2H0JA

Crystal structure of pucm in the presence of 5,6-diaminouracil
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
114
structure length
112
Chain Sequence
MGKLTTHILDLTCGKPAANVKIGLKRLGESIMKEVYTNNDGRVDVPLLAGEELMSGEYVMEFHAGDYFASKNAADQPFLTIVTVRFQLADPDAHYHIPLLLSPFGYQVYRGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Transthyretin-like protein pucM
publication title Structural and functional analysis of PucM, a hydrolase in the ureide pathway and a member of the transthyretin-related protein family.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 22
structure length 112
sequence length 114
chains with identical sequence B
ec nomenclature ec 3.5.2.17: Hydroxyisourate hydrolase.
pdb deposition date 2006-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 2h0jA00
4YDNA 2G5UA 3CXFA 3CN0A 4Q14A 2FBRA 5FW8A 2F8IA 1GKEA 4PM1A 4TLSA 1QABA 4TLTA 3CN3A 4QYAA 3DJSA 4FI8A 5DWPA 4MASA 5E4OA 5EN3A 2G4EA 4DESA 5L4JA 1DVTA 1DVYA 4IIZA 1IE4A 5JIMA 4TQHA 4N85A 5CM1A 3P3UA 3DJZA 1TT6A 2B15A 4TQ8A 1DVUA 1IIKA 1QWHA 1TZ8A 3NEEA 4PWHA 3FCBA 1TSHA 4TL4A 1E3FA 4TLUA 4FI7A 4AC4A 4TQIA 4PMEA 2ROXA 4QXVA 3D2TA 4Y9EA 1TTBA 4PWJA 2FLMA 2G3ZA 3I9PA 3Q1EA 3DJTA 1DVQA 3I9AA 3IMWA 3CBRA 2QELA 2H0JA 1TTAA 3GPSA 1E4HA 2ROYA 5CLXA 1TTCA 4N87A 4I87A 4IK7A 5JIDA 3CFTA 5FO2A 3CN1A 4HIQA 3A4DA 5AKSA 5E23A 3CN2A 5BOJA 3B56A 1RLBA 3TCTA 1DVZA 3KGUA 3BSZA 5L4FA 5TTRA 1U21A 5K1JA 3CFQA 1SOQA 4WO0A 5JIQA 4IKKA 4WNSA 3HJ0A 4PVLA 1F86A 1IJNA 2IGLA 3DIDA 1ETB1 3ESPA 3GRGA 3GS7A 3CN4A 4YDMA 2G4GA 3U2JA 4ABVA 4PVNA 4WNJA 5FW7A 2H1XA 5CNHA 3GS4A 5CR1A 5CLZA 2H6UA 4L1SA 5FW6A 2QGDA 4Y9BA 5L4MA 4PVMA 2H4EA 4DERA 2G3XA 1SOKA 2TRYA 1X7TA 5AL0A 1BZEA 5E4AA 4PWIA 1ICTA 4AC2A 1BMZA 1ZD6A 1X7SA 5AYTA 4L1TA 3SSGA 3GLZA 2QGEA 1IIIA 1ETA1 4I89A 4TM9A 4HISA 3A4EA 3NEXA 4TL5A 1BZ8A 5AKVA 5DEJA 4DETA 2GPZA 3OZKA 1THAA 1SN2A 3NG5A 1SN5A 1GKOA 3M1OA 4ABUA 4TKWA 3KGTA 2B16A 2B9AA 3IMTA 5EZPA 1TYRA 2G2NA 3CFMA 3DJRA 3IWUA 4Y9FA 5K1NA 4I85A 3IWVA 4ACTA 4D7BA 4PMFA 4ABWA 4ABQA 5CN3A 2F7IA 3DGDA 3CFNA 5AL8A 1BM7A 1TFPA 1THCA 3P3SA 3FC8A 5CLYA 3IMRA 3IPEA 3GS0A 5L4IA 3IMSA 1SN0A 4TQPA 3NESA 2GABA 1TTRA 5AKTA 1Y1DA 4IKJA 4PWEA 1OO2A 2QGBA 2G9KA 4HJTA 3P3RA 4PWKA 1BZDA 4MRCA 4IKIA 2PABA 1Z7JA 2TRHA 3I9IA 1DVSA 1KGJA 3NEOA 2QGCA 4HJSA 4PWFA 4QRFA 4TLKA 5HJGA 2QPFA 4MRBA 2B14A 4FI6A 1G1OA 3KGSA 1F41A 4DEUA 4TNEA 3ESOA 2B77A 3IPBA 2H0EA 3IMVA 3DO4A 3OZLA 3P3TA 3ESNA 4ANKA 5A6IA 3DK0A 3IMUA 2H0FA 4TNFA 2NOYA 1TLMA 3GRBA 3BT0A 4N86A 1KGIA 3D7PA 4HJUA 1E5AA 3A4FA 4TNGA 1ZCRA 4Y9CA 4IKLA 2G2PA 2WQAA 3QVAA 4KY2A 3U2IA 4IK6A 3DK2A 3TFBA 1DVXA 1FH2A 4PWGA 4DEWA 5IHHA 1FHNA 4Y9GA 3W3BA
chains in the Genus database with same CATH superfamily
3CFJA 2PPEA 3O6MH 4Y5YA 2BSTB 4N25A 1S7UA 2P8PA 2HFEB 3KZ8A 2GJPA 2E76C 3K8MA 2YPVL 1IBHA 5ETUA 5J1AA 3WUWG 5IW6B 1WIUA 1YG9A 4YJZL 4YVNA 3BP7B 3O2WL 2NUPA 2CUMA 4HS3B 4P0DA 4AMKL 4KRLB 3L1EA 3CCHB 1Q9KB 3TBTA 3L8QA 2NY5H 1RULH 1WE5A 2Y3NA 4UV7L 3VG0H 4LESA 4JX0A 5JMRA 2XV6B 4PG2A 2QDVA 2XWXA 3TT1H 1DBKH 5D7IB 5AVZB 1JVKA 3NSCA 4D9QE 2VXQH 4CC4A 1G0YR 5IFJB 1TJMA 4UB0L 4F57L 2LU5A 3CFQA 1MRFL 2GJ6A 4QTIH 1YEHH 3B9DA 2E4TA 3K4ZA 1XIWB 3VFUA 5C0IA 2CO4A 2J4WH 4XVTH 1YMMA 3BZEB 3U4EB 3QQ4A 3BUBA 4YSRA 3O2VH 3FUEA 1AVAA 3MUZ1 3CSFA 3WUWB 4TRPL 5D5MB 2RB8A 3RGVA 2IDSA 5HJDA 3HE7D 2BVPA 4ZSOE 4Z7VF 2I25N 4D3CH 2DIBA 3TVMC 2LV4A 2QADB 4M93B 4AGLA 5ADOL 3GFUA 1EA9C 1H8NA 3RY6C 2Q7AA 1GGYA 2ZSVA 1RK1B 4WWOA 4G9DB 4PGJA 3IJEA 1G1CA 4PS4H 4D9LL 3DVNA 4DKTA 4RMUA 3CFKB 3CK0L 3LS5L 4HXBH 1U8MB 1X5ZA 1T1YB 1SXNA 4TVPE 1Z1WA 3RI5F 4F91B 1GL4B 2PO6C 5GS0L 5DEFB 1EXUB 1YNTB 1EFQA 2PPFA 4L2LA 2WSDA 3KPSA 3O6FB 1QR4A 4Q97A 5GS0D 5IBLD 4XPBL 1CLZH 1N3NB 3RIFK 3KPPB 2J5LC 5DQDL 1BBDH 3MV8E 2Z92B 2YHGA 3ZL2A 5BXFB 2V37A 1RHHA 1KTRL 1KPRA 2FECL 2JE8A 2VXVL 1XL4A 4ZNEE 4O51B 2A1WL 4GKZB 3SE8H 3U1QA 5L2JB 3KW8A 3INUH 2WNGA 2HN7A 3CZSA 4X6DE 5DD5L 3OB0H 1S7WA 4IBSA 1CR9L 4I7ZC 4XNYL 4QXTB 2X2UA 1WEJH 3NCYS 1XAUA 4NQCD 4YDLB 3L3KB 2XWDA 2VO8A 3OMIB 2R69H 3QUGA 3UBFA 3W0WB 4OLYH 2YD5A 2YOAA 5BO0D 2G5UA 1HNFA 2R1WA 1P7KA 3E1ZA 3FQRA 4DEPB 3ZYOA 1GZQB 4MDJB 3V4VA 3BP6A 2OR9L 2QADC 4XGZB 1FZOA 3QFJB 4Q0XH 1A6TA 2QQNH 2V9TA 4WWID 3T09A 3T1FA 2VITA 1U36A 4MA8H 4YUEH 5E03A 5AZEL 5DD3L 5IQ9A 5B38B 1MWAL 2EIZA 1FG2B 1UH2A 5DS1A 3MUJA 4G42A 1HHKB 2YN3A 1K4CA 1LEIA 1E4HA 1I1AB 2YRLA 3U9UA 3C6LB 3V0HA 1I7UB 2NXZD 4M43H 4MNHA 5EA0L 3N43F 3VRLF 2IWFA 3X11B 5D2NB 4AV0A 3SPHA 1XB8A 3G08A 4KRNA 5I0WA 4LEOA 4AYMC 3BSZH 1H3XA 4P5TB 5GZNC 4MA7H 2J55A 3EDFA 4MWFA 2FE0A 4MXVF 2KERA 2Y1ZA 3Q6FB 3ZX1A 1WBYA 4GAYA 4EE2A 3S4SG 5EOCJ 4QUOA 3VGBA 3B5GA 1EHLH 4BKLB 5JW4M 5FDYA 5IVNA 1UHVA 3JV4A 1BLNA 3ETBF 3S2AA 3MJWA 2GYSA 4DKEL 2OMWA 4AQEA 3QDGB 2ZE0A 3FQ2A 4X5PA 5EOTB 1JPST 4YDLC 1PW3A 5B1JC 3EKCA 4ZYKB 5JQHC 2BNQA 1HSBA 4JO5A 4IRZL 1H3UA 1OTSD 5CGMA 4NKMA 3VJ6A 1TZHB 2AV7B 1I3VA 3ZHDA 4JQIH 2Y07L 5T5FH 3IAGC 1CGTA 5TDPA 3PXLA 1P1ZB 4M6MH 2FB4L 3FB7B 4OLWH 4OZ4B 1I31A 4BQBA 2EUXA 4L18A 1O9WA 4KXCA 3SPCA 1E4WL 1ACYL 1FVEA 3O11A 3GBML 3EYVB 