2H0JA

Crystal structure of pucm in the presence of 5,6-diaminouracil
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
114
structure length
112
Chain Sequence
MGKLTTHILDLTCGKPAANVKIGLKRLGESIMKEVYTNNDGRVDVPLLAGEELMSGEYVMEFHAGDYFASKNAADQPFLTIVTVRFQLADPDAHYHIPLLLSPFGYQVYRGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analysis of PucM, a hydrolase in the ureide pathway and a member of the transthyretin-related protein family.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Transthyretin-like protein pucM
total genus 22
structure length 112
sequence length 114
chains with identical sequence B
ec nomenclature ec 3.5.2.17: Hydroxyisourate hydrolase.
pdb deposition date 2006-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 2h0jA00
1DVZA 4PWFA 3CFNA 1ICTA 3HJ0A 4MRCA 3CFMA 2F7IA 4DETA 3P3SA 2H6UA 4PMFA 3A4FA 4QRFA 5IHHA 4TLKA 3GPSA 4DEUA 4PM1A 3IMVA 5HJGA 2GPZA 4WNSA 1ETA1 3GRGA 3P3RA 1BZDA 3ESNA 3GRBA 1DVSA 3IPBA 4KY2A 4TNFA 1SN0A 1Y1DA 3DIDA 2H4EA 3ESOA 3IMSA 3QVAA 4Q14A 3BSZA 4TLSA 5AL0A 2QGBA 3CN4A 5L4JA 1ETB1 4Y9FA 3CFQA 2QGCA 5FO2A 2G2NA 1RLBA 2NOYA 5K1NA 3SSGA 5CLZA 1BM7A 1DVTA 1OO2A 3DK0A 3DO4A 3IWVA 4HJTA 5CLYA 5A6IA 1TSHA 2ROXA 2B14A 2B15A 2FBRA 4TL4A 4TM9A 1F86A 1DVYA 1TTRA 1DVQA 1E4HA 4TNGA 4Y9EA 3OZLA 4FI6A 4Y9CA 4WO0A 3B56A 4MASA 2B16A 4HJUA 1SOQA 4L1TA 1IIIA 1TLMA 5JIQA 4TLUA 1GKEA 3DGDA 1THAA 4PWJA 1TT6A 2QPFA 3GS4A 4PWKA 4PWEA 5AL8A 2ROYA 5AKVA 4N87A 2H0FA 2G3XA 4TLTA 5FW7A 3P3UA 4TQPA 4ABVA 3NEXA 2WQAA 1SOKA 3OZKA 3CBRA 4IIZA 5DEJA 1TZ8A 1TTCA 2PABA 3DJSA 3CXFA 2F8IA 2FLMA 3KGSA 1THCA 3U2JA 1TYRA 3I9PA 4IK6A 1X7TA 3D2TA 3I9IA 5CM1A 5L4IA 5L4MA 1FHNA 2H0JA 3IMRA 4IKIA 2TRHA 4TQHA 3IMTA 2H1XA 1SN5A 3NESA 4ABQA 1IE4A 3KGUA 4DEWA 5E23A 4PVMA 1X7SA 3P3TA 4MRBA 3GS0A 2H0EA 2G3ZA 1TTAA 4HJSA 4WNJA 1G1OA 2QGEA 3A4EA 1Z7JA 3CN0A 5AYTA 2B9AA 3DJZA 4DESA 4FI7A 4AC2A 4PWGA 1QABA 2G9KA 2QGDA 4PVLA 3TFBA 1DVUA 5FW6A 5EN3A 4ABUA 1ZD6A 4L1SA 2QELA 3D7PA 4FI8A 5DWPA 3TCTA 3FC8A 3NG5A 4HIQA 5L4FA 4ACTA 1U21A 3GLZA 2G2PA 4TQIA 5BOJA 5JIMA 1KGIA 4YDNA 1QWHA 3GS7A 3ESPA 4ABWA 3U2IA 1FH2A 3IMWA 1GKOA 5AKSA 4IKJA 3CN3A 3FCBA 1E5AA 1TTBA 3BT0A 4D7BA 2B77A 3W3BA 3IMUA 4TNEA 3CN1A 3DJTA 1BZ8A 3I9AA 5JIDA 4DERA 2G4EA 4TQ8A 2G5UA 4I85A 2TRYA 5CNHA 1DVXA 4N85A 1IJNA 4I89A 5AKTA 5E4AA 1SN2A 4IKLA 4IK7A 5CR1A 2GABA 3CN2A 4HISA 4PMEA 4ANKA 3DK2A 4QXVA 4Y9BA 4Y9GA 5EZPA 5TTRA 3IWUA 4QYAA 1BZEA 5CN3A 1E3FA 4PWHA 4AC4A 3CFTA 4PWIA 1ZCRA 1F41A 4I87A 4TKWA 5FW8A 3Q1EA 3A4DA 4IKKA 3IPEA 4TL5A 3DJRA 1IIKA 2G4GA 2IGLA 1KGJA 3NEEA 4N86A 4YDMA 3NEOA 1BMZA 5E4OA 4PVNA 3M1OA 5K1JA 5CLXA 3KGTA 1TFPA
chains in the Genus database with same CATH superfamily
1S7QA 1MG3C 3EYQC 5CP3A 4F57H 4YHML 3LH9A 3DETD 3VI4E 4MNGB 3ZZ1A 5A2KH 5DHYA 4DT2A 5F6IC 4I1NB 5D7IF 4DKDC 2HRLA 5T1DL 5FKAA 3V0AC 2XFXB 4XRCA 3RFZB 1SFDA 4ZX5A 2VW4A 2Q0ZX 3VFGH 1D5XB 3TFKD 1CGTA 5CIPB 2WQRA 3RPIB 4QEGA 3VFOB 4WHTA 4JFZH 2FB4L 4YX2H 1LP9A 4TL4A 5IHZA 5A16A 1FE8H 4OFVA 2C3HA 1OAKL 4TNGA 4AOFA 2GSMB 3WJJC 3VFMB 5JPMC 1JV5B 2ODIA 4LCYB 4ZS6D 1RMFL 1S7RA 3FFDA 5DYOA 3DGDA 5AL8A 1MCCA 4JKLA 4PGDB 3MRQA 3T3MF 4FG6C 5KOVC 1LO0H 3F7VA 2CMRH 2HJLB 1FZJA 5BW7A 5EBWB 3LXCA 2X3BA 4R4FL 5K9JL 3RZCC 3N43B 4XVTL 3CXFA 1UOWA 1K4CA 1NUDA 4Y4FD 3UIZA 2CD0A 1X4XA 3VDBA 2DQHH 1HSBA 2NSXA 4HK3J 4L8CB 1EAPA 3SHSA 3SPCA 3TZVA 5IY5B 1J8SA 3V4PA 3ARQA 2C4FT 5E8OB 1YNKL 4XPGL 1H9VA 4MAYA 2HH0L 4N2OA 5I1LA 3OV6A 4G6KL 1I1RA 4BIKA 1MJ8H 1X5MA 2RACA 3MR9A 4PN6A 4Y4HA 1IC4L 3UYOD 3NRQA 4XPFL 3GTNA 5C0EA 3CU7A 3IFNH 4PW3A 3SKMB 5I16A 3K46A 4EZKA 4HOZA 3VA6A 1UH4A 1CICA 2PYEB 2OULB 4CADA 4UQEA 2FR4B 1UADC 3CC5B 5JIMA 3F7YB 2XKSA 1F8TL 5C8JA 4YN3A 3KPRA 4QJ5B 4QJ4B 2PWDA 1N19A 3ARRA 2OTWB 3FO2B 4P5TB 5CJXA 3QCTH 1FV1A 3BEWB 4DQOL 3VXTB 2MKWA 1RPQA 3V0WL 3K5RA 5A7BA 3MLVL 3CLFL 1I3VA 2EDQA 5BS0E 2R2CA 2ZQKA 1PGRB 1YNTF 2ZXDA 4NEHB 3WTXA 4XX1G 4AENB 4BHUI 3KM1A 4P9HH 2QR0A 2ZD0A 4NJAH 4ZPVB 2X1QA 1N68A 2E59A 3CZGA 3VWJA 3NK4A 1OHQA 2YEZA 3NAAL 4UV4L 3MRPB 2I5YL 4FQQA 4J3UA 4RSVA 3DO7B 3BVUA 3MBXL 1Y7VA 4A2FA 1SLUA 1KN4L 3D09A 1FFQA 4U6VH 3ZTJH 5IVNA 1AHKA 3AS3A 3L4UA 4B9YA 1KFAH 2G75A 4LDCA 2DEYX 3GC3A 2FWUA 2NYZA 4JHAH 3WL9A 4FQ1H 2IPUK 4WV1B 1C7TA 5IQ9A 4D0BB 4F20A 2KI6A 5F7YC 1QTPA 3SYPA 3ILPB 3FFCA 4A7VA 4MCZB 1LP9B 3WV0A 1ZE3C 5L8KB 4UBDC 5F72S 2NNAB 1PEZA 2FWSA 4MX7B 4A04A 2VJ0A 2JIXD 5HDBF 1D5XA 4B5ZA 1DYZA 4E9TA 3D0VB 2E74C 1E4XH 3NZUA 5FK9A 3MHZA 1WZ1H 4GRLC 2COVD 2IAMD 2J6EL 2XV0A 3MROB 4HMEA 3UOAB 3QJHB 4RRPG 1AH1A 4NKDB 4RGMB 4FL4C 3VXNA 5HD8D 5ALBL 2C5DC 1OTTC 2DYPA 2XXGA 4MJJA 1BBDL 1VADB 4IK6A 1Q90A 1KCKA 2XBDA 4KKLC 4UM8A 2E46A 4RQQA 4X7SH 3KE0A 1GS7A 4Z7UB 1INEH 5BMFL 5KBDA 3HZ3A 2H26A 5C6WH 4E0RA 1TDQA 3OR6B 4I0PB 3BVTA 3UPAA 4I9WD 1F4WL 3WTTA 3BKYH 5J1TC 2VM9A 4ZTOH 2EH8H 2F54D 5DFTA 2D31A 7FABL 1XGQB 4GLRI 5C2UB 1FL3B 4PI0A 3QJQB 4JPVH 2BSDA 3MREB 4OV5B 1T0OA 1FWXA 5KZCB 2DLGA 4A68A 3HUJB 3FT4A 3D33A 3OWEA 3NJJA 1YMMB 5GPRA 4GXUM 4KITB 2DWDA 3ARFD 1X5KA 4Z0XB 2Q76A 2COQA 5FUOH 4JDEB 3MA7B 3S88H 3QQ4B 3H85A 4YHPA 