA8L 5FGRA 2FZ3B 5C0IB 5J1AA 3V0WL 3PHQA 1UJ3B 3O9WD 4NPYB 5FM5O 4RGMC 4GW1B 3IETA 2XZCH 2J5LB 3RNQA 4R26H 1DEDA 5ANME 2LABA 4HH9A 2EXWD 2VDOL 4PY7A 3UYOD 1QFPA 3PQYE 5ID0A 4YJZL 4M6MH 2BHZA 3BXNB 4IHOA 1WBZB 4XNQB 5HDBE 3FO0H 2OQJB 1U8KB 2R29H 5E70A 3FN0L 3VFRA 5C6PB 1HE7A 1S9YA 2VXQL 3BH8A 3VFVA 1YEHL 4D9LL 4PJ5A 3TO2A 2ZCKH 5AG8A 3RWHA 5T33L 3BYYA 1MCPL 5GS1C 4HMCA 3GHEH 3QDGB 2QHLA 3MV7B 2WZPD 5D1ZB 3RL2B 4FOMA 2HWZH 3LV3B 1PD6A 4UQ2B 4YNYA 1D5XA 3H3KA 4QXTB 2E8ZA 4X9FA 3FQTA 5CJ5A 5T3ZE 4Z7UE 3S3SA 4KK6C 3U7WL 4D2NA 2VDQH 2YN5A 5LWYL 1U58A 2IH1A 4KROC 2Q76B 2G5BA 2D0FA 5DWUH 1IEBB 1I7RB 4PREA 1C12A 1XR9A 5EU3B 4ZUWB 5DHVA 1GGYA 3DROB 1UM6L 1QFHA 2AJZB 5CZXC 1WCBA 2B2XH 2VJXA 4NRZA 4FFWD 4NCDA 3HAEG 4P9HH 4NKIH 4YHOH 1WWCA 2COQA 4OCYL 3MREA 2XWBB 1CFSA 4PRHE 2BP3A 4NO3B 5T1MB 2YD2A 1ZA3B 2FLRT 4GLRH 1G9MC 3ZKXB 1BREA 4S2SB 3IFOA 5AUMB 1BD2B 1C08B 5KSBA 5HHOE 2AABL 2Q3AA 1CXLA 5D5ME 1OLZA 2BC4A 4Z0BL 2R2BB 5KG9A 2OXHA 1MWAH 4N5UA 2ZJSL 1KN2L 2B1AL 1A64A 4Z76A 4D8PA 1X5GA 3SDCB 1H15A 1T89A 3H9SE 5CSGA 4OGXH 1FGNL 2R2HB 1RURH 5M95B 4OIBA 1QLFB 1T2QL 2HVKA 5EPMA 5MEQB 4L8BB 1R5VA 4LKCA 1Q9LB 1P6AB 4XPGL 4DFHA 3P11L 3LSOB 5C92A 1UACH 4P3WA 3KYKH 4QY8A 4GBXC 5KSAC 2XZCL 4KKBC 1F3JB 4YK4C 4BZYA 2GKIA 1MFBH 4N68A 2NTFB 1HINH 4R26L 5EC1B 3O3DB 1CGSH 3E6FB 1FZMA 4H20H 5CIPB 5ILTL 4DCQB 1IM3A 4UT9H 4Q0XH 5SWZE 1WTGT 4H8WH 1FVDA 3VRIB 4M6ML 4WWID 4Y4KA 2IGFH 5M7QA 1QRNA 1MRDH 4XVTH 5D6CA 1EEZB 3ZYJA 5IMKA 5JHDB 3FO0L 4HS6A 2R29L 1J8KA 4JO4H 4BSVA 2C1OB 3C6SB 2NY2B 1BQHB 3BP7B 4U7KA 2GCYA 2B5IB 3KLAB 5IB5A 4M8QA 1BZ9B 4FQPA 3ARUA 5C9JA 2V2WA 2ZCKL 1OF2B 1YYMH 1TZHB 1CFNB 35C8H 3BPNB 4OQTH 4QYOA 4IS6B 1TMCB 4CMMB 4FTVE 4PR5A 3VD7A 2HWZL 1Y6NR 3HRZA 5D4QA 2W60A 4LIQE 3T0EA 4QRRB 2EEDA 2YWYA 4Z7OF 4TNVF 3DO7B 2CMRH 3E8UH 3EAKA 1AGDA 1MFNA 3W82A 5IGXH 4NN7B 3VI4F 2VDQL 5DVNA 4EDWH 4S11A 2EDOA 2FEEI 5GS3A 3SDDD 4LLMA 4JG1H 5DWUL 5I71C 1S8DB 4GXVH 4NQXB 3T0AA 4F15C 4ZAKD 1JPST 2R0WH 1QEWB 3KYMB 5TF0A 2B2XL 3MLTA 5F8RC 3FFDA 2DQEH 1YA5A 4P9HL 4NKIL 4YHOL 4PJBF 1BIIA 2VLKA 1ODAA 5E8EA 1VHPA 4IIQB 1A6AB 2ADIA 4FQQB 2OL3H 2P5ED 2L7JA 1JZ4A 4OBRA 1H8OA 5DMKB 2AQ2A 3BJ91 4XCEA 