4I9XA 5FGBC 1V5JA 1KELH 3TBYB 3WY2A 2R8SL 2F7QA 4OIFA 4ZMPA 3BO8A 4D8PB 3MTRA 2B77A 5CD5C 2V2XB 4CU7A 3C6LC 1LMKA 4WFED 5M94B 3OZ9H 5A6IA 3ULUD 5ANHA 5D2NC 5E5LA 5F89B 4TVPH 4NGHL 4G6KL 4Y2LA 4HC1H 4YXLL 1UB6A 4IKLA 3S2CA 3ECQA 4P5TC 2QFRA 4JFPB 3OPZL 5D1XE 2XX0A 2FH6A 5LGHL 1JYVA 4FA7B 4XPTH 3WXVH 2EIEA 3SOTA 3VXTB 4WJG3 4I3RL 3KNBB 1YPZE 4HIIB 4W4OC 4JFHE 2DF3A 3NFNB 1OALA 1SDDB 3CLFL 3R19A 5FYJE 3RL2A 1SJEA 1DLFH 3QXDB 2N7SA 3P0GB 2OR7A 2IGFH 2WVSA 3GSUA 4JPQA 3NSJA 1LNUB 1KIRA 3H7LA 4A68A 3KDMA 2PCFA 4OFKA 5C7XL 1JPEA 4QYAA 4W93A 4OI7A 1GPOL 3VM7A 2L7EA 3HZYA 3VB8A 4ZTOH 3V5DB 1FC2D 1LO0H 4PJFA 1BVKA 1DFBL 3L48A 2YD7A 1YZZA 4G6MH 1DZ0A 4BRVA 3LPPA 1CDYA 1ZGLM 4XN2A 5C07D 3LPOA 1U3YA 2ENYA 2MH4A 3ZTNH 4NLHA 1KXQE 1T0MB 3BRFA 1XSKA 5EC2B 2RJMA 4NKOB 3V0WL 1IX2A 1U2YA 3DC0A 2Q8BH 3UJJL 3AWFA 3Q06A 1IGCH 2YC1A 3TEXA 4QXUL 3ECBB 1PDKB 3QRFM 3IDMB 4HGWB 3F6LA 3FCTB 4UIMB 5KN5A 4OB5L 1B88A 3ZT6A 1SN5A 2AK1L 1N5YL 4BFIA 4YHOL 3MRJA 3TBSA 1LLAA 4FXKC 2AJVL 3JWDL 3FQWA 4PBDA 5AOJA 3BRGC 3UYRH 4ES8A 3W1ZA 5F0JB 3B2UD 1CGVA 4HH9B 3GWJA 3V6ZA 4ERSH 5IHZB 4D8OA 2IH1A 5I1GH 2JKRM 4HEPA 3AUVA 1P5VB 2EXYC 4Q2ZB 2R69A 5E8DL 4L0ZA 2YXMA 4WFGE 4W68A 1MVUA 3BYYA 4N20A 4WKZA 1NZRA 3EO0A 1F5WA 4IBUA 3L7FB 1PZDA 3FB8A 3WJLC 2F0CA 4LVNB 4M5ZL 4YK4C 4LP5A 4GG6A 3A4AA 1CXLA 4Z78B 1BFVL 4LCIH 2JB5H 4JPSA 3UERA 4EIUA 2EC9T 2W0PA 1TJIH 3KLAB 5GRVL 2VWEC 4JJHA 4X6BA 4JCLA 3QPQD 2NXYC 1BFOB 3WJJA 5J3HD 2NX5E 1QLFA 1IU1A 2XZCL 3DVGA 3TXAA 1FGNH 3HC0B 2ZKHL 3P77B 4YPGA 5JXEA 3JVGC 3EJUA 1B3JA 2I69A 3A24A 4UMGA 4XWOD 3ZL4L 2EE6A 2P9RA 3TO4C 1J87A 1E4JA 2CBTA 4G2AA 4IBLT 1RIHH 1XR8B 1KJ3L 3C2AH 3VW3L 2NNRA 2EYSA 1ND0A 4YXKL 3Q7JA 3D34A 1MH5A 1U30A 4J8RB 3T04D 3ME0B 3WEAA 3LKPB 3QEGH 43CAA 2CIKB 1S7TB 4YE0A 5IV2B 3WMSA 2NW3A 3ZE0E 5H37H 4AJ0A 3HFFA 4WWKB 3GO1H 4RMQA 5E2WH 2KKQA 1U8QB 3RBGA 4KZEL 2IPTL 3HTLX 1KGUA 5D1ZC 4OAWB 4X99B 2YOCA 3HI5L 3PWUB 1XSJA 5JA8B 5FO2A 2A2QT 4HGMA 3WY1A 5IMKB 3LH9A 1MFAL 2WSPA 3FTWA 2BM3A 3VVWA 1I7ZB 4NJ9H 3UBXI 2BK8A 5ALCL 2JCCE 3DX6B 4JKNA 4PS3A 3VO0A 5I73C 3AZUA 4Y4KD 1JZJA 1XR9A 1CU4L 1CL7L 2A9DA 2ZOLA 1DN2A 1QNIA 5EC1B 3TU6A 1C7SA 1FZMA 3HC3L 1E9QA 1MCFA 1IEBB 1MQ8A 2X1PA 4ZSOA 2DQ6A 5ESVA 1N7MH 3VH8G 4L3EB 4GQRA 4BFFA 5KUKA 1RUQH 3N1FC 3TJEL 1CI3M 1QEXA 2ENSA 2FEDD 1DVFD 2VUOA 3VXSA 4I89A 1OE3A 2H2PD 2DRUA 2BSED 2RFXB 4TVUA 5AKVA 2BSRB 1WA1X 3UEZA 5CF3A 2DYPB 3RIAK 2YGNA 1OSEA 5DVKA 5KOVC 3K6IA 4A6YL 1WGVA 2GFBA 2FYYA 4QKTA 3MLVH 3NPZB 3CBJB 2H3KA 4I18A 4P07A 5IKCA 3RGHA 1QVOA 3CC5B 2NY4D 3QJUB 1UA3A 4K7PY 1KB5B 3U4AA 3QIUC 2HTLC 3EDJA 5H94A 4P23D 1NIDA 1HZKA 1G5AA 4AV4A 1FE8H 1U42A 1DUYB 2XA8H 5B21A 3H56A 1CXKA 2DYRB 1HQ4A 4ES9A 4H8WL 4Z77B 3VH8B 4WUUA 4HMCA 4XP6L 3MBXL 2F53E 1OO2A 2CXKA 4HFUL 1JPGA 2CIIA 1KC5H 3DVIA 1ZY9A 3APMA 3SODB 4EDXA 1BJ8A 3FN0L 1QP1A 3Q5TA 4LSTL 4P3WA 4XX1G 5I1LB 4HU2A 4N2DA 2CHXA 4WWKC 4ZNEA 1MRDH 2BCKB 4N2HA 5JR1H 3SE9L 1MRCL 4JFYA 1RUAL 4GSDL 5C0BD 3N41B 2OYPA 3HHSB 3H2WA 3LZOA 4JFWA 1MLBA 2VLLA 4QTHA 4Z76B 4XN4A 2NY6B 4WJKB 3L2NA 3K0YA 3RWCB 4K15A 4BIKA 4BXSV 3DVFA 2BRQA 3BDYL 3PAVA 4UTBA 4DQAA 3ZE2E 1K6QH 4BQ6A 5F7WC 3B7YA 1LK3H 1TVBA 1D3CA 1KTJA 1KENH 5JHDB 1BREA 5I6KA 1UWEH 4CKQA 1DJSA 4JKWA 4GXVH 3ZO9A 1OEZW 3REVA 1CLCA 1DQML 2HP4A 1Z6JT 1EMTL 2GAZB 3DJZA 5MEQA 5KBDA 3WS6A 3IDYB 1A7BA 3VD0A 3VXPB 4AT6B 5HHOB 1HINL 3QULA 5AAMA 3MBWB 5TJWK 4JREB 1QSVA 2D2OA 2HT4C 4O02L 5D1QB 3I9PA 3VFPB 4OSUH 3QAZB 4EZLA 5JHLA 5L6YL 2HMID 4K23L 3RVVD 3NRQA 5D2LE 2MNJB 5J9PB 1YO4A 5AKSA 5A2AA 1J1XL 3TCTA 1JGUL 2JSFA 1P84J 4IDJH 1ZV2A 4PW4A 3ZZQA 2AQTA 3EDKA 5LXVA 4JG9A 4UOQA 3VTAA 5F7NC 4JFZL 3WKPA 2HVJA 3MRBB 2M83A 1XSOA 3QQ9C 4KQ3H 2B4CL 3S37X 5L4MA 2O61A 1WFJA 5CJOH 5KG9B 3HHRB 4XBMA 4BKTC 2V17L 1SOKA 4DVBA 5KTEH 3L9BA 4P9HL 4A04A 4ATWA 2Q2LA 4NN6C 5KBMA 1RIUH 1A3QA 1IIIA 2UWEE 5LNEA 3OSVA 4PRNA 3V4PA 4GSUA 4JY6A 1M57B 3AXIA 5A1AA 3BXNA 1JDDA 3P9LB 1NBCA 1CE6B 1U3NA 2NY6C 3AXHA 3PG2A 3QIWD 5HTSA 5LGJA 4KQ4L 1A2YA 2XIIA 4WHYH 3NK3A 5C0AB 4TUKH 2L7UA 4C58B 4EI5D 4HIEA 4CGUB 3O8XA 3LQMA 1YEIH 2NY1B 4JRYE 2RHEA 1PG7W 4QRRD 1QBLH 2OSWA 2QSTA 3K7UA 1CIUA 1FBIL 3GJEA 3PGFL 4LEXH 1WQVT 5FKPB 2A6KB 2X4OB 4IU2A 2WP3O 2UY7A 4PJ7B 3FMGH 1L3WA 3MJ8A 4R96A 1UCTA 1FN4A 2J57A 1MZZA 2QPDB 3M46A 4AZ8B 4OCSL 3HG3A 1MCSA 5A16A 2BZDA 3FT2A 4L8SB 3UTTE 1CFSB 4Z7UE 4A2HA 3QORA 2WHVA 5KYWB 4JREC 3O6LH 1DSFL 1JP5A 4OZHF 4G9FE 5D1QC 2EDRA 3QAZC 4AITA 4AKOA 1I8MA 2OYMA 1CFTB 1J10A 1J1PL 5H37A 2NTSP 3ZHNA 1DTUA 1YUKB 4NO0D 1ZHNA 1GS6X 5BS0A 1MCCA 3VFGH 1L9SA 4XXDA 1BAFH 2IBGA 2NY7L 2AEPH 5EN2A 1SF3A 1SOXA 3M6DA 5JOFA 1HH9A 2ARJA 1U0QA 2H1PH 1INQB 1X9RA 3PQYB 3CN3A 4M8UA 2DQEL 35C8H 3V0EA 3WE6B 2DLEA 1XVSA 4NDMA 1J5HA 3B9KA 1GHFL 2QQKH 2BHUA 1YPZA 4YS4A 4EUPB 3DRQA 2EUWA 2NLJB 2VR7A 3EO9L 4ZXBD 3VDAA 3BAIA 5BZWB 4JNXA 5SX4I 2GITA 3CDZA 2QVFB 3WIHH 5HYSB 2VW6A 5FCSH 2ZTBA 2GG1A 4HV8A 5GRUH 5I1DB 1FIGL 1J05B 2Z6FA 4XB8A 4YWGH 4PR5A 4JY4B 3ECWA 4Q9BA 5FK9B 1J8HB 1M7IA 2O6EA 3BT2L 3STBA 2PCXA 3C75A 5IVXA 5ESAB 2NY1C 3U0PB 4ZFZB 2OXHB 1DE4B 4JCWA 3AS2A 3M7OA 4FCHA 4HS8L 