2H0JA

Crystal structure of pucm in the presence of 5,6-diaminouracil
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
114
structure length
112
Chain Sequence
MGKLTTHILDLTCGKPAANVKIGLKRLGESIMKEVYTNNDGRVDVPLLAGEELMSGEYVMEFHAGDYFASKNAADQPFLTIVTVRFQLADPDAHYHIPLLLSPFGYQVYRGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transthyretin-like protein pucM
publication title Structural and functional analysis of PucM, a hydrolase in the ureide pathway and a member of the transthyretin-related protein family.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 22
structure length 112
sequence length 114
chains with identical sequence B
ec nomenclature ec 3.5.2.17: Hydroxyisourate hydrolase.
pdb deposition date 2006-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 2h0jA00
4QRFA 2TRYA 4PM1A 1SN0A 1G1OA 1BZ8A 4IKLA 3CFNA 4IKKA 4ABWA 4TM9A 4N86A 5AKVA 3BSZA 4HJTA 3DK0A 3W3BA 4DESA 4MASA 2B77A 3TFBA 5L4IA 3KGSA 3NESA 3IMWA 4IK7A 5AL8A 3D2TA 4PWIA 4ANKA 1SN5A 1SOQA 1KGIA 4ABQA 2G2PA 5CN3A 4PWJA 2G3ZA 1DVZA 4PMFA 5AYTA 4DERA 1DVSA 3IWVA 3CN1A 5K1JA 1F41A 4KY2A 4DEWA 3IPEA 3ESNA 4PVMA 4TKWA 4Q14A 3TCTA 4WNJA 1BMZA 3DK2A 5BOJA 5L4JA 5FW7A 2F8IA 5TTRA 2QGDA 3DGDA 3B56A 5EN3A 1ZD6A 1DVQA 1KGJA 1ZCRA 4TQIA 4TQPA 5EZPA 3NEOA 3CN4A 3GPSA 3P3TA 4TNEA 5AKSA 4WNSA 3IMUA 3BT0A 5JIQA 3IPBA 4IKJA 1SN2A 5FW8A 1SOKA 4TL5A 4HJUA 1TTCA 2B9AA 1THAA 4HISA 2ROYA 4HIQA 2H0EA 5FW6A 2QGEA 3IMVA 3I9PA 3CXFA 3ESOA 4D7BA 5CM1A 1IIKA 1X7SA 2NOYA 4TLKA 1E3FA 1BM7A 3A4EA 1OO2A 1F86A 3P3UA 1TFPA 5CLXA 1TTAA 4TNFA 5JIDA 2H0JA 4DETA 3IMSA 4Y9EA 3FCBA 4HJSA 3NG5A 3P3SA 5DEJA 2H4EA 3IMRA 4N87A 1TLMA 3GS4A 4ABVA 1BZDA 1TTRA 1TT6A 1DVUA 2GPZA 2WQAA 2IGLA 4PWEA 4Y9BA 3U2JA 5K1NA 5L4MA 3NEXA 3HJ0A 4N85A 4TLSA 3U2IA 3M1OA 3GS7A 5AL0A 3QVAA 5DWPA 3GLZA 1IJNA 3DJZA 4AC4A 3KGUA 3OZKA 3DIDA 3DJSA 4QYAA 1ICTA 2ROXA 3DJRA 5IHHA 2B15A 1QWHA 3CN0A 3I9AA 4MRBA 4DEUA 5HJGA 5JIMA 3FC8A 2GABA 2PABA 2G4EA 1DVXA 3CBRA 1IIIA 3GRGA 4PMEA 4WO0A 5E4AA 1RLBA 2H0FA 1FH2A 1FHNA 2F7IA 1TSHA 3GRBA 4TLUA 5CNHA 4L1SA 4TLTA 1U21A 5A6IA 3A4FA 1E4HA 1GKOA 5CLYA 3CFTA 4IIZA 2B14A 2H1XA 2QELA 4AC2A 1ETB1 5L4FA 4FI7A 1DVYA 4TNGA 5CR1A 3P3RA 4MRCA 5AKTA 4Y9CA 3SSGA 4PWGA 5E23A 3KGTA 4I85A 2G2NA 4PWFA 1GKEA 2QGBA 4TQ8A 4ABUA 2G9KA 2QPFA 4IK6A 4FI8A 4QXVA 4PWHA 1X7TA 5CLZA 3CFQA 2QGCA 3DO4A 3Q1EA 1TTBA 5E4OA 4PVLA 5FO2A 3IWUA 4ACTA 3CN3A 1QABA 3CN2A 4PWKA 2G4GA 3OZLA 2B16A 4TL4A 2G5UA 1TZ8A 3A4DA 3DJTA 4L1TA 3D7PA 1TYRA 4IKIA 4TQHA 4YDNA 1E5AA 1Y1DA 4YDMA 4I89A 1BZEA 1Z7JA 4PVNA 3GS0A 2TRHA 4Y9FA 2FBRA 1THCA 1IE4A 3CFMA 2H6UA 1ETA1 3I9IA 2FLMA 2G3XA 3NEEA 4FI6A 3IMTA 4I87A 1DVTA 4Y9GA 3ESPA
chains in the Genus database with same CATH superfamily
4TN9A 2I24N 3D8MA 3IAGC 3LEXA 3T6VA 4UUJB 5CWSA 4MJ2A 3WUZA 5FFGA 2YARA 5I1KH 3KM1A 1DLHA 4YN3A 3UC2A 4APXB 3JTSA 4K73A 5DO2D 4PR5A 3QXWA 3WEAA 3L81A 2NT0A 1BFTA 2CJSA 4TS6A 4GW1A 1QKZL 1OP3H 3CBKB 3EOAB 5HY9A 4R7DA 2KUTA 1MVUA 4NCDA 1H15A 3UTTE 1T80A 3IBOA 4N8UA 4ZS6C 3DO7A 4PCTA 4PB0L 1OB1A 1P0SE 3NQIA 3WLWD 4QRPE 4M1DH 1Z2KA 4HJUA 3D4ZA 4RGMC 4LKXA 1J86A 2AZAA 2VDNL 5L2KD 1TEFA 4PPTA 5FW6A 1EO7A 4DVBB 5F9OH 2DYSB 4TUUA 4JLRB 1DBKH 5TF0A 3CFDB 4Q8BA 1GHFH 5ICZA 5DUBB 1YY9D 3E8UL 4P59H 3AG4B 3NJIA 2Y07H 2F7RA 2RR3A 2KLSA 3O6ML 8PAZA 1QPKA 3FJTA 1B4JL 3B7SA 3GJEB 3NIDB 2ZOOA 4GG8A 4JAMA 4LVHB 4YDZA 3RTQA 1RAMA 2XKUA 2XZAH 1NH6A 2ZCKH 3VXNA 4RZCA 3C09C 4EZMA 4KC3B 3RWEB 3GKWH 2L7UA 3P4LA 2WSPA 4K5NA 2X38A 3EFOB 3BUPA 2R0WL 3KPPA 4JJ5B 1S7TB 1T1ZB 1P5UB 4Z0BL 4AXWB 4PJDE 4D9RD 2F53D 5IHZB 2YZ1A 4PJ9C 2BVOA 2JQMA 5KVFE 3U46A 3GI8L 1JF5A 4BA0A 3KJ6H 1H3XA 2X2HA 2OX5A 1WBZA 1A4KB 2ZXAA 3MFGB 3PCYA 5E00A 3TN0B 1RUAH 4TF4A 4OFPA 4YWGH 4H88L 3VGFA 3T65A 3B8SA 1KYOK 1MDAA 2VCOA 5EV7A 3MJ7B 3QGVA 4IBQA 5DD3H 4P46A 4FTVD 1AD9B 3OKKB 3KPSA 5F88B 5BZDA 4AQEA 2JVUA 1XTMA 4YSTA 5I8EA 1KGYE 2X4RA 1AGCA 1MCBA 1BECA 4NPYB 4PJ6A 3PXHA 3DECA 3T2OA 3R8BB 3UZEA 4BFKA 4E41A 4AW4A 1Z32X 4HIJB 4ISVA 4W9DC 4R26L 2VQTA 3MPCA 3SKUD 2GK0A 3CFQA 3D85D 2JF1A 5I0YA 4G6MH 4HGWB 4Q97A 1OGAE 1E50A 3RURA 2LT9A 2ODHA 3PDDA 5DK0A 2VZVA 3RNKB 4YDJB 2F58H 1GC1C 5T3ZH 2P52A 2D8KA 3FU9A 3BIKA 4GRLC 4NC2B 4DZ8B 1ZHNB 4XMLH 4GRWE 1NCHA 3IDYC 4JFHE 1CD1B 3ABMB 3CDZA 1SDYA 1USZA 1XGPA 4OM0H 1T04A 2AJ3A 3QIUB 4JPIB 1WSST 4WUUB 3RWDA 1M2OA 1OCZB 3IFPA 1PEWA 1QLFB 2L8AA 4ZTOH 2BZ7A 2OSLB 3ZGHA 4FF9A 2ARWA 4UNUA 3TIDB 4EEEA 1JPFB 4DP9X 4RZKA 5LNEA 1A7RH 5E8OB 1EHLL 3M7FB 2RH0A 4NZUH 1U8KA 3H9YA 3V7MA 4G9FE 1G7LB 3IJSA 3BAWA 4Z7IA 3ILPB 1N2RA 2QFRA 3C5JB 5CBAA 4UT9H 2AQPA 4WW2F 4YIQB 4K23H 1I1YA 3S34L 4IHBA 1HKLL 3QIBB 3RY6C 3KYNB 4UTAL 2VQUA 4K8RH 1XZ0B 3CN4A 2F1BA 4IEFA 1NKGA 4EN3A 2JK5B 4GUCA 4H8UA 3IXTB 4Z3TA 1QYGH 5F96H 3VMNA 3K71A 3FN9A 1OAUL 3ARBD 2WB7A 3PAZA 4NS0A 3O2VL 5DJYA 5F0MB 2C7UB 2NR6D 4R96B 5DR5L 5A2LH 5T3XD 4LLVA 5E6SB 3SKNA 3NT0A 1PF3A 3TJHC 2B9BA 1MRCL 1AGDB 5I6LA 2ZOLB 2EDBA 4JRFA 1UB6A 3PUUA 4NO3B 4L0PB 1OVZA 5ISZA 3BD3A 5DD1H 4ZMQA 4FGMA 4UINL 2BC4B 4DF9A 4U4IA 1FWXA 5DZPA 5TE4H 1U8NB 4YEEA 2PETA 3REWA 3O3BB 2FDBP 