3RZCC 1XGRB 3JV4A 2YPLD 1MWAL 3UTSA 4QEGA 4QWWD 5HHNA 3TBYA 1VEOA 3O3AB 4ZFFA 5A2JH 1UKSA 4QHMA 4OGXL 1OL0A 1RURL 4PJGA 2DLEA 1YYLH 3TPUB 2V5TA 1N26A 2X1OA 3AM8A 5D6DC 1UACL 1UZ8A 4MJID 1T5XA 2GTWB 4OFDA 2QSQA 3KYKL 3JWNC 1NEUA 4O5LL 4P9HC 4OZ4A 1FH5H 2QQQA 4E41A 1MCHA 1MFBL 5GSVB 4PS4H 1HINL 1EXUA 4Y19D 5K33A 3DV6A 1RPQA 3PGCA 5IVOA 1CGSL 4H20L 5D9SB 1HH6B 2R1WB 2IANB 2IAMA 3EGSB 4UT9L 4Q0XL 4H8WL 1S9VB 2EICA 4IEFB 3F5WA 2IGFL 1MRDL 4XVTL 1EK3A 2JLLA 2HKFH 4OI9A 5L0QB 4JO4L 4XHQA 5FO8A 1TIUA 7CGTA 2ZUQC 3MNVA 5F9WC 1FYTA 5D93B 1T66D 1YEDA 4F80A 2VWEE 1CDUA 1YYML 1Z9SA 35C8L 3KJ6H 1S7TA 4OQTL 1IEAA 4X9BA 4HWZA 4ORGA 3S97C 2EDNA 1K8DB 5I75B 4Y5VC 2OI9B 4B41A 1EO5A 2DYPD 4OI7A 4Y16C 1C5BH 1I75A 2CMRL 3E8UL 4KUZH 5D7LD 5KS9A 4U1MA 2HJFA 3MRNA 4D0BB 1YNLH 4EDWL 4ZFZB 3FO1B 4H8WC 3VXSA 2WUCH 4JG1L 5GXBB 5KW9H 2VQUA 2P8MA 2B4CH 4P5MA 4GXVL 4KKAC 3LDBC 5J6GB 2NY1D 5B3JE 2R0WL 1FORH 3CFDA 1BWWA 1ZHLB 4OLXH 2HTLC 2DQEL 1NGZA 1NCBH 1RQ5A 5C09E 3CIQA 1ED3B 2IPUG 1FSKC 3DXAD 2CKBA 5E2JA 2OL3L 4GG6E 3R1GH 4MNGB 1CFBA 2V9RA 1MCNA 4QXWA 4UOW1 4UZGA 4WWKA 5FGBC 4JM2C 1X4YA 2IALB 5A2KH 4E42A 3CSGA 3C5JB 3HNVH 1S78D 3P9LA 3DX6B 2Z92B 4LCIH 4Q97A 1JF1B 4M3KB 2KH2B 2BMKA 4CU7A 2IADB 4HGKC 1BX2A 1YYLL 4X7SH 2RB8A 4NO5A 3VXPB 4K07A 4RFNB 3O4LA 4ODUB 2EC8A 3VXOA 5SWSE 3DRQB 1A1NB 3ZLQC 4M43H 1PKOA 3P4LA 4PIRF 3VMPA 3QXDB 1Z5LB 1QSFB 2NY3D 1FH5L 2FX8H 3ARBD 4C83A 1HXYB 3BIKA 3OR6B 3VDCA 3PGDB 4PS4L 4PRIA 4APQA 2YXMA 5BZWB 4QF1A 4ZPVB 4PJIF 1S7XA 2YS4A 4P5KB 43CAB 2P44B 2Y72A 3IFLH 3SE9H 5C0JB 3ULVF 2VLRB 1CFTA 5A43C 4V1DA 4AM0A 2HKFL 2A2QT 3MCG1 2YWZA 2I9TB 3AB0C 5HYFA 5IMMB 5DGRA 3RBSA 3L7FA 2CDEB 3FQNA 1HOCA 3FO2A 2H3NB 1IC1A 4F7EA 3BVNB 4NZRH 3FT2B 1XIWC 3FQUA 4KMTH 5C0FB 3QQ4B 5JW3H 3KJ6L 1H0DA 3LD8B 5E99H 4HS3A 4MXQC 1T0MB 4X4ME 4CW1A 1U92A 3WIHA 5JW5B 2EH7H 2NXZB 5F3HA 3TA3A 1C5BL 5JA8B 3TBVA 1I1FB 2W0FA 4KUZL 2WP3T 3CFIC 3MQIA 1YNLL 3HUJB 3BP5B 5I1EH 2WUCL 5KW9L 2B4CL 5FYLH 1P6FA 5D7KD 1QR1A 2IMNA 3OBAA 2RR3A 2WQRA 1FORL 1ZTXH 5E6ID 4FABH 1EHXA 3AY4A 4OLXL 3RDTC 3T0WA 1YMMB 4PJFF 1NCBL 2F54A 5FKPB 4P2QA 1YPZB 1Q94B 2ARJQ 3PWPA 2GFBB 4YFEA 1FGVH 1CGXA 3R1GL 1PKQE 4QHNA 3GJFB 