2H0JA

Crystal structure of pucm in the presence of 5,6-diaminouracil
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
114
structure length
112
Chain Sequence
b'MGKLTTHILDLTCGKPAANVKIGLKRLGESIMKEVYTNNDGRVDVPLLAGEELMSGEYVMEFHAGDYFASKNAADQPFLTIVTVRFQLADPDAHYHIPLLLSPFGYQVYRGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transthyretin-like protein pucM
molecule tags Hydrolase
source organism Bacillus subtilis
publication title Structural and functional analysis of PucM, a hydrolase in the ureide pathway and a member of the transthyretin-related protein family.
pubmed doi rcsb
total genus 22
structure length 112
sequence length 114
chains with identical sequence B
ec nomenclature ec 3.5.2.17: Hydroxyisourate hydrolase.
pdb deposition date 2006-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 2h0jA00
3IMUA 3ESNA 2H1XA 2TRYA 4L1SA 3A4EA 1SN2A 4PM1A 5FW6A 5K1NA 3CXFA 2H4EA 3DJZA 3CN0A 3HJ0A 4N86A 1THAA 4TQPA 4IKLA 4MRCA 3CN3A 2B15A 1E4HA 3DJSA 1KGIA 1TT6A 3DIDA 2H0JA 1TTCA 3GRBA 3D2TA 5CLXA 1TTBA 4ABUA 5E4AA 4QYAA 2NOYA 4PVLA 4ABQA 5L4JA 1TSHA 1IIIA 4Y9GA 1QWHA 4YDNA 4AC4A 1FHNA 1ICTA 3GS0A 5HJGA 3CFMA 2B14A 3CN1A 2H0FA 4ANKA 2G2NA 1E3FA 4PVNA 4FI7A 4QXVA 4TL4A 3TFBA 2G9KA 2IGLA 5FW7A 3IWUA 4ABWA 4D7BA 1Y1DA 4PWKA 3BT0A 4HJSA 4IKIA 1U21A 1RLBA 2G4GA 3DJTA 3SSGA 2F7IA 4KY2A 3CN2A 3CFQA 2QGEA 4I87A 1ETB1 5AKTA 2QELA 3QVAA 3D7PA 3U2IA 1DVZA 3DJRA 2B16A 2TRHA 4L1TA 3KGTA 5CNHA 5EZPA 1ETA1 4PWEA 5TTRA 4IKKA 5L4MA 3GPSA 4I85A 2H0EA 3A4DA 3Q1EA 3A4FA 2PABA 1TYRA 1GKOA 1TZ8A 1ZCRA 3CFTA 3KGSA 3NESA 4I89A 1BZ8A 3IPEA 1DVYA 2GPZA 4PMFA 3ESOA 1DVTA 1SN0A 1Z7JA 3GLZA 2B9AA 4TM9A 1BZDA 2QPFA 5FW8A 5L4FA 1X7TA 5DEJA 5IHHA 2G4EA 4N85A 4TNEA 4PWIA 2WQAA 3P3UA 1OO2A 2H6UA 1GKEA 3I9PA 2G3XA 1TLMA 3CBRA 1TTAA 3DK0A 4TLSA 2QGDA 3IMSA 3BSZA 3ESPA 4TL5A 1FH2A 3FCBA 3GS7A 5CM1A 4IK7A 4YDMA 5JIMA 3I9IA 1IIKA 5FO2A 3GRGA 1BMZA 3IMWA 1E5AA 2G3ZA 3NEXA 2FLMA 5AYTA 4AC2A 3OZKA 4Y9EA 3DK2A 1DVQA 1SN5A 1TTRA 5CLZA 5JIQA 4PWJA 1ZD6A 3P3TA 1QABA 4QRFA 3DGDA 1TFPA 3CFNA 1F86A 3DO4A 3IPBA 3M1OA 4PMEA 4TKWA 4TLTA 1SOQA 3NG5A 4Y9BA 5CR1A 4HISA 3TCTA 4IK6A 3I9AA 5AL8A 4WNSA 5K1JA 4HJUA 1BZEA 4HJTA 1SOKA 5CLYA 3IMVA 4PWHA 4MASA 5JIDA 1KGJA 3FC8A 3NEEA 3IMRA 5E4OA 3CN4A 5CN3A 3IWVA 3U2JA 3IMTA 5EN3A 1IJNA 1DVSA 4DERA 4TLUA 4IKJA 4PWGA 2QGBA 2ROXA 4DETA 4IIZA 1DVXA 1G1OA 1THCA 2FBRA 3OZLA 2GABA 3W3BA 3P3RA 5DWPA 4FI6A 4WO0A 4ABVA 4FI8A 5A6IA 3GS4A 4DEWA 3KGUA 1BM7A 2F8IA 4Q14A 2ROYA 4MRBA 4PWFA 4WNJA 4HIQA 4Y9CA 5E23A 1X7SA 5AL0A 5BOJA 4TNGA 1IE4A 2G5UA 5AKVA 4Y9FA 3NEOA 5L4IA 4PVMA 4TNFA 1F41A 4TQHA 4TLKA 3P3SA 2QGCA 3B56A 4TQ8A 2G2PA 4TQIA 5AKSA 4ACTA 4DEUA 4DESA 1DVUA 2B77A 4N87A
chains in the Genus database with same CATH superfamily
4XB7A 4K7PX 1FL5B 1MH5A 2LT9A 4BINA 4P23C 4BV1A 2BW4A 4XZUA 1CPUA 4KK5D 1HWWA 1BBJB 4OLWL 2JJTC 1M2VB 4LARL 4NRXA 2VLRD 1QRNA 1IZKA 4YHNB 2EH7L 3WEBA 1X5KA 4H5SA 2PW1A 3QIWD 4D0BA 3ZKND 3BWSA 3EYFA 1ID5I 2W07A 4NQDD 1OP3H 4AC4A 43C9B 1DQMH 2VXUL 4M7KH 4XODA 4ZW8A 7PCYA 4QTHA 2Y1VA 2N7BA 4BH7A 1DBAL 4YIQA 1QNZH 4IIQA 3P3YA 4TS6A 3LPPA 3UBXA 2BOCA 3UFIA 2B7DT 4J12A 4RFNC 1E30A 1JPFA 3IJSA 1AR1C 4HKZA 4JO4L 5C6WH 2EIEA 3OJMB 4XZUB 1UB6A 5IQLA 4D9RD 3V0WH 5JOPD 3T0BA 1ZLUK 2E9WA 1XB6A 2VLKE 3DX6A 2BMKA 4TXVB 3VXPB 5GGQH 3FCSA 4HKJB 3PYCA 3K81A 3AVEA 1WFOA 1C1EL 2X1PA 4JRXE 3JV6B 1V54B 4TUUA 3UTOA 4CW1B 4OZ4B 5IK3B 3RZCA 3CC1A 4O5LH 1AY1H 1UKSA 3NJVA 3PFQA 4CSTA 4EQ3A 5DJDA 4QHLB 1R0AL 3BPNC 1JWUB 2WSDA 3GSOA 1T89C 1BMZA 3Q2CA 4Y5YC 1Z9SA 1YJDL 4JFPA 4N3UA 5IMOB 3CZEA 5DRNB 5DMIL 1QYGL 4J3UA 3MBED 5I1LA 5D7LB 2Y72A 2ITDA 3ZR5A 1RHHA 4KHXH 3T3MB 4MQXD 3KR3L 3HS0B 4GT7A 5DD3H 4F8QA 3LYRA 1ZT7A 3KXFB 3MRIB 3W9EB 3BUQA 3ARFA 3TH4T 4HOWA 2KDYA 4M3HA 4IRSD 5F44A 4X99B 4MS8D 5BQDA 3C9NB 1UG9A 1N0LB 5CCJA 5BRZE 5F72S 5GGRB 1G0DA 3HZMA 3HC4H 4YBQD 2W81C 5AVVB 2GY5A 4XAWL 1UQSB 3QISA 4Y9CA 4PJ7B 2NYYC 2X4UA 4Z0XB 3CZNA 5FYKH 1QI4A 3CZJA 4OCYH 1J5OH 4CKQA 3DYOA 2GB2A 2X3CA 3CQQA 4QY8A 3KLQA 3PQYB 4B0MB 1DFBL 2FHBA 3EYVB 2XTJC 4WI9A 5I8KH 1U92B 4OZGE 3A4EA 1S8DB 3DV4A 3L9YA 1U2YA 4XXCC 3I6LD 4APXA 5IGXL 2VJ0A 3QG6A 4HQQL 5DD6A 4HHAB 5INDB 1A14L 1IGFH 2P47B 1S7VB 4I0CC 1WISA 4NUGH 5E0FA 3ZIYA 4F7TB 1RU9H 3V79C 1PL3A 3ESMA 3Q1SL 4P2CG 4EN3C 4LAQL 5GGSB 3ELQA 4XP6L 1MCDA 3V10A 2EVGA 5J8OA 2B5IB 2B14A 1BDYA 3G04B 3DUUA 3JUZA 4XPHL 4A7GA 1U8KA 1HHKA 2IXQA 5I6NA 5TF1L 3DPBA 4NYLB 1OP5K 1RLBA 3IRCA 1Z0NA 4L2YA 2QVMA 3CSYA 2XFXA 4JG0H 2O6PA 4ZUVA 5HGGS 4QRPB 3S9DB 4GG6A 1YQVH 1JPTL 3MV9B 1PMYA 4I8DA 5IT2H 1D6VL 2BDNH 1E4WH 3OMIB 5KVEH 4L8SB 3QRFM 2AABL 1ND0A 1NBQA 3EG9A 3VFRA 4EZLA 1IQDB 1U8LB 1UWGL 2ZT9C 3NSDA 4AYBA 4C83B 3ZZSA 5DZAA 4XO3A 4NOBA 5DF0A 5HI5C 5ENWB 3FFOA 5IEKB 2HVJB 1TQVA 3ME0A 1HS6A 5CUSL 5DDHB 1DN0A 4PRNA 1OT1A 1QFWI 4UDTA 3MC0A 4V1DE 1TG8A 3E0GA 1UA6H 1A6ZB 3L3GA 4LSRH 4MJIB 3BUYA 5HJBA 2QMKA 3INOA 5HVGB 4PLKD 2D3VA 2X6UA 3H0TA 4D9QD 3DI2B 5JW3L 4Z8FH 1QSZA 1B4RA 3INUL 4BQBA 4D0DB 2VR3A 1FN4B 1AG6A 1NPJA 4LLDB 2CJUH 3QUHA 4JDVB 3T8XB 3BRDA 1U8KB 2IXQB 4IK6A 5CP3H 