2PO6D 1N7ML 3G5VA 2FIKB 1AZBA 1B0IA 1P1ZB 4RMTA 2XN1A 1G0XA 3L9BA 4HPYL 3OLIA 2K7PA 4RH4A 1BF5A 3ATAA 3FL7A 2WY3B 1CLYL 3LZOA 3EYSL 3MJ9L 4JLRA 4OZGE 1P5UB 4TRPH 2M26A 3T1FA 4NCC1 4HWBH 2ATPB 4XNUL 3BMVA 1MFMA 3OZ9H 5EOCL 3MPCA 3WELA 2AQPA 5C70A 3SODB 2WKGA 1AIZA 3AM8A 1UC6A 1FFRA 1YPZE 5TGBB 1OPGH 2J7LA 3KPLA 5C0AB 3B9DA 5KSVB 4TL5A 4WKXA 1CF8H 5LB1A 5LCVA 1XEUA 1LDPL 4FNTA 3TA3C 4KXZH 3DX4A 4DEUA 4Y4KC 1J1PL 1PFOA 3WMSA 1IVTA 2H6UA 4HT1L 4S0TD 4FYRA 3QZWB 4GAAA 5C0BB 4Q74A 5F3BA 4HKBA 4IKNA 4FMFA 1T1YA 1JPSL 5MENE 4G9FB 1DQML 2DWXA 1YY9D 3GMPB 1H3PL 3ZE0E 4B9IA 4G1EA 5I30H 2X1WL 4PRHD 5ECJE 5HI3D 2QQKH 3EGSA 3JT0A 5DA4A 1P4LA 2R4RL 4N8CH 4IBYA 3HMWH 4F2MA 1PLBA 2Q8AH 1NJ9A 4WU7B 4AL8L 5D6DC 2AANA 5GZNC 3RJOA 1MRCH 4UZSA 5GSRB 2ZWYA 5BVJA 5BZXA 3RTQB 4JQXA 5DJCA 2CDEA 4UYQA 1U30A 1RUAH 1AZCA 3QWNA 4QRSB 1BBDH 1HL5A 2WWKO 4PRDA 4WV1C 2BINA 4XMZA 5D1ZI 4Z3FA 5B3JF 4KAQL 1IBBA 4YXLH 2F19L 1H3GA 2MIZA 3DOHA 5BO0D 4KQ0A 2F8OA 5EC1A 1NCNA 3IXAB 4URTB 2MTPA 4LSUL 3OMAB 4FTVA 4K7PY 3E3QE 5EO0A 3MGTA 1E0OB 3Q2LA 2OMXA 4JRFA 1VGEL 4WRLA 3W57A 2CJTA 3MMEB 4MD5B 4UOJA 4YC2B 3WMQA 2AK4A 2JLPA 5KVFL 1ACYH 5J9PA 3V79C 5E2VH 4MA8L 1DBMH 4PVMA 3WJMA 1ZLWK 2X7LA 1QW8A 2G3ZA 2O6FA 1TVDA 1VRSA 3IETB 2V17L 2FSEA 4PRIB 3FQ4A 1JNLH 2V9UA 2XYCA 4ZOEA 4PJCF 3WHXB 3EOTH 2YXFA 4PLJC 3X12B 4YHLH 4HX1A 1X9LA 4WJKB 4W9LC 3HNSL 3AXHA 4KZ0A 5BJTA 2CA3A 1NGYA 3CXHK 3D0LB 5L4FA 3NCEB 5HGAB 3WY4A 1EJOL 43CAB 2B9BA 1CB4A 3T3ME 3LYRA 1D9KD 2FD6H 5C09E 3Q3GB 1OAZL 3AG4B 4ZSOE 3RDTD 3MRFB 4NN5B 2B5IC 3UJTL 1IC5H 1ORQA 3ARDB 3MNWB 2A4CA 4RSYA 3BGFB 1EERB 3IU4L 4FQLH 1AZRA 4I89A 3MLXH 3VMOA 2V4LA 3KLQA 1KYDA 2K45A 1SEQH 4JFUA 2HX9A 4UQCA 3NDZE 5D7SL 1ZGLM 5EU6A 1SRDA 1CDIA 1D6EB 1U95A 3HI1A 5C97A 3QCTL 2RGSA 3U9UA 3A6BL 4LF3B 1DQJB 2P47B 3T3PB 2P5WE 3NCYS 3E6FB 1KJVA 1Z5YD 2DWYA 3LKQB 2P8LB 4JPVL 4HIPA 2CPCA 4N0YH 4UT7H 4ZNEA 4UM9B 1ZJBA 1Q9KA 2QEJA 2Q8AL 3ULUF 5E9DD 2D03L 3RTLA 5DK3A 4P3DB 5ISZE 4JG1H 3PWJA 1IGJA 3L9RA 2CKBH 3H9SD 2Y7NA 4GP8B 4YBLB 1ZA3B 3DYOA 1QACA 5J11C 4ZMOA 5TK4A 5LBSH 2AEQL 2UY7B 1T03H 1A7PH 1NBZA 4JHBA 5C0ND 2DICA 3ABMB 4QGTA 2QQNL 1Q0XL 4JFXB 5LAXA 5AVUB 5JR1H 3NACL 1WBZB 3FSAA 4FN0A 1XZ0A 5GRUL 1RVFH 5I2IA 3I9GH 5D6DA 5F7LB 3QUMB 2OYPA 3WAKA 4LIQL 3HG5A 3WY3A 4ZD3L 1T7YA 4YDJB 4RIRB 1QFPA 3HMXA 4BUQA 3HB3C 4BFOA 4MXVE 4LLYB 3GYRA 4PJ6A 3VD0A 3MXWH 1MFAL 3E1F1 4OQTA 1WFOA 3LKOA 4HLZG 2FDBP 4OZGB 3UC0L 2QLVB 2NUTB 3D2TA 4LLUB 5JXAH 4M5ZL 3WS3A 4GSXA 2X6VA 3WENA 5KSUB 5LBSA 4NO0A 4OCLC 1BX2B 1T0MB 2E47A 2A73B 4Y5XC 4H2CA 3VWKB 5FPIA 3BUDA 3EFDH 2DL9A 4OSUH 4FTVE 2V3DA 2DQCL 4P49A 3PWLA 1KFAL 1LJMA 1Z7JA 3GMMB 4JY6B 2HG5A 2VDLB 2R1YA 3D30A 1KGCD 4Z76A 1RZJL 3KNBA 2DQFA 1J1XH 3BP4A 3U7YL 2H2SD 3GBNL 1D5BB 3CDFA 1MCOH 3MGAA 5FF6A 3PXLA 2DLFH 2ITFA 2HTKC 4KKNA 2OM5A 3DWTA 3IMWA 1XSKA 1CD1A 4QTHB 5GGRY 1IUZA 3RB5A 4RESB 1FGNH 1TJIL 3DJTA 3LEVL 2YD7A 5D7KD 5DJZB 5T33H 4GRWF 5ID0A 2WLIB 3MJ8B 1CTNA 2D8KA 3S5ZA 1NINA 3FT9A 3ZZLA 1L7IL 2WHVA 1JZ3A 3DX9A 5HI5C 1G9NL 5CN3A 5EIIA 4X2UA 4AQ1C 4GQRA 5E00B 1D5ZA 1ZPUA 4CSZA 4ESKA 3SDCD 25C8H 3MRBA 3PNWA 3V6OA 3FT1A 4XP4L 1AGDB 4Y2LA 2O5YL 5HY9A 3BGFC 3R0NA 4FGMA 4NRZB 1BGXH 5L2JB 1U8IA 5HJ3A 1I8UA 3M1CA 3POCA 4OAWA 1JNNL 4LSPL 4OJCA 4Z7QF 3DGGA 35C8L 1HOCA 4XR8C 2UY6A 2YA2A 1U9KA 2YARA 1N4XH 3GI8L 1ZT4B 2ICWB 4TV3A 2FEJA 2PW2A 1RIVL 1KPRB 1RVFL 3BPLB 4UUJB 3QAZB 2X40A 1GZQA 3GSWA 1RXLA 3L7FB 5J57B 1M7IB 1JGEB 1UWXK 1S7XA 1QNZH 3RURA 4Y9CA 3ZUNC 2D0GA 4P2QA 1MCLA 1VKXA 3SDDC 5DK0B 3M8OH 2HT4D 4P2QD 3GPEA 1SDDA 1BJMA 4WI8A 1L9PA 1SLXA 2EDTA 4TULH 2RTTA 2H6PB 3NT0A 5B1BB 4RMQA 3NSDA 5HYSA 3S37L 3TBWB 1XZ0B 3T3MB 4ZFOB 2W88A 2IH3B 4H4NA 2A9NH 4LPXA 5FW7A 1A14L 1P6WA 4ACPA 5FDWA 3QNFA 2HT3D 4ZSOB 1G7LB 3UG4A 1E5YA 2C26A 1JPST 3WMPA 4APQD 3WN5C 3WKYA 3ZR6A 4UMGA 2ITDB 1XR9B 4X4MA 4IEFA 2HCZX 1MIEL 2R1XB 4IOFC 4JDVA 2VDOB 5JMOC 1DQLL 3Q5TA 2BIPA 3DX6A 3SDAC 1QLEH 3FUHA 4V1DD 1IEAA 3IFOA 3NFNB 4WUUB 4HSCX 1XF4A 4PHZA 4DN3H 4LSTL 1T1XB 4S1SH 2A77L 1YNTB 4HG4K 2MOGA 1YEFL 4JY5L 3B2VL 3JTSB 1AD9B 4N1EA 1M42A 2BOCA 3MCG1 1Q0XH 4BZ2L 1C5BH 4ODTH 1JHTB 2QGDA 2V33A 5K9QG 5DWPA 1U6AL 2PYED 2BFGA 2XKNB 4LU5L 1QSFB 4Q9CA 3FTXA 2C9QA 1DQQB 3KDPB 1N12A 2Q7NA 4FXGA 3HBPA 4BD4A 4YHNB 1KGCE 2G30A 1ZDSA 3U2IA 2WNXA 1I7TA 2O5ZL 2YD5A 5I8OH 2Y1AA 2OR8A 5I28A 1DUZB 1IGYB 4HFWB 3N41F 2X87A 4UINL 5DHEA 1R3HB 4Z8FH 4LCUB 1WYJA 2GJPA 3SDCB 5ID1A 4ICWA 3LVTA 3EO9H 3Q3GA 1FRGL 3RWDA 3ESUF 3KEDA 5IIEA 1NGZA 3VFRB 2DL2A 1QRKA 5IB3B 5MEQA 3ATDA 4OT1L 4Q89A 4W9CC 1B2WH 4BA8A 4NM4L 4GJTB 1J0HA 5EFIB 1QRNA 1WC7A 5HXMA 1KIUB 4HX1B 5I6OA 5ESQB 5E1QA 1WIOA 5ENWA 1ZHBB 2DQTH 3EYSH 3K72B 5H4YA 1M56B 4KUCF 3T77A 4AWJC 4DOHB 1KF9B 5HYJD 5D2NA 1ASPA 4U1LA 2OTUB 4KAQH 4JPIB 3KYNA 3D5OF 5DEZA 2JKNA 1RLBA 1C12B 3NJFA 4G70B 3UIYA 4O2EB 1EJOH 4RMVA 1OPGL 5D6CB 4AUYA 4FTVB 1VERA 4ZOCA 5GRVK 1F4YH 1I1YA 1S8DA 3QFJD 4KQ4L 4TOYL 5KS9E 2XOTA 3RGVB 1IV8A 1INDL 4KROC 2GHWB 3MCKA 1CK0L 2GSGA 2NXYC 2JLLA 2F0CA 2HT2C 2OL3L 3VXSB 4XBPA 3GS4A 3CFBB 3ZTCC 3WKMH 4AV5A 2CM5A 1T7WA 2PWEA 3F01A 4NI6A 