3HE7B 2BVUA 4G7YH 3OKDA 2VQTA 3RWJA 3HNVL 1KUMA 2WP3O 4EUPG 4LCIL 3ULVD 5IHZB 3ARZA 4M61A 1XAUA 2BRQA 5HVHB 5IB2B 3SDYH 2P24B 1I4FB 5ID1A 3BZ4A 4X7SL 1RJYB 3WFBH 2R1XB 4RAUB 3KPMB 4WHDA 4HKZA 4YBHA 2IQAB 1CG9A 4G8GB 1EEYB 5L8LB 4M43L 2HRPL 2DBLH 4ZUUB 4IMKA 2VZTA 3PWNB 4MB5A 3KXFA 2FX8L 1D6EA 3CMOH 5FO9A 4PB9H 2ILLA 1H5BB 1AIFA 1TTGA 4ZQKA 1RK0B 1TETH 2A6IA 3S3PA 5I74B 4F37F 3IFLL 3SE9L 3KYAA 5DI8A 1ORQA 1K4DB 2BSED 4PJ5E 1QFUH 4PLJC 2UV3A 5CJOH 4PRDA 2YUXA 5EUKA 1BWMA 4IRSD 5IEKA 5JHLH 3CSYA 3C6LB 4AEEA 4OF5A 4LF3B 5SX4H 4WTZG 5ANMB 4IMLB 4X4XA 2VLME 4UDUB 4LLVB 3PQYB 5JR1H 1Z0NA 4CVXB 1G7QB 5ACMA 3MRIA 5IV2A 3JSSA 4NZRL 3WFEH 5JW3L 1FFPA 3BHBB 1FNEA 5F7DA 5E99L 5HPMB 1MHEA 1QBMH 1B6UA 1MCLA 2HA1A 1T7XA 1N3NB 4DVBA 1UQSB 2EH7L 2DWDB 1L7TH 3TVMB 4O02H 3ROOB 1VEMA 4P99A 4HUWA 1L6ZA 1ORSA 4UBDC 4H1LG 5CZXD 5I1EL 4HCRA 5FYLL 1IJ9A 3CAFA 1F2XK 1ZTXL 4TSBH 4EN3D 4FABL 4Z7UB 3QNXA 4OCRL 5GZOC 2ERJB 1DL7H 4RMUA 3QUXD 4PJHF 3WYRA 5IQ9B 1LE5A 3H9HA 4KJPC 4K55A 4GOSA 1ZA6B 3ESVF 1K4CA 2YD9A 1FGVL 3V0VA 5EORH 1ZT4A 5F89B 3UX9B 1ZWIB 1ZSDA 4X5WB 3BUYB 4NUGH 4G7YL 4ZUVB 2F9BT 3OGCB 2NLJB 5TE6H 4Y4FB 1I8MB 5FFLA 4LSTH 3V6ZA 1BVLA 2QQKH 4D0DA 3SDYL 5HHOB 1HHJB 4NRYB 1MUJB 3KPRA 3PWJB 4JY5H 3MLUH 5D5MB 5DT1L 4GBXD 5DRNA 4KKLC 4DOHB 4PJAF 4Y4HC 1NLBH 2A83A 5KSAD 3CDGA 3W11D 3WFBL 4ZO6A 5A2LH 1SY6A 2G2RB 5EBMA 5H35A 4HT1H 4E0RB 2R8SH 5DUBB 4R2GD 3EOTH 2NY0C 1PJ9A 4WUUD 3MCKA 2PXYD 4O9HH 2DBLL 3QDJE 3L3DB 4JFEB 5TGBA 1EAPA 2CLZA 3H9SB 3VXUE 2VC2H 4PBWD 1WAAF 3CMOL 4PB9L 1MQKH 4JRYD 1JP5A 3BD3A 4EXPX 3LN5A 1ZVHA 4F9PC 1EBAA 1REIA 1A21A 3O2DA 3TNMA 2W07A 1L0YA 2CO7B 3BGAA 3EFFA 4RMTA 1QFUL 5CJOL 3QFJD 1XEDA 4GRLB 5JHLL 4X6DB 1EDQA 3AAZA 5J6HB 3FRPA 3OL2A 1Q9KB 2MSPA 1BJ1J 1YQ2A 1EO7A 3T3ME 5JR1L 1WZLA 3FJTA 2GHWB 3TZVC 3WFEL 5SV4A 3KJ4B 3WHE1 4XWOD 4H0HB 2ZG3A 3U7YH 4ZFOL 4GAJH 1QBML 4TVPD 4OD2B 1SQ2N 1OAXH 3RKPA 1CDGA 2NCMA 3SEPA 2BSTA 1Z2KA 4ZD3H 3FAWA 1L7TL 2PW1B 4DN3L 4O02L 4BK4A 1FVCB 2DWEA 1A6WH 1DVFB 4LHUB 4GKZB 1R6VA 5HSFA 4L8DB 4FTVB 3EYFA 4HJ0D 4TNWF 2VXVH 3QZWB 3RWIB 4PJXE 4Y1AA 3P4NA 2JIXD 1ROWA 4WI9A 1U93B 4TSBL 2FJGA 1KNOB 3LIZH 3D3VA 5I66B 1DL7L 3TFKD 4KY1H 