4OV5B 2PTVA 4CSTA 4JFDD 4YQXL 3FUJA 3O3DB 3A24A 1QPXA 2FECI 2OXGA 2R29A 1OT4A 3SE6A 4BFIA 4Y0GA 5DF0A 3KWVA 4POZC 2BHUA 2OSXA 4P06A 1I3GH 1MJUL 4N0CC 5I18H 1D6EB 5B3JF 2HX8A 5D1QA 2BNRE 4HV8A 1WICA 5E8NB 3DOSA 4GQQA 3UO8B 3ZKMD 5JW5B 5KVGE 4JK0D 1W0WA 1ESOA 1NJ9A 3VXOA 2VLKE 1BQUA 3FKUS 4YL9A 4CL7A 1IAKA 4Y5YC 1KJMA 2ENJA 2EYRA 1AZNA 2J72A 5JW3H 3SE3A 4AI7A 1SJHB 1QATA 4M1GL 1DQQA 1MN4A 2GJZB 4MDJB 5TQ0H 4MXWH 2A9AA 5F9JA 3GO1H 2H3XC 3RILA 1YDPB 3N1MC 3MA9L 2YBGA 4B9ZA 4CU6A 5E6IA 3ARGA 2F68X 5E5UB 3PWPD 3QEUB 1YN7B 3TIEB 2H47C 4XMKH 4LCUB 5FYJE 1NLDH 2AMGA 1PMYA 2TRHA 3N0PB 4KOBA 3D07A 4MCZB 3ULAB 3RU8L 3BPLB 1NBVL 4G1MA 5D1ZD 2O30A 3NGBB 5ALCL 1CL7I 1IGFL 4N1CA 3MRMA 2AK4E 4I0PD 1YPZA 2HSIA 3IKKA 4ZXBA 1DBBH 1AIFA 3TFBA 4TTDD 4KVNL 5I1IL 1O5DT 1JN6A 1MCDA 3AWEA 3HUJA 4JRLA 3BP7A 1J8HE 4UBDD 4WFGE 4PS4L 4LPXA 5I6XC 5GHWH 5DYOB 1EGJA 1O0VA 1KLUB 2WUCL 5T1MA 2R39A 3HEIB 5D7EA 2XKNB 1MWOA 4LOUD 4LMQI 1HJCA 1S7WA 5K69A 4U1GC 3VH8B 5K59E 1LDSA 1A0QH 4PJXA 5BZWA 3IPBA 3VQLA 1X5IA 1VKXA 3NH7L 2Z31B 4XC1H 3AQZA 5F8QC 1MKFA 1NCAH 2ZCZA 2NZIA 2P5PA 3RAJH 3WS3A 1XGQA 5CM1A 4ZFFA 2IADA 1MHPL 4YOKA 1CF8H 3N1PC 1OO2A 1EUUA 1UXSB 1FAKT 3D34A 2Y06L 2B4CL 5GRJH 1DQMH 2QTEA 4GI6A 1A7OL 3G5XB 5EEXA 3UBXG 2AZUA 2IALA 2BVPA 4ABVA 1H6TA 2MHAB 4HJIA 2ZIDA 2A38A 1UT2A 4PRPA 2HFTA 5B3JE 5L4MA 7FABH 3AREA 3MNVA 1NCDL 3TURA 2Y2YA 5AAWA 3W9DB 4KZDL 3K1KC 2NNCA 5FC9A 4DN3H 5E9AA 3MYJB 4BXSV 1ZHBB 3KZ8A 4OLZL 4YHZH 2B15A 2BIMA 2FR4A 1OCOB 3P69A 2GT9B 3IAQA 3LPFA 4RNRB 5DMKA 1QRND 3ZQXA 1PX4A 2YXFA 4KROB 4JFFE 4ELKA 1R4XA 5I1EH 4WEBH 4AENB 1PBYA 2ADJB 3BT2L 2Y69B 1LEKA 2K3HA 4JFQB 3OKOA 1OF0A 1GY1A 3T2NH 5E6RB 4JFPA 1FO0H 3V7AE 3VD3A 2FD6H 4R4BA 2PNDA 2CBPA 3S88L 5GRUH 4MZIA 3FO9B 3D25A 3L5IA 3SSGA 2I85A 5EUOA 4FFYL 4AQ1B 2CUMA 1F6FB 4KJQC 2YS4A 3MLYL 4TPRL 2ZPKH 2J12B 4DP6X 3OJDA 4I4WA 1TYRA 4IU3A 2VZ1A 4AWJC 5EU4A 2K8QA 3ABGA 1AQDB 2SEBA 5T5FH 3HG3A 3UBXB 3MTRA 2IPKA 2NLJA 3PHOA 4WWPA 1MLCA 2P5EB 4JUSA 4MJ6B 4PTTA 4W6WB 5FKAA 3I9IA 5ID0A 4YXKH 1JHKL 1I8AA 3F7LA 4N0FA 5MEQA 2J3SA 3AXLB 3QCVL 4AOFA 3CXHK 4GXFA 2CG9X 2LU5A 3QJVB 4IOFC 5F7DA 5EZOL 5AEAA 3VI3B 2X42A 4AGNA 4FAAB 2YUXA 4JVPA 3IMWA 3Q8CA 3SE9L 1YEIL 5FOBA 3REVA 2FHCA 2NYZA 2VIRA 5CJQL 3SKOA 5CF3A 4ODSL 3OPZH 4WDIB 4DERA 3FQTB 1GOFA 1F4AA 4RFNC 3CFCH 5FYLD 2R8SH 1WA2X 4TNWK 5JHDE 1R5WB 2R1WB 2GIXA 3HI1A 5L4JA 4TULL 1I85A 3BKJL 2X41A 2F5AH 4HSAC 4RX4D 2AEWA 4OUUB 2R2BB 1E8XA 4K3EH 3MO1B 3L48A 5ICYA 3DGGB 2XZCL 5KS9E 3RL1B 1YMMB 2ATKA 4HS8L 3QZWA 3VWKC 1C5DB 3LB6D 4MKTA 1EHXA 5C09A 4Y1TA 1XB3A 3NCYS 4JO4H 5IHWA 5E1GA 3UIYA 2H0JA 5GRZA 3SE4A 2ZOTA 5I8CB 2IMNA 3DMMB 1RHFA 5LCVA 3M17A 1C5CL 1J0YA 4WKZA 1N6UA 4AEFA 2WPGA 3QO1A 1RU9H 4EI0A 2V6HA 3U0WL 1MWAL 3LKOA 3VFTB 3VFGL 3MCKA 5GSVA 4K94H 2BIQA 4X7EC 1TJHL 4HQQL 4HVBA 3Q1SH 2ARJQ 1VFBA 4YSDA 1HYSD 3ZE0B 1BJMA 5G55A 1CD8A 4NO0A 3OHMB 4D9QD 1VGKB 4XNXH 5B38A 1Q0XL 3A4FA 4J3BA 4LVEA 3WHE0 4YX2H 3IFLH 4IU2B 5IQNA 2OYKA 5I1AB 3ARUA 3GINA 2Z65C 3LZOA 5HI5C 4RFEA 2BIHA 1FVCB 4N8VA 1JHTA 3DROA 4XE5B 3L3GB 3V55A 1BJ8A 3D6GA 2Y7MA 2JQZA 3SDCD 2FYYB 5J8OA 1ZSHA 4XO4A 3DNKA 1J7VR 4YDNA 3U2SA 3DHJA 3Q0HA 4PY7B 2LVEA 1KFAH 4QCIB 1PGRB 4AK2A 4EQ2A 2KYIA 2WNKA 4K5LA 4AE1A 4F7CA 4NLHA 5FB8B 3X14B 1O6TA 3WAKA 2ZAGA 4KNQA 1IEAB 3WE6B 4CSPA 3ZZQA 3GB7A 4P9HC 2ZJSH 5DVMA 2UXTA 4WO4C 5JW4M 3EFDH 1XIWA 3WN5C 1T6WA 4U6VH 2CDFB 2P47B 3OKYA 4LHJB 5AYQA 4AX3A 1J5HA 1V05A 4UTBA 4GMSL 4GEJA 3IT8D 2WKLA 4WQOA 1E8WA 1MCOH 2UWEF 4OIFA 4X8CA 1X7QB 5F1NA 5H35B 4ANKA 1KIQB 3GSOA 4ABQA 5AG8A 3QA3A 2N56A 4PSRA 3KR3H 3QS2A 1B90A 5AD0B 3LNHA 3EJYC 4M61A 3WO4C 1PCXA 4RVBA 5IG7B 3ZKXB 1REIA 2I9TA 1HHHB 4W93A 4AT6B 1KCSL 1ACYH 1IZJA 3DRQB 3U1SL 5TE6L 1U2HA 4C55A 4JREC 2QVMA 4FOMA 2VN4A 2NT1A 5EZIH 1QO3A 4DO4A 5HYQA 1FL6B 4UIKH 5TQ2H 4KVCL 2OL3B 4HMDA 3T3MF 4PJHA 1FFPA 2DQ6A 1Y6MR 4EMZA 4KXAA 4QXWA 2RA1A 4GXUN 4DNLA 3SOBL 3BW9B 4HMEA 2V8LA 1PKQB 5FFOA 3R7QA 4I2XE 2CHNA 2AXHA 5CN1A 2DEYX 43CAA 1QLRB 2GPZA 4PWEA 1UJ3A 2IGLA 3FSOA 4G3YH 1Z3RA 3VXMD 4FTDA 1JWMA 5AFAA 5AZEL 4GOSA 4HCIA 2A9NH 3EOBA 1OWWA 1KT2A 2ROXA 3HRZC 2DWDB 5IGXH 4UB0H 1HXKA 1NFDB 2WIIB 4KDWA 4UILL 2P24B 1NCWL 4FQ2H 1X5MA 5IW6B 1A6WH 5F93C 4HFUH 1HL8A 3FDWA 5E7FA 3SDAD 3V52L 3NCCB 3SYAA 4XT1C 4JS7A 5BV7H 1A9EB 1FVEB 3CVIH 3NCJH 4Z5RA 1FG2A 5FFLA 4LCYB 4P5TB 2PYFA 3UBHA 4HXBH 3ZL2A 4QHMA 2XYBA 3DETD 3Q8BA 3H3PH 5D2LB 5G5DA 1KPVB 3O3AB 5F7BA 3HE7A 4OSUL 3V0AC 4PJ7A 4YO0B 1WEJH 2ZUQC 4OCYL 3EG9B 4UV7L 1HOEA 2V3FA 3O8XD 5EU7C 4D2NA 2AK1H 3Q2LA 4U1LA 5EZLA 4X9YA 3QJQB 5DD5H 5KVDL 3WFHB 4ZPVA 4GBXC 1IC4L 4XN5A 5C07D 4OGAD 4JG5A 5E2VL 1SM3L 5GGSB 3U9WA 4RGNE 3G5VB 4YUEL 3GQFA 1SNRA 3IDMA 2VXUL 3PAUA 4PM1A 2VDQL 4WNQB 3SD2A 3AM8C 4CVXB 3GI9L 4O02A 3CSGA 1OCWL 4WJKB 5D9SA 4Y2OB 2YA0A 4XB3A 1K72A 4F7EB 3BGFB 1VZHA 2XIIA 1A6AA 3DPDA 5IHUH 5C0BE 4JQXA 4JFEB 4EUPG 2EJ1A 1HXMA 32C2A 4LDLB 5IB2B 2IDUA 3T77A 3TV3L 1E0OB 3VRJB 2EIZB 5I2IB 5ACLA 2Q76B 3V4VL 1RFDH 4N4YB 3D39D 5GS0H 4NOFA 2AVGA 3FT3B 2N0MA 3OZ9H 3K6SA 4PJAB 3KBPA 1F1DA 3OGCB 2FX8L 1IO4C 2VW4A 1BM3L 3PDOA 4BCXA 