4L3FA 1E6OH 1T22B 1RSFA 1U8JA 3QZOA 3QR1A 4H5SA 5E2JA 4BINA 3UTPD 5INDB 2B1AL 2QSQA 3P73A 3T0EB 4E0RB 3BN9D 5ICZA 1ETB1 1PKQE 1TPXB 2IAMA 3IRPX 3Q2VA 3VFWB 4F8NA 1NFKA 4XCNA 1JERA 5I1EH 1TNMA 1Q94A 1ES0B 4Q9QH 5IK3B 1KIUA 2XZAH 3FYIB 3Q9QA 4W9KC 1KXQA 2W95A 3L3DB 3SKJH 3WG7B 4L8SC 1WO2A 2YSSB 4U33A 1DANT 1G9MH 5C0EA 3OLDA 1F4AA 4FRWA 2DBLH 4Z0XB 4DP8X 4N2IA 3MZTA 4LSRH 1KG0A 5KSAA 3ECVA 4GRLB 3KBHE 3S3JA 3VFTA 1B0RA 5E00B 4UV4H 4KI1A 3L4ZA 2A73A 2JKJA 1P4IL 3R8QA 3SDCB 5GGTL 5GXBB 4Z3FA 2A0LC 3H9SE 4LLUA 3AU1A 4MNQD 3CQQA 3BH4A 3QCTH 2WKOF 2D31A 4MAUL 3LVTA 1G0XA 4PW9A 1CDIA 3GBLA 4PQXA 1JNJA 4IS6A 5ERWB 3TWCL 1I9EA 5HDQH 3VA2C 1YC8A 4L0PB 3TIEA 3PDOB 4F7TB 2IJ0C 5DO2C 3PYCA 1J0KA 1NIEA 5AWNL 1PLGL 2JQAA 5GRVK 3BKJL 3ZKXC 1TF4A 3RWJA 1BZDA 1CQYA 3GMLB 3PP4L 1VENA 4ODTL 2HG5B 5EU7C 3ETSA 1T89A 4N2BA 4ZMNA 1FORL 3DMMA 5C6TH 4O9HH 1FNEA 3ARFA 5CGYD 2MSPA 1B0GB 1BVOA 1CICA 1MXDA 4G6JL 1T2XA 3FNKA 4KK6C 1Z3GH 3G5VA 4F2MB 5D7IE 3BVUA 2KLSA 4OLZH 3GMPB 2Y1YA 2XG5A 3QNYB 1H19A 4AGMA 1ZLVH 5MENB 2ZD0A 3B7TA 1OPGH 2H7WA 3QUKB 5DC9B 5IBTL 2NX5A 5DZJA 1KXVA 2X70A 3T0EC 1ZJAA 4XMKH 2K45A 1TPXC 5DU7A 4OFQA 1I1YB 3OKNA 3QEHA 2KZKA 4PCTA 3SJVB 2XTSA 5D5ME 1HCFX 3JV0A 4KU1A 3Q44A 4RQQA 4IIQB 2Y3AA 4DKDC 5IM7A 1RZIA 1PNDA 1WV7T 3UZQB 4NP4L 2OL3B 1MIML 3H1ZA 3P3YA 2ERJC 5CM1A 3TO2B 2ZKYA 1KIPA 3BCDA 4K5MA 3BKYH 3I9GH 4UQIM 4AW4A 4BH8A 2APSA 2IDTA 1G5GA 4LLDA 2QPUA 4G5ZH 4R26H 3ZGIA 3P9MA 1MCHA 4W9IC 1R46A 2OPCA 2ZQKA 3D69A 3SDCC 5D71H 4ZMZA 3L3OB 2DWSA 1C12A 3MJGX 3OJ2C 4YEFA 3HNSH 5L0QB 2DB8A 2NSXA 4GLRI 4M7LH 2FX8L 4F2FA 4HZLB 3IVKA 1UKSA 1KV7A 4E5XB 1YEEL 4JZJB 2JVUA 2O5ZH 2C3HA 3HMWL 1A6ZA 3LNEA 4QT5A 4XNUL 1D5RA 2P80A 4IU3B 2BY3A 5HDBB 4OLEA 3WD5H 1NAMA 3V0VB 1AS7A 2QVTA 5E6RB 4PJ8A 1MUJB 1YMMD 3QDMD 3WDHA 2R23A 1MNUL 2YPLB 3RGVD 1A1NB 2BHFA 4PUBL 4D0DB 1VGKB 4MKTA 5ICUA 3L3JB 3AY2A 3LIZL 5E95B 1E67A 5FM5O 5DD1H 3QQNA 4PJCA 3GJFH 5F1SA 1AC0A 1HXMA 5DZPA 5B1KA 2C3XA 3FZUD 3VFRA 3T2NL 4XBGA 3W0WE 3VSTA 4HWEL 1IKOP 1EEZB 4MJIA 3BLBA 3DGDA 3U7AA 1JNHA 4I8DA 1QBMH 4X98B 4IIQC 3PHSA 1GGCL 4F7MB 4I48B 1BZOA 3W57A 4HF5H 3GS0A 2V7NA 3I75A 2APXA 1X5KA 2B39A 3UPAA 3QFJE 4H8QA 3KPSD 2CDEA 5DRXA 1XV8A 1ZK9A 2DKSA 4AQ8A 1YJDC 2XZQL 4AGPA 4IQHA 5E1QA 4G8IA 5I8OL 1Y0LA 3RAJH 1JI1A 1I3RB 4FI6A 5EBGA 2YA1A 4MAYB 3QYNA 1AIZA 1MCEA 5D93B 1MFDH 2V2TA 2OMTB 2GSIA 4YSSA 4BH7A 4G7YL 5KSBF 3I6GB 4L4TA 1L0YA 4Y1SA 4NRZA 3V0DA 2YZ1A 5D2NE 5FEBA 1SXBA 1KULA 5C70A 5IB1B 3RDTC 3WNNA 3MXWL 3ZU8A 4P2RA 1WRFA 3UX9B 4A7VA 2WWMC 4P4RB 2OZ4L 4JZJC 3W2DH 1RJLB 4FG6D 3UTQB 1H6TA 3MACH 4XI5D 2J5WA 4GMSH 3I6LE 3IJHB 4LOVA 2H8PB 4NXKA 5DVOA 4OZGF 3VE0B 4LAQH 3W39A 4OCLC 4GKSB 3F3HA 2Q76B 2JJSC 5FF6B 4L37B 2X0WA 1UURA 5DWPA 5IWLA 3EYUL 1XD1A 4RZCA 4PY7B 4C83B 4N2KA 5DK0A 5FFOA 3MNWA 4OKVB 2CGRL 1UC6A 2BHYA 3PFQA 5PAZA 1ZPLA 3WLWD 5HGHB 2X7LB 3QDGE 2J8UA 1HJCA 5DI8A 5I16A 2P4AB 2A6JB 4PIRF 3K71B 2YAEA 4OBRA 4NP9A 4BZ1L 1N70A 1A7OL 4MMZB 1UWGH 1FSKB 1TTAA 2N1TE 3MUUA 3O4OB 1CDHA 2VJ8A 5AW6B 4E9QA 3IXTA 4FOMA 3ARDD 4WFFE 1OB0A 3QNZA 1EERB 4G1EB 4X9YA 1OCCB 3EJSA 4MNGA 2AQ1A 5LXGL 1FNHA 2CHNA 3WN5B 5I17B 3G5YB 1VFAA 1Z66A 4XNQA 4ZFFB 1RPQA 1ILSA 2K7QA 2VN5A 1FFNB 4FQIH 1UWXH 1B2YA 4JG0H 3AT8A 4NNYB 1C8QA 2DIAA 1QSFB 2E3VA 1MW3A 3EJJX 1D5XA 1X7SA 4MAYC 5C0DA 3D50A 5EEUA 1FL5B 3H2PA 1ZXQA 4RESB 2F5AL 1H5BB 1NDGB 3V9FA 4JGUA 4M7ZC 4I5BA 1JN6A 2BC4B 2CUHA 4MQTB 4PN6A 1CLYL 1YEDB 5CMAA 4YE4L 4PRAA 4FQLH 4WU5A 3P9WB 5IROC 4QD2E 2F74B 4A39A 1G7HB 4JRYA 4YDVB 2I5YH 4WGKA 1AYOA 2ICWB 3ZIYA 4TYUA 3WEXB 5I5RA 4U1NA 4V11A 4AL8L 5JOEA 3V9CA 5FHBH 3O6ML 4Z7VB 1OZTG 3HMXA 5I9QB 3RWHB 3QYMA 1G84A 1JGDA 5LQBH 3QQ3A 5C0CA 1MAJA 2XY2A 5G4NA 5L88H 1BXAA 1A1MA 5F9JB 1MY7A 3OKOB 4PJGF 4WW1A 3NZ8A 1FSKC 1QFPA 3O4OC 1OT1A 4QHMA 4GMTH 1KWGA 1V7NH 4HLJA 2NY5L 1RULL 3N06B 5MEOB 2FJHB 4OIBA 3VG0L 3FHAA 4LCWA 4ZOAA 4MYPA 2NYKA 4PJIF 3C5JA 3QZPA 1K72A 4UNUA 3AJ7A 3TT1L 1DBKL 3QVAA 3WN5C 2YLKA 4FZ8H 5HDOA 3CFCH 4DOHB 2VXQL 1I53A 1PEWA 3ZYIA 1HHHB 2N56A 4L3CA 4QTIL 1YEHL 3MROB 4UAOB 3UTSE 4WK4B 2R2HB 5FKAB 2CLVB 3F7QA 4FADA 2J4WL 4XVTL 2NCEA 4P2QB 1IE4A 4OGXH 2Y22A 3O2VL 3C60B 1DEDA 5TGBA 1H5BC 4D3CL 4XHJD 5I8EB 4M5SA 1NGPH 4IEFA 4H1LB 3OWEA 1YEFH 2EKJA 2XN9A 2B7DT 4PCSA 1OKEA 2QKIA 1SHWA 4ZS6C 3E8UH 4WO4D 5FHAH 2ETWA 4A38A 5JIDA 4LOFA 4PS4L 3SOBH 2WC7A 1VAHA 2EEBA 4HXBL 4M9OA 4PJ6A 1T6VN 1O7SA 4FG2A 4RDBA 5I8KH 4IMLA 5HP5A 4W81A 1XBRA 3PP3H 3GZOA 2PWHA 2JELH 2I07A 2CMRH 3LDBB 1U33A 1OOAA 1WBXA 4V1DA 1AHWB 3KLLA 1AXIB 1T5WA 1CLZL 3G5XB 3KAAA 5DZOA 4B6ZA 2EDKA 5TE4H 3APDA 2W92A 1AKJA 1LO5A 1BBDL 2HJFA 2WYTA 3CTTA 3D18B 3O3EA 4JFDB 4U3SB 1KFAH 4QXGH 1HHIA 1F4WH 2P43B 3SE8L 3INUL 1NANH 3IMTA 4PGBA 3A47A 4N5ED 5EG6C 1B4TA 2XLLA 3AG1B 3H7BB 3N43B 3QJVB 1A9EB 3N9GH 4WUKH 1UM5H 2BP3A 1WEJL 2X2HA 5E1AB 4CNIA 2R69L 3GIVA 2NY2B 3O45A 1AR1B 4KRPB 4OLYL 2OXGA 4R2GC 1AO7B 4Y4HD 8FABB 1BP3B 4AG4H 1RI8A 2X44D 2G9KA 3BP7A 3H3PH 1MXGA 4R7NB 1LQSR 2PYEA 4I88A 4IKIA 3VWJC 1TNNA 5LDUA 3CCHA 4NHCL 1PEZA 4Q0XL 2XX1A 2QQNL 5AOLA 4U1SB 1X5GA 2PLTA 5D4JA 1GGBL 2X4TA 4URTB 