5EZLB 4AEEA 2X9XA 2JKIS 4HXBH 4P2QE 2DM7A 5IFJB 1AXSA 4K7FA 1HQ4B 3SGEH 1YEGL 1AOZA 4DN3L 4ILDA 1LO5A 2F74B 2VLRD 4UOZA 3Q05A 1HHKA 3DV4A 5E1IA 2BNQB 5I6NA 4G42B 5DLML 1JIBA 1U8QA 2WANA 3MJGX 2C1OB 4PRPE 1UZ8A 4G1EB 1H8OA 3BESR 3ULUH 5I75C 1VSCA 2FWLB 4U3XA 1HEJC 3PL6C 3T77B 5ABZA 1N0XH 3N44B 5C0BA 1PEWA 5F3BB 3VFPA 2VXSH 1HH9B 3W39A 2F8XC 4Q9RH 2D7TH 1IX2A 2HA1A 3L45A 4WFFE 3W5MA 1UCBL 5EOQL 2C3VB 3KR3H 3ME0A 5C0AA 4W9GC 3OGCA 4ZUVB 5KN5B 3P77B 4XAWH 1RK0A 1ZVNA 2OSYA 4M6AA 2JB5H 1RK1A 1FZOA 1RERA 3S3SA 3ZDXB 5BOJA 5IIEB 1UWGL 2XWZA 4JM2F 3OXRB 1WFNA 5GS0D 2HPTA 1R4XA 2Q8BL 3GM8A 4X6BB 3APNA 1FORH 3CN3A 3P0YL 1OW0C 4L0YA 4HETA 3RDTA 4F8PA 5T3ZL 4UWQB 5HDWA 1E6JH 2ED6A 4UV4H 4WWOA 4JN1H 3W9EB 1J0YA 1BIIB 2I25N 4B0MM 2JI1A 2B20A 4MYPA 4JQIA 1YYLL 4HJEA 5IJCC 5E2WH 3BUIA 3RWDB 2GC7C 1OB1A 3B5TA 1IM9A 1JXDA 1R33A 1K3IA 3MA7A 4JPWL 4UQ2A 2AERT 4Z0XA 4PS3A 5DRNB 1N6QL 4FXGB 4NPJA 3P4MB 1YEFH 4K55A 4NRXB 1RHHA 1G6RL 2ZNXA 5HHPA 5DJDB 1AR1D 4MB1A 4G8GA 1JRHL 4DGYH 3AGVA 4J3VA 3DUUA 4BZ2H 4F8LA 4KO7A 4WTWA 1ZT7B 2VLLB 4ZXBD 2A38A 5I74C 5IGXL 1TZAA 4NO3A 5LN4A 5CD5D 2ARJB 3LQAH 5I23A 3GK8H 2F19H 4GW4B 4P59L 3B34A 4FTVD 1QSFA 7FABH 2P8MB 4PRHB 1B4RA 1CR9H 2V6HA 3BAKA 4O00A 3QFJB 5FO7B 12E8H 2YD4A 4WUUE 4DHLA 3GMOA 1M2VA 1SVCP 3FQUA 3PFQA 2Q86A 3BD5A 3T09A 5EWIH 3ZDYF 1G7LA 3KXFB 1Q1JL 3V5HB 2SODB 5IJVA 2OCCB 4I4WB 1UJ3C 4LCCA 3RTQD 1MCPH 4L1TA 3W11C 3SDDD 4KNTA 5EZOH 1QSFE 4Z7IA 2DQUH 3QR0A 2VDMB 5E0FA 3TURA 4CMHC 4P5RA 4X98A 5C0CE 3TO4B 2HWZL 1I85A 2WK2A 5B3NA 1PKQB 5AW0B 1S9WA 3ZDZB 5F7NC 3ULVC 2AK1L 1LMIA 2NY0C 4X8GA 4LT7A 5IB5A 1EDYA 4ENZA 3W81A 1WBXB 2GT9A 3DDGA 3VXRE 1X5HA 4M1GL 4XPAH 3WL9B 4XMKL 3PABA 1QLRB 5LHDA 3KPPA 5HP5A 1JGEA 2QFPA 3ML8A 3D3VE 5E6ID 3WIFA 3BCFA 1DUYB 3VG0L 2K9UA 1A64A 1OW0A 4TRPL 2BP0B 3VYOA 1MAMH 1ZT4A 4ZPVA 4HS8L 2QELA 4FI8A 3R18A 4OJEH 5B8CA 3JWDL 3L2NA 1V7NH 4YXHL 2CA4A 4BCZA 1F11A 4DOHE 1N70A 4MNHA 4JPKH 4K3JH 3D85D 4PJHF 4NRZA 1TJMA 4U3SB 3HVNA 4F5CA 4I8DA 1JHLH 3IAPA 4P2AA 3SQRA 2V9QA 4I88A 2YAEA 1KXHA 4I5BB 1NMBH 3QA3B 1CI3M 1ZK5A 3JVGA 1ZIBA 4RZCB 4R8WL 3X3FL 3M17B 1CFNB 1IKFH 1CFNA 3NABH 1GYVA 2BOLA 2G9HA 3FONB 4EZMA 5AZ2H 1EXHA 1MCOL 2WLIA 3MJ8A 1S5HB 5ADOL 3UJJL 3BE1L 1ZDQA 4IKKA 4NLHA 5KBMA 3H7BB 2ED7A 4N1CA 3A6BH 4JN2A 2CHZA 2DKUA 4ODWB 2P24A 2P26A 3PP3K 3K1KC 4N0UA 1IKFL 1AIFB 2X28A 2D9CA 3TVMB 1L9QA 1XCXA 4PJ5B 1KGWA 2GB2A 3KLLA 4LLDA 1FNEA 4XMVA 4EAEA 3BP7B 1GSMA 5KVEH 5CZKA 1UB5B 2R7EB 2DYPD 3BEVA 4PRPB 2B1AH 1E90A 3HG1E 1BDYA 1YJDL 3BO8B 1YUHA 4F33A 3LQMA 4B9KC 3DO4A 3SDDB 3C5SA 1I53A 1H3PH 4YHZH 2IAMA 5H37A 3VX0A 2FQEA 3VWKA 1HI6A 4P46C 4YEFA 1HS6A 4MS8D 3ELQA 1IGFL 2LLLA 3LIZA 2XSKA 1BQLL 1MW3A 3MRQB 4M62H 4ZFGL 2UYLA 4EN3A 3G6JB 3IEAA 5IVOA 4JANA 3FFDB 1CD9B 1YA5A 5I6XC 4YPJA 1KPVA 2GYSA 1S9WB 3VXSD 2ZAGA 1QPXA 3UZQB 1DFBL 1QZNA 1P6FA 1U8NB 2R51A 4KK5C 3WNJA 2V2XA 3TBTA 2QKIB 5H2BB 3H3KA 2DD8L 2QTVA 2XPGA 2OI9B 3V0VB 4N9OB 4XN7A 3C5JB 1INQB 3NTCH 5E6IB 2VZVA 3FB7B 2FYYA 2CO4A 4FFYA 5I19H 3IMTA 5I76B 1WVZA 2VXUL 2ZZUT 5FYKL 4F8QA 4WI0B 4ODXA 5GGRA 5DQDH 3VWJD 3E2HC 2VDPB 5DHYB 3TN0A 1KGYE 1F6FB 4ETQB 2WXFA 4JM2C 1OTSD 1T0NA 1DE4B 1UD5A 2Q3ZA 1HKLL 3L4VA 4K9EC 2UXGA 1N26A 3CGTA 1U95B 1E27A 3C6LD 1OP4A 4FZEH 4WGVB 3T0EA 4YDNA 2ZWKA 3DROB 1FH2A 3FUKA 3QFJE 4NZUL 2IDQA 1KJVB 3B2DC 5A3ID 4IGBB 3KG5A 1IJ9A 2QFRA 1WZAA 3AMLA 4UQAA 2V9RA 1DVFC 5EUKB 1EGJA 3UZEC 2WUBL 4HHGA 5M7QA 4NN6B 3HN3A 2CXGA 3MRFA 3KXFE 1A4AA 4Y16A 1J1PH 1E8XA 4XCCH 1MLBA 2YMXL 5DHVA 5AAMA 2V8LA 3A21A 2ICES 2NMSA 1BYOA 2ZUUA 1XF2B 3ARZA 3C5ZB 3LKRA 1NGQL 2X2YA 3ULVL 1AD0B 1W91A 1UM4H 3BPCB 2GTWA 3BXNB 3WHXA 1CL7H 3HHRB 3HJ0A 3QZMA 4IHOA 4OGAC 4W70A 4PRPD 4ZO6A 4A6YA 1TJHH 1NANI 3D8MA 5I5IA 3NZ8A 4C4BA 4HHAB 2RD0A 1PLAA 2WVVA 3QIUB 4W9DC 4MDIB 5AL0A 1GGYA 2BSRB 1YN7B 2RHEA 3V6OC 3UPRA 2YMOA 1EMTL 4ZQKB 5KYWB 1JWUB 1RUAL 1U2YA 2FSEB 2QMJA 4PRIA 4X9YA 1UWGH 5K33A 4LSSL 3IBOA 5T5FL 5AG8A 4H25B 4YE0A 3AT9A 3GEWB 3OXSA 3MX0B 4PYGA 2HUEA 5DS8B 2PWHA 5I1HH 4YBLC 5E5LA 4TSCL 5EPMB 3IVKA 4QRSA 2VITB 2ZUYA 3BGMB 2QSVA 2ZG2A 3EJQA 2CAKA 1HHKB 3QDJB 2K0RA 1EPFA 1OM9A 2ZCZA 4P3CH 4P9HL 3N0AA 5TQ0L 1RIHL 4G5AA 4X8XA 4N2CA 2AFNA 3D48R 3O9WD 5J56B 2NLJA 4YDVB 5FGRA 5HPMA 2NY1D 4CC0A 2BY0A 1ZRUA 3CLEL 2JWYA 1TYRA 3D1MC 4GEJA 4K3DL 3RBGA 4H0LC 4PP2A 2CCWA 4WSJA 1TQBC 3HE7B 3VGHA 3GSNH 3EGSB 1M7UA 4YFDB 1ZHLA 4HZLA 1JD9A 4OF0A 5GSRA 3S97C 3GI9H 3PWPD 1QWUA 2IXQB 1CG9B 3IE9A 5IW1B 3TBSA 1R17A 1WIPA 2QQLL 3EJJX 3TNMA 1E4XL 1Z6JT 2W9LA 4PS4H 1A9VA 3L5HA 5DQJB 4Z0BL 3V4UH 2FHCA 4MHHG 3BLKA 5FKPB 4AIOA 4LVNB 1NH6A 4V2CB 3GSQB 2V7HB 2ILLA 1PAZA 4Z7NB 4JG9A 1UGNA 2XZQL 1KIUA 3D50A 1KV3A 3AGWA 3RY4A 1NCWH 4EUPB 5MEOA 4HIHB 1N9PA 1BQSA 3NRFA 3V4UL 1Q38A 2HFEA 2FIKA 5EOQH 3QYNA 4LFHD 3FB6A 1A8ZA 4UDTB 3WIIH 2EYRB 4A6YL 5AW1B 3NFSH 1P5UA 3T1FB 2OSXA 2EE0A 4O58H 1P5VB 3T0DA 4R83A 2MNWA 2PETA 5F1KC 2ZKYA 3DSNA 2OQJB 5T1LB 4JFQB 2ZICA 3M8OL 3CSBA 1X5JA 4YHNA 3SEPA 1E40A 1T5WA 2DWDB 1FNSH 4KUZH 4ZPTB 3H53A 1WGOA 2H3XC 3MLSL 5AKRA 1CFQA 3FUDA 4PY8I 5I0YA 4F7EA 4U4BA 2ADJA 5HHMD 1OGTB 