1UM5H 1CIUA 1SVZA 3S35H 4MQ7A 5F71A 1U3HB 5JOFB 4AEHH 1MHPH 1E27B 3NTCH 4HWBH 4ORZC 5ESVA 3DX9A 1RUMH 5E94A 4NUGL 4R7NA 4PJGE 1UH2A 1I7UA 2D7NA 5GS1A 3V0AC 5TE6L 3ARPA 4NUJA 1JRHI 2NPLX 5JOEA 1HZHH 4LSTL 4UAOC 4JFXA 2QQKL 1VEPA 3AVEA 3SBWA 1DEEA 1T6WA 1HSBA 3MLUL 4JY5L 1CWVA 3QIUC 4HUVA 4M7LH 1NLBL 2DJ4A 4HT1L 1CICA 2R8SL 3OKOB 5FECA 4EI5D 3EOTL 4OF6A 5DUMH 2G75A 5CFHA 4O9HL 2F53A 1U0QA 1F58H 2VC2L 3F12A 1FG2A 3F7QA 5JMRA 1MQKL 4OZIA 3U9UB 1F4XH 5TDOA 2J7LA 2VXSH 5L8KB 5H8DA 2FIKB 5TH2A 1WV7T 3L3KA 1FYTE 4K71C 4IRJB 5E9DD 3FOLA 4Y8DC 3GMOA 4ODWA 3ZHKA 1BGXH 1M6OA 3QH3B 3F58H 1D5BA 2VR9A 1OARH 2NXYD 5HDOA 2XKNB 4PJDF 4GKSA 1WEJH 4JPWH 5C0BD 4JN1H 3IDYB 1P9MC 2FL5A 4JFQA 3K3QA 3B5TA 2J88H 2GAZB 1UXWA 3T1WA 3U7YL 2ESVA 1LK2B 3CD4A 4GAJL 3B43A 1P4IH 4LLYB 5L8JB 2Y9RT 3FFCD 5C0GB 3VXSE 4PRNB 2VISB 1OAXL 1QA9A 3MYJA 3F7YA 2KQNA 5C0DA 3WNKA 1A6WL 2X9XA 3U36A 2DTSA 4YHPA 4WDIA 1J0IA 2UWEA 1AD0B 3DTXB 2FDBP 1JWSB 2VXVL 4G9DB 5C70A 4XP5H 3IRPX 3FB7A 3D85B 4EQ3A 4XH2B 1TZGH 1W0YT 5KANI 1YNTB 2PF6A 1DE4A 4U1GB 4X5LA 4JLRB 5EU6A 5DO2C 2VXTH 2XQYG 3LIZL 3MLZH 4TSAH 5LQBH 1UKQA 2Z93A 4F7CB 4KY1L 1UM5L 3IDMA 5I1JH 3S35L 4V2CB 1IZKA 4BELD 1XZ0B 3GB7B 3JXAA 1LDPH 1CDJA 3OXSA 2APWA 3ELAT 1FFQA 3KHOA 1U8LB 4AEHL 1MHPL 1JCKA 4OZFG 3NTCL 1NCDH 1V8HA 1AKJA 1RUML 1HHKA 1KCKA 3WIIH 5C09B 4OFYA 3DMMD 3WV0A 1B9ZA 3HZKA 4JFFA 1HZHL 2AJVH 4GG6B 1ZHNB 32C2B 3OHXB 4CDGC 3CZFB 5I1DB 3UTOA 3EOBB 1K8IB 3BP4A 4M5ZH 4OZHF 3T1FA 6FABH 3TT3H 1MFDH 4M7LL 4MD0B 3V8OA 1F42A 2MQ3A 1F3DJ 4GS7C 4LFHD 4PRPA 4R8WH 3HC0B 4WV1B 1MCWM 5DUML 1F58L 1PZ5A 4V1DE 4JPVH 2D7PA 2RCSH 4ZXBB 3PV7A 4NT6A 1F4XL 2BSRB 3OKMA 1F90H 2HT3D 3W39A 2VXSL 4WTXA 1H3GA 5SWSB 5EUOF 2CIKA 4G43B 1FPTH 3QJFB 2R4SH 2E7LC 2UVFA 2PKDA 1BGXL 3ZE1F 3F58L 3LVEA 1OARL 3I6GA 3IDIB 3QUZC 2YPLE 3RZCA 2ZUYA 1WEJL 3PHOA 2FEEL 3H42H 3MLSH 4JPWL 4BSWB 1H9VA 4JN1L 1KIQB 1RJZA 4C56A 2J88L 2X89A 3QHZH 3TIDA 1RZGA 5FKAB 1P4IL 3GMMA 4EVNB 4GUPA 1YEIH 2ICWI 5D6DA 1CE6B 3G5ZB 1MCFA 3I6LD 1PX4A 3FQRA 5C6TH 1FZKB 1PYWA 2P47B 4JY4A 5BZDB 4Y19E 1GHFH 4P2QE 5HHMD 4XP5L 2ADGA 1OQXA 1KYOK 1SEQH 5I1AB 3PWPE 4P2OD 5J13B 1TZGL 3ULVH 2EDBA 4L3EB 3VFTA 2OSLA 2VXTL 