2H0JA

Crystal structure of pucm in the presence of 5,6-diaminouracil
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
114
structure length
112
Chain Sequence
MGKLTTHILDLTCGKPAANVKIGLKRLGESIMKEVYTNNDGRVDVPLLAGEELMSGEYVMEFHAGDYFASKNAADQPFLTIVTVRFQLADPDAHYHIPLLLSPFGYQVYRGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transthyretin-like protein pucM
publication title Structural and functional analysis of PucM, a hydrolase in the ureide pathway and a member of the transthyretin-related protein family.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 22
structure length 112
sequence length 114
chains with identical sequence B
ec nomenclature ec 3.5.2.17: Hydroxyisourate hydrolase.
pdb deposition date 2006-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 2h0jA00
4TLKA 4ABWA 4MASA 1THCA 4TQ8A 4YDMA 4KY2A 4PMFA 2TRHA 4IKIA 3TFBA 3CN2A 5CN3A 5L4MA 5FW8A 1DVZA 4IKJA 4TNGA 3GPSA 1OO2A 4HJUA 4PVNA 4YDNA 3CN4A 4TQPA 4MRBA 4Q14A 4PMEA 3KGSA 5HJGA 2B15A 2H4EA 3D7PA 3DK2A 3GS0A 2H6UA 3D2TA 3DK0A 2H0JA 3CFMA 4TNFA 4Y9CA 5JIMA 3CN1A 3IMTA 3IWVA 4DERA 1G1OA 1IIKA 2QGBA 5TTRA 5IHHA 3TCTA 2F7IA 1ETA1 2ROXA 4TLTA 2NOYA 1E4HA 3IWUA 4FI7A 5CLXA 5K1NA 1SOQA 1TTBA 3ESNA 1IJNA 3GLZA 3CFTA 2H0EA 4IK7A 4TNEA 1FH2A 1DVYA 3IMWA 3SSGA 3CXFA 4ABQA 3IMSA 5E23A 4TM9A 4L1SA 4QRFA 4QXVA 5L4FA 5L4JA 2G2NA 1GKEA 5CNHA 4TKWA 3Q1EA 4PWFA 4Y9FA 1DVQA 1IIIA 3P3RA 4DESA 2GABA 2G2PA 3I9IA 3IMRA 5AKSA 5E4OA 2G5UA 5AKTA 2B77A 1E5AA 1BM7A 5EZPA 3NESA 4DEUA 3GRGA 1ICTA 4PWKA 3NEOA 4WNSA 4Y9GA 2QGCA 3CN3A 4IKKA 4TL4A 4TL5A 3OZLA 2G4GA 3FCBA 4PVMA 5CLYA 3DGDA 3CFQA 1QWHA 1SOKA 3KGTA 5AYTA 5K1JA 3BT0A 1TLMA 3DJZA 5CLZA 3P3UA 1Z7JA 4WNJA 1THAA 4N87A 5L4IA 4AC4A 2FLMA 4D7BA 1DVTA 4DEWA 1BZDA 2QPFA 2H1XA 3ESPA 3P3TA 4I85A 5DEJA 2WQAA 5E4AA 4PM1A 1DVUA 1X7TA 4TQIA 1ZD6A 5FW7A 4N86A 3BSZA 2B14A 2G3ZA 3DJRA 3GS7A 1TTCA 1F86A 4FI8A 3DJSA 5CM1A 3IMUA 1SN5A 2GPZA 3W3BA 1X7SA 4ACTA 3NEEA 3U2JA 4HJTA 3A4FA 1U21A 5EN3A 5CR1A 3B56A 1BZ8A 3NG5A 4HJSA 5BOJA 1TZ8A 1DVXA 3OZKA 3QVAA 2QELA 1BMZA 3DO4A 2B16A 3DIDA 1TYRA 3A4DA 4AC2A 4ABUA 4WO0A 2G4EA 4L1TA 2PABA 2B9AA 1RLBA 1QABA 4PWEA 3P3SA 1E3FA 4HIQA 3NEXA 5JIQA 4IKLA 4HISA 4MRCA 3CFNA 4N85A 3IMVA 4PVLA 5FO2A 5AL8A 2IGLA 1FHNA 1TFPA 3GS4A 5FW6A 4ANKA 4TQHA 1SN2A 1IE4A 3HJ0A 3FC8A 3ESOA 3IPEA 1TSHA 2ROYA 4PWJA 4DETA 4Y9BA 1BZEA 4PWIA 3I9PA 5AKVA 5JIDA 4I89A 1TT6A 2G9KA 1DVSA 4Y9EA 5A6IA 3GRBA 3IPBA 2H0FA 4IK6A 2FBRA 4PWHA 4ABVA 3CBRA 1ETB1 1Y1DA 2QGEA 5DWPA 4QYAA 4IIZA 4TLUA 2TRYA 1KGIA 4PWGA 1ZCRA 3KGUA 4FI6A 2G3XA 1TTRA 3U2IA 3A4EA 1SN0A 2QGDA 3DJTA 3M1OA 1F41A 4I87A 3CN0A 1GKOA 4TLSA 5AL0A 1KGJA 1TTAA 3I9AA 2F8IA
chains in the Genus database with same CATH superfamily
2OSXA 3K46A 1SGKA 1DFBH 4WHTB 1XIWD 1SYVB 3RWEB 3UBHA 1HEHC 5HYQB 3TFBA 3MRCA 3P1VA 2NX5A 1CGXA 3JV4A 4PJGF 4AQ8A 1SBSL 3MNZB 2P80A 4I18A 3MA9L 5J8OA 4PMEA 4YMPA 1T4KB 4M1CC 4R26L 3DLQR 3L3OA 3NCEB 3ZSSA 1C8PA 2QADC 4YHKH 3DK0A 1B2YA 5DJCA 3SODB 1EO8L 1ZLWH 1OD7A 1XD0A 4Z7QB 4OH2A 2ITDB 5E6RB 3I50L 3B9KB 5T1LB 1V7NH 2Q76B 3R06A 5DGRA 1SLXA 3I9GL 5ACMA 1CFNB 2VZTA 3BQUA 5B1JA 5DHYA 4OM1L 3RWGB 2E4TA 3ILDA 4Y16C 5DRXA 3MRRB 4XPTH 2R1WB 3LKSB 3ETTA 4WEBL 5I23A 3O3AB 2C34A 4XMUA 3REVA 4UOJA 4RESB 3IDUA 3Q43A 4JNXA 4L4TA 3KYNA 2NDGA 3PREA 4QRUB 3WNOA 3WBDA 5INDA 2Y72A 4UYPA 2X2IA 1KGYE 3HNTH 5B38B 3Q5TA 4FA6A 1WFUA 5DMYA 1Y07A 3L5XH 3T8XA 4NWUH 2E7MA 2KPWA 4K71C 4HFUH 1J5IA 4XODA 4E9LA 1RIVL 3A3YB 5CGTA 2L04A 1AQMA 1C16A 3AITA 3RYMA 1F90H 4OZ4B 2DIAA 3HZKA 3WNPA 3U0WH 4NWTL 1BIIB 1TCRB 2OMUB 4QMEA 5EF1A 1JPST 2WVVA 2BSRA 1ZDQA 5CD5C 4B9YA 1AZVA 3D2UD 1BOYA 3MFFB 4HUXA 1OZTG 2WAQA 3P2TA 4UM9B 4R2GB 4AJWA 1P7KA 3B9VA 2DQDH 4OJFH 2Y5QA 3AG4B 3SKNB 1PZAA 4FXLA 4PJ9D 3QG7H 4DUXA 4TMPA 3SJVD 3LS4H 1N6UA 4UZGA 3W5MA 2C3XA 3SDXF 5JW5B 3AACA 1ZEAH 4NN6B 5CSGA 2VDQH 2P5WA 3QO1B 3T09A 3ZDZF 2CSPA 1MCHA 2JVUA 4YHNB 3NJHA 5CD5D 5BV7B 4PWHA 4AZ8B 5E6IA 3IN0A 3WFCH 1QSED 3QRFM 4I2XA 3R1GH 3HN3A 1A4KB 1JWMA 3EDKA 3QXDB 3HNSL 2M26A 5IMKA 3ZRSA 3AS2A 3U4BH 2HVBA 2O1AA 4LLUA 3FSZA 2P5PA 3QFJE 4XPBH 1JBJA 4PP1D 4PJXB 3AUWB 1BZ9A 4Y5XB 5HYSA 4X5QA 1TUPA 2ZXDA 5J13C 2AK1L 1UZ8A 5K59E 1Q1PA 1VKXA 5HDQH 5BZDB 3QPXH 2ADFH 2JJVA 1C9SA 4M3KB 2ETWA 1T1WA 3CN1A 3UOAB 2ZCKH 1NMCB 4UUJB 3GXFA 3S8FB 1IGTB 1ZT1B 4I48B 1ETA1 5ENWA 2NOYA 1E4HA 4YXLH 2WQ8A 3JWOL 4YL9A 4HS3B 1B9ZA 4YBQC 1V8HA 3UTSA 4W68A 2ORBH 5H2BA 2V7NA 5IOKA 5FUCC 4HMDA 1ZVYA 2KPNA 2MSPA 5HYSG 3OQ3B 4P2RD 1CR9L 2WB7A 4G43B 3SE3A 5C0DA 3D25A 5DFTA 2O5NA 5E4OA 3WIIL 1J1PL 3GSRA 4Y4FA 1B4TA 4H20H 3DRTB 1UZGA 3W0WB 3FCBA 3T4YA 1PEZA 3IFOA 3TO2A 2WLHA 4UNTA 4TXVB 4HXBL 2Q86B 3EJJX 3FK3A 4YBQD 1IKFL 3UMTA 2ZX9A 4I85A 5ANMA 3SO3B 4U1IB 3EYOB 1A5FL 3QRGL 5HXMA 1HEJC 2EECA 1RZKL 5GJTH 4M3HA 2W80C 4K23L 3MQIA 3HG5A 4Z3FA 2BS9A 1A6VH 2EIKB 2R0LL 4LHUB 2HVJB 5BZWA 1CZ8L 1PZ5A 1QAWA 4MWFB 5C0GB 3KPLA 1OCOB 4W9GC 3DX0A 1U6AH 1UJ3C 3KYOA 4LRIA 3MUY1 3ZQXA 1JTTA 3IDXL 1DBMH 4EDWH 5E8OB 3CVBA 2YD6A 1ZA6A 4HF5L 2R1YB 5IQLA 5JUEL 3WFBH 3L4WA 1BX2A 5FGBA 4X7CC 4EN3B 2CPCA 3CDZB 