3VXUA 5HI4C 4MA8L 4QOKB 4YUEL 3TV3H 1GTFA 3Q8FA 4Y8DC 2PTTA 3OZLA 2ADYA 5D7IA 2Q3AA 1VRSA 2X4RB 3GF8A 4BEIA 7CGTA 4X80H 1UD2A 4GEIA 1P6AB 1MSPA 3QA3B 5DUJA 3HE6B 4L9LA 3LB6D 4L8BB 4P4KA 1XIWA 3QE5A 4M43L 4NSKB 1DVXA 5EBWA 2KZWA 3LDBC 5JXED 3WUWA 4AQOA 1WWAX 5E99H 2ATKB 3BSZL 4OI9A 5D5MA 1W0WA 3HG0A 5AW7B 3PL6B 1RP9A 4MA7L 3FDWA 4FX5A 4L3EE 5KZCB 4HBQA 3ILPB 3INOA 1PY4A 5I74B 4U31A 1QATA 3UROR 1P7QA 4F20A 1RK1A 3WV0A 1EHLL 2F5BH 32C2A 2Y6SC 3OL2A 3Q3GA 3X13B 2H2SD 3U30B 3U9PH 1T1YA 5FWQA 4BK5C 2CDGA 1FFOB 4MXQD 3X14A 4L0YA 2D9QB 5F88B 4JJ5A 2V33A 1MJ7H 1EXUA 1YNTA 1MCQA 4PEEA 2WYIA 3HUJB 2R51A 3O6FA 4G3YH 1N10A 2CJUH 3JXAA 3CFEB 4NFBA 3V52H 4BFJA 1AR1C 1F6AB 4KRPC 5CU5A 4D9QD 1PFOA 4JQIL 2H1XA 1HYSC 5T5FL 4JGNA 2XNAB 3SE6A 2Z92A 3S5LG 5C8JA 3FO1B 5BXFA 1JPSH 3GSQA 4M6ML 1S7VA 4JRXA 4OLWL 4GKZA 5LG1A 1JVLA 2MKWA 2G2RB 2Y5TB 1I7TA 2CDFB 3EFOB 5GGRY 5LUMA 5KJ7E 5JNYA 2C26A 1F00I 1KELL 3MRNB 1SDAB 3VXSD 2IVFC 4JPWH 1RMFH 4QXTA 5EWIH 2WGNB 2ZUYA 3HE6C 1EVUA 3L3KA 1V7MH 3L3HB 3OZ9L 3ZKNC 1L7TH 2N0MA 4NKDB 3T6ZA 1I4FB 4HJEA 4TVPL 4NZRH 3RHWF 3OJDB 4HC1L 2HPOA 1XMEB 1PZSA 1C5DB 4TVPD 4CRPA 3IPEA 4MDJA 5BUAA 4NQSB 1QO3A 1OIOA 4N1CA 5I74C 4K7FB 4XPTL 3WXVL 4HX1A 4L1LA 5HHOE 4GKNB 1VA9A 4TLKA 3F84A 4CL7A 4BUGA 5B38A 4WJ5A 4TOYH 3MJ7B 3MRHB 1MF2H 4JL2A 5D1QE 3UADA 2BS8A 4OCRH 1DLFL 1HHKA 3MV8D 4TNEA 1G7JA 2IGFL 1I1AA 1QOKA 1RD6A 1BIHA 3ZZ1A 1I7UA 3KYNB 1ANUA 3X11A 1CUOA 1MJJB 4C54A 4WHTA 4JN2A 4DGUA 3MGTB 4QJ5B 3FONA 2UX7A 4PTTA 1P69B 3VXMB 4XOCA 4UTBL 4N0FB 5EUKB 4ZTOL 1LO0L 2P5EB 3Q6FA 1U6AH 5DURD 3PGCB 4G6ML 4PPTA 3S5ZA 1G9EA 4PV9B 1FNAA 1TFHA 4JFQA 4BKLA 4J3UA 2VN7A 1JF6A 4MLIA 3ZTNL 4AYFA 2RAMA 4PJ5A 5I15H 3IS1X 1R24B 3PJSB 5GGRB 3U25A 2JH2A 2BOBB 4TNWK 2Q8BL 2K1MA 1TZ8A 5DJ2A 3B2PA 3NPSC 1IGCL 4YHPB 1JHTB 3D12B 3D08A 2NZ9C 3ZHLA 1QTYT 5E8OB 5C0AE 1NFIB 1WLHA 4AGQA 5DD0H 2EVIA 1CD9B 2Y9RT 1BXXA 2FZ3A 3MLSH 2YK1H 4RVBA 3H3KA 4FD0A 3QDJA 4RFEB 2XDHA 3NN8B 1JPTH 4S2SB 4AGNA 2AV7A 1JGEB 2W60B 2R29A 1NGYB 4F7CB 1UXSA 3UYRL 4BWUA 1NINA 2L0DA 3S4SA 4HOZA 4B9IA 4PJ7E 3MV9B 2X41A 4ERSL 5J6GB 3B6SB 4PRIA 5I1GL 1ADQH 3FB7A 4LOUC 4CU6A 4QO1B 1OAYH 3ZDYF 5CBEB 4PU2A 4RGNB 1K2DA 3R18A 3MFFB 4AWJC 4FABH 2BP0B 2CJ3A 2ZAHA 4D8PA 4LLQA 2IG2H 4LCIL 2JB5L 2V2XA 3QNXA 1BD2B 4R3SB 2OMYB 1IAKA 2OTUB 3IFPB 2EDYA 1TJIL 3UG3A 4Y1AA 5F89A 5BUPA 1MCRA 3P4LA 3NJJA 5HYQB 1MFNA 3IJ8A 5E51A 5GRXG 1QUPA 3FTGA 4H0GA 4H4NA 1NMAH 4JFPA 3WTWA 3ETBJ 2R1XA 1FGNL 2EINB 3U0WH 3PQYE 2ED6A 3QO1A 3NABH 4GFXA 5CS7A 4GBXA 4P5MB 1TJHH 2WBJB 4PG9B 1CXIA 2CJSA 2X2YA 3JYCA 3NFNA 3ZQXA 1RIHL 2JQMA 1M1XB 4TUJB 5KS9F 3C2AL 4PY8I 3QXAB 3QXDA 1KY6A 2ITEA 2MKLC 4G8EA 4HJSA 4PSPA 4ZG1A 1SF5A 1LNUA 2W1NA 3MREA 1ZT4A 4R83A 1IZJA 5K69A 1J8HE 4HCGA 3QEGL 4GIPD 4RETB 5F3FA 3QORD 3WEBA 1ZSDB 2FR4A 2Y36H 3GO1L 4X5QA 5E2WL 4APQB 3VD1A 3C8HA 1U9KA 1TLMA 2H3NB 3U1SH 3T0EE 3UJTH 5CJ5A 5IR1A 4L9DA 4BA8A 2A83B 3K6SA 3GMNA 2P52A 2FK9A 3QIBC 1JL8A 4J3TA 1JYXA 2ZXGA 4ZX5A 5EPMA 4NJ9L 2AQPA 4NKOA 4RGNC 2FBRA 2WBWB 4XMWA 1W6LA 1BMWA 5EOQH 3ZMRA 5DC2A 1X4ZA 5D1XD 2C9VA 5E6SB 1AXSA 4P5SA 3GM8A 1PDKA 4RGOL 3GUTA 3IDMA 4HGWA 4ZAKB 5FYJL 3KL5A 5I1IH 3FCTA 2W9LA 3B9KD 4UM8A 1M05B 1N7ML 4K7PH 4TL4A 4H7VA 1SUJA 4LSQH 1RUQL 1LQBC 5FYJD 5E70A 3RFRA 1FUNA 4U6XA 1TZGH 1OTUD 1WWBX 2GEEA 3QISA 4HIJA 2HJLA 5E1IA 5IHZA 1SZNA 3M88A 3MLVL 3ATDA 1LK2B 2FGWH 5DC4B 1OWWA 4LVHB 4K5LA 2HG0A 3L7FA 1N67A 2GJZB 3DNKA 5I76A 3MJ9A 1FE8L 4EIZC 5I71B 1SLUA 2XA8L 3SDAD 2OJZH 1OTTD 3ATBA 2E6JA 1OPOA 2YQ2A 4W9EC 3HW7A 4QWWD 1KC5L 2PPDA 3OB0K 1EHAA 3SYPA 3L5HA 4F2ME 4P2OA 4JANA 4KTEH 3F85A 1BFOA 3JZ7A 4APQC 1MRDL 5JR1L 4J3OD 4LEBA 4GIOA 2V7HB 3RB7A 3HC0A 2YMXH 3C8DA 1PL3A 4HKXA 3RNKA 3P77A 3AAZA 3L3GA 3U2SB 2CQVA 2FUQA 4NPYA 3SJVE 5T3XE 2X1WL 4XCEA 3CFNA 5A3IC 2QQLH 1WCBB 1XR8A 1QA9A 1K6QL 1OCWH 2ITCB 3WI9A 2PUQT 1R17A 2P8MA 4QLWA 2MCMA 1LK3L 1U4FA 4HAGA 1KENL 4O58H 2ZZUT 4WFGD 1UWEL 4ZAKC 2YKKA 5DMYA 4WHDA 3LKPA 5LBSH 2MWCA 2CIKA 2HH0H 3F83A 3HZKA 4GXVL 2XG4A 5IV2A 3CPUA 6CGTA 4OQTH 2C1OB 5D72H 3GRWH 3O9WB 4OAWA 4X99A 3O3BB 2VOTA 2YRPA 3PWUA 4AEFA 1KDIA 3DMMD 4ESKA 3ARFD 2CCLA 1XEUA 5F6IB 1LO3H 3S3SA 1CICD 4LLWB 3LRSA 3NIGF 4XNXH 2H0PA 4OSUL 4AEHH 3BZDA 3FH8A 3T4AB 4LL4A 1S9KC 1SVCP 2FWLB 3DX6A 4Z7OE 1HESA 3BMVA 2XXCB 3QG6B 4QNPE 1AOZA 3MRPB 2H6PB 2NX5D 3FOLA 4IDJL 1MI5A 5ECGA 4PWGA 5HDBE 4CADA 2LU7A 4LL9A 4EUPH 4R7LA 3C5SB 1XGUB 1DR9A 3DROB 4K3JH 2YPLE 4KQ3L 2VXSH 3HB3D 1PZ2A 4EI6B 1I85C 1IT9H 2BVQB 2JLLA 5CJOL 5CCKH 2RFXA 5B7MA 5KTEL 5FYJU 2BSRA 1TYJA 2WMPB 4OZHB 2DYPA 1PFCA 2M26A 1RIUL 3SBQA 2G3ZA 4XMZA 3CC5A 3CBRA 4XCCH 1KB5A 4GSQA 4N9GA 4P06A 2ADFH 1MCNA 5E23A 2ED9A 4TUKL 3DUUA 2Z7UA 1WS8A 2HT2D 3VB9A 1YEIL 2WZ5A 5FYLE 2BXYA 3DO7B 1SUHA 3LMJH 3VH8A 1J5OH 1BAWA 2BFGA 1PGRB 1H3GA 1QLRA 1OB1A 2CPUA 4LEXL 1A7RH 5DC0A 4GO6B 4Z3TA 1DJHA 2BVUA 2P80D 5GRWA 1WT5C 3FMGL 2V3EA 3QUMH 3IGAB 1JZEA 3BAEH 2BCKA 2XTLA 1X7QB 1U41A 1CDUA 4X9HA 3O9WC 3APCA 1JZ2A 2R9HD 3QXVA 5CGBA 3O6LL 1IB5A 3ABMB 5J5EA 2H32A 2Q6WB 1NCUA 2FQDA 1HQRB 1FJ1A 2ZKMX 4RBPK 3RWCA 4AENB 2ED7A 1LHZA 2Y72A 2WAHA 