3MLZL 4TSAL 4WU7B 5LQBL 2FH6A 5JORA 5D1XD 1JGUH 5I1JL 1B2WH 5SV3A 1XF2B 1M7IA 4PTUB 4L8SB 4NNPL 2X4RA 3GGWB 2OTWA 1NCDL 1NGWB 4LCCB 4PJEA 4M7LT 3C08H 2NR6D 4J7RA 3HPLB 3WIIL 3OJMB 5IR1A 4Z77A 2BSSB 2V5SA 3QCVH 1Q1JH 3QPQC 2AJVL 4GW5A 1S7QB 2BY3A 2VE6B 3TCXA 1VFBB 4ZG1A 5JXEC 2VLJD 4M5ZL 4Y16A 5D7LE 6FABL 3TT3L 1NDMB 1MFDL 4RWYH 3SJVB 2IQ9H 1TJIH 3PJSA 4HIHB 1IKFH 4ELKA 4JO3H 3HAEH 3QIBD 3FN9A 5J1AB 4J3WA 1WWWX 1P7KA 3MFGB 1H8SA 3KPOA 3PHQB 4JKLA 4KQ3H 5F97E 2LU7A 3IETB 3X11A 1NC4D 3BAEH 1MJUL 2JB6A 4JPVL 4AIZA 3WXVH 3BP6A 3S4SG 5CZVH 2PYFA 1F90L 4HH9B 3QRFM 5DJAA 1A22B 5ID0B 1DBKH 1FPTL 2R4SL 3SCMC 4N0CC 4OQTA 4BZ1H 2B8OT 2ED8A 4IHOB 4JFDA 2DB8A 5FGBA 5E4EC 3VFRB 4JM2A 5I15H 5LJYH 1GSMA 3B8SA 1NSNL 2UUDK 1S9YB 3H42L 2R56H 3MLSL 4MDIA 3BH8B 3VFVB 3H2WA 4PJ5B 4XNMA 3TO2B 4HG4J 4P3DA 1MCJA 3RWHB 1T83C 4N9GA 3QHZL 4Q74A 1DSFH 2JTDA 1P4LA 3BDYH 3QEUA 5LGKA 4YNYB 1D5XB 1YEIL 4UUJA 1C7TA 3C2SA 3FQTB 4P46D 5GS2H 2AKRB 2YOCA 1BQUA 1VADA 1DR9A 1C7SA 4HLJA 2JKXA 1NBZA 3OF6D 4B0MM 1U58B 2IH1B 4LLAA 2DM3A 2G5BB 1GHFL 5IBUB 3S35X 5HGAA 1RZFH 2CQVA 1NFDF 3QDMD 1C12B 1SEQL 1XR9B 2OL3A 2APXA 4KJPD 2UY7A 4BUHA 1L7IH 3ULVL 2KBGA 4OFKA 3Q5OA 2O5YH 3OPZL 1WCBB 1OCWH 4NRZB 3WBDA 2XACC 5IWLC 5A1AA 2O93L 1JGUL 4ENEC 1B2WL 3MREB 1AGEA 3A67H 1CFSB 2PTTA 2FO4A 1PVHA 3UPCA 1OAQH 5DA4A 3IFOB 4XVUD 3WS6C 1HKFA 4WEUD 3WEXA 5JXAH 1MJJA 4TOYH 5KSBB 5ESAA 1UXSA 1XIWA 5CEZE 3C08L 4XC1H 3GUTA 2BC4B 3G5XA 4TNVK 3ZKMC 5KG9B 3QCVL 3DBXA 1Q1JL 3DV4A 4NM4H 2YD3A 4Z76B 2ARWA 4D8PB 5DQ9A 4YXLH 2NY0D 4Z78A 3H9ZA 5D2LA 5FYJH 1M05B 4RWYL 2XV6B 2HVKB 5EPMB 2IQ9L 1R5VB 4LKCB 1TJIL 2OLDA 4XB8A 4JREB 5J4MA 5JQ6L 1IKFL 4JO3L 4QNPF 3RA7H 4YC2B 5T1KA 5C6WH 1MCKA 4FQXA 2AK4A 3B6SA 4FS0A 2C26A 4JFHD 3U48A 4WW2C 3QYCA 3BAEL 1N4XH 2X1XR 4KZDH 3RDTA 4KJWC 3RPKA 3T04D 5CZVL 5D7IF 1FZMB 1IM3B 2CSPA 2H1PL 3EFDH 3UZQA 1DBKL 1FVDB 4Y4KB 3HZMA 2VSCA 3CLFH 3VXUB 4DEPB 1BQSA 1QRNB 3ME0A 3NGBB 5F1SA 4AH2A 4BZ1L 5D6CB 1PG7X 5IMKB 1TVHA 4HS6B 3TZVD 3DO3A 4BSVB 5J56B 5I15L 1CLCA 3CZJA 1ZLVK 2GCYB 2MKLC 2R56L 5IB5B 4M8QB 3MV8D 5C9JB 1G1YA 2EO9A 2V2WB 4PGDA 3U83A 4GW4A 1DSFL 1GC1C 3JV5A 1J18A 1X5HA 3BDYL 4MDJB 4PR5B 5C0CD 1QR4A 