4P2AA 4GH7B 4JFZH 5B3NA 2LV4A 1IGJB 3CFKB 5GS1B 3T1FA 2P3YA 1T5XB 2QFRA 3PV7A 5C71A 1BECA 2ARJQ 2L7EA 2F7QA 4PB9H 3ALXA 4OV5A 4MBOA 2CHDA 1Q0YH 4YXHH 7TAAA 2F8XC 3MLSL 4LF3A 4JRXA 3LVEA 1LO0L 4P9MH 5ADPL 3BJ91 5JW3L 1DJGA 5C0BE 4DNLA 5KS9E 2ZXGA 3CN0A 2XN9A 4AQEB 4A7TA 4RLDA 4TUOB 3B3IB 2WUCH 2GSMB 3FBQA 1KCRL 2ZUUA 3UJTH 1W2KT 4MASA 1T7ZA 2X89D 2BNQD 4YDMA 5C0BB 5KS9B 5I1AB 4B6ZA 4LOEA 5F7DB 3HZVA 1EZUA 3ILQC 2F54A 1P7HL 2IANE 1M42A 4FYTA 1UUSA 2QADB 3MRNB 4FABH 3L9BA 2O93L 5HHOB 2NTSP 3QWQB 2F61A 3ZTNH 3GNML 3AADB 4OCRL 4P4KD 3OKDA 2IANB 3RUGE 5HYJA 5D7JA 5FK9B 4MD4A 4OKDA 5BRPA 1TZOA 1WQVT 1C12A 4A38A 3VGBA 3VYPA 2GAZB 4Y16B 5MEOA 6PAZA 3RUGB 4MZ3A 3UBGA 1E3ZA 1TLKA 1JWSA 2GSIB 2GUOB 5ILTH 2EXTA 5L4FA 4NP4L 3BI9X 2W38A 2YPLA 3ZW3A 3HC4H 4JRYA 3VFGH 2XC8A 3H7BB 3DHMA 3AWGA 3TIEB 2R23A 4KROC 3VI4F 1IAOB 2CK0L 3DWTA 2FJSA 2I5YH 3KCPB 4G71B 3B1UA 3GIVB 4Q89A 4XO3A 3VGEA 4GQZA 1TETH 4K71B 5D7SL 5DQDL 2IPUG 1IFRA 4LARL 1JNHB 3W57A 2EDXA 1F1DA 5A2AA 3IRZA 5TF1L 4RZKA 1UEMA 1E7UA 4J6RL 5HGBA 2B14A 1YEIH 4PJGA 4W9DC 3QH3B 4LCCA 4PTTA 4OY9A 4UTAH 1U91B 2PW2B 3RZWA 4AM0Q 2F9BT 2YUZA 2E9IA 3B56A 3VD9A 3ULVC 3FCTB 1LILA 5DWUH 4F93B 5I0ZA 4ZI8A 4LK4A 5I76A 2Q8BL 2NY3B 2CUAA 2EXWC 3CPLA 3ZKND 1IQWL 4N0YH 4R9HA 3UX9B 3OGCB 3V0AC 1RLBA 1S9YA 3AQZA 4ZMLA 3BRDA 4QRSB 3A6BL 5AYQA 4WK2B 1FSKC 3EJPA 4NBXB 4JFPB 4LEOA 4TVPH 1ZOXA 1JGVL 1MCLA 5CCHE 4P06A 4NI3A 5CFHA 3PWPE 5L88H 4KZDL 1T1YB 4J3SA 5AKVA 2R69L 4MSWB 5DJYA 5IB3A 1AQDB 2JJSA 4HT1H 3NSXA 4M9PA 3RAJH 5IWLC 3ULVD 1QATA 4HJEA 3LH9A 2Q87A 4BH7B 2YGOA 4KUCD 1NCWL 4CVZB 2QQQA 1E5CA 1N8ZB 1F42A 4EE2A 2AJYL 1Q72L 4RMSA 3U7WH 2A9MH 3ARFD 3LN5A 3F12B 4UTBH 1LNUB 1RQ5A 1EEZB 1N5AA 2VDMH 3BPNC 3V5HB 2L4OA 3GMRA 4K5MA 4PSRA 3NYKA 4X5WB 2CALA 1EAOA 1V7MH 5C9JB 5MI0C 2UZXA 2CUIA 3APMA 2FK9A 3BUYB 1U8MB 5EU4B 3TA4D 5J1TC 2GTZA 1JRHI 1FRGH 1KJ2H 1MCWW 2AEQL 3DX4A 2FQGA 3LEVH 4TRPH 4AE1A 5IB4B 3K6OA 3HHRB 2X7LB 3PYCA 3U0TB 5GJSL 4U1HB 5HHPA 4N8PA 25C8L 1B9KA 1DVFD 3DMMB 4X42A 3HHSA 2ZOLA 3ZO0A 1E4JA 3SGEH 3DHPA 3GO1H 4MA7L 1INQB 1QRNE 2J21A 4AG4H 1AYRA 1SDDA 1E6JL 4BH8A 2PWDA 4HIXL 2FBJL 4KOBA 4XXCA 3AFLA 5D7HA 5TPWL 3SDXA 5K39B 3JZ7A 1JP5A 1O0VA 1CJYA 3CE1A 2P52A 3PNRB 1AHWA 1MCDA 1QRNB 2D03H 1G84A 4HMEA 4F7TB 1DJWA 2NXZB 3SKOA 3MNVA 5IHWA 1Q9LB 3GSOA 5DS8A 1CG9A 3ZRFC 3C87A 1OGAE 1FFRA 5ITFB 3HG1D 1IT9H 1R5VA 3BMVA 2ZSVA 1X7TA 2VXVH 1EJOH 5JOPD 1H5BA 1U8LB 2IQ9L 3GSQB 3VFWA 3TVMD 3EH2A 4NJAH 3MRJB 3V52L 5J57B 1IFHL 4ZX6A 4N2FA 1XQ4A 2ICCA 1UJ3B 1J1OL 1I9RH 1N19A 1MFUA 2FECI 5C7XH 2WXQA 5J6GB 5E8DH 3WJJA 2ZQKA 2I7SA 3LNGA 1EPFA 5KBPA 1M6UA 1Z0NA 1CDJA 2IGLA 4NQUA 4P9HL 5F7WC 3FQNA 5AALA 1KELL 4WUUB 2Q7AA 3DSNB 2WC7A 1C1EH 2OQJB 5DHVA 5EOTB 1ET7A 4AOFA 4CMHB 4LE8A 5EWIH 2Z0UA 1XCTA 2ITCB 1MFEL 3SOTA 4ETYA 1TNNA 4N4YB 2H26A 4PIRF 4U6YA 5FOBA 5DC4B 3D4YA 5KTEH 2IG2L 1H8LA 2X70A 5AG9A 1CDYA 1KYOJ 3FTGB 3KGRA 1TU2A 1IL1A 4MMZB 5SWZE 2N7BA 1U3NA 5DRNB 3WKQA 5JOEA 1UTDA 2J5LC 2Q7NA 1Q94B 1OGPA 1P4LA 1KIPA 1N4XH 1L9PA 4KXZH 3M88A 5SWZB 3KDPB 3LZNA 2XG5A 5EEWA 1K6QH 3WEBA 2MHAB 4QRTB 4CC4A 4JFEA 3CHRA 2J1ZA 4IIQC 4Z1PA 1U8KB 2WO4A 5GHWL 2VITB 1DQIA 5FO7A 2H6PB 4Z7VF 3ZGHA 3DHUA 3R19A 3RL2B 4KAQH 4NOFA 3H55A 1GC1C 5KVFL 3TV3H 4MJID 1BLNB 4Y2DA 4MAYB 5C0FA 1DCLA 3N40P 3HPLA 2JCCF 4OF5A 1F00I 4RISL 3UG4A 2G9HA 3UAJA 1OP4A 1R34A 4RZCA 4XP6H 1CE1H 3QYNA 4L4VB 2CRMA 5I15L 1I75A 2AF2A 3IFNH 3TA3D 4L29A 1RZ8A 1KTLA 2DIEA 1BM7A 4KROB 1G7QA 5JHBA 1XBDA 1HX0A 1XWVA 4G42A 2X3AA 4FXKB 2DQJH 2PNDA 4CILA 4Q2ZB 1QWHA 1JF1B 3BWZA 4G6FB 3RGVD 4Y5VA 1VGEL 2Q8AL 3H9ZA 4PRDA 4NQSA 2GBAA 1BJ1J 3I6KB 1EDYA 5BUAA 1A7NH 4LZKA 5FLUA 1K8DA 2BIPA 1D7BA 4AUJA 1R0AL 4A67A 1HAUA 3H85A 4X7TA 1NOLA 2Y25A 3BMWA 4CGUB 5E6ZA 2ZPKL 1U21A 4BWWA 2B3RA 4JN1H 1PFOA 4IRJC 3KCWA 1UOKA 2B0SH 2JK5B 4QXGL 2DQHH 5D93C 5SWSA 4WI9A 4EJ1C 1GRWA 2XFXB 2ESVD 2H1PH 4X5RA 6FABH 1NMBL 1BFTA 1FSKB 3MROA 3OKMB 3FW6A 1IJ9A 1KLGA 4FQHA 1ZVHA 1T83A 1VEMA 3TO4D 4GW4B 4RH4A 5J6HA 2W81C 4L8CB 1SHSA 1KMGA 1JPEA 1UWXH 4JG1H 4AYFB 1OGSA 4KXZI 3EFOA 3V5DA 3VRJA 2FX9L 1FYTE 2IDQA 4F8TA 4D0DA 3FB8B 1PX3A 4XB7A 4J4PA 1NGYB 1U3HC 3VI4A 3EYQC 4H1LB 4XVSH 2FEDC 1XGYH 1FYTB 2AV7A 2P8LA 2PO6C 3EO9H 5DK0A 5BS0D 2BFVH 2RFXB 5KVEL 3QS3A 1P1ZB 2IXQB 3SB3A 1BBDH 3WSQL 2VRKA 5DMGC 3SKMB 3KE0A 2A6DB 5B3JE 1FN4A 1WHPA 3BH4A 4PRAB 1PJWA 1U2YA 2FJUB 1AGDA 5MI0B 3JV4B 1E0OB 3NZ8A 4QNPF 4O2FA 4KKZA 2YGPA 2I26N 4YN3A 5KYUA 3K81A 2OAAA 5DD0H 3KW7A 2SODB 3HFMH 1OF0A 4K9EC 5DJCB 5K9KB 2R0WL 3MO1A 1BQRA 3OMAB 1QFPA 1I7TA 3I3BA 1XAKA 3IVKA 3HCVB 1IBZA 3R7QA 3NJFA 2FATH 2BOBA 2R69A 4TULH 2P42B 4OCWH 2Z8VC 3P0VH 2E59A 3ZHFA 1XSIA 2WN3A 2X05A 3Q1SL 3P69A 4UQ3A 3WGVB 2HRPL 2KDGA 2Y5EA 4L4TE 1OPGH 1VEPA 4NM4H 3D8MA 2MCG1 4DQOL 5IV2A 3ABLB 3NZHH 3ZR6A 1BQLH 1ZGLM 4A6YL 2DWEB 4R7NA 3KJ6H 4L4TB 4Z3HA 3VDBA 4WTZG 1ILSA 4KQ3H 4D8PA 3FO2A 1V3KA 1DQTA 2DM2A 1Z9PA 4LOUC 5D1ZC 3VI3E 3V4LA 2WXGA 4HBCH 1JNLL 4PJ8C 2V2TB 1RZJH 2E9JA 3B2XA 4OGXL 3RWIA 5FKPB 3VI3B 3IU3A 2JTYA 4MQ7B 4DPBX 5CMAA 4A55A 1J88A 1CB4A 2C9UA 2ZUYA 4WLCA 5E5RB 4Y5YC 1HHGA 1NCNA 