2Q8BL 2BZCA 5DRNA 1LHZA 4QRAA 4WW1A 1INDH 2ZF9A 3BH8B 3C2SA 3PIQA 3GRWL 3AWEA 4JM2A 1U8LA 4ZTPL 2BINA 5J3HC 5HI5D 5ADOH 4FXKC 3QEHB 5KOVC 1MJJA 3ORJA 4WJKB 4FLQA 1PZ5A 1RQ5A 4NUMA 2K0RA 5IWLC 1R9FA 5T8IA 4CC4C 3RVXD 3N42B 4JRYE 2YN3A 3T08A 2WLHA 2O5ZH 4PLKC 4PI2A 4MKMA 2Q8BH 4NKDB 1OGAA 4YFEA 1IILE 2LVEA 2ZWKA 3SDDA 1PEZA 3QEUB 3RL2A 1DCEA 4B9YA 4O4YL 3VRJA 2NYYD 3AADB 1P4UA 2IALA 1FJ1B 2HWZH 5I6OA 1G1CA 1JL8A 1YYML 2ATAA 3WHXB 1J9RA 3U2SA 4HUKB 3VQ1C 4XNXH 4L23A 5DYOA 5F1IA 4LCWA 4P46B 4YIQB 4YFDB 3QJFA 5T1MB 3UGUA 5DD3L 2YEVB 3ARXA 3Q0HA 4FQXB 3TJHC 5ANHA 4U3CA 4GW4B 2Q7YB 5FWRA 2VERN 3ES6B 4P5KB 1KTKE 3MUHL 3LXUX 3QIBD 3QAQA 5C0ND 5BS0A 3PL6C 4N90E 5IROA 3MRHA 5TE7L 4FTVD 4PW4A 4EN3A 4YR6B 3S8WA 4X9HA 3HMWL 3U9WA 6CGTA 4S1QL 1IKFL 2DBJA 5TH2B 4JGJA 3L3JB 4S0SD 3F8UB 1EO8L 4NKMB 3ZE1B 2GTZB 1X5FA 1AOZA 5C0CD 4YZFE 3NPSB 2XT1B 3BD3A 1J10A 1P6FA 1IBGL 5KYNA 1TJXA 2PABA 1WDAA 5FOBA 1BLNA 2YQ3A 2M83A 5DURD 2KZ1B 1XT5A 4L4TE 3U0TB 4JPIB 4HBQA 4OFYA 4I88A 4UIMB 4NC1C 1RU9L 2XWTA 3OGOE 4AQ1A 3QQ3A 1CO1A 1MZZA 5DJ2B 1YEWA 15C8L 1O5DT 1RIUL 2WLLA 5DQJB 4U1IA 5CM1A 3DIVA 2DWEA 4TVPE 3ESUF 5L8KB 1MNUL 3CVCA 3AQYA 4O58L 3LN4A 3D39E 3KPRB 4PN6A 4HJEA 1PZAA 1E28A 5JIQA 2C3GA 3FQWB 5L7XL 4JFED 4XO4A 1FG2A 5HYJA 4KJPD 4HISA 1A3LH 2D9CA 4JFVA 4D3CH 5BRZA 1QSFE 3QC6X 2HKFH 3CFUA 2ZAGA 4OLWH 3L4XA 1FFRA 2F19L 4K8RC 4K7PY 2HTKC 3TEUA 1IBHA 4X98B 2GABA 2R29L 3LRMA 1OTSD 4GO6B 5DFAA 2OYPA 3TZVA 4BYHA 2WLZA 3ZR6A 1T1WB 4I0PD 5LN4A 3QRLA 4MXWH 1NCOA 4LLUA 3TJHD 1LDSA 3B9KC 3GSXB 3O2WL 4GEIA 5J9PA 4KBPA 3MOAL 1CGVA 2GKIA 4G6MH 5L4IA 3OF6A 5E1QA 2EIZB 6TAAA 4HIHA 1M7XA 2E4FA 3QUZD 5LJYH 5EBLB 3SHSA 1JG9A 2F54D 1RK1B 3HUJB 5AAPA 1RIHL 3D85B 3NIDB 4LLWA 2NY6B 2FEDD 1T22B 2FEEI 1XH0A 3CXFA 1FHGA 2D7MA 3U1SL 4EBQL 4X6FA 3CSYB 5I18L 3DMMB 2DLHA 4YBLC 2R0WH 3FL7A 4UINL 3HZVA 1DSFL 2NOYA 2YAFA 4Z7VA 3MOBL 2VDRB 2WUBL 1XAUA 1RIVL 4OD2B 2RH0A 2VDQB 1XO8A 4PRIB 5CIPH 2FHCA 2WO2B 3AU1B 3RRQA 2ZNWA 4GP4B 1ZTXL 4X4YA 2X4QB 1JGVL 1E8XA 1PD6A 3GRWH 3KVQA 4KTEL 1KPVB 4ZFQA 1P1ZB 5FGCE 3JSSA 3ZE1F 5AD0A 1JHLH 3BWUF 2ZYSA 1SJXA 1JVOA 2APFA 2DMKA 2HJLA 3DJRA 4P2QE 5E9NA 4BKLA 4Z7WF 3T0EA 1N0XL 2FJHA 2IMNA 2IBGA 2AHIA 3VXMB 2PO6C 3MODL 3Q1EA 4ODHL 4MFHA 1BBDL 2FBJH 4KHTH 9PCYA 1BZ8A 1VKXB 1N4XH 3FUJA 3T77A 1OARH 2DQTL 2J2ZB 4IMKA 1T6VN 1R5WB 1NANI 3VJ6B 2DLGA 1RZKH 4EZJA 3RGBA 1WHPA 4HUVA 1I7RA 3PABA 2IPTL 2VDMH 1BEYH 4HF5L 4CVXB 2WB7A 1AQHA 5B1KA 1T5XB 4N0FB 1ADQL 2MNJB 1CXHA 3I84A 3WE6B 2VDKB 4JFZH 3ZYOA 1X5XA 4EIZC 2O26U 2CNYA 1TTRA 4FLSA 1NIFA 1OP4A 3FQYA 4LVOB 4HKXA 3AU1A 3CFNA 3ZKNC 1H19A 4IRSA 2HKFL 3CHXA 2CCWA 2A5UA 3GZKA 2HSIA 3ETTA 5D7JD 3ZHLA 3QJSB 2OJZL 3C5ZA 4FHJA 4R90L 4YSEA 1DVSA 4ZMNA 1KCLA 4MQ7B 2GBUA 1LGVA 3V0WL 3B9DA 3COOA 5C08A 5T3ZL 4JFZL 3GNMH 4JO1H 1KCBA 2ISDA 4RLDA 4N2NA 3QUKB 2Z9TA 4IU2A 5DFVC 4A6YB 1ED3A 3TT3H 1G94A 2FT6A 2K4AA 4QHNA 1USQA 4U6HA 1J8KA 3H53A 4PBDA 4B9CA 1A1OB 3HZ3A 4PJCB 5DHYB 3UMTA 4ODVH 1KPRA 2VR5A 4E41D 2PCFB 5ELIA 1O0VA 2MNUA 4JO8A 4NBXB 1QLEB 1MCPL 5DUMH 4PRIE 2OZ4A 1DFBH 4WI7A 5B4MD 4XMLH 1E3ZA 4JFOB 4BCYA 4LBAA 1JV5A 4GO9A 3EYUH 1IV8A 4JKLA 4GQ9H 4GQZA 4N0RA 2CRMA 1CC3A 2IV9A 4FNRA 3FYIB 2DQEH 1CBVL 1DR9A 1QFWH 3WHE1 4NO2A 3MA9L 2AAVA 1W72H 4Z7AA 1GJIA 2NUPB 3PG2A 1RP8A 2GI0A 4HJ1A 2EXTA 2DWTA 4KI5F 3ZSTA 4OZIE 3TNNB 4RH4A 5F8QC 1WFNA 4LP4A 1KZQA 4UILH 5B1BB 4BWWA 5CEXB 2GJZB 3WFBL 3C5ZC 4QD2E 2IMMA 2QPSA 3Q48A 2XN9B 1JHKH 2QGEA 2ZSWA 3VMOA 3KG5A 3K80A 4KMQA 3MRPB 5D2LB 4XP5H 4NDMA 3VD0A 2ZOKB 3RWFB 2ID5A 1CGUA 2B9BA 3K1KC 4TQIA 4PJ9D 4HUNB 4HV8B 1OKEA 5C0BB 5IW1A 4QTIH 3P11L 3GI8L 4LSUH 4U1MA 1IC5H 4R7DB 1M05B 4M9OA 4DTGH 3KVPA 2WYIA 2ENPA 1EMTL 3QDMA 4JFXA 1LEGA 3VXOA 3VWJC 2H0PA 2JKXA 1N6QL 3V9EA 1IGJA 2H8PB 4DH2A 2JB6A 1AZBA 4X7SH 3IF1A 4G6AC 4HDIB 4NZTH 5EC1A 3TURA 2OMWA 4Z3JA 5HHOB 5I1CH 1ASOA 2J71A 3UAJD 2AMGA 3U4EB 2NY1D 4XPTH 3HPJA 4FRWA 3DUSB 4QXWA 3PJSB 3W5NA 5CSGA 4NHUB 4Y9BA 4LCWE 4S2SA 1F45A 4E0RA 1QX1A 2RACA 3AITA 3TA4D 4OFKA 1PX3A 3AZUA 5AB9A 2PW2A 3OKOB 4X5QA 4U1KA 4J1UB 1QSED 4YWGL 1NFDA 5K93A 1G7PB 5FLVA 2A9DA 3IWVA 4Z0XA 2ZG3A 4K9EL 1RLWA 1I8AA 4XMWA 4TUKL 1A6PA 1NUDA 2P5WD 1FNLA 2Y25A 4XBEL 2R69A 4AVIA 1CGWA 2C1PA 1MNUH 2VDLB 2EC8A 3S96B 2QR0A 3EH1A 4X9YA 3MU3A 5AW2B 3VG0L 1XD0A 4PD4K 4RA0C 4AVKA 3O9WB 1IAMA 5F7DA 3ZHNA 3VFOA 4HIQA 4HJIA 1UC6A 4K94L 4WHTB 5DMKA 1UZ6F 2Z64C 4LSSH 2UYLB 3G5ZA 3W9EA 4NQDA 3FCUB 3DKHA 3EJYC 1LVEA 1NCHA 1XR9A 3U46B 1KB5L 4HBCL 5FC9A 4NHUA 5ID1B 4YUEH 4YMPA 5B38G 3J8F7 2AFNA 3ZT5A 4IKNA 1CFQB 4Z7UA 4NRXB 2NX5B 3HRZA 2JKIS 2BOBA 4I13B 4ZMTA 1MREL 3WKNA 4GKSB 2XQ0A 2FGZA 1XTLA 4Y5VA 2FJGA 3WYRA 1TQTA 4PJFE 3QGVA 5IJKA 3QWOA 2AQSA 5C09D 2HRPL 2ZPKH 5HGBA 1IAKB 4OGYH 5ICUA 2XRAH 3RFRA 1NDGA 3S3DB 3I6KA 3I75B 4JHVA 5CZKA 5EZOH 1ZA3A 1KTLA 3CBKB 4FE9A 4NFCA 1GZQA 1YEDB 1MEXL 3L9RA 3OKYA 4WTWA 4Z3EA 5I8CA 4UTBA 2NYZA 3QZOA 4AYFA 4F37K 5I0DA 2CHWA 5EWIL 1K4DB 5D2LF 3QQ4B 5CJOL 1SZNA 4PY8J 1VSCA 2OYLA 3BVNA 3D51A 1T04B 2V6HA 3UL4A 4I77H 1KJ2A 2FO4B 4DP9X 1YYMH 1YECH 2BPBA 2H6PA 3UG5A 1CLYH 4M62L 3UIZA 2DQ6A 1CFSB 3QNXA 