1SDYA 1UUSA 2EO7A 3S96B 3VFGL 4GO9A 1BAFL 1BPLB 5E56A 3WHE1 3U0TA 5JHDA 3DX9B 2AEPL 2X3CA 4ZUSB 1KEMH 4FQXA 1QFOA 1M53A 2WANA 2FQEA 2YZ8A 1CVSC 1NWOA 1O9ZA 2XWZA 4LCCB 4BWWA 1UZ8A 2MCPH 4UT6H 5AKTA 2H1PL 4PB9H 4K9JA 1YYLH 3EJCA 3P2TA 4JFFB 1IEHA 35C8L 2CNYA 5HHOA 1DHKA 3TP4A 2QQKL 2R0ZH 4K9EC 1J11A 2UZYB 5F1KC 4CDGC 2F53D 1SLWA 3RB5A 4AYGA 1M2VA 4YHNB 3VACA 3WIHL 2R4SH 3DPBB 4W9JC 2ODIA 3U7WH 1ITBB 5GRUL 4EN3B 4IRJB 3NBNA 4YWGL 3QEUB 2C9PA 2NOYA 4YFLF 4JRWA 3LV3A 1IVLA 4L4TD 3A4FA 1FDLH 2NPLX 2B0SH 5KYNA 4F9LA 1HWHB 1H15B 1HN1A 2VQTA 3MRBA 1E6OL 3TNNA 4P2RD 4WWNA 3L4VA 1FQ9C 5KG9A 1PZCA 2FX9H 1F4XL 1GKEA 1QSFE 2IPKB 1YJDH 5I1EL 2E27H 2NUTB 4Q9QL 2FWUA 3PY9A 2AJ3B 1CL7I 2XZAL 2E7DA 2VC2B 3HE7C 1QSEA 5I82A 2K6WA 1PQZB 1G9ML 2CO6B 5DHVA 3RIFF 2DBLL 3P9LA 4TLUA 1CE6A 4C55A 2P44B 4LSRL 1XF1A 2BFVH 1AGCA 1RHFA 5C0AA 1TENA 3OC5A 2QQQA 3I9AA 1J12A 1JV5A 3QWNA 5DGRA 4UV4L 1NCDH 4OBSA 2TSAA 4HCRH 3MA9H 2PCYA 3Q5YA 3SE3C 4YXHH 1VZIA 1L0QA 3U1PA 1QTSA 2YJQA 3PAYA 3QCTL 4PJ7A 2IGLA 3CWGA 2ITDA 4XP5H 5AB0A 2WWKO 4LCCC 4Z7VE 3TEWA 3G04B 2ZCZA 1KLUB 4KKLC 2DQFB 5I5MA 3BJLA 5KBLA 4YHYB 5CHNB 5HDQL 4FC3E 3WDJA 2P26A 1F3JB 5FYKE 4KITB 4YNYA 5I66A 2IPUK 5AL0A 2ICES 4RIRA 4KKAC 3GSNB 5E6YA 4HUUA 2LHAA 2VW4A 1U8IB 4EIGB 3DUHA 4P48A 1RZGA 2WTPA 2NY3B 4I3SH 1YN6B 2WP3T 1CFTA 2MIZA 3MOBH 3QWRA 3ZKMC 1XTLA 1KPUB 5I8CB 5C6TL 4O9HL 1IC7H 2B16A 5HDRA 4B0MB 3MRIB 4NZTL 4GG6F 5AB2A 4OJDH 1JK9A 1Z3GL 4JB9H 1ZEAH 4OLZL 4XMUA 4AVIA 4DOHE 1OPGL 3MBEA 2DI9A 4MD4A 3SKOA 5FYLH 3VXOB 2NT1A 5DRWB 4Y5XA 4XMKL 4QRBA 4P2QE 4JRYD 5ISZB 1J5DA 4NQXB 2NLJA 4BSJA 5BZWA 1G7LB 2QGBA 4IBYA 3ALPA 5IB4A 1GOGA 2DWTA 2JNZA 2FO4B 1XF5A 4C56A 1N18A 3QJOA 5KYXB 1QPPA 3AWEA 4KKCD 3MRLB 4DO4A 5I1DA 5L8KB 2FNBA 2BIOA 1BYPA 4JY4A 4JFEB 5FK9A 3RTLA 1J8HA 3BKYL 4L29B 3I9GL 4TQEH 5GGUB 4F7EB 2VAJA 2F8OA 4G5ZL 3U0PA 4R26L 1U58B 3HN3A 2IBBA 5D71L 4JHAH 1TOXA 5GS1B 4NC2B 3K6OA 4HG4K 3GRBA 2B9BA 3VFMB 3HNSL 2NXZC 5F0LB 2WCPA 5BZZA 2FATH 2GCYB 4M7LL 3GI9H 2YEZB 1T6BX 1X5JA 4HALA 4N8VB 3RKDD 2QR0A 2WNWA 4YHYC 3Q8AA 2O5ZL 1MCIA 4NKQB 4AQ1A 2RACA 4XAKE 4CSSA 4Z0XA 3WD5L 4PV1C 4JFDE 1AQDB 2Q7YB 1XF2A 3FQNB 2NY3C 4GRLA 3T3PB 2D2CC 1ADWA 2BVOB 4DCQB 3D33A 4WF7A 5KSBB 1KXHA 3LEYH 4AW7A 5DZ9A 2E74C 5BV7B 3ELAT 1ZTXE 3NP3A 4G8AC 3I02A 4XVOA 3S36H 4DPRA 1H0DA 2VYRE 2UX6A 3AQYA 3KBFA 5DD1L 4PYGA 1P9MA 5I5IA 4NCC1 5C2BH 3E0GA 2D7NA 4U1MA 5ERWA 3H9ZA 4G6FB 4OZGB 1R3HA 3PDOA 4GXUN 5D4QA 1AO7E 2HJKA 1AGBA 4DGYH 1IGJB 1QBML 3S34H 4K2UH 2ZSWA 1JHKH 2KZBA 3OG6B 4KXDA 1AZVA 2BSDA 1N4XH 3BCFA 4HF5L 5DRNB 4BD4A 2HX7A 4B3EA 3NQIA 2IANB 2VMFA 1E2VA 4HFWA 5IZ7A 5E8NB 4C57C 2V3DA 1J9QA 1NFAA 5JQIB 5F1NA 4C4KO 2WXRA 4XT1C 5E6UB 4QOKE 3MXVH 2Z35A 2OQJA 3UAAA 3VGFA 1W8EA 3RAJL 3DIFA 2EUZA 1AKJD 1JIBA 5MENA 1HXYA 1MFDL 4PS7A 3MRDB 2X0UA 5T1MA 1B4RA 3PXHA 1KCWA 2BSSB 3BGMB 5L9DH 1IE5A 3LNDA 3ULUC 1J9CT 1JZGA 3NTCH 4UM9B 1I1YA 4KK8D 4ABWA 3EYQD 3SJVA 3GI8H 5IESH 3GMOB 3P3SA 1JJUA 3W2DL 3H9SD 2PO6D 2DLIA 5IJVB 3MACL 5CEZE 1PX8A 1G7MB 1HS6A 1XGZA 3FUDA 2OL3A 4GMSL 5FYKH 4XO3A 4LAQL 2X6CA 3TO2A 2Q3ZA 5F7HA 3VD3A 3P4OB 2HLFC 4RMTA 1VACB 3QUYB 3EJPA 3VRIA 4OGQC 4F5CE 4X4KA 5TDOA 4RDQF 3ZTDC 3VXNB 2EICA 1U93B 3L3OA 4AVHA 5BV7C 4I4WA 2ZOKB 5DEGB 1MDAA 3OKDB 1IAIM 2LLNA 2WXIA 3EYFB 4HEMA 4UOJA 1WFUA 4HKBB 1GA2A 4CC0A 2WLIB 1OY3B 3HUJE 3VXUD 1CB4A 1UWGL 4UTAH 1EAQA 2Y1AA 4FN0A 2FHBA 1NCAH 3IT8D 4IU3A 1KIQB 2R27A 3QWOB 3FT1A 5HGAB 5T5NG 5AYTA 5B4MC 1BQLH 1XIWD 3FYEB 3G6JA 1MUJA 2ADGA 1IQDA 4FQIL 1D9KB 2EIMB 1A1NA 4JG0L 5D4HA 4GP8B 4D0DA 1VGKA 4YC2B 3FSAA 1XGPB 3IDNA 2KQMA 4PJGB 1M9WA 3HAEG 3UDWA 5J6SA 2NDFA 1P7QD 1M2OA 4YMPA 4X7FC 4TSAH 1KTKE 2C1PB 3ZRCC 2QTVA 4FTVB 4FGMA 2Y7NA 4KMTH 5DHMC 3PABB 4PJIB 1G9NC 1U3HB 3K6FA 1XCQB 2AEQH 5IMOB 3B2UC 5HHVH 4ZK8A 4FQLL 4I48A 1ERNA 2H9GB 2WB7A 3GDCA 1W8OA 2LR4A 5EU6B 4AEEA 2BH0A 2I5YL 3VTTA 4Z5RB 3O6FD 3BFOA 3QUYC 4RMRA 3MC0A 2Z7WA 4OLXH 5FHBL 1I3RA 1AD0B 1KBGH 1W72A 2FQFA 3HC4H 2P42B 1S7XA 4B96A 2A5UA 3S6CA 1KYOJ 3LKSB 2DJSA 2C7UA 1VLXA 2OMTA 3ABLB 3BD4A 3BUDA 2SEBA 3R7RA 3OAZH 4IOFD 3U48A 5JYLA 2ZXCA 3TF7C 5LQBL 4PLNC 2EDLA 1Z9SA 3B8SA 1RFDH 2DJMA 1DVFB 3OAUL 5L88L 2VABA 4KC3B 2GK0B 2QJDA 3VXME 3QPQC 2UXGA 2YD0A 3AC0A 1N12A 4GMTL 1QRKA 1RJLA 1V7NL 2P5EE 5IROA 3QS2A 3UTQA 2RIKA 4P3DA 3D07A 1N59B 3IJHA 2H8PA 3VE0A 4XWOC 2EEDA 2EDBA 1EZLA 5CLYA 4B9ZA 5FF6A 2FJFB 4FZ8L 3GXFA 1E6JH 3CFCL 3MV7E 2ZG1A 3SEPA 4PY7A 1RZ8B 4Q74A 4C83A 3H0TB 1D9KC 4LLVA 1E9OA 5E1GA 2TSBA 1C1EH 4OKVA 4F80A 3EO1A 1FCCA 4XCYA 2A6JA 4OGXL 1GVIA 1AD9A 3AT9A 4HLEA 4M61B 4OCYH 1T0NA 1F02I 2CK0H 4MMZA 4TUOB 2ZF8A 1TDQA 1NGPL 4LCYA 4A37A 3JYBA 4F9PA 1YEFL 3ESNA 4D0BB 3CXDH 3RY4A 5D7JA 4W9ZA 4LKXB 5CD5D 1I1AD 2IIJA 3MV9E 3C6LD 3E8UL 1R75A 3KJ6H 5FHAL 5GJTH 3T0BA 5T1KA 3UBXG 3NIFF 5F9AC 5KVFH 2V4LA 1L6XA 3NOIA 3RIAF 3SOBL 4GUQA 4ACPA 3B9VA 4L05A 2MNWA 2BNRB 4ZFFA 1YLBB 4N0YH 1FFNA 4RGNE 5CEZH 4U7MA 4NXSA 4P5TD 4BSWB 1VFBB 3L4TA 5IVXF 1DBBH 1MW1A 2JELL 2CMRL 2VL5B 3I6LD 2ZCKH 3SGDH 1CC3A 1BD2E 2IMNA 2QLYA 5TE4L 4PJ5D 5E6ZA 1DVFC 1O6SB 1UG9A 5EEYA 2H2PC 5D9SB 