3V0DA 4PJGE 1XGQA 4YZWA 1VFUA 3KZ8A 5J13C 4OIAA 5GZOC 1P84K 2HLAB 4N2AA 2FJGB 1YG9A 1G7QB 4WWPA 5GS3A 5HYEA 4Z6AT 3DHMA 3QZPA 4YOKA 2IQAB 2B16A 1IEAB 4CSTA 3RWGB 2Y0SA 4UCFA 1TOXA 4TLUA 3OJVC 4RQQB 5D2NE 2CALA 5DD1H 4X6CB 2Z31C 4YLCA 3UJIL 3TJPA 1EFXA 3B5GA 5CJQH 4LESA 2J5LB 1LE5B 1CFVL 4AYBA 1MHHB 5FGBC 2EXTA 2YPLA 1UM6H 4L3AA 2JB6A 3UDWC 1ETZB 3V7AE 3MLTA 4JGNA 3L8QA 1SLVA 2EDBA 1BMGA 1K5NB 3F7LA 3KCWA 4LGRB 1P7KA 5C92A 2HVKB 3FQYA 1JGLL 4B95C 2VMCA 4ODSL 1BXVA 4D0CA 1DFBH 1WGVA 3P3TA 5K1VA 4XOBA 3HNVL 4ZDHA 4W68A 2CKBA 2WLHA 2VC2B 3B2UC 2L4OA 2HKFH 4DESA 4PJBB 4KTGA 3GIVA 1N5YH 3L9EA 2ICWA 1CLOH 1S7WA 5AVXB 4NP4L 5CUSL 3QEQD 5GRJL 4XHQA 4YDKL 2G75B 1CBVH 1B4JL 1M1XB 4GQQA 1JXJA 1YZZA 3ABKB 4OAWB 5GGUA 4KKBC 5CBAB 3QR1A 4FHKA 1U8IB 5HJ3B 4LSDA 3LHAA 4V1DE 3DX7A 2HFFB 2PO6C 1MW1A 1J5IA 4O2CA 1E5AA 4M62L 3VXTA 3CN1A 3JVFC 5DJ2B 5F1IB 4N85A 4OF5A 2OTWA 2DLIA 3CJJA 3KS0H 4HS6A 4Y0GA 4KZDH 1JI1A 5EIIB 4ZW7A 1DCLA 4BM7A 5F6IB 1BGXL 3MBEB 4A1RA 4IQHA 4B97A 1OK8A 1J5DA 3PUUA 3WLWC 1T1ZB 3BH8A 1AHMA 1IC4H 4UTBA 2D2OA 5CS7A 1ZEAH 3BPOC 4P2RD 3UGUA 4AJ0A 2J2ZB 3SD5A 1AR1B 3VTMA 3TPUA 4YR6A 5DR5L 3ETBF 4LRNL 5KBNC 1Y1UA 2VR9A 3A4FA 2LU4A 3T0ED 2ADGB 5FF6B 4NDMB 4JKWA 4WW2A 4UILH 4ADJA 2L0DA 3QUXA 5JZ7D 3KNBB 2WLJA 3WD5H 3PNRB 4B9GA 3QISA 5K9JH 1AJ7H 3L2LA 3BI9X 1X6LA 4YSEA 4L8CA 2X05A 1J88A 2EIZB 2HTLD 2OV0A 3S9DB 5KVFE 3QJFB 1AS7A 2HFFA 3SJVB 2X4PA 2HJLA 2WCPA 1W0WA 4DPRA 4EKJA 5EEYA 5AOLA 1JNHA 2ZUWA 3KLSA 3MO1B 2WZPD 4EBQL 5I1GL 4YDIL 2E4TA 4PGDA 3DURA 2VXTL 2Z8RA 3MTRA 2EVIA 4OZHA 2P45B 5ES4B 3RWFB 3BX7C 3TO4D 3ARBA 4IRJA 1NL0H 2JI3A 4WFGD 3U4EB 1E4XI 1FZMB 4A2GA 5JW4N 3H42H 2KH2B 4LCWD 3KR3L 4G80A 3I9PA 5CCGE 3EHBB 3JV4A 1DSWA 1PZ3A 5GHWL 5C86A 3MTXA 2IH1A 1X5GA 3DGCR 1R47A 1SMOA 1U8CB 2QDVA 1RUKL 4KJWD 4KNSA 3VWKD 2YKLL 4MGXA 3ARUA 4JPQA 1LO4L 2B5IB 2XV3A 5TE7H 5I1EH 1A66A 5IHZB 1UZGA 2UY7A 3P73A 2EEAA 3QEQB 1NFDF 5JOFA 1G7MA 4N2EA 4UDUA 5FA4A 3V4VL 2P46B 5BUPA 1KJ2L 5I8CA 1V54B 3QORB 3NMEA 3PWJB 4NT6A 5JDSA 5I18L 3CVHB 4L3EA 3RWCA 5D1ZA 3EH5B 5A1AA 3IGFA 4JNXA 1QWHA 3LNGA 4LDOB 4N20A 5C0GA 3PIQA 5BCAA 3CC1A 3GSRA 4PJGB 1FO0H 4AJYV 2IALA 4YEEA 1DQJA 2AJYL 2NNXA 3IRPX 1ZLUK 5JHDB 2B3RA 4BSVA 2G4EA 4DERA 5I0WA 2I27N 1KB9K 3HI1B 1WFIA 3VXQA 1CZ8H 1IFGA 4FKHA 5TDPA 2K6YA 4G9DA 1A3LH 3IFLH 5EUOE 2Y1VA 4KJYB 3HC3H 4NJ9L 4QYAA 1I1AB 2GJ6E 2OMZB 3QPQC 5JNYA 5B1AB 1R19A 4WUKH 4YWGL 1FFNB 3LRLA 2E7HA 2JXMB 3V4VA 5F1NB 4GSUA 1KCVL 3DX0A 5E2UH 5K69A 1BZ9A 1LE9B 3OKKA 2OQJA 3C09C 3OKMA 3LN5A 5B1JA 3V5DA 2WBJC 3NH7H 1RJCA 2N7SA 5J5EA 3SY6A 4IBUA 1MHPL 3PHOA 1SBBA 5HGHA 4BK8A 2I9TB 4PS7A 4ZTEA 2J1WA 3PQYE 1XDTT 1BAFL 2GJ6A 3ESNA 1U3ZA 5GJSH 5T1LD 4P57B 2CWRA 4UTBH 2DDQH 2IOMA 4LQFL 4XOEA 1KZQA 4DSYA 4NKQB 4XNMB 2FK9A 4PJ7E 3TESA 2ZX9A 1GW0A 2GITA 5B1CA 2ATAA 3WEBA 2K4WA 3EGDB 1BWMA 4E9QA 3MLSH 2HX8A 2W5PA 2Y3NA 3NSXA 1WT5A 4L4TB 1XF3A 3GLEA 2NR6A 2V7HA 3SE3A 4FD0A 4D94A 4IBWA 4MD5A 3ZVVA 5FB8A 4Y5VB 1THAA 2QBWA 1L6PA 3DPBB 3G5XA 2NX5E 3BFWA 1GS6X 4I3RH 5JHLH 1WTLA 5F8QC 3BH9A 3AG2B 3WDJA 4NENA 1CF8L 5ADPH 1AGBB 1PTZA 3GSOA 2YAOA 3IXAA 3WNOA 3NABL 2OMYB 3VFVB 1H15B 3TBSB 1MRDL 1ZGLB 3GB7B 3C8DA 3D18A 1EZVX 1SNRA 2CRZA 1MHEA 5GXBB 4FZEL 4PJ9C 5EH1A 5B38A 1D6VH 1ZA6A 3F05A 4S2SA 1XV8A 4D9QD 2XWBA 3N91A 5KANI 1MFDH 4WY7H 4ODHH 3VW3L 4OCNC 4XNQA 4MCMA 3ZDZF 2JK5B 4PP2B 1X7QB 1QUNB 5GRWA 1XF5A 3I6GA 4MXQD 1DJSA 4MB3A 5DTFB 4WHDA 2CBOA 2LU3A 4F2MB 4J3WA 4UOQA 3QUKB 4M5ZH 4FC3E 4BSJA 2IG2L 3ZIYA 2XG5B 4AG4H 1EGJL 1CXKA 2AITA 3MRIB 4NM8L 3DPBA 2AJZA 5EEVA 4UT6L 1A7NL 1TU2A 3IS1X 1I3GL 3O6FD 3PPEA 1KXQE 2Y06H 3S2CA 5B38G 3TNNB 1WITA 2V9TA 2YA1A 4NBXB 1JPSH 1I1AD 3KPLB 4LP4A 3K71B 3RGHA 1TQWA 4O02B 3D39A 3H9HA 3B7TA 1UVQA 4NUQA 5JQHC 3EXLA 1A6AB 4PHXA 3L3IA 3KPSD 3ZKMC 3FN9A 4FOMA 2H0PA 3NZ8B 1C5DB 3IDMB 1MCWM 3OSKA 4GFXA 5KSAC 5A6MA 3CNKA 3IDGA 2WYHA 3U2SA 4A38A 2Y2WA 3CHPA 3OKMB 1JXFA 5B7FA 3BPCA 5IR1A 5GGVY 4HKZA 4UTBL 4UNIA 4F7MB 2NTFA 3P4OA 1JP5A 1Q0EA 1YN6A 2EDEA 2J8UE 1MCRA 4HC1A 1FQ9C 5ESAA 3MC0A 1S7VB 2NXYD 3GXFA 4HSQA 2VRQA 4JDEA 4AQ8C 1SHXA 4U6XB 4LGPB 4GO6B 2A9BA 1RU9L 2VN7A 4OF6A 1CLCA 4WNSA 1ITBB 1YRKA 1RI8A 3RNQA 4JG0H 2GHZA 4KJYA 3QIUD 1F3JB 1PJWA 2O5YH 1YEWA 5JZ7C 5IHLB 3F2LA 1UASA 2FBJL 2VOTA 2WQXA 1BQHA 3WXVH 3BLBA 5BV7C 3B6SA 4X5RA 5C09D 3UTPE 4KKAC 4FQ2H 2IH9A 1PPIA 1E9PB 3P0VH 4NO5B 1E2VA 3G6DH 4FI6A 4WO0A 1MJ7L 2OK0H 1DP0A 4PJAF 4RX4A 4NNPH 4JR9L 5EB9A 1NANH 5ILTL 1NOFA 4FXTA 4GW1B 2K70A 1RD6A 5DVPA 1EUTA 3H2PA 3BZFB 4X4YB 1TT6A 1Z3RA 5LKNA 2EDJA 2ZAHA 3HG3A 4OJFH 5FOBB 2IAAC 4JFEA 1B2WL 1KTJA 3EJYC 5JDSB 4N2KA 2VLRA 5L6YH 4Z7AA 5GGSA 3ZZQA 5I8CB 2W8CA 4TF4A 1MFDL 3CTTA 3UO8B 2MQCA 3QFDA 2ORBH 5I75B 1TZIB 1WJ3A 5C0BE 2IDTA 4ZFGH 5F9WC 4OLYH 1LQSR 3ULVH 4ODXB 5GGRB 2UXVA 3N3EA 4H8WC 5AG9A 4PJFA 4U1IB 5DMKB 3QQXA 2AZAA 5DC0A 3U30C 5IREA 3EHBD 4LOUD 1A6WH 1ACYL 2HT3C 5B4MD 1F1AA 2YQ2A 2RAMA 5AVWB 5CZVH 4AYFB 3SOTA 1Q0YH 4WTXA 4U1KB 3UZQA 4NZTL 1XL4A 4ZI8A 2ID5A 2OR9H 3EZ8A 5F9JA 2D3VA 3B9EA 1FI8C 4H1LA 1CJYA 4OZFB 2K9FB 2ZT9C 1A9BB 2P8PA 4TQIA 5DI8B 1R9FA 4XC3L 4KK6C 