4XNDA 3NT0A 1LK2B 3TO2B 5ABDE 2IQ9L 2Y23A 2CJTA 4YWGH 2O5XL 4FFZA 1JPGA 3OQ3B 4LPTA 4P2QA 3RY4A 4RDBA 3B9VA 4LCYB 2LVCA 2J25A 3X11B 3APMA 5GSRB 3DNKA 2CKBH 1CDUA 4MNGE 5DHEA 1LNUA 4XNBA 5FGRA 2FYYA 4R7NA 3T0XA 3ZXAC 1SXAA 1WCBA 5EUOB 3RP1A 3NEXA 1J12A 1RHHB 4FADA 5CMAA 1B6DA 1NDGB 2WO4A 4HOZA 4DWHA 2Y07H 4PMEA 2ZXGA 3NG5A 5GZND 5ICZA 1QUNB 2Y0SA 1ZEAH 1NBYB 1A4JB 2K8MA 3A23A 2UV3A 3KPNB 4JFSA 4YPJA 3VI3B 3ULUE 2UXVA 4WTXA 5AW7B 1J0ZA 4FQHA 3D30A 3DARA 5H94B 5C07E 1YEKL 1K85A 4KO7A 3TF7C 1A66A 4CVWA 5T33L 5DFWH 2CM5A 3B2VH 4JKNA 1PAMA 3J07A 1ZDQA 2X40A 3BD4A 8FABA 4KROD 3L5XL 2Q86B 3SOBL 1I7ZA 2JLLA 1PLGH 1JDCA 4YSCA 4Y16A 4WZ9A 1IKFH 3L4TA 4L05A 4PJ9B 1NA8A 2H1PL 5A6LA 3RTQC 5HVWA 2D2CC 3ARGC 4OAWA 2DQJH 3WY2A 2QTVA 1JD7A 3VB9A 3SYOA 2R56H 2ZX9A 2DQHL 2XV3A 3PAUA 1TCRB 3KYKH 2HCZX 5IMLA 2YWZA 2JKTM 3BW9A 1WS7A 1MXDA 3OKDB 3VXSD 4MMYA 2Z65C 1ODUA 1BGXH 3E1F1 2FGWH 3L13A 3X14A 4D3CL 4N24A 5DS8A 2Y7LA 4NC1E 3UJIL 4N22A 1PPIA 2X87A 1I1FA 1SY6A 2FDBP 5LVEA 4I48A 3PAZA 1TZHA 4G9FB 1IT9H 3AABA 1C16A 3S37X 5HYFA 4XMXA 4JFUA 4PJIF 4BZYA 4Y0GA 3Q6GH 2BSTB 1RMFH 4TL4A 2PO6B 2J72A 2R2HA 4MSWA 1T2XA 1UOVA 2RBLA 3LNEA 5GRVL 2C1OB 3BI9X 5I1AA 3FRPB 3MXVL 5LBSL 4IKIA 3WV0A 2MQ0A 1TFHA 4XX1E 2WXMA 3QDMB 4PGCA 3KYNB 1NCCL 3Q8FA 1WBZB 4MDIA 5IMLB 5IQ7L 1VFAB 2C7UB 4HPOL 4X6DA 1R19A 1MCIA 4LSVH 1TZ8A 1ZCRA 2Y07L 4U6XA 4Q52A 5FYJE 4F91B 5HYJD 4Z7QF 3TBYB 3H9HB 4FD0A 4R90H 3UTTD 5DZVA 1ZTXE 2WWKO 4RMSA 2VQ1B 5ICXA 3ZKMD 1CWVA 5GS0H 4LF3B 4Q9QH 2UYLA 1ZLUH 4E42A 4BQ8A 3NJKA 3H7LA 1RZFL 3JTSB 4U31A 5KBPA 2AEIT 5E8OA 1IGMH 4ZUSB 4FFTA 1ZWIA 3QFJE 4ACPA 3DUHA 4NGHH 3DO7B 4RGNC 4G9FD 4LPVA 3TVMA 3UBHA 3AT9A 1TTUA 5K59F 1LE5A 1EZUA 3O8XB 3PWPB 4P5TB 3AUVA 1HHGB 3CDGB 4GFTB 4QTHB 4QRFA 2LAAA 2IGTA 2X4TB 3KYMA 1VCAA 2I07B 2ZNXA 1EFXB 4HUUB 5E5UB 2P80A 4FQXD 5MEQB 1URLA 3FO1B 1E90A 4NSKA 4XBPA 1SJVA 1ZJBA 5EV7A 3RY6A 3VACA 1SXCA 3OKNB 1F90H 1I8IA 4P46D 2WNWA 5E99H 2WOYA 1IAIM 2EUZA 3WL9A 1IJ9A 3L7EB 4G7SB 5I66B 1BBDH 2FBJL 4PW3A 5EBGA 4OZIA 3BUIA 2X4NA 4GKNA 2C9VA 2FECI 3GB7B 2ED7A 3GS4A 3M1BA 5BS0D 3WGUB 5GJSL 2VXQH 3RGVC 4A67A 4QJ5B 1R0AH 4NNYB 4Q14A 1A7NH 2YGPA 4F8TA 4WK0B 2P5WA 4NQXA 1RFDH 2EDJA 5GS1A 3GHBL 1CE6B 5DK2B 1YN7B 1OAKH 2NR6C 4L37B 5E1AA 4J2XA 3PWPA 4P5TA 5T3ZD 4X6CB 3EFFB 2YD4A 4XMLL 3K0YA 3E38A 4N8VA 1HQ4B 1ZRUA 3W1ZA 2PR9A 2OSWA 1CG9A 5JPNA 3DMMD 3FN3A 2F53D 1E2VA 4HZLA 2OMYB 3DX1A 3STZA 3BPCA 3TA3D 3QDME 2AEQH 4B53A 1W8OA 4FP8H 3MAWA 2TAAA 5B3NA 3VQLA 2BSEA 2Z4TA 3I3DA 3FB5B 4G8EA 4XC1L 5ITBL 4B60A 4V33A 5EA0L 3AM8A 4PAZA 1KG0B 4TNWK 4D7PA 3S6CA 5DRZB 1YEGH 2GW5A 4IJ3C 5JQ6L 1F2QA 4OGQC 1UADC 1XF4B 1KTDA 4AYSA 1T80A 3OXSB 5E2WH 2JCCA 1AGFB 1FYTD 1L9RA 3AS3A 2IDFA 5D4JA 2VTFA 1L9QA 1C5BL 1UZ8A 3X12B 4C8XA 5JPMA 4YHIA 1EXUB 3HC0B 5FR3A 2P7TA 4F3FB 4B5ZA 3K91A 5E1AB 1TJHH 3L3OB 4EAEA 1G9EA 4LLMB 1JTTA 3G5XA 1W72A 4L8BA 4Y4FD 4XCYA 2EUVA 2BDNL 3QC5X 4G8IB 3B5GA 2CKBB 4H25A 5IIEB 1GY2A 1XGPA 3V5DA 1JE6A 2VN5A 3MV9D 3MGTB 2PXYB 5EU5B 3P4MA 1BZ7B 4MYWB 1TSRA 5TF0A 1AS6A 3EFOB 1P4LA 2FLBT 4K8RL 1IIKA 1N4XL 3VU2A 4AGQA 4F2MB 3V6FB 3CDZB 3QH3B 2R1YA 3OZKA 4DKDC 3BYYA 3JWOC 1S9WB 1FGVH 4NQSB 2W9LA 1XF5A 5G2NA 1TVBA 4L8CB 2OMXB 3V6ZB 3SQOH 1XAKA 1FFOA 1JHLL 1M7DB 3IDYC 4GW1A 4U6HB 4QWWD 2B4CC 3SE3C 4NUGL 4APQB 4MA7H 2YS4A 2FEJA 5ESVA 5ACMA 1WFMA 5FFOA 1PNDA 4NO0D 1UJ3B 1JBJA 1V55B 4YK4C 3HC2A 2H26B 1RZJC 3L6FB 4HUWB 5I76B 1JDDA 2CIKA 5D55A 1NAMH 3OC5A 2W8CA 3GMRB 1JTPA 3UXFA 2C26A 1IBZA 2VLMD 1TZGL 3ZOAA 1Y7VA 2ROYA 2O61B 2YFNA 2C1PB 5HI3D 2E27L 3S96A 1GOGA 4ZMLA 1QI5A 3V6FA 1DEDA 1HSAA 3MV7E 2DL9A 3FO0L 1KXVA 1RULL 2CJUL 4TNFA 2WNXA 4X6DB 3SO3B 1XEUA 5MEPA 2EUWA 1UWEL 4AL8L 5ESAA 4A2LA 2QSCL 3TO4D 1GSMA 2BIQA 1S6NA 4HXBH 4G8FA 2WC7A 4IYKA 3E9TA 3BVWA 3CN3A 1ZLWK 4RMRA 5J1TC 4U1SA 1OQOA 3H7BB 2Q2LA 3GIVA 3LEXB 4AG4H 2VO8A 2WYHA 2QL1A 4LKCB 4W9CC 5FPIA 4XNXL 5E8NB 1HL9A 3IJ7A 4HWZB 4Z78B 2FRGP 3QEQB 2A73B 2Q8AH 4PP2A 5BO1L 4FCHA 3RA7H 4AL8H 2O61A 3DXAB 4ZW6A 2WLJA 3AS0A 5HDRA 1J5DA 4M1GL 2I07A 3K72A 4DHLA 3BT0A 2CCVA 2YGQA 2CD0A 4XPFH 4YL9A 4EUPH 1YSOA 2DH3A 5IJKC 3MCKA 2BHUA 3K1DA 4LPYA 4KFZC 4NO2B 4NWUL 5D1ZI 1YPZE 1UA3A 1WC7B 3D39D 5D6CB 3VWKA 3KGTA 4LLQB 3PAVA 5CKAA 1AZVA 1TU2A 3IXAB 3FN0H 1JWSA 1O9WA 1AKJA 1G5GA 4ZO6A 5DU7A 3U9PL 2E9BA 5HDQL 3CE1A 3SKMA 5JR1H 2G0KA 4JGMA 3UTZB 3KBHE 1NBZB 1B4JH 3NABH 3V4VH 3ZL4H 2G3MA 1MCRA 2DF3A 2K1MA 3TT1H 2NQ3A 4FP8L 2JJWA 3ZIMA 1YUHA 3FZUC 4WW2C 1M1XA 4XWGL 1BF5A 2MWCA 2YKLL 2XQBH 4QRQA 4OUUB 2E75C 1IQWH 2E7BA 1E5YA 2GIYA 1KLGB 2CLZA 1D9KC 4KRNA 4F7PB 1SGKA 4NXSA 3W0WE 3GB7A 4QY8B 4MB5A 2F68X 4ZO9A 4W4NA 4ZXBD 3IVKA 3BVDB 1OALA 3O81A 3M46A 3RX9A 1IO4C 4NJ9H 3VXUD 3GTVA 3MV7B 2WQUA 1OK0A 4QRTA 2W38A 4QXGH 3IF1B 1I82A 2E47A 4HW6A 1C9SA 1WTLA 1E28B 4DVRH 3QBTB 2IQAB 2PXYD 1BQUA 1YVLA 1KTDB 4IRJD 1OB1B 3VFGL 1FSKC 1F90L 3V4PA 5BOZG 3FCTA 3HS0C 3JT2A 5GHWH 2OW6A 4ODSH 3MRCB 1B9KA 5J1AB 3KR3H 5MEOA 4B9IA 1P4IH 5D1ZD 1HIML 1A4AA 3LHPH 4UIMA 4YFLF 3CX2A 2IAMA 3ERXA 3GKWH 4Y1AE 5JOEA 3U82B 4NFBA 4PV8B 5KJ4A 5K59E 3OVUB 4Y16B 5F1KC 4QRRA 4NM4L 4MAZA 