2BC4A 3F7PC 3QJZA 4E41A 4PGEA 2VN3A 4NC1C 5KW9H 1KFAL 2FLMA 2YD3A 4QXGL 1N2RB 5F7EH 3PNWA 3P0YH 1F4WL 3QDGD 3UBXB 4HWZA 4NIKB 1G7HA 3UYPA 2VH5H 3QRBA 3ZUNC 1L3NA 4LNRA 3WEXA 2X4PB 4OZIA 3N9GL 4WUKL 3QDJD 1P4LB 4P23C 1UM5L 1NIAA 2Y25A 4M6OH 1KWKA 1UA6H 2ZX5A 5JIPA 2EJ1A 4GRWF 4PRID 4ICWA 2YFNA 4Y5VA 4U0RB 1UJTA 1GZPB 2GBTA 4KTDH 4B0MM 1ICTA 4AG4L 3FFOA 4FYQA 4Z7AA 3H3PL 4UZSA 5F9JA 3T2OA 1A7QH 4QI3A 3QZLA 3OKOA 4LPCA 1CWVA 3X12B 1ZLVK 15C8H 1BZ8A 2CHWA 5CEXB 5MEOA 1S9VB 1CD8A 2FJHA 4J8QA 1SYSA 1I8KB 4G7VH 4X8JB 3TV3L 1DJWA 4OCWH 1Z9LA 3QIWB 1ED3A 4KDTC 5HGGS 2WXLA 5BNXD 4X80L 4NWTH 5E9DA 5IBUB 4GUPA 1WP6A 3MROA 3QUXB 3VFSA 2MHAB 5FKAA 1HDMA 3IBOA 4LF3B 1ZS8B 2WBKA 3BQUA 5L4IA 1KBVA 5AG9A 2EXYD 1Z9OA 3C60A 3BZFB 2FRGP 2HZHA 3IB4A 5E99L 3H6AA 1FAKT 2X3AA 3ARVA 2X89A 5I8EA 4JM0A 4YSOA 1PYWB 1LP9A 4CMHB 2DPKA 4H1LA 4X4ME 3IE9A 5ELIA 5IJCC 5DZAA 1PBYA 1ZHLB 4E36A 1MJUH 3LTVA 1P5UB 2F5BL 1J8SA 3DO4A 3WFDH 3P4MA 5E0FA 3U9PL 3RVVC 1KGIA 1FLTX 1V3KA 4FLSA 2Z0BA 4JJOA 1A1OB 2XACC 3RILA 2NNFA 2OJ1A 3OAYH 1MJ7L 4OIAA 4FQHB 1LEGA 3QH3B 1WFOA 3K2UH 3BKCH 5FA4A 1AHWA 4G3YL 2CJUL 4AJVA 3G5XA 3V52L 1KMGA 1WHPA 5DJCA 1HCVA 1CIDA 4U0RC 1AKPA 4MASA 4N22A 5SWZB 4YGAB 4YGVB 4AH2B 2MCAA 1R3KB 4U3SA 1JPSL 4AIZB 5T1LA 2EDDA 5F96H 1U91B 3GJFK 4R4FH 4IHBA 3LKRB 1BHGA 3H7BA 1G94A 1KJ2B 5JW5B 2HSIA 3QIWC 1A9EA 2QSCH 3RX9A 3K0WA 4JPWL 1RMFL 2LAAA 5EWIL 3V4UH 4HBCH 3D9AH 1V7ML 3QUXC 3PGDB 1JXKA 1L7TL 2WINB 1PNCA 3JWNC 4OGZA 4FHJA 4WW2A 2OFQA 4IKKA 5ALBH 4NZRL 4JUSA 3DARA 2DAVA 4PJCF 3RDJA 8FABA 3MCYA 3BUIA 1D7DA 1USQA 3QW9A 1K8IA 1UJ3B 1LE9B 1QKZH 5C6WH 2OLDA 3ZQWA 1OP4A 4DP7X 2AI0H 4OD3H 3SY6A 3UAJA 4CMMA 2FDBP 1P5UC 3OKKB 2YD4A 4MCYB 1BXVA 5HGDB 4TOYL 2BHZA 1MF2L 2X4RA 1UB5B 4P46A 1N26A 1XH3A 4OCRL 5J6HA 3H3BC 3QA3A 4NN5C 4P2OD 1MY5A 1IFHH 4X7CC 2R0LH 4MD0B 4NSKA 1E3ZA 2O72A 1T1ZA 3EFDH 4ABQA 3EZJB 1EAPB 1IO4C 4MNQB 3PL6A 3MFGB 2EDFA 3MRGB 5DSCA 2HTLD 2MOQA 3BC9A 4GYBA 2HX8A 1EO8H 1JWSB 1NA8A 2J88H 3LNIA 3ILPA 1DUZB 2JV6A 4DN4H 4LFHD 5AZ2H 1N0LB 3B8YA 2LOEA 1VPOH 3F7LA 4G8GA 4OZHE 1WAPA 4ZXBC 5I15L 3X13A 3MNMA 3LH2H 3A6CH 3NCBB 1P2CA 2VJ0A 4HKZB 4LAJH 4ZO8A 2MJWA 5IJKC 3ORJA 2DMCA 1OLZA 1QUNA 3NAAH 1NPNA 4WWKD 3FF7A 3DX2A 1RZJC 5CD3B 3V8OA 5DD0L 5A7BA 2EDJA 4C47A 1OLLA 4W70A 3DX0A 2I26N 1R6VA 1I8AA 3MLSL 2YK1L 4P57A 1NCBH 1TKWB 4QAMB 4WDIB 2NR6A 1YQVH 2J8UF 1JPTL 3QRGH 2DV6A 2PXYB 1Q8MA 1S4IA 1UWXK 3CLEH 4LPYA 1E4XH 4FFZH 4R8WH 2AVFA 3FO1A 1OP5K 1UJ3C 5KS9B 1RUPH 1J8KA 3CG8A 3KBEA 4ZQKB 1MCJA 1OAYL 3FQ1A 1T7ZA 4HK3N 2G2RA 4RNRB 2CDFA 2CR0A 3EFOA 5GZOC 4FKKA 1B4JL 3M45A 2LQRA 3CFJB 2F54A 4L3ED 4FABL 3HBPA 1S7UB 3KWWB 2P8PB 4M7JH 3VG9B 4WRLA 4XMTA 2ZCHH 3ARGB 4PMEA 2IG2L 1GZHA 1MPAH 2DYPD 4B97A 5J1AB 4MA3B 1ORQA 2COQA 3GXIA 2NUPB 2IQ9H 1LM8V 3OJDA 3UCQA 3STZB 1NMAL 3S5LA 4NQSA 4A2MA 3U0WL 3F05A 2F1EA 4JFFE 1NBZA 3TM6A 4GKNA 3NABL 4Y9BA 1TJHL 3MLTA 2GJ6B 4U6YA 1HEJC 3QQ9D 3SQRA 4FKHA 2XI9A 3MJ7A 2AF2A 3T77A 1UD3A 3ZRSA 3QQ4B 3NEXA 4BFEA 4V33A 1FWXA 1WGOA 3P02A 1MJJA 4H40A 3OTTA 2O4EA 2Y7OA 3VXMA 5E5MB 4LPVA 2DH2A 3L6FA 2AXHA 2NY6D 2Y36L 5EUKA 2PXYC 5EBMA 3K46A 1FFQA 2J43A 2ZSVB 2GHZA 1NGXB 3U1SL 3GXPA 3UJTL 3AUWB 3IJEB 2KI6A 3DVNB 2X12A 3ZTEA 2GW5A 3DUSA 1SNRA 1GIGH 2PPAA 5JHDD 1ZLUH 1HVXA 4AIEA 2BOBA 5EOQL 1GGUA 5IW3A 2TRHA 4G72B 2ZUVA 1JHTA 1M71B 4Y5YC 4RRPM 4YHPA 5FW6A 3VG9C 1J0HA 5B3JF 1Y7VA 5I1IL 4J39A 3PLYA 5AVRB 5HHOD 4K7PL 3LN4B 4KV5F 3IPBA 4LSQL 2VR8A 1B6DA 3NN8A 2XFXB 2XWBB 4RFEA 4S2SA 4BDVA 1NUDA 1TZGL 2A9NH 2W60A 2WIMA 1NGYA 5D1QD 1IAIH 5MEPA 3EBHA 1M3JA 2BIIA 3MV9A 5J6GA 4TNVK 2AMGA 3D39A 2Q8AH 3EYSH 1T21A 1EJOH 3IF1B 4YSUA 4PG2C 1S7WB 2FGWL 1IC0A 2WOBA 3VMOA 2A6DA 4CC4C 3MFFA 3QZMA 4KX8A 2VLRA 3TV8A 3HNTH 1PCSA 2ICEA 4RA0C 4K9EH 2OJZL 2BP0A 2IOMA 3P3UA 4R3SA 4XNMA 5FM5M 1BEYH 1OM3H 5AB9A 1ZHKB 2JMRA 2OTUA 3IFPA 2R1WB 1P7KB 3FQRB 2VDNB 4KFMA 4CA4A 3E6HA 3NCFB 3V4VB 1DQDH 5CCHE 1HX0A 2C4FT 3L5WA 1VADA 2I60H 1KFGA 3NIGB 4KTEL 1JYNA 1FZOB 1A6TB 3P0VH 1NLDH 3EH2A 1MW2A 3FU7A 3ALWA 3HG1A 5I6PA 2YMXL 3HG5A 5C0AD 5INCB 2VITB 3T1FB 1NIFA 2I32A 4AE1A 3FZUC 1UFGA 1C08A 5IQ9B 2KBGA 2NY1D 5ISZE 1BF2A 3V0AC 4G42B 4P5MA 1OAKH 5LCVH 1LEIB 2WBJA 4PG9A 2QQLL 1TQCB 4TUJA 1M1XA 2EC9U 2DBJA 1OCWL 2VQUA 5D7HA 4MNHB 5B1BB 3W9EA 2FWOA 3QXAA 3W56A 1OE2A 3G08B 2AANA 4Y1TA 5SWSA 4LEOB 1KUMA 1J5CA 4KO9A 1BMGA 4O58L 4JFEE 4L5FE 2JTYA 1PG7L 4KJPC 4MWFB 3UTOA 2EDTA 5LBSL 1WBYB 2A6IB 4NERA 4TL5A 1QFHA 4F58H 3VI3F 4LBEB 1ACZA 2I9TB 3NJFA 4OQTL 4P59H 3BPCB 5D72L 2G2NA 3GRWL 3KLHD 3ULUE 4OW6A 3TF4A 2Q3XA 4HK0A 2ZX9A 1LO3L 4FAAB 1TQSA 4XNXL 1QWNA 1V3JA 4AEHL 4AQEB 3VCLB 5DQJA 4BJLA 4XI5C 3DWTA 2BNQB 1HSBB 4ZDHB 2KHAA 1G6RA 2UZXB 3T3PE 3VJ6B 1A7PH 5DJ8B 1OXYA 4K3JL 4ZW7A 3SHSA 4B9PA 5E2UH 5KSBE 2QHRH 2VXSL 1ZK5A 4AYSA 2CH8A 5CCKL 1IT9L 2ZNWA 3PUCA 3WLWC 1E8XA 2XETA 3MLRH 4WIQA 1AS6A 2J25A 5FV2A 4XMVA 1Q9WA 4UQCA 1EANA 5CJBA 4ALAC 3O11B 1J8HD 1LK2A 4KK6D 2WXPA 3E8VA 4OZGE 4XCCL 2P24B 2ADFL 4MJHA 2NCMA 3BO8B 3VA6A 2GJZA 2LLLA 3IJYB 3ULVD 1TQCC 2MQ0A 3KYOA 1R5IB 3T0ED 2VO5A 5J56B 2VC2H 1IC4H 3LMJL 1J5OL 3HRPA 1PSKH 