1CYGA 1WWBX 2YAQA 2XZCH 1HWWA 2W60A 3NFNB 1FFNA 5DQJB 4LOUD 1MSPA 2QELA 3FSAA 3ZGIA 4BSVA 4EZJA 1ZWIB 2DQ6A 3RA7H 2YRLA 5JHDA 4XP4L 4J1UB 1PIFA 4L0YA 2JCWA 4D7PA 5IESH 3ARGD 1MHCA 1TQWA 3WFHA 2ZOKA 3GT6A 4MDIB 3RWFB 3APFA 2JKWA 5CILL 3VFOA 5D6DC 4S1QH 2PYFB 3BZFB 4G9DB 4H8HA 4YZWA 4PWIA 4QLWA 4QRRA 4FQQB 3VGDA 3BAXA 5FS5A 4KJYA 5I6NA 4PBDA 1VFAA 4I2XE 4HPOH 4XPHL 5DUPH 5D96B 4LL4A 3U46A 3GZQA 4O4YH 3HE7C 1FE8L 5E6IB 2WSPA 3WXWH 3T5WA 4A63A 4HZ1A 5DC0A 3CMOH 1JWMB 4JE4B 1IGYA 1DBBL 5D8JL 3IDNA 1IUZA 1U4EA 1CI3M 1MHEA 4R7LA 5LXGL 3MV8E 2E9BA 3K5RA 4N2CA 1BZ9B 4ATWA 4JMXA 2VKXA 1KWKA 1YPZE 5JA9A 4GLRI 1ZT4A 3CZJA 4M8RA 5B7MA 5JXED 1G1KA 4Q14A 4D0CB 3MV8B 2NXYD 1E43A 3ABKB 1U30A 5DR5H 2ZICA 1YPZB 5BQ7B 3HE7D 1E27B 5FAAA 3WKYA 2NNAB 2EH7H 3P9MA 1AS8A 4NO2B 1H3GA 1JRHL 1I8KB 5I73C 3QCVL 3H0TA 1U2HA 3OHXC 4B3VA 5I30L 4JQVA 3ASOB 5LVEA 5DMKA 1MH5B 5E2UL 3GHPA 3T65A 1CD8A 3D9AH 2EYTA 2YWZA 2VWEC 2K3HA 4PGZA 4HUNB 1PKOA 1NAMB 3AROA 2Q2EB 5K93A 4BZYA 2OK0L 3QP3A 5I28A 2V7NB 1AR1D 1KFAL 4LQFH 4DGIH 1RI8A 2OMYA 3CDYA 5E95B 1S78C 2OW6A 2PW1A 2OJEB 1SZNA 4KI5D 3TBYA 4YLQT 4AH2A 8FABA 2EDHA 5I2IA 2IGFH 2QGCA 3N40F 5L8LB 5F72S 3B5HA 4Y4FB 1L7IH 1S9VA 2ZJSH 3NFPB 5BRZA 5J1AB 2IPUK 1MREL 4HGMA 2PWHA 2ZX7A 5EOQH 3BHBA 3IFOB 3GRWL 3HHMA 5C09A 5DHEA 3S37X 4EN2A 2XWZA 4ZUWB 3ILPB 3KH3A 5CIPH 2YD2A 4EMZA 1F86A 1UA6H 5E8NA 4QJ4B 1NBZA 2J1KA 3NJLA 3PIQB 4NQEE 2F5BL 1B0GB 3SE4A 4IRJB 4R7DA 1S2EA 4KV5F 1O9VA 4UQAA 5BZWB 1EUTA 1VACA 5D93B 5JYMA 2YMOA 4B0MB 1PZ5B 2E4FA 2BSBA 2ZXWB 3GMLA 4NQEB 3VFMB 2WKLA 3KPLB 4Z7VA 2EZ0D 3DX6A 1LP9F 3KD4A 3DPBA 4YBLC 1HI6A 5FO8B 4R84A 2FECL 4POUB 4I9WD 3W1ZA 4B9CA 1P7QA 1GIGH 4WUKH 5DYOB 2JCCA 4ZMPA 1F3DJ 2BX5A 1LK2B 4PG2C 4XN5A 5I17B 4XO5A 5F8QC 3T8MA 2GCYA 1CU4H 1NIAA 3EO1A 4JRXE 3T1FB 4D9LL 4GMSL 4AYDC 4OD2A 4DGVH 4OI7A 2YKLH 1U3HB 4ANVA 2ALWA 4BKTC 1I7RB 3TBCA 3A23A 2XN9E 3H4HA 4YDKH 1AO7B 5LQBH 1ZCRA 2PO6B 3KGUA 4KVNH 4WIQA 4YC2C 2FX7L 3OXRB 3ZL4L 1K4CA 4I3SL 2XQBL 2WSKA 2Y7SA 1G9EA 1Q38A 4FZ8L 5FHBL 2F54E 2NNRA 5BZXA 3TX4A 5IJVB 4YAQB 4F33B 1K3ZA 1LWHA 3ERXA 3IXTA 2V5SA 3QZMA 1E2VA 5JNYB 1QACA 3DIFB 3VX0A 1C5DA 1NLBL 4XNYL 5I6KA 4ERSL 1CIDA 3OKDB 3K2MC 2N1KA 3E8UL 4B9JA 1MAKA 4KH2A 5D7JB 4LOVA 2UXFA 2WBJC 1ZLVH 4BQ9A 1XIWA 3B9AA 3UZEC 2YPLE 1P0SE 5IFAH 3JVGA 4TM9A 4JRYE 4O5LL 5KVDE 1BOGA 2H32A 4M8QA 3D4GA 1QR1B 1MJJA 4ZUSA 3QHFL 2WYHA 5T3ZH 4BZ2H 5JPNA 2WIIA 3JV5A 1SF3A 2XPGB 2YPLB 4ZO9A 1RJYB 4JRYB 5IEHA 4MB5A 3IAGC 3P9WB 2WXLA 2DKMA 5D1ZB 2DDQH 2OKMA 3BWUC 3I84A 5EORH 4PJ8B 4A7GF 3NSJA 1PG7W 1UM5L 1VF5C 4H8VA 3VWKA 5L7XH 3Q5OA 1QLEB 3QRBA 4ISVB 1BHGA 3MJGX 4EZKA 4PJGE 1VADA 3B8YA 4AQOA 3WMPA 4XC1L 4XP5H 4Y5YB 1HHJB 4KO9A 2BSTB 4PJGB 4PRID 2DEWX 3MXWH 5D71H 5H37H 1U8QA 4JKNA 3CAFA 3OWRA 1QPPA 4W9FC 2YS4A 2NZ9C 2EXSA 3G6JF 4G3YL 2NMSA 4S1RH 4KUCF 3SE6A 5IJCC 5FGCE 4H44C 3AG3B 5I76B 5EBGA 2G4EA 4Y2NA 3ULVL 4XMPH 2QLYA 4OFIA 2NW2B 1GYUA 3CFNA 5MHSE 4NKOA 5FGCB 5T5FL 4UZUA 4IBTA 4BFBD 2E0PA 5ITBL 1MRFH 2NYKA 3F01A 1IMHC 3NPSC 3RDJA 4TNWF 5FXCH 1WZ1L 3RURA 2VDLH 2RA1A 3S37L 4XP9H 3TN0C 1J0KA 5T1KD 4X99A 1V5JA 2FSEA 1WAPA 3D2UA 4JRLA 5E08L 4PJBF 4RX4D 1DN0B 2W5PA 2AJ3A 3G6DL 3A47A 1AQKH 1O9WA 4PJ9A 3LN5B 1AGCA 3SJVA 2OXHA 3RZCC 1D5BB 2C5DC 4HJUA 2FWLB 1GL4B 3GMRB 4R8WL 3NJMA 4RFEA 2WLZA 2UZXB 2MQ3A 3KPSD 1S7QA 1BQ5A 1YMMD 2GTZB 2IAMD 1KBGH 1QSEA 4GRWF 3MRGA 1JPGA 3VCLA 3OHXB 1DZBA 2AXGB 2BLFA 4TSCH 4XI5C 3V6OC 2C9RA 3QIWC 4DIXA 5HHPB 3SDXE 3C5JB 1EEUA 2D3LA 1JVKA 1WP6A 1YYLH 4N90E 4NKIL 1OCRB 4OCSH 2CLZA 3WFEH 3S36H 1A0QH 5E99L 2R51A 3KBEA 1KLUB 1YUHB 2ZCHH 2A6IA 1D6EA 1JAEA 1OP5K 2YAHA 1BXAA 3U6XA 2JWYA 4P2YA 3HN5A 1S7XA 5AW5B 4P57A 3T77B 5DI8B 5AVZB 3FT2B 3MOAL 2HVKA 3H2PA 3W11D 4ANWA 5KJ7E 1CFVL 1X5HA 4WFHD 4X9GA 5DHDA 5I75C 4RIRA 4HCGA 3VFSB 2PWEA 1BFVL 1CXFA 5F9AC 3EHBD 3MRIA 1BV8A 2ZSVB 4NZTH 4OF8A 4HEMA 2EDFA 3L9RB 3CCHA 2CM5A 4H0GA 5I1DB 4V11A 2FR4A 4NCC2 4ZS7L 2V7HB 4R0LC 3VFWB 4IW4C 1LEIA 2QQNL 4P2RA 4RNRA 3MAWA 2VOTA 4J3VA 5EA0H 4YDIL 4WHYG 3VFVA 1XCQB 4R4BA 5DEGA 4NZUH 1HKFA 2WXPA 1NFIA 1A3RH 2UXGA 2BY0A 2Z8SA 3FQ4A 2AABH 1SRDA 1LYQA 1YEKL 1JMXA 3WTVA 5HHME 3LSOA 3QORC 2VDKL 3SKUD 4MLSA 1FIEA 5J9PA 3T6QC 3IPEA 2WCPA 3FQNB 4ZZKA 3D18A 1NGXA 2Z31C 2VN6A 3FH8A 3BD5A 3ESMA 3MLTB 4N0UE 2UWEF 3CZKA 4FXGA 5HHMB 1OVZA 4EUPH 2H47C 1XR9A 5DHVB 4NS0A 3HMXH 3LZFH 1DTUA 1XCTB 4HPYH 3GBDA 1PZBA 3GRWA 2ZNXA 1S46A 1A7OH 4IIZA 4U6YB 4X6DF 5DMIL 5AEAA 3F7LA 1WAAF 2Y36L 4N0UB 5D7EA 1MJ7L 4YC2B 2HKFH 1FDLH 4NO3A 3A24A 1URIA 3DOSA 1PLAA 1QSZA 1GGBL 1OW0C 4IHOB 3CQPA 4J8QA 3N6YA 1VERA 3QJHB 4UU9B 5AAPA 4GPVA 3BXNB 1M56B 3JSSA 4NKQB 4L5FH 1HH9A 2J2ZA 1P4LB 4JFEE 3TL5A 1KIPB 3ZYZA 1G9MH 4LPVA 4YVUA 4ZFOB 2CDEB 2FT7A 1ADQH 4NC0B 1IKNC 3NCXA 2FJHA 1NL0H 4LP5A 2MCPH 2YWYA 4JFXA 4QGTA 5DHXB 4WI5A 2W65A 4JFEB 4G80A 3UYRL 3JV0A 2CA4A 4GMTH 3IJEA 1MIEH 3HAEH 3HIZA 4R7XA 3RVVC 2IV8A 1LO4L 4AEEA 3VXTB 4LKCA 3KJ4C 4M1GH 1J0JA 2XG4B 1LP9A 3PGCA 1I31A 1TTBA 3EOBA 4NQXA 2GEEA 2ADJB 2KH2B 5T1MB 2WBJB 3T71A 4ECNA 3MR9A 2BPBA 4ZUVA 1EHLH 2X89A 5CCKH 3GJFB 2BNQA 2DKUA 2JJTC 4FP8H 