4ODUB 5E9DD 4AZ8B 1Y18A 2XX0A 4X6DB 2ZXGA 4XPGL 4GG6B 2V17H 3PQYA 3H2PA 2ZQKA 2VISB 4GO9A 1SHSA 2BSSA 3HG0A 5LHDA 1ZLWK 2AQ1A 4JN1H 4YFDB 3GZOA 2FJHB 5C7XH 4KI1A 1FYTB 2E76C 4LNVA 2NY7L 1MFBL 2W91A 4QLRA 4XBGB 2H4EA 1S9KC 2EH8L 2CR3A 2VN3A 5HHVH 5SWZB 4ZOAA 4NZRL 1BVZA 4MA7H 4NKDB 4X9BA 3SO3B 2O26U 1BMWA 3JTTA 4DFHA 1FJ1B 1U3JA 1XB6A 4M7LT 2P8MB 1OQXA 3MRIA 4HWBA 3SHSA 3QS3A 3SPHA 3RKDD 3KXFE 3CH1A 3ASOB 4HZ1A 4XVTL 4M43L 3Q6FA 4K9EC 4U7SA 5EBWA 4F7MA 3KPRE 4JY5H 3HE6A 4FQLH 5E4AA 1XVSA 4FNUA 4G59C 1RLBA 2H0FA 5GISH 4B27A 3WTYA 3O9WA 3BXNB 1QSEB 4EUPB 1A6ZB 2YLKA 1HC1A 3OHXA 3QORD 1A1OB 4XC3H 3TBVA 3Q2VA 5HVGB 2AMUA 3B2XA 3RIFF 4B7IA 5EC1B 1INDH 4GI9A 4GAYB 1WWAX 1NC2B 3AITA 1SZNA 5ALBL 2E7LC 4K9JA 1H5BB 1UM4H 2ZUVA 3O4LD 4Z3EA 1CFSA 1PEZA 1ZEAL 5E23A 3GHPA 3VG0L 2B1OA 4S2SB 4FLHA 1CDCA 5DQDH 5E8DH 2ZOKB 3VD9A 4NENA 4X50A 3OZLA 4OZFG 5LBSL 3WLBA 3BVWA 1Z3GL 3LIZL 3INUH 3S36H 3B6SA 3ZRSA 3FN0L 1ZLSH 1LDPH 7PCYA 4JPVH 5I1HL 1BEYL 3MRBB 5TGBB 2VXSH 3F7KA 2EVIA 1OAYH 1S9XB 4PJ5E 4C56D 3ZHLA 4HC1L 2AJZA 4YC2B 5AAMA 1DUZB 2AI0L 5JQ6L 1DSFH 4PJIB 4OZHA 4LP5A 1DFBH 4RMWA 3UZQB 5IB3A 2QDVA 2LQRA 4PLNC 3CLFL 3TBTA 4P23A 3QDMD 4Y19B 2W07A 1LK3L 5C2BL 3EGDA 1QOKA 3QQ9C 4NN6B 5DFWH 2GSGA 2H6PB 3QDJD 2OCJA 4LASL 2R4SH 3I50L 3MOAH 4L0YA 1PZ3A 5JPNC 1OANA 4B9KC 3KNBA 4R3SB 4AY0A 3EW3B 1S9WB 2MOQA 4CW1A 4U31A 4IBVA 1IQDB 4ZMYA 1OD9A 1VCBC 3IB4A 3R1GL 4FQQB 4NQUA 4FD0A 1D3CA 1TJIH 3PIQA 4BZ2H 5D7LD 2H26B 3CX2A 5DMGD 1JZ3A 3ULUC 4K7FB 1A4CA 5IV2B 1U0QA 4Y4KC 6PCYA 3ZT5A 4A2GA 1KBWA 3FB6B 2HTKD 1AZVA 3NIDF 2QADD 3SPVA 1S9VB 1MZYA 4M6MH 3WELA 5F89B 4OZFB 1KY6A 1NUNB 2RCSL 3GUFA 5T5NF 5AW2B 4PJ9B 2AQ3A 4D9LL 2ZG1A 3JVGC 4K7PY 1S7XA 1UQSA 4X80H 4POYA 3KPQB 2B5IC 2NX5D 3C8KB 3Q7JA 4BQCA 2E47A 1T22B 3HAEG 5DVPA 2XQYK 4HWUA 2ZYIA 5KN5A 5M94B 1PCSA 4JM2D 1DEEB 5DWPA 1KV7A 4X7TA 2HN7A 4K0OA 1MNUH 3NK3A 3IS0X 1INEL 3SPGA 1A6UH 4FKHA 3ETTA 4J6IA 5D71L 5BW7C 3CBRA 3QDGD 2AANA 4NWTH 3S37X 1T5WA 4ZX5A 1EHNA 2NCMA 4OCRH 2VAAB 5IBUG 2OMYB 2H3NA 3FU7B 3TNNB 1ONQA 1ULVA 2PKDA 2HKFH 2MPVA 4B9CA 4AGPA 2R1XB 5BRZA 2ZSVB 3QJOA 3BD5A 3NIFE 5MEPA 1D5ZB 4JDEA 2IWFA 3IRZA 3O2DH 5TE7L 4NQED 1CFNA 3MV8D 3SJVB 3T0AA 4GRLB 1OALA 3GMLB 3T1FB 4CVZA 2NDGA 3IDYB 2AJSL 2YIHA 3IYLW 1KC5H 3FQNA 3ESVF 3SGDH 4PRDA 3VD0A 3CHXA 2WBXA 5IVXB 1JTTA 1E5AA 1TU2A 3QFJB 5HGAB 2KZWA 1KGXA 4Y16D 2B1HL 3QI9C 4HU8A 4GP4B 2FJFA 1AZBA 4JO5A 3MACL 1IRAY 3EO0A 2UY6A 3QZLA 2HRHA 3FUMA 1KCRL 4JW3A 2YD9A 1QPPA 1E3ZA 1IBZA 5KVEL 3HAEB 4NGHH 1XGTA 5DK3A 3VJ6B 2VITB 2CKBH 4G8GB 3F3HA 1O9VA 4IRSC 1EO8L 3VTAA 3O6FA 3QIWA 4YSRA 1MRFL 5SX4I 1WYJA 2XBTA 3UTOA 3NCEB 4JPKH 5FCSH 2Z3FA 2ZAIA 1A6PA 5IBUB 2J1ZA 4Z7UA 2GIYA 3FUHA 2VXQH 1BMZA 4NO2B 1HI6A 1EDYA 3NIDE 4J2QA 25C8H 4WFEE 5I26A 1UTDA 5DYFA 3L7EA 2VDML 3EUUA 4KJWC 2ADGA 2XQYG 4PGBA 3MRDA 1AXTH 4HIEB 4TL5A 2K6WA 1N59A 4ZTPL 4KY1H 3OR7B 4UQAA 4XE0A 3PJNA 2QGEA 3TCXA 2EVGA 3P0GB 4ODWB 3GMPB 2IH8A 1CGSH 2A83B 3EOTH 4XI5D 5EOCJ 2NW3A 2PXYD 5GJSH 4Y1AD 1FZJB 3BH9A 3IU3B 4YBLC 4NP9A 2B1AH 4P5MA 4AUYA 5FF6A 3NSCA 1J87A 1C12B 4MMZB 1CTOA 4NQDA 4ZMOA 1M4KA 1RIUL 1T7ZA 3AROA 4AVHA 2IWKA 3M1OA 4HDIA 3AT9A 3C8DA 4OKVB 4DVRL 4Y4FB 4ESKA 3FQXB 1T21B 2BVQA 4NKQB 5ACMA 3G04A 3KEDA 2AQNA 5SWSA 2Q8BL 2EC9U 3QUZD 4BSVB 1YG9A 2A2QT 1CIUA 2Y5QA 1XB8A 3APDA 4TVPE 3ROOB 3IVKB 1MFEL 2XG4A 2FBJL 2APFA 5I71B 1SOSA 5C9KA 5FGSA 2YD2A 4P04A 5AYUL 3R18A 3GBNL 4HUWB 2W60B 4X9HA 1TZIA 4Y4HA 5JDJA 3MRRB 5KAQG 1KCLA 2X9ZA 1DQLL 2WNGA 3JV0A 1XXDC 3F7YA 2G2NA 1ZT7A 2NSQA 2KKQA 2FGWL 1QKZH 1NFIA 1WF5A 4NC0B 1LP9B 1ZMYA 3NIGF 1CXHA 3TZVD 4WHYG 3B2VL 1G7HB 3GZKA 1BWMA 4PB0H 4WJ5A 3L9RA 1QZ1A 4Y88A 3BJ91 3GMQB 1MVFA 3RVTC 4R5XA 3EYOA 2H2SD 4JKMA 2R0KL 6FABL 2VDNH 2VR4A 3LN4B 3T2LA 2MNJB 4WI0B 1ETA1 5C0AD 1KACB 1G7IB 4KKQA 1KB5A 1DO6A 4B41A 4L37A 4R8WL 1ECYA 3K4ZA 3E8UH 4OJEH 3D52A 3O6MH 3RVXD 1B4JH 3UAJA 2QVKA 2YPKA 4DKTA 1EO5A 5MHSE 1I8KB 3FTXA 3MRHB 3MV9D 2BNUA 4A1RA 5L2KA 4L4TB 4F5CE 1TEGA 1EHKB 2R0WH 3GEWB 4IS6B 3T8VA 4JN2A 2WKOF 2B7DT 1Z9NA 4Z0BH 4DEWA 1A9BA 2XXFA 4RAHA 4WSKA 1UT1A 2Y23A 3GI8H 1R3JB 1OP9A 3WNIA 4PHZA 3B8YA 3C75A 1FHGA 4PY8I 2BLFA 1CI5A 1VEOA 4UWQB 2VM4A 3RWCA 4H88H 4N3UA 1IGTB 5FW8A 5HDBB 3R06B 4UIMA 1Q38A 4GKNA 1BFOB 2O1AA 3NSFA 4LSRL 2F53A 3GSXA 5IUSA 4HH9B 1R3LB 3LKNA 2VUOA 3MBEA 4IMKC 1J9TA 1N68A 2BIIA 2VABA 3RIKA 5C6PB 2HVBA 3K72B 2X4QB 3GXUB 2EO7A 3LS4L 1V10A 2XRAL 3DGCR 2R1YB 4OIIL 4GSDL 2LHAA 5F6IB 5LGJB 5JZ7D 2BCKB 2NSMA 4R26H 5AW0B 1MHHB 2V0AA 1SF5A 1N6QL 5IFJB 2WJ5A 3ZE2B 5DZAA 5DZLA 1JMXA 5CGYC 2NZ1A 2X1XR 4AC4A 1P4BL 3DJSA 1R5VB 1T1WA 3X3GL 4P9HL 4L8BB 2NNAA 3LH2L 4P46C 2WXNA 1YUHA 3BZEA 3UPRA 5DZJA 5C0EB 3V6OA 3JV4A 3D85A 4AZUA 1YEGL 2EIKB 3IJYB 2GTWB 2VDKB 3ETSA 5TDOA 4WWID 4C4UA 4OVVA 3UZEC 1FNGB 2VW7A 2QKIA 2XWXA 1X6NA 3IK2A 2O5YL 1M7DB 3BVVA 3ZMRA 1HYRC 2ZCHL 3UGEA 1EHLH 1AS7A 3LKQA 1IAMA 1UA6L 3MU3A 2NZ9D 1AGFB 5F1IB 3BPCA 4JO3L 3RPIA 1HHIA 1TZAA 4MQXC 2N59A 1EJOL 5T1JA 2ZXQA 5DRZA 1W8OA 1TTBA 4I48B 2NXZD 4PWKA 2G9HB 3S34H 1E27B 1HKLH 1AG0A 1AHWB 4UTAH 2W8CA 1YLBB 3EGXB 3GIVB 2MQ3A 2WLJA 