2QVFB 3LPWA 4OI9A 2Y07H 3KYOB 3L3JB 3BVDB 5F1OB 3FQXB 1RULL 2KPNA 4J8QA 1TTBA 2X41A 1SJHB 1IBGH 4NUPA 2XQYG 2VZ3A 5SWZD 3HNTL 4P4KB 4M6OL 5DD0L 4X8JB 8CGTA 1YUHB 1D6VL 3CX5K 2R0WH 4OLWL 4J5VA 4NI3A 3BKJH 4JQIH 5ITFB 1UKTA 1G1CA 1UXWB 4FABL 1UT1A 2OJZL 4GY4A 4MSWA 2NTSP 1S78C 1FNEB 4AYEC 2R4RH 4N8CL 3DMMB 3PWVA 4Z3EA 3JWNC 5CJXC 3QEGL 3BVNA 4ODWA 4JRXD 5DT1L 1K5WA 5E2TH 4B7LA 4I0PD 5LXGL 5D7JD 4GG8A 3IJHA 4NQED 3O3EA 3C09B 4XMLL 1HZLA 2YD9A 2XN2A 4XAKE 4MQ7A 3T9WA 2Z92A 4HALA 3NIGB 4PRNA 1CICB 2PYEA 3ILEA 4WEUD 5C09B 4DGYL 5T5NG 5LUMA 1A65A 4I5BA 3MV8B 4GMSH 4U7SA 3REWB 3AY2A 3H2QA 5FX3A 4DP1X 2V0AA 5T1DH 3X1EA 1WWWX 2BSBA 3AVEA 3BKMH 4OCRH 3FRUA 3S34L 3BQUD 1TVBA 4KK5D 5CBAA 3U6RA 2P5EB 4MCNA 2GIMA 2A3TA 4PB9H 1XGRA 1OP5H 4AVIA 5DJAB 3RDTC 5BVPH 2O26U 3ESVF 3WFBL 1KEGL 4ZD3H 2JCWA 1IARB 4JFPA 1B3IA 2WUCH 5EBWA 1KIRA 2VE6B 1HHIB 3CHSA 1OGAE 3U30B 3LXUX 5FUZH 1UD6A 4U2ZA 1U0QA 2CKBB 3EOYG 2WXPA 4PB9L 1RJYB 3ZDYE 4R90L 3EJTA 1C7SA 1E65A 2XN9A 5E2UL 3T6XA 4NCC2 5ANME 1NPNA 3BFQG 5EZIH 3UC2A 1ILSA 3WFCH 4FFZL 5CO1A 3X1FA 4FG0A 1OCOB 3HPLB 1AO7B 1UXMA 2VXVH 2GT9B 4EDWH 3DYPA 3ARGB 4QOKD 1AKPA 5EF2A 5D7EA 4QRQA 1XB8A 4GKNA 3OKOB 4U1SA 4OCYH 5FYLD 2E76C 3A67H 2J25A 5IJDC 5CIPA 1BJ1J 2WQSA 1CZ8L 3UBXB 2E6JA 2MJWA 5IM7B 1AGFB 1XGPA 2XFXA 4XRCB 1GAFH 3X11B 2FBOJ 1EO8L 5F0PB 4X6CA 1CE6B 2B0SH 2F7QA 2O4EA 4QR7A 5TF1H 4HH9A 5CP7B 5B39A 5ITBL 2YEQA 1KGIA 4M61A 2O6DA 5SWZB 4MNGA 4WJG3 2IQAA 1T2QL 5LGKA 3LIZH 3N50A 3SDXA 2IVFC 2ZOLB 4H40A 1PX8A 2OFQA 3CWGA 3VH8B 5DD1L 5DFVC 1J10A 1UJ3A 2HJFB 1MIEH 3ZDWA 1QX1A 3ZO9A 1IGCL 3IDIB 4HV8A 5F88B 2X3CA 1NCJA 2WB7A 5FO7A 1A2YB 3BW9B 1INDH 1LEKA 5FHAL 3CFUA 1Z5HA 4PJ7F 3GDCA 1CU4L 1I1FB 1LEGB 4BZ1A 4TUJB 5A40E 1E6JL 1SJXA 1D2PA 5D7JA 3A47A 4U1MB 5HI3C 1BQHG 1D9KC 2FGWL 1DBJH 2VL4A 4UF7C 4FNSA 4PJ7A 4HUNB 1CBJA 3H7LA 5JR1L 4B60A 4G8GE 3QQNA 3OWRA 1DSYA 3NJHA 4H20H 4TSAH 5FYJL 2Q9OA 3OR7A 3SCMA 4AM0B 1DJGA 4YE4L 3INOA 4L4JA 1TQTA 1HIML 2DMBA 4DZ8A 2EYRA 3V95A 5IUCA 3SN6N 1B0GB 1KYUA 4WKZA 2J8UF 2LE9A 5CGTA 5EIIG 3TWCL 3N1QC 2XRAL 3Q5YA 3ZLQC 4G6AD 3BN9C 1P4UA 3H56A 1A7BA 2MTAA 2GY5A 1UKSA 4KXCA 4R26L 3GK8L 3LB6D 3PS6A 2I69A 5GGQH 4MJIA 4HJUA 4PH8A 1A22B 2CO7B 2VRAA 3MLYH 4YDZA 4N0FB 1RK0B 3IDXH 2IAND 2XTJD 4H88L 3T4YB 5KW9H 5GSVB 4Y5YC 2OK0L 2Y5TB 4HIJA 4X5WA 3ZT6A 1WEJL 3HC3L 4NJ9H 2IXQA 1BYNA 3BZEA 1WIUA 2X4OB 2XZCH 2YSSB 2NDFA 4PLJD 4B50A 4HZLB 4QXGL 5EHFA 2EIKB 1VGEH 2APWA 3A67L 3CDYA 4ZODA 3KPSA 1RQ5A 2NY4C 4MJIE 3FO9B 4E42A 2AJYH 3KGUA 3GMQB 3M46A 1XBDA 4H5SB 2A9DA 5B1JC 2X4NA 5ADPL 1KV7A 3S4SG 4X5QA 1GYWA 1T5KA 5CAYB 5HTSA 4QMEA 2OXHB 3EYFB 3EOTL 4L1DA 3O2VL 2Z0UA 4LPCA 4E9RA 4GKSB 3RBSA 3ULAB 4JZJA 3K6DA 4ATWA 4DNLA 1OGPA 4J6RH 3WFBH 4RX4D 1HWWA 1KEGH 3BIAX 3V5KB 4GEIA 3VXOA 3RYMA 4IIQB 2OCJA 2FX8H 4W81A 3L3DA 1IJNA 3DA0A 4OJYA 1RU9H 4S10A 3TIDA 1OWRM 1FE8L 4BK5A 4KI5F 4MDIA 3QIUA 3QDGB 5DLLA 1UCTA 1Z9SA 4JFYA 2FQDA 4R5TA 1BZEA 3IJEB 2R0ZL 1DHKA 4TSAL 1T04B 4TTDD 1ZE3H 1FIGH 3HRZA 4N0RA 4GXVL 4QCIB 4GRMB 1IM3A 5K39A 4L18A 5GS1B 1V05A 1ZHBA 1IIKA 1PVHA 5GRZA 5ENWB 2OMNA 3ROOA 3BKCL 3CVDA 2OYLA 4NWUH 2WOBA 1XF2A 1H5BB 4NOFA 1QBAA 2P48B 2X4RB 4HHWA 4OIFA 4XXDA 5DUBB 3VFRA 2AEPL 2OI9C 3P3RA 4JRXB 1MLBB 1GCYA 1E5CA 4YVUA 5M94B 3QDME 4ZAKD 2ZWNA 4JG1L 1AO7E 1PG7W 4LCUA 4LPWA 1R3HA 3S3BB 2GY7B 4HZ1A 3QC5X 4KUCD 2O6EA 3PF2A 3HAEG 3MSPA 4B3VA 5CEYB 5TDNA 2XKUA 1AAJA 1I7TB 2GTZB 3VW3H 4XN5A 5BV7B 2AK4D 3DROA 4G6JH 4RWYL 1TLMA 1AKJA 4GP4B 4ZX4A 1G6RB 2L7UA 2Y06L 3E2HB 4UZGA 3GEFA 1JV2B 1S7SA 3OJ2C 1RP9A 1SYSB 3NPZB 4KC3B 4U4IA 1A4KA 1DE4A 5AWNL 3HZKA 5LO7A 2VDMH 4AIZB 3BZ4B 3US1A 1BA9A 4HXAH 2BFVH 2BXZA 4AQAB 1NFAA 4NNYB 3HE6B 1ZLSL 3V6OE 4AYDC 3P9WB 1IM3B 2DMGA 4QHKJ 4IS6B 3MRRB 5CSZB 1OEZW 2FUTA 2RQEA 1BXAA 3F6JA 1D5IH 1Z9SB 4QO1B 4AEIL 1U3HB 5SX5H 1HXKA 3DVGB 2DI9A 1LMKA 4CSPA 1EMTH 1VENA 2V2XB 1XCTB 2CIIA 3TBTB 2J1XA 2CQVA 1XH2A 2Y7OA 4OSUL 5D1XE 4N5EC 2A74B 1Q4NX 4LQFH 3VXUB 4ECNA 2NY2C 2WP3T 2J6EA 4ZW5A 4XN8A 2AV7B 3QUHA 2UYLB 4PCYA 2YD1A 2AC0A 4WUKL 2YC1B 3MUGB 3BKML 3PP3H 4L3ED 4YWGH 3S34H 4YK4B 3C2SA 3U1QA 4JJ5A 4NX0A 4P2QB 5T3XL 5DXWA 1T6VN 4DP2X 2YRLA 4AVKA 1NOLA 5LGHL 1HL9A 1M7IA 4P4RA 2EDOA 1UQSB 4W9KC 3LKNA 2BIHA 3U0TB 4TNWK 4V33A 4ALAH 4P2OD 5ITBH 1TCRA 3PYCA 1B2YA 2XWTB 1ZSDB 2Z0BA 2B39A 3BEVB 1BPLB 4E42B 1G7JB 1M53A 5ICXB 1G6VK 5TTRA 2E6QA 1ZVSB 2Y7QA 3PJLA 4KPHH 2BVQA 3KM2A 1ET7A 4HQQL 1ZMYA 2ICEA 2GVYA 2J6EH 1J8HA 2WYTA 4FQIL 1AIFA 1RV6X 5GS0L 1WS8A 2VXVL 1OANA 4YXKL 3EXJA 1DN2A 2HT2D 3FHAA 3CFJA 2NSQA 3ARBD 4OQTL 2C3GA 2HLEB 3SO3B 3ARFA 1GPOL 3QQ9D 1RL1A 5E00A 2NY3D 3U0WH 4DO5A 1AQDA 2H9GB 2A9NL 1F58L 3FONA 4KO9A 4Z7OE 2AMUA 1GC1H 2FE0A 4MJIB 2BCMA 2F54A 2IWEA 1INEL 1EAQA 4R84A 2W0FB 3TO4C 4X7TA 4HIIB 3CU1A 2IBGA 3QJRB 1I9JH 3ISWA 2NZIA 3O2DH 1L7TL 5A2LH 4OM0H 1RPKA 4ZUTA 3D25B 1CD1B 1NL0L 4QTHA 3PHQA 3LZNA 2JELH 1EWHA 4MNHB 1FFPA 2YSTA 5D1ZD 5C0NC 4JFDE 3I2CH 1YPZB 5BV7H 1KT2B 4CKQA 1MAKA 4L5FE 4NZTH 3B2UD 5LLIC 5J7CC 4DVBA 1KCRH 2XZAL 5FHAH 1RUKH 4E5XA 1U42A 3CBRA 3UCRA 2A2QT 1AHWC 3AU0A 1YEIH 1NSNL 3B1UA 1CLYH 