4OJEH 1WHOA 4OZFH 4NHCL 2FWSA 1R17A 1BZ9B 1AOHA 3MBEA 3P9MB 4OIFA 3FSAA 5AOZA 1CFTB 4OCSH 2GIXA 4JQIL 5HHME 4GUQA 1ZEAL 1G7MA 3ZK0A 2IG2L 4I2XA 4KJYB 3RNQA 4X5WB 2OYMA 1TSHA 4NJAL 3HIZA 3MRHB 1WZ1L 3OSVA 5KYXB 4D0DA 5T1KA 4GXVH 1PFOA 4PVNA 1JGDA 5SWZD 4Q58C 5B4MC 4HWNA 5TQ2H 1OF2A 4PSRA 3WD5L 5JXEA 2F19H 3SPVA 4JO2L 2GITA 2R2HB 1BG1A 1Q9KB 2R4SH 3KVDD 2VW7A 4QXTA 3GK8H 3HCVA 2X1WL 4JFHD 3NIFE 4WO4B 4IRSB 4IBTA 4JLRA 2V7HA 3KJ6H 2R9HC 3LXAA 3GSNA 3OR6B 2XPGB 3A6BH 1NEPA 4MHHG 2WCSA 5FHAL 1NEZG 1QKZH 5D7EA 1RZ7L 5SWQB 5E5LA 1CGYA 3LJ3A 2H32B 3AAZA 3TWCL 1SLUA 4M5SA 2WXKA 2VR7A 5I1JL 1QRNE 2WINB 4MD5A 5KS9A 1JZ6A 1HFUA 2WZ0A 4M61A 2XU9A 1E4KC 1FC1A 3QO0A 1BIHA 2YXMA 3F6LA 1FJ1A 1KIPB 3GJFA 4UMSA 4M5YL 4NGHL 4DVBB 2AABH 2W9EH 2WUCL 4UYQA 1OTUD 3LKQA 3E2HC 2FX9L 4YBQC 2X28A 2NRDA 3GSOB 3T04D 1PCSA 3MLPA 3TYFB 2UZPA 1D9KD 2V5TA 5F21B 5AZUA 3ULSA 5E8EA 3WAKA 3IMVA 1HDMB 2ZUQB 3QCVL 4F15C 1GOFA 1F4WH 4IRSC 5E4OA 5C0IA 5K5YA 3W38A 1NQBA 2VXSL 4OF5A 1TUPA 4ETQA 2I27N 4KKBD 2DIEA 3HS8A 4HZAA 4AH2A 2KYIA 4PS4H 2WUCH 2W9EL 4Q9RL 4Q4EA 4M8RA 4PJBB 1N59A 1FLRH 5FYLH 3I6LE 4B9PA 5D71L 2AF2A 2ZOLB 1MWAL 4POZD 5I6PA 1Z5HA 3W11C 1ROWA 4WU5B 1UURA 5F96H 3QPXL 3HZMB 4UB0L 4K2UH 4ATWA 3CC5B 2QGCA 3MRCA 1FIEA 1UXSA 2B3IA 1AYRA 3F7QA 5E00B 4AGLA 3QWQB 1ZVYA 1YEFH 3NCJH 1I9JH 1BIIA 4R9HA 2Z6FA 1BQRA 4IGBA 1E4XI 2F7RA 2ADGA 5DJAA 5DZOA 4X42A 5B1CA 3GRWA 3OV6A 2KBGA 4ZDHA 1MI5A 1QSVA 4A2DA 4L0ZA 2CZNA 3HLKA 4CGTA 4PRHD 4HJGB 1G9HA 2YJLA 1EHLH 1M7IA 4M7JL 2ZOLA 2P26A 4DUVA 1MOEA 4MQXC 3GMOB 2YRLA 5E03A 5CEZE 3GBDA 2JSFA 4NKDA 4YDIL 1TQBB 1BW8A 3HG2A 1N18A 3SDCB 1FORH 1KBBA 4KY2A 4BFRA 2FIRT 1EERB 5IMKB 1HHKB 4N2IA 2HPTA 2FR4B 1NGZA 4AMWA 2OV0A 4HX1B 2XN2A 3TH2T 3ABLB 2BNQD 1NGXA 2P8LB 4TSCH 2UWEE 2FSEB 3VD4A 4GG8B 3EOAB 4OLEA 4DEPB 2OMZA 2ZUUA 3UYRH 3VYNA 5KVDE 3NA9L 3ZDXE 4OT1H 3ML8A 1S78C 4ZS7H 1D9KB 1YJDC 2DI9A 2IAMC 4ELMF 1F02I 4DKAA 5B3JF 3RFZC 1IAII 2IDCA 4PJ7A 1AQKH 4WO4C 1BM3L 4BBWA 2AI0H 3C2AL 4A7GF 3D08A 5DQ9A 4D9RE 4N8CL 4O2FB 3RX8A 3T2PA 3VGGA 4BQ6A 4GW4A 1OEZW 4F7CB 5DMKB 1DN0B 2K7PA 3BKCL 3UJJL 4TUOB 4IJTA 1KIPA 3RVXC 3WY1A 5JW4N 5BRPA 2AV1B 2J8UF 2X7LB 5B38A 4JK0D 5JPMC 4HEMA 2AK4E 1KBVA 4XRCA 4M7ZC 3V52H 1A6UH 3CK0L 1KGUA 3ZUNC 3T71A 2ADIB 1KELH 4U1NB 2E9IA 5TK2A 3GHEL 2R2CA 1WP6A 4M62H 5JA8B 1AR2A 3UZQA 3IU4L 4WO4D 5KVFL 1QWUA 1FE8L 5EIVA 1KCUL 3ZLQC 1N26A 2ZUWA 4F5CA 2ZCHL 4HUXB 4E9WA 2XDHA 4ZUVB 3AGWA 3EZJB 5CP3A 1FA4A 3JWDC 2EDMA 2HN7A 4ZTOL 3BKJH 4MMXB 5INDA 4MB3A 3G5YA 2C3VA 3BPOC 4WSJA 5SWZB 1UGNA 4HOMA 2VN7A 2CH8A 3GSNL 2JKJA 2VZTA 3ZKQD 4LIQE 4DGYL 3FH5A 1FSKB 1JXDA 5IVNA 3AS2A 4LVEA 3VRLF 4BFIA 3KJ4B 1XTMA 3L08A 2QJDA 2B77A 2CR6A 1XCTB 2CAKA 2NXYB 3MGOA 3CCHA 5M94B 5C3IA 4L4TA 2CDEA 2R83A 2WXNA 1UWXK 4R2GC 3VFMA 1IKOP 4Q8BA 1OE3A 3MFFB 5FM5O 1UB5A 4OH2A 4FYQA 4LASH 1JI1A 4Q7DA 4TSAL 3WE6A 4OV6F 1LQBC 2HT2C 1DANU 1DLHA 2CA4A 4HC1L 1HL4A 4JG9A 2C3HA 2OPCA 4HOXA 1INQB 3KCWA 4LU5H 3D8MA 3V7AE 1WH0A 5AFAA 2WQ8A 4ALAL 4LLVB 5GS0D 4A68A 3UH8A 3S98A 4YR6A 4FG4A 1FZKA 1BZ7A 2QKIB 1NC4D 3P73A 1XSKA 3VA2C 2NY7L 4GP5B 4K7FB 3PHOB 1AI1H 4ILDA 5KUKA 1VA9A 3F7PC 5CZXD 5CIPB 1AHWC 3MJWA 2OXGA 3VI4B 4ZXBC 4MAYD 2H7WA 4XNMA 4L3EA 3VE0A 3N44F 4O2EB 5EMYA 5EORH 4LDEB 3CZFB 2R4RH 5A2IH 3KL0A 3AY2A 1U9KA 4CW1A 2YARA 1PU0A 1GGCL 3OHXA 1DBKL 4PHXA 4OLXL 2VMCA 4LHUD 3PIQB 4PGEB 5JLZA 2XV0A 4MJ5B 4UANA 1N10A 1B88A 1VGEH 2LTQC 3QQNA 4N5ED 1HEJC 4M1DL 4M4PA 5AD0B 4W9JC 2FQEA 3VGBA 3PJNA 2H3NB 4POUB 4QCIA 3RPBA 1YLBB 5L6YH 1OWWA 4MWFB 1C12A 5ICYA 4I2XE 2WNGA 3ZPDA 3CSPA 2HH0H 4PRAA 3R1GL 3AAZB 5FKAA 3C5JA 4V11A 3X3FL 4YX2H 2O93L 3TTYA 2QGBA 4ECNA 5LKNA 1D7FA 5HDQH 4NQSA 5FB8B 5LUMA 2GJZA 3BZEA 5DSCB 1OCZB 3QO0B 2JI3A 2K9FB 5TH2A 3SO3C 4ZMXA 5I9QB 2FR4A 4WY7L 4R4FH 3MBWA 1WAAE 2A6DB 3OLIA 3VXRB 4AEHH 3BRGC 3QDJD 4QT5A 3SB3A 1MFMA 3FT4B 4WLCA 1C5CL 4LAJH 5F70A 2R39A 4PBWD 2Q8AL 4G3YH 2HFFA 3DJZA 4FQ2H 5CCHE 5HD8D 1PAZA 4X80H 4OB5L 5I15L 4ISVB 2E7LA 4FFWD 3LKPA 4WY7H 3CWGA 1KJ2H 1OANA 3QI9A 2G9HA 3GSQA 3ALWA 4CN1A 3KPRA 4X6CF 1JN6A 2X6BA 3CVIH 4DOHE 2ZKHH 2EICA 1MCSA 3NH7H 3O3BB 4G1MA 2YLHA 3RGVB 3SKMB 4XCNB 5BVPL 5HYJB 3FONB 2QADC 5FIEA 5F0JB 3DJTA 4MX7A 3JV6A 3W82A 3JT0A 3SGJC 5EEXA 4NQVA 1FFNB 2R51A 3MV8D 5D5MA 1ETZA 4H88L 4I3GA 4NENB 1E50A 4DJMA 1XCXA 2UX7A 3MUGB 5F8RC 1MQKH 4W9ZA 2WLLB 5IJDC 1OCWL 5JPNC 5FKPA 4LK4A 4XB3A 4KZDH 4QRRE 5C08E 5C7ZA 3T4AB 2DDQL 2PO6D 3ULVH 1A0QH 5I1EH 4P5TC 2A74A 4MLSA 4RGNB 1RXLA 1R33A 4MAUH 2R0WL 2EH8L 3G9VA 4OU3A 4ZX6A 4YHPA 4NP4H 1HX0A 1U8PB 3FQRB 3RL1A 1AIZA 2DEXX 3MRIA 4FTVB 4GY4A 2BVTA 4YXHH 3T1FB 3HE6D 3D3VB 3HG1E 3EDEA 1W0VB 2EXWD 1N12A 3F6IA 2EYSA 5KBMA 3VUAA 4UNVA 4MSWB 3SGDH 4OZHA 4BZ1L 1K5WA 1WTGT 1AVAA 3Q8CA 5D7IF 1ZLSL 1I31A 1U8QA 2APTA 4U2ZA 4CU7A 4F33B 3IGLA 4PJAA 3SYCA 1NH6A 3JUYA 1HWGB 1WIPA 3BKCH 3UJJH 4NI6A 4DERA 3FRUB 5E94A 4XMTA 3EF4A 5C0IB 4KKCC 1F13A 4O02A 1XR8B 3O8XA 4OW6A 2UVEA 2VDLL 3SJVE 3GJFK 4EVNA 5HYSG 1JYNA 3LXBA 4X6EB 2R9HD 3K5RA 5L0QB 3NJIA 2A77L 1MDAA 1TKWA 1Z9LA 5EB9A 5E1HB 3WSQL 4Y5VC 4QWWC 1XF4A 1ZS8B 2A9AA 1RUAL 1JGVH 1RUQL 