1SEBA 3BEVA 1BJ1H 2WLLA 3EH1A 4OF3A 5C08D 1T2QL 2F5BL 1GMEA 1OAUH 2Q3AA 4N25A 2WXHA 3BOVA 5JOPE 1VFUA 3O2VH 2X3AA 3OR6B 4I87A 5DR5H 3ZOAA 1MRCH 2YPLB 3MNWB 4GKSA 5DVNA 4AE0A 1IFRA 4UINH 2EXWD 5B1AB 5EC2A 3UTTD 4ZNEA 4LF3A 3TC9A 4Y1SA 1PD1A 3HG4A 1CB4A 1LWHA 4J1UB 3QUXD 4EN3C 1NCTA 2VTFA 3B2UC 4MD0A 4YQXH 2EYTA 2XN9D 2VC2B 5E1AB 1DVQA 2DM2A 2IH1B 4DEPB 1MJUH 4XCNB 2UUDK 4FXKB 1EWHA 2N1KA 3FT2B 4ZPTB 5EOQL 5LAXA 1VENA 4HSCX 2XN2A 2GUOB 3NSDA 4RMBA 2N0KA 4MSWB 3WMSA 3LMJL 1RP9A 2PUQT 1RPQA 4NQTA 1E67A 1G7JB 4WLCA 2HT3C 4A67A 2ADIB 2JKLA 4M1GH 3KS0J 3SPJA 5EU5A 2VM3A 4IQHA 5DHEA 1PZ5B 2OCFD 2FSDA 4ZFQA 5KBNC 3CK0L 4LFHD 1A2YB 2O6EA 3MA9H 3ZE0F 4EDWL 5IWLA 4FCAA 2OYMA 4Q6IA 3TFKD 3FCUB 2F15A 5D1QC 2CUAA 2I27N 4UT6A 4BQ8A 4MMXC 4NRXA 5T1KA 3UADA 5JNYB 4Y5VA 1YSOA 3RU8H 4DW2L 1LE9A 1Y6NR 3U36A 3T6WA 1NBVH 4X4ZA 3HB3D 4G80A 4X6EA 3K74B 5EBMA 1A65A 5ALCH 1JCVA 1IGFH 1RJLB 4ZAKA 3SE3C 3QEQD 2BRRL 1RK1A 3SDXB 1BX2A 1PNDA 2A0LD 4MJ5A 4XN8A 1T6VN 4KVNH 5I1IH 4N9GA 2P5EE 2FIKA 2VDPL 4MQ7A 5DURB 3HN5A 1OGAD 3IETB 2OSYA 1CFQA 4NWUL 2FECL 2IO5A 2UYLB 4JFXB 4PS4H 4ZW6A 3ARGC 5CJ8A 4UZUA 1ZWIA 4WI7A 4XVSL 2NY3B 4IK6A 3NFNB 1YVLA 1H8OA 1UZ6E 4ZDHA 4I0PA 1ODUA 5ECGA 3VI3E 2WUCH 2W9LA 4EQ3A 4FQJL 3S35L 3LOWA 4I0CC 4WO4B 2EVFA 1YAIA 4KQ0A 3AS2A 3KPNB 4XBPB 3LTVA 4G43A 3BFQG 1G87A 3UG4A 1I7UA 4GO8A 3NH7H 3CMGA 1BFSA 2WXRA 4LCWD 4AIZA 1DQDL 5IKCB 2AJYL 1DJGA 5GQBA 1MHPH 3MXVL 3P77A 1Z9SA 2TRYA 2Y06H 2B4CH 2ZXCA 3MLSL 2PP8A 1A7OH 3ARQA 3WO4B 3QWOB 1A1NB 1UVQB 5JO5B 5HD8C 4KUZL 4IW4C 1YMME 1FUNA 1UD5A 4WVRA 3SPCA 1Q9KB 3TASA 4ELMA 4JREB 1NCDH 2WQ8A 4R9HA 1N10A 2ZAHA 3HZMA 4AW7A 4KZDH 1R24A 4K9EL 3MUGB 4JDTL 4OLZH 5T3ZD 1CL7L 1SEQL 1JMZA 2CRIA 2CHDA 3HRPA 1I8LA 2R23B 5KW9L 2H45A 3LNFA 1NUGA 4HISA 5F2FA 5HTSA 3VDCA 3G08A 3ZE0E 4P48A 4CBPA 1LILA 2NOYA 4TNWF 5ITFB 5LUMA 2FL5A 1QRNA 2NYKA 3AREC 3AS0A 4HU2A 3ILEA 4OFQA 5F7UA 1XEUA 4HJSA 4QD2E 4TV3A 3TT3L 5AAWC 4FFYH 1U95A 4NUMA 3S35X 1SMOA 1L9SA 4U7KA 3S4SG 3EADA 2H32A 2HLFC 4PGEB 1NOAA 5DVOA 2ARJA 5IM7B 1I9EA 4QAMB 1KXQE 3KHQA 3MLYH 1FG9C 4TPRH 4A68A 5BJTA 3LCYA 1NFDF 2E5EA 1U8JB 3PWJA 2FWLB 2Z91B 3BD4A 1S7QA 3MGOA 4L05A 4K8RD 4MMYA 4UDUA 3N41B 5K39B 4D8OA 4ZMAT 4MYWB 4YEFA 4I2XA 2XYCA 1GSMA 1SY6A 4FLOA 1PZAA 3HNSL 3PP3K 2JJVA 1JHKH 3PJSB 5LGKA 3TP4A 3OLGA 4PEEA 1E4HA 3QCVH 4DGIL 4F2FA 1ET8A 1KJVB 2CLRB 2AHIA 5IJDC 5EZOH 5C7ZA 2EVJA 4OD2B 3OJVC 4AM0B 4PFEA 5BVJB 1E5UI 3BRDA 3SE9H 3C12A 1YEIH 3PAVA 3QUHA 5AVTB 3DI2B 3EYQC 5CJQH 2NY6C 4ODSH 1OEZW 1JSYA 2OMZA 3QQNA 3B37A 2NY0D 2WYZA 2FWOA 5KBDA 1FE8L 4PCKA 1E30A 1O7SA 5FO2A 2HTLC 3BVNA 1ETZA 4DCQA 3DSNA 4E9QA 1HHGB 5IEHB 3ULUL 4TULH 2ATAA 1XF4A 3HVDA 3ZMEA 3BKJH 1DBML 2NY1C 3V0WL 3GSNL 3C2SA 4JVUA 1GGIL 4XWGL 2XZCH 2VQ1B 3QNZA 3LN5A 4QRUA 2P49B 3S4SB 3IDIA 4Z8FL 1UD8A 4HS8H 4DWHA 4GEIA 5BUPA 3CDGB 4MWFA 2RFXA 1GGYA 3M45A 4RX4A 2BIPA 1NDGB 5J11C 1CFTA 5DUML 3NSYA 5CIPH 5FX3A 1C5CH 5F97E 2OZ4L 1B2WL 3LD8B 2BZDA 3IJ7A 1I85C 3HA0A 3U0WH 1MWAH 3RDTD 3U6RB 3VFGH 3E80A 3MA7A 1PKQE 2DW5A 1TJHH 5C0CD 4HQQH 5KZCD 4NQXA 1K5NB 4L4VB 4K2UL 1T0PB 2QPEB 3UTZA 2B2XL 2P28B 4YDIL 3OKDA 5H2BA 3TPUA 1FGNL 1YC8A 3GHBL 5JPMB 3MRCB 1E4XL 1Q0XH 1XF5A 4FHJA 4G72B 3WKPA 5C0BA 3SE4C 4X6BA 1F4XL 4WI3A 2CBOA 4JRXB 1FIEA 5I19L 2BWDA 4N20A 4KRNA 3NJXA 2CIIB 1NFDE 4FP8L 4D0BB 2W0FB 3APNA 3HPJA 4X4ME 3COOA 1AZZC 1RUML 5B4MC 4Y9EA 4HYTB 2RB8A 4L1LA 3V8OA 3FQ1A 2C34A 1G1CA 2IF7A 5EU6B 5AOJA 1ID5I 1XF2A 2J1XA 4PJBA 4QKXB 3AU0A 3V9FA 4L3EB 2OMVB 2MIZA 4UYQA 4WSGA 5TDNB 4JFFD 5D2LE 7PAZA 1GVIA 2YD1A 3I6GB 1KXHA 1KDJA 4KO6A 3NA4A 1RZGB 3NZUA 5DJXB 5J12C 4AVJA 3RL2A 1MVYA 3X11B 1G0XA 3SDCA 3MGTA 4GMTL 4NHCL 2GITA 1S3RA 1HNYA 1HJBC 4GMSH 4M3JA 5I1CL 4LVNC 3GZQA 1ZSDA 2NMSA 2BMKB 1K2DA 2GK2A 4HCGA 5C0DA 3IAPA 4G8IA 1IBYA 4P4KD 4YBHA 3TF4A 2QGBA 1UATA 3SBPA 1SRDA 3KH3A 2YAQA 3VFVA 3GSUB 1JZ8A 5FS5A 3WNNA 1KCSH 1AE6L 3U1SH 4OFDA 5TE6H 4WUKL 1XIWC 4JFEE 1S7VB 1WISA 3OMIB 5HVHC 2NCEA 3F7PC 3ZQ9A 1NMCB 4HIXL 4O2CA 4KVCH 3SQBB 4GUOA 3K5RA 2CWRA 2Z93B 1NM9A 2HVKA 4PP1C 3FUFA 3RJQB 3RY4A 3CVDA 4PJAE 2ISDA 4MA1B 3SOBH 2J6EA 3HR5A 3QFDA 4UANA 5JR1L 1AANA 4X6DE 4DESA 4GG6E 4I77L 5DZVA 1NCBL 1MHCB 1LEIA 2VR7A 1A8ZA 4N2FA 1RK0A 1TQBB 4OFIA 1N5AA 3D2UB 4NAJA 3UYPA 2BWIA 2Y5TA 5AZEH 3IPEA 4OCSL 4HKXB 5B1JA 1L9TA 5LG6A 3M88A 2C1OB 1Q94B 3LSOA 2R69A 4JJOA 3VXQA 3GSNB 5CKGA 3ARFC 5SWZE 2PYED 2YC1B 4LOFA 4UILH 1BIIB 1LEGB 4L8DA 1WD9A 3T4YA 1NCWH 1P1ZA 3FOMA 2C9PA 3V52H 3VXMA 1IAII 3WFDL 3U30C 1W16A 4BFFA 3JWNG 4HIIB 4LSTL 5ELIA 3MLXL 5I5IA 1UJ3C 1FQ9C 3KL5A 3M8OL 4KRPB 4X6CB 1AKJD 1VEPA 1QSEE 2JB6A 4CC4C 3SDAA 3V4PB 3UP1A 4OSUH 5SV3A 3RWGA 3U4AA 1NCUA 2VJXA 3TBWB 4UM8A 4Z23A 2YGNA 2EDEA 4M00A 4PRIE 4OCYH 4H20L 4QYOB 4UV7H 5JHLL 2NUPB 1MHEA 4Z7WF 2YXMA 2O93L 2YMXL 1CGVA 1MFDL 5MENB 1TITA 4P2RB 3C5SB 2FT8A 4X98A 2I9LB 5KVDH 3ZSTA 2MQ0A 1IC4H 5IR1B 2IIJA 3L3HB 3KVDD 4WO0A 1A02N 1SM3H 4X5XA 2V3DA 1UENA 4L1SA 4X7FC 4YUEH 1X9LA 2VXUH 2UXGA 2VDQH 4ZJ9A 3O8XA 4H8VA 4LSPL 5HDLA 1I53A 3GI9H 4EN2A 5ANHA 1OCWH 1UUNA 2AAVA 3HE7C 3FO1A 4TNGA 5D4JA 5IB1A 2YMOA 3P3RA 