3HRZB 4Y1AE 2W60B 3HNTH 4HF5H 3T0EB 3UAJC 2FRGP 5HYSG 4XNYH 5JIPA 1AGDB 5IJKC 3UPRA 2BY1A 4JVWA 4LLMB 4LEXH 3D2UA 1RZFL 4OCLC 3BQUC 1L7IL 4XBPB 4F9LC 2O5YL 5BW7C 2DLTA 4RSVA 1OCWL 3MLTB 3FFDB 5IOPA 4MD5A 1BIIB 3A67L 2VLKB 1OTUC 5E8EB 1OAQL 4Y2DC 5ESQB 2ADIB 3RIFK 5JXAL 4TOYL 1J87A 4XC1L 1QFWM 1UA6H 5F3BA 4XCEB 2RIKA 1XGPA 3QIWC 3JV4B 1A7NH 3QPXH 4NM4L 3UTSB 3G6JF 4D9RE 2VB5A 5HHNB 4WJ5A 3TBYB 4ZFFB 3HC4L 3OX8A 2F53E 3G9AB 2DOCA 2FEDC 4YXLL 2B0SH 1HHIA 4QHMB 3RAJH 4PJGB 3RJDA 5FYJL 5J3HD 1SBSH 1OP3H 4OZIE 3P2TA 2R9HC 1C5DA 3VFNA 1XF1A 1UZ8B 1T5XB 3L3OA 1NGXA 1G7IB 4OZ4B 4Z7VE 1N4XL 4E41B 4KZDL 2F8OA 1EXUB 4P59H 1X5JA 2CLVA 3DV6B 3ZHLA 4DGYH 5JPNA 3PGCB 2IAMB 2OM5A 3EFDL 4U2ZA 2XIDA 3CLFL 3STZA 2ATKA 1IQDA 2ZNWA 3WO4B 5EULV 2ESVE 2EXYC 4P49A 1AGFA 5FO8B 3N50A 2OR7A 4HWNA 4ZYKB 5JO5A 3MNVB 5F93C 1FYTB 2MQCA 1QUNA 1NDGA 1YEDB 3SO3B 3SKJH 4WFGD 3GSRA 5HI4D 1S7TB 1IEAB 4YDLC 4HWZB 3KR3H 3S34H 3JTSA 2UWEE 4ORGB 3MO1B 4Y4HA 1I8LC 3A6BH 3MUHL 4AG4H 5B4MD 1FQ9C 4HF5L 4XAKE 4XNYL 2APVA 5KS9B 4U1MB 2HJFB 5EU6E 3MRNB 5A3ID 3ZDZE 4F7MA 2BERA 2VUOA 3VXSB 4NQSA 5DD1H 2P8MB 4P5MB 1QNZH 2X6MA 4KGLA 1JRHH 3FHAA 4D9QD 5HVWA 2E7CA 1FV1A 3CFDB 1ADQH 3DVFA 3HFMH 4PJCF 1NGZB 2C3VA 3DHJA 3PL6C 2UY6A 5FA3A 1K3IA 2BY0A 4FXKA 1I8KA 4FQ1H 1TCMA 4Z7WF 4JFFE 2CKBB 3VG9B 5BVJA 3GMQA 2NY2C 5BS0D 3AS2A 3HTLX 1HWGB 3ULSA 5HXMA 4WWKB 1UA6L 4TVPE 4E42B 4KK8D 4RAVA 3QEQD 1A7NL 1KB9K 3QPXL 3P9LB 4JZJC 3MV11 2NNAA 3CDYA 4N0UA 4PRPE 1PAMA 4CN4A 4MD4A 2B0SL 2BMKB 1A4JA 2ATPA 3RAJL 1BX2B 3MX0A 1SBSL 4AK1A 4NO5B 3QISA 9CGTA 4KRNA 3O4LB 2NY4D 3VXOB 4KDWA 2IH3A 4F2MA 1JNNH 1KEGH 2AJYH 2Y7QA 4X7TA 4PJ8C 1MCOH 4PTTA 1QFWI 3VD3A 2YD4A 2R2CA 4C83B 3BIKB 4UNUA 1N2RA 4PRIB 2FGZA 4APQB 4P59L 3RWFA 1JZ3A 4DGYL 4QF1B 4BFIA 5C08D 1S7XB 1Y6MR 3Q5TA 1T7VA 4JDVA 5JZ7D 3AFLA 3SDXA 1CFTB 5MHSD 1WAAE 4IIQC 4XRCA 4C56E 4EUPH 4V1DB 3NH7H 4ZFOA 1INEH 2V5RA 4G6JH 2IPTH 3M1BA 2NX5A 1K85A 1UB5B 2LVCA 2MQ0A 2VLLA 3L7FB 5IB1A 4R9HA 3FQNB 1HOCB 3FO2B 4F7EB 1H3TA 2K9UA 3SKJL 3FQUB 4L4TD 1H0DB 1QHPA 3KR3L 3S34L 4HS3B 4GRWH 3C5ZC 2E6PA 3QIUA 2X1WL 4XWGH 3E3QC 1U92B 4CW1B 3SO5A 3A6BL 3QI9A 5CD5C 4AG4L 1BFTA 5C0AD 2JJWA 5F3HB 