4H40A 4ONHA 3WEOA 4AV4A 3CZUB 2DJ4A 3GSVB 3WKML 3IKKA 3KLAB 1XX9C 2EJ1A 1SY6A 4JM2C 2QHRH 1MEXL 4W81A 4ONGH 5A6LA 3PHSA 4IYKA 5EUKA 4L29B 1RZ8B 5CZKA 3BESR 4WFED 3RGBA 4TL4A 2FQDA 1G7QB 4P4KA 3V0HA 3P4MB 1I85C 1HNYA 2P47B 3DV4A 4UT9L 5AVTB 3P3UA 2X4RA 5KBNC 5I1HH 3MREA 1XT5A 3QI9C 2PPAA 1YYCA 2HYMA 5LJYH 3FSOA 2F8VA 1GSMA 1ZS8A 3KLQA 1E9OA 1RLWA 2PXYA 4JM2D 5F44A 3ZZQA 4JR9H 4W9IC 3PGDA 2HP4A 4FJ6A 3LQMA 3I74A 3P11L 3UZVA 5SWSE 2XYBA 2CGRH 2FWUA 2YSTA 4QWWD 4XAWH 1MY5A 3BZDA 4Z7OB 4G1EA 1J7VR 1YY9C 2PPFA 3MRBA 4KJWC 2WZ6A 3V6BR 4FNQA 5HDOA 3TNMA 1Q1JL 2TAAA 4XCEA 1KCLA 5DJ0A 3ZTDC 2RMNA 3QAQA 3V95A 3GUTA 4UOZA 1WIPA 3EOAA 2EH8L 5AL8A 3GZKA 3UROR 3U79A 1Q90A 2H6OA 1KLGB 1S9XA 1UCBH 4KX8A 4JFYB 4BGLA 1D5XB 5DFWH 1TDQA 1Z66A 4ODUB 1GTFA 3AY2A 1F6FB 1UWGH 3WI9A 3LRMA 4JZJA 3SDAD 4Z0BL 4I1NB 4YX2L 3QZOA 1OLZA 3EFOB 2NYYC 4JO8A 3L17A 3OR6A 3VRJB 4U1KA 1CN4A 4D0DB 3TN0B 2GT9A 1IQDB 1AGEA 3O6KL 5CGMA 1JXKA 1R5IA 1PL3A 2C8NA 4P3DB 3SY0A 3L2MA 5EZJA 4BFGA 2YD9A 3KS0H 4A7GA 3LZOA 1JFQH 1KIUA 1AIFA 1SEQL 4Q52A 5GIRA 5DK0B 1E6OH 4ZUUA 3QR0A 1UEYA 3NA9H 1K2DA 1HILB 2Z91B 5AAWC 3RZCB 3T04D 3WN6A 2CDFA 2OR8A 1WITA 1AE6H 1VGKA 5CEXA 4Z5RB 4RRPM 4J12A 1CUOA 2FCBA 4H8WH 3ECVA 2CD0A 1J05A 4WJ5B 3MJ9L 2AJSL 1ZHBB 2AHIA 5F1KC 1ETJA 4JZNB 3WOVA 5DRWB 1HNGA 3FU7A 3G6JA 1HL4A 3JWDC 1DBKL 5FM8A 5DDHB 5KVGH 2IDSA 4JKPL 3QIWB 1I7TB 4OZFB 1MFBL 5DUML 4H4NA 2WO2B 3QDGD 3ARFA 2VR6A 2J56A 3QQ9C 4JY5H 5E9DD 1KT2A 1A9EA 4Y1SA 2DQGH 2BP8A 2XWBB 4ZMOA 1KJMB 5KG9A 3D33A 4HIIA 2EUXA 2IBZX 2R1XA 1AD9A 2EILB 4FYRA 2IFFL 2XA3A 4GUCA 2VLME 3EADA 1OIOA 3EFDH 4KHTH 4X4KA 3F83A 3D87B 4IKKA 2HKHL 1LQBC 4YDLC 2OYLA 1MHPH 4BFJA 4GRLC 3U82B 3WJMB 4D8PB 3FO2B 1F58H 5CJOL 5EZOH 4PJBA 4ZQKA 1DVFA 3QULB 3CD4A 3QJOA 1MHHB 2EO7A 2WTRA 3L7FA 1IC5L 2KZKA 1CYXA 1UT9A 1UD8A 3RWIB 4DT2A 1QNIA 1U41A 1MVUB 2GI7A 3GXNA 1KB9K 4R0LB 1YECH 4ZXBC 5CM1A 2P49B 4LLDB 4C4KO 1QI3A 5H94A 1HHGB 4HUVB 3FUDA 1RJLA 1TJGL 1MCIA 1QSFD 3F2LA 1NCUA 5E51A 3BGMB 2AI0H 4G6AC 3BEVA 5C3TA 4QTHB 1G1YA 2B16A 4ODSH 2VZSA 4AUUA 2FGWH 3VTMA 3QCUH 1WWAX 3VGHA 5CLTA 2WXRA 3K0YA 1VFUA 3QORB 4JUSA 1MHCB 3HG1A 4JFDB 1DQLH 4NHCL 4QRRE 5HJBA 1UQSA 3MLRL 2ZOKB 4R6UA 2QJDA 4PHZA 3ZUCA 3N44B 4QHUA 2KKQA 2Z31B 3E9UA 3VFOB 1FJ1B 2UZIL 3HKFA 3TVMA 1VSCA 4LLQB 4YHLH 1KTCA 4KJYB 3GHBL 4X9HA 3ULSA 3QNZA 3WDJA 1DQDH 5ALBH 1VFAB 1EANA 1JHTB 2MIZA 4OLZH 3UTOA 4AVKA 3O81A 4YHZH 3MCYA 3UPAA 2OCCB 4KTDH 1NIDA 3EO0A 4BQBA 1F41A 4XNZC 1PNDA 3RNKB 2HMID 1RUMH 4DP6X 5MEPA 3MBWA 3FOLA 3JWNG 2V17H 4ENEC 2V5RA 1O7VA 4HK3N 4LCIL 1MRCL 3TBWB 2CO7A 1ZT4B 2X0WA 3OWEA 3O8XC 1A7RH 3RLSA 1NKGA 3L1EA 1RULL 4I3RL 4KI5F 3MX0A 3ZE2B 1CXIA 1MG3C 1ZLUH 1CK0L 1F56A 5C2UB 2VXUH 5LKNA 1E4XL 5LHDA 2VQ1A 2VXSH 2X4NA 2E8ZA 2X0UA 3H0TB 5C0ND 4ENED 2PR4H 4F8NA 2F1EA 5DMKB 3KBHE 2DYPD 1UM6H 4N2DA 1P6AB 3KLLA 3T65B 4L2LA 3K8KA 5FA3A 3RX8A 1E67A 3O8XD 2UWEA 3K2UH 1UWEH 2Y23A 1FCGA 3IMRA 3L5JA 1VCBC 1S5IH 5BRZE 3VUAA 3OAWA 2J4WL 3IBEA 3BKJH 4LAQH 2PW1B 4X6DA 3HBQA 5C09E 4AH2B 8FABB 5EC2A 1WAAA 4XNUL 3LDBB 5CKAA 5I2IB 5SWQA 3C9NB 3HZYA 1FZMA 2EEXA 1S9VB 3MODH 3BQVA 3PCYA 3QI9B 1RJZB 1RVFH 2I9LA 4KKCC 2FVNA 1BAWA 5C09B 3FB5B 4BHUI 3F3HA 4JFOA 1DVUA 2DQEL 5FUZH 5HJ3B 5IJKA 4MNQD 43C9B 4N5UA 1N0XL 2CUHA 4G7QB 2BC4A 4URTB 3UACA 3K6SA 3EYVB 3RPBA 4IMKA 5KVFE 3MLUH 5TDNA 5E8NB 2F74A 1JF5A 1IEBA 4Z7VE 3TA3A 1Z6JT 5HHNB 1AKJB 3H3PL 2ZUQB 3EBAA 1I1AD 4R7DB 2AK4D 2Y3AA 1H3TA 2VJXA 1VACB 4LLYA 4ABUA 1EMTL 3LKOA 3B6SA 3PXJA 4FQ2H 4XPFL 3BVNB 5DRZA 1BEXA 3RGVA 3SDCC 2WZ0A 3ATEA 2JCCE 3H9SD 4MRCA 3ML9A 3NIDF 2YMXL 3CZEA 2HLFD 4PGDB 1HI6B 3UL4A 3VXMB 1S7SB 4GQRA 1KB5A 3H2WA 1P7QB 2G75A 3RFZA 2JCCB 3TEWA 4CW1A 2VLRA 5CEZE 5A16A 5GGSY 2JNZA 1N6QL 4KUZL 1KEGH 2CUMA 4UT9A 1XB6A 2GCYB 1N5YH 2OTPA 4WDIA 2IPTL 2WXNA 1A1MA 4PY7B 4PS8A 4AQAB 5BJTA 5GGVL 4WI0A 5KEZA 1RUAH 3OGOE 4FQIH 2A2QT 2ESVA 1MFAL 1UKSA 2E46A 3ECBB 3L54A 4HH9B 4AEHL 4GQ9H 1QKZL 2YA0A 2GIXA 3EG9A 2BJML 1KB3A 5D55A 5JORB 1K4CB 3TO4A 4U6TA 5DD5L 3S7GA 2DLTA 3TYGL 2YPVA 2EDDA 3DIVA 3BPLB 3SQRA 1DANU 5C9KA 2FD6H 1R33A 1A1OB 4MYPA 2A77L 1OSZA 2VDQB 1UA3A 3KPMA 4PY8J 3H9HA 3D50A 2QSVA 1HJBC 4UMGA 3HUJF 4KKNA 3KEDA 2ROXA 3QE5A 1HZKA 5BS0A 3GSUA 1CICA 1XZ0A 2IH3B 5DJZA 4X8JA 4HIEA 2Z7YA 4YE0A 1WTLA 1PSKH 1QFUH 3B2VL 1WWCA 4FZEH 5EEZA 1SJMA 4HIJB 4RMTA 5EBWB 2P43B 1T66D 1BOGB 4M8QB 3AG1B 5KJRH 1MJJB 3GKZA 5AKSA 3RGHA 3OKNB 2WIIB 1BVZA 1JGIA 4Q9RL 2F58H 4YDLB 3ZKSD 4OCNC 4HS8H 2AZUA 4GRLB 1AI1L 4LGPB 4NZRL 2ENPA 3BEWA 4NQVB 4WFFD 2ZKHL 2PF6A 2O72A 3QQDA 4NHUA 3S88L 3TYFB 4HU8A 1K72A 5L4IA 4KRLB 2ADIB 1FNSH 4FQCL 4H88L 1HN1A 3VWKB 7PCYA 3BRFA 4LASH 1MZYA 3SDYH 3MJ9A 5DHMC 4CNIB 2YBRB 1NC4D 4N86A 4GB9A 5D1QD 4ZXBB 1EAQA 4R4FL 4FI8A 2VN4A 1YEHL 1H8NA 2CKBH 3S2CA 5CWSB 4N2IA 1KJVA 1U8QB 1KCVH 1GXEA 1INDL 2WMPA 1S7TA 4U0QB 3Q6GL 3GINA 2R7EA 2Y4SA 3CLFL 3CDGA 4NYLA 5MEND 2ICWJ 5T3XE 5C3IA 3NACL 4PY8I 4LVOC 5I8EA 4H13C 3ZDYE 3ZUNC 3JTTB 1MDAA 4Z7IA 2DS4A 2ED9A 3VXPA 4PVLA 5I6LA 4ODTH 2ZOWA 2BNRE 3ZDYB 1IC1A 1M7IA 4K5PA 4ZBJA 4M6NH 1RZQA 3GSNL 2VJ8A 3OKOB 4PJ5A 4DKEL 3DO7A 