4PJFB 4W68A 1TIUA 4PJIE 3RPKA 2VZUA 3VE0B 3TV3H 1JGLL 5IVXF 5CD5C 5DZ9A 3WU1A 5GGUA 4U1IB 3F5WA 4Q9RL 3T04D 3V4VH 3SYOA 2HMIC 4ORGB 2HCZX 2E9IA 1UADC 1FH5L 2E46A 3JSSA 1KXTB 2HT2C 4PJ8D 3QJFA 4Y19E 5C0ND 4CU7A 2BNQD 2VN6A 2FX8H 5BVPL 1XAKA 1DQIA 4K71B 1BM3H 4MXQD 4Z3JA 4KKCC 2Q3XA 4XPGH 4D0CB 2IPUK 2AF2A 1NIAA 1S46A 5D4IA 1WFTA 1ZLWH 1NEUA 4ZSOB 4PW9A 4QY8B 3D39A 4UUJA 4X4XB 1U58B 2DQUL 2VERA 1OTSC 4JQXC 2NY7H 1MFBH 2D73A 4APQD 4FYSA 3T0ED 2YK1L 2EH8H 3CSYA 4ZUSA 3HMWL 4B9IA 4OGQC 5GZOA 4NZRH 5FLVA 2BOCA 1RJZB 1TMQA 5F3HA 4ICXA 5LDSA 4E5XG 1GS7A 1KFGA 3N5AA 3AT8A 2JQAA 5I9QC 1JCKA 2E0PA 1RY7B 2KZ1B 3K80A 5DRXA 2QGDA 4MNHA 3GDBA 1ZD6A 2J21A 2XPGB 4XVTH 4EVNB 4M43H 5EEZA 2OKMA 1EEYB 2DWEB 1BLNB 3AU1B 4KO5A 3FQWB 5FM5O 1PW3A 1K8IB 5B1BB 1I4FB 5F0PB 3SD5A 2C3VB 2VT0A 5D96B 4O9HL 2AXJA 4HEME 4P5KA 1KY7A 1RHHB 3B83A 3GJEA 5AVSB 1UEMA 3IRPX 3EJRA 3C5ZD 3LZFL 5ALBH 4P57B 4HP5A 1P5VB 1TCRA 1Y6KR 1W72B 1ZA6B 3RWEA 1ZEAH 1I8MA 4JEGB 1COBA 3VG0H 4Z7VA 4JJ5A 4NN5B 1P5UA 3S8WA 3CDFA 3FAWA 2X6UA 4N2IA 3QORA 4BFNA 5IB5B 5LBSH 3U2IA 1H3VA 3LIZH 1Z3GH 1A4KA 3HE6C 4BDVB 1ZS8A 3FN0H 1WBYB 5A2CA 1IJNA 5A7BA 3BRFA 3O9WC 5E9NA 1BEYH 3O4LA 1SF3A 2WTRB 3RGVB 5I1HH 3SJVE 2H2PC 4EDXB 1U3HD 4LLDB 3OHXC 4HC1H 3VXUD 2AI0H 2JXMA 5JQ6H 1AD9A 3OKKA 3QPQD 3HFFA 4L5FE 4TSCL 1UXLA 2RTTA 4DO5A 3VFNA 5IVXE 5JHMA 5AOIA 4E5XB 1QA9A 3QFJE 3S3JA 1MH5A 2AXFB 2IPUG 1XR9A 4RIRB 4ANUA 1JD7A 1HHJA 2DN7A 3CLFH 2ZP9A 1CZ8L 2E7DA 2FEDC 1SJXA 3MJ6A 4PJEB 4WU7A 5D5MA 4GFXA 1LK3H 5C2BH 1F5WA 2O5XL 1L0XA 5HYJB 1LD9A 2AQSA 2WVTA 1A7BA 4Y9CA 4QLWA 3BX7C 4LASH 1M9SA 3TEUA 3I50H 5CEZL 3E9UA 4BQ6A 4G8GE 1CE6A 2TAAA 3LEXB 4N5UA 5D7KE 3RNKA 5DLML 1TYEB 3WTVA 1XCQA 1DLHB 3QDMA 3R1GH 5AAMC 4KX8A 4ES9A 3JTSB 4RGND 3QDJA 3BWUC 2K0RA 3QIUA 4WUUA 4GW1B 5HY9B 4L1DA 4R7DB 4MQTB 1MVUB 1HEHC 5AB1A 3IMTA 1H15B 3TIDA 2FO1A 3DO7B 3BUBA 4POUB 1EZVY 4JM4L 1F3DH 5LJYH 2R0ZL 3BYYA 2RCSH 1OB1B 1E43A 3NUKA 5D7LA 5E8OA 1XEDA 5C8JA 4D9LH 4Y2LA 4U6HA 2R29L 5DMIL 2E7HA 4LKXB 4W6XB 1HILA 2CE6A 3ILPA 4ICWA 5DHMC 1H3PL 1AZCA 1BWWA 1OLLA 1S7UA 3BPOC 3DLQR 4IIQA 5ICZB 3IWVA 3K8MA 3KYNA 4DZBA 4KZCA 1Y7VA 3HMXL 3ILQD 1XZ0A 1IAIM 3VA6A 3OX8B 4MJID 2C3HA 1INEH 4JAMB 5F7AA 3IXTA 3RTQB 4TQPA 4EI5D 5IBLD 2X2IA 3VXNB 2IGFL 4RZCB 1MW0A 5D71H 1E4KA 3FT4B 5HHOD 2NX5A 3BT0A 4HGKC 1CTMA 4IRZA 4F8TA 1OARL 2J5LB 2OYLA 3WNLA 4XAKE 4JFSA 4JM2A 1GR7A 3BGAA 4KQ4L 2BVOB 2ZOLA 3DKHA 3ZDWA 2EVHA 1IBFA 2QSVA 2XXMB 5FUZL 2OX5B 2OI9B 4E2OA 5E00B 3ZYZA 2JV6A 1MAKA 2MQCA 3QDGA 4LOEA 5L2JA 3ZE2F 2ERJC 2PW1A 1TLMA 4H0HB 5TE7H 3MLTB 3OAYK 4H1LH 5H37G 1RH8A 3WJJA 3APFA 3W57A 2AJSH 2HWZL 4L48A 3KPSB 5BZDB 3NBNA 4FQ1L 4ZQTA 2YAEA 4AQEB 3A22A 1B4TA 2G0KA 5GS0D 5I8EB 2X4RB 1QTSA 1NBCA 2B1HH 4E41B 1CGXA 1D6EA 3RZCB 1AR1D 2JCCF 2JKNA 3MACH 4NQEA 4B95C 3MV8A 1LP9E 2GK0B 5E8NA 1KCRH 5JW5A 3LNGA 3U6XS 3VGAC 1TZGL 1ZTMA 4BBWA 1VIWA 5KVEH 3TM6A 5DK0B 3BWSA 5KYYA 2YQGA 4ZW5A 3ZKND 4Y16A 1WBXB 3BIKB 1EO8H 4KK5C 2V2XB 4WHYH 4X83A 1MRFH 2V7HA 2BJML 2OA9A 3CDZB 1P7BA 2I07A 1S5HA 2X09A 1K8DB 1XGPB 4FG2A 4PWFA 3X12B 1T04B 4J4PA 3RWDB 3NAAL 3V0VB 3PL6C 4HJ0C 1HCFX 1BYPA 5FA4A 1J9RA 1MREL 2VDMH 1J1OL 1BZEA 1CG9A 3DHMA 1U8KB 5JA9A 1JGDA 4XWOC 3K8LA 2VLMD 4ZTPH 4DN4L 1UG9A 3IJSB 1SXSA 1C7SA 1HQRB 5CBAB 5CFHA 2ED6A 3H6AA 2HJFA 4L29A 3ZE1B 3PXLA 4IEFB 4EN3B 2WBKA 5B1CA 1V54B 3MRFA 3K71B 1LJMA 3SYCA 4WI2A 1KLUA 5DJYB 3SKNB 1RIUH 1RERA 3ALWA 3GNML 1I9RL 1X5FA 4LLVB 2CU9A 3QBTB 4DVRH 1ZLEA 1E8ZA 2YD0A 1ZTXL 2PXYA 5IJVA 4M03A 2UXVA 1UB6B 5FW7A 4QXTB 3VH8A 4Y1AA 1CYWA 5I8OL 5ISZB 2Q8BH 3GXTA 4Q4EA 4YPGB 3ZE2E 3DHUA 1Z9PA 4N28A 4L1BA 5EEUA 1MFEH 3REWB 2FBJH 3J2PA 2ZUXA 3C6LD 3V5HA 4HIQA 2YMTA 1KZQA 5EZJA 3ZW3A 3LDBC 2D03L 5AYUH 1ZT4B 2OXGB 4NZ8A 3ZMNA 4BFIB 1RJYA 3GBNH 2Z4QB 4F9PA 3LRGA 3QUZA 4WV1B 1W8EA 1DQLH 3DX9A 1XBDA 3C87A 2JCCE 5D1QB 3W0WD 2P43B 3NACL 4OIAA 4YDVB 3CIAA 3VWJD 1DVUA 2B3IA 3TS8A 1NJ9B 3B2VH 3VXOB 2GT9A 1IAKB 2Y5EA 1KJMB 3EAKA 4XB7A 1A8JH 1JZ4A 2EYRB 5E6UB 3T1WA 1DQQB 1YEDA 2R0KH 6FABH 4DSYA 2ADJA 2XLLA 3MNZA 3TZVA 3CX5J 1E6JL 1KGCD 4OGXL 1ERNA 4R8WH 1J48A 5E6IB 1DQJA 3ARGB 3CFBB 4B9GA 1G5GA 4QGYA 4PS8A 1ZXKA 1DEDA 1LQBC 4QHKJ 3ZYJA 3L16A 1SJEB 1IC1A 3D48R 3KYAA 3H9HA 3JYCA 1G4MA 2Q86A 3GRWL 3TA4D 4AQ1A 5AKTA 4OD1L 5HJ3A 3DX7A 4G1MB 1HZKA 5D93B 4RMTA 2YPLE 3MRMB 5E4OA 1YPZB 1GJIA 2QV4A 4ZXBB 3ULVL 1X9RA 3MV9A 2CM6A 1JN6B 1S5IL 2R27A 3HUJB 2P5EA 4MJ6A 3BP7B 4XP4L 1KCKA 3CQQA 2ZE0A 4HUMB 3MR9B 5KUKA 4LSRH 5CS7A 3UAJC 3AXLA 1GYVA 1KCBA 3WLWC 5B21A 5A40E 4IBSA 1S7WB 3LS4H 2XRAH 4OIIH 3OBAA 4GSDH 1RZIA 2ICCA 4FKEA 2GCYA 4Y5XB 4JZJA 4B0MM 1KDIA 4RH4A 1N6QH 3WS3B 4ZFFB 4J8RA 1ITCA 2IADB 1FLRL 1NIEA 4B60A 3ROLA 3DURB 1P4BH 4JL2A 1ET7A 3UO1L 3X3GH 5HSFA 4P9HH 2IALB 2BVPB 2DQTL 4RMVA 3LH2H 5I24A 3FU6A 3NEOA 1ZY9A 4ANXA 3MBEC 1YEGH 3MNVB 4LRIA 1C5DA 1AP2A 1MFMA 5JHBA 3FCTA 2Z1PA 5E99L 3TESA 1KIPA 1NFKA 2ICEA 3TBYA 3BMWA 3TNMA 2GYSA 1MXGA 4NSKB 5I8CA 2O5YH 3NPSC 2FR4B 5CJXA 2ZCHH 5DMKB 1FCCA 1UA6H 3L5JA 5EHFA 1ES0A 4JO3H 2D7OA 4JHUA 1LEKB 1EJOH 2WQAA 1IC7L 2FJSA 3HFML 3SDXE 3OKOB 3QR1A 1U9KA 