5JMRA 5KSAB 5F9JB 2CE6A 4ZO8A 4CBZA 2G2PA 3KBEA 1DFXA 3UYPB 25C8L 5GGQL 3UDWC 1G6RL 1MY5A 4RVBA 2DY2A 3L5WB 1BVLB 4P4RB 1EIBA 1QO3B 4FQLH 4UM9D 1JF6A 4HUCA 1IKNC 1VERA 2XA8H 4DQOL 2YUWA 5FYLD 3OLDA 3DPBB 2W0KA 3P69A 1FZMA 3JVGA 4NYLA 5E8NA 1QVOA 4M7LL 1CLZH 1VJSA 1J1OH 1D7CA 5CFAA 5AW3B 3ARGB 4LSSL 3LV3B 2NNFA 2XICA 3V0GA 4IMLB 2AJUL 3KNBA 1PSKH 4MJ5A 3ZE0E 1QA9A 4HUXA 1NFAA 3VSQA 4LNVA 2LLLA 2ZICA 2YOAA 3WO3B 1BZQK 3VH8G 4N8VB 4LNRB 4KXDA 2RFXA 3G5YB 1OLLA 3RNKB 5I8OH 2EAEA 1LLAA 1JPFB 3IJSB 4QRSA 1VADA 5A2LH 2ZOOA 2Z93B 4O9HL 2YRBA 1C8PA 3N43B 5K9JH 2JELH 5C0JA 2WINA 3OB0H 4MD5B 4UQIM 4L1TA 1P2CB 1TOXA 1OM3H 2GTWA 4J6RL 4RA3A 3EH4B 3NFNA 3K74B 5IEHB 3CFTA 5J12B 3LPOA 4S11A 3ZU8A 3FSZA 2JJVA 3CFIC 5FGSA 3LH8A 3ZMNA 5JYMA 1G4MA 3VXSA 5IF0B 2AXFB 4GSXA 4I0PA 1KFGA 3NZHL 2HX8A 3GMQA 1GYVA 4AM0A 3BUTA 1RK0A 4G1EA 4M3JA 4EJ1C 3BRFA 3HCVB 4WFHD 3BP4A 2ED9A 3FHEA 1X5MA 1Q9LB 5BPPA 3VD5A 3D3VD 4OTXL 3IM1A 2WTOA 3V4VB 4YE0A 4JKPH 5TE6H 4N0YH 2X41A 1C8QA 1ULVA 5BW7C 2I60H 1JZDC 3LKRB 3S88L 4H8HA 3CX5J 1EX0A 5DVLA 2Y4SA 4B50A 1Z1WA 4WDIB 5C97A 1KEMH 1IC4L 1U3HA 4BWUA 1XX9C 4OJYA 2EABA 3A24A 3GDBA 1Y07A 1CK0L 4HMCA 4PG2A 1ZA6A 4D94A 4Q9QL 3FMGH 2CO2A 3IDGB 1AKJD 4ODWA 3FB7B 4WWOA 1C1EH 1TDQA 4ONFL 2Y2WA 4E41A 2C1OA 2RQ8A 1SEBA 1VGEL 3VWKD 1T20B 5AYUL 5FUOH 3NPZB 1AXSA 5E6UB 2B8OT 5KYWA 4PWFA 4PJ9C 5E23A 1I9IH 2BVEA 5EU6A 3FUIA 4P57A 3RGVD 3PQYA 4PJHF 5M95B 3LXCA 4G59C 1WPCA 1T7WA 4PJ8D 3WELA 1JRHL 1GYCA 5FF6A 2X88A 2AV7B 2GFBB 4XWOC 1I7TB 4PJHE 4IRJC 1XMWA 4HEPA 2RHEA 3MGAA 4KUZL 2UY7A 4BKSC 4DKEL 5ISZB 4A2HA 2Z8VC 5E8PA 1P5UB 1MF2L 3RL2B 5DD5H 5DJXB 3C08L 1T0MB 4WHCA 4H13C 5DJZA 1ORSA 3HPLB 1KIRA 1E2ZA 1UHVA 2FQGA 4HALA 3VXRD 3ZDYB 8FABB 2EE0A 2JKNA 5IQNA 1GXEA 3O9WC 4RNRA 5BUGA 4MBOA 4GRWB 3PY9A 3NIDE 4ZUSA 5KJRH 1L9PA 2K6ZA 4ERSH 2VQ4A 2AS5M 4GUOA 3RIKA 1GGBL 1TZIA 1EXUA 1WUNT 3HC0A 3QS3A 1Z9SB 1DE4A 4JFPB 4MDJA 4ONHB 3U2IA 3WMSA 3MX0A 4R3SA 1MFDL 3WTTA 3MYJA 4RMQA 5AEAA 5C0FA 4X4ME 3B2VL 5A2CA 1KY7A 3K6FA 2VW4A 4NPYB 1N64H 5KBLA 4Q9BA 4QF1B 2XWBB 4GRMA 1H3WM 3EFDL 1FDLH 4MMZB 3I6GA 3ISWA 5FGCB 2IPTH 2HJKA 3GSRB 1ADWA 1OAZL 2O5YL 5GRZA 1Q72H 1F6LL 1J9SA 3TFKC 3UZEA 2C9QA 2ZXCA 4PSPA 1TVBB 3GXFA 3HNSL 3MJ8A 5J1SC 4GUCA 1L6ZA 1Q1JL 3QZWB 3QSKB 3PGCB 2Z1KA 4PP2B 1SEQL 4GLRH 5KG9B 2H45A 5I5RA 4QYOB 5D7SH 3T0EC 1WS8A 5K9JL 2W94A 4YHKL 2XC8A 5CXPA 5JNYB 4MASA 3SDAD 5EOCL 2ETWA 2EDHA 3EHBB 4I18A 5IROD 2X9YA 2LV4A 3CN4A 4OZGB 3TYGH 2I5YL 5I8OL 5DZNA 5ACZA 2IAAC 5F7KC 2YUZA 4YNYB 1JPSL 4MA3A 4NKOA 1KLGA 2CLZB 1MAML 1WBXA 1YECL 1MCOH 2O6CA 2V33A 5MENB 2SEBB 1W6WA 3W3BA 1II4E 2YKLH 1W8EA 4N6RA 1JNHA 4MCMA 2AJUH 1L5GA 4DEWA 1MI5D 2QHRL 5AVYB 2DBLL 3DX9B 4HDIA 5EC1B 1TEFA 2VQ1A 4FQ1L 2G75B 5BOJA 5D5ME 3NJGA 4CVZA 4TMPA 3GSVB 2XWJB 1ZIAA 4OCSL 3CZGA 4W1TA 2MCMA 5CR8A 4QHPA 2EDOA 4JFFA 1ZJAA 4FFVC 4QRQB 2ZKMX 4B41A 4JZJC 4K5MA 1E3XA 4QRPD 1JAEA 2MHAA 2YN5A 4OKVA 1AO7E 1J9TA 1M6OB 3QQDB 4CC0A 1XGPB 3OC8A 4G8GA 4PJIA 5IVZB 3RVUD 5J1AA 4I1RA 3IDIB 4DN4L 1GAFH 3HMXL 5KANG 1QG3A 1L0PA 1Y0LA 2AVFA 3B9KA 5KUMA 4Z3GA 1CR9H 1DUZB 4FYTA 3OX8A 1J1XH 2FD6H 3TBBA 4H1LH 1JNHB 2XZCH 2VN6A 3V6OA 1E6OH 4OLUH 1AGEB 3K8KA 1HK6A 1TKWB 2ZE0A 2V9UA 2BOCB 1VGKB 4KXBA 4KRLB 1SLVA 1H3PL 4DT2A 5CD5D 2GCYA 4PQXA 1G7IA 3O11A 3IJEB 4ICWA 2XIIA 2PPCA 2J57A 2W88A 3CHOA 1EGJA 2BCKA 1JPGB 3QYCA 5CHNA 1ZIBA 3STBA 4L3ED 4TTDC 2XZAL 2P5WB 1T83C 3D69A 1OB0A 4K0OA 4W9KC 1FFPA 2HFGL 3A0OA 2C3XA 5EHFA 5D96B 4NXKA 2WWMC 1NINA 1I4FB 5DWUL 1QSEB 2ZOUA 3OBAA 1G9ML 4KY1L 3IDNB 1U4EA 4TUKH 3P30L 3AQXA 1N8OE 3A67L 4B0MM 2P3YA 3S2AA 3CFEB 2VJXA 1JV2A 5D1XE 4FA7B 4AGOA 5DVNA 1A4JA 4UTBH 4PB0L 4JBSA 4ZMYA 5E08L 5KVGL 2Y7QB 5ESAB 2ED6A 2ZXBA 4KKCD 2OJEA 3IDXL 4HWBH 5KSUA 5DR5H 1FBIH 4WCYL 4KI1A 3QE5A 2I9LA 3BZDA 3LIUA 1I8MA 4JFDA 3B5TA 2H2SD 4I5BB 1R75A 4LPWA 4W9LC 3L95B 5BVJA 1X9QA 5K9QG 3O6FD 2VISA 1I9RL 2I7SA 2L4OA 2VRQA 3MLXH 3DROB 1CICB 3HVNA 4JFQB 7PAZA 2FEEL 3PF2A 1NAMA 3QUGA 4DSYA 5J4MA 3NIGF 4HLEA 4Z1PA 3GJFB 2Y7NA 1CLOL 2Y6SC 3S88H 5GGTL 5DUBB 1WVZA 1IJNA 5IROC 5IHLB 4YPGA 4AM0B 2VL4A 4XH2A 1G1OA 1HOCA 4W70A 4Z78A 3HAEA 4FNLL 4UTAH 2BZDA 3HE6A 3NJFA 5FWQA 4OV5A 5B1AB 1OAQL 5CBEB 4G70B 3M86A 3T3ME 4CNIA 3KYNA 5IV2A 2UY7B 3B9EA 3CQFA 2Z7WA 3NEOA 1E8WA 3K7UA 5F71A 3PWPD 4P5TD 4LCVA 5J0BA 1S5HA 3FTVA 1AFVH 2XNAB 4KVNH 2Z8RA 1AC0A 5IUSA 4MD0B 5E56A 2BSTA 3GMPB 4UAOB 2Y6TE 1ZGLM 1GC1C 4GI8A 5D1ZA 1MWAA 3HNVH 3O41B 5D72L 43CAB 4KKAC 1I8UA 3FQXA 4JDZA 5IW6A 3EJTA 4RQQA 2Q3ZA 2V7NA 3WFCH 1X5HA 4Z6AT 4ODWB 3NOIA 2N0KA 2L0DA 1OW0A 4JFEB 4TVUA 1HTYA 3TTSA 3H6JA 1FCGA 4FCAA 1UUNA 4JVPA 5C7XH 1RHFA 1D5BA 4Y4HD 1F42A 5KSBA 5F89A 3NGBB 2AQQA 4JFOA 3CN1A 2QVTA 1PLBA 1M1XB 1V7NL 4RISL 5I1IL 4EE2A 3Q8BA 3P2DA 3MXWL 1URIA 1H3UA 2CHDA 3M7FB 3QJHB 2WNKA 3G6JA 1OP5H 3TBSB 3OKLB 3LN4B 1IUZA 3W2DL 3KPPB 4WWPA 4RGND 1CFMA 2V2XA 5ADPL 6PCYA 1DVZA 4OJFH 1DSWA 2DQCL 5EF2A 3C6EA 4YDJA 2Y36L 2BLFA 4IKKA 4FQIL 1ZHBB 4RAHA 3DX4A 4K9JA 3MR9B 4JHZA 3EUUA 3EOBB 3GNML 4JO1L 2IIJA 1KBWA 4NM8L 2VMEA 1JDAA 5DRXB 3X14B 4JREC 4GG6F 3MRMA 1EHXA 1ZK5A 3E6HA 4PRDA 