3O45B 5DEFA 5BUPA 2X1OA 2OCFD 3QG6A 1GZHA 1X5YA 2BNRB 1XFPA 4JVWA 2Z4QA 3BFOA 1JXDA 4U05A 5I24A 1O5PA 3F7RA 4IRZL 3RDTD 4M62H 2ZWYA 1HQ4A 2DH3A 1CD0A 3PP3K 5F3BA 4XNZB 1H3PH 1A1NA 3DURB 4RAVB 4HA1A 3D2UB 3ARGA 4P5SA 3SJVE 3MBXH 4LSUL 1F4HA 2FIRT 3I2CH 1FVDB 4A1RA 1KF9B 3AQDA 4J3OD 3NCFB 1AGCB 1CFSA 2K70A 4YEEA 5KN5A 1HOEA 1YZZA 4WZ9A 5TE4L 1N3NA 5GZOA 2B2XL 1ZHKA 3D2TA 3OMIB 5IHUH 2HLAA 4HDIB 2YEQA 1A6ZB 5EMYA 3PRZA 5KSUB 5BXFB 5FB8A 3BH9A 5D7LD 1JNNL 4TLTA 1MZZA 3U36B 1J1XH 4CVXA 2ICWI 1VCAA 4LKXB 5L9DH 3G9VA 4UQ2B 3CHOA 2IH8A 4KK8C 4UI2A 3TEZA 2ZAHA 1PLBA 4J3XA 1R24A 1MNUL 2R4SH 3DBXA 3QNYA 4WQOA 3UCQA 1HXKA 4PGBA 4YHOL 3G08A 1ML0A 2OZ4H 4TVSa 5F70A 3NH7H 3PHQA 5JXEA 3S35L 2CLZB 5GGTH 2ALAA 3HR5B 3DROA 3QUXD 4NNPH 3EOTL 1B0WA 3RKDD 4NQDB 3HE7A 3I3DA 3CK0H 1CDGA 4UQ9A 3PGFL 3KXFB 1EJFA 1JGLH 35C8L 2J8UF 3SBPA 3U9UB 4KK8D 2D7TH 2HVKB 2QPFA 2WYTA 5AOMA 1HDMA 1T3FA 3H42L 1P5UC 1ND0A 5AOKA 2CLRA 3GM8A 4W9CC 1TTUA 4P2RE 4L23A 4YQXH 4DKDC 5CBEB 3BISA 3A22A 3CCHB 1A3ZA 2AP2A 2BVPA 4HBQA 2ED6A 2WLMA 3MU3A 1OKEA 2PR9A 3DX2A 3KPOB 3LZLA 1TZGL 4P2RB 4RNRB 4XMVA 4EKJA 1PG7L 3E7JA 3QEQD 3D06A 5C1MB 3SDCB 2OPCA 4K94L 2YFNA 3VFVB 2HXAA 4I7ZC 4DK5A 3AG2B 2YAMA 2PPEA 4R4BB 3RTQC 2QQLL 5KUKA 1FC1A 1LLAA 1NFIB 5GRWA 3TNNA 2OL3L 2YEZA 1BJ8A 3C08H 3MN8A 1X6NA 3NSYA 3OHMB 5CBAA 3O2DL 1AMYA 1SN2A 2XVLA 5D1XD 5MEQA 2L7JA 2A83A 4P46C 2P7TA 3A67H 5J9PB 5I1KH 4QY8A 1RUKL 3BN9C 2BIMA 3DVGA 3M1BA 4KOCA 4GW5A 3D18B 4WU7A 3II2A 2DBJA 4M7KH 3ZL2A 3G3LA 2EKSB 4UIMA 3JXAA 1XF5B 1XR9B 3VVWA 1HESA 3D69A 3ZX1A 4HOZA 5LUMA 1E90A 3ULUH 3N2JA 2Z65C 1JYNA 4HUCA 4IOFC 2Q1EA 1A7QL 2FT8A 3GGWA 3QA3A 1A7PL 3KVPA 5C08D 5ESAB 1KTKE 5AKTA 3RU8H 3M8OH 2C9XA 3O9WC 1A14H 5C8JA 1HEZA 4M7JL 1ZSDA 2APBA 2I24N 5TDOA 1T03H 4LFHD 1B0RB 2LW3A 5EO0A 3MTRA 1FNEB 2UX6A 3D48R 4JFWA 4KV5E 4AZUA 4K8RH 5I82A 2M2DA 1CLYL 2NY6C 3GBML 2FJHB 3GSXB 1A6WH 3O4LD 4K7PY 4JDTH 1TQTA 4GXUN 1CT8A 3OMNB 5IG7B 4S1SH 1U9KA 4WI8A 1JWUA 5AW0B 5G4NA 1QHQA 2CJ3A 1G7HA 4OGYL 3ZOAA 1LHZA 1VAHA 2WZ5A 2NY1D 5F3FA 3SBWA 3N0PB 4L8BA 4LKCB 4ZSOA 1CXKA 3PWNA 4NCC1 3L7EA 1G9NH 2AQPA 3NCJH 2DTMH 4U6XA 5B7FA 2J88L 4UILL 1TZHB 4KKAD 4ZUVB 5I19L 5IB2A 3MHZA 3C5ZC 1NEUA 1XXFC 3EZJB 2MQ0A 1XVSA 4WY7L 2ZWNA 1I7ZB 1OSPL 4X7DC 5EZPA 4F15C 2YIHA 1ODUA 4PIBA 1DFBL 2LVCA 3QUKA 3GB7B 4KXDA 4X98A 4UOW0 4HD9A 5CLZA 2JTDA 2MPAH 3K71A 3N9GH 5K9JL 3WUZA 5I66B 3DV4B 2OYKA 3EAKA 2X4SB 1E3XA 4IOSD 1LEKA 2GHZA 3D09A 4XNMB 4EBQL 3Q6FA 4ONFL 3PQYD 5HGDA 5EPMA 1NANI 2PXYB 2JH2A 4W6XB 2WB1A 2YPKB 4JPIB 3PGDB 4RMWA 3UZVB 1MCPH 5F88A 3WTSA 1RHHA 5DK3A 3HUJA 4LVOB 4C4KT 1F8TH 5CR8A 5ICZA 4G1EB 3MRBB 4BKLA 1IEAB 4AQ1C 3EGSA 3P54A 4WVRA 2FL5B 4XPAH 5DJ0B 2GJZB 5FHAH 5F0PB 5KANI 3SCMC 2NTFB 3ATAA 3MXVH 1P84K 4P23C 5CUSH 3UAEA 5B39A 4GO6B 3IDJB 1RZJC 3HNTL 2H7WA 3GMNB 4F58L 1MF2H 3FQYA 4PRIA 4NWUL 5A6IA 2HAZA 4ODBD 2AVFA 4HFUL 3THMH 4G8GA 3KL5A 1UCTA 1V05A 5CP7B 2FEEI 1ZVSA 4U0RC 1V27A 2GT9B 1AGEB 2NY0B 3SY0B 2DWTA 3PY9A 5EZJB 3H7LA 4HS6A 4YPGA 1ZHNA 3QJQB 4QHNA 3LN4A 12E8H 2EEBA 3U4KA 2F8IA 4P23D 4RGOH 1AIFB 4MMYA 3CX5J 2WQRA 3VG9C 2DMKA 1JL8A 1TMCB 4WSGA 4ZW6A 4N0RA 1NA8A 2J57A 4PVNA 3FO1A 4AT6A 1W72H 3KPNB 3OB0H 4Z7NE 5CEXB 5HVHC 3G6JE 3ZE0F 5B39G 1XO8A 2DQDL 1XGRA 2EYRB 2YR3A 4P04A 4ENZA 5T33L 4OJFL 1Q9OA 1L5GA 3V4VL 3QG7L 4OFQA 4Z7NB 1FZOB 3LS4L 4I13B 2CIKB 2XV3A 4L9LA 3G6JB 5TTRA 3U4EA 4KK9C 1ZEAL 3N0AA 3UC2A 5C0CA 1PKQA 3E1F1 1QEWB 4NPJA 1AGFA 3GSNA 1UA7A 2YLHA 2Z92A 4RX4A 3QWRA 4U1JB 1J8RA 3IXAB 4E41D 2F6AA 1ZA3A 3ARFB 4HLZG 3TWCH 2P8PB 4D3CH 1KT2B 3FUFA 3L16A 1SMAA 4IRZA 4WNQA 2BP8B 2VR9A 4GAAA 1UXMA 5L4JA 1GYVA 1QR4A 3U4BL 2R1XB 1DBJH 1KENL 3OD3A 4QAMB 3X13A 4C56A 5ALCH 1II4E 2D3NA 2ICES 2G30A 3KPSA 2XKNA 4XAKE 1YMMA 1NCTA 2IAMA 2X9WA 2YD5A 3L6FB 4KK9D 3PJSA 4PJBE 1D9KD 3DVIA 4XRCA 3RJOA 1KBPA 1BF2A 2OSLB 2WLIA 3IGAA 1XR8A 3KYAA 9PCYA 1PYWA 4ZW7A 5HDQL 3EYFA 3TASA 4PJBB 2DD8L 1P5UB 3LHPH 2X44D 4I5BA 1N2RB 2WTRB 4NX0A 3X2QB 3PL6C 1JPSH 4G6KH 5A40E 2Y2YA 3ARDC 1LO3H 4F7KA 5IEKB 4ETQB 4OCYH 3BAWA 3S34H 1R47A 3C8DA 2ED7A 4GRWE 5LBSH 5H94B 4YO0B 4UQBA 3WEXA 5HGHA 3JWNE 4GBXA 4WTQA 3ZRCC 3NIFF 3HG1E 3IN2A 3RTQB 3BEVB 3Q8EA 5ICXA 1C7SA 4B9ZA 2BVQB 4GRWB 5GRVL 1CS6A 4TSBH 1QWUA 3VRIA 1TJIL 5H35A 4JN2B 3DX1A 1Y18A 3C8HA 4P46B 4Z23A 2WGNB 1MW0A 4M9OA 1G7JA 2O6EA 3PDOA 4LLWB 4U2YA 5FECB 3FAXA 4GW1B 2EE2A 1FAIH 5D6CA 1A8JH 1UD4A 1ZLEA 3CVDA 5AD0A 1N7ML 4KDVA 3HOGA 4PN6A 3ULSB 2HX7A 1KGIA 2XV6B 3S3DB 3BKMH 5JQ6L 5JPMA 5IT2H 5GJTL 2J8UA 4M02A 3WS6A 1BPVA 3O9WB 1A6VL 3IDYC 4Y19E 4AKPA 3NIGE 1HOCB 2JQMA 4C54A 5D7KE 4YDZA 1LM8V 4EIZC 1U6AL 5K9QI 2Y7QA 3QQ3A 2NY6B 1INEH 4Y19B 5JZ7C 4P07A 3NIGB 2JJWA 1S3RA 4F24A 4EDWL 2CO7B 2H41A 1GY2A 4HZLB 2G2RA 3TCLA 3WFBL 4ELKA 1B4RA 1BVOA 2OL3A 4KKPA 3BKCH 3MX0B 2BOCA 3O2DA 3IDMA 4ZX3A 4RSYA 4XN8A 5EEXA 4DAGH 4MHHI 2WLLA 1FFQA 4AIZB 2JB5L 2ZX6A 4G7YH 2O5ZL 4PB9L 5ESVB 5GRUL 1MNNA 4OSUH 4RA3A 1IAIM 4YDJB 4YHYC 4YXHL 5KVMC 4LP8A 4IKNA 2ZWKA 1T21B 3OG6B 5EZIL 5HHVL 4GKSA 4U1SA 5IQNA 5IB1B 1QO3A 1TO4A 3N42F 4TSAL 4F15B 2WUCL 3GMMA 3VB8A 1TOXA 1R1CA 