1KCLA 1UB6B 5E9NA 3W81A 2MOVA 4YSEA 4R7XA 1A7RL 1MCBA 3ZUCA 1VEMA 2DKUA 2Y69B 4KAQH 5HVHC 3LZNA 3QUML 1GMEA 2YSTA 5I6NA 1ZV5A 3BAEL 5B8CA 4AC4A 2V7HA 3JTSA 4GRLD 3ZTJG 3WNPA 5JW4N 4XN1A 1CBVH 2XN2A 4XNZC 3U2SA 5JHBA 3SY0A 4OFDA 1KCRH 4AJWA 3RL2B 3SDCD 1FHGA 1X5IA 3GSUB 2EO1A 4GQPH 3B56A 1WCBA 1D6EB 1AGDB 2ITCA 3KDMB 2PCFB 4IKNA 1UQSA 2RCSH 4HH8A 4LHQB 5TE7H 2DH3A 1JPFA 3GSNH 1KSRA 2X9WA 3HZYB 1QASA 3OM3B 1KEML 4LNVA 2XWJA 4PJFB 3CZUB 4XPHH 4DFIA 4ENED 3DURA 2NMSA 2MCPL 4UT6L 4U2YA 4PB9L 1YYLL 3C8KB 3SSGA 2FEEL 2DWDA 3O9WA 2BIPA 2R0ZL 3CVBA 3O3BA 1KYFA 2EZ0D 2GT9B 4PRHB 5I0ZA 3PDGA 1HAWA 1G43A 5D55A 1QLEB 5BJTA 2R4SL 3T4AA 3U7WL 4JM2A 4N2OA 5MEND 4ANUA 3TN0A 3TASA 5KN5B 5DHDA 2WGXA 3CE1A 4Z7QF 4ILDA 4HWBH 3TBSB 1TFPA 1FDLL 5AVSB 3C5SA 4XE5B 1XGUA 5EU3A 2CU9A 1SMAA 1VIWA 3SJVD 5T3XD 2Y07H 1NLBH 3JV6A 1CGWA 2FX9L 3IXAA 1S78C 5ICYA 4OY9A 2X09A 2OS7A 4G11A 1YJDL 1YRKA 2WMPA 4L5FH 4PJGE 3CVHB 5T1JA 2E27L 1JNNH 2BNUA 4QRSB 2K8QA 5L8LB 1UATA 4M5TA 4WKZB 3WTYA 5CSGA 3EO0B 3OMNB 2RA1A 4WK0B 4FTVE 3C6SB 1OK0A 3FW6A 5AOIA 3BOVA 3FRPG 5BO1H 4GG6B 4PJIE 2JXMA 3ULUH 4GXFA 2BFVL 4ELDA 3VUAA 4MAZA 3ARBA 1MCWW 4Y2OA 4BK4A 1FLRH 5EU6E 1FNFA 1NCDL 4XOAA 2MMXA 4HCRL 1W91A 3UG4A 4EI0A 1BQHG 2BMKA 3MA9L 3HS8A 4YXHL 5IJBC 2WWMD 4F1ZA 1QLFB 3DVGB 4XP5L 5LNDA 3W37A 4PM1A 2O6CA 5E4OA 4YPGB 3IGAA 4K3EH 4CSPA 3TCLB 3MNZB 1BOGA 3OQ3B 1X7QA 4LHUG 4XP1H 1EZUA 4KXZH 4RISH 4X8CA 2CD0A 1IBGH 2G9HA 2HFTA 5BV7H 4BQCA 2YPLD 4PWHA 3D06A 4NC1E 5DXWA 3DXAA 4I3SL 4PJ9A 3WFHB 3MOBL 1MH5B 1UM6H 2YR3A 2X5PA 4LPWA 1IC7L 4N5EC 3S0PA 1FP5A 4X5WA 4WSGA 3S96A 4DPBX 4RWYH 2PR4H 1GPOH 2K0RA 1ZEAL 4JB9L 3DX9A 4IRSB 4KY1H 5E4EC 4BA0A 1DFBH 5J1TC 4OIIH 5FYLL 5DUMH 4NENB 2YXVA 4JFFA 1QG3A 5FYLD 4MX7A 4PS8A 5ICXA 2UZYA 1T1WB 3KLKA 5FO8A 1ID2A 2QLVB 2JFCA 2B3RA 1OV8A 2XYBA 3OXSA 1RSYA 4LKCA 4PD4J 2FJGB 4EN3A 4IRJA 5I1JL 4MAYD 3WO3B 3QEUA 1FZMB 4W9DC 5ESVB 4H20H 4OB5H 4Y89A 1FZJB 1G9NH 2WKOA 4TQEL 1EBPA 2E8YA 3DRTA 3QC6X 5EUOF 4BFGA 3VXSB 1JG9A 2BNRE 1H15A 2AXGB 4JHAL 5I6XB 3DETD 5GRJH 3LB6C 3WJJC 4MDRA 1MCLA 1TR7A 2DD8H 2DLTA 2GSMB 4ONHA 4C8XA 5IROD 5DO8A 2FATL 2GFBB 1TITA 1P4UA 3M7FB 2HLAA 3QBTB 4RGMC 1FNGA 4I18B 3GI9L 5JXEC 5IKCB 2DQUH 4UINH 2OK0L 1N8ZA 2ZOOA 3OAWA 3QCUH 2GABA 3AT0A 3ZO0A 3WSQH 2EIBA 2VZVA 1WFNA 1BJMA 2Y2WA 3RX7A 4DETA 4QRFA 5DTFB 4NO3B 4R5VA 1HL8A 3JV5A 5E4IA 3G9AB 4G83A 4WUUB 1WZ1H 3NYKA 3FJTA 5I30H 1G0DA 3LEYL 3I3DA 4EDXB 1P1VA 5EF3A 3H2QA 3X1BA 3S36L 3LXBA 3UP1A 3VFVA 5I28A 1WFIA 3D7PA 4OV6F 2JJTA 3H9HB 4HHGA 5C2BL 5HYIA 1DANU 3G04A 1NMCB 1KLUA 4S1SH 2J44A 1MLBB 4QTHB 2AJUH 2PETA 4KX9A 1FHNA 2FBJH 5CHNA 4Z9KB 3W5NA 1NCCH 2F2HA 4RAUA 4A66A 1MCPH 1OCRB 4DGYL 3I85A 3LHAA 2CUAA 3S34L 4LLYA 4M8QB 4K2UL 3WNLA 1JHKL 1N4XL 4YDZA 1F1GA 3CGTA 1YN6A 4N3UA 1QSFD 4J2XA 2B5IB 3HG4A 3HS0A 4H0LC 1KPUA 5I8CA 3ISRA 3T0DA 1WC7A 4APXA 3MRIA 1KYUA 3JT2A 3US9A 5HI5C 3MXVL 3IKCB 4PWJA 4J4PA 2VZTA 4LXFA 4U3XA 4WSKA 4B9JA 5MEQB 2XTJB 3HEIB 3CN2A 3QULB 2BINA 4OR1A 4EVNA 2J3SA 5L9DL 3JWNE 2HVKB 4NUMA 2N1KA 3NTCL 2Y7LA 5JIQA 4I18C 2RH0A 2J8OA 1F86A 4P2AA 4PVLA 3GI8L 3K2IA 2CSPA 4L4JA 3UO8B 5IESL 2FL5B 2VR4A 4TULH 3SD5A 3T0VA 5GGVY 5CR8A 2XY1A 1JDCA 5C0GA 5FYKL 3DBSA 2DQCH 1MEXH 4JAMA 5F3HB 4KNSA 5DS8A 3KS0J 2HVJB 4L29A 1FL3A 5GGUA 4F7EA 4KQ0A 1S9XA 2O61B 4QRTB 1NSNH 2WZAA 4FXGA 5GS1A 1LEKB 4PBWD 2EABA 3ENEA 4GKOA 3VFMA 4TNWF 4NJAH 1JGIA 4QCIB 2KDYA 1FGVH 2GCYA 1GC1C 4JZOA 4F3FB 2AXWA 1JNLH 4UTAL 1HZHH 5LGJB 1NCAL 3KXFB 1U8CB 5GS3A 5E9DD 3SKMA 5SWZE 4KJQD 1X5AA 1D2PA 4HIEB 3HN8A 3O8XB 2F8VA 3LZRA 1AQDA 1BQLL 2MEJB 1P7BA 1PY9A 3GJEB 4P2QD 2BVOA 3RVUD 3C60D 3DYMA 4HJGB 4XNDA 3C5XA 4MRBA 4M1GH 4PJXF 4F37K 1I1CA 2X89D 3KGSA 4UOW1 4R96B 5CJXA 3MCG1 1FN4B 4MMXA 1EUTA 2OK0H 5A16B 2XTJC 3WS6C 1E27B 5TH2B 3FT2B 1FYTA 4TSAL 4XP9H 3QORB 2DEYX 5HI4D 1QWUA 3RX5A 3II2A 4OZGA 2JKXA 5C7ZA 4KMTL 3ZLQC 1ZCRA 3WU1A 3UTPE 5H2BA 2AEQL 5HHVL 2J1ZA 2VLJB 2CXGA 5DRNA 5BS0B 4A2FA 1KY7A 2IANA 4HETA 3ILEA 2P5WA 3GHBH 3R8BB 5E8NA 5CP3A 5EN2B 4FP8H 4BM7A 3L95A 5JOFB 2ARJB 5A40E 1FO0H 4OLXL 1LWJA 1M1SA 2V0AA 5E9AA 1KBGL 3HC4L 4XAKD 5PCYA 2GK2A 2PF6A 4PJHA 5IB3A 4Q52A 2W8CA 4JFDD 3HJEA 4NBYB 5FFLA 4NDMB 3FQTB 4ZS7H 2BSSA 2QVMA 3Q43A 1G1YA 3DRQB 2Y6SD 3ML9A 1RFDL 4M8VA 1JYWA 1A4KA 3SBPA 4W9GC 2GITB 3CDZB 3NIFB 4A2LA 4C4KT 4C4UA 3WENA 2ZX7A 1CTOA 4MNQE 4HV8B 3ZDYE 5CILH 4PR5B 2X9YA 4G7SB 2VXTH 3F01A 1G7MA 3JWOC 5FM8A 3O8XC 3LKOA 1BBJA 5IVXB 4WNJA 1UH4A 3TTYA 1GGIH 2NY2D 1E6JL 1VACA 1NUGA 1AR1D 2Z8VC 2CLRB 4KRPD 1IBDA 1AO7D 2Z31A 4H5SB 4BZ2H 3BKMH 4X5RA 3P73B 4B5EA 1T20B 1XCTB 1C1EL 3RJQB 5ICZB 1U93A 2IAMB 2OTPA 4S1DD 3UMTA 4XCNB 2XPZA 1SQ2N 1Q94B 3LQAC 1H6EA 1VCAA 1M3IA 3OKDA 3ZKQD 5C9JA 3UAJD 4OCYL 4OQ1A 4L1HA 2CK0L 2B9AA 3QORC 5C0EB 4QOKD 3VSUA 4YVUA 4FFYA 5TFSH 2NZIA 5KSAB 1KG0B 4P46D 1EEYA 3JWNH 3K1DA 1KIQA 3CXDL 3QWOA 2XQYA 1JGLH 2WXOA 1B0RB 1HKFA 3VFTB 3M1CA 5KVFL 1T7WA 4LPTA 4GUOA 4ORZC 2QZQA 5I1KH 5KS9E 1EGJA 3CZFA 3H54A 1L6PA 4GRWB 4N0YL 1EEQA 3ZT7A 5CEZL 7PAZA 1MVYA 4LLUB 4TSBH 3AU1B 2YA2A 3PL6D 3FF8A 3B2VH 5KZCD 3RU8H 1ZVYA 2OI9C 1DBBL 1XGPA 