3LEVL 4Y4HC 3SYPA 1AANA 3BVXA 1CE6A 4BFKA 3LNFA 4BHUA 3KPQB 2XWJA 3L5HA 2I7OA 5C71A 2GJJA 3TZVC 1D2PA 2OMNA 1BD2A 35C8H 1N67A 3C09B 1YEEH 4JE0A 2YD8A 3IGAB 1PY0A 5KSBB 1JMXA 3KPMB 4PJEF 4PCTA 4R5XA 4MJ6A 3FQ2A 3UBXG 4AYID 2XTLA 2YPKA 1F8TH 3ECVA 2Y22A 2R27A 5CWSA 2FT8A 4MNQB 3I9AA 4JDTL 4BH8A 1LEGB 3BO8B 3BP5A 2VIRB 1L4IA 4LBEA 1XZWA 1TJIL 3VXOB 1JZFA 1OOAA 3NPSC 1EEQA 2A9ML 3DMMC 2AJXH 2EVJA 1MHCB 1D7DA 4DPAX 1JZJA 2UZYB 4HKBB 2C4FT 3TBVB 5E2WL 4PJ5A 4X9BA 3VXMD 2YPVH 4IU2B 1UD5A 2Y2YA 2GAZB 2EYTB 2OQJB 5CGYC 2VXVH 1Z66A 3EGDB 3KDMA 2XETA 2ZUSA 2XLLA 3MR9A 1BVLA 5HI3C 4A1RA 2JCCB 3MYZA 5EU3B 2DQCH 1CDHA 3HRPA 2X3AA 3LNDA 4BA8A 5IB1B 2NXZB 1GIGH 2N1TE 3NVQA 3Q1SH 1G7PA 4G8GE 2VC2H 4H40A 3B9KB 3CFKB 1KPVA 5DJ2A 2IOMA 3E3QE 1TPXB 4HJJH 3REVB 4HFWA 4G8EB 2A1WL 4R96A 3KHQA 4LRIA 5DA0B 4KTGA 4RFOL 1MW3A 4XBGA 4C56D 5T1LB 5ITFB 1NAKH 4EN2A 4ODXA 2H1XA 3I75A 3DX7A 1O75A 1UXMA 1AQDB 4LCCA 1HEZA 1A5FL 4JPKL 2BIIA 3IDJA 4NIYE 2RCSL 3FU7B 5E1IA 3Q5TA 1GIGL 5GS1C 3QCTL 4Y4HB 1PCXA 3X3GH 4Q6YA 3MFGB 2O72A 2WSPA 3L3IA 4JREB 4F2MA 4AK2A 2D31B 5GSVB 1QWHA 3FONA 1DJGA 3BVNB 1L5GB 3CZFA 4LKCA 2VWEC 2WXJA 2VJ8A 2YMOA 2J1XA 4DKFL 1Y6MR 4GLRI 3G6AB 3UP1A 1I4FA 3HA0A 5GS1B 3LSOB 1TZHB 1V3KA 4U1LA 3DJ9A 3D9AH 5DZJA 1E4JA 2CKBA 2ENJA 3A3YB 2VYRE 3LVEA 5KTEH 2X1XR 4MXQC 3BIBX 1Z9PA 2NDFA 4NCC2 1Q9WA 4UT9L 3RI5F 3F84A 1ET7A 2VDNL 2XACC 2DEWX 1Q9LA 5EO9A 4ONGL 4TQEH 1QYGH 1P9MA 2YSSA 1LMIA 3RBSA 3B3IB 1ZXQA 4HLZH 4J6IA 3WTVA 4M6MH 1INQA 5SWSE 4JFXB 5IJBC 3D2UA 1XH3A 2J8HA 3I2CH 1DP0A 2H9GA 4U1IB 1U8CB 5TFSH 3MRMB 1CICA 3EO9H 4QHKI 1FV1A 2B1HL 1LP9E 1IM9A 3ZDXF 3CXHJ 3F58H 3H4HA 4QRUA 4ZX4A 4PV1C 1TQSA 3GRGA 5E6RB 2UWEF 4XOBA 3V0VA 1A6AA 4PPTA 1KTCA 1SEBB 4QIRA 1LO3H 1E6JL 4JM2C 5HHNA 5DQDH 5KSVA 1U3ZA 4OZFG 4GI9A 3L4ZA 2Y3NA 3GDCA 1CFNA 3THML 1NDMA 3WO4B 1NOFA 3EUDA 3ZO0A 3FC8A 5EOTA 1UYWH 1O7SA 3OHXB 2ENSA 4KJPC 3T2LA 4BJLA 4EDWH 1T7XA 4BE6A 4CADB 4K3GA 1P4BH 3ZQXA 3OMNB 1VEPA 4HPYL 1T2QH 3RVWD 3IGFA 3RWDA 2HN7B 1TZOA 1X5ZA 3P3RA 4HP5A 4FI8A 2E74C 4IRZA 3GHPA 2Y1ZA 3QRGL 1CICC 3L3JA 4ZFFB 4MJIA 5J11B 1BFVL 1JOIA 5E2UL 1BX2A 1PVHA 5CINH 1BGXL 4EN3B 4EO5A 4YHYC 2HX7A 4UU9A 3TONA 3QFJA 3L7FA 1RZ8B 1UWGH 2Y5TB 3X13A 3HG4A 4JB9H 3QK0A 3O45A 2IADB 2KERA 5D1QD 4PGZA 2AJSL 4QXUH 2E9JA 4A7VA 3FQUA 5LBSA 2VDPL 1A7OL 5F9OL 2VUYA 3V5KA 2CDFB 2H1PH 5E0QA 2FJSA 4CU6A 4JRXB 5IB2A 4P5MA 3D4ZA 3NK3A 4O2FA 2IDQA 3PP4H 2YA0A 1HOCB 5AENA 4MWFA 4CA4A 1UD3A 4A7TA 1FNSL 3BEVA 3PREA 1JP5A 2NY4B 5T33H 3E6FA 2CBOA 5D96C 4IBLT 5I1LB 4YN3A 3L45A 2V5RA 3SGEI 1RUKL 3MRGA 2N7SA 5JHAA 4PJBA 3K6SA 1UEYA 1GW0A 1X5GA 2XFGB 2E3VA 5IG7B 4PJCA 1EEZB 3RIFF 3P4NA 2WLIA 2HT4D 5HGAA 1H3XA 4A6YH 5AOLA 2ZWSA 4BRJA 5FM8A 3HN8A 1V8HA 4XN5A 3IPEA 5IMMA 4FFWC 1YYCA 1SFHA 3BH9A 4FG6D 4HIXH 1I7RB 1U42A 2AEPL 3CVHH 2ZP9A 5J9PB 1AGBA 1DE4B 1U3JA 3BEWA 5GRWA 1GKEA 1L9MA 3FO9A 1ZV9A 2ZXDA 3VH8B 4OSUL 3KPOB 1YYLH 1AD0A 3B2XA 1Q9OB 1SHMA 2VLRB 2QADD 3EHBD 5F0LB 4XHQA 5EC2A 3JVFC 3UTPD 4F7KA 4P5KA 3ZX1A 4FKHA 2H47C 4NQDB 4K9EH 1M71A 4PWJA 5LHDA 4JM2F 4J8QA 2JKLA 3W5MA 1GTNA 3RYMA 3MLRH 4GUPB 5EOCJ 4QEGA 4PLJD 4NKIH 4YSPA 5TQ2L 1ZWIB 4BHUI 4OM1H 3R0MA 3PGFL 1MHHA 3MJ8B 5F0PB 3N04A 2DLFH 4POZC 1E2WA 2XTJB 3FO9B 4XP1L 2V3DA 1I7ZB 2F15A 3O6KH 5LB1A 3F05A 4JFFE 4DP0X 1TF4A 3EHBC 3WJLC 2JXMB 5D7JB 4IOSA 4M7LT 4QRPA 5FYKD 5H37G 4AUJA 2HRPH 4WNJA 4JPIA 1G9MC 1BLIA 1FIGL 2CKNA 2D7PA 1LMKA 3CZKA 4XCCL 3DX8B 2VABA 3GSUA 3NA9H 2ZCKL 4AMKH 5E94B 1JCVA 2RGSA 4F5CE 3PJLA 4BCZA 4BSWB 3MRFA 4DO6A 5GQBA 2PPFA 4JZJA 2W9DL 3FQNA 1A1NA 2FQFA 3IS1X 3QHFH 3IJYA 2BSRA 1J87A 4MLIA 3MRLB 4R4BA 4W9HC 2ZUXA 4LSQH 4HBCH 4P5RA 3AT0A 3ECWA 2DMGA 4JS7A 4H8VA 4AL8C 3RPIA 5T5FA 5ALBL 3SZ6A 4UM8B 2Y3AA 3PQYD 1IIIA 2VZOA 1G7JB 2D0HA 3HNTH 1CURA 5K9KA 5GGRA 4FG6C 1D5IL 2BM3A 2VKWA 5ACLA 3BMWA 3Q6GL 3VD3A 2Q7YA 2G9KA 4Z7QB 5E7BA 1A9BB 3T2OA 2XV2A 4HJSA 1U21A 3QW9A 1NCTA 2VAJA 3O3UN 2CBTA 4HIHB 4OJCA 5TDNA 3WUZA 4ADIA 4X5RA 4WGKA 4KRPC 1NCWL 5G5DB 3HFMH 1PX8A 4D9LL 4NLHA 2JJTA 3GSXA 3BGFB 1A9EB 4XMVA 4ESKA 1CXIA 1BPVA 2BRRH 4JM4L 2CUHA 3KYOA 4G5ZL 4I89A 1GSKA 1V3LA 3MRQB 1NCGA 1NGYB 4ADJA 1RK7A 3VI3E 1SQMA 3BP6A 1NGWB 3LZRA 2F8OA 3KM1A 3JWOL 3KS0J 4Y4KC 2G60L 3IJYB 3RWIA 1JPTH 4AYFB 4W9EC 5D7LD 3BH9B 3CDCA 3S5ZA 5KYXA 1Q38A 2G3XA 4RCAA 1P7HL 4RFNB 4JG0L 1YPZB 1UACH 2WBJA 3VFPB 3EFDH 5IK3A 4XCEA 3LQAC 5AW1B 3CPUA 5DJYA 2DYPD 3R4RA 2Y7MA 1FNGA 1OOWA 4A55A 4ZFOL 3KLDA 2MSPA 1JK8B 4OTXH 3N0PB 4PBXA 4DP7X 4UOW1 1R4XA 4L2LA 1K8DB 2Y7OA 3K2UL 3RVVC 4ZQKB 4XCFH 1ZV2A 4OLYH 3KYOB 2MQCA 5DD0H 5LXGL 3ULUF 1SBBA 3O6LL 4RSVA 4AVJA 4HEPG 1S3KL 1H0DB 3GBML 2OMTA 4H0GA 4PUBH 3OGCB 1HKFA 2X2HA 3C6SA 4DAGL 1JYXA 3P0VH 3AG3B 3EGSA 3MN8A 5TQ0L 5KBNC 4B9JA 4JY6A 4FQQA 4WHTA 5ABZA 1QTYT 1KPUA 4MMZC 4RGMB 5HDOA 3WFZA 4Z3HA 5IQMA 3OKEA 2A0LC 3CHPA 3BVUA 4LCWB 4P46A 4R0LA 1X44A 4NCDA 4NKMA 3AXLA 4O9HH 3V5HA 3OJDB 3T0ED 1G6RA 3PNRB 1E9OA 3IRPX 5IKCA 2AMUA 2XWRA 2WD0A 3GLDA 4L4VB 1DVUA 1R24A 4BGLA 2L7EA 4PRHA 3ZMEA 5BZDA 1X5LA 3S37H 4AVHA 4JY5H 1H0DA 3TIEA 1Q0EA 3KNBB 5ALBH 3AT8A 1YNTF 4L5FL 4YHPB 1AD0B 4ZNEE 