3AY4A 3N1FC 2WINA 3I6GA 4X4XA 1EIBA 4A2GA 5EC2B 1PMYA 4GOSA 4N0FA 3HZYB 1FZMB 2DMHA 4LPCA 4NM8H 4NO5A 1QTSA 2DOCA 4AIOA 4FABL 2I9LB 5KSAD 5IFHL 4JJHA 4XZUB 2WQUA 2F7PA 4PM1A 1MXGA 4WKZA 3UP6A 2ZUWA 5FYKE 4M3JA 1JGUH 5E0QA 5FF6B 4XPGH 2C9QA 3VTAA 1KJ3H 3MJ8A 4FC3E 4BFFA 2BC4B 5EOCJ 2XXGA 2K4WA 4WK4B 4WRLA 3W3BA 3LYRA 5AW6B 3D0VB 3L8QA 5HHXH 2EIZB 1OAUH 1ZJAA 1NPJA 1MAML 3QCTH 4ZAKD 1OCWL 5ILTL 4QHLB 1HT6A 3DOIA 1XH3A 3QIBD 4AQ1B 5EO9A 4TOYL 3LKOB 3B6SB 5DRZB 3Q05A 3SCMB 1U58A 5ANHA 3VFGL 4RFNB 5HI5D 2VLRE 4MJHA 1ZTXE 2ZOUA 1NUFA 2DH2A 2DQTH 3QDMD 1KB5B 1KV7A 2I5YL 5FDWB 3UTPE 3E3QC 4U31A 2VLRB 4PD4K 3V9FA 1TETL 4OKVA 4L3EE 3LIZH 3Q06A 4NT6B 3HC0B 1M1XB 4HC1H 4ZD3H 3BIBX 3ULAB 4U0RB 1PVHA 5T3ZD 4OT1H 2WWMD 2C9SA 4WDIB 3BDBA 4NOBA 1A1MB 4Q0XH 3INOA 4CSPA 4L3EB 3WHXB 4M48H 4KPHL 2X12A 1UT2A 1DQQB 3DDGA 4UTAL 4N24A 4BHUA 3ME0B 3IDIB 1RZIB 2A4CA 5DQ9A 3CFJA 4BXVA 4YSSA 4KK5D 2KYIA 5DWUL 4DW2H 3FH5A 2AQ3A 2XSKA 3TO4B 4QAWA 5FA4A 3ZKXC 1X7QA 2VO8A 4YSAA 3SDAA 4BUHA 3G04A 2CHNA 4Z78A 4N0YL 4MYWB 4ZFZA 1KBKA 2RQ8A 3TEUA 5IK3A 5J3HC 1MCCA 1LEGA 5ERWA 3PHOA 3FFCE 5E2VL 1HSAB 3KPMB 5HGAB 3UTTD 4DJMA 1JZ4A 5L88L 4XNDA 5HP5A 4KMLB 4MS6A 3QZPA 1KPUA 1TTFA 3FFCB 1KG0B 2ILLA 2Y2TA 4OF0A 3FHEA 4XOEA 3GLZA 4HT1L 1CICB 2NYZA 4X6EB 1XZ0B 3RAJL 1Q0EA 2OR9L 4LT7A 3QIUA 4JDZB 4PV8A 2F53D 4D0BB 3U2SA 1WH0A 3DECA 5BCAA 5L2KD 4F57H 2A9ML 2ZXAA 1JXFA 3EJUA 4UTBL 3IB4A 2QVMA 2IO5A 2FDBP 3K4AA 4WI4A 2VDML 3BUQA 2HTLD 4AITA 4J8RB 3DUSA 5I8CA 1T0MB 2JXMA 3MJ7B 3SYCA 5FCSH 3WUWA 3BEWB 5KSBB 4J5VA 3NGBB 4NHUB 4N2GA 3GTVA 3LPPA 3QDGA 4OBSA 4OCXH 2XKSA 4GI8A 1JPTH 3QEHB 5E9DA 3FYEB 3PL6B 1FRGL 2KT6A 5D9SB 1KJ2L 3U7AA 2JV6A 3ARDB 4DZBA 3V4VA 2Z93A 1UT1A 3FL7A 3BWAA 3H56A 2FIKA 1J9SA 1IBHA 2ADGA 2YD8A 1LL1A 3Q9PA 3II3A 4BE5A 1ZANL 2NR6C 5DD3H 3UYPA 4AG4L 1TZ8A 1DVXA 1X5AA 1MCOH 1ASOA 5CSBA 1S7TB 5KBDA 4QXTB 2E7DA 3QHZL 2R7EB 4TTGA 3CDGB 4NYLB 5FM4A 4NENA 3G5XA 5I8EB 2WKOF 2XBDA 2IIJA 1AGBA 3QUGA 1PLCA 3KPTA 5HD8D 4PJ5E 3WUWG 4XE0A 1S7WB 3C09B 4J3OF 5JDJA 2DLGA 5ES4B 5F2FA 2JKIS 3CFEB 4PJ5B 3OLEA 1JGEB 1CDBA 4Z7WF 5BW7C 5INCB 3FRPA 1JZEA 1QSFA 2OYPA 3O3BB 3SKJL 2VXVL 1EJOL 1UACL 4OZGE 4MB4A 4U1LA 4UV4L 5D2LF 4O2EB 2R0KH 4U4IA 5AW2B 3VSTA 4OD1H 5LDSA 4FG6C 4RBPK 4AMKH 4BK5A 4EIGB 3IDYB 4X4YA 2AVGA 3LRGA 2FWOB 2WNKA 4KXCA 5MERA 4JREC 4OZGB 5IMOB 3LN9A 1IGML 4MS8D 2PMZA 2K3TA 1IFGA 1I9RL 3BZEA 1NAKL 4YK4C 2LU4A 1J9TA 5EBLB 3NJNA 4XN7A 5EU7E 1CFSB 2HT2D 2X1QA 3L4ZA 1D3CA 4U49A 4TTDC 4YWGH 3CFCH 4NLHA 4NO0D 4JE0A 3FNKA 4CU8A 1QQDA 2EE6A 2RAMA 2XBZA 5IHBA 3FRPG 4KMQA 3FONB 2VH5L 3FO0H 5AWNL 4DPCX 3ZPDA 4YHYB 5FYKU 3IMSA 4WTXA 1GTNA 2RGSA 4WWOA 5KTEL 1R24B 4YHPA 1QHOA 4JZOB 4KQ0A 3DBXB 3QNYB 4HK0A 5DJ8A 1O6SA 4PGBB 4RDBA 5ADOL 1Z5LA 4HJGA 3G08B 1EJ6A 2OA9A 2XV0A 5I1JL 1XSKA 32C2A 4XTRC 1G6RH 3RB7A 1G9MC 3HI1A 4M5SA 3NEOA 5DJXB 4HSCX 3CN3A 3F6JA 3TFKC 4U3CA 2Q5BA 3KGTA 3MV9D 1K6QL 2P9RA 3L4YA 2D0HA 3DYMA 1W0WA 1IM3A 2VLJB 3O6LH 1JK9B 1IGIL 1OAQH 3MYZA 3PNWB 3PXLA 3TBBA 1M7DA 2ZOOA 2DYPA 1T3FB 2H2PD 4XVTH 3MUHL 3VH8A 2G3ZA 1ND0B 1MFNA 4KI5E 3MJWA 3O8XA 4ALAH 3NJJA 4KY1H 1FL6B 4PBWD 4HUUA 2A0LC 1CGSH 4PRNA 2ICEA 3L1FA 4PLKD 1AJ7H 2FLBT 4ICXA 1ZE3H 5GGRA 1FV1B 4JFQB 4C58B 2ICWA 1CGWA 1X9LA 3IE4A 4GKOA 3OJDB 3IFNL 1BW8A 3KG5A 4CUCA 3P4OA 1RSYA 5K1VA 4MNQA 5CBAB 1H6TA 1R3KA 1E4KA 5EBMA 3UERA 2DQJL 2VQ4A 2Y6TE 4HWEH 1ED3B 5GSVA 4F1ZA 2GJ6D 4XGZB 5J89A 2G9KA 4MJ5B 2CHWA 2BRRL 3DVGB 3DX7A 1LDPH 4GW5B 4APQC 5ICYB 3VH8G 1ZDSA 2IBGA 3QUZD 1MJUH 3MZGB 1A7NL 1WV7T 3TBVB 1I1AA 2FNWA 1QNZH 2AK4A 3P73B 1SJEA 4WHDA 3REWA 3D69B 1SM3L 3RY6C 5IW1B 2AC0A 3ZT7A 3QXWA 1L6XA 1L0PA 5AVUB 3ROLA 3QA3B 1XL4A 3G5WA 3JT0A 5E5MA 3UAFA 4B0MM 1R9FA 1W9XA 3VNYA 2GTWA 3ZKXB 3NAAH 3IF1A 1EAPA 3CN2A 2H2SC 3T3MF 1EBPA 3P77A 5EO0B 2UY6B 2H1PL 4LEEA 4APQD 1NEZA 1BFOA 1I8AA 1KCUH 3KHQA 4OZIF 3LNIA 4F2ME 5LG6A 4TPRH 5C86A 3MGOB 1CLZL 1J8HD 3K0WA 5EU3A 1JWUB 3Q3GA 3NIDE 3RVXD 4JG1L 4F2MB 3X1NA 3FCSA 3SGDH 1U8OA 2E3VA 3DJ9A 3U9PH 3APNA 1P1VA 3OZ9L 1KEMH 3TCXA 3NIDB 3L7EB 3S9DB 3POCA 5DURD 4X9IA 3NABL 3EO9L 4KC3B 1LO5A 3CZFA 1IAIH 3US9A 1WYJA 3IGKA 1S4IA 1DYZA 1E5AA 2EE0A 1ZMYA 4WW1A 4H8WC 4Y4HC 4BFIB 2PYEB 1NEZG 4RMBA 1WZLA 4ZG1A 2VR7A 4RRPA 4MAZA 4OLVH 4AY0A 2WXFA 1I82A 1KBBA 2AITA 2KZ1B 3K71B 4NAMA 5ECGA 1XF1A 4UB0H 5EB9A 2YK1H 1B4LA 1VLXA 5DD0L 3U6RB 1LEKB 3HFML 4Z9KB 4E9YA 3Q6FB 2DYRB 3HS0C 3WXVH 3VQMA 4JO3H 1AP2A 5EPMB 4Z77A 5FOJA 4JRWA 4N1CA 4AK1A 4PG9A 1DEEB 4IBUA 5EDSA 4CN4A 3GKWL 2W0FA 3HE6C 3TGXA 4OCWL 3OKYA 1H8OA 3F5WB 1ESOA 4ANXA 1RHHB 4AGQA 5L6YH 3B2DC 1NCJA 1Y0LB 1OPGL 5ICZB 4K5LA 3PWUB 4NM4L 3LJ3A 3L9EA 3IMVA 4MCYB 1BQLL 4Z8FL 5JR1H 2HJLA 4FX5A 3KJ6L 4PRIE 3FOMA 2XZAH 4GG6F 1NC4A 4KQ3L 5D1QA 15C8H 4I89A 5D72H 2TSBA 4G8GE 4XMLL 3KZ8A 4HBCL 4CKVX 4L8DA 5CHNB 1Z9SB 1MPAL 3HE6D 4FKKA 1S8DA 4EF3A 5K5YA 2NY2D 4K3JH 1ITCA 4QHKJ 4F9LC 4LU5L 5MENA 4G8GB 4MJ6A 1ECYA 2VDPH 3BDYL 3FN0H 2N4IA 3WE6A 2EEAA 4XHQA 3RI5F 3FT1A 4K3EH 1KPRB 4JREB 3P0GB 1NM4A 1TTAA 4HS6B 5EFIA 2XZCL 3LN4B 4NQCA 3E6HA 4MMYB 5IY5B 4TQ8A 3OLIA 2X1WL 3WTXA 4EI0A 5HDWA 5I6MA 