3UTSD 1QG3A 4JFPB 2WWNA 1JV5A 4MLSA 3U0TB 3V6OC 5HBBA 4GAAA 3IU4L 1ID2A 2BZCA 4ZMZA 5D55A 3BKML 4UTBL 3D25B 3FUKA 5E8PA 4ZODA 2ZCLL 5EUOB 2ZUWA 3FTWA 4A7TA 1T2QH 5ACZB 2F5BH 5LLIC 3QZWG 3FUIA 2QKIC 2WMPA 4FERA 1VFMA 4N0YL 3T0XA 1EXGA 2APBA 2NYYD 2VN7A 2NY6B 3BP6B 2QSTA 4CA4A 3OJDB 4I4WB 5I15L 4IU3B 2WY3B 5EU4B 3I6KA 4OW6A 3RKPA 1V27A 4DUWA 2SEBB 3L3GA 4UT7L 2D7TL 4DUVA 5C08A 2IPKB 4KUCF 2NLJB 3PHOB 4AM0Q 1MLCB 4PTTB 2IAAC 3AG3B 3PFUA 4M8VA 2EDJA 3PHSA 4XX5A 1U8IB 4FG6D 5MEQB 5ANMA 5CLTA 3ATAA 1O5PA 3F7RA 3VYOA 2W0PA 3IWUA 1TMCB 3CHRA 4PY7A 1UWFA 2HUEA 5D1XD 2A9DA 5F7DB 5E4EB 2EIBA 3ARDD 1M7UA 2UUDH 4L1TA 1DYZA 1CC3A 1FRGL 1FNFA 1IEAA 1QBML 5FOBB 2XSKA 1P9MA 2B0SL 3T0BA 5B38G 5EOQH 2FRGP 3ZZSA 3QEHB 1X5ZA 5J11B 2APXA 2CDFA 3QUXA 2ZWLT 3CXDL 2LV4A 1UKQA 1LO2L 4K7PL 1NBZA 4RSVA 3VFRA 3VFMA 2XN9A 3LMJH 4N8VG 2EEFA 1GZQB 3UMTA 4TM9A 3A4AA 5EOCL 3QZNA 5HP5A 3IMBA 3B7YA 2BSRB 4IK7A 3BQVA 1ZA3B 3CIQA 2ATKB 2F54E 3WL9A 3QZWB 3SDDD 1J5OL 3S3CB 3CK0H 1VEMA 3IGLA 1ZIAA 5C09B 4EDWH 3ARSA 1P2CA 3P9LA 1A47A 1QHPA 3QYCA 2DWSA 5LNGA 3DRQA 1KBGL 3C6SA 4RDBA 4BH7B 1C16A 4XNAA 4QTFA 2IGTA 1FL6A 4WAFA 1D5IL 3M17B 4M02A 4WKZB 3PREA 4DW2H 2OL3A 4BWWA 3UTPE 3GDCA 3MXWL 1DBAL 3ALPA 4BH8A 4EAEA 3LKOB 5E51A 1R47A 4AGMA 3MCKB 3L1GA 2Y7NA 1U33A 3NDYE 3T0WA 2BRRH 3BW9A 4A7VA 1PKQA 1VFBB 4M8RA 2VDPH 4U2YA 3ZKMC 2EDQA 2BPBA 3UCRA 5IWLC 4NO0B 3JT2A 3O11A 1VESA 4NQQA 4NWUH 5F7LB 4Q6IC 1UOKA 1HH9A 5B38B 4XVSH 1AAJA 5B39G 2A9BA 5J12B 4M48L 4LGRB 2P80D 3FUEA 3QEQA 4AQZA 3PP4L 4FQJH 3S35H 4Y5VC 2YZ8A 4WWKD 3WIHA 1CI3M 2WIIA 4N8VB 1LYQA 4G70B 4N3TA 4ZOBA 4O02L 1MRDL 5BCAA 4ZAKC 4HUXA 2CHXA 1DQDH 2AXGA 4ODBD 1R6VA 2AJYH 2VB5A 1A9EA 4FC3E 4HUKB 2BY3A 4LCYA 4P5TA 4MZRA 3MXVH 2IFGA 1NPNA 3H55A 3KW8A 4DK5A 2B20A 3DYPA 3HN8A 5J89A 1AO7B 1OWRM 3U2SB 5F7EL 4KNTA 1JGVL 3MLSH 1J5DA 2GSIA 3JXAA 3RVWC 1JXKA 3BE1L 4KUZH 1T1YB 3LZNA 4URTB 1DE4B 3WXVL 3DTXA 3OV6A 4I0PC 3N2JA 5HJDA 4LCWA 2X1WL 5H8DA 5ID1A 3ECVA 3GB7B 5MI0B 1CXLA 1WK0A 4DKAA 3QHFL 2XWDA 1L7TL 1FN4B 3LH8A 2WGXA 4K9EH 4JDTH 5KVMC 3QCTL 1MQKL 4TQHA 2P45B 1CL7H 1SEQH 2YQ3A 3F58L 2QMKA 5F1NB 3QUYD 5DT1L 2DM4A 5KW9H 3QA3B 1MJ7L 4LOUC 1AXSA 3E6HA 1C1EL 5HDQL 4KK9C 4M61B 3R19A 1WVZA 3EUDA 5B39B 1FSKB 3O4OB 4L4VE 4MTMA 4HULB 3W38A 4BHUA 2I9TB 4BQBA 4MXVF 4QRRD 2D7NA 2ENQA 2H1LM 1M7XA 3IDNA 3VFWA 5AB2A 4F24A 2J6WA 4Y2OA 3PLYA 2BDNL 3KMDA 2GBTA 3TT3H 3WKYA 3ULUF 1QO3B 2CUIA 2WB1A 5HYQB 4HWBL 5HI3C 2ZYRA 4JRXE 3QP3A 5F9AC 3VRJA 2EIZA 4A6YH 4PJHB 1T5XA 2P48B 1FFPB 4N2CA 1NGXB 2EC8A 3BUYA 2OTUA 3H9ZA 1OPGL 3NZSA 4HIPA 4JG9A 1QFWI 1I8LC 3C9NB 3FT3A 5KSAD 3UIZA 3OGCA 1ZANL 2VRQA 4FXLA 43CAB 4BFOA 1KGJA 1KOAA 2CXKA 1QTPA 4X6DA 5EU6E 4GG6A 1UJ3B 2OS7A 3PABA 4H5SA 5AKSA 1TOXA 1R19A 2VISA 3HNSH 3SBQA 4L3EE 1NCJA 4UT9A 4XVOA 1JWMB 1IX2A 3RX5A 2PPDA 1CR9L 1XGRB 2EDXA 4H0LC 4X6CF 4DGIH 3EOBB 4OTXL 4NQCB 1FYTA 1KT2B 3EHBB 4WKXA 3WFEL 4HKZA 3WO3B 4A7UA 1PKOA 1IMHC 3SGJA 4KKAC 5DFVD 4NYLA 2MPAL 3FCBA 5FO7A 2L7QA 4JY6A 4ATTA 3IFNL 4HXAL 4Z7QF 1L9MA 1QUPA 5E0QA 1FE8H 4OT1L 4U2ZA 4Z5RB 1FG2B 2PP7A 4KHXL 2PYFB 2NXYD 3ULUH 4LMQE 4Q9CA 3BH4A 3LXCA 1JYWA 2CGYA 1ADWA 4G8AC 1DBMH 3FTUA 4TRPL 2BP8A 5L6YL 1C9SA 3V0WH 3GSNH 1NDTA 5G5DB 1GGIH 2AV7A 1HCZA 4XWGH 4UOQA 5HJGA 4ENED 3BWAB 1RMFL 4KKZA 1XL4A 4EUPA 4Z8FH 1BMGA 4PJ7B 2EACA 2D7MA 1L0PA 4Z76B 1ZHKA 2WOBA 4O00A 3MOBL 5D72L 2OULB 4U1LB 5EZLB 4LBEB 1H5BA 3CPLB 4MLIA 4ZPVB 5DUMH 1RZQA 3LZRA 3V79C 2HFGL 4OQ1A 4S2SA 2BXYA 2OZ4H 1B2WH 4JR9L 3IDMB 4X8GA 3KW7A 5EH1A 2CO1A 4O02B 1EHAA 2E7MA 2FT6A 4K2UH 5D9SB 4PRBB 2B2XH 4YDIH 1FGNH 1S9XA 3EGSA 1B4RA 3Q6GL 3DX6A 4FZEL 3ULUE 1A6AB 1DUZA 1T2JA 3GHBH 3GJFB 1E4XH 4PJGF 2MOGA 32C2B 3SPIA 1M57B 3T77B 3RDTA 1VF5C 2HP4A 4XR8C 3CVHA 4OCXL 1F4XH 3UZQA 4BGDA 2DAVA 3S9DB 5I19H 5C0CA 4HWEL 5J4MA 4XNDA 1UWEL 4PIRF 4FP8H 2JI1A 1VLXA 2IAMD 1RUMH 2JI3A 2R9HD 3HZVA 4NERA 3MUHL 3N9GL 3PDOB 2GSMB 3DV4B 4I1RA 4OCWL 1Y18B 5FV2A 4HD5A 5ENWA 1AMXA 4HWZB 1F6AA 2XTJB 3GXMA 4L1HA 3CZFA 2IOIA 2WXLA 4X6CE 1M05A 4FQQA 4HPYL 2H26A 4P2QD 4UU9B 3MREA 4HUNB 5IV2A 5KVFL 2W88A 4NRYA 3KVPA 2DQMA 5IIEA 1BF2A 4GMTH 4NHCH 4V1DD 1PD0A 1DUYB 3D3VE 5MENE 3JTTB 4P2RE 4OZFA 4HK0A 3ARPA 5I1CH 3VA2C 3MRIB 9CGTA 2XPZA 3A4EA 5BOZG 3EH4B 3QPKA 3CH1B 5EBWB 1BG9A 1F4HA 4FE9A 5FECB 3HE6B 1AS8A 2DQDL 1UFGA 3OHXB 4ODHL 3TBVB 2G0LA 4FYRA 2BM3A 1X5LA 2ZG2A 1AE6H 4PJFE 4JKLA 4K15A 1NGZA 2Y0SA 4WUKH 1S9YA 3VSUA 2D3VA 3VD4A 3ATBA 4A7GF 1CFSB 5CEYA 4P4KA 4YE4L 1P4LA 1INQB 3S3BB 4HIXH 4A39A 2WXJA 4HAGA 1CQKA 1OGSA 3ZDXF 2J57A 3JWNE 4HD9A 3ZPDA 4FL4C 4PJEF 3UXFA 2ZSVA 2L0DA 3WLBB 3B1TA 2ITFA 3OKLB 1LO5A 4OI7A 3B6SB 2Y6SD 3H4HA 1VSCA 2PWEA 5JR1H 2AITA 4JANA 4XXCA 1G6RA 4I77H 1NCBH 4HS3A 4QT5A 4FYTA 3IFOA 4ZUVB 4ZSOE 2AJZB 2FX7L 1XV8A 3QR0A 1JTOA 1QBLL 3RNQA 4OZHB 2K7PA 4N2GA 1IGML 4NXKA 3V5KA 3TCLB 2ESVE 4OCSH 3IGAB 1FO0A 3TBTB 1QW8A 1SDDA 2H0PA 3DBXA 3N55A 4MCNA 4P23B 4B9FA 1FFOA 5KYXB 3BAXA 2Z8RA 3EGDB 3TV8A 2X6AA 5GGSY 2LU4A 2EAEA 3L3IA 4IRJD 4JHBA 3GBLA 2GSGB 4NM4L 4MX7A 3WFDH 2TSAA 4LGPB 3HAEA 4FHBD 2AEIT 2XTLA 3KNBB 1BGXL 4LSTH 1UZ8A 4OZIF 1M9WA 