4P2RA 3ZOAA 2FX7L 2A74C 2YO3A 4NO0B 1WD8A 3ZE0B 5EU6E 4UU9B 4CNIA 4HEMA 3V0JA 1UEMA 3ZE1F 4AW7A 3BIBX 3P2DA 1U92B 3QDGE 3II3A 1UFUA 4E68A 4Y2DD 2NUTA 1BD2E 1HILA 4XN4A 5I1DA 3MODL 4M4RB 5GISL 2APTA 1B9ZA 3FFCD 4R7VA 4GUCA 1OAUH 4K23H 1ML0A 3G6JF 5TDOA 3IU3A 1JPGA 3ASWA 2WJ5A 4PWGA 3TO4A 3LRSA 3MRMA 4FNRA 2YGOA 4F57L 5E7BA 3VFWA 3I02A 3ARXA 4MD4A 2Y7SA 3REVA 4M61B 2X10A 4WFED 2JKRM 5DJ0B 5LAPA 4OZFG 3Q8EA 3RVXC 2Y24A 2BP8A 3ALWA 2EDKA 4H13C 4M6ML 5E8PA 5C0CB 3CFEB 2ADIA 3FQ1A 1QQDA 1AFVL 5IW3A 3EFFB 4AKQA 2XFGB 3IU3B 2Q86B 1XSJA 3ZDZE 1RJZB 3NGBB 5CD5C 1ZXQA 3FQUB 4NUGL 2C9RA 4QI3A 2R15A 2DD8H 4AYSA 4F8TA 3VXRB 2ZKWA 4HISA 3C9NB 1NBYB 3T08A 2VDPL 1DO6A 4AKPA 4YQXH 4OQTH 2WSKA 5H4ZA 2UUDK 2FYVA 2VM4A 4PUBH 1I8IA 4QHNA 4XCFH 3AXLB 4MWFB 1GVIA 1ZOXA 1KCLA 1PKOA 2WXRA 2BC4B 3LZFH 3OF6A 3AB0C 3UTZA 3AU1A 1SXZA 2NY2D 3CDGB 4PCSA 1QBML 3VGAC 5DO2D 1HJBC 1BFOA 4IRSA 1R0AL 4N8UA 2CIKA 2WW8A 3BUTA 3L3GA 1Y1DA 3ZT5A 1NFKA 5E4EC 1HQRA 3D25A 2GAZB 3BN3B 4MJ5B 3MLWL 5E2VL 4HDIA 4MZRA 3DX2A 1A4BA 5D1XB 4GT7A 3ILQC 4Y4HD 5BV7L 3OPZH 2QQNH 4LVNC 3KPQA 3S3CB 5B7EA 3VXUE 2F54B 1J5CA 3T8XB 3W9DB 3NZSA 2WJ7A 1I8LA 3IJYA 2KLSA 2XQYK 1XXDC 4D9QE 2BRRL 2RFXA 4M5YL 4ZUVA 4E41E 5KN5A 4X99B 4I18C 4ZFZA 2DAVA 1GGCL 1NWPA 4OF3A 3CFDA 1A4JB 1U3NA 2PO6B 4PV9B 4MJ2A 3VFPB 3KDMA 1ZLVH 5D72L 4JMXA 5AYQA 4DZBB 2NX5D 3CIQA 3IU4H 4PIRF 4Q9BA 5ISZB 5LQBH 5HGDA 2N7BA 3F6LA 3L54A 4UM9D 4XPTH 3ARPA 2BFVL 1ZSDA 2X9WA 2F58L 2R9HC 4APXB 2WAQA 2BRQA 4PREB 2VT0A 1CXFA 4G83A 4DJMA 2D73A 2R0LL 4CSSA 2JIXB 2Y25A 3AREC 4L29A 3WNPA 3ZHFA 2G5BA 4ENEC 3QXAB 1K4DA 2XXCB 1EFXD 2ENQA 1R24B 3WNLA 3BP5B 1X9UA 3BDYL 4QNPF 4WEBL 5JPMB 5E99H 5T1MA 5IEHB 4EJ1C 4KNQA 4XPHH 1GIGH 1ROCA 4ABWA 4QHMB 4MNQB 1IGTB 4Z7OB 1YEKL 3NP4A 3VRLF 5JW4Q 3DTXB 2AEWA 5BRZD 1NAKH 2OX5B 4FQXB 5A2JH 2DQHL 1T3FB 2R56L 4RMUA 2FH8A 2Z31B 2J12B 1CFBA 3EH3B 3O4OB 1XCTA 2H1PH 4R7DA 3UH8A 1CDUA 2H2SC 2X70A 4GRLB 2Z7ZA 4PY8J 3S36H 1GY1A 3K2UH 4BSWB 2X5PA 4U1LB 1A21A 3U36B 4MA8H 2P52A 1BVZA 5LBGA 3RWJA 4NIYE 4IRSC 1KJ3L 3HN8A 2BW5A 1XGTB 4KVNL 1FL5A 3EADA 3GZOA 1T5XB 1Z0MA 1WAEA 3KCPA 2W92A 3PPSA 3UTTE 1OOWA 1T21A 2NXZD 2XNAA 5EZJA 1W0YT 4NXSA 1QRNB 1MF2L 1WC7B 4Y5VC 5H35A 1OOAA 1KIQA 4JFFE 4QRFA 5MHSE 5F0MB 5FR3A 2DOCA 1MWOA 4AI7A 1GJWA 2R69L 1G6RA 2WO2B 4KY2A 4NN6C 4QRPD 3PFUA 4Z7UF 2AJSH 5I1IH 4FRWA 5EBLA 3LKSB 5A6LA 3EFOB 2VDML 3FOLB 4ELKA 1KACB 2VGLM 1GPOH 4EDXA 4YK4C 2Y6SC 4PRID 1BQHB 1OE2A 3G5VB 3AITA 3F04A 4EZLA 3IGLA 1Y18B 1ACXA 4KI1A 1IIIA 4PBWD 3VD9A 3RRQA 4AT6B 4GG6B 2WVTA 3GRWL 4G5ZH 4OD1H 1WCBB 3DUSA 1JHTA 4ZZFA 4LOUC 1PIFA 5F7EH 3Q8AA 4PJGF 5LWYH 4PS4L 5DK2B 2OP4L 2AABL 1S7TB 4TS6A 5AW3B 2DN7A 3B7RL 1QO3B 4M5SA 3IDGB 3U25A 5CWSB 4NB7A 2JKLA 4HYTB 5CGBA 3EYVA 1QAWA 1SY6A 4QCIA 4PJIA 3LS5L 5FIEA 3TBYA 3HRPA 1KPUB 1MQKH 3PJSA 4R9HA 4RMWA 5EDXA 2LLGA 5HHOA 2IBBA 1CT8B 1UWXH 3L3IB 4WSGA 1QVOA 3BAEH 3GSNB 3DXAA 1SYVB 4IEFB 4JY5H 4MRBA 5JORA 2BHUA 1NFDB 2WBJA 3TBVA 3L4XA 1G1OA 1JG9A 4X6EB 2GBVA 3GO1L 3UBGA 2H8PA 3ECBA 4JAMB 2L7EA 4IIQA 5FHBH 1IAII 2GI0A 5FDWB 5HDBE 5K5YA 1WBYB 1TQVA 7PAZA 4HS8H 1CGSL 1W0VB 5C1MB 3MCLL 4I0KA 1U21A 2QSQA 2D7TL 1AXTL 2FJHA 3C6LA 3QDJE 5CJQL 3B8YA 4U3HA 3AT0A 5CZRA 4BQ8A 1VKXB 2PXYA 1ADQA 2FJUB 3HPJA 3CMGA 4BQBA 1L5GB 2QMKA 1JK8A 3ET9F 4Y2OB 3WFDL 3ELAT 3HE6C 4HWUA 4RRPA 4JFOB 3II2A 3QHFL 1HESA 4IYKA 4XTRC 1CGXA 4D0BA 3RVTC 5IQ9B 1L9TA 3JTTA 1SQ2N 4XCEB 4AGNA 2HVJB 3LN4B 3L3OB 5G4MA 5CBEA 3WLBA 1MI5D 4XPTL 3ABZA 3N43F 5C71A 4OKDA 1T22B 4J3OD 4HJGA 4PR5A 3MV9B 1MHEB 3WUWB 4BE5A 5KJRH 5F7WC 4W93A 3QH3A 3VWJB 4LLVA 4UQDA 4FFTA 4MRCA 2KDYA 2Z4TA 5D96B 1ZY9A 3V0FA 2XTSA 5DD6A 3KH3A 3GRGA 2FO4B 5HYJE 4U1JA 1G9NC 2ZF9A 3GRBA 4HUKB 1NC4B 4Y5VA 1PNDA 3K8MA 1MNUL 4PGBA 1MJUH 4AV0A 1VAHA 2HP4A 3BPNB 4P23B 4DUVA 1YJDH 2E7BA 2OZNA 1J86A 3BEWA 4S1SL 2BP3A 4HWEL 4JO1H 4NERA 1A02N 3FO2A 2A99A 3GJEB 3V0IA 3JXAA 1I7RB 4LVHB 1UH3A 4Y9EA 5GGTA 4KZDL 1L7IH 2ENSA 2E8YA 3KVDD 5CF3A 3BRDA 3C60B 1I3RA 3EYOA 3QYCA 3LNFA 5F3FA 4JMNA 4J3OC 1KN2L 4P57A 3CC5A 4FA8A 4NUGH 1JWSA 1RFDH 2YD0A 3ZK0A 5HGGS 1UA6H 2C7FA 3ULSB 2A6KB 3O45A 4LHJB 4BFBD 1CXLA 4FE9A 4MNQE 1DVFB 1QFWM 1UD4A 5DEJA 4EDWL 4XC1H 1CBVL 2PLTA 4FMKA 2WV3A 4BFNA 1ED3A 3MR9B 1KB5L 4IIQC 3G5ZB 4XCFL 2EICA 1O9VA 4MAYB 3TEXA 1JGVH 2TRHA 3ZQ9A 3TH4T 1SN5A 5DSCA 2HKAA 3V52L 1MLCB 1LHZA 3HI6L 5F9OL 2B1OA 3M86A 4GSQA 2YPVL 5LCVL 6PCYA 3BSGA 3GTTA 4XMXA 3DJZA 4L9LA 2ZOLA 2MCPL 5IKCA 1JZ6A 1U8JA 3ZTJG 4PJHA 3FCTA 3D85A 5HJDA 1QRNE 2JCCA 1J8HD 4Y88A 4Z18A 4PTUA 4XT1C 5IJKC 1IGCH 5CP7A 5HYQB 3RFRA 1YSOA 2DJSA 5DYOB 2A6DB 1P4IL 3S98A 5DVNA 1WBZA 4JBSA 3TN0C 5IUSA 3K91A 3U1SL 3D9AH 1AGFA 1XGPB 5AW2B 4PGJA 4WWID 3DI3B 1AMYA 4XMUA 1DQLH 2YPLE 1WZMA 1HNGA 2YAQA 1AVAA 4ZO7A 5LJYH 5D5MA 1OT2A 4OZ4A 4Z5RB 2ENPA 5EULV 4YSCA 2F15A 5KS9A 2NPLX 4JHVA 1OD9A 1I3UA 3H0TB 3O6FC 1N2RA 2VQ1A 4LZKA 1FHGA 3V8CA 9CGTA 4D3CH 1RZKH 4KHTH 5E8DH 3U9PL 2BM3A 1WUZA 3ARBB 3OHXA 1V3JA 1PAMA 3SKOB 5EF0A 3RWFA 3CSPA 3FO1A 3PV7A 5IROA 3MCLH 4P48A 2VMDA 1FUNA 2WQWA 3EOAA 3VFUB 3L9YA 5I6XB 1HFUA 5D1QB 2ISDA 5K59E 3ZUCA 