5EZJA 3QR0A 4L4TB 3MLTB 1O6SA 1U95B 1U8MB 5AYUH 3CQPA 4APXB 3GM8A 3U48A 4QGTA 5LGJB 1J7VR 2WXOA 3BHBB 4DKTA 1A6TA 3IDGA 1N5AA 1E3FA 2NXZD 4Z7OF 1F4XL 1P5UC 2YJQA 1KEGH 5GGSA 2YMXH 3DX6B 1U8PA 3MREA 2K3HA 5PCYA 2EYRB 3QXTA 1Q90A 1XGUB 4N5UA 4U3XA 4U7SA 2BVPB 3OF6D 1S9VB 1NLBH 5EZPA 3MQIA 4PWEA 5DQ9B 4YVUA 5C8JA 4A2MA 2WV3A 4UI2A 4E9XA 3QIBB 5FEBA 2FJFA 2KKQA 3UJTL 4RBPK 3PXJA 5LAXB 1CIUA 5HHOE 2QKIA 3WXWH 1OSPL 4UUJB 1BYOA 5B1JC 1KACB 3OLEA 4LVHB 5B39G 4XVJL 3IJHB 3ETBJ 4XRCB 3BHBA 4BUGA 3OPZL 3SPGA 2ITCB 3HS0A 2Z1PA 1XWVA 5I6LA 4JDTH 3GXUB 4ISVA 4N5EC 2VR6A 4XCNA 3VDCA 4I0PC 1R3IH 3MLTA 2F74A 2XWZA 2VR9A 4F2FA 4PEEA 4G7YH 1BQLH 5DLLA 1CE1L 5FFLA 1ZD6A 2WXLA 12E8H 4GAJL 4AE0A 4JZOA 3E8UL 1NIBA 2H2PD 1FAIH 2BJMH 3EJQA 3JTTA 4K3DL 4K94C 2J6EL 1NCWH 3SQRA 4UM8A 5L0QC 1JXGA 4HJTA 1QEWA 1I1AA 2RCSH 5BV7H 1FPTL 3JZYA 5FA3B 3RVVD 1JNJA 5B3SB 2QZQA 4FJYA 2OR9H 3GTNA 1WT5A 1U36A 2A74B 4FC3E 3ROOA 3M88A 1IB5A 1XF3A 2CMRL 1DANT 3EXLA 4L0YA 2Z8SA 5GS0C 1P6AB 2FBRA 4KI5C 4Z95H 4JFDD 4EOWH 4YDLB 1E42A 1P1ZA 3WFHB 4DPCX 4R8WH 3I9GL 1CLZL 1KG0A 2DB8A 3ATFA 4X6FB 3BT2L 1B6UA 2PYFA 3MMEB 5FUZL 2FSDA 3RVTD 4QLRA 2YAPA 3OLGA 3ZBMA 4UNTA 1LO2H 1HAUA 1M3IA 1U4FA 1SJMA 1DDHA 1DTUA 1WIUA 4HWUA 2NY3B 1CLCA 3MZTA 4FZ8L 5AKSA 4GP8B 4ZX5A 2JI2A 3UDWA 5C07B 4AV4A 5KEZA 2WO3B 3ESNA 1MQ8A 5IKCB 1FNSH 4G1EB 3Q01A 3OPUA 2VNCA 4OKDA 5F3BA 5F97E 1O6TA 5TE7H 4O02B 2MRYA 4NN7B 1RPUA 2LAGB 1YCSA 3MUZ1 4PH8A 1KEGL 4DZ8B 3K72B 5T1LD 3CFMA 1U8HB 2CK2A 3F65A 2JTYA 3IN2A 2AVGA 5CLWA 3SE9L 3ES6A 3QUYD 2WOBA 1NFKA 1T0NA 1NMBH 2ZCLH 1SJHB 4YDVB 3GINA 1IFHH 1WFIA 4YHOL 2PYED 2XZQH 1YY8A 4UQBA 1PYWB 5D7IA 4IRJA 3HE7C 2D31A 3D07A 2CO6B 4Y4FB 1OGPA 2OXHB 5H8DA 2XPYA 3IGUA 4JO5A 2VXTL 1EAPB 3JWNC 1JGEB 4KX7A 4B9ZA 3ESOA 3U25A 3LSOA 2NNXA 1JRHH 1SXSA 4QHNB 1U8IB 3MNMA 4HU8A 2K78A 1UXLA 2XVLA 3VYOA 5C9JA 5AOIA 1IBDA 1OGSA 4GMTH 1XIWB 2JK5A 5GS0L 3VGHA 4J4PC 2NY1B 5TGBB 2DQFB 3O3EA 1SOSA 5C0AA 5C2BH 1G0YR 1J9CT 1MELA 3P4OA 1O7VA 1XIWD 4HIEB 4JPWH 3LQMA 3V4VL 3ZL4L 5EF3A 1WEJH 4LRNH 5FKAB 5SWSA 4UM9B 4A2GA 2FLMA 4BUQA 4P4KC 3EGSB 1I85C 4Z5RA 3QULB 1PKQB 2IAND 5GIRA 4UOQA 1MXGA 1I1RA 3QUZB 1DO5A 5EZIH 3ABMB 2WLNA 3SE3A 1V05A 2IOOA 2WWMD 4TULH 4WK2B 4O2CA 3EFOA 4MGXA 4XVTH 4B3VA 4X99A 2R2BA 5DXWA 1KDJA 4B7IA 4L3EB 4B96A 4ZPTA 1CLVA 5T1DH 2Q3XA 4JCLA 4N0YL 4PD4J 5AOJA 1X4XA 2YXWA 4R84A 1YEJL 1QR4A 4FULA 3OZ9H 4XAKE 3BKML 3MNVA 1ADQH 3ROOB 2WLMA 2Y2TA 4F93B 2QQLH 3QEQA 3ZUCA 2R8SL 1W72B 1X5JA 4UV4H 3JV4B 4LL1A 3BFQG 4K23H 3U1PA 1HI6A 3QI9C 4PTUA 3SBWA 2CGZA 5T1MA 1OT2A 2YGVA 3DWTA 4MCYB 4B5EA 1BD2D 3U0PA 4R4NC 1TTFA 1I7UB 3O8XD 3KLSA 4XP4H 3ARDB 2D03L 2A3TA 4YQXH 1EGJH 5L2JA 4TSAH 4A38A 1QW8A 3HE6B 5GGTH 2EKSB 2OSLB 5EPMA 1I8KA 1SYVB 2ITCA 1JZIA 2QADB 4Z7WE 5DC2A 1AQ8A 1OXYA 4NC0B 4GXUM 1J05A 4N6QA 1AGEA 4ZXBB 4HCIA 3CBJB 4F27A 1MFCL 4KXZH 1D5IH 3ZE2E 3HZVB 3EKCA 3WEAA 5DEGA 1CQKA 2K8QA 3MJ7B 2NY5H 5FA4B 2BW5A 5CGBA 3W81A 2ARWA 3MCLH 3HBZA 1EO7A 2AXGB 4JRXA 3CFQA 5F7MC 1ILSA 3DHUA 1ETB1 3WNJA 4YGVA 1H6TA 5LWYH 2VB5A 4LHUA 3SKUD 1IKNA 3RJQB 4FFYL 4KX9A 1AP2A 43C9A 3VCLB 1UCBH 4S1SL 1XF3B 3L4UA 3BO8A 3BP5B 3DXAA 4LBEB 3BDYH 4HS6B 2DQGL 5GISH 1CQYA 2CO6A 1SN0A 3M1BB 4ZG1A 2B9AA 3UC2A 2BK8A 1U95A 1V7MH 1Z9MA 5DDHA 4WFEE 5GRUH 3V9CA 3FT3B 4I4WB 2PWGA 3AMKA 5FYJU 1YN7A 3TO4C 1QWNA 5IB5A 1LE9A 1JGLL 4HFUH 1KN4L 3QO1A 3GM0A 1CF8H 3TN0A 4DCQA 4NNYA 3HNVL 5MERB 5CZRA 3E8UH 1E5ZA 4K3DH 4PJAE 4WKZA 3OB0K 3RWCB 5GSRA 3KJ4C 4YSSA 2OR7A 1GMIA 1AHWA 2AJZB 4NP9A 4HVBA 1A7QL 1S9YA 3N50A 3RX5A 3P54A 4QOKE 1C7SA 3E6HB 1K4CA 4ZUTA 1NJ9B 1G7QB 2BVQA 4MB1A 3VX1A 2Z34A 5D2LE 1ZXKA 5IT2L 5I2IA 4KRMB 2B0SH 3SE8H 3D12B 4ALAH 3JWDL 2VSMB 4KQ3L 4WUUB 5LXGH 4KROB 1IAOB 2N3JA 3EBIA 5LO7A 3SDYH 3ECBA 3QFDB 2IH3A 4YXLH 4LIQH 2EDLA 5ABAA 3DOHA 3Q8AA 1IM9D 3CMOL 3KGRA 4MJHA 3QR1A 2ZAIA 3QDJB 4IIZA 1IL1A 2Y7SA 3I6GB 3OGCA 5DWPA 3BPLB 2NY3C 2IBBA 2Y36H 3H9HA 4WJ5A 2BHFA 3KL5A 2VERA 2YXVA 4BE5A 1VZGA 2OBGA 4LGRB 1DJWA 2CXGA 2PP7A 2R0ZL 1BQSA 1OF2B 2QQQA 1LP9A 1S7XA 4HQQH 4FQJH 3IFOB 3N2JA 5HGBB 2FX9H 1TXKA 4HMDA 5ETUB 2RAMA 3U36B 4QHLA 3NYKA 1EDYA 1MAMH 4RQQB 2BSED 1H6EA 4H8WH 1MQKL 3HJ0A 4ALAC 2V2TB 2D8KA 4Y5XB 1CT8B 3VD2A 3SE6A 5I19L 2APXA 4M43L 3V7AG 1E4XH 1UQSA 3DJSA 5CGYD 2ZX7A 5FCSH 3BEVB 5IJCC 3Q5OA 2IAMB 3WFCL 2FYYB 1CXLA 4R7NB 3PUUA 2F8VA 4NSKB 4XBPB 5SV3A 5AVQB 1RMFL 4OZGA 1QLFB 3KM2A 1KTRL 2PWHA 2K7QA 5DWUH 3VFOB 4KVCL 4HG4K 4J39A 4QAWA 5FW7A 4L8CA 4HS3B 1KNOA 1C16B 1RPQA 2UUDK 1R5IB 3PP4L 3ARFC 1B9ZA 1XL4A 3F7YB 4NQCE 3SSGA 4JN1H 3CDZA 3VWJD 3FT0A 4F8LA 4RX4D 4G8AC 2E7LC 4GXFA 5DJCB 1KXTB 3FCTB 3POCA 4KJQC 1J8HD 3GZPA 4Z77B 4XVJH 3WD5H 2NX5E 4NRZA 2W91A 2ZJSL 4QHUA 4HS8L 4NFDA 5KVGE 2WCGA 4YE4L 1O5PA 2CHXA 4LO9A 4LOUC 3V0HA 1T7ZA 4Z9KB 4CMMB 5ESVB 4MMXC 1L3WA 1DSYA 3UTSE 3B7SA 3QIBC 4XVUC 5C0NC 3RWDB 1EMTH 2Z0BA 1AQKL 2P45B 3QXUA 2NY5C 3I02B 1T21B 5H2BB 3I3BA 4OGAD 5JO5B 2HRHA 3KPRD 5ICXB 2E86A 3PWVB 1RH8A 1Z3RA 2PETA 3MLUL 3DYPA 4IDJL 4HD9A 1ZT1B 1INEH 3B3IA 3AXIA 1IEAB 5EOQH 1E5AA 3SGDI 3LZFL 3MA7B 3L3HA 2ZUYA 2CLVA 3P3TA 4TKWA 4WAFA 1AGDB 