2YD7A 3ATDA 3MLXH 4LQ1A 3M8OH 1RZ8B 2PYEA 3PIQB 1YUKB 1YA5A 3S5LB 2GBVA 3IEAA 1BZ9B 1QFWM 2B77A 2HG0A 2ENYA 5B1JC 4N2BA 1G94A 3HBGA 2B3RA 4HJ1A 1FA4A 2G2PA 3NYKA 5F9WB 4HUUA 5TK2A 1DVZA 4NO2A 5JHLH 3SPVB 4H20H 3EXLA 2YMXH 1HNFA 4HZLB 1MFDH 3LRLA 4CILA 1KLGA 3TO4D 3WNMA 4HIEA 2XBZA 1FFNA 4WJG3 1DDHA 4ORZC 4H8HA 1I7RA 1MJJA 4S1DD 4X2UA 2ERJB 5KN5B 4ODWA 3GMPA 2YFOA 4LSPH 4X7TB 2C4XA 5E2TL 3SDAC 4AYGA 2A73B 5FOJA 3VRIB 1KYFA 4WTXA 3IU3A 2DWYA 3RHWK 5KVGL 2QZ5A 2WM0A 3P3UA 1CXIA 2FEEI 4IM8A 1HAWA 4M1CD 4MNGB 5LBVA 4GPVA 4JPWL 1T5WB 3QRFM 3U0PA 3UFIA 3ZDZB 4BYHA 1JGLH 3WOVA 2HJLB 1ONQB 4H8PA 4JRYD 4Y4FA 1CICD 4Q9RH 5BRZB 4H2AA 2IJ0C 1T21A 4PJEE 3UAAA 1FH5H 1KB5L 1GYUA 2CBQA 1SHWA 2WTOA 2E9BA 5MEPB 4EKJA 5HYJE 1UM5L 5BVPH 4IOSD 4F3FA 4YHPA 2WLNA 3BLBA 3ROOA 1CFNB 3O8XC 2KH2B 5KSBB 5G4MA 4CVZB 5FYJL 4G7QB 2H7WA 4GSUA 3FQNB 4HEPG 1EJ6A 4PRDB 1LNUA 2DQUH 4OGAC 2VDOL 2BNQA 2X4OB 1NCCL 1D2OA 1U6AL 4M62L 1DVYA 2YK1H 2FJFB 3HMWH 1WJ3A 5JMRA 4V33A 1VJSA 4X4YA 2UY6B 3PNRB 2VMDA 4D0DA 3VW3L 4XN9A 1YNTB 3E7JA 1G7HA 4QXVA 1PG7X 4MNQD 1XGTB 3BQUD 3IDGA 4YSUA 1AJ7L 4QHNA 5DJCA 4APQA 2W9DL 4S1QL 3BDBA 3GMQA 4FJYA 2PW2B 4A2DA 1OP5K 1F3JA 3O6FB 3T0EA 3QIWB 5D7JB 3MRPB 4Z7OF 1QVOB 5F3BB 4AJYV 1I8IA 2J20A 2VLJD 3LN4A 4UTCA 3VXRD 4W4OA 4WI0A 3H7BA 1G7IA 4O9HH 2I25N 2VDLL 4FMKA 2BCMA 3BMVA 4HJGA 3P2TA 5GZOC 3L7EB 3LZFH 1TETL 2WZPA 5IT2L 5LGHL 2ADGB 3MRHA 2DI7A 3AJ7A 2K3TA 3DA0A 3FTGA 3D05A 3MRDB 3TONA 8CGTA 4L4TA 2UVFA 3CHQA 2JB5L 3FPXA 3FFCD 3QFGA 1N59B 3V0IA 1QEXA 3QB7C 1RI8A 2EEBA 5JQIB 3WEOA 4PI0A 1BPVA 3GK8L 1F41A 4KY2A 2NW3B 1AFVL 3MRQA 3L3KA 3GSRB 1DVFD 2YWYA 3NSJA 4Z0XA 4AEHL 3BH9B 4AJVA 1KIUA 2V5RA 2R2EB 3BP4B 4HS6A 4P5MB 5FF6B 2KZBA 4NKIL 3AABA 4GLRI 1BFOA 3KPSE 3FSWA 3L4UA 5KOVC 2PTTB 3FK3A 3F85A 4KRLB 4NQDB 5L9DL 4L0ZA 3W9EA 4TSCH 1R3LA 2E6PA 2V2WA 1VPOL 4B7LA 2QQNL 3N1GC 1AZUA 3K72A 4KI5E 4QTHA 4E41E 1KBKA 1V3KA 2BVQB 3G04B 1CZ8H 5SWSB 1P5UC 3ESUF 1U3HA 2O5XH 4U3SA 1NANH 1UM6L 2JCWA 4PRID 4X9FA 2EILB 3VRLF 4LPCA 3VXUA 4CDGC 3WE1A 2Z92B 1EAOA 3TN0C 1ZJAA 2AAAA 5CEZH 2EUWA 2XG4B 3H9SD 3MV7D 4L4JA 5D6DC 5DLMH 4LLMA 1I75A 4TLSA 3QE5A 1ASQA 4L8BA 4Y4HB 4P3DA 4R2GB 1L5GB 3OXRB 1FIGL 2W80C 1BD2B 2NY4D 2VUYA 4I5BB 2XV6B 2L3BA 1ZT7B 5IOKA 1OLZA 1NGYA 5CCHE 4HOXA 5EIVA 1R3IL 3STZA 3KGRA 1JYXA 2N01B 2UWEA 3SIKA 3NJJA 1KWGA 2ED7A 4YXHL 1BYOA 4JM4H 3RI5K 1I7ZA 2R0ZH 4WJ5B 4NP4L 1KYDA 2QELA 3L9RB 2R29H 3EYOB 5DMIH 3KPLB 4KQ3L 4J3WA 3EYFB 1UWYA 1H3PH 2LVCA 5DS1A 4WGWB 4ZS6D 3VB9A 4BSWA 1KB5B 1T89A 4L37B 3ZE1E 3EGXA 4ZFOB 3UABA 3HMXH 2CJ3A 2ETWA 4LP4A 3VSVA 4MVBC 4N22A 2Y1ZA 2YPKB 3WTXA 3QIUC 2OZNA 3CSPA 4XCFL 2IGFH 1EA9C 1ROCA 2BNUB 1KBBA 5L2KB 4KO7A 5DC0A 5IY5B 4F92B 1OARH 2DIEA 1S78D 5D4HA 1A9BB 1DQTA 4ZI8A 2V5MA 3QUKB 4KQ4H 4RRPA 5AOMA 4DP0X 4PJXF 5HGGS 5ISZE 4MJIA 2MTPA 5FUZH 4WEUD 5ABZA 1HCVA 3RWCB 3OAYH 2QADC 5HHOA 4YLBA 3QIBC 4P2OA 1ZDSA 1AI1L 3BKYL 4GKNB 5CXPA 5AL8A 2F53B 3GSXB 5ICXA 2HWZH 1JPSL 5FKPA 2FB4L 3CHOA 4FQ1H 2VABB 2X4UA 1E4KC 1HS6A 3BN9C 5E1AA 4TKWA 2C1PB 4A2EA 2IH1A 4O4YL 5D1QE 2IQAB 3T3PB 1WC7A 1E28A 3FT2A 4ZPTA 4JM2C 3NPSB 3VRLE 1G7MA 3SZ6A 2IVFC 4FTVB 4BHUI 1TZGH 2GJ6D 2EIJB 1F56A 2YFNA 1NMAL 2X28A 4ZO9A 1KEGL 3KBHE 2AEPL 3QZMA 1G7JA 2A74A 4NBZB 4XPAL 4L3CB 3WJJC 1WZ1L 4K3EL 2ADIA 2NNAB 2BJMH 3R8QA 1YUHB 4TNFA 3UPRB 3VI4F 3B34A 3D85B 3GMMA 1DANT 5TDOB 1T2XA 3NAAH 1B0GA 2JIXD 5K1NA 3B5HA 3SJVD 2FNWA 1KPUA 5EUOF 1X5KA 1MREH 3HR6A 1J1OH 4XPFL 5JNYA 2EICA 2IWGA 3LKQB 5LDUA 1VAHA 3BPCB 4WFHD 4DN4H 1HHIB 2XU9A 1YPZE 3TF7C 4Y16C 5DRZB 5DHVA 3FSAA 3SE8L 3GBDA 1LL1A 4EIUA 3HUJE 2J71A 3DHPA 3KVQA 1SEBB 3BEVB 3JVFC 1RCYA 3IETA 4AYDC 4J4PC 5I28A 1CCZA 2UYLA 2X6CA 3ATEA 3D1MC 4JFXA 4BFBD 2BSED 2N1TE 3Q3GA 4MZ3A 4HSQA 4EOWL 4UOW1 4WU5B 3ET9F 3GNMH 1I9RH 4AG4L 5AENA 2C3GA 5DQ9A 1J1XL 1ZTXH 3LEYL 4QEGA 4XTRC 4HLJA 1JRHI 5DVLA 4XBPA 12E8L 4KGJA 2QZQA 5EUKA 1GMIA 3RJOA 5I8OH 3OAUL 4MA3A 3P40A 3NGBC 2Y7SA 4ODXA 4OF0A 1MY5A 4YL4A 3ARBB 4PVNA 5EC2B 2J8UA 4LF3B 1ZLVK 5JORA 3TJHD 1DHKA 3ZKQD 2CA4A 3BHBA 5SX4H 1QBBA 1CXKA 2F7QA 5HHMD 2WLYA 5I76A 4MD0B 3F62A 1O7DC 3NEEA 4LPUA 2D03H 4MJHA 2AEOA 2DMKA 2EYTB 3QWOA 2K4WA 2OMTB 4YDLB 4JDZB 2CALA 3BDYL 1HOCB 1HSAA 1VFOA 2X0VA 1P7HL 4HKJA 4PLOB 3ULVF 1BHGA 1N19A 3FUNA 3NACH 2PXYC 3RIAK 4GQRA 2FE0A 1N18A 3C6LA 1SY6L 4JFDB 2WYIA 4DGVL 1CJYA 3MUGA 4POZD 5CHNB 5CEXA 2WWMD 3L1OL 4N0CD 4CJ1A 2QVIA 3KE0A 1XL6A 4N90D 1GOHA 1ZTXE 3Q8EA 4J23A 2WBJD 3VWJA 5EU5B 5T1LD 1LWJA 4U1JA 4F93B 1E6JH 4F9PC 2VXTL 3QUZC 1WWCA 4OGXH 5J6SA 2XETA 4OI9A 3US1A 4KZEL 3NJNA 3QXAA 4OCMC 5EUOE 5EEVA 2BP3A 1X5XA 4CC0A 1JHLL 4GSRA 1HKFA 4BZ2A 1ZVSB 1F86A 3ZDYF 3GRWH 2DJMA 4Y5VB 4DQOL 4OD1H 4G1EB 4UZGA 1LE9B 2HFEA 3U36B 1GCFA 1P6WA 5IM7A 4G80B 4X6EB 3A21A 5CUSL 5EBMB 3PV7A 3J07A 3PWPB 4KROC 3FHQA 4N8CL 3QWQB 5J06A 3ULVH 1PZCA 5AL0A 2FIKB 4MQ7B 1S5IH 3TZVC 4FFTA 2A9CA 4XP4H 4FQIL 4FNLL 1M6OA 2GBAA 1ZWIB 5D1ZB 1GW6A 4I0PB 1KJVA 3LZLA 2H2SC 4LNRA 2ODIA 4AQ1C 4CADA 2DRUA 4AM0A 5KYUA 2VR3A 1I7UB 3RBGA 4B0MB 2DY2A 3MJ9A 2CH8A 4DGUA 2LU7A 3KDMA 3GEFA 4KBPA 4AIZB 4X5WA 4HETA 3RVXC 3MV01 