3RA7L 4NKDB 4NZJA 3TP4A 5IESL 1X5MA 2BY1A 2Z7ZA 1ONQA 3FFDB 2RCSH 2Y06H 3SE8H 3CFMA 3RDTA 3VFRA 1XGRB 2B08A 5G4MA 5C0CE 1T89A 4EUPB 4DERA 4LOFA 3OX8A 3IETA 5F7HA 3N41B 5EOCL 4JX0A 3U4EB 5LGJB 2WKOA 5C0CB 3DYOA 1SUJA 1TQBC 4HPOL 3K3QA 1EZSA 1OY3B 3RILA 3M1CA 2NLJB 5HDBF 1N0LA 4MAUH 2XZQH 4O4YL 4C56E 4WNQB 4LBEB 4R3SA 3WXWL 3KPSE 4OGQC 3CMOL 5GGQL 4LGSB 4DP2X 4KJPC 2D4DA 4HKXA 4Z7WA 4M43H 5JHLL 3FTUA 3X14B 4C56B 3X13B 5TH2B 2PLTA 3NVQA 2HCZX 5D2LA 5D7LA 3JV6B 4QHKI 3QUMH 3BT0A 3ARRA 2D7NA 4UT6L 3T0EC 2IC2A 4IU3B 5EIQA 3W37A 2WLIB 1SPDA 3BUPA 2SEBA 3IGAB 4FFWD 2XWDA 2VN3A 5DR5L 1ULVA 3GTTA 3V4PL 1QSVA 3S97C 3ZHDA 3T2QA 4ODHL 3M17A 5AAMA 1NICA 4Z3TA 2X4UB 4AYMC 1QA9A 3RY5A 4X50A 1KTRL 3QUXA 4J3OG 2R2HB 4PJIE 1BZ8A 2NUTB 1J0IA 3L5IA 3QVAA 4K2UH 3D9AL 2XTSA 3SOBL 2JELH 3OAUL 1UOWA 1OAYL 2VDOL 3WEXB 4GBXB 4WFHE 1G7IA 4PJIB 4G9FD 2N3JA 3BE1H 4AL8H 4HWBL 5C6PB 4LQFL 1BWWA 3Q2WA 5FO2A 4MDJA 1ZHLA 5IKCB 2BXZA 1IAKA 1OAKH 4LPXA 5D4QA 5GS2H 3VRIB 1URLA 2IGFL 1BZ7B 1BXUA 3TT3H 5GRJL 1QX1A 3AXLA 5F1IB 2ZWLT 4KTYA 4OD3L 2HTKC 3HRZA 1MI5B 2X4PA 5D6CB 2ZX5A 4M5YH 4YXKH 3T4AA 3T0AA 3MV7A 2NZIA 3W2DL 2J8UE 5F7BA 4G8FB 3A4EA 3HA0A 3CH1A 5JPMB 3ZHKA 1UA6L 1CDCA 5AZEL 4JO4L 3OKKB 4JDVA 3K72A 2J8UB 4L1BA 1KN2L 5KSVA 2RTTA 5F71A 5DZNA 5D1XA 4JJ5B 2KDYA 4YSPA 2X2UA 2W9EH 2BSED 4UINH 4AYSA 2WXOA 5HHQB 3VXOA 1KFGA 5JIMA 5C6TH 5IHZA 1W91A 1GIGL 4WO4C 4WUKL 1HXYB 2G2RB 5KWYC 5F96L 2YOCA 4G5ZL 5B21A 4XN1A 4X5LA 5GSRA 4DVRH 3IJSA 4QOKB 2NPLX 5C08A 4ZNCD 3WN5A 4XCNB 2XDHA 4KMTH 2YKLL 2XI9A 2BMKB 1R46A 4I9XA 2B59B 4L1SA 4P2QD 4UDUB 5LQBL 2O6DA 3QDJB 4AV0A 2P24A 4KVNL 2YQ3A 3U30C 1CURA 3CX2A 4M03A 1BXVA 4Y4KA 2NNFA 2EVHA 2OLDA 4GKSB 3GBNH 1EHAA 1HSBA 1YNLH 3GMMB 1BGXH 3CC5B 3WL9B 2FJGA 1CLOH 2HUHA 4PCSA 3LQAL 1MUJB 4PRPB 3QXAA 4DP7X 4O58H 1OWRM 3VWJC 4ZTOL 5J56B 3NDZE 3ESPA 1BMGA 2W9DH 5FFLA 4OLUH 1OQOA 1L7TH 3JTSB 2V37A 1S6NA 3HS0B 1MCFA 2PN5A 5IBLD 2HRLA 4S1DC 2H3NA 4A68A 4PJ6A 1GYAA 3GM0A 4LFHG 3MJ8B 4OZIA 2WNWA 4UWQB 4HUKB 1GC1H 4UQIM 3MCLL 5AOLA 1XF4A 2YEVB 4WJG3 4RDQF 2CKNA 1A66A 3K2IA 1A47A 2R2EA 4N8CH 1QBLH 4NFCA 1KXVC 1NC2D 3O4OC 5T3ZL 3PPEA 5EO9B 1YEWA 4FERA 4HISA 1AYOA 3EJQA 4KDTA 2A38A 5GS0H 2GBVA 1P6WA 2R27A 2A9CA 1BVKA 4N8VA 2EUVA 3FO9A 4V1DE 1NJ9A 2W59A 4S1DD 2OI9B 4N68A 4FF9A 5EORL 4HXAL 4YGVA 5TGBA 1ILUA 3AS1A 1DLHB 2Y1VA 3VD3A 5L7XL 2WVUA 1T1ZA 4E0RB 4OKVB 4V1DB 1Z9NA 3LRSA 3CZSA 2Q2LA 3WNJA 5AW8B 3FXIC 2R56H 4XP5L 1NWOA 3ARZA 1MN4A 1WBYB 4WW2F 3B43A 4OGAC 2MNUA 4MHHG 2Z4TA 3Q9QA 1NH6A 5DA4A 1NFAA 3V6ZA 3CFJB 2V4LA 4FKHA 4IEFA 5AENA 2VM9A 2EC8A 4JFFB 1EAJA 1X7QB 5FA4B 4G8AC 3MVSA 3S4SA 3OC8A 3SDAB 4N8VG 4CADB 3ARTA 1HL5A 1LWJA 1I9IL 1S9WB 4G59C 1CDIA 1YNKL 2YXWA 5AOJA 1Y1UA 3LY6A 3PHOB 4N2MA 4N2OA 3MLVL 2ATAA 1FORH 3OM3B 2PUQT 4OGAD 1F6LL 3G5ZB 1TQBB 5TQ2H 1U93A 4MJJA 1CBVH 2VDLL 4MMXC 4IK7A 3FAWA 2VDNB 4XP9L 3KM2A 4M6OH 5JO5B 1A4BA 5CSZB 3WLBB 3G6AB 1WDAA 4CA4A 3QIUB 4GG6A 1CQKA 4PUBH 5MP6H 4ZFFA 4OLXH 3GSWA 5CNHA 3D39A 3X12A 3C6LC 2ZKMX 3T0EE 2VJ0A 1A4CA 1XGTA 2A5UA 1D5IH 5E2WH 4P2OD 3QZNA 1Z32X 1XF2A 4UTCA 3H53A 5GRVK 3S4SG 4H5SB 4ELMB 2QMJA 3BYYA 2A1WH 4L2YA 4PS7A 5E9DE 3T0EB 5C0AB 3FN9A 1KPVB 1BZDA 2DYSB 1RERA 2QDWA 4LSQH 2EUWA 1X6LA 4FTVD 5E9DB 5EN2A 5JOFA 1M2VB 1E8YA 1V3JA 4S11A 3ZE0E 4X5XB 1UFUA 5A7BA 2IALA 3DJSA 4DZBB 1IC7H 3U7YL 4TSCL 1R3JA 2FHCA 3ZE0B 2J6EA 3QEGH 5DD6B 1RAMA 5IB5A 2WNGA 4XBPB 3SPJA 2DWXA 4QTIH 3IFLL 4DHLA 3BAEL 4X6FA 1KYAA 2V5YA 1IVTA 1D9KA 3MSPA 4V33A 2VXQL 1YEGL 4MKMA 1MLCA 3S36L 1A0QL 2R2BA 4ICWA 2CE6A 5LGYA 3FUKA 4L3AA 2ZCHL 4ANKA 2AQSA 5EO1A 5JLZA 5HYEA 3OTTA 3IDGA 5JHLA 5K33A 1NOAA 2VM4A 5KVDH 1MCQA 1QSFE 5DJ2A 1MVFA 2EDQA 1RZ7L 4DCQB 4UT6A 1A25A 1BBJB 4HWUA 2BVYA 1QLEH 3RWCA 5GISL 5DJ6B 3MA9H 3E6FA 3VXUB 3V4PA 4UDTA 1JZJA 4ZFGL 4R26H 2A9DA 4UQCA 3NFSL 1EO8H 4Z0XB 1DUYB 1SYSA 3L4TA 3MKKA 1TZAA 3I50H 4DO4A 3VSQA 3O6FC 1A3RL 3K4ZA 3NSFA 1RZGB 1HKLH 5TF0A 1QUPA 1SHWA 3NIFE 2ATKA 4OM1H 4WO4B 4XN4A 5ISZA 4HWBA 3GHEL 1IGCL 4JG5A 2IDCA 4JQIH 4KRPC 3VXSB 4GG8A 2NQCA 3QNFA 5CKGA 4WEBH 1N64H 4X7SL 1RP9A 3NIFB 4P5MA 2DRUA 4ZDHB 2CRZA 3SGKC 2XIIA 4FOMA 4PW3A 3ULUC 4P48A 1G5AA 1GZQB 1CO1A 3HMXL 2CNYA 3FQRA 4HPYL 2A73A 1A7OL 3F58H 3VSUA 3O6FD 3D0LA 5AB2A 3HFFA 5GS3A 3U30B 1FDLL 3TBSA 4PWFA 4DOHE 1T20B 3C8KB 3PWJA 4PU2A 4RMVA 3RVWD 4C47A 32C2B 4DEUA 2CMRL 3RL1B 3VG0H 1RIVH 2C1PB 3WLWD 3HI1B 1AOZA 4K8RC 2Z9TA 4GP8B 2VAAB 1PDKA 1TKWA 3T2NL 1P2CA 3LKNA 3AT8A 4PREA 3VWJB 1NL0L 1NCCL 1L4IA 2AW2A 2HB0A 4FMKA 4NWTH 1WGOA 3QUYC 1V3LA 1IM9D 2GSGA 1K5NA 1IM3B 2R9HC 2WV3A 2RD0A 1OGTA 2OTWA 3MCG1 1MIEL 4I0PA 1G94A 1MFDL 3PFUA 2ENQA 1JN6A 1G9NC 1I1CA 1YC7A 3X1FA 4M6AA 3IEAA 5T1JA 1B90A 2ZKXA 1UUNA 5FWQA 1DJSA 4HUUB 4XP1L 3LKPA 2IQAA 3WHE1 2DIBA 2BO0A 1QFOA 3O4OB 3EH4B 3LS5L 3CZGA 2WN2A 3E1ZA 2ICWB 2EO1A 2QHRL 1UB5B 2VDRB 4GS7B 4ONGL 5KSAA 5DUBB 2EVJA 4LPYA 5J11B 3QPQD 3SDDD 1R3HB 3S96A 2J7LA 1Z9MA 3D85D 3HNSH 2ERJB 4OQTL 4EPSA 3TF4A 5EBMB 1PZ3A 1X5JA 4ZT1A 5SX4I 3WHE0 4DEPC 1M05A 4JPWH 3ZMRA 5GSVB 1PJ9A 2H0FA 2WXJA 1KCSH 5I1HL 1FL5B 2X1XR 3DX7B 1KN4H 4S2SA 4QCIA 3D3VE 