3TA3B 5LG1A 3TBVB 2W0FB 1CLZH 5BJTA 4F37K 5CSZA 3ALWA 3MRBA 4UIKH 2ZG1A 5DD1L 3K46A 1JNHA 3ETBF 5HPOA 3OZ9H 1QNZL 1QR1B 2VQ1A 1S3KH 4X7DC 4KRMB 1JRHL 1J9CT 4YIQA 1JYWA 3GSUA 7FABH 4J3SA 3U30B 1ADQL 4TTDD 4PJEE 3HFML 5HGDA 4P2QB 1D9KD 4DJMA 4FQ1L 4H0IA 4S1DD 3PWPB 5L0QC 2XXMB 2Z8WC 3EIFA 2X5PA 1QFOA 4LLUB 4QHNB 3OKDB 1J88A 5DJXA 2GY5A 3RWJB 1FL3A 5CGYC 2X1PA 4QRPA 1T7ZA 4N90E 4M61B 4H1LH 1IFHH 4LP4A 1F6FB 1X5LA 1OAKH 5ID1B 1VESA 3IYLW 3BZ4B 3J7HA 2VMFA 1U8IA 5B39A 5GGSY 5DZLA 5HYJD 2N7BA 1OTSC 2EEAA 4U6XA 2K7QA 4HDIA 4HKZB 1YEFH 1JNNL 1CG9B 3RWEA 4GAYA 5DEGA 1KEGL 5LVEA 2AJYL 4M9OA 1MCOL 4XI5C 5IVXF 1CGWA 4JFDE 1D6EB 5FO9B 4RZCB 5AAWA 3B9KD 4ZNCD 4ZQKB 3D39D 4UQ3A 4TUOA 3NN8A 2A6IB 1R24A 3TNNA 5DI8B 1K2DA 1ORQB 4ZAKA 1NMAH 4PRDB 5EUKB 3CSYB 4UI2A 4TVSa 2F15A 3NH7L 1INEL 4G6JL 2IPTL 3BW9A 1XT5A 2A6DA 4X4XB 2A6KA 3HHRB 4WGWB 4BQCA 3MRHA 3BIAX 3RGVC 3MRIB 5IV2B 4MHHG 1FFPB 3EYSH 3T2PA 1FNEB 5F7DB 5F9AC 1MHEB 5GJSH 4XWGL 3MRJA 3QAZB 2F5BH 2EO1A 3M8OH 5F7LB 3ZDYF 1OB1A 2CDFA 4DVBB 5JA9A 4NKOA 5DD3H 2P45B 2XYCA 1CLZL 4N5EC 4LCWA 2EE6A 4HUWB 4Y89A 1WLHA 4AEFA 1ORSB 1BJ1H 1TVDA 5E5RB 3W9DA 4UIKL 3VRLF 3V4VH 4HBQA 3DSNA 3OZ9L 1I9RH 4MJIA 1S3KL 3KG5A 4JZOA 4HWBA 1INDH 5ALCH 3QNXB 2PNDA 4ZO7A 5EWIH 7FABL 4HW6A 5FXCH 4LCYA 1Q0XH 4XNZC 3A6CH 3GSQA 4FFYH 1LE5B 3H9HB 4I0PD 2H9GA 3MNZA 3FO9A 4QRQA 1BECA 3HLAA 3QUZA 3V0VB 4P23C 1SJHA 1ZSDB 1CQYA 3ZL4H 5D2LE 5L2KD 1TQCC 3P9WB 5TE7H 3KPQA 3I6LE 1IFHL 4J6RH 3V6ZB 1BVLB 4D0DB 1HXMA 1OAKL 4TNWK 4LP5A 1Q38A 5GRUH 1XF3A 5DRNB 4JRXD 4YHIA 4LSUH 2IPUK 4IRZH 2A83B 5F9OH 4DQOH 3CDGB 3E6HA 3RIAF 5H35B 5EBMB 1A9EA 3C5SA 1YEFL 3LS5H 3L3HA 3MCKB 3KPLA 3UJTH 5FOJA 5TGBB 1EAPB 1OSZA 2CLZB 5IEHA 3QCUH 2NY5C 3VXRD 3LN5B 4W6XB 4U2YA 3LKNB 4ZFGH 4NKMA 4FG6C 4BA8A 5AYUH 3EFFB 1NMAL 2IBZX 4N8VA 1E28B 3BKYH 1V5JA 5LGJA 3RTQC 5HYQA 4C55A 4OAWA 3DVNA 2BNRA 2EZ0C 3VFGH 1G7MA 2VLJE 3HZYA 5ICXA 1DFBH 3TBWA 3EYSL 5JXEA 2XA8H 3UAJD 4MA3A 1NBYA 4MXWH 5GJSL 4U6YA 1JPTH 2P1YA 2F5BL 4PUBH 3M8OL 4UMGA 3ULUF 3JVGC 2BSTB 4LMQE 4UU9B 5IROC 1CTNA 2DWEB 5DD3L 4M9PA 3GMLB 4RGMB 2HG5A 2JJSC 3EYFB 1IILE 3V4VL 4Y1AB 2W1NA 5GZNC 1I9RL 1H5BC 1ZMYA 3P4NB 3P4OB 1N59A 1INDL 