4C4KO 4WENB 2CRZA 3VSTA 1P7QD 4TQ8A 1HHGA 1FLRH 1QLEB 3P77B 3MC0A 1Z9SB 2E9WA 4RISL 4PN6A 1IE5A 3QQ3A 3K2UL 3EDJA 1JZEA 1RL1A 5FV1L 3UO1H 4XNZB 2YRLA 5KOMC 2DQTH 1PL3A 1L9OA 2VM9A 2M83A 3EJZC 4J3UA 2J1WA 2CAKA 2B39A 1A5FH 5C09E 4ELMB 3WNJA 5E99H 3P4OB 2YBRB 4A7SA 2D7QA 3HZMB 3C6EA 5BS0A 2JKXA 4G6AC 2DD8L 4UAOB 1CGUA 1XF3B 3W11D 1R24B 2MTAA 3L2MA 4R5TA 4AJWA 4ZMLA 4UZSA 4H2CA 1CN4A 4DIXA 4HJTA 3N1QC 2GI0A 4ALAC 2XQ0A 3UBGA 5JXAL 4G7YL 1HVXA 1IC7H 3F84A 3HFMH 4RFOL 3QJHA 5I6OA 1WO2A 3G08B 1TTGA 3PY9A 1X5YA 5JZ7C 2ITEA 1K5NA 1P69B 1SVZA 2A6KA 2CA3A 2DMGA 4L4VA 1KJ2B 4NHUB 3WKNA 3IU4H 4CAGA 4M8UA 1QRNB 3BKMH 4LRIC 4UTBH 1WAAE 2ZCLH 3E2HB 3EF4A 4KXZI 3ZDYE 2C9VA 2ICEC 1WIOA 1AOHA 2H32B 3BUIA 4OJAA 3VNZA 4Z3HA 5SX5K 2FQFA 2GJJA 3WEBA 1W0YT 5G4NA 3ZJAA 2FZ3A 1LO4L 3WGVB 4IKJA 4N0YH 4PV1C 3S48A 2VXQA 4GAJL 4D0BA 5I15H 3PWJB 2K6ZA 5IQ7L 5CFAA 1BXAA 1S7QB 3MGOB 4MMYB 4UDUB 3B2DC 4JQVA 5A43C 4UT7H 2D7TH 3ZYOA 3M1BB 5AW7B 5KYWB 3KL0A 1YRKA 4KJQD 5I0ZA 5EU6A 1HAUA 1G9MC 4P07A 4NQVA 2DJUA 2XPYA 1AO7E 2GTZA 4L3EA 2OMVA 4LEOA 5IFAL 3STBA 2ED9A 4KXDA 3I6GA 4EPSA 3WV0A 1RZGA 4WHTB 4M5YL 1U41A 1FRGH 4PJ7F 3QG6A 3L54A 1QBMH 2J6EL 2B0SH 3D18A 3CVBA 4HLEA 3VM7A 1CK0L 3MRLA 1MCJA 2HJKB 2FWOB 2W94A 3T4AA 3CXDH 1CURA 4NO5A 1LO2H 2JKTM 3BVNB 1ETZB 4K7PH 3DSNB 4HH8A 4KTGA 5D1XA 4DCQB 2X6VA 2WUBL 1XF4B 3ARDA 5CLYA 2BMKA 1JF1A 4NI6A 5AQ0A 1MDTA 3MJ8A 5EOCH 4B3VA 3QNZB 2ZWYA 3LN5B 4QRUB 3IDIB 3CFJB 1J5OH 4NBXB 2DS4A 1QI5A 4LU5L 4FNQA 1UXMA 1WT5A 3EDDA 4N2LA 1KBGH 3QRBA 1P9MC 2P8LB 2RFXB 5I6PA 1OAQL 1EH9A 1UGKA 1S7VA 1CFTB 4LARL 3QUXC 3AS1A 1D5IH 3AXIA 4P99A 3VWKD 4PJHE 4PU2A 3SQBA 3SDDA 1YAZA 3OKNB 3U79A 4JKNA 1R33A 1DBAH 1MCPL 2F19L 3MXWH 1ZLUH 4M3HA 1CLOL 5ABAA 4NQXB 1C08A 5AZ2L 3GFUA 1J05A 5J7CC 4RA0C 3L9EA 3UTZB 1MHCA 5H2BB 3OKDB 3TPUB 2F8OA 3QARA 5CJBA 4ZUTA 4W9IC 4XHJD 3D2UA 3DBSA 2OP4L 2HUHA 1XF5B 3L17A 4AK1A 3UTQA 4W9HC 4NQCE 4M48H 1G1KA 3PP4H 1KTDA 1PDKA 1JD9A 1DTUA 2YC1A 3VYNA 1BIIA 1A1MB 1MRDH 2DIBA 2F8IA 4O02H 4P2YA 1PY4A 2EQDA 2FQGA 3TFKC 1CPUA 1OE2A 3DXAD 2WZ5A 5AW8B 5HI5D 3QT2A 2P80A 2UY7B 1XF2B 3G7TA 4GQZA 4K3GA 4PJBB 4HIIA 4R90L 4ZBJA 3V6FA 5DZOA 5F7EH 1JGVH 1JZHA 3HB3C 3BE1H 3UAFA 1MW2A 3CX5K 5ITBL 1A7NL 1O6VA 3WXVH 3V4PA 4YMPA 5JIDA 4PJ7E 3DVNA 3HC2A 3WY3A 5J1SC 1VFAB 5FAAA 3SDCB 1JK8B 3QHFH 4N87A 5IVNA 1I3RA 1XSIA 4XVUC 1L7TH 2NUPA 4OM1L 5MENA 5I73B 3HS0A 2I9LA 1GGTA 1UXWA 1ZSDB 3QCTH 1MQKH 4FL4B 1K2DB 1M3IA 5IR1A 3F58H 4ZO8A 4DK3A 5DT1H 1PIFA 3DIDA 3FB7A 4P5TC 5C0DB 4G8IB 1MJ7H 4J8QA 4OAWA 1EXUA 5HDQH 3P73B 1F1GA 3OLEA 3QW9A 4RESB 1ED3A 1F97A 5HGDA 2V5TA 3VCLA 4WF7A 2BDNH 1EFQA 5DU7A 2H1XA 2AQ2A 2WKOA 3ILDA 1PSKL 3QUYA 4FQCL 4PJFA 4EIGB 1E9OA 4HWBH 3F7QA 1WE5A 4KTEL 2BVUA 3BWUF 3FNKA 3OD3A 3VE0A 4AL8C 1AHMA 3QHZL 3KBFA 1IGYA 1FFTB 4HHAB 1OE3A 1ZV5A 2QQKL 4ORGA 2WC7A 4I3SL 4QRRA 1OPGH 2NTSP 3A0OA 5A2IH 3QJZA 3V0EA 4MS6A 2FHBA 3VX1A 3HR5B 3QFDB 1ZANH 2Q20A 3OLIA 4ZTEA 1LEIB 4GUQA 2AXWA 1RK0B 3UYPB 1N5AB 2X2YA 2XTJE 3CSTA 4KKBC 4WI4A 2VNCA 3KCPA 4QY8A 5DS8A 2Y5TB 4FFWD 1CR9H 3BGFC 3CLEL 1U58A 4LDEB 4OTXH 5KSAA 4UTAA 1ASPA 2WCPA 2O6DA 2N3JA 3CVCA 2FO8A 3WFEH 3T6ZA 2F54D 4ZW7A 3UROR 4UDTA 1R34A 3TO2A 2E6JA 3BH8B 2MPAH 5DJ2A 3T4YB 5FDWA 1KXVC 1P1ZB 3D87B 3GXFA 3IFNH 3VXMB 4HXAH 4OT1H 1JDAA 2QTVA 4KHXH 1U8QA 1SBSL 3Q5OA 4DO6A 5IT2H 1AR2A 3L4CA 4K4KA 3NSXA 3P0YL 1KN2L 1ACCA 2NQDA 2XPGA 4TRPH 4YAQA 3BSGA 3TVMD 5L6YH 1EEYA 1GAFL 2JB6B 3SDAB 1Q9OA 3VXSD 1UH4A 2DKSA 2KZKA 4KDVA 1RMFH 3RWGB 3UDWA 4F80A 2VSCA 2VO8A 3DUUA 4K8RC 4UM8B 4EIBA 3UJIL 1I7TA 1CWVA 4TVPL 4RWHA 3SGJC 1ANUA 4DPBX 4LEBA 3MOBH 5D72H 4P57A 1WITA 3UEZA 3ESOA 4X98B 3SO3C 3ZTDC 1P5VA 5JDSB 1W72A 2W81C 3ZDZF 4JHZA 4JFUA 4LDCA 4EKXA 2UZYB 2HFGH 1OSPL 2YAHA 4F7KA 1HSBA 4JR9H 4X5XB 1U36A 1MEXL 5IB5A 5FPIA 3O8XB 4GBXD 1NOLA 4KUCD 3RGVA 2WTRA 2NY0C 5IB1B 1NCGA 3B7TA 4XMPL 3O3EA 1WUNT 3KDPB 5C07B 4LLDA 2QL1A 4ZS7L 4ZX6A 1NMBL 3Q6GH 4FZEH 4XMTA 1BXUA 4OZHE 5K9OA 3WGUB 3CC5A 8FABB 3NJLA 4F8NA 3W81A 4MDRA 1E90A 2CIKA 4OCXH 1H5BC 1AY1L 1HE7A 1YEHL 2FH6A 1PD6A 3F5WB 4R0LB 4RIRA 5DJZB 4MAUL 5ETUA 4HWEH 1L3WA 1UWEH 1XCWA 2JTYA 1OAJA 3QJFB 1J9CT 3N9GH 2HX9A 1NGPL 4OCWH 4HAKA 3N04A 2EXSA 3I9GL 4WEMB 4X7SL 3HHRB 3AGVA 3KS0H 4IRZL 3D39B 3RTLA 3Q8AA 1L3NA 2IAMA 4YC2C 3Q1EA 3MUJA 4GRWF 4ACTA 4HPYH 4WHDA 3RDTC 3FO0L 3CSYB 5KVFH 4OI8A 5E9DB 4ZUSB 4HOWA 2V33A 4Z7UF 4GRMA 5EWIL 3L13A 4OFKA 3UX9B 1U3NA 4U0RB 2BOCB 5F3HB 5JIPA 3KLAB 4QHPA 3MLRL 2APWA 1SXAA 2ITCA 4NN6C 1SMAA 3FL7A 4JGMA 4KAQL 5DRXB 4P2QA 2HVJA 4MNHB 3V6ZB 1QSFD 3K91A 1M7IA 2PPAA 3JV6A 4Z7NB 4UYPA 1QFUL 2XQBL 2FATL 4V1DA 4GP5B 5FYKU 2JWYA 3D69A 2DQDH 1AXIB 4Q0XL 4ODHH 4P5KB 3PXJA 3I6SA 1NUDA 2VYRE 3OX8A 1VERA 1EMTL 4MNGE 5EMYA 5A6MA 1XGZA 2PMZA 1TCRB 3FT4A 5TTRA 4YE4H 3ZDZE 1I8MB 1MFNA 2FWSA 2ZICA 4Z7VB 5C6TL 3ZL1A 5BRZE 4GRWH 3QORB 2J88L 5I17A 1XT5A 1ZE3C 4JFVA 3TH2T 3ZTCC 2BSTB 2NSXA 1ZS8B 1NAMB 5GGQL 3RX8A 1HEZB 2X6BA 4CRPA 3O4LB 4CMHC 2ZX7A 2MSPA 5KSBE 3MLTA 5CCKL 3GXPA 2FX7H 4Z6AT 5HYIA 3Q06A 2JXMB 1A4AA 1QBLH 3I02B 1X6LA 3VFNB 1OV8A 1IGMH 1YEFL 1QA9B 1MH5B 1XR9B 2A9ML