5KVDH 2H4EA 1U4FA 5SWSE 4UQ9A 4C4KO 3IAGC 4V1DB 3WD5L 3GGWB 1CFVH 3CFQA 4NAMA 4CN1A 2YLKA 3F12A 4L3CB 1KLUB 3QJFA 1IAIM 4Z7QB 3DK0A 3GHEL 3GFUA 3HN5A 4NKOA 3TC9A 2LT9A 3RAJH 1W8EA 1OAKH 4AY0A 4TQEH 2R69H 5CKGA 3W82A 2FZ3B 2XY2A 2LR4A 4ANVA 5IVXE 1D9KB 3M6DA 1H8SA 2EQDA 2H32B 4Z9KB 3RTQC 2XXFA 4K5PA 2CSPA 43CAA 4HUWB 3ZL4H 3GUFA 4L23A 3WJJA 4NDMA 2FX9H 3L81A 4O5LL 2ATKB 2FAUA 3H4HA 5DS2A 1CFTA 3RX5A 1Y0LA 2BVTA 3V0HA 1BVNT 4G8GD 3QIWA 5D4IA 3TV3H 3CSFA 3QCVL 4FP8L 3EG9A 4PS8A 5TJWK 3QUYC 3WFHB 5IT2H 1IZJA 4L9LC 4J27A 4TUOB 2DWEA 5FM5M 1RZPA 5C07D 4Z77B 1T1ZA 3BH8B 4KHXL 2EUXA 1GGBL 3CH1A 2FQGA 1LWJA 1VF5C 5L9DH 1JRHI 4YUEL 4QOKB 2UVEA 2N1TE 3KEHA 2ZX5A 1N6QH 3NSYA 3FSOA 5FAAA 1HH6B 3T0WA 3FTYA 1GGIH 3EKCA 3FSVA 5DWUL 4HUVB 1SJHA 4HOMA 2Q6WA 2IEPA 2G9KA 4A6YH 5I73C 4WAFA 3C2AH 3UYRL 2FQFA 3MV9A 4L0ZA 4OQ1A 1EXUA 1MWAH 4P2RE 3FT2A 5HYJB 5CBEB 3RTQA 2HVJA 2AZUA 5FO8A 1KJMA 4FQIH 4LK4A 2YBGA 3KWWA 1PKQE 4M1DH 12E8L 3PGDA 5LXVA 1U2CA 3TX4A 3WY1A 2GEQA 2FBJH 4KRMB 3WAJA 1T4KA 1WFJA 4XBEH 1QYGH 1AZUA 3N41B 2YAHA 3QC6X 1A1OB 4I85A 4BCXA 3DOSA 5DLMH 3P0VL 3L1FA 3MNDA 2Y07L 4LPYA 1KCUL 1MZYA 1RULH 1IAOB 3GMRB 3RIAK 3RZCB 1W0VA 2P28B 4GINA 4NO2B 4U6YA 3B2XA 4Q0XL 1ET5A 4EE2A 2E7LA 1DBBL 1TZIA 3CXHJ 1W8NA 5DDHA 1Y07A 1LE5A 4TVSa 1X5FA 2P9RA 4L0PB 4ZS6C 3TEYA 3TBVB 1P4BH 2LAGB 2VUKA 4CVXA 1NDMA 2MPAL 4AGQA 3HW7A 5IB4B 4GMTH 4X6FA 1L0YA 2AQTA 1NAMH 2XJLA 2QGBA 1ETB1 4MA1B 3T2QA 4QHUB 5AENA 4KY1L 2Q10A 3APMA 2ZX7A 1BVNP 1E9PA 4HAFA 2B1HH 2XQBH 2DQMA 1BZ7A 3FCSA 4WO4B 5IHWA 1T1WA 1F58H 1X4ZA 2ZUQB 3EH4B 3MVSA 3SZKC 1PW3A 5GZOA 4J3OH 1JGDB 2VRKA 5EUOB 3UO1H 5EF1A 3QQ4A 3K6SA 2BY3A 3C8KA 4ONOA 1OGTA 4ZFQA 3ZU8A 4C56D 3FKUS 1DL7L 3HC0B 3CZFA 4UV7L 1JZDC 4LSUH 4AGMA 2WAHA 2IBZX 3QG7H 1BG1A 1DANU 3QQDB 4E9WA 4J39A 5C0AD 3LSOB 3OJDA 4LL9A 4TLTA 1OCWH 3NCJL 3P4LA 1VEPA 5DZLA 2ZUVA 1IBFA 1OAXL 2J21A 3ECQA 4NKIH 5AW9B 3DSNB 2Z8SA 1LO2H 1NPUA 1JZEA 5DRZB 5C0BD 2F8IA 4K94C 2E9BA 3HNTH 1CPUA 3JV0A 5TQ2L 3O3AA 4QHUA 1J5OH 1C5DA 5I1CH 2L8AA 2W80C 3NCJH 4PJ5D 4PGEA 3DETC 3LCYA 2O1AA 4X6FB 3HG1B 5JW3L 1SBSH 3VI3E 4Z3GA 2XA3A 4CVXB 4OZIF 2JKTM 3DX1A 4IDJH 5F7AA 3RX9A 4NZFA 3SCMD 5E8NB 2DS4A 4XMWA 3TNNA 1VFBB 2PR9A 3ZE0F 4L4TE 4LLQB 3VXNB 4AQZA 5AZEL 3D69A 3CXDH 3SGJC 3QIBC 2OMUA 4MXVF 3F5WB 3H2WA 3OPZL 1FLRH 1T80A 1IAOA 1PLCA 2FVNA 3G6JE 4LRIA 4PJEF 5EU5B 5HDRA 5KTEL 4U1HA 1OKEA 4BSWA 1DDHB 3QBTB 3TNMB 4P5TC 4E36A 4FNLH 3VGAB 3QPKA 1FVEB 3GMNA 2VR6A 1OCRB 3DECA 2VB5A 3GMLA 4FQXD 4XODA 5CGYD 5IW1A 3ILPA 2BP5M 1ORSA 2EXWD 2YRZA 3RZCD 2V5MA 1QBMH 2WQ8A 1NEZG 5JXEC 4DWHA 1MCIA 3CVHL 3ZKND 3F7RA 2GK2A 1NC2A 1ZHLB 4MMXB 1II4E 1E9OB 5ACLA 5IMOB 4QHMA 5F97E 2EO7A 4M03A 5HYJA 3GSVA 2D3JA 3RGVC 4CMMB 3Q2WA 1CGYA 2W9EL 5HBBA 2DF3A 1KGJA 4KROD 1F4XL 5FUOL 2WTPA 2VR8A 3FW6A 4L8DA 1V7MH 4PREA 5EBGA 1GXEA 1U58B 3UTSA 1OT4A 1R3IH 3HE7C 4QOKA 1F90H 5C9KA 4XTRD 3OQ3B 2P1YA 1KCBA 3HS8A 2FEEI 1GGCH 3GM0A 3P9LA 3HMWL 2NQ3A 4LOVA 4JZJC 1XF3B 5FYKH 2L7QA 2Q6WB 4OCWH 1BLNA 1W8OA 4M7LL 4K3HA 3GZPA 4C56B 4GYBA 2P43B 1HIMH 2Z35A 1TTRA 3HKZA 1YMMD 3JQOB 4DKTA 4K0OA 5CJOL 3RKPA 1EFQA 2ATKA 1ONQB 1URLA 2RALA 1S3KH 4ZUWA 1A25A 3PCYA 1XH3B 4NNXA 3KHQA 4Z77A 3FQTA 5GZNA 4HCRA 3B2VH 4KDTA 2LVCA 4O2FA 1YJDC 3X13B 3W9DA 1QLFB 2BNRE 1DCEA 4IHOB 3GJFA 2X0VA 4ABVA 1FF5A 1SOKA 1A14H 4QXTB 1JGUH 5TH2B 3MUJA 2AJXL 3IGUA 3LKRB 5F1NA 4KKPA 5FYJD 2BWDA 4V1DA 5KS9F 5F7DB 5L7XH 5DHVB 5CLTA 3L3GB 2H1XA 4I0PC 2A6IB 2GJZB 4HLJA 1WRFA 3PDGA 4PV8B 2NYYD 1JJUA 3FO1B 1I8AA 2AXFB 4NC1E 3WEMA 3UTZB 1U8PA 1ID2A 3VXMD 4DAGL 3DXAE 1YEEL 4G9FD 4PVLA 4Z78B 3E3QC 4ABUA 1IAKB 1WA0X 3BD3A 1ZV5A 3QEHA 1I8IB 4QHNB 3MUY1 1F2XK 1XBRA 3QNYB 4W6WB 2WOYA 1BG9A 2WXJA 3KPMB 4M43L 1JV5A 1ZS2A 2NQDA 4N28A 5K93A 3DIFB 3W0WB 2WUCL 5F7MC 4EUPH 3BAIA 4KXDA 4XZUA 5A16B 3UTSD 1I82A 4MVBD 1OQXA 1NBVH 1MWAL 2EDDA 4LHUG 4YFEA 3RKDC 1WFTA 3MRGB 1AG6A 1Q1JH 5EWIL 2BY1A 2R0WL 2BVYA 2MPVA 3FB7A 3EDDA 3R06A 5J13B 3OM3B 3F6IA 4PTUB 5H37G 4G59C 5H2BA 3ZGHA 3VFWB 2X4SA 4KHXH 2FWOB 1GGBH 1AGEB 4BH7A 3D9AL 1FZMA 5DZOA 1PZ5A 2J1KA 3DVNA 5G55A 2E75C 3QO1A 1KPVB 2VN4A 4DGIH 4PMFA 2B0SL 2XWDA 1EO8H 2WLLB 1E5UI 3RY6A 3H8NA 4N8VB 3DURB 4QWWC 3NQIA 2OXGA 4UIMB 1DVSA 1R6VA 1Y6NR 3HHSA 3QEHB 1RP8A 4O51B 2LU7A 1OGSA 4MVBC 4Z78A 2MCPH 3FRPG 1AYRA 4Y9FA 5T3ZH 1E4KA 3VI3B 3G5ZA 5AW6B 3SJVA 2JE8A 2MSPA 3HC4L 3FMGH 3QCUH 3L17A 3US0A 3VXPA 3WFCL 4D9RD 3ZYJA 2EUZA 1HEZB 3NACH 4K8RC 1CFSA 3IFNL 5CEZD 1DVFA 1B6DA 2NY6C 4HT1H 2R7EA 5JIQA 4LEOB 3G08B 1YPZA 2NQCA 4PLOB 1A6WL 2SEBB 4UANA 1ND0A 5JMRA 4LLDB 2FGWH 4N87A 5KVDL 4JFHE 4HLEA 4PJ5A 3P3UA 2X4TB 4GUQA 2K8MA 1I7RA 1H0DB 1J9QA 5F6HI 4FULA 3H7BA 4FG4A 4O2FB 2FECL 5JXAL 2VUOA 3Q7JA 4P23A 1LO3L 5F71A 3NIGE 4D3CL 2H0JA 3DHUA 5L0QC 3JWOC 4OZFH 4KHTL 1WFUA 4QT5B 3RY6C 4ZUSA 1F00I 1E2WA 5IP4A 5EU3B 7PCYA 4WDIB 4JVPA 2DLHA 4P9HC 3GJEA 4HFUH 1BFVH 2A1WH 4F9PC 3E6HB 1EHAA 3C5XA 3R8QA 1TUPA 4ZFFB 4YPGB 1UWYA 4AK1A 4EI5D 2EE9A 1ZD6A 1I8KB 4FXKB 4ADGA 5EO9B 1NC4A 3OSVA 3PDDA 4HIQA 1J0KA 2ICEB 3BWUC 1IBZA 3HMXH 5DJYB 5A2BA 1G7IA 1WG3A 1F11B 4C55A 5A43C 2Y7QB 