1K5NB 3WUWB 5C92A 1DVFA 1NCBL 4HAFA 1AZCA 2HVBA 3O9WD 3B6SB 5DI8B 5DURB 4UZGA 1AHKA 1G7LB 1LO3L 4ZZKA 5FV1L 4HK3J 4UT6H 1JGIA 4OI9A 3V5KB 4DVBA 3ZTNL 4MXVE 2WPGA 2ZKWA 4KI5E 3UABA 4B27A 4EI6A 2DLEA 2ICEC 1BMWA 5HDBF 2NY0C 2Z35A 2D7OA 2OL3L 1TMCB 3JXAA 3TBSA 1MWOA 4XNAA 3TESA 4MZ2A 1CN4A 2NSXA 4MA3B 4NKOB 2EC9T 2A73A 1I7TA 3WU1A 1BM7A 1ZHLA 2R1XA 1IEHA 5AAMA 3BLPX 3KXFD 4JDEA 3REWB 5KWYC 3IE9A 1RZIB 4AT6A 1ONQA 4FFYA 1U8CA 4Y9FA 3LQZB 1V27A 3LPGA 4BSJA 4NQXB 1F2XK 4P23A 3MNWA 4GSDL 1CDCA 2WVVA 1OY3B 5LQBH 4GRLC 4N87A 4ZOCA 5K1NA 3NIGB 4ONFH 3LOWA 2BXZA 2BXYA 4X6BB 4QTFA 1KGIA 1BX2B 4KK6D 3GPEA 3LKSB 4K23L 5MHSE 3VFVA 4F9PC 1A02N 1JGDB 3B6SA 3QIUC 5DI8A 1FDLL 4Q6KA 1IAIL 3MBXH 4XT1C 4ZPVA 3RILA 4L1LA 3V4UL 3VCLA 3A5VA 4ATTA 1HXYB 5CBEA 3UJTH 3IWUA 3G7TA 5E9DE 4QF1A 2OKMA 4LASL 3B2MA 3Q8EA 2NTFA 4JG5A 4M6OL 1TQCB 5SV4A 3ZZ1A 1QLRB 2BNQB 4XCCH 1KT2B 3MDJA 1NUNB 1XF2A 1WZMA 4AE1A 1D3CA 1T1YA 3GKZA 3C5SB 2EVIA 5ACZB 3LN5B 3LRGA 3WNMA 2YIHA 3JTSA 1NGYA 1HHHA 2P52A 4L0PB 4MXQD 3JWNH 2C9UA 5D1ZB 3ZE0B 3AC0A 5DEFA 3T4YA 4X7TA 2YMXL 3WJMB 3F7RA 4X6BA 2VSDA 5IQ9A 3RA7L 1SDDA 4UQ3B 1MPAL 1OAXL 1ZTMA 4WRLA 2FAUA 2X6CA 3MZGB 3TYGL 4PRBB 1XL6A 3EGDA 1SRDA 2EINB 5ISZD 2KQMA 5I82A 5CLTA 2IDUA 1JF5A 2J8UA 4ANXA 3EYFB 2VXVL 1R3LB 5T3XE 4J27A 3A6CL 3DURA 3PWUA 2DQGH 1N7MH 2OMUA 3BOVA 4GKNB 4PJ8B 3AB0C 3UPRB 2Y06L 4IBUA 5CSBA 4PRPD 4FYRA 5J13B 5HGHA 3HAEG 3TEZA 2PR4H 3WFDL 3L3IB 2BSRB 1IGJB 2H8PA 4BFNA 4F2EA 1H3PH 2NW3A 2ZYRA 3DRQB 2VLJE 4BFOA 1UUSA 3FU7A 4FXLA 3ECQA 4IRZL 4XN1A 3ULVL 3KW7A 4GBXD 3L9EA 4B9KC 1AKJB 3UTTA 3K2MC 1B4TA 4UT7L 3AS1A 5HGDB 1J1XL 2QQNH 4E41B 1S3KH 2NY0D 2E7MA 4YL4A 4UINH 4XH2B 1SNRA 4GSRA 3T09A 3LZLA 5A16B 4TVPL 2RB8A 4WV1A 4F57L 4ZMWA 3QJRB 2C8NA 4Y19A 4B9GA 1OE2A 2KZBA 5K9OA 4FOMA 2VDOH 2EXYC 2D0FA 1DZBA 3DRTB 3HG0A 3MBEC 1HKLL 4NM8H 4XE0A 5D7JC 4R97B 4RDQF 1NLDH 3T6WA 3WFEH 5DLMH 5E9DB 3W9DB 2QR0B 5AKRA 3C87A 3WJJA 3FFDA 4BFFA 1VFMA 4X6EA 3EJUA 5ADPH 3C8KA 4OD1H 5FUZH 2GJ6E 2AQ3A 4WENB 4JN2A 2P44B 3DOSB 5DK0A 2WXHA 1N6VA 1UENA 3OKMB 3WIIL 2A0LD 3MLSH 4QYAA 3UERA 3D2UB 1M6UA 4UCFA 1BD2E 3ET9F 3DGCR 4K55A 3B1UA 4M6NL 3SYAA 5GXBB 4NN5C 3FF8A 2GAZA 3SBRA 1YEJH 1ACZA 1I8LC 1XCWA 3QNZB 3LNHA 4M9PA 2BZ7A 2R29A 5D7KD 4AI7A 1OSZB 1T6BX 3IN0A 1ZVSB 2X9WA 3KWWA 2WVSA 2WP3T 3C75A 2DQMA 1WWBX 3V6OE 5I1GH 3B8YA 2Z91A 1M6OA 3QQDA 5ID0B 1EZLA 1QHPA 2XG4B 5JQ6H 3I6KB 2CIKB 1KCSH 3HOGA 5C0AE 1F1DA 5KSUB 4KZDL 1YNKH 2J73A 1WD9A 3RKDD 3HW7A 4RMVA 3JYBA 2PKDA 3QUZA 4KKBC 1OO2A 1QEXA 5FB8A 3BZEB 4KX8A 4YGAB 1TTAA 1LO4H 4JPVH 4AQOA 3WDHA 3FTSA 1E27A 5DK0B 1NAMB 5DRZA 2X5PA 5DHVB 4HCRL 2ESVA 2NY6D 3U4KA 5T3ZH 1E9PB 3OAYK 1OAJA 1HCVA 1MRDH 1UJ3A 4ZUWB 1G6RH 4OFQA 3GZQA 4X4XB 5IF0A 2ADJB 4BXSV 2UXGA 3IPBA 1MFUA 5HHQB 2XYCA 2RALA 4LCYA 4QHUB 1NCAL 1KOAA 1S9YB 4XP5L 5DVKA 1S4IA 2NR6D 2Z7ZA 1SOKA 5AB1A 2IBZY 3FRUA 1RZIA 2F1BA 2X1OA 2ZTBA 4XC3L 3RWHA 1KC5L 3CD4A 4C55A 4PGEA 4U4BA 1HYSC 2ALWA 3ETSA 4H25B 4CN4A 4MHHI 4TLUA 1FNEB 4M02A 2BNRD 2GQHA 4OAWB 3M1CA 1UJ3C 4WW2B 3F6JA 2R0LL 2XV6B 2CO3A 4K3EH 4AIEA 5H37H 3MSPA 3P4MB 2BFVL 5L2JB 1BQKA 3T77B 1HQRA 3IU3A 4YDKH 3QCUL 4U3HA 3CFCH 4XNMB 4CSPA 3ZSSA 5DVMA 1NPNA 2WIIA 4IOIA 3VXUB 5E6IC 3CZSA 2L8AA 3V4LA 1IBBA 4JKWA 5DJXA 1KJ3L 4BZ2H 1Y6KR 4OFYD 1FYTB 3O4OB 1FNFA 3S8FB 3A6CH 4U6YA 2ZXWB 2P8MB 1ZT4B 3FSOA 2AXHA 2YPLE 5F3BB 3NQKA 2BSDA 2HH0L 1AD9A 3U36A 3CUPA 4W9IC 5E9DA 3FCGA 3KPQA 1B2YA 2AITA 2X89A 2GK2A 4KJQD 5DMGD 2AGJH 5DHYA 4P06A 4M7LH 4OD2A 1QSFA 3T4AA 4CSSA 5HYIA 4KAQL 4PJ9A 1TNNA 5J7CC 5GJTL 5I76A 3ARPA 4HZLB 4JANB 1JGUL 1URZA 1TO5A 3HAEB 1L0XA 2OK0H 1M57B 1L0QA 1H15A 4GXVL 1SXBA 3ZTEA 1E6OL 3P2BA 1PNCA 3FU8A 4RGNE 3SOTA 3WIHA 4EOWL 4QO1B 1OPGH 4HSQA 4PG9B 3GXDA 4UYPA 4D7BA 2UWEA 2YA2A 1OCWH 5F1OB 1ZLVH 2W65A 1NZRA 2IFFL 2YPLD 4P2RE 1G9NL 1KIUB 1M53A 2LW3A 2QT6A 2D7QA 1MCJA 2IH1A 3SQOL 3TIDB 1PKOA 1DL7H 1A6WL 2H6PB 5CN2A 2JKSA 2YHGA 1WJ3A 4N1CA 1LWHA 1L0YA 2J1WA 5EU6D 5BW7A 1CXEA 4Z3IA 1IBFA 2HT2D 2O5NA 3LEXA 4JJ5B 3GKWL 1KENL 1EAQA 4OI7A 5J56B 5KOMC 5IB4A 1E0OB 3S2CA 1NGQL 3QEQD 3M8OH 4NS0A 1TQUA 4LHUG 5BJTB 2H6UA 2Q2EB 1YG9A 5I0VA 2BNRE 4Z7VF 4Z3TA 1MUJA 5D93C 5D2LA 3LDBC 3WJLA 2JTDA 1N7ML 1R5VA 4FQ2L 2R0LH 2BS71 1S5IH 5GGVL 1MFEH 2X2UA 1MJ8H 3L17A 3ME0B 4NPYA 4XX5A 2DQHH 1GGTA 3EJJX 4X8CA 3VO0A 2ZAHA 4PJ5E 5I1KL 3SPIA 4PS7A 4PJ7E 3RIAF 3KEHA 5KJ7E 1QI3A 3NCYS 3SYQA 1MFNA 2F5AH 4L9DA 1CF8L 1KYOK 3D34A 4X7TB 5E2JA 3WJMA 1BJ8A 5AAWC 2AI0L 1E4XL 1M9SA 3MRJA 5EEUA 3BLKA 3HJEA 5DRXA 4NERA 2X4RA 4L3CB 1ETZB 2NW2A 4NQEA 1NCNA 3PXHA 3VGEA 2ESVD 2O6FA 5C8JB 2BNUA 2IWGA 2OFQA 3BAXA 1F4XH 1W15A 3X3FH 1AXTL 2IDTA 2YD1A 3RVWC 4F7MA 4G6KH 4P8QA 4ZS6D 3UCRA 2V2TA 5DQJA 5C2BL 4HHWA 1LWRA 3L5IA 1E5UI 4FLOA 4XTRC 4ZOEA 2XWTB 4N2CA 4P2AA 2OTWA 3II1A 3O2DL 4PVMA 5I8CB 5JIPA 2DQDH 2Q0ZX 5D1QC 5E6ID 2C4FU 2EKSA 1PYWA 1XR8A 4KDWA 4MNHB 3IU4H 3T2NL 4YAQA 4HWBA 4N6RB 1FO0A 2LU3A 4PM1A 3OMAB 4N68A 3SN6N 1NPUA 4UT6A 4XPGL 5IVXE 3DRQA 1JGEA 3E9UA 1GW6A 3PABB 4W6WB 5CIPA 1NICA 1KIRB 1YNTA 3T3PF 4DQAA 4X80L 3K6OA 4HCRA 2Y5QA 1LO0H 4YLCA 2J8UE 3KYKL 3PPSA 2H32H