4OCMC 1E42A 5CEZD 3KD4A 2ZUWA 2ZCKL 3NRFA 4Q6YA 2DQIH 1LDPH 3B9KC 1MWAB 2WXKA 3FU0A 1BJ1J 4FTVA 3STLA 4HJJH 3RWJB 5T8IA 4PJIA 4ISVA 1OTUC 1U3HA 5IUSA 4AOFA 2BWDA 5B3NA 5KW9L 1XCQA 5IMOA 2A9CA 4JPVL 5F7EL 3P0YL 3DMMB 4M7KH 3ARFB 3D09A 4LHJB 3BI9X 5D7KD 5EU6A 2M1KA 2VH5L 3HOGA 1FFPB 1WZLA 3G5VB 2F68X 3DI2B 1H3WM 2XG5B 1TEGA 2ZWYA 1MCWM 1VKXB 3GHPA 4N2FA 3SQOH 5B1AB 3B7SA 2QMKA 1XZWA 4N2MA 5T3ZE 5KANG 2GJ6E 1HEZB 1DJXA 3AADB 4M6OL 1AD0A 1UA6L 1QMUA 2CCVA 2X70B 3HAEA 1T5XA 5EN3A 3RVXD 4DESA 3D3VA 1XGYH 2IAMC 2J6EH 4I0KA 4MJ5A 5E8EA 4FXLA 1MAKA 3QEHB 1KJ2H 1I7RA 4QWWC 4KTDL 4RQQB 4Y0GA 1AQMA 5IM7B 1RZIB 1A7QL 1RZJH 4MDIB 1B4LA 1WUZA 1A4BA 4XMPH 2B59B 5B1CA 1S9YA 4J3OC 5KSAC 2IOOA 5F2FA 2IBZY 4N2LA 2O93L 4U7SA 1ET7A 4G7VL 3BISA 4OCWL 2DIEA 5C86A 2XZZA 2PW2B 3F7VA 3P9MB 5CJQH 2FJFA 4Z7NF 4YL9A 4NWTL 1C12B 1RZ8A 3HJ0A 1B0WA 4FZEH 1ECYA 2GUOA 4O2CB 3NRPA 1USZA 4QHUB 4HJ0C 4ZFGH 2E75C 2FIKB 2VDPH 4LOUD 2G3XA 4X42A 3EBGA 1JXGA 2C3VB 2IGTA 4NX0A 4QT5B 1A6ZB 3GEWB 2DLFH 4AE0A 3DGCR 1IEAA 1H9VA 4LPXA 2MNUA 3FSOA 1NAMB 4PJ8B 2EIJB 3X3FH 2EYRA 2F7OA 4ODVH 1T89C 3DX7A 1MJUL 2R23B 5BQ7A 3DMMC 1CFQA 3ARFC 2HXAA 3EJRA 3KPLB 2W9DH 3BZ4B 4N2GA 1SLXA 3WFDL 3I3EA 5HYJB 1TZIA 5J8OA 1X4XA 5IFAH 4TTDD 3VXMD 2Z65C 4OKDA 4PJCB 1XHHA 1VFBA 3L2MA 2ESVA 4CC1A 3MCLL 4FQCL 1HXMB 2P5ED 5CWSA 1C5CH 4KGLA 1KXVC 3K2UL 1SN0A 3VFRB 3BKCL 1WICA 4WY7H 4XBGB 4YHZH 4IMKC 4MJIB 3ULVF 5HXMA 3S48A 1JNHB 3HB3C 1O6SA 2QGCA 4OD1H 3ZSSA 3I75B 1MAMH 5T33H 3B1TA 3GLDA 5F96L 3UBXA 1MJ8H 2CDEB 4R4FL 3S8WA 1UYWH 2C34A 4DP2X 3IMUA 4ETQA 1Y0LB 2X4PA 1MHPH 4DK6A 2V2TB 2J20A 3V4UL 1O5PA 2GSIB 5F21B 4HBCL 4P2YA 4UQ2A 4ZI8A 3D9AL 2A4CA 2D7PA 2JI3A 3BGAA 2YRZA 1PVHA 3II1A 4L4TB 4MS6A 4NRZB 3MV9D 1JVOA 4QRAA 1EDYA 2AEOA 2VJXA 5AOMA 5ALBL 2P5PA 1NFDA 3U2IA 1CJYA 1GZPA 4P2RB 3DJSA 5IEKB 1DBAH 4W9CC 3LN5A 3UGEA 2VDOB 1MHHB 2ZAGA 2W5PA 4UZGA 2FLBT 1MIMH 1QKZL 1CTMA 3W39B 5CEXA 1FL6A 4PGDA 4PJ8C 2AI0L 4OD3L 3BSHA 2K7PA 1BD2D 5AVQB 2WN3A 1SPDA 4RZCB 1TU2A 7FABH 2CKBA 3KR3H 5DFTA 5BRPA 4WENB 5DK0B 3VGAB 4X6DF 1WAAA 4MB4A 3GPSA 1UKQA 4N87A 2J8UB 2PKDA 4HSQA 5BOJA 3KYMB 5ACZB 1IFHL 2CO7A 3N91A 1IM9B 2X6BA 5I16B 2R0LL 3QJXA 2W81C 4YFEA 1ZS8A 3C5ZA 3AB0B 2BNQE 2FH8A 2VRAA 1HSAA 5T3ZH 3EFDL 2IV8A 3BZFA 2PNDA 3IXTB 1HIMH 4OGYH 1VF5C 3QNZB 5IQOA 2WBJD 3TA3A 2J88L 2YPKA 1AQHA 3AG4B 3RWEA 3CDGA 1PYWA 4DN4L 4MNGB 3VNYA 4LVOC 5AZ2L 3BD5A 1TQBB 1VPOL 4JMXA 2ZF9A 1MCKA 1IBFA 2VN6A 5SWSD 1CDCA 5IREA 3TOPA 3PXJA 4AQ8C 2E46A 4YLQT 1F3DJ 3LH2L 5FPIA 3MKKA 2ALAA 3A6CL 3I2CH 3Q01A 3WMPA 1WCQA 3OMAB 5KVGE 3NAAL 2P1YA 1IBYA 1D5XB 4NZUH 5C0DB 4APQD 2Y5QA 1LD9A 3FCSB 1D5IH 3OB8A 1EAJA 4FQHA 4JZNB 4BGDA 5L2KA 4CU8A 2H26A 1FNSH 3MCKB 5FECA 1NCBL 4I5BB 1YQVL 2ZOUA 3QRGL 4XWGH 1E5BA 1M7DA 4PRAB 5ID0B 3B2MA 3CLEL 2GY7B 3JSSA 4Y7OC 1E4XL 4FFZL 1AOHA 4YGVA 1LWHA 4R8WL 4AH2A 1VEOA 2X1QA 3DV6A 1RY7B 3HZMA 4OCXH 1RUPL 4R6UA 4MRCA 3Q5OA 3LKRA 1Z0NA 4HD9A 5GHWH 4HUVA 2CBMA 5HJGA 4ZAKD 5IWLC 1CFBA 3K81A 4N90E 3MRFA 1INDH 3RVWD 3W9DB 4EOWH 4GAAA 4HAKA 2UY6A 3G6JF 2E7LA 5EIIG 5EIQA 4M7JL 2VSCA 2ZCHL 2YQBA 3OHMB 5I0XA 4FULA 1MPAL 1AXTH 4F7PA 1SBBA 3QQ3B 5C0CB 4HVBA 1YDPB 2E9BA 2VN4A 3NSDA 3OSKA 3PV6B 5TK2A 5HPMA 2IQ9L 1NANI 3E3QE 4JQXA 3KWVA 4WAFA 3LEXB 2DTSA 4QHMB 3VRJA 5LN8A 4PJFE 3H42H 4GFTB 2GTZA 4NUJA 4WEUD 4Q14A 4LCWB 4PCKA 1LE9A 3FB6A 3C5JB 3QJSB 3DO3A 3OAZK 1AP2A 3SPJA 4PI0A 4KPHH 1A22B 1W2KT 3Q05A 3V4VH 3OKKA 4XCFH 4PRHE 1KOAA 4L3CB 4MCYA 3NFPA 4HDIA 5EIIB 4OZFG 3FCBA 1UB5A 5LBGA 3FQUA 5C08A 4ALAH 1CVRA 4A6YB 2FHFA 1SJVA 1N64H 4NZFA 1PLAA 3ILQD 3VQMA 3WGVB 4MD0A 3QAQA 4I0PA 1CI5A 1GH7A 5TGBB 2EE2A 1PJWA 1ZVSB 3TPKA 3D25B 2EO9A 2H47C 4IEFB 3IS0X 4YIQB 1A6UH 4NUQA 5CINH 4QIRA 1X9LA 2XN9B 4WQOA 1KN4H 2XN1A 4Z23A 1IJNA 4ZRGA 2XOTA 4HUKB 1N0LA 1DBJH 1UOLA 2NQDA 4LSUH 1T83A 3NJGA 2UZIH 5E94A 3WTVA 1GIGL 4IMLB 4OZFB 4KTGA 5B7EA 4XB3A 4GG6E 2I07B 3CH1B 4W4NA 3UP6A 2VR6A 4PSRA 4KKCC 2VLKB 3VU2A 4V1DB 3NH7H 5CD3A 3QB7C 5I24A 1CDJA 3O9WD 4HLZG 1I1FB 2GIXA 2DYSB 4ZD3H 2HJFB 4ZMOA 3O3EB 3VD2A 2A9NL 4NQVB 4OF0A 1IAIL 3GTTA 1HHIB 5FB8B 3ZZSA 5JIIA 1ULVA 4AJYV 1XF4B 3LPFA 2M2DA 3GXNA 3KE0A 2Q8AL 3EYSL 4K5NA 3MX0B 1EJOL 1OSPH 3OLEA 3EADA 4ZQKA 2J56A 3FUMA 5CJ8A 4KI5F 4CNIB 3FOMB 3G6AA 4LDCA 2K6YA 3H4FA 4WEEA 3WS3A 3HNTL 4PWFA 3KWWA 3GIVB 4K9EL 1ITCA 1RZ7H 4CVZB 2ATAA 3ARGA 4J6IA 3O45B 3VI3B 2OXGB 1BEYL 2J72A 1OM3L 4XO5A 4O02B 4MA3A 3GSXA 4YR6A 5KVGH 2YEQA 4LE8A 2PYEB 2CO2A 3T5WA 1E3XA 1DQDL 4PRPB 4WNQB 3STZA 3ARTA 2I60L 2IH8A 1PG7X 3MO1A 3P0VL 1NLDL 5D1ZI 5K59F 3UPRA 2QKIC 1UZ6F 2X4TB 2OMUB 4GB9A 3VXUB 4IK6A 1PD1A 5DRZA 3H85A 3CXHJ 2PTTB 4KZDL 4DP9X 1N8OE 1IC5H 3NCEB 1ZV9A 3QI9B 4X0KA 5FLVA 1OAKL 5LCVL 4L9LB 5BCAA 5I0DA 3NACH 4P4KB 5ABDE 3VYNA 2VSDA 5JDJA 5EBWB 4OZIF 3DOIA 4QPEA 1UKTA 2ZUQB 5E2VH 1W0WB 3ES6A 2JTDA 1JK8A 1IVTA 1Z9MA 2L7QA 5E5MA 3VXSE 4F58L 1GYUA 4UYQA 1P7QB 2HT3C 4HA1A 4P59L 1CGXA 1TETH 1NGXA 2OMBA 1XH0A 32C2B 3Q3GB 5IVZB 3ZSTA 3RTQB 4KK8C 2BS71 3EYQC 4WNSA 4V2BA 3V7AG 1N6QH 2CDGB 1P53A 2NY0D 3X14B 2XICA 4JJ5B 4GI8A 2WXMA 1XWVA 3QDAA 3D0VB 1M71A 4GOSA 4KKLD