3JUZA 4ATTA 2OBGA 1MVYA 4RCAA 1GS8A 3MV7E 3NP3A 5FM5O 1DBML 2DW5A 2UZIL 3EHBC 3GIVB 1W72B 3QG7L 4ANXA 2B77A 5BMFH 3D39D 3K2KA 2UXFA 1NIBA 4U7KA 3WIFB 3RP1A 3G9VA 4QXGH 3TYFB 3SDXE 5ANMB 1OALA 4YHLL 1VDGA 3O6FA 1C9SA 2D7MA 5DC4B 2I9LB 5FUZL 1UXLA 4N2BA 4R2GD 3KLHC 4GRWB 1GC1C 2WN2A 3CFTA 2GI7A 3QHFH 3LS4L 4XPBL 5BO1L 3TP4A 5I71B 2YKKA 4YIQA 2NYYC 3GMLB 3PWUB 4Y2OA 2CO6A 4BUGA 2YQGA 1G7PB 1DDHA 2X6AA 2BSTA 3CVBA 2DLEA 2XYBA 3GPSA 4PJ8A 2B59B 4CU7A 2GPZA 4C83A 1KENL 3DC0A 1R5WA 4QTIH 2WXGA 4HKXA 2ZCHL 4H7VA 1O5PA 4X83A 3TBYB 4JAMA 3ERXA 2XZQH 4PG2A 5F7FA 2V5YA 2CK2A 2V5TA 4TUUA 4YAQA 5IB3A 2FJGA 1M2VB 2WXOA 3DXAB 1TQCC 1U41A 3RVVC 3GHPA 5BS0A 1I7ZA 3RL1A 1VIWA 4MASA 4PGEB 3TT3H 3UZEA 5ICYB 1N3NB 2X89D 3RZWA 1VHPA 4OF8A 4P23C 1ILUA 3MRHB 4QKTA 2QPFA 4JGUA 4DTGL 3T1WA 4GG6A 3EYVB 4FFYL 2NY4B 5CCJA 4GKLA 2ZPKL 4S1QH 3H6AA 3WE6A 1WP6A 4FNPA 1ZT7A 1S7TA 4EIGB 2VLMD 3QUYA 1JF1A 2R23A 5KW9L 1P5UC 1WWAX 1CU4H 4G8GB 3FU3A 4Q6KA 4LVOC 3SDYH 3MRLA 5HHPB 1IEHA 2YN3A 3QIWD 1FNSL 4KUZL 3GD1C 3VGDA 2VDQH 4XP9L 1IM9B 3FB6B 4F8NA 1EBPA 4Y4KD 3EJZC 4IRZH 2EH7L 1F6AA 1HHJB 3HS0A 4YUEH 1J05A 1IGML 4F3FA 2JB5L 4YHOH 3WFZA 2MPAH 3OB0H 2X53A 3FOLA 4ELKB 1QPPA 1P2CA 4YNYB 4GQ9H 2PCPB 1MFAH 2F5AL 5J06A 3S7GA 5EOCJ 3WFDH 3QHZH 2PTUA 2J72A 4BZ2A 2MWCA 1V10A 4YHOL 2Y1YA 5FM4A 1LLAA 2RJMA 4X6CF 1FAIH 2W81C 1MI5E 3ULUC 2X70B 1T21B 2QQKL 3O6LL 4U6HA 4JKNA 1S9YA 1IFHH 3X1NA 5F9AC 2WMPB 3V9CA 1MW0A 1NWOA 1T3FA 4HKJA 1EDQA 4G7YL 3O11B 4YE4H 3DNKA 4PG9A 1N8ZA 2CLZB 5L2KA 5E6ZA 3DO3A 4AUUA 4Q6IA 3UTQA 1C5BL 4PWHA 2ZKHL 3MNVA 3TYGH 2VXQL 4GKSA 2WQVA 3QB7C 4PIBA 4APQB 5CKAA 3EW3B 2LFGA 2WZ0A 2JQAA 1LO5B 3ISRA 3O4LA 3SY0B 4F5CE 3EYFA 2BS9A 3G04A 1JZ5A 4GO9A 4PVNA 3SBWC 1HXYA 4YMPA 2XVLA 2BDNL 4NQVA 1XVSA 4PY7B 3ZKXC 5IBLC 2BK8A 3GJFH 4M1CC 5HJGA 3QDHA 5DWUH 2JTYA 1I8MA 4XCYA 3VX1A 5ICZA 2Z1PA 1MFVA 2WKOF 3T8VA 5EBMB 4Q9QH 1NAML 4U1GC 5B3SB 5K1NA 1DQTA 2QGCA 2NOYA 3OXSB 1FNLA 4OTXL 4C57C 5I1EL 1S7UB 3SBQA 3BZEB 4KI5C 2H3NA 1RHFA 4APXA 2BIMA 1E5ZA 2PO6A 4F15B 1XF1A 5AVRB 2EVJA 3BUYB 2WKOA 2WNKA 4HGMA 4WVRA 3VU2A 2K3HA 4FZ8H 4XOCA 5MEPA 1JI2A 3ZT7A 4OFQA 3G5YB 3K72A 1DLFL 3BJLA 4CC4A 3NEXA 4R3SB 3ZE2E 3IXTB 1IB5A 4LLMB 2GTWB 3BXNA 3OGOE 1OP5K 2H5UA 4IOSD 3O6ML 2K8QA 5IBTL 1MF2H 3PGFL 3B5HA 3O2VH 4N3UA 5DC2A 3U6XS 2VZTA 4LE8A 5EFIA 4Y4KB 4DUWA 3Q6GH 4JRXE 2RFXB 2F1BA 4EIZC 2PW1A 3UEZA 2HXAA 3QXDB 1LD9B 4RAUA 2V37A 3QUXD 2CBQA 5KANG 3TV3L 5IB2B 4IRSB 3EOBA 4MZ2A 4N2FA 4NQSB 3CDGA 1R3KB 4RFNC 5D7IB 4DVRH 1JFQH 4NKOB 1XFPA 5FWQA 3QULB 5FYKE 1WA1X 1EJ6A 1QABA 2YMXH 3AXLA 4MWFA 5AFAA 3MRDA 1JD7A 4L1SA 1Z9PA 2HX7A 3ENEA 2ED9A 5HVFB 4FKEA 4X50A 1MHPH 3VRJA 4C58B 2CO2A 4NZDA 1NGQH 1L9RA 5JO5B 1DQQA 1VZGA 2R69A 3LH2L 2AS5M 1CICD 2XKNA 1EEZB 4B0MB 3VXME 1T0NB 2HKHL 1JERA 5F88A 4Y5XB 3OX8A 3VWKC 2VLJE 4WEBH 2UV3A 3CUPA 1RJZA 4KJQC 4KTDH 3TV8A 2OMVB 1K8IA 1MCWW 4OH2A 4WI0A 4XP1H 4DPAX 2EIJB 4Y9BA 4OZ4B 1XGUA 5KWYC 2FYYB 5TE7L 4HUCA 1NQBA 4Z7WA 5D71L 4Q97A 5IHBA 3TZVD 1SUJA 2QKIA 2R1XA 1OQOA 2D9QB 2P49B 2XIDA 4PTTA 4R96B 4QIRA 4HJJH 1XT5A 2YMTA 4GSDH 2BNQD 3OMIB 4NQCA 4NQCB 4UI2A 1LXMA 2WVSA 1Z3GH 4XVJL 4QRBA 4OLZH 1CGVA 1FO0B 2B3IA 5I1DB 5D72H 2J5WA 4P0DA 3L1EA 4RGMC 3RI5F 4DFHA 2JCCB 5D7JC 4DAGH 3FQRA 1GCFA 5DK0A 3WI9A 4HJJL 3MRMB 4HCRL 4P2YA 3CQQA 3WOVA 1BEXA 4TTDC 5IBUG 1MCDA 4IDLA 4ELDA 4HJTA 4PJEA 5AVVB 5I9QC 3AACA 4OR1A 4NKMA 4AEHH 2YD8A 4OY9A 2EADA 1N5YL 4I3GA 3SE4C 3HZYB 4UBDD 3V6ZB 2WBJD 1XXFC 5DJAA 3C8HA 1K9TA 1D2OA 2VISA 4HK0B 4HCFA 5GISH 1SLWA 4BYHA 3DXAD 4N5ED 4B53A 3IJSA 5KYNA 1AY1L 4OJAA 4YLBA 3NCXA 5AB9A 3FU7B 1TVBB 3QXWA 3X1GA 4N0UB 2XZAH 3QPQD 4S0SD 2CGRL 4K7PX 1KBBA 1H19A 1PX3A 4WK2B 3LZFL 1ECYA 1AGDA 3U83A 3O45B 3V2AR 4NIKB 3GXTA 1NSNH 3PG2A 4MAYD 3AS2A 4UQ3B 3FJTA 5IG7B 5CEXA 2Q3XA 3DX9B 3M17A 4MQ7B 1AQDB 3F00A 9PCYA 2QADD 3EJZD 5DD5L 5LG1A 5DJZA 3GI9L 4ZQTA 5DZVA 3U7WH 1RZ8B 2V5RA 1N18A 3CFJB 1GZHA 5E24E 1NCDH 2O72A 1GR7A 1VA9A 4R3SA 3VFNB 3U6XA 1E4WL 5I1AA 3O41B 2BHYA 1QKZH 3GHBL 2FUQA 3EBHA 1FYTA 1U8MA 1S5IH 3EH1A 3JYBA 4TUKL 4JFEE 2X2JA 3NYKA 1O75A 5BZWA 2VABB 3SBPA 4X9FA 3FS9A 1UXWA 1N6VA 1XTLA 5GS0H 3T6WA 1C5CL 1KXVA 5AOIA 3LMJL 4LSQH 2OW7A 4AV4A 3F7PC 4LP8A 4JREC 4M8QA 3GMMA 1L3WA 4XH2A 2MFNA 3PWLB 5CNHA 1NBVL 5AAWC 1NTDA 5DA0B 5ABAA 1MRCL 5LNDA 3L3JA 3BD4A 1A6UL 1U8HA 3PABB 5KSAA 4XCEA 5DFVD 1C16B 1QFOA 3MLWH 5AALA 4X5XA 4AQ1B 4FQPA 2XWTA 2F61A 3QUXC 4IOIA 3OC5A 3IDYB 1YCSA 3UERA 1NMAH 2W07B 3FHQA 1BXUA 2XTJB 1DBAH 2MOQA 3VXUA 4KJPD 2HRPH 3ZE2B 3BFOA 3B1TA 3RVWD 4MJ6B 4YDJA 1VFAA 3FQWA 2Z7WA 3PY9A 4TLKA 3C6LB 4Z3TA 3M88A 4QWWD 3DVGA 1YYLH 3D4CA 1AE6L 5DMKA 1KYAA 2DMCA 5I2IB 3CCHA 4M7KH 4UT9H 3V5HA 5CD3A 4U05A 3ABGA 4R2GC 5D7IE 4AMKH 2I7SA 1FP5A 2CM6A 4C47A 1F90L 1N64L 5KSAD 4CBZA 3OPUA 3O9WA 2WBKA 3D07A 4HJ1A 4R97C 3QNZA 4ZW8A 5JDJA 3VG9C 1SOQA 1IGJB 4KI5E 5GS1C 2R0KL 1XSOA 2J8OA 4LKCA 3MRRA 4KXAA 3C5ZD 3MLRL 3WU1A 3KWTA 4DP0X 4XAKD 3AXIA 4XC3H 3HI5L 1P2CB 1NMCC 2TSAA 5IFHL 1Z66A 5AWNH 5CEYA 5TDNB 2R8SH 1HL4A 1A4KB 1XIWA 4FZ8L 2Z4QA 3BQUC 1QZ1A 5LBVA 4M29A 2Z1KA 3A22A 2WNGA 5A2FA 2