5ALCL 2XG5A 3MTRA 5EWIL 5HI3D 5C07A 2FJGB 4RCAA 1Q0XL 3D3VB 4TSCH 1GZQA 3A6CL 4ETYA 4FFYL 3WS3A 3V6FA 4CN6A 2IJ0C 3H6JA 2VKXA 3OGOE 1EIBA 5JW4R 3QDGD 3MV7D 2Y6SC 3L9RA 5D1ZD 5ESVB 3DX9B 5E94B 1T83A 3OXRA 4R7NB 4WCYH 3ZL4L 1VDGA 1RJLA 4U1SA 5F72S 1I7UB 1S7UA 5GS1B 4D0CA 4D94A 4FFVD 4NUJB 5TE7L 4MAYC 3PDOA 5E56A 4J6RL 4JFXB 4Q6IC 4RGOH 3BT2L 4FA8A 4M7KH 5GRUL 1DEEB 1CIDA 1IT9H 4OZGA 4LSUL 4HUVB 4IRZL 1WGOA 5F9OL 4DQOL 2VL4A 5IQ7H 3QDME 4KROB 3LS5L 2G75B 3DX7A 2F53B 3T3PF 3UJTL 4Y5YA 4XTRD 4PBVC 4A6YH 2HFTA 1FG2B 3QCUL 3QEGH 4FQCH 4OF8A 1UH3A 2RAMA 4OZIB 2EEBA 5TDOB 3UTTA 3ULUD 5IWLA 1BD2D 4FHBD 5TH2B 1X5YA 4HZAA 3L3KB 4JB9H 5GGSA 5AYUL 4JZNA 3FOLB 3KYOA 4ODWB 4OUOA 2X1QA 3WS6A 4Z7VB 3BKYL 2G9HA 2AQ1A 3KPNA 1D5BB 1V3JA 3UJJH 2CUMA 2XXCB 3ZSSA 4NKDA 4GKSB 1F3DH 4I2XA 1EUUA 1A6PA 3DPBA 3SDCD 4NDMA 3VFGL 3MACH 1P84K 2FL5B 4JFQB 1DFBL 1E6JH 2XA8L 2Z8RA 1UXWB 3TF7C 4DKFH 2ESVB 4MXWL 4LQFH 1CXKA 5BV7C 5J9PA 1JPTL 2PUQT 5GGUA 2Q86A 4PUBL 2VZUA 3OR7A 1QA9B 1RFDH 3MYJB 3G9VA 2V9TA 5C0DB 3PP4H 5IESH 3U36B 4YHPB 2DDQH 4WDIB 2UWEB 1UT9A 4WW2A 1OOAA 2OJEA 4YK4B 5CP7A 4XT1C 3FB7B 4Y0GA 3ARFA 4NRXA 5JHDD 4DZ8B 1QHOA 1HYSC 1OQOA 4JFOA 1DE4B 5KVEH 1RI8A 5I0ZA 3CX2A 5EU6B 4TSCL 2NY2D 2HTKD 2Z93B 2X4NA 3FL7A 4P57A 1ITBB 2AJ3B 3IJYA 4XZUA 3IDMB 5HDQH 4RIRA 4U6HA 3OXSB 4OCNC 4G7VH 5KOMC 4GAGH 5DUPH 2FYYA 4N0UE 4NKQB 2VDLH 1T0PB 1AKJB 1HHKB 4WCYL 4PYHA 4PLKC 4G8EA 3HZKB 1J05B 4N1CA 2WBJC 3EYOA 4QRRD 3HAEA 4JFFB 4JFYA 4CVWA 1CT8A 3MRCA 4WI3A 4KC3B 1A2YA 5EZOH 4RGOL 3T1FB 3BP4B 4M7KL 4OCWL 5EG6C 3GZKA 4MHHI 1IT9L 3RBGA 2IBZY 2A0LC 3T65A 1WBXA 5IJKA 4PRAB 5IQ7L 4LU5H 4PRPB 3U1SH 4G6AD 5I9QC 2IBGA 2FBJH 2DM7A 3BQUA 4A6YL 5IBLD 2MCPH 1PZ5B 3QEGL 4RMSA 3MOAH 5BW7A 4FQCL 4PP1C 4G5ZH 3HS0B 4NT6B 3OKMB 3W39B 4QNPE 2QQLH 3VWKC 2CIKB 3CK0H 4JB9L 2DI7A 2ICCA 2J8UA 2H8PA 1U3HC 3MJGX 1AC0A 1AR1C 4NFBA 3UJJL 3I6GB 1HH9A 1KENH 4HLZH 4LHUG 3RZCB 4RFOH 3PHOB 3QIWA 5E8OA 3MACL 3DGGA 5A2IH 5CLTA 1IGJB 1RJZB 3F6IA 4AY0A 1E6JL 4C56B 2D0HA 4DKFL 3TIDB 4EI6A 3C2AH 4HPOH 4I77H 4LQFL 1BJ8A 2E27H 1AE6H 2XWTB 3GMMB 4GUPB 5KBNC 4J3TA 3RWDB 2A1WH 3I75A 3MPCA 5I0DA 1RFDL 3FQRB 4M3JA 5ERWA 3PP4L 5IESL 1KTLA 2DDQL