1I8IA 4JLRA 3NJIA 5KYXB 4X6CF 3VXNA 4ZAKA 3Q5YA 3REWB 2AK1H 1ROCA 3QIBA 2AQQA 4FDWA 1MRDH 2GTQA 3OLGA 3O3EB 4OAWB 2X2JA 4LCVA 3D3VB 2XWTA 2CA3A 1PGRB 5E5MB 1WC7B 4XAWL 4HW6A 3ZU8A 3QDMA 4ZFQA 2YN5A 1EAPB 3VQ2C 3MGTA 2Y0SA 3AXHA 4AYEC 1JJUA 3FUEA 2H6UA 1BFOB 1B4JH 3CMGA 4LSSL 3HLAA 4DO6A 5J6SA 1UWGL 3AXIA 4QIRA 3Q3GB 1E4WL 4F7CB 1CR9H 4MMXB 3FCSB 3OQRA 1U8OB 4B96A 1J1PH 1AQHA 2JFCA 3PAZA 4Y1AE 5JW4Q 2AQ1A 4XXDB 5DD1L 5DHVH 2MTAA 2YKKA 1CE6A 1CL7I 3C6LB 1GKEA 2YBGA 3IJYA 2YFOA 4HXBH 5IR1A 4Y1AB 3ARBD 1IKFH 4IBYA 1E6OL 3GDBA 5E00A 3NA9L 4LLMA 3W9EB 3VU1A 1E8ZA 2GY7B 3QRGH 1DJIA 1J9QA 5IMLB 2XTJC 3UTTA 2Y7LA 1U95B 2V2WA 1SVZA 4HHGA 1RZKH 1AQ8A 3AU1A 3LIUA 4IRSC 3VXRB 4Z18A 4AC4A 4F2EA 4RDQG 5CJBA 2R0LH 4WW2A 1XCXA 5CP3A 1CZ8H 3LZPA 4V2CB 4N8UA 4QF1A 5I18L 1VPOL 1I8LA 2F53A 1T0PB 4N0CD 4LSVH 4WWKC 1TJXA 2W07A 5FGSA 2XXCB 3VGFA 3LEXB 4PLNC 3IDXH 4GRMB 5L2KA 3MA7A 5EU6D 4AEIL 4OJDH 3P4NA 3MRLA 4Z77B 4NQTA 2DLEA 4HF5H 5AVQB 5A43C 4AIXA 4X80H 4JY5L 1HHKA 4PG9B 5JUEH 4HJSA 2BVEA 1NCHA 2VC2L 2XTJD 2DQGL 4WFFE 2W0FB 1QZNA 2KL6A 1NFDF 4EI6A 3DXAB 4AYBA 5JDSB 1FVEA 1NGWB 3P3SA 4KKLC 2X6UA 4PJ7F 3QFGA 2J5WA 4XWGL 1IAMA 2XNAB 4HAFA 1TFPA 3EFDL 3MLSH 1Q0XH 5EV7A 1LO0H 1P7BA 2JIXD 1EEYB 1MHPL 3DX9A 3FOMB 3I9PA 1LD9A 1X5IA 5B1CA 1N8OE 4JKLA 3B7TA 5GZND 3HMWL 1F58L 2DMCA 3ZE1F 2WXHA 5MENE 4WFGE 3BVTA 1GJIA 2X9XA 4HCRA 2F2HA 2CGZA 4O02B 1S8DB 3R18A 4WU5B 1D5MA 3BVVA 4G8EA 4E36A 1XMWA 4A66A 3RJDA 4NQCE 1E9PB 4JDEA 2EDYA 1HYSC 4GJTB 3CSYA 3CVHL 4GQPH 5AZ2H 3R8QA 4LCYB 4BDVA 3C5XA 2XY1A 3STLB 5J4MA 3GNMH 1OCCB 4NQCB 5EH1A 1AIZA 1FO0A 2AI0L 2OMTB 4WV1A 4F8QA 2YMTA 4K4KA 2ZT9C 4ODSL 4QHMB 3Q44A 2VMEA 2CO6B 4MCZA 5C0IA 4NERA 2VXQA 4UBDC 1DQLL 3ULUE 4KRPB 2ZX8A 4P5TC 3L1OH 1EXHA 3B9KD 1M4KA 3BKYL 5T1LD 4N6QA 5JIPA 1MWAA 2Y22A 2E27H 4NP4H 4ZMXA 4OIIL 1Z9OA 3IETB 4YHLL 3LKRA 3KYMA 1DDHA 1BREA 2QMKA 4RFOH 1DQDL 1GR7A 5ALBL 1JV2B 2H8PA 3U1SH 5B22A 2CK0H 4B27A 1L9RA 3FQ1A 4YHZL 3ORJA 2BP0A 4FMVA 4Z7WE 2MOQA 1H6UA 2F7RA 4KTDL 3UZQA 2V5MA 1N59A 3ECQA 5HBBA 1CBJA 1P9MA 2FYYA 4LARH 3US0A 4NO0A 5D7LE 3VDAA 4HKXB 1RUML 2J55A 4WNSA 1I3UA 4IOIB 4J6RH 3VE0A 3ROOA 3SHSA 1G4RA 2JE8A 2O5YH 4XVUD 3G9AB 3H6AA 3OR7B 3E0GA 4YE4H 1CIUA 3F84A 4R2GC 3QZWG 1I9JH 3AUVA 3QZBA 3QUYB 3S3PA 3I6LE 1A7RL 3H1ZA 5HTSA 5F7MC 3MBEC 2SEBB 1KIRA 1WTGT 3DKHA 5EZLB 1S7RA 2UYLA 1A6PA 4OJCA 5FO9A 1IQWH 4NPYA 1FL3B 1SN5A 3ZTJG 2BW4A 4LCWE 2KZBA 3GUFA 3DV6B 3FT9A 1K3IA 1TENA 2Y5TA 4HJTA 1JV5B 2X41A 1JGVH 5DVMA 2PR4L 3L48A 2QSTA 4HIPA 1UM6L 1CFQA 4UM9D 3HMXA 3A4DA 4LCWB 4U2ZA 4R2GD 2R69H 3HPJB 4I0KA 1F3JA 4P4RB 1G7IB 3B4NA 2LU5A 4HJ0D 3T2LA 7CGTA 4ODVL 4MDJB 1ZHLB 3BKJL 4LAQL 2WW8A 1IBYA 1IAKB 4M7LT 4JGUA 1X44A 5DLLA 3C5SB 3MV7E 5D4HA 3MODL 4P0DA 1KWGA 1M3IA 4PJHE 5D5MF 4HWZB 2WK2A 1UWXK 2VR8A 2XWXA 2ITFA 4F3FA 3MV7B 2LOEA 3HBPA 1NMCC 3MRMB 2HJKB 4R90L 1KIQA 3QR2A 4H0LC 4PJHB 2AXFB 2AEPL 2QQKH 3CH1B 3V8OA 3MLUL 5IW6A 4PPTA 1PY9A 1M6OA 2AQ2A 4JDVB 4EVNB 1HK6A 2AEQH 5IF0A 4DN3H 5DJAA 4W4OA 4M29A 4XXWC 4FQ2L 3ZTCC 1X5FA 3KPRD 1A6UH 1ETZA 2GJ6A 5DK2B 4R5VA 2EABA 2NY7L 4JY6A 5E0FA 1HZHH 4NP9A 3SD5A 1DQJB 4MA7H 3CSPA 3QUZA 4QXWA 1BZQK 1H0DA 1E6JH 1UKTA 2NSQA 4B5EA 4HIXH 2FBJH 5C08E 2ZONA 4WAFA 4Q6IA 2VZUA 5I0XA 4KZ0A 1NIBA 5IM7B 3IS0X 2WP3O 2AJZA 2VMDA 2EIJB 1KEGL 4OQTA 3EJRA 3LRKA 3IM1A 3ZR5A 1SQMA 3CXFA 1A9BB 3HAEG 3EJZD 2W91A 2YZ8A 4JHUA 4LIQL 1CYWA 1RUQL 2A74A 3NCMA 5IJDC 5FM5M 3OJVC 3J07A 2DQIL 3GK8H 3P9LA 4JO2L 4B95C 4XH2B 5E1IA 2IWGA 1IIIA 2P24B 4QRQB 4R96A 2AKRB 2O61B 2J20A 1W72B 4Y4KB 3BP5A 1FVCA 2F19L 3B2PA 4MNHA 3C60C 3RIFF 3W0WD 3KDMB 1J8HA 4G83A 4HIHA 1IC0A 2C3VA 4X6CA 2IOMA 4IRSB 4HSAC 2DY2A 1T04A 2CLVA 3KM1A 2YA1A 2FUQA 1TJHH 1U4FA 4NRZA 3L13A 3RPIB 3T3ME 1I8MB 4C83B 4PJFF 1LE5A 4WWKB 4EN3C 4EXKA 1JHKH 3VDCA 4OZIE 3H3KA 2X3BA 5GPRA 1IBBA 3T3MB 1KXTA 3SD2A 1FUNA 3K1KC 2BHUA 3ET9F 1JERA 2Y6SC 4LHUD 4BA0A 2H3NB 1WSST 3SQBB 5IIEA 4JVUA 2FZ3A 3CV5A 4AUYA 1KELH 4WWPA 1M7UA 1QFUL 2B4CL 1XF4B 2YO3A 4P5RA 1WIOA 1OAXL 4HJJH 2R2EB 3SE9H 3RI5K 1MFEH 3DGGA 2AMUA 3AU0A 1FHNA 4EN3D 2VERN 2F58L 1N67A 1IB5A 2HN7A 2IG2H 2C7UB 3RVUD 4IS6A 1G7LA 4FYQA 4F7EB 2YRPA 5I1LA 4O9HL 5E2JA 4RQQA 3EYSH 3N1PC 4L48A 4NAQA 4G7VL 3VB9A 4FNUA 1T1ZB 1NSNL 3OKLB 4CMMA 2NZ1A 3BLPX 3MNWA 5G55A 1NUDA 1EV2E 3V0GA 1G5GA 4Y2OA 4LLVA 3VFUA 2ZWSA 1WZAA 2CKBL 3QJFB 1T1XB 3L3DB 3MGAA 3CFIC 1KB9J 4TNVF 5C0BD 1KCVL 4A2MA 4XX1E 4GSDH 4KY2A 4EI5A 4XO4A 5L8JB 4M1CD 3V6ZB 2OCJA 2VE6B 1AY1L 1OTTC 2QADD 1MCRA 2X4OA 1YEFH 4QRPA 5HHOD 5KBKA 5KVFH 1H9VA 2I7OA 3S4SB 4ODTL 1TCMA 2OFQA 4P5TB 3MRQA 5F9WC 4YSEA 1EHKB 2IAND 3B83A 3P4LA 4RISH 1D5ZA 2MTPA 1NFDA 2XN0A 5K9OB 1R5WB 2WTPA 3NSCA 4A2DA 2P8MB 1SOQA 2D7PA 4PJ7A 4Y16D 4GG6E 2J3SA 3CFTA 4CSZA 3BUBA 1WE5A 1XTMA 2EYSB 4M62L 3N50A 4KJQC 3LPOA 3D39E 4R97B 1T2QL 1OTTD 3FH7A 3MMEB 1MCJA 1VGEH 2Q8AH 5CEZH 2F08A 1TTGA 4NQQA 5DVOA 3MBXL 3V55A 3WFZA 3D39B 5F9JB 3I2CL 1S7UA 1CL7L 3CVHA 1DL7L 5IVXE 4OU3A 2NY3C 1R0AH 5F89B 4P05A 4X83A 4P49A 1VDGA 4OUOA 2N59A 3PHAA 4PAZA 3MBEB 1AZBA 3KWUA 5BO1L 2ZPKH 4PGEB 5IVXB 3CXHK 5IHUL 3WG7B 2ZCLH 5AVVB